Issuu on Google+

Mau Dimana Anda Shalat Jumat...? Lihat hal. C4 Dan C5 Masjid Raya Medan

JUMAT, Wage, 6 Januari 2012/11 Safar 1433 H

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) No: 23735 Tahun Ke-65

Hari Sabarno Divonis 2,5 Tahun JAKARTA ( Waspada): Mantan Menteri Dalam Negeri Hari Sabarno (foto) divonis hukuman 2 tahun 6 bulan karena melakukan

Lanjut ke hal A2 kol. 7

Terbit 28 Halaman (A1-12, B1-8, C1-8)


Harga Eceran: Rp2.500,-

Plt Gubsu: Jadikan Masjid Sarana Membangun Karakter Pangdam I/BB Minta Jangan Dipro-kontrakan MEDAN (Waspada): Plt Gubsu H Gatot Pujo Nugroho mengatakan, masjid bukan hanya berfungsi sebagai tempat ibadah yang mengatur hubungan manusia dengan Allah SWT. Namun, masjid juga sebagai sarana atau fasilitas membentuk karakter bangsa. Di mana saat ini, bangsa Indonesia komit membangun karakter anak-anak bangsa. “Ada pelajaran yang harus kita ambil dari cara kerja Kodam I/BB yaitu, analisa daerah operasi-nya. Di lokasi ini ada empat sekolah. Di mana sekolahsekolah yang ada di sini memiliki murid hampir 2600-an. Sehingga dengan dibangunnya masjid ini, dapat dimanfaatkan untuk membangun karakter

anak-anak bangsa,” kata Gatot, saat acara peletakan batu pertama pembangunan masjid, TPA, dan perpustakaan di Jl. Timor, Kamis (5/12). Dengan dibangunnya masjid, Taman Pendidikan Alquran (TPA) dan perpustakaan yang digagas Pangdam I/BB di Jl. Timor ini, kata Gatot, para siswa dapat memanfaatkan sebagai pembinaan karakter generasi muda. “Jam-jam istirahat siswa dapat memanfaatkan masjid ini. Baik untuk berdiskusi, berzikir dan membicarakan persoalan-persoalan masa depan, untuk kemajuan bangsa ini,” tegasnya. Lanjut ke hal A2 kol. 6

Tadi Malam Di Aceh Barat

3 BURUH DIDOR BANDA ACEH (Waspada): Kawanan orang tak dikenal (OTK) kembali melakukan aksi penembakan di Provinsi Aceh. Kali ini terjadi di kawasan Simpang Aneuk Galong, Kec, Suka Makmur, Kab. Aceh Besar. Para buruh bangunan asal Semarang, diberondong senjata api mengakibatkan tiga orang kritis.

Penembakan itu terjadi Kamis (5/1)pukul 19:05 dan mengakibatkan tiga orang kritis, yakni Gunoko, 30, kena tembak bagian kepala, Agus Swetnyo, 35, kena di bahu, Sotiku Anas, 25, ditembak di bagian perut. Hingga berita ini diturunkan

tadi malam ketiganya sedang jalani perawatan di Rumah Sakit Umum Zainal Abidin (RSUZA). Informasi dari Humas Polda Aceh Kombes Pol Gustav Leo, laporan sementara ada terdengar 5 kali tembakan dan diperkirakan pelaku memakai

jeket hitam dan memakai helm. Setelah kejadian, polisi terjun ke lokasi kejadian untuk olah TKP, dan mengamankan sejumlah barang bukti untuk penyelidikan.

Lanjut ke hal A2 kol. 5

Pulang Kampung

Waspada/Gito Rolis

DUA dari tiga korban penembakan di kawasan Simpang Aneuk Galong, Kec. Suka Makmur, Kab. Aceh Besar dirawat di RSUZA.

Mantan Plt Wali Kota Siantar Divonis 2,5 Tahun

BIREUEN (Waspada): Puluhan pekerja galian kabel Telkom bersama empat dari 7 orang yang menderita luka tembak yang dilakukan penembak misterius (Petrus), termasuk dua wanita tukang masak di Desa Blang Cot Tunong, Kec. Jeumpa, Bireuen, Sabtu malam, dipulangkan ke kampung halamannya dengan bus PMTOH. Lanjut ke hal A2 kol. 3

MEDAN (Waspada) : Mantan Pelaksana Tugas (Plt) Wali Kota Pematangsiantar, Kurnia Saragih divonis dua tahun enam bulan penjara oleh Ketua Majelis Hakim Tipikor Suhartanto SH dalam sidang lanjutan kasus dugaan korupsi dana APBD Pematangsiantar tahun 2005 senilai Rp1,2 miliar di Pengadilan Negeri Medan, Kamis (5/1). Pada sidang tersebut, terdakwa selain dikenakan hukuman penjara, juga dikenakan denda Rp50 juta, subsider 2 bulan kurungan serta, membayar uang penganti kerugian negara sebesar Rp378 juta lebih atau subsidair 1 tahun kurungan apabila tidak membayar kerugian negara. Dalam amar putusan Ketua Majelis Hakim Suhartanto menyatakan, Kurnia Saragih terbukti bersalah dalam dakwaan

Lanjut ke hal A2 kol. 3

Kasus Perkelahian Anak, Kedua Belah Pihak Dijadikan Tersangka MEDAN (Waspada): Polresta Medan mengambil alih penanganan kasus perkelahian anak yang masih pelajar dan telah menetapkan terlapor dijadikan tersangka dalam kasus tersebut. “Kasusnya yang di Polsek Patumbak diambil Polresta, dan masing-masing terlapor sudah ditetapkan menjadi tersangka, namun tidak ditahan,” jelas Kasat Reskrim Kompol Yoris Marzuki didampingi Kapolsek Patumbak SW Siregar dan Kanit PPA AKP Hariani, Kamis (5/1) malam. Dijelaskannya, yang ditetapkan jadi tersangka yakni F, 12, yang dilaporkan orangtua RH, 12 ke Polsek Patumbak. Begitu juga dengan RH, Iptu H dan isterinya S br S yang dilaporkan orangtua F yakni Ali Nur ke Poldasu, yang kemudian dilimpahkan ke Polresta Medan 16 November 2011, dan sudah dijadikan tersangka. “F dilaporkan dengan pasal 80 tentang perlindungan anak ke Polsek Patumbak pada 3 November 2011. Sedangkan RH, Iptu H dan isterinya S br S dilaporkan ke Poldasu hari yang sama

Lanjut ke hal A2 kol. 3

Waspada/Abdul Mukthi Hasan

KELUARGA anggota Polres Bireuen melambaikan tangannya kepada para pekerja galian saluran kabel Telkom yang menjadi korban pemberondongan OTK saat meninggalkan Mapolres Bireuen Kamis (5/1).

Aksi Blokir PLTU Dapat Dukungan Pemkab Langkat PANGKALANSUSU (Waspada): Aksi pemblokiran akses jalan menuju megaproyek Perusahaan Listrik Tenaga Uap (PLTU) di Desa Tanjungpasir, Kec. Pangkalansusu, Kab. Langkat sudah memasuki hari ketiga, Kamis (5/1). Aksi yang dilancarkan warga mendapat dukungan dari Pemkab Langkat.

Menurut Kabag Humas, Syarizal, Pemkab Langkat pada perinsipnya mendukung sikap masyarakat sepanjang tidak anarkis. Menurut dia, tiga orang perwakilan masyarakat, yakni Mawi, Aminah dan Ijah, telah me-lakukan pertemuan dengan Pemkab Langkat, dihadiri

Perlindungan Allah Oleh Tgk. H. Ameer Hamzah Katakanlah: aku berlindung kepada Tuhan yang menguasai shubuh dari kejahatan makhluk-Nya dan dari kejahatan malam apabila telap gelap gulita. (QS. al-Falaq:1—3).

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 1

Dua Kapal Ikan Tanjungbalai Dirompak Lima Pria Bersenpi TANJUNGBALAI (Waspada) : Dua kapal ikan asal Kota Tanjungbalai, KM.Camar Rezeki dan KM.Tuah Bunda, dirompak lima pria bersenjata api di perairan Kuala Tanjung, Kab. Batubara Kamis (5/1). Kawanan perompak sempat menyandera nakhoda dan awak kapal, namun akhirnya dilepas setelah isi kedua kapal itu dikuras habis. Menurut nakhoda KM. Camar Rezeki, Syamsul Bahri, saat itu mereka sedang menangkap ikan di perairan Kuala Tanjung. Tiba-tiba, menurut Syamsul, satu unit sampan kecil bermuatan lima orang mendatangi kapalnya. Selanjutnya, tiga dari lima penumpang sampan kecil itu naik ke KM.Camar Rezeki sambil mengacungkan senjata api ke arah awak kapal. Kawanan rompak itu, memerintahkan agar kapal yang dinakhodai Syamsul Bahri dan 5 ABK, mendekati KM.Tuah Bunda yang dinakhodai Amiruddin bersama 10 ABK. “ Kami berada dalam ancaman senjata api,” sebut Syamsul dalam laporannya ke Pangkalan TNI-AL Tanjungbalai Asahan. Kawanan perompak selanjutnya masuk ke KM.Tuah Bunda dengan mengambil alih radio dan mengumpulkan awak

kedua kapal itu. Setelah itu, para perompak menguras seluruh barang berharga di KM. Camar Rezeki dan KM.Tuah Bunda seperti, radio, satelit, komputer, alat komunikasi, dokumen kapal dan 4 unit ponsel serta seluruh hasil tangkapan ikan. Sebelum melarikan diri, salah satu perompak sempat memberikan nomor ponsel dan namanya kepada para awak kapal. “ Namaku Syahrul, dan


SEBUAH baliho rusak di kawasan Tanjung Duren, Jakarta, Kamis (5/1). Hujan badai mengguyur sejumlah kawasan di Jakarta sejak pukul 14:00 mengakibatkan banyak pohon tumbang dan sejumlah fasilitas umum rusak.

Badai Landa Jakarta JAKARTA (Antara): Sejumlah pohon dan papan reklame tumbang akibat hujan lebat yang disertai badai, bahkan beberapa ruas jalan ditutup di wilayah Jakarta dan sekitarnya pada Kamis (5/1) sekitar pukul 13:00. “Beberapa ruas jalan macet total karena pohon tumbang,” kata petugas Traffic Management Center (TMC) Direktorat Lalulintas Polda Metro Jaya, Brigadir Satu Widi Lanjut ke hal A2 kol. 3

MEDAN (Waspada) : Cuaca di kawasan Medan dan Sumatera Utara pada umumnya masih berfluktuasi yaitu berubahubah. Pada siang hari panas dan gerah, sementara pada sore dan malam hari diguyur hujan lebat. Panasnya pada siang hari mencapai angka 33 derajat Celcius, terasa sekali bagi kalangan masyarakat Kota Medan yang berpendudukhampir2,2jutajiwa. “Kalau panas pada siang hari hingga berhari-hari dan hujan lebat intensitas tinggi pada sore dan malam hari bakal turun hujan,” kata Hartanto, Kepala Data dan Informasi (Datin) BMKG Wilayah I Stasiun Bandara Polonia Medan di Bandara itu, Kamis (5/1). Kata Hartanto, sebenarnya kondisi cuaca di Sumatera Utara relatif lebih aman sampai seminggu ke depan, dibandingkan akhir Desember 2011. Hujan

Lanjut ke hal A2 kol. 6

kalau sampai di darat, bilang sama toke kalian supaya menelfon aku untuk menebus barangbarang yang kami rompak,” ujarnya kepada para awak kapal. Komandan Pangkalan TNIAL Tanjungbalai Asahan Letkol Laut (P) Retiono Kunto melalui Pasi Intel Kapten Marinir Irfan Hilmi di dampingi Lettu Wuryanto, membenarkan kejadian itu. “ Kasusnya masih tahap penyelidikan,” jelas Hilmi. (a14/a32)

6 Nelayan Deliserdang Pulang Dari Malaysia LUBUKPAKAM (Waspada): Pagi ini sekira pukul 07:30, enam nelayan asal Deliserdang yang ditahan di penjara Tapah, Malaysia, dijadwalkan tiba di Bandara Polonia, dengan menumpang pesawat Air Asia. Kepulangan keenam nelayan tradisional Pantailabu, Deliserdang hasil upaya maksimal anggota DPD RI asal Sumut, Parlindungan Purba dan Ketua Himpunan Nelayan Seluruh Indonesia (HNSI) Deliserdang, Rahmadsyah, SH. “Alhamdulillah keenam nelayan ini yang seluruhnya warga Pantailabu, Deliserdang

besok (hari ini-red) bisa berkumpul kembali dengan keluarganya,” ujar Rahmadsyah kepada Waspada via telefon selular, Kamis (5/1) malam. Rahmadsyah menyebutkan, keenam nelayan tradisional itu adalah, Iskandar, 33, warga Desa Denai Kuala, Pantailabu, OK Hasan Basri, 38, warga Desa Paluhsibaji, Pantailabu, Ady Aprizal, 35, Dusun 2 Paluhsibaji, Pantailabu, Harianto Simbolon, 33, Paluhsibaji, Pantailabu, Hairi Fadli, 25, Paluhsibaji, Pantailabu, dan Mukhlis, 22, juga warga Paluhsibaji, Pantailabu. Lanjut ke hal A2 kol. 2

Ada-ada Saja

Cuaca Sumut Berfluktuasi

Al Bayan

ALLAH Azza wa Jalla mengingatkan Nabi Muhammad SAW dan orang-orang beriman agar selalu berhati-hati dalam hidup ini. Hati-hati dalam menyikapi segala hal agar kita selamat di dunia dan di akhirat. Selamat di dunia dalam artian kita tidak pernah terjerumus dalam dosa-dosa besar. Kita diimbau untuk selalu berlindung kepada Allah yang menguasai shubuh. Subuh itu masih gelap, mungkin ada makhluk jahat yang ingin membunuh kita. Karenanya kita berlindung dan bertawakkal kepada Allah Maha Kuasa.

konsorsium PLTU. Dalam pertemuan dipimpin Sekdakab, Surya Jaisa, mewakili Bupati Langkat Ngogeso Sitepu, masyarakat tetap pada prinsip terus melanjutkan pemblokiran akses jalan sebelum pihak perusahaan memperbaiki

Waspada/Surya Efendi

PLT Gubsu Gatot Pujo Nugroho didampingi Pangdam I/BB Mayjen TNI Lodewijk F Paulus, Wali Kota Medan Rahudman Harahap menyaksikan peletakan batu pertama pembangunan masjid, taman pendidikan Alquran dan perpustakaan oleh Ka Kanwil Kemenag Sumut Abdul Rahim di Jln Timor Medan, Kamis (5/1).

Mata Dicungkil Gara-gara Rebutan Remote TV


DI USIA 91 tahun, Nek Rusuwen masih tampak energik.

Kisah Nenek 28 Buyut Penjual Pecal

‘Kalau Mau Sehat Jaga Kebersihan Hati’ MESKI usianya telah cukup senja, tapi Rasuwen tetap berusaha untuk mempertahankan hidup. Nenek 25 cucu dan 28 buyut ini sejak remaja sampai usianya 91 tahun tidak pernah berhenti berjuang. Kalau sebelumnya ia berjualan penganan dan pecal untuk menghidupkan lima Lanjut ke hal A2 kol. 6

GARA-gara rebutan remote TV, seorang pria asal AS tega mencungkil mata pamannya sendiri. Korban berusia 62 tahun ini sempat meminta pertolongan, dan polisi yang datang mendapatinya tengah duduk di lantai bawah rumah dengan posisi tangan memegangi

Lanjut ke hal A2 kol. 2

Serampang - Mangan ora mangan asal ngumpul - He...he...he...

Siapa Khatib Jumat Anda ? Lihat Hal. C4-C5

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Wage, 6 Januari 2012/11 Safar 1433 H z zNo: 23735 * Tahun Ke-65

LHOKSUKON (Waspada): Untuk menelusuri kasus Petrus (penembak misterius) terhadap dua buruh sawit di Desa Seureukey, Langkahan, pedalaman Aceh Utara, Minggu (1/1) malam lalu, Mabes Polri menurunkan tim khusus ke Aceh Utara, Kamis (5/1) sore. “Tim akan meninjau Tempat Kejadian Perkara (TKP) di Desa Seureukey. Selain kasus Sureukey, tim menelusuri Lanjut ke hal A2 kol 2

Petrus Beraksi Lagi

Cuaca Sumut Aman Di Jakarta Kacau MEDAN (Waspada): Cuaca di kawasan Medan dan Sumatera Utara pada umumnya masih berfluktuasi yaitu berubah-ubah. Pada siang hari panas dan gerah, sementara pada sore dan malam hari diguyur hujan lebat. Panasnya pada siang hari mencapai angka 33 derajat Celcius, terasa sekali bagi kalangan masyarakat Kota Medan yang berpendudiuk hampir 2,2 juta jiwa. “Kalau panas pada siang hari berhari-hari hujan lebat intensitas tinggi pada sore dan malam hari bakal turun hujan,” kata Hartanto, Kepala Data dan Informasi (Datin) BMKG Wilayah I Stasiun Bandara Polonia Medan saat dikonfirmasi di Bandara itu, Kamis (5/1). Kata Hartanto, sebenarnya kondisi cuaca di Sumatera Utara relatif lebih aman sampai seminggu ke depan, dibandingkan akhir Desember 2011. Hujan yang terjadi saat ini merupakan hujan-hujan lokal. Kalaupun hujan sporadis yang mengguyur Medan seperti Kamis dinihari, sifatnya tidak lama hanya berkisar antara 0,5 jam hingga 1 jam, namun intensitas hujan tergolong tinggi. Hujan, kata dia, kadang-kala diselingi angin kencang bahkan petir, namun masyarakat Medan dan sekitarnya masih tergolong dalam kondisi lebih aman. Hartanto menilai, seminggu ke depan, kondisi cuaca di Kota Medan dan sekitarnya menurut prakiraan Badan Meteorologi Klimatologi dan Geofisika (BMKG) wilayah I, cukup aman dan tidak ada gejolak mengkhawatirkan. Sementara gangguan cuaca di Laut China Selatan (LCS) hingga saat ini mulai mereda, bahkan pumpunan awan ke Sumatera Utara mulai berkurang dibandingkan akhir Desember. Lanjut ke hal A2 kol 1

Terbit 28 Halaman (A1-12, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

Mabes Polri Telusuri Petrus

Tiga Buruh Bangunan Ditembak

Waspada/Gito Rolis

DUA dari tiga korban penembakan misterius (Petrus) dirawat di RSU ZA, Kamis (5/1).

BANDA ACEH (Waspada): Kawanan Petrus (penembak misterius) kembali melakukan aksi penembakan brutal di Provinsi Aceh, Kamis (5/1) sekitar pukul 19:00. Kali ini terjadi di kawasan Simpang Aneuk Galong, Kec, Suka Makmur, Kab Aceh Besar. Para buruh bangunan asal Pulau Jawa (Semarang) diberondong senjata api. Sampai pukul 21:00, ketiga buruh tersebut kritis. Peristiwa penembakan itu memakan korban tiga orang, yakni Gunoko, 30, kena tembak bagian kepala, Agus Swetnyo, 35, kena di bahu, Sotiku Anas, 25, ditembak di bagian perut. Kondisi para korban kritis, dan hingga berita ini diturunkan ketiganya sedang menjalani perawatan di RSUZA. Sebelumnya lima pekeja Lanjut ke hal A2 kol 1

Pekerja Asal Jawa Tinggalkan Aceh

Hidayat Nur Wahid Lirik Dahlan Jadi Capres JAKARTA (Waspada): Anggota Majelis Syuro Partai Keadilan Sejahtera (PKS) Hidayat Nur Wahid secara pribadi menilai Dahlan Iskan layak dijadikan calon presiden pada Pemilu 2014. Sepak terjang Menteri Badan Usaha Milik Negara (BUMN) itu sangat cocok dengan kriteria yang diinginkan PKS. “Dahlan Iskan merupakan sosok yang sangat bagus,” kata Hidayat di Solo, Jawa Tengah, Kamis (5/1). Menurut dia, Dahlan Iskan adalah sosok pekerja keras, bukan tipe yang banyak omong dan senang berwacana. Dahlan juga dinilai tak suka melakukan pencitraan. “Beliau juga terbiasa be-

kerja di lingkungan birokrasi dan organisasi. Tipe tersebut yang dibutukan sebagai presiden,” ujar Hidayat. Track record Dahlan Iskan selama menjabat Direktur Utama PLN juga dibilang sukses. Hanya saja, menurut Hidayat, Dahlan Iskan bukan orang Parpol. Padahal pencalonan calon presiden melalui Parpol, sehingga akan sulit untuk maju dalam pencalonan nanti. “Saya melirik Dahlan Iskan karena sosok yang konkret, track record jelas dan terbukti sukses di berbagai bidang,” kata dia. ‘’Meski tidak orang partai politik, nantinya tidak menutup kemungkinan untuk mencalonkan sebagai wakil presiden ataupun presiden.” (vvn)

Gayus Dituntut 8 Tahun Penjara, Denda Rp1 Miliar JAKARTA (Waspada): Mantan pegawai Direktorat Jenderal Pajak, Gayus H Tambunan dituntut delapan tahun penjara dan membayar denda Rp1 miliar yang dapat diganti

dengan hukuman 6 bulan kurungan. Tuntutan tersebut dibacakan tim jaksa penuntut umum, Lanjut ke hal A2 kol 3

BIREUEN ( Waspada): Puluhan pekerja galian kabel Telkom bersama empat dari 7 orang yang menderita luka tembak yang dilakukan penembak misterius (Petrus), termasuk dua wanita tukang masak di Desa Blang Cot Tunong, Kec. Jeumpa, Bireuen, Sabtu malam, dipulangkan ke kampung halamannya dengan satu unit bus PMTOH. Mereka diberangkatkan dari Mapolres setempat, Kamis (5/l), bersama Wakapolres Bireuen, Kompol Warsito Eko Sulistyo, SIk, Dandim 0111 Bireuen, Letkol Inf. Muhammad Arfah,

Sekdakab Bireuen Ir H Razuardi Ibrahim, MT dan keluarga besar Polres dan sejumlah anggota masyarakat diwarnai suasana haru. Empat korban luka tembak tersebut, adalah, Yaiman, 28, Jawa Timur, Anshari,40, Jember, Imam Maliki,27,Jawa Timur, Andrianto (bukan Andri)14, Jatilongor. Sedangkan rombongan pekerja sebanyak 40 orang, termasuk

dua wanita yang selama ini menjadi menjadi tukang masak di barak, Yuni,40, dan Latifah,50, Sedangkan, jenazah 3 korban yaitu, Suniyoto,28 asal Jember, Daud,30, Bayuwangi dan Suparna,31, Jember, sudah diterbangkan pulang beberapa hari sebelumnya m e l a l u i Ba n d a ra Su l t a n Lanjut ke hal A2 kol 3

OTK Potong Dua Tower PLN

SIGLI (Waspada): Orang Tidak Dikenal (OTK) memotong dua tower transmisi Saluran Udara Tegangan Tinggi (SUTT) 150 KV milik PT PLN (Persero) di kawasan persawahan Desa Lueng Sagoe, Beureueh dan Desa Blang Tidiek, Kec. Mutiara Timur, Kab. Pidie, Rabu (4/1) sore. Warga yang mengetahui dua tower itu hampir tumbang, langsung melaporkan kepada petugas PT PLN dan kepolisian setempat. Pihak PLN yang turun bersama aparat segera mengambil tindakan cepat memperbaiki tower itu dengan cara dilas, untuk Lanjut ke hal A2 kol 5


TERDAKWA kasus dugaan korupsi Ditjen Pajak, Gayus Halomoan Tambunan mendengarkan pembacaan tuntutan oleh Jaksa Penuntut Umum (JPU) di Pengadilan Tipikor, Jakarta, Kamis (5/1).

Al Bayan

Perlindungan Allah Oleh: H. Ameer Hamzah Katakanlah: aku berlindung kepada Tuhan yang menguasai shubuh dari kejahatan makhluk-Nya dan dari kejahatan malam apabila telap gelap gulita. (QS. al-Falaq:1—3). Allah Azza wa Jalla mengingatkan Nabi Muhammad SAW dan orang-orang beriman agar selalu berhati-hati dalam hidup ini. Hati-hati dalam menyikapi segala hal agar kita selamat di dunia dan di akhirat. Selamat di dunia dalam artian kita tidak pernah terjerumus dalam dosadosa besar. Kita diimbau untuk selalu berlindung kepada Allah yang menguasai shubuh. Shubuh itu masih gelap, mungkin ada makhluk jahat yang ingin membunuh kita. Karenanya kita berlindung dan bertawakkal kepada Allah Maha Kuasa. Lanjut ke hal A2 kol 2

Ada-ada Saja

Mata Dicungkil Gara-gara Rebutan Remote TV

GARA-gara rebutan remote TV, seorang pria asal AS tega mencungkil mata pamannya sendiri. Korban berusia 62 tahun ini sempat meminta pertolongan, dan polisi yang datang mendapatinya tengah duduk di lantai bawah rumah dengan posisi tangan memegangi matanya yang berlumuran darah. “Tolong, aku tak bisa melihat,” ujar korban seperti dikatakan polisi. Menurut laporan, biji mata pria tersebut menonjol ke luar hingga setengah sentimeter dari kelopak mata dan mengalami pembengkakan. Korban mengatakan bahwa keponakannya laki-lakinya yang berusia 32 tahun itu sebelumnya menghancurkan remote TV. Setelah mereka Lanjut ke hal A2 kol 5

GUNUNGTUA (Waspada): Puluhan mahasiswa dan petugas keamanan terlibat bakuhantam saat mahasiswa mengatasnamakan Aliansi Mahasiswa Masyarakat Bela Rakyat Paluta (AMMBRP) melakukan unjukrasa di Kantor Bupati dan Gedung DPRD Padanglawas Utara (Paluta), Kamis (5/1). Mereka demo memprotes rusaknya hutan dan merajalelanya pembalakan liar di wilayah Kab. Paluta. Pantauan Waspada di lokasi, aksi ini ricuh saat massa mencoba menerobos masuk kantor bupati. Massa mencoba merangsek maju, namun dihadang petugas keamanan. Awalnya saling tolak. Tidak jelas siapa yang memulai,

massa mahasiswa dan petugas keamanan kemudian terlibat baku hantam. Ketegangan antara massa mahasiswa dan petugas keamanan berhasil dilerai aparat polisi. Dalam aksinya, massa menuntut Bupati Padanglawas Utara, Dra. H. Bachrum Harahap menindak tegas Kepala Dinas Kehutanan Padanglawas Utara, terkait kasus kerusakan hutan yang terjadi di kabupaten tersebut, serta mencopot para pejabat yang tidak membangun dan hanya ingin memperkaya diri sendiri. Koordinator Aksi, Ahmad Saleh didampingi M. Husein dan Waris di sela-sela aksi Lanjut ke hal A2 kol 1

Kasus Perkelahian Anak Kedua Pihak Jadi Tersangka Waspada/Muhammad Riza

Beberapa petugas PLN (Persero) Provinsi Aceh, Kamis (5/1) sedang memperbaiki kaki tower transmisi yang dipotong orang tidak dikenal di areal persawahan di Desa Lueng Sagoe, Beureueh, Kec. Mutiara Timur, Pidie, Rabu (4/1).

Vonis 2,5 Tahun Penjara, Hari Sabarno Banding JAKARTA (Antara): Majelis Hakim Pengadilan Khusus Tindak Pidana Korupsi menjatuhkan vonis 2 tahun 6 bulan penjara terhadap mantan Menteri Dalam Negeri (Mendagri) Hari Sabarno (foto) atas tindak pidana korupsi pengadaan mobil pemadam kebakaran di sejumlah daerah. Ketua Majelis Hakim Tipikor Suhartoyo dalam persi-

Mahasiswa Dan Petugas Baku Hantam Di Kantor Bupati

dangan di Pengadilan Khusus Tipikor Jakarta, Kamis (5/1) menyatakan Hari Sabarno terbukti secara sah dan meyakinkan melakukan korupsi bersama-sama. Selain divonis 2,5 tahun penjara juga dikenakan denda Rp150 juta atau subsidair tiga bulan kurungan. Berdasarkan fakta persidangan, menurut Hakim, Hari

telah mengarahkan 22 kepala daerah agar mengadakan mobil pemadam kebakaran dengan spesifikasi yang hanya diproduksi perusahaan milik Hengky Samuel Daud, dengan menerbitkan radiogram yang ditandatangani Oentarto. Hakim juga menganggap Hari mengetahui dan Lanjut ke hal A2 kol 4

MEDAN (Waspada): Polresta Medan mengambil alih penanganan kasus perkelahian anak yang masih pelajar dan telah menetapkan terlapor dijadikan tersangka dalam kasus tersebut. “Kasusnya yang di Polsek Patumbak diambil Polresta, dan masing-masing terlapor sudah ditetapkan menjadi tersangka, namun tidak ditahan,” jelas Kasat Reskrim Kompol Yoris Marzuki didampingi Kapolsek Patumbak SW Siregar dan Kanit PPA AKP Hariani, Kamis (5/1) malam. Dijelaskannya, yang ditetapkan jadi tersangka yakni F, 12, yang dilaporkan orangtua RH, 12 ke Polsek Patumbak. Begitu juga dengan RH, Iptu

Briptu Ahmad Rusdi Harahap Dijatuhi Hukuman Disiplin 100 Sandal Jepit Untuk Kapolri


SEORANG pria memperlihatkan sandal yang akan diserahkan kepada Kapolri di gedung Kadiv Humas Mabes Polri, Jakarta, Kamis (5/1).

PALU (Antara): Briptu Ahmad Rusdi Harahap, anggota Brimob Polda Sulteng yang menjadi korban pencurian sandal jepit dilakukan AAL ,15, dijatuhi hukuman penundaan mengikuti pendidikan paling lama satu tahun karena terbukti telah melanggar ketentuan disiplin anggota Polri. Putusan itu diambil pemimpin sidang Kompol Indra pada sidang disiplin terhadap Briptu Ahmad Rusdi Harahap itu Markas Brimob Polda Sulteng, Kamis (5/1). Selain penundaan mengikuti pendidikan selama satu tahun, Briptu Ahmad Rusdi Harahap juga ditunda kenaikan pangkatnya selama satu periode, dihukum teguran tertulis, mutasi bersifat demosi, dan penempatan dalam tempat Lanjut ke hal A2 kol 6

H dan isterinya S br S yang dilaporkan orangtua F yakni Ali Nur ke Poldasu, yang kemudian dilimpahkan ke Polresta Medan 16 November 2011, dan sudah dijadikan tersangka. “F dilaporkan dengan pasal 80 tentang perlindungan anak ke Polsek Patumbak pada 3 November 2011. Sedangkan RH, Iptu H dan isterinya S br S dilaporkan ke Poldasu hari yang sama dikenakan pasal 170 KUHPidana,” jelas Yoris sambil menambahkan, pihaknya saat ini masih memberkas BAP kedua belah pihak sebelum dikirim ke Jaksa. Dijelaskan Yoris, dalam kasus ini pihaknya sudah Lanjut ke hal A2 kol 1

Gaji 10 PNS Malas Diblokir

TIMIKA (Antara): Pemerintah Kab. Mimika, Papua, memblokir gaji 10 orang Pegawai Negeri Sipil (PNS) malas yang terbukti tidak melaksanakan tugas dalam kurun waktu yang sangat lama. Wakil Bupati Mimika Abdul Muis di Timika, Kamis (5/1), mengatakan 10 PNS malas tersebut bertugas di Pemkab Mimika. Selama ini, para PNS malas tersebut kebanyakan berada di luar Mimika seperti di Yogyakarta, Jayapura, Sumatera, tanpa alasan yang jelas tetapi Lanjut ke hal A2 kol 7

Serampang - Mangan ora mangan asal ngumpul - He.... he....he....

Berita Utama

A2 Orang Sakit Luput Dari Api KRUENGGEUKEUH ( Waspada): Rumah milik Mustafa Ishak, 40, petani asal Desa Lancang Barat, Kec. Dewantara, Aceh Utara, Kamis (5/1), sore ludes terbakar. Beruntung istrinya, Nurhayati, yang sedang sakit di dalam rumah berhasil menyelamatkan diri bersama anaknya. Informasi dihimpun Waspada, Nurhayati baru mengetahui kejadian tersebut

dari warga ketika api sudah membesar. “Beruntung Nurhayati meski kondisinya sedang sakit, berhasil menyelamatkan dirinya dan anaknya,” ujar Geuchik Lancang Barat Razali Yacob. Sedangkan sumber api diduga dari bagian dapur rumah korban, di mana warga melihat bagian dapur sudah ludes kemudian merambat dari bagian lain.

Warga di sekitar lokasi, sempat membantu memadamkan api dengan menggunakan peralatan seadanya. Tapi karena api sudah menguasai seluruh bagian rumah, upaya warga tak berhasil. Camat Dewantara H M Yunus ketika dihubungi mengatakan, dia sudah turun di lokasi dan mengupayakan bantuan kepada korban. (cmk)

Petrus Beraksi Lagi ....

olah TKP, dan mengamankan sejumlah barang bukti untuk penyelidikan. Pemilik toko Sofian (tgk Cek) tempat korban bekerja menjelaska, jumlah pekerja 24 orang asal Semarang. Sebelum kejadian, para korban baru siap makan dan duduk di depan barak, setelah itu terdengar suara tembakan dan teriakan minta tolong.

“Seorang pekerja yaitu Ansori melihat kawannya sudah tergeletak di depan barak berlumuran darah dan Ansori langsung minta tolong kepada warga sekitar,” terangnya. Sofian menjelaskan, para pekerja sudah bekerja selama empat bulan dan habis kontrak satu bulan lagi. Setelah kejadian tersebut, kepala tukang Bandio mendapat sms dari no XL, isinya: semua orang Jawa penipu. (cb01/b05/b01)

juga menjadi korban Petrus di Banda Aceh, Bieruen dan Aceh Utara. Informasi dari Humas Polda Aceh Kombes Pol Gustav Leo, laporan sementara ada terdengar 5 kali tembakan dan diperkirakan pelaku memakai jeket hitam dan memakai helm. Setelah kejadian, polisi terjun ke lokasi kejadian untuk

Kasus Perkelahian ....

berimbang dengan menindaklanjutinya dan menetapkan masing-masing terlapor sebagai tersangka. Yoris menjelaskan, dalam kasus perkelahian ini, Polsek sudah mengirimkan surat ke Balai Perlindungan Anak dan Saksi (BAPAS) tentang permohonan untuk dilakukan penelitian, 23 November 2011. “Sampai saat ini BAPAS belum datang juga. Kemudian saat F menjalani pemeriksaan di Polsek Patumbak, yang bersangkutan didampingi orangtuanya. Polisi masih menunggu kedatangan BAPAS untuk melakukan penelitian terhadap si anak,” jelas Yoris. Dalam kasus ini, Yoris mengharapkan kedua belah pihak berdamai mengingat kedua tersangka masih anakanak. “Kedua belah pihak supaya mengedepankan perdamain karena tersangka masih anak-anak,” jelasnya. Mengenai kasus ini diambil alih Polresta Medan, lanjutnya, supaya dalam penyelidi-

Mahasiswa Dan ....

mengatakan, ketakutan, keresahan, keraguan, bahkan kegelisaan telah menghantui masyarakat Kab. Paluta, pasalnya pemerintah daerah dan DPRD Paluta hanya sibuk dengan partainya dan kepentingan sendiri sehingga mereka lupa tanggungjawab kepada rakyat. “Contohnya , hingga saat ini pemerintah masih mem-

Cuaca Sumut ....

Nelayan Aman Menyinggung kondisi perairan, Hartanto menilai untuk saat ini nelayan aman baik di pesisir barat Sumatera Utara seperti Deliserdang, Langkat dan Asahan. Demikian juga kawasan pesisir barat seperti Madina dan Tapteng. “Tidak ada kendala bagi nelayan-nelayan tradisional turun ke laut menangkap ikan,” ujarnya. Misalnya di Selat Malaka, tinggi gelombang laut mencapai 0,5 hingga 1 meter, sementara pantai barat seperti

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ....., b1(M). 2. a8(M) atau Rh2, Mh7+mat. (Jika 2. Ba4, Mh1+mat).

Jawaban TTS: TTS Topik

Mimbar Jumat

biarkan dan pura-pura tidak tahu bahwa masih merajalela perambahan hutan di Kab. Paluta. Padahal kalau dipikirkan, hutan itu adalah paruparu dunia,” jelasnya. Massa tiba di Kantor Bupati pukul 11:00. Mereka menuntut Bupati menegakkan supremasi hukum, supaya masyarakat Paluta hidup nyaman dan tenteram. (a35) Sibolga mencapai 1 hingga 2 meter. Trembesi Ditanam Presiden Tumbang Hujan deras disertai angin kencang yang mengguyur Jakarta, Kamis (5/1) sore, menyebabkan ibukota semra w u t . B e b e ra p a p a p a n reklame rubuh dan pepohonan tumbang di beberapa ruas jalan Jakarta. Hal itu mengakibatkan arus lalu lintas menjadi padat, karena terjadi penyepitan ruas jalan. Beruntung conopi tersebut tidak menimpa kendaraan yang berada di bawahnya. Hujan deras disertai angin kencang yang mengguyur Jakarta juga menumbangkan satu pohon di pekarangan tengah Kompleks Istana Kepresidenan. Belasan tukang kebun yang bertugas di Istana Kepresidenan di bawah siraman hujan langsung berusaha menegakkan kembali pohon t re m b e s i y a n g d i t a n a m Presiden Susilo Bambang Yudhoyono pada 8 Juli 2010. (m32/ant)

Mabes Polri ....

kasus penembakan di PT Satya Agung dan kasus penembakan buruh galian kabel optik di Bireun,”kata Kapolres Aceh Utara AKBP Farid BE melalui Kasat Reskrim, AKP Marzuki, kemarin siang. Namun, Kasat Reskrim, belum tahu siapa yang memimpin, karena tim belum tiba di Mapolres Aceh Utara. “Yang jelas tim itu turut didampingi tim dari Polda Aceh. Kemungkinan, setelah selesai di Satya Agung, tim bergerak ke sini (Mapolres Aceh Utara),”kata AKP Marzuki, kemarin. Tim yang dipimpin seorang perwira menengah itu

Y A' B A N A A D I N S I I R I A H H M A T Y A H MU K M I N A A H B A S MA L L A H A L A K B A L A S I H I R Al Bayan .... R H K D Malam hari sering terjadi F A H A A Y A N kriminalitas. Misalnya rumah dimasuki maling, harta dicuri, R T A A T H bahkan nyawa pemilik teranJawaban Sudoku: cam. Kita harus minta perlindungan Allah daripada kejaha3 5 8 1 2 6 4 7 9 tan malam apabila telah gelap 1 7 2 5 9 4 6 3 8 gulita. Gelap gulita juga ber4 9 6 3 7 8 2 5 1 makna tak ada cahaya kebenaran sedikitpun dalam dada 8 3 4 9 1 7 5 6 2 manusia. Masyarakat sudah 5 6 7 8 3 2 1 9 4 rusak parah, jauh dengan nilaiagama. 9 2 1 6 4 5 3 8 7 nilaiKita juga perlu waspada 6 1 5 2 8 9 7 4 3 kepada wanita-wanita jahat 2 4 9 7 5 3 8 1 6 (tukang sihir, tukang tenung, pelacur dan wanita-wanita

T D A 'i W S A F A F H L J A S I U A MU B A A A' T A I N U T


kan berimbang sehingga masing-masing terlapor dikenakan status menjadi tersangka. Ketika ditanya kronologis peristiwa ini,Yoris menjelaskan, kejadiannya pada 3 November 2011 di salah satu warnet di Jl. Panglima Denai, Gang Seser, Medan Amplas.Waktu itu F dan RH yang sudah saling kenal berada di warnet tersebut. F kemudian meminta chiep point blank kepada RH, namun tidak diberi. Setelah itu keduanya perang mulut dilanjutkan dengan perkelahian di luar warnet dan sempat dipisah. Setelah itu, keduanya berjalan menuju ke rumah masing-mnaisng di Jl. Seser, Medan Amplas. Sebelum sampai ke rumah, keduanya terlibat perkelahian lagi dan sempat dilerai kedua orangtua masing-masing. “Namun saat dilerai itu, F merasa dianiaya orangtua RH yang kemudian membuat laporan polisi ke Poldasu. Sedangkan orangtua RH, Iptu H juga membuat laporan polisi ke Polsek Patumbak,” jelasnya. (m39)

7 8 3 4 6 1 9 2 5

Pekerja Asal ....

Iskandar Muda (SIM), Banda Aceh.Tiga lainnya dirawat di Banda Aceh.Yaitu, Abdul Wakid,28, Jawa Timur, yang menderita luka tembak di lutut kiri, Hasan,40, asal Jember, tertembak di bagian perut dan bagian hati, dan Kahirul,31, Jember tertembak di bagian rahang kiri, ketiganya masih dirawat di Banda Aceh. Wakapolres, Kompol Warsito Eko Sulistyo mengatakan, pihaknya sekarang ini sedang menggali informasi dari saksi

Gayus Dituntut ....

diketuai Eddy Rakamto di Pengadilan Tindak Pidana Korupsi, Jakarta, Kamis (5/1). “Majelis hakim pengadilan tindak pidana korupsi yang memeriksa, mengadili perkara ini, menyatakan, Gayus H Tambunan bersalah melakukan tindak pidana gratifikasi, suap dan pencucian uang,” kata Eddy. Jaksa menilai Gayus bersalah dalam empat kasus sekaligus yang didakwakan kepadanya. Dalam perkara pertama, Gayus dianggap terbukti menerima suap Rp 925 juta dari Roberto Santonius terkait kepengurusan gugatan keberatan pajak PT Metropolitan Retailmart. Gayus juga diduga menerima uang 1 juta dolar AS dari Alif Kuncoro terkait pembuatan surat permohonan banding dan surat bantahan pajak untuk PT Bumi Resource. Pada 2008, Gayus ditemui Alif Kuncoro di apartemennya di Jakarta. Saat itu Alif meminta Gayus agar membantunya membuatkan surat banding dan surat bantahan untuk kepentingan PT Bumi Resource dengan janji pemberian uang. Meskipun aturan di Direktorat Jenderal Pajak melarang hal itu, Gayus menyanggupi permintaan tersebut. Gayus meminta 500.000 dolar AS untuk pihak lain di Pengadilan Pajak, yaitu Panitera Pengadilan Pajak Majelis sebesar 500.000 dolar AS. Setelah surat yang diminta selesai, Alif memberikan uang yang diminta Gayus. Namun, Gayus tidak pernah memberikan uang itu kepada Panitera Pengadilan Pajak Majelis Idris Irawan. Dia menggunakan uang untuk kepentingan sendiri. Berdasarkan fakta persidangan, hubungan Alif dan Gayus tidak berhenti di situ. Menurut jaksa, Alif kembali meminta bantuan Gayus untuk mengurus Surat Ketetapan Pajak PT Kaltim Prima Coal

WASPADA Jumat 6 Januari 2012

Pangdam I/BB: Jangan Pro-Kontrakan Pembangunan Masjid Jl. Timor

Waspada/Abdul Mukthi Hasan

KELUARGA anggota Polres Bireuen melambaikan tangannya kepada para pekerja galian saluran kabel Telkom yang menjadi korban pemberondongan OTK saat meninggalkan Mapolres Bireuen Kamis (5/1). lain dan berupaya mencari motif. “Barang bukti yang ditemukan di TKP pasca terjadi kasus tersebut berupa 10 selongsong dan 8 proyektil sudah di kirim ke Labfor,” katanya. Sementara itu, Kapolres Bireuen, AKPB Yuri Karsono yang ditanya terpisah mengatakan, para korban dan pekerja galian kabel Tellkom akan diantar ke kampung halamannya dengan bus PMTOH. Mereka dikawal anggota polisi bersenjata lengkap hingga per-

batasan Aceh dengan Medan yaitu sampai ke Aceh Tamiang. Setelah itu anggotanya kembali ke Bireuen, sedangkan bus yang membawa rombongan langsung ke Jawa Timur. “Empat korban luka tembak setibanya di Medan akan diantar ke Bandara Polonia Medan, lalu terbang ke Jawa Timur, yang lainnya diantar dengan bus,” katanya. Sekdakab Bireeun, Ir Razuardi Ibrahim, mengatakan dia sempat tak bisa berkata-kata saat melihat Andriyan-

(KPC) tahun 2001-2005 dengan janji uang. SKP PT KPC ini tidak keluar karena ada masalah penetapan kurs terhadap kewajiban pajak PT KPC. Gayus pun menyanggupi permintaan itu dan menghubungi Maruli Pandapotan Manurung. Setelah SKP PT KPC keluar, Alif menyerahkan 500.000 dolar AS ke Gayus. Tak hanya itu, agar PT KPC dan PT Arutmin mendapat fasilitas sunset policy, Alif meminta Gayus membuat pembetulan Surat Pemberitahuan Pajak Terhutang Pajak Penghasilan (SPT PPh) per iode 2005-2006 dengan janji uang. Setelah Gayus menyelesaikan permintaan itu, Alif menyerahkan 2 juta dolar AS kepada Gayus. Dengan demikian, total uang yang diterima Gayus dari Alif Kuncoro mencapai 3,5 juta dolar AS. Perbuatan Gayus yang menerima hadiah berupa uang dari Alif ini dianggap melanggar Pasal 12 B Ayat 1 dan 2 Undang-Undang Pemberantasan Tindak

Pidana Korupsi. Pada perkara kedua, Gayus tersangkut kasus kepemilikan 659.800 dolar AS dan 9,68 juta dolar Singapura. Jaksa menilai uang tersebut merupakan hasil tindak pidana gratifikasi. Gayus terbukti menerima pemberian sesuai dengan Pasal 12 B Ayat 1 dan 2 Undang-Undang Pemberantasan Tindak Pidana Korupsi jo Pasal 65 Ayat 1 KUH-Pidana. Perkara ketiga terkait penyimpanan uang tersebut ke dalam safe deposite box Bank Mandiri cabang Kelapa Ga d i n g . Me n u r u t j a k s a , dengan menyimpan uang tersebut ke dalam safe deposite box, Gayus melakukan tindak pidana pencucian uang sesuai dengan Pasal 3 Ayat 1 huruf a Undang-Undang Tindak Pidana Pencucian Uang. Dalam kasus keempat, Gayus dinilai terbukti menyuap sejumlah petugas Rumah Tahanan Mako Brimob Kelapa Dua, Depok. Salah satunya kepada Kepala Rutan Mako Brimob, Komisaris Iwan Siswanto. Total uang senilai Rp 264 juta diberikan Gayus ke Iwan agar dia dapat meninggalkan tahanan. Selain perkara di atas, jaksa menuntut majelis hakim agar memutuskan penyitaan barang bukti berupa uang tunai senilai Rp 201 juta, 34 dolar Singapura, 659.800 dolar AS, 9,86 juta dolar Singapura, serta beberapa tabungan yang disebutkan dalam dakwaan. Jaksa juga menuntut penyitaan mobil Honda Jazz dan Ford Everest milik Gayus. (kps)

Vonis 2,5 Tahun ....

menyetujui penerbitan surat pembebasan bea masuk untuk mobil damkar yang diproduksi PT Istana Sarana Raya milik Hengky Samuel Daud. Selain itu, Majelis Hakim juga menilai Hari terbukti menerima mobil Volvo senilai Rp808 juta dan perabot rumah tangga yang pembeliannya dibayar oleh istri Chenny Kolondam. Tindakan Hari tersebut, menurut Hakim, memberatkan Hari karena jelas tidak mendukung program pemberantasan tindak pidana korupsi yang digalakkan pemerintah. Hal yang meringankan adalah Hari belum pernah menjadi terpidana, berjasa atas pengabdiannya pada negara, serta selalu sopan saat menjalani persidangan. Atas vonis tersebut Hari pun langsung menyatakan banding.

sudah berada di Aceh dua hari lalu dan sudah memulai kegiatan dengan melakukan penyelidikan termasuk mengumpulkan barang bukti dan keterangan terkait kasus itu. Selain kasus penembakan terhadap Wagino alias Dimas, pekerja Toko Istana Boneka di Simpang Ilie, Kec. Ulee Kareng, Banda Aceh pada malam tahun baru, tim akan menyelidiki kasus pemberondongan terhadap buruh penggali kabel optik PT Telkomsel di Bireun yang juga terjadi pada malam tahun baru serta penembakan dua buruh perkebunan kelapa sawit di Aceh Utara. Kabid Humas Polda Aceh

Kombes Pol Gastav Leo yang Waspada konfirmasi, Kamis (5/1), membenarkan hal itu. “Keberadaan mereka di Aceh untuk membantu Polda Aceh mengungkapkan kasus penembakan yang terjadi di daerah ini yang terjadi pada malam tahun baru dan yang terjadi sehari setelah itu, termasuk pemberondongan terhadap buruh perkebunan PT Satya Agung yang terjadi akhir 2011 lalu,” kata Kabid Humas Gustav Leo. Namun, Kabid Humas menolak memberi keterangan lebih rinci tentang kegiatan tim dari Bareskrim Mabes Polri itu. (b19/b05)

jahiliyah yang membenci Islam). Ingat, wanita sumber keburukan dan kebaikan. Bila mereka baik tidak bermasalah, tetapi bila mereka buruk, negara bisa kiamat. Kita juga mengharapkan perlindungan Allah dari orang-orang yang dengki apabila ia dengki. (Lihat: QS. al-Falaq: 4—5). Dalam suasana yang tidak menentu, di mana kematian sudah menjadi bagian yang sangat akrab di telinga kita, perlu kita berdoa kepada Allah SWT agar malapetaka itu tidak menimpa kita. Dalam shalat lima waktu, rakaat terakhir

bacalah qunut nazilah. Usai shalat perbanyaklah zikir dan doa. Doa itu otaknya ibadah, doa juga senjata orang mukmin. “Ya Rabbi! kami berlindung kepada-Mu. Kami ingin selamat di dunia dan di akhirat, serta bebas dari api neraka. Kami mohon ampunan-Mu dari segala dosa. Baik yang kami sengaja atau yang tidak! Ya Rabbi! Berilah negeri ini aman dan makmur. Satukan hati kami dalam satu Islam yang rahmatan lil a’lamin. Jadikanlah kami semua kelompok yang selalu bersyukur”. Amiiiin.

OTK Potong ....

menyambung kembali baja tower yang terputus. “Ada dua tower yang dipotong. Apabila kedua tower itu roboh, tujuh kabupaten di Provinsi Aceh terancam gelap gulita. Antara lain, Kab. Pidie, Pidie Jaya, Bireun, Bener Meriah, Aceh Tengah, Banda Aceh dan Aceh Besar,” kata Manajer PT PLN Cabang Sigli Taufik Hidayat, Kamis (5/1). Menurut Taufik, pihaknya tidak mengetahui motif di balik aksi pemotongan dua tower trans Sumatera itu. Namun, tindakan itu sangat merugikan masyarakat, sebab keberadaan listrik sekarang ini sudah menjadi kebutuhan pokok. Pantauan Waspada, Kamis (5/1), dua tower yang dipotong hampir roboh, karena bagian kaki tower itu hampir terputus. Beberapa pegawai PLN terus melakukan perbaikan menyambung kembali tower yang terbuat dari baja murni impor itu. Kasat Reskrim Polres Pidie AKP Jatmiko membenarkan telah terjadi pemotongan terhadap dua tower milik PLN di kawasan persawahan Mutiara Timur. Hingga berita ini diturunkan, pihaknya masih melakukan penyelidikan terhadap kasus itu. (b10)

Ada-ada Saja ....

berdua berkelahi pelaku mencungkil mata pamannya dan mendorongnya hingga ke jatuh dari tangga. Dalam insiden ini, tidak disebutkan alasan mengapa paman dan keponakan ini bisa bertengkar masalah remote hingga terjadi perkelahian. (st/rzl)

to yang masih berusia 14 tahun seorang korban luka tembak.Bahkan saat itu, Razuardi mencari tahu alamatnya yang kemudian didapatkannya dari seorang anggota rombongan. Sebagaimana diberitakan, rumah kost buruh penggali kabel Telkom di Desa Blang Cot Tunong, Jeumpa, Bireuen, Sabtu (31/12) sekira pukul 20:30, diberondong senjata api oleh dua pria penembak misterius (Petrus).Dalam kasus itu, tiga buruh tewas, 7 orang lainnya kritis. Terus Kumpulkan Bukti Kapolres Bireuen, AKBP Yuri Karsono mengatakan, pihaknya terus mengumpulkan keterangan dari para saksi dan bukti-bukti untuk mengungkap motif penyerangan dan menangkap pelakunya. Sementara itu, Dandim 011 Bireuen, Letkol Inf Muhammad Arfah secera terpisah mengatakan, secara umum situasi Bireuen pasca tercajadi kasus menyayat hati tersebut , normal dan aman. (cb02)

Briptu Ahmad ....

khusus selama 21 hari. “Terperiksa Briptu Ahmad Rusdi bersalah karena tidak mengingatkan dan mencegah rekannya Briptu Simson saat mendorong AAL hingga terluka itu,” kata Subarkah. Pimpinan sidang menilai bahwa dalam tugas kesehariannya, Briptu Ahmad Rusdi berkelakuan baik dan tidak mempunyai catatan buruk sebagai anggota Brimob. Secara terpisah, ayah AAL, Ebert Nicolas Lagaronda ,55, yang hadir dalam persidangan itu mengaku puas dan menerima seluruh putusan pimpinan sidang disiplin bagi terperiksa Briptu Ahmad Rusdi Harahap. Ebert mengaku belum berencana melaporkan Briptu Simson atas kasus dugaan tindak penganiayaan yang menimpa AAL anaknya itu. “Belum tahu, saya koordinasi dulu dengan penasehat hukum saya,” katanya. Sebelumnya, pada Rabu (28/12), Briptu Simson Jones Sipayung, 29, anggota Direktorat Reserse Kriminal Khusus Polda Sulawesi Tengah juga diberi sanksi penundaan kenaikan pangkat satu periode atas kasus dugaan penganiayaan terhadap seorang anak yang dituduh mencuri sandal jepit.

MEDAN (Waspada): Plt Gubsu H Gatot Pujo Nugroho mengatakan, masjid bukan hanya berfungsi sebagai tempat ibadah yang mengatur hubungan manusia dengan Allah SWT. Namun, masjid juga sebagai sarana atau fasilitas membentuk karakter bangsa. Di mana saat ini, bangsa Indonesia komit membangun karakter anak-anak bangsa. “Ada pelajaran yang harus kita ambil dari cara kerja Kodam I/BB yaitu, analisa daerah operasi-nya. Di lokasi ini ada empat sekolah. Di mana sekolah-sekolah yang ada di sini memiliki murid hampir 2600-an. Sehingga dengan dibangunnya masjid ini, dapat dimanfaatkan untuk membangun karakter anak-anak bangsa,” kata Gatot, saat acara peletakan batu pertama pembangunan masjid, TPA, dan perpustakaan di Jl. Timor, Kamis (5/12). Sementara itu, Pangdam I/BB Mayjen TNI. Lodewijk F. Paulus meminta, agar pembangunan masjid ini tidak perlu dipro-kontrakan. “Intinya pembangunan masjid ini sebagai alternatif untuk warga dan musafir beribadah, dan yang paling penting ada empat sekolah di sekitar sini. Dimana, siswa-siswa tersebut dapat memanfaatkan untuk beribadah, berinteraksi dan menimba ilmu, makanya kita lengkapi dengan TPA dan perpustakaan,” katanya. Terkait pembangunan kembali Masjid Al-Ikhlas, dia menjelaskan, ada dua hal yang ditinjau, pertama dari aspek hukum dan aspek sosial. “Dari aspek hukum, tanah itu sedang berproses dan saya tidak bisa intervensi. Dari aspek sosial yakni, hubungan saya secara vertikal sebagai manusia kepada Allah, dan hubungan saya kepada masyarakat Kota Medan,” jelasnya. Jika dari aspek hukum dirinya tidak masuk untuk membangun kembali masjid tersebut, maka dirinya mencoba masuk dari aspek sosial. “Nah, dari aspek sosial inilah saya dan prajurit Kodam I/BB berniat untuk membangun masjid di jalan Timor ini,” ungkapnya. (h02)

Gaji 10 PNS Malas ....

tetap menerima gaji. Beberapa orang lainnya diketahui berada di Timika, namun tidak pernah masuk kantor. “Siapa saja mereka menjadi rahasia kami, yang jelas mereka tidak pernah melaksanakan tugas,” kata Muis. Ia mengatakan untuk menindaklanjuti penjatuhan sanksi bagi para PNS malas tersebut maka Pemkab Mimika sudah membuat surat yang ditujukan ke pihak Bank Papua Cabang Timika yang menyalurkan gaji PNS di Mimika. Melalui surat tersebut, pihak Bank Papua Cabang Timika akan memblokir rekening milik 10 PNS malas tersebut. Menurut Muis, selama ini

para PNS malas tersebut seenaknya menerima dan menikmati gaji meski tidak pernah melaksanakan tugas. Selain memblokir dan memotong gaji mereka, menurut Muis, Pemkab Mimika juga akan menindak tegas PNS malas tersebut dengan menerapkan Peraturan Pemerintah Nomor 53 tahun 2010 tentang disiplin PNS. Ke-10 PNS malas tersebut terancam akan dikenai sanksi berupa tindak pemecatan dari status mereka sebagai PNS. Selama beberapa bulan terakhir, Wakil Bupati Mimika Abdul Muis rutin menggelar inspeksi mendadak (sidak) ke semua instansi di lingkungan Pemkab Mimika untuk mengecek keaktifan para PNS setempat.

Si m s o n y a n g d i d u g a menganiaya AAL juga dihukum kurungan selama 21 hari. AAL adalah siswa Sekolah Menengah Kejuruan (SMK) di Kota Palu yang telah menjadi terpidana kasus pencurian sandal jepit milik Briptu Ahmad Rusdi Harahap setelah mendapat putusan hakim PN Kendari, Rabu (4/1) malam. Hakim memutuskan bahwa AAL terbukti bersalah melakukan pencurian seperti yang dituduhkan jaksa namun tidak menghukum terdakwa tetapi mengembalikannya kepada keluarga untuk dibina. Sementara itu, aktivis Aksi Gerakan Seribu Sendal untuk Bebaskan AAL, mengirimkan 100 sandal ke Mabes Polri, Kamis (5/1). Koordinator aksi, Budhi Kurniawan menyatakan, 100 sandal itu dikirim untuk Kapolri Jenderal Pol Timur Pradopo. “Ada dua dus. Isinya ratusan, sisanya kita akan kirimkan ke Kejaksaan, Mahkamah Agung, KY, Menkumham dan Lapas-lapas,” kata Budhi saat ditemui di Mabes Polri, Kamis. Budhi mengungkapkan, gerakan ini adalah sebagai wujud dukungan dan solidaritas masyarakat untuk membebaskan AAL. Dia berharap polisi introspeksi dan tidak

mengulangi perbuatan yang sama dalam menegakkan hukum. “Ini bentuk solidaritas masyarakat yang kecewa, marah dalam penegakan kasus hukum. Bagaimana seorang anak dituduh, ini tamparan buat penegak hukum,” ujarnya. Budhi mengatakan pihaknya akan terus memantau jalannya sidang. Mereka mengaku kecewa dengan proses persidangan, dimana barang bukti yang dihadirkan bukanlah milik Briptu. “Ada kejanggalan. Hakim memutuskan anak bersalah tanpa adanya bukti dia mencuri,” terangnya. Sementara, Kepala Sub Bagian Pelayanan Pengaduan Mabes Polri H Umar Anshori mengatakan, menerima dan mengucapkan terima kasih. “Mudah-mudahan sandal ini dapat disalurkan ke yang membutuhkan dan menjadi bermanfaat seperti di Masjid. Teriring doa, semoga kita tetap dapat hidayah,” katanya. Mendengar itu, Budhi menjawab, “Sandal ini tidak hanya alas kaki, ini tamparan, kritikan masyarakat yang dalam praktek penegakan hukum. Kami mengumpulkan 1300 sandal, yang kami serahkan ke sini adalah 100 dan ini pertama kali,” jawab Budhi. (ant/vvn)

Berita Utama


WASPADA Jumat 6 Januari 2012

Gaji PNS Naik 10 Persen JAKARTA (Waspada): Kesejahteraan para abdi negara pada 2012, bakal lebih baik. Hal itu terwujud setelah pemerintah memutuskan menaikkan gaji Pegawai Negeri Sipil (PNS) se-

besar 10 persen.Selain gaji, pemerintah memberikan gaji ke13, uang makan dan lauk pauk untuk TNI serta Polri. “Pada 2012 ada peningkatan kesejahteraan pegawai,” kata

Wakil Menteri Keuangan, Anny Ratnawati, saat ditemui di acara ‘Program Kebijakan Fiskal 2012’ di kantornya, Jakarta, Kamis (5/1). Dalam Anggaran Pendapa-

Poldasu Grebek Judi Kota Bangun Waspada/Rustam Effendi

SEORANG warga melihat ke dalam mobil Avanza BK 909 KS melalui kaca yang baru dipecah perampok di Jl. Madong Lubis, Kamis (5/1) malam.

Pecahkan Kaca Mobil, Perampok Larikan Tas MEDAN (Waspada): Dua perampok bersepedamotor melarikan tas setelah memecahkan kaca mobil milik korbannya di Jl. Madong Lubis, Lingk. IX, Kel. Pandau Hulu I, Kec. Medan Kota, Kamis (5/1) malam. Iren ,25, korbannya warga Jl. Kasuari, Kec. Medan Sunggal, mengalami kerugian uang kontan dan barang-barang berharga. Informasi diperoleh Waspada di lokasi kejadian, sekitar pukul 17.00, korban dengan mengendarai mobil Avanza BK 909 KS datang ke Jl. Madong Lubis untuk membawa barang-

barang karena baru pindah toko. Sesampainya di jalan tersebut, Iren memarkirkan mobilnya di gang kecil dekat toko barunya. Setelah beberapa menit kemudia, korban mendengar suara orang memecahkan kaca sehingga korban ke luar dari tokonya. Saat itulah, korban melihat dua pria mengendarai sepeda motor jenis matic tancap gas dari Jl. Madong Lubis melaju ke ujung jalan yang agak gelap. Menurut Iren, di dalam tasnya berisi handphone jenis Ipad, kartu ATM, buku bank, KTP dan STNK serta sejumlah uang. Kasus itu dilaporkan ke Polsek Medan Kota. (h04/h03)

Aksi Blokir PLTU ...

berkomentar. “Itu masalah internal perusahaan dan lagi pula saya tidak mempunyai kompetensi untuk memberikan keterangan terkait nilai kerugian,” ujar Nainggolan saat ditanya wartawan terkait nilai kerugian ekses blokade warga seusai pertemuan dengan masyarakat Desa Tanjungpasir, Rabu (4/1) kemarin. Ketua Bidang Hubungan Internasional dan Nasional MUI Kab. Langkat, H. Said Ruly Arianza, selaku tokoh masyarakat Pangkalansusu menegaskan, aksi blokade tetap terus berlanjut sebelum pihak konsorsium terutama dari investor asal China, yakni GPEC merealisasikan tuntutan masyarakat. Dampak Bagi Pedagang Lumpuhnya aktivitas di megaproyek PLTU tidak hanya menimbulkan dampak kerugian besar bagi konsorsium. Tapi dampak kerugian juga berimbas bagi sejumlah pedagang kedai nasi dan penjual makanan di seputar lokasi PLTU. Pantauan Waspada, kemarin, seluruh kedai nasi dan warung penjual minuman serta makanan menutup usaha mereka karena tidak ada pembeli. (a02)

infrastruktur jalan yang rusak. Sebelum jalan selesai diperbaiki, masyarakat tidak akan membuka blokade. Juru bicara Bupati mengatakan, dalam pertemuan yang difasilitasi Pemkab Langkat, pihak konsorsium proyek PLTU berjanji memperbaiki ruas jalan yang rusak tiga sampai empat hari mendatang. Diharapkan, keseriusan konsorsium memperbaiki kerusakan jalan segera mengakhiri aksi warga. Secara terpisah Kapolres Langkat, AKBP Mardiyono, yang dikonfimasi Waspada terkait pemblokiran jalan dilakukan warga sehingga aktivitas proyek nasional itu lumpuh total mengatakan, pihaknya tetap bersikap netral dan berupaya melakukan pendekatan persuasif agar warga tidak melakukan tindakan anarkis. Kapolres mengimbau kepada pihak konsorium untuk melaksanakan kesepakatan yang telah dibuat bersama masyarakat. Mardiyono yakin, jika perusahaan melaksanakan kesepakatatan dengan masyarakat beberapa waktu lalu, tidak akan terjadi aksi demo berujung pada pemblokiran seperti ini. Pantauan Waspada aksi demo sudah memasuki hari ketiga dan aktivitas di perusahaan raksasa pembangkit listrik tenaga batubara ini lumpuh total. Situasi di lingkungan proyek selama ini selalu ramai, namun dalam tiga hari terakhir ini sepi. Ratusan tenaga kerja asing dari negara ‘tirai bambu’ terpaksa bertahan di pemondokan mereka. Sedangkan Material Engineering PT Bagus Karya, Ronal Nainggolan, yakni salah satu dari konsorsium PLTU enggan

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ....., b1(M). 2. a8(M) atau Rh2, Mh7+mat. (Jika 2. Ba4, Mh1+mat).

Jawaban TTS: TTS Topik

T D A 'i W S A F F J A S U A MU B A A' T A I N U

Mimbar Jumat


Y A' B A N A A D I N S I I R I A H H M A T K M I N A A L L A H A K S I H I R K D A Y A N A T H

Jawaban Sudoku:

3 1 4 8 5 9 6 2 7

5 7 9 3 6 2 1 4 8

8 2 6 4 7 1 5 9 3

1 5 3 9 8 6 2 7 4

2 9 7 1 3 4 8 5 6

6 4 8 7 2 5 9 3 1

4 6 2 5 1 3 7 8 9

7 3 5 6 9 8 4 1 2

9 8 1 2 4 7 3 6 5

6 Nelayan Deliserdang ... “Insya Allah kepulangan keenam nelayan ini disambut Bupati Deliserdang H. Amri Tambunan dan rombongan di Bandara Internasional Polonia,” ujar Rahmadsyah. Rahmadsyah mengaku upaya ini berjalan lancar atas bantuan maksimal pihak Konjen Malaysia di Medan. “Pihak Konjen Malaysia di Medan telah membangun komunikasi yang baik dengan anggota DPD RI Parlindungan Purba,” ujar Rahmadsyah, anggota Komisi C DPRD Deliserdang ini. Soal keenam nelayan lainnya, menurut Rahmadsyah, dua diantaranya yakni, Ibrahim alias Ucil dan M. Idris karena masih di bawah umur dijadwalkan minggu depan baru bisa kembali ke Tanah Air. “Keduanya terjeruji di penjara Sei Petani, Tapah, Malaysia. Sementara Lukman, Irhanuddin dan kawan-kawan masih ditelusuri keberadaan penjaranya oleh pihak Kedutaan Besar kita di Malaysia. Pokoknya semua pihak yang terkait serius dalam soal kepulangan nelayan tradisional ini,” jelas Rahmadsyah. Seperti diberitakan, 12 nelayan asal Pantailabu ditahan oleh pihak Malaysia karena dianggap melanggar batas kedua negara, ketika mereka sedang mencari ikan di perairan Selat Malaka. (m16/a06/a07/m32/h06)

Ada-ada Saja ... matanya yang berlumuran darah. “Tolong, aku tak bisa melihat,” ujar korban seperti dikatakan polisi. Menurut laporan, biji mata pria tersebut menonjol ke luar hingga setengah senti meter dari kelopak mata dan mengalami pembengkakan. Korban mengatakan bahwa keponakannya laki-lakinya yang berusia 32 tahun itu sebelumnya menghancurkan remote TV. Setelah mereka berdua berkelahi pelaku mencungkil mata pamannya dan mendorongnya hingga ke jatuh dari tangga. Dalam insiden ini, tidak disebutkan alasan mengapa paman dan keponakan ini bisa bertengkar masalah remote hingga terjadi perkelahian. (st/rzl)

pemain berusaha kabur. Namun, kesigapanpetugasparapemainitu berhasil ditangkap setelah polisi mengeluarkanbeberapakalitembakan ke udara. Bandar beserta para pemain diboyong ke Mapoldasuuntukdiproseshukum. (h03)

BELAWAN (Waspada): Tim khusus Polda Sumut menggerebek judi dadu atau samkwan dan sabung ayam beromset ratusan juta rupiah di Jl. Perak, Kel. Kota Bangun, Kec. Medan Deli, Kamis (5/1) sekitar pukul 20:30. Dalam pengerebekan itu sempat terdengar letusan senjata api. Letusan itu sengaja dilakukan guna menghempang perlawanan dari sejumlah oknum yang diduga membeking judi tersebut. Selain mengamankan seorang bandar berinisial AK, polisi menangkap belasan pemain wanita dan pria. Informasi diperoleh Waspada, penggerebekan dilakukan dengan mengepung lokasi judi di barak beratapkan rumbia ukuran 10X8 meter oleh puluhan polisi dilengkapi senjata

api. Aparat bergerak bersama, dimonitor dua unit mobil pribadi yang datang dari arah pintu masuk lokasi , dan dibantu belasan sepeda motor dari tim. Ketika personil berhasil masuk ke lokasi, bandar dan para

Badai Landa Jakarta ...

hon, angin kencang juga membuat ambruk papan reklame di wilayah Kebon Jeruk, Jakarta Barat, hingga menewaskan seorang pemuda bernama Yadi. Hujan lebat yang disertai angin kencang juga menjatuhkan tutup papan iklan di jembatan penyeberangan orang di depan Central Park Sudirman. Peristiwa lainnya, sebuah mobil angkutan barang tertimpa papan reklame yang ambruk di Tol Dalam Kota Tomang arah ke Kebon Jeruk.

Intelijen Amerika Serikat (CIA) yang mengatakan bahwa meningkatkan ancaman kekerasan kepadaIrandemimengamankan Israel, maka akan menjadi sebuah kesalahan terbesar abad ini. “Bila kebijakan retorik ini tidak dapat terkendali dan terjadi insiden di Teluk Persia ataupun Selat Hormuz, bisa jadi akan membawa wilayah tersebut ke dalam perang. Tetapi dampak paling parah adalah Israel akan hancur dalam sekejap,” ungkap Ray McGovern seperti dikutip ABNA, Rabu (4/1). Wakil Presiden Iran Mohammad Reza Rahimi memperingatkan dunia Barat yang berniat untuk memberikan sanksi kepada Iran, negaranya menutup Selat Hormuzbilasanksidijatuhkan.SelatHormuzadalahperairanpenting yang menjadi penghubung tanker minyak dunia.(ap/ok/m10)

sangkutan didampingi orangtuanya. Polisi masih menunggu kedatangan BAPAS untuk melakukan penelitian terhadap si anak,” jelas Yoris. Dalam kasus ini, Yoris mengharapkan kedua belah pihak berdamai mengingat kedua tersangka masih anak-anak. “Kedua belah pihak supaya mengedepankan perdamaian karena tersangka masih anakanak,” jelasnya. Mengenai kasus ini diambil alih Polresta Medan, lanjutnya, supaya dalam penyelidikan berimbang sehingga masing-masing terlapor dikenakan status menjadi tersangka. Ketika ditanya kronologis peristiwa ini,Yoris menjelaskan, kejadiannya pada 3 November 2011 di salah satu warnet di Jl. Panglima Denai, Gang Se-ser, Medan Amplas. Waktu itu Fdan

RH yang sudah saling kenal berada di warnet tersebut. F kemudian meminta chiep point blank kepada RH, namun tidak diberi. Setelah itu keduanya perang mulut dilanjutkan dengan perkelahian di luar warnet dan sempat dipisah. Setelah itu, keduanya berjalan menuju ke rumah masing-masing di Jl. Seser, Medan Amplas. Sebelum sampai ke rumah, keduanya terlibat perkelahian lagi dan sempat dilerai kedua orangtua masing-masing. “Namun saat dilerai itu, F merasa dianiaya orangtua RH yang kemudian membuat laporan polisi ke Poldasu. Sedangkan orangtua RH, Iptu H juga membuat laporan polisi ke Polsek Patumbak,” jelasnya. (m39)

mess Pemko dan kendaraan dinas Rp25 juta, biaya penunjang operasional walikota tahun 2005 Rp50 juta, biaya anggaran rutin dan pengadaan Alkes Dinas Kesehatan Rp650 juta, panjar kegiatan rutin Triwulan I tahun 2005 Dinas Kebersihan LH Rp230 juta, pemeliharaan jalan dan drainase tahun 2005 Dinas PU Rp250 juta. Panjar nota dinas SKPD yang disetujui terdakwa dan dicairkan Panahatan Sihombing, merupakan panjar nota dinas yang diajukan Kabag Umum, Zainal Arifin Sinaga sebesar Rp239 juta pada 6 April 2005 dan Rp50 juta diserahkan kepada Lomo Gultom pada 20 Mei 2005. Selanjutnya, tiga nota dinas yang diajukan Kadis Kesehatan Andy Rangkuti sebesar Rp650 juta pada Maret-Mei 2005, nota dinas yang diajukan Plt Kadis Kebersihan dan Lingkungan Hidup Painan Siagian sebesar Rp230 juta pada 1 April 2005, dan nota dinas yang diajukan Kadis PUK Pematang Siantar Albert Nainggolan sebesar Rp250 juta pada 1 April 2005. Dana panjar yang dicairkan

melalui nota dinas itu, Panahatan memotongnya sebesar Rp25 juta-Rp60 juta, dengan alasan untuk pemotongan pajak kegiatan. Wa l a u p u n t e r d a k w a mengetahui pengajuan panjar nota dinas tersebut tidak sesuai peraturan, karena saat itu APBD belum disahkan dan belum ditempatkan dalam lembaran daerah serta belum ada Surat Keputusan Otorisasi yang ditandatangani wali kota, sekda dan kabag keuangan Vonis yang dijatuhkan majelis hakim lebih ringan 1 tahun penjara, dari tuntutan Jaksa Penuntut Umum Flora Rajagukguk pada persidangan sebelumnya, yang menuntut Kurnia Saragih 3 tahun 6 bulan penjara denda senilai Rp50 juta subsider tiga bulan kurungan, serta membayar uang pengganti kerugian negara senilai Rp385 juta subsider setahun 8 bulan kurungan. Sementara itu, Kurnia Saragih menanggapi putusan majelis hakim mengatakan, akan pikir-pikir dahulu untuk mengajukan banding. (m38)

Sedangkan, jenazah 3 korban yaitu, Suniyoto,28 asal Jember, Daud,30, Bayuwangi dan Suparna,31, Jember, sudah diterbangkan pulang beberapa hari sebelumnya melalui Bandara Sultan Iskandar Muda (SIM), Banda Aceh.Tiga lainnya dirawat di Banda Aceh.Yaitu, Abdul Wakid,28, Jawa Timur, yang menderita luka tembak di lutut kiri, Hasan,40, asal Jember, tertembak di bagian perut dan bagian hati, dan Kahirul,31, Jember tertembak di bagian rahang kiri, ketiganya masih dirawat di Banda Aceh. Wakapolres, KompolWarsito Eko Sulistyo mengatakan, pihaknya sekarang ini sedang menggali informasi dari saksi lain dan berupaya mencari motif. “Barang bukti yang ditemukan di TKP pasca terjadi kasus ter-

sebut berupa 10 selongsong dan 8 proyektil sudah di kirim ke Labfor,”katanya. (cb02)

di Jakarta, Kamis. Briptu Widi mengatakan kebanyakan peristiwa pohon tumbang terjadi di wilayah Jakarta Selatan, Jakarta Pusat dan Jakarta Barat, sehingga masyarakat diimbau mengambil jalur alternatif. Widi menyebutkan contoh kemacetan laju kendaraan total terjadi dari arah Semanggi menuju Slipi, Jakarta Barat, karena ada dua lokasi pohon tumbang. Selain menumbangkan po-

Kasus Perkelahian ... dikenakan pasal 170 KUHPidana,” jelas Yoris sambil menambahkan, pihaknya saat ini masih memberkas BAP kedua belah pihak sebelum dikirim ke Jaksa. Dijelaskan Yoris, dalam kasus ini pihaknya sudah berimbang dengan menindaklanjutinya dan menetapkan masingmasing terlapor sebagai tersangka. Yoris menjelaskan, dalam kasus perkelahian ini, Polsek sudah mengirimkan surat ke Balai Perlindungan Anak dan Saksi (BAPAS) tentang permohonan untuk dilakukan penelitian, 23 November 2011. “Sampai saat ini BAPAS belum datang juga. Kemudian saat F menjalani pemeriksaan di Polsek Patumbak , yang ber-

Mantan Plt Wali Kota ... subsidair, melanggar Pasal 3 jo Pasal 18 UU No. 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi sebagaimana diubah dengan UU No. 20Tahun 2001 jo Pasal 55 ayat (1) ke-1 KUHPidana, yaitu bersama-sama atau koorporasi melakukan tindak pidana korupsi. Menyalahgunakan wewenang untuk memperkaya diri sendiri dan merugikan keuangan negara, dengan menyuruh para bawahannya melakukan korupsi dana APBD Pematangsiantar tahun 2005. Sebab saat memangku jabatan Plt Walikota masa itu, terdakwa telah menyetujui nota dinas sejumlah Satuan Kerja Perangkat Daerah (SKPD) tanpa disposisi Sekda dan Kabag Keuangan, sehingga panjar nota dinas sebesar Rp1.205.069.081 dapat dicairkan Panahatan Sihombing. Dana panjar kegiatan yang tidak bisa dipertanggungjawabkan hinggaTahun Anggaran (TA) 2005, berakhir merupakan biaya pemeliharaan rumah dinas wali kota/wakil walikota,

Pulang Kampung ... Mereka diberangkatkan dari Mapolres setempat, Kamis (5/l), bersama Wakapolres Bireuen, Kompol Warsito Eko Sulistyo, SIk, Dandim 0111 Bireuen, Letkol Inf. Muhammad Arfah, Sekdakab Bireuen Ir H Razuardi Ibrahim, MT dan keluarga besar Polres dan sejumlah anggota masyarakat diwarnai suasana haru. Empat korban luka tembak tersebut, adalah, Yaiman,28, Jawa Timur, Anshari,40, Jember, Imam Maliki,27,Jawa Timur, Andrianto (bukan Andri)14, Jatilongor. Sedangkan rombongan pekerja sebanyak 40 orang, termasuk dua wanita yang selama ini menjadi menjadi tukang masak di barak, Yuni, 40, dan Latifah,50,

Pengamat CIA: Israel Bisa Hancur Dalam Sekejap JERUSALEM (Waspada): Beberapa waktu terakhir kabar mengenai serangan terhadap Iran terus menguat, namun ada kekhawatiran bila serangan ini terjadi maka Israel yang akan hilang dari muka bumi. Perkiraan itu disampaikan seorang mantan analis Dinas

Al Bayan ... Malam hari sering terjadi kriminalitas. Misalnya rumah dimasuki maling, harta dicuri, bahkan nyawa pemilik terancam. Kita harus minta perlindungan Allah daripada kejahatan malam apabila telah gelap gulita. Gelap gulita juga bermakna tak ada cahaya kebenaran sedikitpun dalam dada manusia. Masyarakat sudah rusak parah, jauh dengan nilai-nilai agama. Kita juga perlu waspada kepada wanitawanita jahat (tukang sihir, tukang tenung, pelacur dan wanita-wanita jahiliyah yang membenci Islam). Ingat, wanita sumber keburukan dan kebaikan. Bila mereka baik tidak bermasalah, tetapi bila mereka buruk, negara bisa kiamat. Kita juga mengharapkan perlindungan Allah dari orang-orang yang dengki apabila ia dengki.

3 BURUH DIDOR ... Pemilik toko Sofian (Tgk Cek) tempat korban bekerja menjelaskan, jumlah pekerja 24 orang asal Semarang. Sebelum kejadian, para korban baru siap makan dan duduk di depan barak, setelah itu terdengar suara tembakan dan teriakan minta tolong. “Seorang pekerja yaitu Ansori melihat kawannya sudah tergeletak di depan barak berlumuran darah dan Ansori langsung minta tolong kepada warga sekitar,”terangnya. Sofian menjelaskan, para pekerja sudah bekerja selama empat bulan dan habis kontrak satu bulan lagi. (cb01/b05/b01)

(Lihat: QS. al-Falaq: 4—5). Dalam suasana yang tidak menentu, di mana kematian sudah menjadi bagian yang sangat akrab di telinga kita, perlu kita berdoa kepada Allah SWT agar malapetaka itu tidak menimpa kita. Dalam shalat lima waktu, rakaat terakhir bacalah qunut nazilah. Usai shalat perbanyaklah zikir dan doa. Doa itu otaknya ibadah, doa juga senjata orang mukmin. “Ya Rabbi! kami berlindung kepada-Mu. Kami ingin selamat di dunia dan di akhirat, serta bebas dari api neraka. Kami mohon ampunan-Mu dari segala dosa. Baik yang kami sengaja atau yang tidak! Ya Rabbi! Berilah negeri ini aman dan makmur. Satukan hati kami dalam satu Islam yang rahmatan lil a’lamin. Jadikanlah kami semua kelompok yang selalu bersyukur”. Amiiiin.

tan dan Belanja Negara (APBN) 2012, anggaran belanja kementerian/lembaga (K/L) dialokasikan sebesar Rp508,3 triliun. Anggaran tersebut juga meliputi belanja pegawai sebesar Rp127,7 triliun. Anggaran belanja pegawai tersebut meliputi gaji dan tunjangan yang melekat pada gaji, remunerasi/tunjangan kinerja/ tunjangan khusus, honorarium tetap, lembur dan vakasi, kenaikan gaji pokok sebesar 10 persen dan gaji ke-13, Anny menjelaskan, pemerintah telah meningkatkan anggaran belanja pusat sebesar tiga kali lipat dari 2005. Pada 2012, anggaran belanja pemerintah pusat mencapai Rp965 triliun. “Dengan peningkatan rata-rata sebesar 16 persen per tahun,” kata dia. (vvn)

Cuaca Sumut ... yang terjadi saat ini merupakan hujan-hujan lokal. Kalaupun hujan sporadis yang mengguyur Medan seperti Kamis dinihari, sifatnya tidak lama hanya berkisar antara 0,5 jam hingga 1 jam, namun intensitas hujan tergolong tinggi. Hujan, kata dia, kadang-kala diselingi angin kencang bahkan petir, namun masyarakat Medan dan sekitarnya masih tergolong dalam kondisi lebih aman. Hartanto menilai, seminggu ke depan, kondisi cuaca di Kota Medan dan sekitarnya menurut prakiraan Badan Meteorologi Klimatologi dan Geofisika (BMKG) wilayah I, cukup aman dan tidak ada gejolak mengkhawatirkan. Sementara gangguan cuaca diLautChinaSelatan(LCS)hingga saat ini mulai mereda, bahkan pumpunanawankeSumateraUtara mulai berkurang dibandingkan akhir Desember. (m32)

Plt Gubsu: Jadikan ... Ditambahkannya, dengan bertambahnya masjid di Medan, diharapkan dapat menambah mental keagamaan bagi siswa. “Salut, apresiasi dan bangga dengan Pangdam, akan ideide segarnya untuk membangun masjid di wilayah ini, belum lagi masyarakat dan para musafir. Saya yakin, pendirian masjid ini untuk menyiapkan generasi Indonesia dengan iman dan taqwa serta teknologi.” Jangan Dipro-Kontrakan Sementara itu, Pangdam I/ BB Mayjen TNI. Lodewijk F. Paulus meminta, agar pembangunan masjid ini tidak perlu dipro-kontrakan. “Intinya pembangunan masjid ini sebagai alternatif untuk warga dan musafir beribadah, dan yang paling penting ada empat sekolah di sekitar sini. Dimana, siswa-siswa tersebut dapat memanfaatkan untuk beribadah, berinteraksi dan menimba ilmu, makanya kita lengkapi dengan TPA dan perpustakaan,” katanya.


GAYUS DITUNTUT DELAPAN TAHUN: Terdakwa kasus dugaan korupsi Ditjen Pajak, Gayus Halomoan Tambunan mendengarkan pembacaan tuntutan oleh Jaksa Penuntut Umum (JPU) di Pengadilan Tipikor, Jakarta, Kamis (5/ 1). Gayus dituntut hukuman delapan tahun penjara dan denda Rp 1 miliar subsidair enam bulan, atas dakwaan telah menerima gratifikasi (pemberian hadiah kepada penyelenggara negara) terkait pengurusan pajak PT Bumi Resources, PT Kaltim Prima Coal dan PT Arutmin saat menjadi pegawai ditjen Pajak.

Hari Sabarno ... tindak pidana korupsi dalam kasus pengadaan mobil pemadam kebakaran (Damkar) di 22 wilayah Indonesia. Tetapi, Jenderal TNI (Purn) itu langsung menyatakan banding atas putusan Hakim Pengadilan Tipikor yang menambah denda Rp150 juta atau kurungan selama tiga bulan. “Mengadili, menyatakan, Hari Sabarno terbukti sah dan meyakinkan melakukan tindak pidana korupsi bersama-sama. Menjatuhkan pidana penjara selama 2 tahun 6 bulan dan denda Rp 150 juta dengan ketentuan apabila tidak dibayar, diganti dengan kurungan 3 bulan,” kata Ketua Majelis Hakim Pengadilan Tindak Pidana Korupsi Suhartoyo membacakan vonis Hari Sabarno di Pengadilan Tipikor, Jakarta, Kamis (5/1). Awalnya JPU KPK menuntut Hari Sabarno dengan hukuman 5 tahun penjara, denda Rp250 juta. Pada putusan tersebut, Majelis Hakim mengatakan, Hari Sabarno terbukti melakukan tindak pidana korupsi bersama-sama Oentarto Sindung Mawardi selaku mantan Dirjen Otonomi Daerah Depdagri dan Hengky Samuel Daud sebagai pemilik PT Istana Sarana Raya. Tindakan tersebut merupakan pelanggaran Pasal 3 UndangUndang Pemberantasan Tindak Pidana Korupsi. Sementara Oentarto divonis 3 tahun penjara dan kini telah bebas, sedangkan Hengky divonis hukuman 18 tahun penjara tetapi saat menjalani hukuman dia meninggal di dalam penjara. Menurut Hakim, Hari menyalahgunakan kewenangannya selaku Menteri Dalam Negeri waktu itu sehingga menimbulkan kerugian negara dan justru memperkaya diri sendiri atau orang lain, atau suatu korporasi. “Hakim berkeyakinan bahwa faktafakta hukum tersebut merupakan petunjuk bahwa penerbitan radiogram benar-benar atas persetujuan dan pengetahuan terdakwa,” kata hakim. (j02) Terkait pembangunan kembali Masjid Al-Ikhlas, dia menjelaskan,adaduahalyangditinjau, pertama dari aspek hu-kum dan aspek sosial. “Dari aspek hukum, tanah itu sedang berproses dan saya tidak bisa intervensi. Dari aspek sosial yakni, hubungan saya secara vertikal sebagai manusia kepada Allah, dan hubungan saya kepada masyarakat Kota Medan,” jelasnya. Jika dari aspek hukum dirinya tidak masuk untuk membangun kembali masjid tersebut, maka dirinya mencoba masuk dari aspek sosial. “Nah, dari aspek sosial inilah saya dan prajurit Kodam I/BB berniat untuk membangun masjid di jalan Timor ini,” ungkapnya sembari menekankan, biaya masjid berasal dari hamba-hamba Allah, bukan dari pengembang. Dia berharap, dengan dibangunnya masjid di wilayah ini, bisa membangun dan membentuk masyarakat yang beriman dan bertaqwa kepada TuhanYang Maha Esa. “Sebagai umat yang beriman, kita yakin

‘Kalau Mau Sehat ... orang anaknya, kini ia menafkahi lima buyut yang sudah menjadi yatim. Perempuan tangguh yang tinggal di seputar Taman Bahagia, Kel. Berasbasah, Kec. Pangkalansusu, Kab.Langkat, ini menjalani rutinitas sebagai penjual pecal keling dan kue. Dengan sepeda bototnya, ia setiap hari berkeliling di seputaran ‘kota minyak’ untuk menjajakan penganan tradisonal yang masih banyak digemari masyarakat. Waspada yang kebetulan menunggu antrean di warnet Jl. Pahlawan, Pangkalansusu, merasa penasaran melihat sosok wanita jompo mangkal di persimpangan jalan melayani konsumen yang sudah menjadi langganannya. Meskipun kondisinya sudah sepuh, tapi perempuan berdarah Jawa kelahiran Aceh ini tampak masih sangat energik. Ia mengaku, tidak

bahwa dengan menjadikan masjid sebagai tempat berkomunikasi secara vertikal kepada Allah SWT, diharapkan kita memperoleh keberhasilan dalam melaksanakan setiap tugas dan pengabdian kita sebagai khalifah,” tegasnya. Sedangkan Ketua Umum MUI Medan Prof. H. Mohd. Hatta menuturkan, dalam Alquran, Allah menegaskan orang yang mau memakmurkan masjid adalah orang-orang yang beriman kepada Allah dan hari akhirat dan mendirikan shalat serta mendirikan zakat. “Mukmin harus tunduk dan patuh kepada Allah. Jangan mendirikan masjid karena takut dan gentar kepada siapapun, kecuali kepada Allah,” katanya. Ditambahkannya, saat ini ada 1036 unit masjid di Medan, dengan dibangunnya masjid ini menambah khazanah yang dapat membangun sebuah jamaah yang kokoh, membentuk manusia-manusia yang satria, tunduk dan patuh kepada Allah, aturan dan tatanan. (h02)

bisa berdiam diri di rumah karena ia masih memiliki tanggungan lima orang anak yatim yang harus diberinya nafkah. Ia merasa bersyukur, kondisi fisiknya tetap sehat dan masih mampu berusaha tanpa ketergantungan pada orang lain. Rusuwen menyatakan, penghasil kotor yang ia peroleh jika jualannya habis, bisa mencapai Rp150 ribu bahkan lebih. Berjualan penganan ini sudah dilakoni sang nenek sejak ia berusia 18 tahun. “Selagi badan sehat, saya akan terus berusaha mencari rezeki yang halal,” ujarnya sambil tersenyum. Perempuan yang sudah lama menjanda ini menyebutkan kunci kesehatan adalah rajin beribadah kepada Allah. “Kalau mau tetap sehat, kita harus dapat menjaga kebersihan hati dan jangan lupa menjalankan kewajiban ibadah,” tutur Rusuwen sambil mendorong sepeda mengelilingi ‘kota minyak’ untuk menjajakan pecal made in sendiri. Asrirrasi


WASPADA Jumat 6 Januari 2012


WHO Khawatirkan Penelitian Mutasi Flu Burung ORGANISASI Kesehatan Dunia (WHO) mengeluarkan peringatan keras kepada para ilmuwan yang merekayasa virus flu burung H5N1 yang sangat tinggi potensinya menyebarkan penyakit, dengan mengatakan apa yang mereka lakukan bisa menimbulkan resiko besar dan harus diawasi dengan ketat. Lembaga kesehatan PBB itu mengatakan, pihaknya ‘sangat prihatin pada dampak negatif’ dari kepada dua tim peneliti flu yang pada bulan lalu mengatakan mereka telah menemukan cara untuk membuat virus H5N1 menjadi formula yang dengan mudah ditularkan sehingga bisa menyebabkan penyakit menular mematikan pada manusia. Rekayasa yang dilakukan kedua tim itu, satu di Belanda dan satu di AS, telah mendorong seruan sensor dari penasehat keamanan AS yang khawatir penerbitan secara rinci penelitian itu bisa membuat calon-calon penyerang mengetahui bagaimana cara membuat senjata bioteror. Badan Penasehat Sains Nasional untuk Keamanan Biologi AS meminta dua jurnal yang ingin menerbitkan pekerjaan

mereka untuk hanya memuat versi yang telah dihapus sebagian dari penelitian yang telah dilakukan, permintaan yang mendapat penentangan dari para redaktur jurnal dan ilmuwan. Dalam ulasan pertama tentang kontroversi itu, WHO mengatakan”Meskipun jelas melakukan penelitian untuk mendapatkan pengetahuan harus dilanjutkan, tapi jelas juga bahwa penelitian tertentu dan khususnya yang bisa menghasilkan bentuk virus yang lebih berbahaya.. akan menimbulkan resiko.” Virus flu burung H5N1 sangat mematikan bagi manusia yang langsung bersentuhan dengan unggas yang terinfeksi. Sejak virus tersebut pertama kali terdeteksi pada tahun 1997, sekitar 600 orang telah terjangkit dan lebih setengah dari me-

reka meninggal dunia. Namun sampai sejauh ini, virus tersebut belum bermutasi secara alami ke bentuk yang bisa dengan mudah tertularkan dari manusia ke manusia, meski banyak ilmuwan khawatir jenis mutasi ini akan terjadi suatu saat dan akan menimbulkan ancaman kesehatan yang besar jika itu terjadi. Mutasi Para peneliti flu di seluruh dunia selama bertahun-tahun telah mencari tahu mutasi apa yang akan memungkinkan virus H5N1 untuk menyebar dengan mudah dari satu manusia ke manusia lainnya, namun di saat yang sama juga mempertahankan kadar mematikannya. Institut Kesehatan Nasional AS mendanai kedua tim peneliti itu untuk meneliti bagaimana virus tersebut lebih mudah menular pada manusia, dengan tujuan mengetahui bagaimana reaksi jika mutasi terjadi secara alami. WHO mengatakan penelitian semacam itu seharusnya dilakukan ‘hanya setelah semua resiko kesehatan public dan keuntungannya diketahui’ dan‘sudah pasti perlindungan penting untuk memperkecil potensi dampak negative terjadi’. Badan tersebut juga mengatakan, penting peraturan baru tentang virus dan ilmu

sains diterapkan untuk memastikan negara-negara yang paling rentan dilanda virus H5N1, terutama negara berkembang di Asia seperti Indonesia, Vietnam dan lainnya, akan mendapatkan manfaat dari penelitian. Selama terjadi pandemic flu babi H1N1 di tahun 20091010, banyak negara berkembang mengeluhkan mereka tidak memiliki obat anti virus atau vaksin untuk memerangi virus baru, meski telah memiliki contoh virus yang diberikan kepada para peneliti dan perusahaan farmasi untuk mengembangkan obat pencegahnya. Biasanya laboratorium di negara kaya yang memiliki tingkat kepakaran sains perlu meneliti virus flu yang kompleks, sementara virus flu burung itu sendiri berasal dari negara-negara Asia. Rangka kerja Persiapan Influenza Pandemik baru disetujui dan diterapkan oleh semua negara anggota WHO pada Mei 2011 untuk menetapkan virus flu yang memiliki potensi pandemic dan berbagi manfaat dari kepakaran yang dicapai. “WHO mempertimbangkansangatpentingilmuwanyang melakukan penelitian virus flu dengan potensi pandemic mematuhi secara penuh peraturan baru,” kata WHO dalam satu pernyataan. Syafri/reuters

FLU burung kembali merebak dan telah menelan satu orang korban di China awal tahun ini.

Rencana Hotel Mewah Di Atas Kapal Induk Soviet


PARA teknisi sedang bekerja di pabrik perakitan pesawat Boeing. Boeing berencana menutup pabrik pertahanannya di Wichita, Kansas, sebelum akhir 2013 serta mengurangi jumlah karyawan mereka hingga ribuan orang.

Boeing PHK Lebih 2.000 Karyawan PENGURANGAN dana dari pemerintah Amerika Serikat telah menyebabkan produsen raksasa pesawat terbang Boeing berencana menutup pabrik pertahanannya di Wichita, Kansas, sebelum akhir 2013 serta mengurangi jumlah karyawan mereka hingga ribuan orang. Perusahaan pembuat pesawat terbang asal AS ini mengumumkan hal ini pada Rabu (4/1). “Keputusan untuk menutup fasilitas di Wichita adalah hal yang sulit, namun hal itu diambil berdasarkan analisis kondisi pasar masa kini dan masa depan,” kata Wakil Presiden Direktur divisi Pemeliharaan, Modifikasi dan Peningkatan “Boeing Defense, Space and Security” (BDS). Mark Bass menambahkan

bahwa analisis tersebut juga mengkaji mengenai kemampuan Boeing agar tetap kompetitif dan dapat memenuhi kebutuhan konsumen dengan solusi terbaik dan terjangkau. Pengumuman tersebut membuat 2.160 orang karyawannya harus kehilangan pekerjaan di pabrik Boeing di Kansas, tempat pangkalan Sistem Transportasi dan Eksekutif Global perusahaan itu. Fasilitas tersebut juga menyediakan sarana pendukung untuk perencanaan penerbangan dan logistik yang terintegrasi. Berdasarkan rencana baru Boeing, bagian pemeliharaan, modifikasi dan sarana pendukung pesawat akan dipindahkan ke fasilitas Boeing di San Antonio, sementara pekerjaan rekayasa akan ditempatkan di

instalasi di Oklahoma City. Alasan utama di balik penutupan fasilitas di Wichita adalah pengurangan dana 500 miliar dolar AS dari anggaran pertahanan dalam 10 tahun mendatang. “Pada masa pengurangan anggaran pertahanan seperti saat ini, ditambah pergeseran prioritas konsumen, Boeing memutuskan untuk menutup operasinya diWichita demi mengurangi biaya, meningkatkan efisiensi dan mendorong daya saing,” kata Bass. Dalam lima tahun terakhir, menurut Boeing, kontrak di fasilitasWichita telah jatuh tempo atau mendekati akhir dan fasilitas tersebut tidak memiliki kemampuan untuk melanjutkan bisnis untuk menciptakan struktur biaya yang terjangkau demi memelihara dan mem-

peroleh bisnis baru. Anggota Konggres dari Kansas, Lynn Jenkins, mengeritik penutupan tersebut. “Perusahaan penerbangan sangat penting bagi perekonomian Kansas dan vital bagi ribuan warga yang bekerja sebagai teknisi, pemasok atau karyawan perusahaan tersebut,” katanya. Ia menambahkan bahwa “sangat memalukan mengetahui hubungan Boeing yang sudah 80 tahun dengan Kansas harus berakhir dengan cara seperti ini”. Boeing menghabiskan lebih dari 3,2 miliar dolar AS dan mempekerjakan sekitar 475 pemasok di Kansas pada 2011 atau jumlah keempat terbesar dalam jaringan pemasok Boeing, meliputi bisnis komersial dan pertahanan, demikian Xinhua melaporkan. (ant/rzl)

Seekor Ikan Tuna Harganya Rp6,7 M SEORANG pengusaha restoran di Jepang mencatat rekor pembelian untuk seekor ikan tuna seharga US$736.500 atau sekira Rp 6,7 miliar. Ikan berharga miliaran ini terjual pada Kamis (5/1), dalam sebuah acara lelang yang berlangsung di pasar

ikan Tsukiji, Jepang. Ikan tuna sirip biru raksasa dengan bobot 269 kilogram ini ditangkap di perairan Aomori utara. Dengan harga tersebut, berarti 1 kilogram daging tuna itu nilainya mencapai sekira US$1.200 atau sekira Rp10,8 juta. Menurut laporan, acara le-

lang ikan di awal tahun itu selalu mendapat perhatian besar di Jepang, dan sudah menjadi tradisi harga yang tercapai dalam pelelelang selalu mencetak rekor baru. Namun tidak banyak yang menduga harganya akan menembus hingga semahal ini.


Kiyoshi Kimura seorang pemilik jaringan restoran sushi memamerkan ikan tuna seberat 269 kilogram yang ia beli seharga US$736.500 atau sekira Rp 6,7 miliar dalam sebuah acara lelang yang berlangsung di pasar ikan Tsukiji, Jepang pada Kamis (5/1).

Hargatahuninimemecahkan rekor tahun lalu yang mencapai tak kurang dari US$400.000 untuk seekor tuna. Pemenang lelang tahun ini adalah Kiyoshi Kimura, pemilik jaringan restoran sushi. Ia mengatakan dirinya ingin membesarkan hati rakyat Jepang dan membantu bangsa Jepang pulih dari bencana gempa bumi dan tsunami dahsyat tahun lalu. “Jepang mengalami masa-masa sulit tahun lalu karena bencana. Jadi kami perlu menunjukkan diri bahwa Jepang bisa bertahan,” kata Kimura yang dilansir BBC. Kimura juga mengatakan, dirinya ingin agar tuna raksasa ini tidak dibeli orang asing atau dibawa ke luar Jepang. Tuna termahal tahun lalu dibeli pengusaha Hong Kong Ricky Cheng, yang juga dikenal sebagai pemilik jaringan restoran makanan Jepang di Tokyo dan Hong Kong. Penangkapan besar-besaran membuat persediaan tuna menurun tajam di seluruh dunia. Hampir 75% tangkapan ikan tuna sirip biru di seluruh dunia dikonsumsi warga Jepang. (bbc/rzl)

DARI stasiun perang menjadi kamar tidur: China merubah satu kapal induk Kiev menjadi hotel mewah. Hotel-hotel mewah berskala internasional bermunculan di timur China jauh lebih cepat dari perkiraan. Seiring dengan meningkatnya jumlah wisatawan China yang semakin makmur, tuntutan untuk menikmati akomodasi baru – hal yang lebih berbau sejarah, alternatif dan komunis – juga semakin meningkat. Bekas kapal induk Soviet, Kiev, tengah dalam renovasi di Tianjin dan disulap untuk menjadi hotel mewah pertama China yang dibuat di atas kapal induk di tahun 2012. Hotel mewah di masa depan itu merupakan bagian dari Binhai Aircraft (pesawat tempur Binhai), objek wisata bertemakan militer dengan luas 80.000 meter bujur sangkar yang dibuka pada tahun 2004 di timur Tianjin. Taman yang dikelola pemerintah itu dibangun di bekas kapal induk Soviet, Kiev, yang dijual ke China tahun 1996. Induk perusahaan taman itu dilaporkan telah menghabiskan sekitar 15 juta dolar untuk mengubah dan merampungkan pembuatan tiga kamar kelas presidential suite bulan Agustus lalu. Kamar suite terbesar luasnya sampai 400 meter bujur sangkar. Meskipun media internasional dan China telah melaporkan pembukaan hotel, menurut

manejer pemasaran Binhai Aircraft, Liu, sebagian besar dari 148 kamar hotel itu belum siap. Perusahaan itu berencana membuka hotel untuk umum di tahun 2012. Liu mengatakan ide pembukaan hotel muncul setelah perusahaan itu menerima permintaan setiap tahunnya dari para pengunjung dengan harapan bisa bermalam di Kiev, khususnya di kabin tempat para pelaut dan awak kapal biasa tidur. “Hotel itu akan memberikan pengalaman unik bagi pelanggan penting,” kata Liu. “Meski tergolong hotel mewah,

hotel tersebut tidak akan diberi bintang, juga tidak akan memiliki kolam renang atau tempat kebugaran.” Restoran Kapal Induk Meski pun hotel di kapal induk tersebut belum menerima tamu, Binhai Aircraft telah membuka restoran hotel pada 22 Desember 2011, dengan menyebutnya sebagai ‘restoran barat pertama di dunia yang terdapat di kapal induk’. Restoran yang bisa menampung 30 tamu ini menyediakan hampir sebagian besar masakan Rusia sebagai penghormatan pada warisan kapal Rusia itu.

Saat ini, restoran kapal induk tersebut menerima tamu lewat pemesanan awal. Dua dasawarsa setelah runtuhnya Uni Soviet, China berusaha mentransformasi perlengkapan militer negara tetangganya itu menjadi atraksi turis yang populer. China telah membeli tiga bekas kapal induk Uni Soviet. Satu di antaranya menjadi kasino di dekat Macau. Dua lainnya direncanakan menjadi bagian dari objek wisata bernuansa militer, satu di Shenzhen dan satu lagi, Kiev, di Tianjin. Syafri/CNN

INILAH bekas kapal induk Uni Soviet, Kiev, yang diubah menjadi hotel mewah.

Media Raksasa Singapura vs Yahoo Terkait Plagiat MASALAH pelanggaran hak cipta membuat Singapore Press Holdings Ltd (SPH) yang merupakan sebuah perusahaan besar media di Singapura menggugat Yahoo Inc. SPH menggugat perusahaan internet besar Yahoo yang dianggap telah melakukan pelanggaran hak cipta dan kasus plagiat. Raksasa media Singapura itu mengajukan gugatan tertulis ke Pengadilan Tinggi Singapura beberapa waktu lalu. Gugatan itu ditujukan kepada Yahoo

Asia Tenggara. Juru bicara SPH Chin Soo Fang mengatakan dalam sebuah pernyataan, bahwa perusahaan telah mendokumentasikan 23 artikel dari koran SPH tanpa izin selama 12 bulan oleh situs aggregator newsYahoo tersebut. Sebelumnya, SPH telah mengajukan panggilan dan pernyataan tertulis ke Pengadilan Tinggi Singapura. SPH sendiri menerbitkan 18 surat kabar dalam empat bahasa, termasuk koran besar The Straits Times. Namun demikian, belum

diketahui nilai gugatan yang diajukan SPH. Hingga saat ini manajemen Yahoo! pun belum mengomentari masalah ini. Sejauh ini Yahoo Southeast Asia Managing Editor Alan Soon memposting pernyataan bahwa perusahaanya akan mempertahankan dan siap menerima gugatan yang diajukan oleh SPH. Gugagatan ini merupakan sengketa besar antara dua media raksasa di awal tahun ini. “SPH sangat bertekad untuk meneruskan gugatan dan melindungi hak cipta dari karya-


LOGO perusahaan Yahoo di kantor pusat Sunnyvale, California.

nya...SPH tidak mengizinkan pihak ketiga untuk melakukan tindakan plagiat atas karyanya tanpa izin dan memuat isi yang ada dalam konten mereka,” bunyi gugatan yang diajukan di Pengadilan Tinggi. Alot Sementara itu, Yahoo membantah semua tuduhan, dengan alasan hak cipta tidak bisa melindungi fakta dan informasi. Dan malah menuduh balik SPH telah memuat ulang isi kontenYahoo dalam website publik yang mereka kelola bernama STOMP. Diantara pembelaannya, Yahoo juga membahas masalah yurisdiksi.Yurisdiksi telah terbukti sebagai masalah yang pelik jika menyangkut publikasi di satu negara untuk memenangkan ganti rugi dari kelompok perusahaan berbasis internet di negara lain yang memiliki undang-undang berbeda dan tidak mengatur perjanjian resmi menyangkut isu penerbitan. Seperti contoh warga Australia yang menggugat sebuah portal internet miliki grup perusahaan berbasis di Silicon Valley, yang memiliki peluang kecil untuk memenagkan gugatan karena masalah yurisdiksi. Hal sama juga berlaku bagi kasus SPH vs Yahoo. (net/rzl)

Medan Metropolitan A4 DPRDSU Minta Dinas Pendidikan Serius Tangani Dana BOS MEDAN (Waspada): DPRD Sumut meminta Dinas Pendidikan serius menangani dana Bantuan Operasional Sekolah (BOS) yang pada tahun ini dialokasikan pemerintah pusat Rp1,57 triliun. Dibutuhkan kejujuran aparatur pemerintah dalam penyaluran dana itu untuk memajukan dunia pendidikan di daerah ini. Anggota Komisi E DPRD Sumut Richard Eddi M. Lingga (foto) mengatakan itu kepada wartawan di gedung dewan, Kamis (5/1). Dia memberikan pernyataan sehubungan dengan penyaluran dana BOS yang pada tahun 2012 ini dilakukan oleh pemerintah provinsi. Tidak lagi dilakukan oleh kabupaten/kota. Richard mewanti-wanti benar penyaluran dana BOS tersebut agar tepat sasaran, mengingat tahun ini tahun pertama pemerintah pusat memberikan kepercayaan kepada pemerintah provinsi menyalurkan dana BOS. Sementara, menurut pengamatan anggota dewan dari Fraksi Partai Golkar (FPG) ini, dana tersebut sangat rentan diselewengkan. Komisi E DPRD Sumut sendiri, menurutnya, sangat berke-

pentingan dana BOS itu disalurkan sebagaimana mestinya. Untuk itu dia meminta Dinas Pendidikan Sumut segera menyerahkan data sekolah di 33 kabupaten/kota yang akan menerima bantuan dana BOS. “Agar kita (DPRD) juga dapat mengawasi pelaksanaannya di lapangan,” kata Richard. Dia mensinyalir, pengalihan penyaluran dana BOS dari kabupaten/kota ke provinsi karena selama ini banyak terjadi penyimpangan. Karenanya, sejak sedini mungkin pengawasan penyaluran dana ini oleh provinsi harus dilakukan. Richard mengingatkan Tim Manajemen BOS Provinsi sebagai pihak yang mengelola dana BOS harus tetap berpedoman pada faktor legalitas dan etika saat melakukan pekerjaan. Dari aspek legalitas, katanya, dana BOS yang dibagikan harus tetap mengacu pada Undang Undang No. 20 tahun 2003 tentang Sistem Pendidikan Nasional, serta Peraturan Menteri Pendidikan dan Kebudayaan No 51 tahun 2011 tentang penggunaan dana BOS dan Laporan Keuangan BOS tahun 2012 yang telahditandatanganiMenteriPendidikan tanggal 5 Desember 2011. Kata Richard, pemerintah juga telah mengatur dengan tegas tentang penggunaan dana BOS, yakni untuk pembelanjaan guna mendukung penyelenggaraan wajib belajar sembilan ta-

Waspada/Feirizal Purba

APARAT Dinas Tata Ruang dan Tata Bangunan (TRTB) Pemko Medan membongkar bangunan Hames Residence di Kel. Bantan, Medan Tembung.

Bangunan Hames Residence Tanpa IMB Dibongkar MEDAN (Waspada): Aparat Dinas Tata Ruang dan Tata Bangunan (TRTB) Pemko Medan bersama Muspika Medan Tembung, membongkar belasan bangunan berlantai dua Hames Residence yang sedang dikerjakan, di Jalan Pukat Banting I, Kel. Bantan, Kec. Medan Tembung, Kamis (5/1). Pembongkaran tersebut disaksikan Camat Medan Tembung Hendra Asmilan didampingi Kapolsek Percut Seituan Kompol M Simanjuntak dan Wakapolsek AKP Azwar, serta perangkat kecamatan dan kelurahan setempat. Saat aparat Dinas TRTB dipimpin Kabid Penertiban Pengendalian Ali Thohar melaksanakan pembongkaran, puluhan anggota Brimob melakukan penjagaan di luar lokasi. Camat Medan Tembung Hendra Asmilan mengatakan, pembongkaran bangunan tersebut karena selain tidak memiliki Izin Mendirikan Bangunan (IMB), juga didirikan di atas lokasi rencana ring road. “Bahkan, lokasi ini sebelumnya adalah Jalan Amal. Jika pun pengembangnya ingin mengurus IMB tidak akan diterbitkan, sebab sudah jelas lokasinya di atas kawasan rencana ring road,” ujarnya. Menurut Hendra, selain belasan bangunan tersebut, juga ada beberapa bangunan di Kelurahan Bantan yang segera dibongkar karena tidak memiliki IMB.(m34)

hun secara efektif dan efisien. Termasuk didalamnya pengelolaan dana BOS dilakukan dengan tertib administrasi, transparan, akuntabel, tepat waktu serta terhindar dari penyimpangan. Dari sisi etika, sebut Richard, dengan penyaluran dana BOS ini, maka ke depan tidak akan ada lagi terdengar komplain ataupun temuan anak-anak di Sumut, tidak dapat bersekolah SD dan SMP. Komisi E sendiri akan melakukan pemetaan kewajaran dan tingkat kebutuhan dunia pendidikan di 402 kecamatan dan 5.867 desa di Sumut. Menjawab pertanyaan, Richard mengakui, penyelewengan dana BOS sangat rentan terjadi. Bayangkan, ujarnya, dana bantuan tiap murid SD dan sederajat Rp580.000 /tahun dan SMP sederajat Rp710.000/ orang/tahun. Bila tiap sekolah mempunyai murid minimal 180 orang saja (kelas 1-6), maka da-

na BOS yang diterima sekolah itu sudah Rp104 juta. Begitu juga untuk tingkat SMP dan sederajat. “Kalau satu kelas 30 orang saja. Maka bantuan yang diterima Rp16 juta,” sebutnya. Menurut dia, ada beberapa indikasi yang mengisyaratkan telah terjadi penyelewengan dana BOS di sekolah. Yakni bila di satu sekolah masih juga menjual buku pelajaran kepada muridnya, sekolah masih melakukan pungutan kepada murid untuk dana operasional sekolah, dan sekolah memaksakan membeli barang dan jasa. Diluncurkan Sementara itu, Kepala Dinas Pendidikan Sumatera Utara Drs Syaiful Syafri MM mengatakan, dana BOS triwulan pertama 2012 segera diluncurkan ke 33 kab/kota pada Kamis (12/1) mendatang. Hal tersebut diungkapkannya saat sebagai narasumber acara Pertemuan Majelis Pendidikan Al Wasliyah se Sumut, di Auditorium Asrama Haji Medan, Kamis (5/1/). “Insyaallah, mulai minggu depan, sudah diluncurkan ke masing-masing kab/kota,” ujar Syaiful. Dihadapan para Kepala Sekolah Madrasah, Tsnawilay Aliyah, SMP, SMA, dan SMK yang hadir dari masing-masing kab/ kota di Sumut, Syaiful mengatakan, dalam penyaluran dana

BOS tersebut diharapkan kerjasama dari masing-masing Pemda, agar dana BOS segera sampai kepada pihak sekolah. Dana BOS yang akan disalurkan kemasing-masing Pemda dikatakannya berjumlah Rp1,2 triliun. “Komitmen pemerintah daerah dan sekolah-sekolah yang ada di kab/kota masih lemah untuk memajukan pendidikan. Sehingga dana BOS sering sekali lama disalurkan. Selain itu Pemda dan masingmasing sekolah juga harus memperhatikan kelengkapan data. Selama ini yang belum membuat pendidikankitalebihmajuadalah masalah pendataan kita yang masih lemah,” sebutnya. Ia mengatakan pendataan merupakan kunci keberhasilan dunia pendidikan di Sumut. Selama ini dinilainnya pendataan sekolah terhadap jumlah siswa yang mendapatkan dana BOS jugabelumdibuatsecaralengkap. Selain pendataan dana BOS, pendataan lainnya yang masih lemah dinilai Kadisdik adalah pendataan jumlah siswa, termasuk jumlah siswa miskin. Pendataan jumlah guru termasuk jumlah guru tersertifikasi. “Pendataan guru sertifikasi kita masih lemah. Mayoritas guru yang mendapatkan sertifikasi juga belum membenahi dan meningkatkan kualitas mengajarnya,” tuturnya. (m12/m49)

Pemko Sembunyikan Empat Nama Kontraktor Diblacklist MEDAN (Waspada): Pemerintah Kota Medan tetap menyembunyikan empat nama kontraktor yang diblacklist (daftar hitam) yang tidak mampu mengerjakan proyek jalan di Medan, karena ketiadaan bahan baku aspal. Wali Kota Medan Rahudman Harahap ketika dikonfirmasi, Rabu (4/1), mengaku sudah tahu soal adanya empat kontraktor yang diblacklist. Namun, dirinya tidak mengetahui keempat nama kontraktor yang sudah diblacklist oleh Pemko Medan. “Aku pun tak tahu, apa saja namanya itu.Yang jelas memang ada empat kontraktor yang tidak mengerjakan proyek jalan,” sebutnya. Rahudman menyebutkan, keempat kontraktor itu memang tidak bisa mengerjakan proyek jalan di Medan, karena bahan baku aspal yang tidak ada. “Namun dari pada bermasalah, makanya langsung kita beri sanksi,” ujarnya. Keempat perusahaan ini sebelumnya sudah diberikan pinalty, berupa pemotongan uang jaminan proyek sebesar 5 persen untuk dicairkan menjadi PAD Kota Medan. Selain itu, perusahaan juga tidak dibolehkan mengikuti tender proyek apapun selama dua tahun berturut-

turut di Dinas Bina Marga Kota Medan. “Potongan uang jaminan proyek perusahaan 5 persen, tidak boleh ikut tender di Dinas Bina Marga Medan selama dua tahun atau blacklist. Dari empat perusahaan itu, proyek lainnya yang sedang ditanganinya juga dinyatakan batal karena dianggap tidak sanggup melaksanakannya,” kata Rahudman. Begitu juga halnya Kadis Bina Marga Kota Medan Gunawan Surya Lubis, ketika ditanya kembali keempat nama kontraktor tersebut, tetap mengaku belum tahu. Alasannya, data keempat nama tersebut ada sama Kuasa Pemegang Anggaran (KPA). “Yang jelas keempat perusahaan ini sebenarnya mau mengerjakan proyek, siapa yang tidak mau mengerjakan proyek. Hanya saja, karena tidak ada bahan aspalnya,” ujarnya. Kata dia, keempat kontraktor itu mengerjakan proyek jalan di pinggir kota Medan. Untuk nilai masih kita tabulasikan. Kalau dihitung, nilai proyek yang dibatalkan dari empat perusahaan itu lebih kurang Rp10 miliar. Gunawan mengatakan kontraktor bermasalah itu sedikitnya empat perusahaan. Namun, dari empat perusahaan

itu bisa saja bertambah lebih banyak lagi mengingat laporan keseluruhan sedang diselesaikan satuan kerjanya. “Laporan sedang diproses. Bisa saja empat perusahaan kontraktor jalan itu bertambah lagi. Karena, dari laporan keseluruhan yang sedang disiapkan ini kita melihat lebih dari empat perusahaan yang tidak menyelesaikan proyek tepat waktu atau proyek yang dikerjakan bermasalah di lapangan,” sebutnya. Menurut dia, pihaknya belum bisa memberikan laporan pasti dan terperinci mengenai jumlah perusahaan pelaksana proyek aspal jalan yang kena pinalty. Sebab, perusahaan yang kena pinalty tidak hanya melaksanakan proyek tidak tepat waktu, namun melaksanakan proyek bermasalah di lapangan juga dikenakan sanksi berupa pinalty dan denda. “Empat perusahaan yang kena pinalty ini merupakan kontraktor lokal asal Sumut dan Medan. Mereka umumnya, tidak menyelesaikan proyek tepat waktu. Bahkan dari empat perusahaan itu beberapa di antaranya sama sekali belum mengerjakan proyek aspal jalan apapun di lapangan, artinya nilai realisasi pekerjaannya masih nihil,” tutur Gunawan. (m50)

Jumat 6 Januari 2012

Waspada/Ismanto Ismail

PETUGAS TRTB Pemko Medan membongkar bangunan tahap dua sekolah Nanyang yang bermasalah, Rabu (4/1).

TRTB Bongkar Bangunan Sekolah Nanyang MEDAN (Waspada): Aparat Dinas Tata Ruang dan Tata Bangunan (TRTB) Medan melakukan pembongkaran level bangunan berlantai dua sekolah Nanyang Zhi Hiu Modern Indonesian School di Jln. Sriwijaya simpang Jln. Abdullah Lubis Medan, Rabu (4/1). Pantauan Waspada di lapangan, petugas TRTB Pemko Medan berjumlah sekitar 25 orang dengan menumpang mobil pick up TRTB dan satu di antaranya Kabid Pengendalian TRTB Ali Tohar datang ke lokasi bangunan sekolah yang diprotes warga tersebut. Kehadiran petugas TRTB yang membawa empat martil (palu) dan gergaji mesin itu disaksikan warga dan mahasiswa yang sudah menunggu aksi pembongkaran bangunan bermasalah tersebut. Para petugas itu menuju bangunan tahap kedua yang berdiri empat lantai yang kini dalam pengerjaan. Di lantai dua bangunan itu, petugas TRTB membongkar bagian level bangunan dengan mempergunakan martil dan gergaji mesin. Pembongkaran bangunan bermasalah itu hanya dilakukan sebagian kecil saja dan hanya

sebentar. Tentu saja hal tersebut menimbulkan kekecewaan warga yang keberatan atas berdirinya bangunan sekolah Nanyang tersebut. Bahkan, warga menuding TRTB Pemko Medan melindungi bangunan bermasalah tersebut. Sejumlah warga mengatakan kepada Waspada, pihak Nanyang Zhi Hiu Modern Indonesian School telah mengelabui mereka. Setelah pembangunan tahap pertama selesai, pihak Nanyang melanjutkan pembangunan tahap kedua tanpa izin dari warga. “Sebenarnya, surat permohonan pembangunan tahap kedua sudah ditolak pihak TRTB karena sekolah tersebut tidak menyediakan lahan parkir,” ujar mereka. Sementara itu, seorang petugas TRTB mengatakan, bangunan level yang dibongkar hanya setengah meter. “Kami mengalami kesulitan untuk membongkarnya karena memakai alat manual,” sebutnya. Pembongkaran bangunan tahap dua sekolah Nanyang itu mendapat penjagaan personel Polsek Medan Baru, untuk mengantisipasi terjadi hal yang tidak diinginkan. (m36)

Al Washliyah Harus Lahirkan Kader Berakhlakul Karimah MEDAN (Waspada): Al Jam’iyatulWashliyah bukan semata mencetak ijazah bagi lulusan (kader), namun melahirkan lulusan yang dapat melanjutkan amaliyah Al Washliyah dan berakhlakul karimah atau akhlak yang terpuji. “Misi Al Washliyah melahirkan kader-kader yang berakhlakul karimah, bukan mencetak ijazah. Sebab, tanpa pendidikan akhlak, maka bangsa dan organisasi ini akan hancur,” kata Ketua Pimpinan Wilayah Sumut Drs H Hasbullah Hadi SH, MKn saat pertemuan Majelis Pendidikan Al Washliyah Sumut dengan Majelis Pendidikan Al Washliyah kabupaten/kota dan kepala madrasah/sekolah Al Washliyah se-Sumut yang berlangsung 4-5 Januari 2012, di Asrama Haji Medan, Rabu (4/1). Hadir pada pertemuan tersebut yakni, Kakanwil Kemenag Sumut H Abd Rahim M.Hum, Sekretaris PW Al Washliyah Sumut H Yulizar Parlagutan Lubis MPsi, Ketua Majelis Pendidikan PW Al Washliyah Sumut H Drs H Hasyim Syahid, Ketua Majelis Pendidikan PB Al Washliyah Prof Dr Ir H Basyaruddin, dan Ketua Panitia Pelaksana pertemuan Majelis Pendidikan Al Washliyah Sumut dengan Majelis Pendidikan Al Washliyah kabupaten/kota dan kepala madrasah/sekolah Al Washliyah seSumut Akmal Samosir SAg, serta Ketua MUI Medan Prof DR H Mohd Hatta MA. Hasbullah mengharapkan, para guru-guru baik dari tingkat Ibtidaiyah, Tsanawiyah, dan Aliyah maupun perguruan tinggi Al Washliyah

harus menerapkan sitem pendidikan Al Washliyah. “Maka itu saya minta para pendidik AlWashliyah harus mematuhi sistem pendidikan yang diterapkan Al Washliyah,” ujarnya. Dia juga mengajak seluruh kader untuk membangun Al Washliyah dengan manajemen yang baik terutama dalam membuat pertemuan seperti pertemuan majelis pendidikan yang mampu melahirkan konsep-konsep dan pemikiran untuk memajukan organisasi di masa depan. Hal senada juga dikatakan Ketua Majelis Pendidikan PW Al Washliyah Sumut Drs H Hasyim Syahid. Menurutnya, sistem pendidikan Al Washliyah jangan mengandalkan ilmu semata, melainkan harus meningkatkan pendidikan akhlak. “Dengan begitu, selain meningkatkan ilmu Al Washliyah juga meningkatkan mutu manusia. Negara ini dibangun bukan hanya mengandalkan ilmu saja, tapi ilmu dan orang yang berakhlakul karimah,” sebutnya. Kakanwil Kemenag Sumut H Abd Rahim M.Hum mengharapkan Al Washliyah Sumut melalui majelis pendidikannya memiliki peran penting dalam mengembangkan pola pendidikan di Sumatera Utara. “Pendidikan agama dan umum tidak ada bedanya, sama-sama mendapat perhatian khusus dari pemerintah. Maka itu saya berharap peran Al Washliyah terutama dalam kegiatan ini sangat penting untuk meningkatkan kualitas pendidikan di Sumatera Utara,” katanya. (h02)

Silpa Kota Medan Rp45 M

Workshop Taman Baca Alquran Di IAIN SU MEDAN (Waspada): Institut Agama Islam Negeri (IAIN) SU menggelar workshop Taman Bacaan Alquran (TBA) di aula Biro Rektor Jln. Willem Iskander, Medan Estate, Rabu (4/1). Kegiatan ini merupakan program Pemprovsu dalam meningkatkan kualitas TBA dan merupakan pengejewantahan visi-misi Gubsu agar Rakyat Tidak Bodoh dan meningkatkan kualitas ketakwaannya. Rektor IAIN SU diwakili Pembantu Rektor II Prof Dr Djafar Siddik, MA mengatakan, pelaksanaan workshop merupakan wahana paling efektif para tutor TBA saling bersilaturahmi dan bertukar informasi untuk pengembangan TBA ke depan. Melalui pertemuan ini diharapkan dapat diterapkan revolusi dalam metode baca Alquran, yakni metode Taman Bacaan Alquran Plus. “Metode ini cukup baik dan memadai dibanding beberapa cara yang sudah ada sebelumnya,” ujar Siddik. Sementara itu, Ketua Panitia Drs Supardi MAg didampingi sekretaris Dr H Harun Al Rasyid MA menjelaskan workshop diikuti tutor, guru yang berkenaan dengan membaca Alquran, pegawai KemenagMedanmaupunalumnimerupakankelanjutandariprogram pembinaan tutor TBA yang telah diterjunkan ke 20 daerah di Sumut. Karena itu, lanjut Supardi, IAIN SU menyampaikan apresiasi kepada Pemkab Serdang Bedagai, Asahan dan Batubara karena telah memberikan perhatian khusus kepada tutor yang melaksanakan pembinaan TBA di daerah itu. Harun Al Rasyid mengharapkan kiranya peserta dari aerah lain seperti Pakpak Bharat, Dairi, Karo, Langkat, Simalungun, Tebingtinggi, Deliserdang dan Madina dapat memberikan perhatian sehingga pembinaan TBA dapat berkembang dengan baik. Dia menambahkan, program pengembangan metode bacaan Alquran dengan TBA Plus, yakni menggabungkan tiga hal penting berupa dapat membaca, memahami Tajwid dan seni lagu dalam membaca Alquran serta memperbaiki bacaan sesuai kaidah yang ada. “Setelah ini ada rencana pelaksanaan seminar nasional tentang TBA yang akan dilaksanakan pada April mendatang,“ katanya. (m49)


Waspada/M. Ferdinand Sembiring

Dalam rangka Milad ke 60, keluarga besar UISU Jln SM Raja Medan dipimpin Rektor Prof Zulkarnain Lubis mengunjungi kediaman pendiri UISU Hj Syariani AS, Selasa (3/1)

Milad Ke 60, Civitas UISU Al-Munawwarah Kunjungi Pendiri Dan Ziarah Ke Makam MEDAN (Waspada): Sebagai wujud penghormatan dan terimakasih, dalam menyambut Milad ke 60 Universitas Islam Sumatera Utara (UISU), Rektor UISU Al-Munawwarah Prof Zulkarnain Lubis bersama para dekan, pembantu dekan dan pegawai, mengunjungi kediaman Pendiri UISU Hj Syariani AS di Jln Garu 3, Medan. “Kunjungan ini sebagai bentuk ucapan terima kasih yang tulus atas jasa-jasa ibu Hj Syariani AS mendirikan UISU bersama pendiri lainnya,” kata Rektor UISU Prof Zulkarnain Lubis kepada Waspada, Kamis (5/1). Atas kunjungan itu, lanjut

Zulkarnain, ibu Hj Syariani menyampaikan terima kasih atas kehadiran civitas UISU di kediamannya. “Pada kesempatan itu, kami memberi bingkisan kepada ibu Hj Syariani AS,” ujarnya. Setelah berkunjung ke rumah Hj Syariani, rombongan melakukan ziarah ke makam pendiri UISU. “Apa yang kami lakukan ini sebagai penghormatan anak kepada orangtua atas jasajasa mereka yang tidak ternilai da lam mendirikan UISU,” tam bahnya. Dia mengingatkan seluruh civitas akademika UISU agar tidak pernah lupa terhadap jasa

dan sumbangsih yang telah ditorehkan para pendiri serta semua pihak sehingga UISU bisa menjadi sebuah universitas kebanggaan masyarakat Sumut. Zulkarnain menambahkan, pihaknya akan terus membangun komunikasi dengan berbagai pihak sehingga terjalin hubungan harmonis. Hal ini merupakan bentuk silaturahmi kepada para keluarga pendiri dan mantan pimpinan UISU yang telah berjasa menyumbangkan pemikiran kepada UISU. Keberhasilan para pimpinan terdahulu tidak terlepas dari eratnya silahturahmi satu dengan yang lain.(m49)

MEDAN (Waspada): Setelah tutup buku anggaran tahun 2011, serapan anggaran Pemko Medan secara keseluruhan hanya mencapai 87,54 persen. Sisa anggaran tahun lalu akan menjadi sisa lebih perhitungan anggaran (Silpa) untuk anggaran tahun 2012 dengan jumlah Rp45 miliar dari APBD Rp3,3 triliun. Wali Kota Medan Rahudman Harahap usai melakukan rapat terkait evaluasi anggaran dengan Satuan Kerja Perangkat Daerah (SKPD) di jajaran Pemko Medan, Rabu (4/1) mengatakan, secara akumulasi realisasi anggaran memang melebihi target. Namun, masih ada sektor-sektor tertentu yang realisasinya masih minim. Seperti contoh, katanya, realisasi pendapatan dari Dinas Pertanian dan Kelautan (Distanla) Kota Medan, harus ditambah pendapatan dari tambak yang ada di Medan. Ke depan harus didata ulang, berapa tambak yang ada di Medan. Begitu juga perhubungan, pendapatan sangat minim dari target yang telah ditetapkan. Sejauh ini, Rahudman menilai, masih ada SKPD yang belum bisa merealisasikan penerimaan APBD dengan maksimal. “Disinilah tadi kita evaluasi, ada dinas yang belum bisa merealisasikan penerimaan, apa masalahnya, anggaran belanja kendalanya di mana,” katanya. Ketika disinggung apakah Wali Kota puas dengan kinerja SKPD yang dipimpinnya terkait realiasi anggaran dan penerimaan anggaran, Rahudman justeru enggan berkomentar. “Itu tak usahlah ditanya, itu sudah domain saya,” sebutnya. Sekda kota Medan Syaiful Bahri menyebutkan, realisasi anggaran Kota Medan tahun 2011 hanya mencapai 87,54 persen. “Selebihnya itu

ada anggaran karena sisa tender, anggaran yang digunakan untuk efisiensi mungkin juga karena adanya kesalahan perhitungan, dan keseluruhan sisanya akan menjadi silpa yang bisa digunakan untuk anggaran tahun ini,” ujarnya. Menurut Syaiful, sisa anggaran tahun 2011 ini disebabkan adanya efisiensi dalam implementasi pendapatan, selain itu karena disebabkan adanya faktor internal dan eksternal. Ada beberapa SKPD yang memang realisasi anggarannya dinilai belum maksimal. Namun, belum bisa dirinci. ”Memang ada beberapa itu. Seperti Dishub itu ada kekurangan penerimaan, makanya pak Wali minta supaya di data kembali, itu karena faktor pendataan. Disperindag juga karena adanya fator peraturan yang menyatakan ada PAD yang tidak bisa lagi dikutip Disperindag, begitu juga BLH mungkin karena datanya belum lengkap,” sebutnya. Pengamat anggaran di Sumut Elfenda Ananda menyebutkan, tingginya silpa anggaran jelas akan berdampak bagi pemerintah dan masyarakat. Menurutnya, Silpa yang disebabkan efisiensi anggaran memang wajar saja. Namun, nilai wajarnya juga hanya 5 persen dari nilai APBD. Artinya, kalau efisiensi anggaran mencapai di atas 5 persen, ini juga sudah terjadi perencanaan anggaran yang salah. “Nilai wajar efisiensi anggaran itu 5 persen, kalau di atas itu berarti ada perencanaan yang salah. Memang perencanaan itu tidak bisa sesuai dengan harga riilnya 100 persen. Kalau sesuai dengan harga riil nya berarti itu juga tidak benar. Namun, yang bisa ditolerir kesenjangan harga yang dianggarkan dengan harga riil itu hanya 5 persen,” kata Elfenda. (m50)

Medan Metropolitan

WASPADA Jumat 6 Januari 2012


Kawanan Maling Asal Pulau Jawa Bobol Toko Emas

Waspada/Andi Aria Tirtayasa

TIGA maling asal Pulau Jawa (tanpa memakai baju dan diborgol) membobol toko emas di Aksara Plaza Medan.

UPAYA tiga pria asal Pulau Jawa, untuk membobol toko emas di Aksara Plaza Jalan Aksara, Kecamatan Medan Tembung, Kamis (5/1) gagal. Tak hanya gagal mendapatkan sejumlah perhiasan dan brandkas, ketiganya pun keburu ditangkap petugas security PD Pasar, karena kesiangan. Ketiga tersangka yakni Su, 34, asal Pacitan Jawa Timur, Sy, 43, asal Pandeglang Provinsi Banten, dan Shd, 44, asal Majalengka Provinsi Jawa Barat, dijebloskan ke dalam sel Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, Kamis (5/1) sekira pukul 07:00, petugas security PD Pasar bernama Syahrul melakukan patroli di sekitar Pajak Pagi Aksara yang letaknya berada di Aksara Plaza. Di tengah keheningan pagi itu, Syahrul mendengar suara mencurigakan dan terus mencari asal suara tersebut. Setelah dicari, ternyata asal suara itu dari Lantai II. Perlahan-lahan, Syahrul dan beberapa temannya melakukan pengintaian. Saat mendekati toko emas milik Bernas Tarigan, petugas security tersebut melihat pintu besi rolling-door sudah terbuka dalam kondisi rusak, begitu juga dengan pintu khusus yang dipasang oleh pemilik toko emas tersebut juga sudah dirusak. Begitu mengetahui ada kawanan maling yang sedang beraksi, sejumlah petugas security pun mengepung ketika pencuri tersebut. Tanpa melakukan perlawanan, tersangka Su, Sy dan Shd langsung ditangkap. Ketiganya mengaku akan mencuri perhiasan di toko emas tersebut namun gagal karena keburu ditangkap, apalagi hari telah pagi. Bersama barang bukti seperti linggis, pipa besi, obeng, gergaji besi, martil dan 2 gembok, ketiga tersangka langsung diserahkan ke Polsek Percut Seituan. Kapolsek Percut Seituan Kompol Maringan Simanjuntak didampingi Kanit Reskrim AKP Faidir Chaniago menjelaskan, dari peralatan yang dibawa ketiga

pelaku tersebut, sasaran utamanya adalah brandkas yang berada di dalam toko emas tersebut. “Perlengkapan yang dibawa para pelaku diduga kuat untuk mencongkel brandkas. Namun, upaya mereka gagal karena kesiangan dan sudah pukul 07:00,” sebut Simanjuntak. Dijelaskan Simanjuntak, ketiga pelaku masuk ke toko emas tersebut setelah merusak pintu bagian depan. Setelah itu, pelaku merusak gembok yang berada di lapis kedua pintu toko emas tersebut. Saat hendak menguras barang-barang perhiasan, mereka ditangkap security. Dari pengakuan ketiga pelaku, ujar Simanjuntak, beberapa jam sebelumnya mereka baru saja tiba di Medan, melalui jalur darat menumpang bus ALS. Selanjutnya, berbekal informasi dari pelaku lainnya yang bertugas sebagai ‘tukang gambar’ (belum tertangkap), ketiga pelaku datang ke Aksara Plaza menumpang bus angkutan kota (angkot) dan langsung melakukan aksinya dengan menggunakan perlengkapan yang mereka bawa dari Pulau Jawa. “Ketiganya mengaku datang ke TKP naik angkot setelah tiba di Medan beberapa jam sebelumnya. Namun, pengakuan tersebut masih belum bisa dipercaya begitu saja, apalagi mereka mengaku ada dua lagi temannya yang melarikan diri. Diperkirakan sindikat pembobol toko emas ini sudah sering beraksi di Pulau Jawa,” kata Simanjuntak. Dia memprediksi, para pelaku tiba tiga jam sebelum melakukan aksi membongkar toko emas tersebut. “Karena agak lama menjebol pintu toko, mereka tak sadar kalau hari menjelang siang sehingga ditangkap petugas security,” ujar Simanjuntak seraya menyebutkan, dua lagi kawanan pembobol toko emas tersebut masih diburon. (h04)

Wanita Vietnam Bawa SS 1 Kg Dituntut 16 Tahun MEDAN (Waspada): Wanita warga negara Vietnam pembawa sabusabu (SS) 1 kg yang ditangkap di Bandara Polonia, tampak sedikit lega saat mendengar tuntutan Jaksa Penuntut Umum Nilma SH yang menuntutnya 16 tahun penjara denda Rp1 milliar subsidair enam bulan kurungan, dalam sidang lanjutan yang digelar pada ruang Chandra Lantai III Pengadilan Negeri Medan, Kamis (5/1). Pasalnya, tuntutan hukuman yang dibacakan jaksa bukan tuntutan hukuman mati atau seumur hidup melainkan 16 tahun penjara, sehingga harapan terdakwa Nguyen Thi Tuyet Trinh, 49, warga 79/36 Jalan Tan Ky Tan Quy, Kelurahan Son Ky Distrik Tan Phu, Kota Ho Chi Minh Vietnam, untuk pulang ke negaranya masih terbuka, meski menunggu waktu cukup lama untuk menjalani hukumannya. Saat JPU usai membacakan tuntutannya, Nguyen yang didampingi penterjemah Drs

Open Genhard ini menyatakan pikir-pikir dan menyerahkan nota pembelaan kepada penasehat hukumnya Eva SH. Bahkan selama persidangan, Nguyen yang memakai kerundung biru itu terlihat menundukkan wajahnya di hadapan majelis hakim SB Hutagalung sembari mendengarkan tuntutan penuntut umum. JPU dalam tuntutannya mengatakan, terdakwa Nguyen sebelum berangkat ke Indonesia, terlebih dahulu pergi ke Kamboja menumpang bus pada 3 Juni 2011. Setiba di Kamboja langsung menuju Kota Bangkok Thailand. Disinilah terdakwa bertemu dengan Uche pada 5 Juni 2011, di sebuah warung kopi dengan menyerahkan dua bungkus sabu-sabu seberat 1000 gram atau 1 kg. Setelah terjadi kesepakatan di antara mereka, terdakwa kemudian berangkat dari Thailand menuju Malaysia pada 6 Juni 2011. Sesampai di Malaysia, terdakwa dengan menumpang maskapai penerbangan Air Asia berangkat dari Kuala Lumpur pada 7 Juni 2011 menuju Bandara Polonia Medan. Namun, saat berada di Bandara Polonia, aksi terdakwa yang hendak menyelundupkan sabusabu ke Jakarta melalui Medan, berhasil digagalkan dua petugas BeaCukaiBobbyHSinaga,24,dan

Penjambret Dihajar Massa MEDAN (Waspada): Seorang penjambret dihajar massa di Jalan Keadilan Gang Family, Kelurahan Indrakasih, Kecamatan Medan Tembung, Rabu (4/1) sore. Dalam kondisi babak belur, tersangka berinisial BA, 22, warga Jalan Terusan, Dusun V, Desa Bandar Setia, Kecamatan Percut Seituan, dijebloskan ke dalam sel Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, sore itu tersangka BA dan temannya (buron) mengendarai sepedamotor Mio melintas di Jalan Keadilan melihat korban Herlina Wati, 31, warga Jalan Budi Utomo Pancing II, Kelurahan Indra Kasih, yang juga mengendarai sepedamotor. Kedua penjambret langsung mendekati korban. Tiba-tiba tersangka BA merampas kalung berlian korban seharga Rp5 juta dan kabur tancap gas arah ke Jalan Cemara. Namun, Herlina Wati terus melakukan pengejaran terhadap kedua penjambret tersebut. Kedua pelaku membelok ke Gang Famili dan korban terus mengikutinya. Tanpa diduga, sepedamotor pelaku kehabisan bensin dan berhenti di depan rumah warga. Seorang pelaku masuk ke rumah warga pura-pura menumpang ke kamar mandi. Sedangkan korban yang melihat kedua pelaku langsung memberitahukan kepada warga bahwa mereka penjambret sambil berteriak maling. Warga spontan menangkap tersangka BA berikut sepedamotornya. Tersangka BA menjadi ‘bulan-bulanan’ massa, sedangkan temannya berhasil meloloskan diri dari sergapan warga. “Tersangka jambret berinisial BA sudah dijebloskan ke dalam sel sedangkan teman pelaku masih diburon,” sebut Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan. (h04)

Terdakwa Dugaan Korupsi Taman Mahoni Minta Dibebaskan MEDAN (Waspada): Penasihat hukum terdakwa Masrul Siregar atas kasus dugaan korupsi pembangunan taman mahoni tahap I Kabupaten Asahan, yang terindikasi merugikan negara sebesar Rp68 juta, meminta majelis hakim membebaskan kliennya dari segala tuduhan. Pasalnya, kliennya tidak terbukti. Hal ini disampaikan M Sa’i Rangkuti dalam lanjutan sidang perkara dugaan korupsi pembangunan taman mahoni tahap I Kabupaten Asahan 2007 lalu. Sidang yang dipimpin Ketua Majelis Hakim Jonner Manik dengan agenda pembelaan terdakwa atas tuntutan Jaksa Penuntut Umum (JPU) Hendri Sipahutar. “Kami minta terdakwa dibebaskan dari segala tuntutan. Sebab, berdasarkan keterangan saksi dan fakta persidangan klien kami tidak terbukti bersalah,” kata Sa’i usai persidangan, Rabu (4/1). Menurut dia, sejak 7 September 2007 lalu, terdakwa tidak lagi menjabat sebagai Kadis Tata Kota Asahan. Sementara pencairan dana dilakukan 24 November 2007 atau sejak dijabat Sayuti. “Seharusnya apabila ada persoalan dalam pencairan dana atau masalah lain dalam perkara ini, kadis yang baru bertanggung jawab. Dan ini sudah disampaikan saksi-saksi dalam persidangan,” sebutnya. Sebelumnya JPU Hendri Sipahutar menuntut terdakwa Masrul Siregar selama 3 tahun 6 bulan penjara denda Rp50 juta dan membayar uang pengganti sebesar Rp17 juta. JPU juga menjawab secara lisan pembelaan penasihat hukum terdakwa. Mengingat 13 Januari limit persidangan 120 hari sudah melewati batas. Dalam jawabannya, JPU tetap pada dakwaan dan tuntutannya. “Kami tetap pada tuntutan kami. Kami merasa semua sudah benar dan tepat,” kata Hendri. Masrul didakwa Pasal 2 ayat 1 jo Pasal 18 dan Pasal 3 ayat jo Pasal 18 UU tentang tidak pidana korupsi. Ketua Majelis Hakim Jonner Manik melanjutkan sidang ini 11 Januari mendatang dengan agenda putusan. (m38)

Omry Manurung, 23. Petugas BC tersebut curiga melihat gerak-gerik terdakwa. Kemudian petugas melakukan pemeriksaan terhadap atas warna hitam yang ditenteng oleh terdakwa, ternyata setelah dibuka berisikan dua bungkus shabu dengan berat 1 kg. Walaupun terdakwa lolos

dari hukuman mati, namun dirinya bergarap agar majelis hakim bisa memberikan keringanan lagi kepada dirinya. Alasannya, saat bertemu dengan Uche, warga Afrika tersebut tidak menceritakan apa isi dalam tas tersebut. “Waktu itu, Uche hanya menyuruh mengantarkan tas ke Jakarta melalui

Medan, sebab sudah ada orang yang akan menjemput,” sebutnya. Majelis hakim menunda sidang hingga pekan depan untuk mendengarkan nota pembelaanterdakwa.Dalamkasusini, terdakwadikenakanpasal112ayat (2) UU RI Nomor 35 tahun 2009 tentang narkotika. (m38)

Polisi Akan Tindak Pengelola Galian C Masih Beroperasi MEDAN (Waspada): Polresta Medan akan menindak tegas pengelola galian C yang masih melakukan pengerukan tanah di lahan PTPN II Desa Sigaragara, Kec. Patumbak, walaupun kemarin sudah dilakukan razia. Pasalnya, pengerukan tanah yang sudah berlarut-larut kembali dikeluhkan masyarakat sekitar dan meminta Pemkab Deliserdang dan Polresta Medan untuk menindak kembali jika masih beroperasi pasca penggerebekan tersebut. Kapolresta Medan Kombes Tagam Sinaga menegaskan, polisi akan menindak tegas pengelola galian C yang masih beroperasi di kawasan Desa Sigaragara, Kec. Patumbak. Pihaknya akan mencoba melakukan pengecekan ke lokasi untuk ditindaklanjuti. “Ya kalau masih ada, akan kita cek, tapi ya tidak mungkinlah karena sudah kita gerebek di tiga lokasinya,” ujarnya usai menghadiri acara peletakan batu pertama Masjid Al Ikhlas di Jalan Timor, Jumat (5/1). Untuk proses pemeriksaan, kata Tagam, akan dilakukan Pemkab Deliserdang. Pasalnya, aktifitas yang dilakukan pihak pengelola galian C itu dikenakan Peraturan Daerah (Perda)

mengenai lingkungan hidup. “Jadi semua barang bukti sudah diserahkan ke Pemkab Deliserdang, karena itu masalah galian C dikenakan ke Perda,” sebutnya. Saat ditanyai kenapa barang bukti 10 unit eskavator diserahkan ke Pemkab Deliserdang, pihaknya hanya membantu menindaklanjuti laporan masyarakat di sekitar lahan PTPN II itu, tidak ikut memprosesnya. “Karena masih menggunakan Perda yang dilanggar dan itu yang memproses Pemkab bukan pihak kepolisian,” tandasnya. Masuk DPO Reskrim Polresta Medan masih memburu pengelola galian C ilegal yang berada di lahan milik PTPN II Desa Patumbak II, Kecamatan Patumbak, yang telah dirusak. Pengelola galian C itu diburu polisi terkait penggerebekan di tiga lokasi yang berbeda, yakni di Desa Sigaragara Gang Rambung, Desa Patumbak Pasar II, dan Pasar IV. Dari ketiga lokasi itu diamankan dua orang, yakni Sutoyo, 30, dan Koko, 30, warga Patumbak, selaku penjaga yang merekap keluar masuknya truk pengangkut galian C dan menyita sedikitnya 10 unit alat berat (eskavator). Selain itu, satu mobil Toyota Hilux BK 8822 HW

juga ditinggalkan pemiliknya karena kabur saat razia berlangsung. “Pengelola galian C ini belum kita amankan karena lari saat penggerebekan. Galian C disini sudah beroperasi setahun, kita sudah mengetahui identitas pengelolanya yakni B. Yang bersangkutan dan beberapa pengelola lainnya masih diburu,” kata Kasat Reskrim Polresta Medan Kompol M Yoris Marzuki, Rabu (4/1). Kata dia, untuk pemeriksaan dua pekerja yang diamankan itu, pihaknya menyerahkan proses penyelidikan ke Polsek Patumbak, sedangkan 10 alat berat telah dibawa ke Pemkab Deliserdang untuk proses lebih lanjut. Polresta Medan hanya membantu proses tindak pidananya jika ditemukan. Ditanya mengenai barang bukti tanah galian untuk diperiksakan kepada saksi ahli, Yoris enggan memberikan keterangan. Pasalnya, dia belum dapat memastikan apakah saksi ahli yang direncanakan dari Institut Pertanian Bogor (IPB) di datangkan ke Medan, atau barang bukti tanahnya yang dibawa ke hadapan saksi ahli. “Belum tau, kita lihat kondisinya dulu,” sebutnya.(m39)

Polresta Belum Temukan Peredaran Permen Narkoba MEDAN ( Waspada): Sat Narkoba Polresta Medan belum menemukan peredaran permen diduga mengandung narkoba jenis amphetamin di kalangan sekolah-sekolah di Medan, yang membuat resah masyarakat, khususnya para orangtua dan kalangan pendidik. “Belum ada ditemukan peredaran permen narkoba di kalangan anak sekolah di Medan,” kata Kasat Reserse Narkoba Polresta Medan Kompol Juli Agung Pramono SH, Sik,

M.Hum, Kamis (5/1). Menurut Agung, pihaknya memastikan permen narkoba itu tidak benar terjadi dan tidak ada di Medan. Dijelaskannya, ketika pihaknya mendengar adanya isu peredaranpermenyangmengandungnarkobadiMedan,langsung melakukan penyelidikan dan investigasi di beberapa sekolah dan tidak menemukan permen narkobasebagaimanadiinformasikan masyarakat. Dikatakannya, isu peredaran permen mengandung nar-

koba pernah terjadi di Jakarta, terutama di kalangan sesama anak sekolah, namun hingga saat ini di kota Medan, belum ada ditemukan adanya permen yang mengandung narkoba jenis amphetamin. Meski demikian, pihaknya akan tetap memonitor dan tetap waspada terhadap informasi tersebut sembari meminta kepada pihak sekolah dan orang tua siswa, agar lebih mewaspadai peredaran narkoba dengan jenis lainnya. (m39)

Jika Torganda Dieksekusi

20 Ribu Pekerja Menganggur MEDAN ( Waspada) : 20 Ribu pekerja terancam menganggur dan 15 ribu kepala keluarga (KK) terabaikan jika Kejaksaan Tinggi Sumatera Utara (Kejatisu) dan Gubernur Sumatera Utara melakukan eksekusi terhadap PT Torganda. “Hal ini dikarenakan PT Torganda merupakan perusahaan yang menaungi 20 ribu pekerja dan memberikan pendapatan terhadap 15 ribu kepala keluarga yang bernaung di dalamnya,” ujar Humas PT Torganda Lalo Hasibuan kepada wartawan di Medan, Kamis (5/1). Menurut Lalo, pihak manajemen menilai wajar adanya unjukrasa Gerakan Mahasiswa Padang Lawas Utara (Gema Paluta) di Kejaksaan Tinggi Sumatera Utara dan kantor Gubernur Sumatera Utara karena perpanjangan sebagian mas-

yarakat yang merasa terzolimi. “Pada dasarnya, perusahaan mengelola system pola PIR (Perkebunan Inti Rakyat) yang memberikan bonus atau pendapatan kepada masyarakat per KK dengan nilai Rp368 ribu lebih per bulan,” ujarnya. Pembayaran tersebut dilakukan melalui koperasi yang diteruskan kepada masyarakat atau anggotanya. Namun ada salah satu koperasi tidak melakukan pembayaran sebagaimana mestinya. “Mereka hanya membayar sekitar Rp9.870 per KK dengan jumlah anggota sekitar 2.700 KK. Hal ini baru diketahui setelah berlangsung selama delapan bulan. Hal inilah yang membuat masyarakat merasa terzolimi.,” ujarnya. “Jika dihitung, dana yang telah disalahgunakan koperasi tersebut mencapai ratusan juta.

Karena itu, kita akan melakukan upaya pemberian dana tersebut secara langsung. Tentu hal ini juga kita pertanyakan kepada koperasi yang bersangkutan,” ujarnya. Menyikapi unjukrasa tersebut, menurut Lalo, ada ketidakmengertian mahasiswa terhadap kasus PT Torganda, yakni sebelum eksekusi dilakukan pihak perusahaan mengajukan PK (Peninjauan Kembali). Tentunya penegak hukum harus menghormati PK tersebut. Dengan PK tersebut, diharapkan dapat dilihat kembali apakah hal ini kepentingan perusahaan, masyarakat atau perorangan. “Kita berharap penilaian tersebut harus arif dan bijaksana dalam menyikapi kasus PT Torganda tersebut,” ujarnya. (m38)


PARA mahasiswa Aliansi Oposisi Mahasiswa Tapanuli Tengah melakukan orasi di depan Gedung Kejaksaan Tinggi Sumatera Utara.

Aliansi Oposisi Mahasiswa Tapanuli Tengah Desak Kejatisu

Usut Dugaan Korupsi Museum Barus Raya MEDAN (Waspada) : Aliansi Oposisi Mahasiswa Tapanuli Tengah mendesak Kejaksaan Tinggi Sumatera Utara (Kejatisu) mengusut tuntas dugaan korupsi Museum Barus Raya, Tapanuli Tengah dan memeriksa mantan Ketua Yayasan Museum Barus Raya (YMBR), H. Sukran Tanjung, SE. “Pembangunan Museum Barus Raya di Kecamatan Barus, Tapanuli Tengah hingga saat ini tidak sebanding dengan anggaran yang sudah diterima mencapai Rp1,150 miliar,” ujar Koordinator Aksi, Khairunnas Panggabean ketika orasi di depan gedung Kejatisu Jln. A.H. Nasu-tion, Medan, Kamis (5/1). Pada 10 Juli 2007, menurut Khairunnas, Yayasan Museum Barus (YMBR) menerima dana hibah Pemprovsu melalui rekening yang ditampung dalam APBD Sumut anggaran 2007 sebanyak dua kali sebesar Rp500 juta dan Rp250 juta dengan nilai total Rp750 juta. “Kemudian ditambah lagi hibah dari Pemprovsu sebesar Rp75 juta pada 12 November 2007 dan dana hibah Rp250 juta melalui

APBD Sumut 2010. Hal ini menjadi indikasi anggaran pembangunan museum tersebut digelapkan,” ujarnya. “Dari data yang kita terima, pada 12 September 2010 pengurusYMBR mengadakan rapat internal di Hotel Fansyuri Barus guna meminta klarifikasi dari H. Syukran Tanjung, SE terkait dana tersebut, kemudian dilanjutkan rapat di Hotel Tiara Medan,” ujarnya. Khairunnas menilai penyalahgunaan pembangunan museum Barus Raya yang bertujuan untuk menjaga warisan situs budaya merupakan pengkhianatan besar bagi masyarakat Kabupaten Tapanuli Tengah. Sementara Kasubsi Humas Kejatisu yang menerima para mahasiswa mengatakan, datadata yang diterima dari mahasiswa akan diserahkan ke Kejari Sibolga, Tapteng. “Dalam hal ini akan kita upayakan untuk menjaga agenda Kejatisu melalui Kejari Sibolga untuk mengusut tuntas dugaan korupsi pembangunan Museum Barus Raya,” ujarnya. (m38)

DIPA 2012 Poldasu Rp1,2 T MEDAN (Waspada): Kepolisian Daerah Sumatera Utara (Poldasu) mendapatkan dana Daftar Isian Penggunaan Anggaran (DIPA) Tahun Anggaran 2012 senilai Rp1,2 triliun. Jumlah tersebut lebih besar dibanding tahun 2011 yakni Rp80,4 miliar. “Tahun 2011 DIPA Poldasu sebesar Rp80,4 miliar dan 2012 naik menjadi Rp1,2 triliun,” kata Kabid Humas Poldasu Kombes Pol. Heru Prakoso kepada wartawan, Kamis (5/1). Dikatakan Heru, DIPA tersebut nantinya akan dialokasikan untuk 12 program kerja Poldasu, di antaranya mendukung tugas teknis Polri, program peningkatan sarana dan prasarana Polri dan program pengawasan untuk akuntabilitas Polri. DIPA 2012 sudah termasuk anggaran untuk kepolisian resort (Polres) di jajaran Poldasu. Namun rincian lebih jelas anggaran untuk Polres tersebut belum diketahui secara pasti. Heru Prakoso juga belum dapat menjelas kannya, termasuk alasan penambahan anggaran DIPA pada 2012. “Saya belum tahu

pasti, tetapi kenaikan anggaran ini mungkin untuk menstimulasi Poldasu dan jajarannya bisa bekerja lebih baik lagi dibanding tahun lalu,” sebutnya sembari mengatakan kenaikan DIPA hal yang wajar demi kinerja Poldasu ke depannya. Sementara praktisi hukum Julheri Sinaga SH mengatakan, kenaikan anggaran DIPA bisa dipertanyakan kepada yang menerima. Karena masih banyak kasus yang belum terselesaikan oleh Poldasu dan jajarannya. Sebagai contoh dari 15 kasus korupsi yang sudah diselesaikan hanya Rp8,6 miliar uang negara yang diselamatkan dari Rp29 miliar lebih kerugian negara. Selain itu, terkait kasus tanah di Sumut, antara pihak PTPN dengan masyarakat belum ada yang terselesaikan oleh Poldasu. Sebaliknya sengketa lahan/tanah masih menggurita di Sumut. “Perlu dipertanyakan kenaikan DIPA 2012. Apa referensi atau prestasi Poldasu sehingga DIPA tahun ini naik dari tahun lalu. Mestinya kenaikan itu mengikuti prestasi yang dilakukan Poldasu,” ujarnya.(m27)

Pemerkosa Siswi SMP Diamuk Massa MEDAN (Waspada): Seorang pria berinisial S, 31, warga Bangun Sari, Kecamatan Delitua, nyaris tewas dihajar massa setelah ketahuan memperkosa siswi SMP di kuburan Cina Jalan Purwo, Kecamatan Delitua, Rabu (4/1) malam. Informasi diperoleh wartawan, Kamis (5/ 1), peristiwa tersebut terjadi sekira pukul 21:00. Saat itu korban berinisial DK, 14, siswi salah satu SMP di Delitua, tengah berduaan bersama pacarnya berinisial A, 19, yang tinggal di kawasan Delitua. Tiba-tiba, tersangka S datang dan menuduh kedua remaja itu melakukan perbuatan tidak wajar lalu memboyongnya ke salah satu lorong. Takut diancam bakar oleh tersangka, lalu pacar korban melarikan diri membawa sepedamotornya. Sedangkan korban tinggal bersama tersangka. Selanjutnya A yang berhasil melarikan diri mendatangi rumah temannya di Jalan Purwo

Gang Sari Ujung, Kecamatan Delitua, menceritakan peristiwa yang dialaminya. Kemudian teman A bersama sejumlah warga kembali ke lokasi untuk menjemput korban. Setelah ditemukan, korban menceritakan dirinya sudah dinodai oleh tersangka S. Warga yang marah lalu mencari tersangka yang diketahui bekerja di salah satu kafe. Tersangka akhirnya ditemukan dan mengakui perbuatannya. Massa yang emosi langsung menghajar tersangka hingga babak belur dan nyaris tewas. Tersangka S akhirnya terselamatkan dari amuk massa setelah polisi datang ke lokasi mengamankannya ke Polsek Delitua. Kapolsekta Delitua Kompol SP Sinulingga melalui Kanit Reskrim AKP S Sembiring yang dikonfrimasi membenarkan kejadian itu. Menurutnya, tersangka sudah ditahan dan masih menjalani pemeriksaan. (m40)



WASPADA Jumat 6 Januari 2012

Renovasi Toilet Rp2 M Tidak Wajar MAGELANG (Antara): Ketua Komisi VIII DPR RI Abdul Kadir Karding menilai dana renovasi toilet di Gedung Nusantara I DPR RI yang direncanakan sebesar Rp2 miliar, terlalu besar dan tidak wajar. “Menurut saya nilainya terlalu besar, tidak wajar, dan di mata publik kurang patut, maka Sekjen DPR perlu melakukan rasionalisasi. DPR biasa saja, yang penting bisa ber-

fungsi,” katanya usai meninjau pembangunan jembatan Sungai Putih di alur banjir lahar Gunung Merapi, di Desa Jumoyo, Kecamatan Salam, Kabupaten Magelang, Jawa Tengah, di Magelang, Kamis (5/1). Dia mengatakan, alangkah baiknya apabila ada dana lebih untuk kebutuhan lain, misalnya penyelesaian masalah penanganan bencana. “Apalagi, saat ini banyak berbagai daerah di Indonesia

sedang dilanda bencana alam berupa banjir dan tanah longsor,” katanya. Dia mengaku belum melihat dan mempelajari langsung apakah yang direnovasi dengan dana sebanyak dua miliar rupiah itu hanya toilet saja atau bangunan yang lain. Menurut dia, karena permasalahan tersebut sudah mengundang rasa ketidakpantasan publik, maka harus dipikirkan kembali dan direvisi. “Diang-

garkan yang patut saja, kami tidak butuh yang mewah,” katanya. Karding mengaku resah dengan berbagai informasi yang terus memperburuk citra DPR RI. “Kami sudah babak belur dengan isu publik yang bermacam-macam ditambah dengan masalah ini. Menurut saya dana renovasi tersebut harus direvisi. Saya kurang paham bisa menyentuh angka sebesar dua miliar rupiah itu,” katanya.

Pelajaran Pancasila Diminta Masuk Kurikulum JAKARTA (Waspada): Fraksi PDI Perjuangan MPR RI menyatakan keprihatinan atas memudarnya nilai-nilai ideologi di tengah masyarakat. Padahal, ideologi itu merupakan dasar sekaligus penuntun arah sebuah bangsa dalam meraih kebesaran. Di tengah krisis ideologi tersebut, Fraksi PDIP mendesak pemerintah untuk melakukan perubahan sistem pendidikan nasional dan meminta mata pelajaran Pancasila masuk ke dalam kurikulum. ”Salah satu yang harus dilakukan pemerintah untuk mengetasi memudarnya nilainilai ideologi adalah memasukkan kembali mata pelajaran Pancasila ke dalam kurikulum,” ujar Puti Guntur Soekarno, anggota Komisi X DPR RI mem-

bidangi pendidikan pada pemaparan refleksi akhir tahun 2011 dan proyeksi 2012 Fraksi PDI-Perjuang MPR, di Gedung MPR/DPR Jakarta, Kamis (5/12). Disebutkan, potret kehidupan sosial di tahun 2011 menunjukkan bangsa Indonesia tengah mengalami penurunan kualitas kehidupan kebangsaan diakibatkan pemerintah tidak sungguh-sungguh melakukan pendidikan krakter bangsa kepada segenap warga negara. “Pendidikan karakter bangsa yang mengedepankan nilai-nilai keindonesiaan, seperti sikap tolerasi, saling menghormati, saling menghargai perbedaan tidak dilaksanakan secara sungguh-sungguh. Akibatnya, semangat Bhinneka

Tunggal Ika semakin jauh dari harapan. Masyarakat semakin terkotak-kotak dengan sekatsekat primordial dan masingmasing saling curiga. Kekerasan dan konflik sosial, kata Puti, pada tahun 2011 cederung meningkat, terutama yang berlatarbelakang perbedaaan agama dan keyakinan tertentu. Karena itu, menurut Puti, masuknya Pancasila ke dalam kurikulum melalui dua jalur, yakni membuat mata pelajaran baru dan memasukkan nilai-nilai Pancasila ke dalam berbagai mata pelajaran lain, seperti sejarah, kebudayaan, kesenian dan agama. Mata pelajaran Pancasila juga tidak boleh dalam tafsiran lain. Tapi harus kembali ke Pancasila yang sebenarnya. “Mata pelajaran Pancasila

akan jadi pintu masuk ke dalam pendidikan masyarakat,” jelasnya. Fraksi PDIP berpendapat potret pendidikan formal Indonesia saat ini terseret arus globalisasi yang meniadakan batas-batas neragara, terutama batas ideologi, budaya dan prinsip-prinsip ekonomi, sehingga menyebabkan generasi penerus tidak memahami ideologi bangsanya, yang akhirnya akan mengancam eksitensi Negara Kesatuan Republik Indonesia ( NKRI). “Dihapuskannya mata pelajaran Pancasila dan UUD 45 pada sistem pendidikan nasional, membuat sistem pendidikan nasional kehilangan roh kebangsaannya,” tegas cucu mantan Presiden Bung Karno ini. (aya)

Rahmat Shah: Tingkatkan Kerjasama Indonesia-Turki MEDAN (Waspada): Anggota DPD RI daerah pemilihan Sumatera Utara DR. H. Rahmat Shah mengakui hubungan masyarakat Indonesia dan Turki sudah terjalin sejak lama. Hubungan yang lebih banyak dilandaskan pada kesamaan identitas keberagamaan antara kedua bangsa telah terjalin sejak ratusan tahun yang lalu. Puncak kedekatan hubungan antara Republik Indonesia dengan Republik Turki semakin terlihat pada saat Indonesia dilanda musibah bencana Tsunami di Aceh dan Nias pada tahun 2004 silam.

Hal tersebut dinyatakan Rahmat yang juga Konsul Jenderal Kehormatan Republik Turki untuk wilayah Sumatera saat menerima delegasi Pusat Bahasa dan Budaya Institut Agama Islam Negeri (IAIN) Sumut yang dipimpin langsung oleh Ketua Pusat Bahasa IAIN SU DR. Phil. Zainul Fuad, MA, pekan lalu. Kegiatan yang merupakan bagian dari rangkaian kegiatan reses anggota Dewan Perwakilan Daerah (DPD) RI ini berlangsung di Rahmat International Wildlife Museum & Gallery di Jl S. Parman Medan. Rahmat menjelaskan, dari

seluruh negara asing yang ikut memberikan bantuan terhadap bencana alam tsunami yang melanda Aceh dan Nias beberapa tahun silam, Turki merupakan negara terbaik yang memberikan bantuan tersebut. Dalam kesempatan tersebut, DR. Phil. Zainul Fuad menyampaikan bahwa pasca tsunami di Aceh pada tahun 2004, tampak bahwa kehadiran lembaga-lembaga Turki telah memberi kontribusi yang besar bagi pembangunan masyarakat Indonesia,yang salah satu lembaga tersebut adalah United Islamic Cultural Centre of Indo-

AirAsia Tambah Airbus A320 J A K A RTA ( Wa s p a d a ) : AirAsia Indonesia, maskapai penerbangan berbiaya hemat terbaik di dunia kembali menambah armadanya (pesawat) jenis Airbus A320. Penambahan Airbus tersebut merupakan pesawat ke17 AirAsia. Pesawat baru tersebut akan digunakan untuk melayani rute penerbangan domestik dan internasional yang dimiliki oleh AirAsia Indonesia saat ini. “Kami sangat senang karena di awal tahun 2012 ini kami

mendapatkan hadiah yang luar biasa, yaitu pesawat Airbus A320 baru, yang sekaligus menambah jumlah armada kami menjadi 17 unit. Bagi kami layanan yang prima dan kenyamanan untuk para penumpang adalah yang utama, dan dengan hadirnya pesawat Airbus baru ini semakin menegaskan komitmen kami untuk mengoperasikan 100% pesawat tipe Airbus A320, “ kata Presiden Direktur AirAsia Indonesia, Dharmadi dalam keterangan persnya di Jakarta,

Rabu (4/1). Sampai akhir tahun 2011, AirAsia Indonesia telah mengoperasikan 16 Airbus dan 4 Boeing serta melayani lebih dari 20 rute penerbangan, baik domestik maupun internasional. Target AirAsia Indonesia di tahun 2012 ini adalah menambah lima pesawat baru. Dengan bertambahnya jumlah pesawat maka AirAsia Indonesia akan segera mewujudkan tujuannya untuk kembali memperluas layanan ke pasar domestik. (j02)

nesia (UICCI) yang didirikan pada tahun 2005 oleh sukarelawan muslim Indonesia dan Turki. Organisasi ini telah memiliki 8 cabang, 4 diantaranya berada di Jakarta, 2 di Aceh dan masing-masing 1 cabang di Yogyakarta dan Kalimantan. Lebih jauh disampaikan, ada rencana lembaga UICCI akan membuka cabang di Medan, Sumatera Utara dengan menghadirkan kegiatan pendidikan keagamaan nonformal berasrama dan program menghafal Quran. Upaya UICCI ini dilakukan dengan menggandeng Pusat Bahasa dan Budaya IAIN SU sebagai mitra lokal. Untuk itu, menurut Zainul, dalam waktu dekat, pihaknya akan mengadakan seminar budaya Indonesia-Turki sebagai bagian dari upaya sosialisasi rencana kerjasama budaya dan pendidikan antar dua negara bersahabat tersebut. Dalam kesempatan tersebut, Rahmat menyampaikan apresiasinya atas upaya-upaya yang dilakukan dalam rangka memajukan kualitas persahabatan Indonesia-Turki sebagaimana yang digagas oleh Pusat Bahasa dan Budaya IAIN SU serta menyatakan dukungannya terhadap rencana kegiatan terkait. (m22)


KEPALA Dinas Pendidikan Provinsi Sumatera Utara Drs Syaiful Syafri, MM foto bersama peserta Rapat Kerja Majelis Pendidikan Provinsi Sumatera Utara Al Washliyah se Sumatera Utara di Asrama Haji Pangkalan Masyhur, Medan, Kamis (5/1).

Dana BOS Dikirim Ke Rekening Sekolah MEDAN (Waspada): Kadis Pendidikan Provinsi Sumatera Utara Drs Syaiful Syafri, MM menegaskan, untuk tahun 2012 dana BOS akan diluncurkan Pemerintah Provinsi Sumatera Utara ke masing-masing rekening sekolah. Hal itu ditegaskan Syaiful Syafri kepada peserta Rapat Kerja Majelis Pendidikan Provinsi Sumatera Utara Al Washliyah se Sumatera Utara di Asrama Haji Pangkalan Masyhur, Medan, Kamis (5/1). Karenanya, kata Syaiful data tentang jumlah siswa harus benar-benar akurat, sehingga dana yang diluncurkan benar-

WISMAN menikmati wisata di Bandung. yang menyedot perhatian baik wisman maupun wisnus seperti Bandung, Raja Ampat, Belitung, dan lainnya. Namun sebenarnya masih banyak lagi yang belum tergarap dan bukan cuma ada di kota-kota besar, melainkan tersebar di sejumlah pulau yang sulit terjangkau dan juga pedalaman. Padahal kalau semunya rata tergali, pasti bakal mendatangkan wisman lebih banyak lagi. Di balik segudang faktor pendukung di atas, masih banyak penghambatnya. Sebut saja beberapa obyeknya masih sulit diakses dan infrastrukturnya belum memadai, masih banyak paket wisata yang belum tergarap dengan baik dan atau belum dibuat, padahal semua tersedia di sini dan layak dijual, dan juga promosi yang belum maksimal. Masih banyak pihak yang belum mengerti bahwa promosi itu sangat penting. Masih

banyak pihak yang belum memahami apa itu promosi dan bagaimana mempromosikan sebuah obyek, event dan lainnya ke khalayak. Dan masih banyak pihak termasuk orang-orang yang berada di bidang promosi yang mandek atau dengan kata lain tidak kreatif dalam berpromosi, padahal banyak cara yang dapat dilakukan untuk itu. Selain itu pemerintah dan pihak-pihak terkait, belum memaksimalkan potensi wisata di daerah-daerah yang menjadi pintu masuk wisman dari negara-negara yang berbatasan langsung atau negara tetangga seperti dari Malaysia, Singapura, Thailand, Filipina, Papua Nugini, dan Timor Leste. Justru negara-negara tersebut, terutama Malaysia, Singapura, dan Thailand begitu gencar melancarkan startegi “perang” menarik wisatawan asal Indonesia sebanyak-banyaknya ke negaranya dengan berbagai

Waspada/Adji K

cara, termasuk mungkin dengan rajin menciptakan imej positif, membanggakan, dan berkelas terhadap obyek wisatanya masing-masing. Dan strategi inilah yang belum dipahami benar Indonesia. Sebenarnya strategi untuk melampaui target 8 juta wisman tahun ini amatlah mudah. Pertama, selain terus membenahi infrastukur di semua obyek wisata dan destinasinya serta menyiapkan SDM termasuk masyarakatnya agar menjadi tuan rumah yang baik, ramah, dan menyenangkan, pun tak kalah penting terus gencar berpromosi dengan bermacam cara. Tentu promosi yang dilakukan harus efisien dan tepat sasaran. Misalnya dengan melibatkan peran media massa, baik online, cetak (koran dan majalah), elektronik (radio & TV) sebanyak dan sesering mungkin dalam setiap kegiatan baik yang dilakukan pemerentah dalam

ningkatkan kualitas pembelajaran. Karenanya manajemen sekolah, metoda pembelajaran dan lingkungan sekolah yang sehat dan hijau perlu segera ditata dan diperbaiki sehingga kualitas pembelajaran bisa berjalan baik dan nyaman. Syaiful Syafri yang didampingi Prof Dr Ilmi Abdullah ketua panitia Akmal Samosir, SAg dan Sekretaris Drs Zainal Abidin, menegaskan jika Al Washliyah punya pemipin yang komitmen, kepala sekolah yang punya manajemen dan guru yang mempunyai kompetensi baik serta proses pembelajaran yang di-

siplin, jujur dan bertang-gungjawab maka Al Washliyah akan mampu meraih prestasi dan mampu bersaing dengan sekolah negeri dan swasta lainnya. Demikian juga dengan sarana dan prasarana, kata Syaiful Syafri, keberadaan laboratorium sekolah, ruang perpustakaan dan ruang ITC segera ditata. Pemerintah Provinsi di bawah kepemimpinan H Gatot Pujo Nugroho akan terus memperhatikan kekurangan itu sarana pendidikan untuk menggulirkan bantuan, sehingga Sumut benar-benar mampu menyongsong pendidikan ASEAN di tahun 2015. (m14)

1,5 Juta RTSM Jadi Sasaran PKH JAKARTA (Waspada): 1,5 Juta Rumah Tangga Sangat Miskin (RTSM) di seluruh Indonesia akan menjadi target Program Keluarga Harapan (PKH) di Kementerian Sosial (Kemsos). Anggaran yang dialokasikan mendekati Rp 2 triliun dari total Rp 4,5 triliun anggaran Kemsos di 2012. Menteri Sosial Salim Segaf Aljufri usai menyerahkan Daftar Isian Pelaksanaan Anggaran (DIPA) 2012 kepada seluruh pejabat eselon I di lingkungan Kemsos, Kamis (5/1) mengatakan, jumlah sasaran pada 2012 banyak dari tahun lalu yang berjumlah 1,16 juta RTSM. “PKH tetap menjadi prioritas Kementerian Sosial di sisa pemerintahan Presiden SBY jilid kedua ini. Target PKH yang sudah berjalan sejak 2007 adalah menuntaskan masyarakat miskin menjadi sejahtera,” Kata Salim. Menurut Mensos, PKH yang sudah berjalan sejak 2007 semula menyasar 500 ribu Rumah Tangga Sangat Miskin (RTSM). Jumlahnya merangkak naik di 2008 menjadi 640 ribu RTSM, di 2009 sebanyak 710 ribu RTSM, 2010 menjadi 816 ribu

Strategi Jitu Mencapai Target 8 Juta Wisman JAKARTA (Waspada): Kementerian Pariwisata dan Ekonomi Kreatif (Kemenparekraf) dalam jumpa pers akhir tahun lalu menargetkan kunjungan wisatawan mancanegara (wisman) ke Indonesia pada tahun 2012 mencapai 8 juta orang dengan devisa sekitar 8,96 miliar dollar. Target ini diprediksi bakal terwujud sekalipun krisis ekonomi dunia belum pulih. Pencapaian target wisman dari 7,1 juta orang pada 2010 menjadi 7,6 juta orang pada 2011 atau 8,5 % membuktikan Indonesia masih menjadi incaran wisman dari belahan dunia. Namun sebenarnya pencapaian itu bisa lebih. Bahkan target 8 juta wisman pun sebenarnya juga bisa lebih dari itu. Faktor pendukungnya amat banyak. Pertama, Indonesia memiliki obyek wisata yang beragam baik alam, bahari, sejarah, buatan, petualangan, dan konvensi. Kedua Indonesia juga dianugerahi bermacam budaya yang khas, termasuk aneka kulinernya. Dan masih ada faktor lain yang turut berpengaruh positif seperti murah dan banyak pilihan, masyarakatnya terbilang ramah, dan terbilang aman. Sayangnya, semua obyek wisata dan destinasinya belum tergarap dengan baik dan maksimal, baik itu sarana dan prasarananya, kesiapan sumber daya manusianya termasuk masyarakatnya dan juga pengemasannya yang masih apa adanya serta cara mempromosikannya belum efisien dan tepat sasaran. Baru segelintir saja obyek wisata dan destinasi kita yang sudah berjalan dengan baik. Sayangnya dari tahun ke tahun masih itu-itu saja, sebut saja Bali, Jogja, Jakarta, Batam, dan Manado. Memang ada nama baru

benar bisa digunakan untuk kepentingan proses belajar dan mengajar di sekolah. Syaiful meminta dana BOS harus benar-benar digunakan sebaik mungkin dan dapat dipertanggung jawabkan pemakaiannya sesuai Juknis Permenteri Pendidikan dan Kebudayaan No: 5 tahun 2011. Tegasnya, Perguruan Al Washliyah harus mampu menjadi contoh yang terbaik dalam pendidikan, termasuk penggunaan dan BOS Perguruan Al Washliyah di manapun berada, baik jenjang SD, SMP, SMA maupun SMK, diminta untuk mampu me-

hal ini Kemenparekraf maupun pihak swasta, stakeholder dan industri pariwisata. Di samping promosi, mulailah melangkah ke tahap yang lebih tinggi yakni menerapkan strategi menjaring wisman dengan berbagai cara. Tak ada salahnya mempelajari cara negara-negara tetangga yang begitu aktif melakukan promosi melalui badan promosi wisatanya, termasuk dengan melakukan invansi maskapai penerbangannya sebagaimana dilakukan Malaysia lewat AirAsia. Atau dengan cara lain dengan rajin menggelar event, festival dan lainnya di daerahdaerah yang menjadi pintu masuk wisman dari negaranegara tetangga seperti di Batam, Bintan, Entikong, Pontianak, Singkawang, Nunukan, Balikpapan, Aceh, Medan, Atambua, Kupang, Jayapura, dan lainnya. Juga membuat paket-paket wisata yang menarik di daerahdaerah tersebut serta membuka kawasan wisata baru yang potensial di daerah-daerah tersebut. Bila strategi ini sepenuh hati dijalani, dipastikan target 8 juta wisman ke Tanah Air tahun ini akan terlampaui bahkan melesat jauh. Terlebih kini ada mesin ekonomi baru berlabel ekonomi kreatif dengan 15 sub sektoral antara lain fesyen, seni pertunjukan, dan kuliner yang menyatu dengan kementerian pariwisata. Dipastikan target devisa tahun ini dari sektor ini pun bakal melambung tinggi. Kini tinggal pemerintah dalam hal ini Kemenparekraf bersama pihak-pihak terkait yang mau dan rela bekerja keras membenahi diri serta kreatif melakukan terobosan-teroban baru untuk mememangkan strategi itu. (adji k)

RTSM dan 2011 bertambah jadi 1.160.000 RTSM. Adapun besaran bantuan kepada masing-masing RTSM sangat beragam, tergantung kebutuhan masing-masing keluarga. “PKH dijalankan selama 6 tahun hingga targetnya di 2013 dan berikutnya 2014. Harapan kita, jumlah masyarakat kategori miskin makin berkurang menjadi masyarakat sejahtera,” imbuh Mensos. PKH menjadi program primadona karena dengan itu

anak-anak dari keluarga miskin dapat pendidikan yang bagus dan dijamin kesehatannya. Jika keluarga belum dapat Kredit Usaha Rakyat (KUR) dapat mengajukan pinjaman,” kata Salim. Upaya mendongkrak masyarakat miskin menjadi masyarakat sejahtera, disebut Mensos, tidak dilakukan Kemensos saja tapi juga ‘dikeroyok’ 19 kementerian/lembaga, di antaranya Kementerian Pendidikan dan Kebudayaan, Ke-

menterian Kesehatan serta Kementerian Agama. Menurut Mensos, mengutip pernyataan Menko Kesra Agung Laksono, jumlah masyarakat miskin makin menurun sesuai data BPS. Targetnya di 2014, pencapaian angka kemiskinan bisa capai 8 persen. Di samping PKH, 22 penyandang masalah kesehatan seperti lansia terlantar, penyandang cacat, anak terlantar juga menjadi program andalan Kemsos di 2012. (dianw)

Revisi UU Pilkada Harus Tegas JAKARTA (Waspada): Anggota Komisi II DPR RI dari Fraksi PDI Perjuangan Yasonna H Laoly menegaskan, revisi UU Nomor 32 tahun 2004 tentang Pemilihan Kepala Daerah harus mempertegas kewenangan antara kepala daerah dan wakilnya. Penegasan itu perlu guna menghindari terjadinya pecah kongsi karena kepala daerahnya tidak memberikan kewenangan semestinya kepada wakilnya. “Harus diatur lebih jelas dan rinci kewenangan yang dimiliki wakil kepala daerah, ada pembagian tugas yang jelas diantara mereka, tidak seperti selama ini, kewenangan wakil kepala daerah tidak jelas,” kataYasonna Laloy di gedung DPR, Kamis (5/1). Pecah kongsi kepala daerah seperti yang terjadi di beberapa daerah, lanjut Yasonna, dipicu oleh aturan yang tidak jelas. Semua kewenangan dimonopoli atau di tangan gubernur

atau bupati maupun walikota. Bahkan ada kepala daerah yang tidak mau menyerahkan kewenangan kepada wakilnya, sehingga wakilnya merasa tidak diberi kewenangan apa-apa. “Kalau pun ada hanya urusan seremonial saja,” ujarnya seraya menambahkan, praktik seperti ini memang melecehkan, padahal keduanya dulu dipilih satu paket dan sama-sama berkeringat. Terkait wacana pemilihan kepala daerah dipilih terpisah, wakil rakyat dari daerah pem politisi pemilihan Sumut II ini mengatakan, kepala daerah dan wakilnya harus tetap dipilih satu paket seperti yang sudah berlangsung selama ini, karena pemilihan kepala daerah sesuai dengan amanat konstitusi. “Ini kan amanat UUD,” ujarnya. Namun dia juga berpendapat, perlu dipikirkan dan dikaji daerah-daerah yang perlu dan tidak perlu memiliki wakil kepala

daerah. Misalnya, ada daerah yang jumlah penduduknya tidak sampai 300 ribu, maka wakil kepala daerah ditiadakan saja, sebaliknya, daerah yang penduduknya mencapai 300 ribu bahkan lebih tetap memerlukan wakil kepala daerah. “Nah, pemilihannya tetap dilakukan satu paket secara langsung,” kata Yasonna. Tetapi ke depan, tambahnya, wakil kepala daerah tetap diberi kewenangan yang lebih jelas, tidak sekadar ban serap. Untuk itu sudah waktunya UU harus mengatur kewenangan yang tegas antara kepala daerah dengan wakilnya, sehingga tidak ada perbedaan-perbedaan seperti yang terjadi selama ini, yaitu semua terserah kepala daerahnya. Menurut Yasonna Laoly, draf revisi UU Nomor 32 tahun 2004 masih di Kementerian Dalam Negeri, bersama-sama dengan revisi UU Pemerintahan Daerah dan UU Desa. (aya)

PDIP Tolak Amandemen Kelima UUD 1945 JAKARTA (Waspada): Fraksi PDI Perjuangan Majelis Permusyawaratan Rakyat (MPR) RI secara tegas menolak usulan perubahan (amandemen) UUD 1945 kelima yang diajukan Dewan Perwakilan Daerah (DPD) RI. “Usulan perubahan kelima UUD NRI 1945 merupakan hak konstitusi DPD. Namun, Fraksi PDIP menganggap usulan tersebut disampaikan dalam waktu yang kurang tepat,” ujar Ketua Fraksi PDIP MPR RI DR Yassonna H. Laoly, SH, MSc saat konferensi pers di ruang Fraksi PDI Perjuangan Gedung DPR RI, Kamis (5/1). Yassonna didampingi Sekretaris F PDI Perjuangan MPR Drs Achmad Basarah, MH memaparkan alasan Fraksi PDIP tidak setuju atas usulan amandemen UUD 1945, antaralain dari segi filosofi bahwa UUD 1945 dalam perubahan pertama sampai dengan keempat merupakan resultante atau kesepakatan politik lembaga yang berhak menetapkannya sesuai dengan situasi ideologi, politik, ekonomi, sosial dan budaya ketika dibuat. Oleh sebab itu, konstitusi dapat diubah manakala terjadi perubahan keadaan ideologi, politik, ekonomi, sosial, dan bu-

daya, baik karena era maupun karena areanya. Dari aspek yuridis, kata Yassonna, UUD 1945 hasil amandemen yang berlaku saat ini, pada dasarnya merupakan produk yuridis ketatanegaraan yang secara maksimal telah mengakomodasi berbagai gagasan dan kepentingan selama proses amandemen itu berlangsung (1999-2002). Semua isu yang sekarang diusulkan untuk dijadikan isi perbaikan kembali, seperti memperkuat sistem presidensial, memperkuat DPD, memperkuat ekonomi daerah, komisi negara, MK, pasal HAM, pendidikan dan perekonomian nasional sebenarnya hampir tidak ada yang baru karena sudah dibahas dan dipertimbangkan selama proses perubahan UUD 1945 tahun 1999–2002. Dari aspek sosialogis, UUD 45 hasil amandemen hingga empat kali, merupakan produk politik yang sudah maksimal dan telah dilaksanakan dengan baik. Sedangkan dari aspek politis, amandemen akan menyedot banyak energi karena bisa memicu perdebatan panjang dan dapat menimbulkan ketegangan dan kegaduhan politik baru yang sangat tidak produktif bagi upaya pembangu-

nan bangsa. Untuk itu F PDIP mendesak semua pihak untuk kembali kepada nilai-nilai empat pilar kehidupan berbangsa dan bernegara (Pancasila, UUD45, NKRI dan Bhinneka Tunggal Ika) dalam kehidupan kemasyarakatan, kebangsaan dan kenegaraan di tanah air. Dan khusus para pimpinan lembaga-lembaga negara di semua tingkatan agar memberikan suri tauladan pengalaman nilai-nilai Pancasila dalam kehidupan sehari-hari. F PDIP juga mendesak pemerintah untuk lebih tegas dan menjamin serta melindungi hak-hak azasi tiap-tiap warga negara sesuai dengan amanat UUD 1945. Pemerintah juga berkewajiban melindungi kedaulatan politik dan teritorial dari kepentingan asing, melindungi kepentingan ekonomi nasional dan melindungi serta mengembangkan nilai-nilai budaya bangsa Indonesia. “Pembangunan demokrasi Indonesia harus dikembalikan pada nilai-nilai Pancasila yang mengutamakan prinsip musyawarah-mufakat dan gotong royong serta bertujuan untuk meningkatkan kesejahteraan rakyat sesuai amanat pembukaan UUD 1945,” tegas Yassonna H. Laoly. (aya)


A8 07.00 Kisah Nobita 08.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 The Little Vampire 14:45 Cek & Ricek 15.30 Top 5 16.00 Silet 17.00 Seputar Indonesia 17.30 Dewa 19.00 Binar Bening Berlian 21.00 Mega Sinetron Anugerah 22.30 Box Office Movie The Sniper


07.00 SCTV FTV Pagi 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 11.03 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Uya emang Kuya 16.00 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 Laskar Pelangi 19.00 ALiya 20.00 Liputan 6 Terkini 20.30 SCTV Sinetron Dia Atau Diriku 22.00 Sinema Wajah Indonesia

07.00 Disney Club 07.30 Agen Oso 08.00 Layar Pagi 10.30 Kribo 11.00 Sidik 11.30 Lintas Siang 12.00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 16.00 Oscar Oasis 17.00 Animasi Spesial 18.00 Shaun The Sheep 19.00 Sampeyan Muslim 20.00 Senggol Senggol Asmara 21.00 Bulan Di Atas Mentari 22.00 Tarung Dangdut 01.00 Lintas Malam 01.30 CErita Dinihari

07:30 Wooow…! 08:00 Friends 09:00 Dr.Brady Barr 09:30 Srimulat Junior 10:00 Kampung Gajah 10:30 BP3TI 11:00 Forum Kita 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang Kungfu Kids III 15:00 Mantap (Live) 16:00 Topik Petang (Live) 16:30 Fenomania 17:00 Warkop Series 18:00 Pesbukers (Live) 1 9 : 0 0 Ta w a S u t r a Coooyyy… 20:00 Deal Or No Deal 21:30 Most Incredible Moments 22:00 Sinema Indonesia

06:00 - Fokus Pagi 07:00 - KISS Pagi 07:30 - Halo Polisi 08:00 - FTV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea) 14:00 - Drama Asia (Korea) 15:00 - KISS Sore 16:00 - Fokus 16:30 - Drama Asia (Korea) 18:00 - Drama Asia (Mandarin): Monkey King (Journey To TheWest) 19:00 - Satria 20:00 - Tutur Tinular 22:00 - Mega Asia

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.05 Eleven Show 11.05 Agung Sedayu 12.05 Metro Siang 13.05 Dunia Kita 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Genta Demokrasi 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 21.05 Top Nine News 21.30 Kick Andy 23.00 Headline News 23:20 Metro Sports

WASPADA Jumat 6 Januari 2012

07:30 Ranking 1 08:30 Derings 10:00 Ngulik 10:30 IBU 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Ceriwis 14:30 86 15:00 Keluarga Minus 15:30 Sketsa 16:00 With Farah Quinn 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 Spesial XL 21:00 The Hits 22.00 Bioskop TransTV 24:00 Kakek-Kakek Narsis 01:00 Bioskop TransTV 03:00 Reportase Malam

06:30 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Jendela Usaha 12:00 Live News Kabar Siang 13:30 Apa dan Siapa 14:30 Kabar Pasar 15:00 Data Dan Fakta 15:30 Nama Dan Peristiwa 16:30 Sport File 17:00 Live News Kabar Petang 19:30 Apa Kabar Indonesia Malam 21:00 Kabar Malam 22:00 Kabar Arena 23:00 Radio Show

08.00 Avatar 09.00 Superhero Kocak 10.00 Obsesi 11.00 Top Banget 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main KAta 14.00 Steve Ewon Sang Petualang 14.30 Deny Manusia Ikan 15.00 Hand Made 15.30 Berita Global 16.00 Top Banget 16.30 Fokus Selebriti 17.00 Penguin Of MAdagascar 17.30 Spongebob 19.00 Star Teen 2011 21.00 Big Movies 23.00 Big Movies

07:30 Selebrita Pagi 08:30 Hitam Putih 09:30 Mancing Mania 10:00 Spotlite 11:00 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-citaku 14:00 Dunia Binatang 15:00 Koki Cilik 15:30 Asal Usul Flora 16:00 Jejak Petualang 16:30 Redaksi Sore 18:30 Hitam Putih 19:30 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:00 Dua Dunia 00:00 Wisata Malam **m31/G

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Rambut Bob Luna Maya Menang Di Film, Marvel Kalah Di Buku Jadi Trend 2012 Gaya rambut pendek artis dan juga penyanyi Luna Maya mulai banyak digemari dan diperkirakan akan menjadi trend di tahun 2012. Sejumlah salon mengaku banyak menerima permintaan dari pelanggan meminta dipotong rambutnya seperti artis cantik yang membintangi film terbarunya My Blackberry Girlfriend ini. Luna Maya di penghujung tahun 2011 memotong rambut panjangnya. Dengan model rambut pendek terbarunya, Luna Maya tampil cantik. “Mulai Minggu (1/1), setiap hari ada saja yang meminta dipotong rambutnya ala Luna Maya,” kata Yuni pemilik salon yang berada di daerah Semarang Selatan, di Semarang, Rabu. Tidak sedikit dari para pelangan yang rambutnya panjang dan indah tetapi minta dipotong pendek, karena di tahun baru ingin tampil dengan mengikuti trend baru. “Kebanyakan mereka hanya bilang, mbak potong rambut ala Luna Maya ya dan saya langsung mengerti,” katanya. Menurut Yuni, rata-Rata para pelanggan mengaku jika tahun lalu gaya rambut panjang, maka di tahun ini tampil beda dengan rambut pendek. Syafa salah satu pelanggan salon milik Yuni mengaku memotong rambutnya dengan gaya bob setelah melihat penampilan terbaru Luna Maya. “Luna cantik dengan rambutnya yang sekarang pendek, jadi ingin potong juga,” katanya. Putri yang juga mengikuti gaya Luna

Film-film diangkat dari komik-komik superhero buatan Marvel (Thor, Captain America) boleh saja menyisihkan film superhero serupa diangkat dari komik produksi DC Comics seperti Green Lantern, dalam deretan film terlaris (box office) tahun 2011, tapi DC dapat mengklaim beroleh satu kemenangan besar.

Luna Maya Maya mengaku ikut potong bob karena sudah lama tidak potong rambut. “Setelah potong pendek, ternyata merasa jadi lebih muda dan rasanya juga lebih `fresh` serta semangat,” katanya. “Mereka mengaku sudah bosan setelah setahun rambutnya panjang dan ingin mencoba rambutnya pendek. Tahun 2011 gaya rambut panjang dan tahun 2012 gaya rambut dengan potongan pendek,” kata ibu satu anak ini.(ant)

Perusahaan penerbit milik Warner Bros itu berjudi dengan meluncurkan kembali seluruh rangkaian buku komiknya dengan 52 serial baru menggebrak di dalam negeri, menyisihkan penjualan buku-buku komik buatan Marvel sejak September tahun lalu.

Ke-52 serial baru (New 52) itu juga berhasil membalikkan kecenderungan menurunnya penjualan selama empat tahun terakhir, kendati pertumbuhan total penjualannya hanya 1-2 persen. Menurut DC Comics, buku-bukuk komik superhero utamanya per 13 Desember 2011 meliputi: Justice League berada di nomor 1, ditulis Geoff Johns dan ilustasi Jim Lee, telah dicetak 361.138 copy sejak peluncurannya lagi pada Agustus lalu dan dicetak sampai lima kali. Batman, ditulis Scott Snyer dan direka Greg Capulo dengan jumlah copy penjualanan 262.379 dalam dua cetakan. Action Comics terjual 250.898 copy, dengan tiga kali cetak Sebaliknya, komik

Meryl Streep/

Spiderman/ rekor terbesar dalam sepanjang sejarah komik. Sukses DC pada 2011 berbarengan dengan upayanya mempublikasi komik secara digital. Semua judul dalam New 52 dicetak

dalam format digital pada hari sama judul-judul komik itu menggebrak toko-toko buku. Para pengamat industri buku percaya komik-komik ini akan laris diunggah.(ant)

Film-film Hollywood Peraih Keuntungan Besar

Meryl Streep Aktris Sepanjang Masa Meryl Streep akan mendapatkan penghargaan sepanjang masa atas prestasinya dalam Festival Film Berlin pada Februari mendatang. Festival juga akan memutar retrospektif dari beberapa film aktris paling populer selama 30 tahun terakhir. Penyelenggara festival mengatakan bahwa Streep,62 yang saat ini baru menyelesaikan filmnya mengenai mantan Perdana Menteri Inggris Margaret Thatcher bertajuk “Iron Lady”, akan dianugerahi penghargaan terhormat Golden Bear pada 14 Febuari. “Kami senang dapat menganugerahkan penghargaan Golden Bear kepada bintang kelas dunia yang sangat hebat. Meryl Streep adalah seorang pelakon brilian, serba bisa, dan mudah menyesuaikan diri antara peranperan di drama dan komedi,” kata Direktur Festival Film Berlin Dieter Kosslick dalam sebuah pernyataan resmi dirilis pada Senin. Penyelenggara berencana menayangkan enam film Streep, termasuk film peraih Oscar Kramer vs Kramer dan Sophie‘s Choice selama festival film bulan depan. Artis kelahiran New Jersey itu dinilai sebagai artis layar lebar yang terhebat dan telah mencatat rekor 16 kali masuk dalam nominasi Oscar. Ia juga dinilai yang terdepan setelah mendapatkan 17 tanggapan positif dalam aksinya sebagai Thatcher pada nominasi Academy Award akan diumumkan pada 26 Januari di Beverly Hills. (ant)

terlaris produksi Marvel selama 2011 adalah Ultimate Spider-Man yang berada di urutan 160, menampilkan kematian sang superhero terjual 159.355 copy pada Juni tahun lalu. Penting dicatat bahwa gambaran-gambaran itu mewakili penjualan pada toko-toko buku, bukan jumlah copy dipesan pembeli. Amazing SpiderMan no.358 yang ikut dibintangi Presiden Obama dari cetakan 2009 masih menjadi komik terlaris di dekade terakhir, dengan rekor jual 530.500 copy. Namun prestasi itu tetap masih kalah jauh dibandingkan komik X-Men produksi Marvel saat buku ini diluncurkan kembali di awal 1990an. Pada bulan pertama dekade itu saja, komik ini telah terjual lebih dari 8 juta copy merupakan

Tranformers: Dark of the Moon/ Ketika sebahagian besar industri film Hollywood menghadapi kendala pemasaran domestik terhadap produksi film mereka. Namun sebaliknya untuk pemasaran mancanegara film-film itu meraup sukses. Ada enam film produksi industri film Hollywood mengalami jeblok pemasarannya di dalam negeri, tapi berhasil ketika dipasarkan di luar negeri. Keenam film meraih keun-

tungan sampai 13,6 miliar dolar AS sepanjang tahun 2011, begitu menurut industri film Hollywood. Keuntungan naik tujuh persen dari tahun 2010 yang mencomot keuntungan 12,7 miliar dolar AS dengan perincian 20 persen lebih tinggi meraih keuntungan dari tahun 2010 bernilai 1,476 miliar dolar pemutaran film Avatar. “Secara keseluruhan pemberian izin tahun 2011 tidak jauh beda dengan 2010,” kata Veronika Kwan Rubinek, presiden distribusi internasional Warner Bros. Ia mencatat bahwa film-film menarik diformat dalam versi

3D berhasil pemutarannya di bioskop-bioskop seluruh dunia dan enam dari 10 film laris di luar negeri dibikin dalam format semacam itu. Produksi layar lebar yang berhasil meraup sukses tahun 2011 adalah Harry Potter and the Deathly Hallows Part 2, produksi Warner Bros meraih 54 persen dari keuntungan total 953 juta dolar dari film box office asing dari produksi tiga dimensi. Anthony Marcoly, presiden Paramount Picture International mengatakan film top studionya adalah Tranformers: Dark of the Moon mendapat keuntungan 771 juta tahun 2011 mendapatkan 74 persen keuntungan dari film 3D. Berita buruk datang dari peraturan kuota impor film dibebankan administrasi negara China bagian radio, film dan televisi yang membatasi filmfilm asing sampai 20 judul setiap tahunnya. Peraturan ini bertentangan dengan prinsip organisasi perdagangan dunia. Pajabat eksekutif studio internasional yang tidak mau disebutkan namanya mengatakan, negeri tirai bambu itu masih menjadi negara menentukan keberhasilan pemasaan filmfilm laris Hollywood di manca negara. Disamping sutradara Michael Bay mengarahkan film Transformers, Paramount merilis Kung Fu Panda 2 mendapatkan keuntungan 501 juta dolar. Film Thor dengan keuntungan 268 juta dolar dan Captain America: First Avenger meraup keuntungan 192 juta dolar. Sementara Mission ImpossibleGhost Protocol dan film Puss in Boots produksi Dream Work Animation diharapkan meraih

keuntungan 201 juta dan 260 juta dolar sampai akhir tahun 2011. Warner Bros menjadi studio top tahun 2011 mengalahkan 20th Century Fox yang mencomot keuntungan 2,860 miliar dolar untuk film laris menandai perusahaan film Hollywood itu menjadi industri film terbesar kedua dibawah Paramount Picture yaitu turun dua persen dari 2,93 miliar dolar keuntungan tahun 2010. Warner Bros disamping film anyar sekuel Harry Potter adalah Hangover Par t II mencapai keuntungan 330 juta dolar. Film Final Destination 5’ mengait 120 juta dolar dan Green Lantern mencomot 118 juta dolar, Sherlock Holmes: A G a m e o f S h a d ow s y a n g mengumpulkan 88 juta dolar di manca negara. Industri film Hollywood meraup keuntungan terbesar ketiga adalah Walt Disney memproyeksikan film-film laris senilai 2,2 miliar dolar turun lima persen dari 2,3 milyar dolar AS tahun lalu. Judul film top industri film ini seperti Pirates of the Carribean: On Staranger Tides memasukan keuntungan 802,6 juta dolar pemutarannya. Cars 2 datang dengan keuntungan 368 juta dolar AS, hampir dua kali lipat keuntungan pemutaran film itu di Amerika Serikat dan Kanada. Rangking keempat industri film meraup keuntungan terbesar di tahun 2011 melalui pemutaran produksi film mereka di luar Amerika Serikat adalah Fox. Studio itu melaporkan keuntungan 2,150 miliar AS turun dari 2,92 miliar dolar dilaporkan tahun 2010. Judul-judul top adalah Rio memasukan 343,9

juta dolar hampir dua kali pendapatan pemutaran film domestik, Rise of the Planet of the Apes meraih 306 juta dolar dan Black Swan meraup 222.5 juta dolar. Sony beruntung 1,830 miliar dolar selama tahun 2011 untuk film animasi atau aksi langsung seperti The Smurfs mencomot keuntungan 416,6 juta dolar hampir tiga kali pendapatan domestik. Film The Adventures of Tintin: The Secret of the Unicorn arahan Steven Spielberg menjadi film andalan Paramount sebelum 21 Desember. Pemutaran awal di pasar domestik meraup keuntungan 265 juta dolar. Film The Tourist dibintangi Johnny Deep terjual laris di pasar asing meraih keuntungan 221,1 juta dolar AS. Universal dilaporkan mengumpulakan 1,3 miliar dolar naik 9 persen dibandingkan keuntungan tahun 2010. Film Fast Five meraih keuntungan 419 juta dolar di pasar asing. Film komedi terbaru Roman Atkinson bertajuk Johnny English 2 mencapai 154 juta dolar dan film hit komedi Bridesmaids menghasilkan keuntungan 119 juta dolar. The Twilight Saga: Breaking Dawn Part 1 meraup keuntungan 410 juta dolar dari total keuntungan. Pemenang Festival Film Cannes Tree of Life meraih keuntungan 48 juta dolar. Universal merilis film Office Romance di Rusia mendapatkan keuntungan 12 juta dolar dan Sony memegang pemasaran filmVysotsky: Thank God I’am Alive, film biografi figur legendaris Rusia menghasilkan 27 juta dolar ketika di putar di Rusia. Nur/thr

Luar Negeri

WASPADA Jumat 6 Januari 2012


72 Orang Tewas Dalam Serangan Bom Di Irak BAGHDAD, Irak (AP): Satu gelombang ledakan melanda dua kawasan warga Syiah di Baghdad, Irak, Kamis (5/1) yang menewaskan sekurang-kurangnya 72 orang dan meningkatkan kecemasan bahwa pemberontak meningkatkan serangannya setelah pasukan Amerika menarik diri dari negeri itu yang selesai bulan lalu. Pengeboman itu dimulai dinihari ketika serangkaian ledakan menghantam dua kawasan Syiah di Baghdad, yang menewaskan 27 orang. Beberapa jam kemudian, satu serangan bom bunuhdiri menghantam jamaah Syiah yang menuju ke kota suci Karbala, yang menewaskan 45 orang, kata pejabat provinsi Quosay al-Abadi. Rangkaian ledakan itu terjadi di Nasiriyah, kira-kira 320 km di tenggara Baghdad. Para pejabat ru-

mah sakit membenarkan mengenai jumlah korban. Serangan tersebut dimulai dengan ledakan satu bom yang diletakkan di satu spedamotor di dekat satu halte bus di mana para buruh harian berkumpul untuk mencari kerja di kawasan Sadr City. Salah seorang yang menyaksikan serangan itu mengatakan, kawasan itu segera penuh dengan asap hitam tebal. “Masyarakat benar-benar ketakutan bahwa lingkaran keke-

rasan kemungkinan akan kambuh lagi di negeri inim,” kataTariq Annad, seorang pekerja pemerintah berusia 52 tahun yang tinggal di dekat lokasi kejadian. Serangan itu diikuti oleh ledakanlainbomjalanan.Polisimenemukan satu bom lainnya di dekat lokasi peledak pertama namun berhasil menjinakkannya. Ledakan dua bom di Sadr City itu menewaskan sekurang-kurangnya 12orang,demikianmenurutpolisi dan pejabat medis. Kurang dari dua jam kemudian, dua ledakan lainnya mengguncang kawasan Syiah lainnya di Kazimiyah di utara ibukota Baghdad, yang menewaskan 15 orang. Para pejabat mengatakan ledakandiKazimiyahterjadiham-

pirbersamaan,dengansekurangkurangnya satu ledakan disebabkan oleh bom mobil. Para pejabat rumah sakit membenarkan jatuhnya korban jiwa dari keempat ledakan, yang termasuk lebih dari 60 lainya cedera. Jurubicara militer Baghdad, Mayjend. Qassim al-Moussawi, mengatakan tujuan serangan itu adalah‘untukmenciptakanhasutan antararakyatIrak.’ Diamengatakan terlaludiniuntukmengatakansiapa yang berada di balik pemboman. Pengeboman terkoordinasi, khususnya daerah-daerah Syiah penargetan, merupakan ciri khas militan Sunni terkait dengan AlQaida. Serangan itu merupakan yang paling mematikan di Baghdad sejak 22 Desember, ketika

serangkaian ledakan menewaskan 69 orang di lingkungan sebagianbesarwargaSyiah.Kelompok depan al-Qaida di Irak mengaku bertanggung jawab atas serangan-serangan itu. Irak masih diganggu oleh pemberontakansektarianmematikan hampir sembilan tahun setelah invasi tentara asing yang dipimpin AS menggulingkan Presiden Saddam Hussein. Kota Sadr adalah kubu radikal Syiah Moqtada al-Sadr, yang milisi Mehdi-nya pernah bertempur melawan tentara AS dan Irak. Dia sekarang menjadi sekutu utama Perdana Menteri Maliki. PM marah kepada para pesaingnya kemudian dia meminta parlemen untuk mengganti wakil

Militan Pakistan Bunuh 15 Petugas Keamanan

Sunni Saleh al-Mutlaq dan mengupayakan surat perintah penangkapan untukWakil Presiden Irak Sunni Tareq al-Hashemi atas tuduhan dia memerintahkan regu-regu berani mati. Selasa,kelompokIraqiyayang didukungSunnimemboikotsidang parlemen dan kabinet, menuduh blokMalikimenjalankanpemerintahan sendiri dalam koalisi pembagiankekuasaanyangseharusnya bisa meredakan ketegangan sektarian.Saturentetanpengeboman menewaskan 72 orang terutama didaerahSyiahBaghdadbeberapa hari setelah krisis politik mulai menimbulkan kekhawatiran atas kembalinyapertikaiansektediIrak, yangmasihterhuyungdiambang perangsipilpada2006-2007.(m10)

25 Tewas Akibat Longsor Di Filipina

Tabrakan Tanker Di Perairan Singapura Timbulkan Pencemaran

MINDANAO, Filipina (CNN): Longsor yang terjadi di kawasan terpencil di selatan Filipina menewaskan 25 orang dan menyebabkan lebih 100 orang hilang, kata gubernur provinsi Kamis (5/1). Longsor tersebut merupakan bencana terbaru yang melandai Pulau Mindanao setelah badai tropis menewaskan lebih 1.200 orang bulan lalu. Cuaca merupakan penyebab bencana Kamis itu, yang terjadi di tempat di mana terdapat pertambangan emas skala kecil. Hujan yang turun hampir tanpa henti sejak pertengahan Desember tahun lalu menyebabkan tanah terendam air, kata Gubernur Arturo Uy dari Provinsi Compostela Valley. Longsor tersebut terjadi sekitar pukul 3.00 dini hari, demikian menurut satu pernyataan dari Dewan Manajemen dan Pengurangan Resiko Bencana Nasional Filipina. Sejumlah korban cidera akibat longsor tersebut dibawa ke rumahsakit lokal, kata Uy. Pencarian dan operasi penyelamatan terus dilakukan.Wilayah itu dikenal berbahaya, kata Uy, dengan mengatakan daerah tersebut telah dikosongkan tahun lalu setelahterjadi longsor mematikan April lalu tidak jauh dari tempat bencana Kamis.(m23)

Operasi Kanker Presiden Argentina Sukses BUENOS AIRES, Argentina (CNN): Operasi Presiden Argentina Cristina Fernandez de Kirchner yang berlangsung Rabu (4/1) berjalan sukses, kata juru bicaranya. Tidak terjadi komplikasi selama operasi yang berlangsung selama 3,5 jam untuk menyingkirkan kanker kelenjar tiroid itu, kata jubir presiden Alfredo Scoccimarro.Minggu lalu para dokter mengatakan pemeriksaan menunjukkan kanker pada kelenjar tiroid yang diderita Fernandez belum menyebar. Presiden Argentina itu sadar kembali setelah operasi Rabu dan akan menjalani proses penyembuhan di ruangan paska operasi selama 72 jam, kata Scoccimarro. Ratusan pendukungnya melambaikan bendera dan spanduk di luar Rumahsakit Austral, yang terletak 60 km dari Buenos Aires. Sebagian di antara mereka berkata merekaberencanaberkemahdiluarrumahsakitsampaisangpresiden keluar dari rumahsakit. “Kami akan menunggu sampai dia pulih dan bisa keluar dari rumahsakit,” kata Angel Cifo. “Kami berharap bisa melihat dia dan menyapanya.” Sebelum operasi, Fernandez menyerahkan kekuasaan kepada Wakil Presiden Amado Boudou sampai 24 Januari.(m23)

Banjir Di Thailand Selatan Menyusut NAKHON SI THAMMARAT, Thailand (Antara/TNA-OANA): Banjir yang terjadi di Provinsi Nakhon Si Thammarat di bagian selatan Thailand telah menyusut dan pemerintah kota menetapkan Sabtu sebagai hari pembersihan bersama, Kantor Berita TNA melaporkan Kamis (5/1). Walikota Nakhon Si Thammarat, Chaowat Senpong, memperkirakan kerugian akibat banjir mencapai 100 juta Baht selain dua tempat yang rusak parah. Keadaan di wilayah lain mulai membaik namun genangan air masih tersisa di empat distrik. Kantor Irigasi Provinsi Kamis menggunakan 19 pompa untuk mengeringkan air dan jika hujan tidak kembali mengguyur maka seluruh air akan hilang dalam waktu dua hari. Chaowat mengatakan pemerintah kota akan berdiskusi dengan pemerintah provinsi dan departemen irigasi guna mendapatkan anggaran sebesar dua miliar baht dari pemerintah untuk melaksanakan rencana pencegahan banjir jangka panjang. Menteri Pertahanan Yutthasak Sasiprapa sebelum pergi ke Laos Kamis mengatakan bahwa Kepala Staf Angkatan Darat Prayuth Chan-ocha memerintahkan Pusat Bantuan Angkatan DaratWilayah Keempat untuk memasuki seluruh kawasan yang terkena banjir dan memperbaiki jalan serta jembatan selain menyiapkan personel bantuan dan alat berat. KSAL Laksamana Surasak Runroengrom mengatakan unit khusus telah ditugaskan untuk operasi bantuan di Narathiwat dan Pattani. Sebanyak dua kapal laut HTMS Chakri Naruebet dan HTMS Surin siap berlayar jika mereka menerima perintah dari pemerintah mau pun menteri pertahanan.

Syria Bebaskan 552 Tapol BEIRUT, Lebanon (AP): Televisi pemerintah Syria mengatakan pihak berwenang telah membebaskan 552 tahanan politik (tapol) yang terlibat dalam kegiatan anti-rezim selama pergolakan sembilan bulan terhadap Presiden Bashar Assad. Pembebasan tersebut merupakan kelompok kedua tapol yang dibebaskan dalam satu minggu di bawah rencana Liga Arab yang bertujuan untuk menghentikan penumpasan pemerintah terhadap kaum pembangkang, yang telah mengorbankan ribuan jiwa. Selain penghentian kekerasan, rencana menyerukan pembebasan semua tapol. Kira-kira 3.500 orang telah dibebaskan Selasa. Menyusul laporan televisi Kamis, para aktivis mengatakan Syria masih menahan sekurang-kurangnya 25.000 tapol. Rencana Liga Arab sejauh ini telah gagal untuk menghentikan kekerasan. Para aktivis melaporkan ratusan orang tewas padahal satu tim pemantau Liga Arab berada di Syria dalam usaha untuk menjamin rezim di Syria melaksanakan apa yang telah dijanjikannya. Sementara itu, pemimpin Liga Arab Nabil el-Arabi Rabu menolak seruan untuk menarik pengamat dari Syria dan mengatakan misi akan dilanjutkan sejalan dengan protokol yang ditandatangani. Liga Arab akan menilai situasi dengan meninjau laporan oleh kepala misi pengamat, Sudan Mohamed Ahmed el-Dabi, kata Sekjen Liga Arab dalam sebuah pernyataan. “Kami memiliki misi khusus untuk waktu yang bisa diperpanjang di mana banyak hal bisa dicapai, tetapi sekarang kita perlu mengevaluasi situasi,” katanya. Dabi diharapkan untuk kembali ke Kairo akhir pekan ini untuk menyampaikan laporan kepada pertemuan para menteri Liga Arab tentang situasi di Syria. Parlemen Arab, suatu badan penasehat untuk Liga Arab, Minggu mendesak segera menghentikan misi pengamat karena berlanjutnya kekerasan di Syria. Para menteri Komite Arab, yang mengikuti krisis Suriah, akan mengadakan pertemuan Minggu di Kairo. Pertemuan itu awalnya dijadwalkan pada Sabtu, tapi Rabu Liga Arab memutuskan untuk menunda sampai Minggu untuk memungkinkan partisipasi yang lebih besar, kata kantor berita resmi MENA.(m10)

DERA ISMAIL KHAN, Pakistan (AP): Militan Pakistan Kamis (5/1) membunuh 15 petugas keamanan yang mereka culik bulan lalu dekat perbatasan Afghanistan, yang menunjukkan bahwa tidak semua faksi pemberontak tertarik dengan laporan perundingan damai dengan pemerintah. Mayat-mayat dalam keadaan tanpa busana dibuang di kota Shiwa di daerah Utara Waziristan, kata warga setempat Sada-uAlla dan Salam Khan. Komandan lokal Konstabulari Frontier Ali Sher membenarkan para petugas keamanan itu telah dibunuh dan mengatakan orang-orangnya telah dikirimkan ke kawasan tersebut untuk memungut mayat-mayat yang penuh dengan luka tembak pada tubuhnya. Dalam satu pernyataannya, Taliban Pakistan mengatakan pembunuhan itu merupakan pembalasan atas operasi tentara pada 1 Januari di kawasan tersebut yang menewaskan sejumlah militan, termasuk seorang panglima terkemuka dari kelompok militan. Taliban juga menduga pasukan pemerintah telah membunuh seorang wanita dan menahan seorang lainnya, “kadang-kadang tindakan mereka terlarang dan dikutuk dalam Islam serta menurut tradisi suku.” Para pria korban pembunuhan adalah anggota kontabulari, satu kesatuan paramiliter di perbatasan dengan Afghanistan. Para pemberontak menculik mereka dalam satu serangan 22 Desember di satu pangkalan keamanan Pakistan di daerah perbatasan. Beberapa bulan terakhir, sejumlah komandan militan dan pejabat intelijen menyatakan perundingan damai dengan Taliban Pakistan, salah satu kelompok militan terbesar dan paling brutal, sedang berjalan. Namun para komandan Taliban Pakistan lainnya telah menampik laporan tentang perundingan damai itu dan serangan-serangan sporadis masih berlanjut. Para pemimpin suku dan para pengamat berspekulasi bahwa kelompok tersebut, yang telah digempur selama ofensif tentara Pakistan dan serangan misil Amerika selama beberapa tahun terakhir. (m10)

SINGAPURA (AP): Pihak otorita pelabuhan Singapura mengatakan dua tanker bertabrakan di lepas pantai negara kota itu, yang memicu pencemaran ketika bocoran kecil bahan bakar mengotori perairan. Otorita Maritim dan Pelabuhan (MPA) mengatakan dalam satu pernyataan Kamis (5/1) bahwa lima metrik ton bahan bakar minyak mencemari Selat Singapura setelah terjadi kebocoran pada tanker Kota Tenaga, satu tanker berbendera Singapura akibat tabrakan tersebut. Tanker tersebut bertabrakan dengan tanker SEEB yang berbendera Malta Rabu malam. MPA mengatakan pihak berwenang telah berhasil mengatasi pencemaran minyak dan bahan kimia telah digunakan untuk memecah tumpukan minyak yang mencemari laut. MPA mengatakan pihaknya masih menyelidiki sebab tabrakan, yang terjadi kira-kira 10 km di selatan pulau utama Singapura. MPA mengatakan tidak ada laporan korban cedera. (m10)


PARA penduduk Irak membantu para korban ledakan di lokasi serangan bom di Nassiriya, 300 km di tenggara Baghdad Kamis (5/1). Seorang pengebom bunuhdiri yang menujukan serangannya pada para jamaah Syiah telah menewaskan sekurang-kurangnya 30 orang dan mencederai lebih 70 lainnya di Irak Selatan Kamis, kata Qusay al-Abadi, kepala dewan provinsi di Nassiriya.

Sejumlah Mantan Pimpinan AB Filipina Hadapi Tuduhan Korupsi MANILA, Filipina (AP): Departemen Kehakiman Filipina telah merekomendasikan tuduhan-tuduhan penjarahan terhadap dua mantan kepala angkatan bersenjata dan sembilan orang lainnyadituduhmengalihkandan mengantongi2,3miliarpeso(sekitar AS$52,6juta)danayangdimaksudkan untuk pembayaran gaji dan kebutuhan pasukan tempur, kata seorang pejabat Kamis (5/1). Di antara mereka yang direkomendasikan departemen kehakiman menghadapi berbagai tuduhanituadalahmantankepala AB DiomedioVillanueva dan Roy Cimatu, kata Menteri Kehakiman Leila de Lima. Cimatu bertugas

sebagai utusan khusus untuk TimurTengah setelah pensiun dari militer. Korupsi merupakan satu masalah yang menimbulkan ‘ledakan khusus’ di Filipina di mana tentaranya amat buruk peralatan dan gajinya, yang memicu beberapa pemberontakan oleh pasukan yang tidak puas selama dua dekade terakhir. Jend. Pensiunan Angelo Reyes, seorang mantan panglima AB dan menteri pertahanan, melakukan bunuhdiri tahun lalu setelah dia dituduh dalam satu skandal korupsi. De Lima mengatakan Departemen Kehakiman juga merekomendasikan sejumlah tuduhan

terhadapmantanMayjend(Purn) Carlos Garcia dan Letjend (Purn) Jacinto Ligot. Sekurang-kurangnya tiga perwira militer lainnya ada dalam daftar departemen tersebut saat ini masih berdinas, termasuk Brigjend. Benito Antonio de Leon. Kol. Arnulfo Marcelo Burgos, jurubicara AB, mengatakan militertidakakanbertoleransidengan korupsi dan akan menyerahkan personel aktif yang terlibat dalam kasustersebut. DeLimamengatakan bahwa resolusi departemen ituadalahmemberikanrekomendasidanKantorOmbudsmanakan menyampaikan pernyataan final mengenaituduhan-tuduhanyang

diajukankedepansidangpengadilan anti-korupsi. Dalam kesaksian mengejutkan di depan Senat Filipina tahun lalu, mantan perwira militer di komisi anggaran Letkol. George RabusamengklaimbahwaReyes, Villanueva dan Cimatu berada di antara petugas yang menerima hadiah besar dan “membawa uang” ketika mereka pensiun. Dia mengatakan uang yang berasal dari dana ilegal yang dikumpulkan dari unit-unit militer utama, yang dipaksa untuk memotong anggaran mereka dan disetujui Kongres untuk gaji pasukan, senjata, peralatan dan kebutuhan tempur. (m10)

Sandera Australia Di Filipina Berusaha Cari Uang Tebusan AS$2 Juta MANILA, Filipina (AP): SeorangmantanprajuritAustralia yang diculik di selatan Filipina tampak di satu rekaman video yang dikirimkannya kepada keluarganyamemohonagardiselamatkan jiwanya dan mendesak Manila dan Canberra meningkatkan uang tebusan AS$2 juta yang dituntut para penculiknya. Video tentang Warren Richard Rodwell, 53, bersama empat foto yang menunjukkan dia diborgol dan tampaknya menga-

lami cedera di tangan kanannya, telah diposkan ke istrinya yang warga Filipina sebelum Natal, kata sejumlah pejabat kepolisian Filpina. The Associated Press telah melihat salinan video dan foto tersebut Kamis (5/1). Mengenakan sweater dan tampak membaca dari selembar surat, Rodwell berusaha membersihkan kerongkongan ketika dia berbicara dalam rekaman video itu, yang diberikan oleh keluarganya kepada penyelidik

kepolisian Filipina. Rodwell yang tampak lesu dan mengedipkan mata berkali-kali, berdiri di depan sebuahterpalbiruyangmenutupi latar belakang tumbuh-tumbuhan. Pada saat dia mengatakan dia pernah menjadi anggota tentaraAustralia,Rodwellmenyatakan kawasan pegunungan di mana dia berada saat ini sulit ditempuh. Salah satu dari foto tersebut menunjukkan borgol berwarna perak dan rantai yang menggan-


MUDIK SAMBUT IMLEK. Para penumpang menunggu untuk menaiki kereta api mereka di satu stasiun KA di Hefei, provinsi Anhui, China, Kamis (5/1). Tahun Baru China atau Tahun Baru Imlek, merupakan dua liburan ‘Minggu Emas paling besar, yang memberikan para pekerja migran kesempatan setiap tahunnya untuk kembali ke kampung halamannya dengan membawa hadiah bagi keluarga mereka. Lebih dari 200 juta orang diperkirakan akan menggunakan jasa angkutan kereta api selama liburan itu, yang merupakan gerakan paling besar manusia di dunia.

tung dari pergelangan tangan kirinya. Sisi telapak kanannya tampak terluka. Di Melbourne, Australia, Menteri Urusan Dalam Negeri danMenteriKehakimanBrendan O’Connor mengatakan kepada para wartawan bahwa para pejabatAustraliabekerjasamadengan pihak berwenang Filipina untuk menjamin pembebasan dengan selamat Rodwell, namun dia menolak untuk mengungkapkan rincianlebihlanjut.Ketikaditanya apakah para penculik meminta uang, dia mengatakan Australia memiliki kebijakan untuk tidak membayar uang tebusan. “Keprihatinankamicumadia dan pikiran kami adalah pada keluarganya dan kedutaan akan melakukan segala sesuatu yang mereka mungkin bisa untuk memastikan dia dibebaskan,” kata O’Connor. PM Australia Julia Gillard mengatakan bahwa pemerintahnya telah membentuk satu gugus tugasuntukmenyelidikipenculikan itu. Rodwell, yang juga sebelumnya bekerja sebagai guru perguruan tinggi di Shanghai, telah diambil di bawah todongan senjata oleh sekitar enam pria 5 Desember lalu di kota Ipil, provinsi Zamboanga Sibugay, Filipina Selatan. Rodwell adalah korban penculikan terakhir orang asing di daerah rawan Filipina Selatan, di mana sejumlah penculikan yang menuntut uang tebusan, yang dipersalahkan pada kelompok militan Abu Sayyaf yang ada hubungannya dengan al-Qaida. (m10)

Jihad Islam Miliki Misil Yang Mampu Hantam Tel Aviv GAZA CITY, Jalur Gaza (Waspada): Kelompok gerilyawan Jihad Islam Palestina memperbaharui persenjataannya. Mereka pun sudah memiliki roket yang dapat menjangkau target ke Tel Aviv dan beberapa wilayah lain. Pemerintah Israel sendiri mengatakan, kemampuan militer Jihad Islam tampak lebih kuat dibandingkan fraksi Hamas. Mereka juga mendapatkan pelatihan di luar Gaza. Demikian seperti diberitakan Imemc, Kamis (5/1). Kepemilikan senjata yang mematikan oleh Jihad Islam atau fraksi Hamas tentunya akan semakin membuat negeri Yahudi itu khawatir. Israel juga mengatakan, Jihad Islam menjalin hubungan yang erat dengan Iran yang merupakan musuh bebuyutan Israel. Kelompok gerilyawan itu juga kerap terlibat dalam sejumlah serangan ke Israel yang belakangan ini terjadi. Meski demikian, Israel selalu menyalahkan Hamas bila muncul serangan roket di wilayahnya, pasalnya, Hamas adalah fraksi yang berkuasa di Jalur Gaza. Sementara itu, kelompok Pejuang Palestina, Hamas mengecam perundingan perdamaian terbaru Palestina-Israel di Jordania, demikian laporan RIA Novosti. Hamas mencap perundingan tersebut sebagai “serangan terhadap upaya rujuk Hamas dan Fatah”. Pertemuanituyangpertamadalam16bulanperundinganperdamaian langsung Palestina dan Israel dilaksanakan Selasa di Amman, ibukota Jordania. Delegasi Palestina yang diketuai oleh anggota Fatah Saeb Erekat memberikan daftar usul tentang perbatasan dan masalah keamanan kepada Israel. Dalam perundingan itu Israel berjanji akan menanggapi usul tersebut pada pertemuan berikutnya. Namun pemimpin Hamas, Ismail Ridwan, menyampaikan penentanganterhadappertemuanitudenganmenyebutnya“sebagai serangan terhadap penyatuan Hamas dan Fatah” dan tindakan yang tidak berguna. (ant/rtr/ok)

520 Orang Tewas Dalam Banjir Di Sindh Pakistan ISLAMABAD, Pakistan (Antara/Xinhua-OANA): Sebanyak 520 orang tewas dan 1.180 lainnya terluka dalam banjir baru-baru ini yang melanda Provinsi Sindh, Pakistan Selatan sejak musim panas ini, kata seorang pejabat. DrZafarIqbalQadir.KetuaOtoritasManajemenBencanaNasional (NDMA),mengatakankepadamedialokalbahwa116.529hewanjuga tewasdanhampir1,6jutarumahpendudukrusakakibatbanjir.NDMA telahmendistribusikanpaketransumkepadalebihdari3.651.054orang, 314.294tendadan55.381selimutdikalanganorang-orangyangterkena dampak banjir, kata Qadir Rabu (4/1). Dia menambahkan bahwa total 434.785 kelambu juga telah diserahkankepadamasyarakatyangterkenadampakbanjir,sementara 10.000 minyak penolak nyamuk telah disediakan untuk menyelamatkan mereka dari demam berdarah dan penyakit gigitan nyamuk lain yang terkait. Menurut Ketua NDMA, 8.000 pendingin air, 130.765 lembaran plastik/tikar, 5.100 ember dan 34.708 unit penyaring air untuk keluarga telah didistribusikan kepada korban banjir yang melanda Sindh. Namun, masih ada 6.912 orang yang tinggal di 20 kamp bantuan yang didirikan di wilayah terkena banjir di berbagai wilayah Sindh, kata ketua. Dia menambahkan bahwa prioritas utama NDMA selama tahaprehabilitasiakanmembuatsekolah,rumahsakitdanbangunanbangunan fungsional pemerintah. Fasilitas air minum bersih juga akan dipulihkan di sana secepat mungkin, katanya.

335 Tewas Pada ‘7 Hari Maut’ Di Thailand BANGKOK, Thailand (Antara/Xinhua-OANA): Sebanyak 335 orang tewas dan 3.375 lainnya terluka dalam kecelakaan lalu lintas dalam periode 29 Desember 2011 - 4 Januari 2012, yang disebut sebagai ‘tujuh hari maut’ selama awal tahun baru. Laporan Departemen Mitigasi dan Pencegahan Bencana, Kamis (5/1), menyebutkan terjadi 3.093 kecelakaan lalu lintas di seluruh negeri selama tujuh hari itu. Meskipun demikian jumlahnya berkurang 11.55 persen atau 404 kecelakaan dari periode yang sama pada tahun sebelumnya. Korban tewas berkurang 23 jiwa dan luka-luka berkurang 375 orang, jika dibandingkan dengan periode yang sama tahun lalu. Provinsi Buri Ram di bagian timur laut Thailand merupakan provinsi dengan jumlah korban jiwa terbanyak: 18 orang. Sementara Provinsi Chiang Rai mencatat angka kecelakaan lalu lintas terbanyak dengan 115 kasus dan jumlah korban luka terbanyak dengan 121 jiwa. Mabuk merupakan penyebab utama kasus kecelakaan lalu lintas dengan persentase sebesar 37,28 persen, diikuti mengebut dengan persentase sebesar 20,63 persen. Sejumlah 2.468 titik telah ditetapkan diseluruhnegerigunameraziapengemudiyangmenjalankankendaraan dengan ceroboh dan melanggar aturan lalu lintas. Sebanyak 70.000 petugas juga dikerahkan untuk menjaga sejumlah titik tersebut.



WASPADA Jumat 6 Januari 2012

Ba Buat Lubang MU AP

BINTANG Barcelona Lionel Messi (atas) melewati hadangan pemain Osasuna David Timor di Stadion Camp Nou, Kamis (5/1) dinihari WIB.

Flu, Messi Malah Menggila MADRID ( Waspada): Sempat dikabarkan bakal absen karena menderita flu, Lionel Messi malah tampil menggila saat menghadapi Osasuna pada leg pertama babak 16 besar Copa Del Rey, Kamis (5/1) pagi WIB. Masuk menggantikan Pedro Rodriguez menit 59 ketika El Barca sudah memimpin 2-0, Messi mampu menam-

bahkan dua gol lagi untuk menutup pesta tuan rumah dengan kemenangan telak 4-0. “Messi merasa tak sehat pagi ini, dia menderita sakit perut dan demam, maka saya mengirimnya pulang,” ujar Pep Guar-diola, entrenador El Catalan. “Saya berkata padanya untuk menonton pertandingan, jika dia merasa baik dia bisa bermain. Dia menghubungi saya tiga jam sebelum laga dan berkata ingin bermain, maka

Ancelotti Tepis Kaka, Pato DUBAI (Antara/AFP): Pelatih baru Paris Saint-German (PSG) Carlo Ancelotti meredam spekulasi mengenai perekrutan bintang Real Madrid Ricardo Kaka dan penyerang AC Milan Alexandre Pato. “Pato adalah pemain Milan. Dia memiliki kontrak, karena itu kami tidak tertarik untuk merekrutnya,” tepis Ancelotti, Kamis (5/1). Mengenai Kaka, dia mengaku tidak ada kemungkinan untuk mendatangkannya saat ini. Namun mantan pelatih Milan itu tetap akan memanfaatkan bursa transfer Januari ini untuk meningkatkan performa pasukannya. “Saya tidak ingin mengomentari keahlian Pato atau Kaka yang masih terikat kontrak. Kami akan berusaha membeli beberapa pemain baru, namun jika kami ingin merekrut mereka, kedua klub itu harus bersedia menjualnya,” pungkas Ancelotti.

Hasil Rabu (Kamis WIB) Sociedad vs Mallorca Barcelona vs Osasuna

2-0 4-0

Hasil Selasa (Rabu WIB) Albacete vs Bilbao Alcorcon vs Levante Mirandes vs Santander Real Madrid vs Malaga

0-0 2-1 2-0 3-2

saya menyimpannya di bangku cadangan,” tambah Pep. Bintang Argentina itu ternyata tetap tampil prima dengan menambah keunggulan El Blaugrana menit 73. Messi kembali membuat publik Camp Nou bersukacita saat kembali merobek jala tim tamu menit 90. “Sesudah istirahat, pertandingan tak pernah mudah, tapi kami turun dengan awal yang bagus. Kami katakan Messi untuk pemanasan dan bersiap tampil. Kami punya laga luar biasa malam ini,” puji Pep. Dua gol Barca lainnya disumbangkan gelandang Spanyol Cesc Fabregas pada babak pertama. Dengan kemenangan telak ini, perjuangan pasukan Pep akan lebih mudah pada leg kedua 12 Januari di markas Osasuna. (m15/goal/espn)

LONDON (Waspada): Newcastle United membuat Manchester United mengalami kekalahan kedua berturut-turut di Liga Premier, Rabu (Kamis WIB), sehingga Manchester City memimpin sendirian dengan selisih tiga poin di puncak klasemen. Gol dari Demba Ba, Yohan Cabaye dan gol bunuh diri Phil Jones, memastikan The Magpies menang telak 3-0 atas sang juara bertahan di Sports Direct Arena. Malam Tahun Baru lalu, Setan Merah MU juga dipermalukan 1-3 oleh tamunya Blackburn Rovers di Stadion Old Trafford. Menurut manajer Newcastle Alan Pardew, Ba yang telah membuat lubang di gawang MU. Penampilan gemilang Ba serta gol pembuka kemenangan Magpies yang disarangkannya menit 33, membuat The Red Devils menjadi sulit untuk bangkit. “Di luar golnya, yang merupakan kelas dunia, keseluruhan penampilan Demba sungguh luar biasa. Dia membuat lubang, dia mundur ke belakang, dia menempatkan dirinya dalam jalur tembak dan dia agresif di udara,” puji Pardew. “Sulit untuk membandingkan dia (Ba) dengan striker lain di Liga Premier. Dia sebenarnya tidak punya cukup waktu di Inggris, tapi tahun ini Anda harus menempatkan dia dalam 4 atau 5 besar,” ujarnya lagi, seperti dilansir Goal, Kamis (5/1). Gol kedua tim tuan rumah dicetak Cabaye menit 47 dan gol ketiga terjadi menit 90 lewat

Klasemen Liga Premier Man City 20 15 3 2 56-16 Man United20 14 3 3 49-20 Tottenham 19 13 3 3 36-20 Chelsea 20 11 4 5 39-25 Arsenal 20 11 3 6 36-28 Liverpool 20 9 7 4 24-18 Newcastle 20 9 6 5 29-25 Stoke City 20 8 5 7 22-31 Norwich 20 6 7 7 30-35 Sunderland 20 6 6 8 27-23 Everton 19 7 3 9 20-22 Swansea 20 5 8 7 20-23 Aston Villa 20 5 8 7 22-26 Fulham 20 5 8 7 22-26 West Brom 20 6 4 10 19-28 Wolves 20 4 5 11 22-36 QPR 20 4 5 11 19-35 Bolton 20 5 1 14 25-43 Wigan 20 3 6 11 18-41 Blackburn 20 3 5 12 29-43

Pencetak Gol Terbanyak


BINTANG kemenangan Newcastle Demba Ba (kiri) merayakan golnya ke gawang Manchester United dengan tandemnya Shola Ameobi di Sports Direct Arena, Kamis (5/1) dinihari WIB. aksi bunuh diri Jones. Ba sementara ini telah mengoleksi 15 gol di liga, minus dua bola di bawah top skor Robin van Persie (Arsenal) “Aset terbesar dia (Ba) adalah kepribadiannya, dia seorang pemenang. Apa pun perannya saya telah memberinya kesempatan, dia selalu mencoba yang terbaik dengan kemampuannya,” sanjung Pardew. Padahal, ini musim pertama Ba bermain dengan Newcastle. Striker Senegal berusia 26 tahun itu direkrut Magpies dari Hoffenheim, setelah sempat menjalani masa peminjaman setengah musim dengan West Ham United. “Satu atau dua pemain tampil luar biasa, namun saya bangga dengan mereka semua. Tugas saya adalah memastikan kami tak larut dengan ini, karena kami

KONI Nilai KLB Hanya Buang-Buang Waktu JAKARTA (Waspada): Ketua Umum Komite Olahraga Nasional Indonesia (KONI), Tono Suratman, menilai permintaan Kongres Luar Biasa (KLB) mengganti kepengurusan PSSI di bawah kendali Djohar Arifin Husin hanya buang-buang waktu. Sebab kepengurusan otoritas sepakbola nasional yang ada saat ini, baru berjalan beberapa bulan. Karena itu, Tono meminta semua pihak menahan diri dan memberikan kepercayaan kepada KONI dan PSSI menjalankan programnya. “Ngapain harus buangbuang waktu menggelar KLB?

Saya sudah bertemu dengan beberapa teman dari pengusung KLB. Beri kami dan PSSI kesempatan untuk berbuat,” tutur Tono kepada wartawan di Kantor PSSI, Kamis (5/1). Ditambahkan, sebagai pimpinan induk organisasi olahraga nasional, dirinya akan mencari solusi menyelesaikan konflik di tubuh PSSI. Ia pun mengaku telah mendapat masukan dari sejumlah pihak, termasuk mereka yang menginginkan KLB. Seperti diketahui, KLB dilontarkan Forum Pengprov PSSI yang mengklaim mendapat dukungan 452 anggota PSSI. KLB itu harus sudah digelar pada 6 Maret mendatang di

BOPI Pecah Tanggapi Kasus Diego Michiels JAKARTA (Waspada): Badan Olahraga Profesional Indonesia (BOPI) pecah menanggapi perselisihan antara Pelita Jaya Karawang dan mantan pemainnya Diego Michiels, yang mengajukan pengunduran diri secara mendadak. Menariknya, suara berbeda dari badan yang semula memberikan rekomendasi bergulirnya Indonesian Super League (ISL), kompetisi yang diikuti Pelita Jaya, terjadi di tingkat atas. Petinggi badan yang dibentuk Kementerian Pemuda dan Olahraga (Kemenpora) itu beda persepsi, setelah Manajer Pelita Jaya Lalu Mara Satriawangsa mengadukan kasus pemain Timnas U-23 tersebut. Ketua Umum BOPI Gordot Mogot, menyampaikan kepada utusan Pelita Jaya bahwa mereka salah alamat mengadukan kasusnya ke BOPI, karena klub itu bukan sebagai klub profesional. Sebaliknya Ketua Harian BOPI Hario Yuniarto, membuka pintu dan berjanji akan berupaya membantu Pelita Jaya mengatasi masalahnya. “Jika Pelita Jaya bermain di bawah kompetisi profesional sepakbola, bisa kami sidangkan di sini kasusnya. Tapi karena ini semi profesional, maka kami tidak bisa,” dalih Gordon di Kantor BOPI, Jakarta, Kamis (5/1). Sedangkan Hario dengan tegas memastikan, pihaknya segera membahas masalah yang tengah dihadapi Pelita Jaya dengan Diego. Menurutnya, BOPI akan memanggil Diego untuk menanyakan persoalan tersebut. “Satu atau dua hari ke depan, kami akan pelajari masalah ini. Kami akan sampaikan hasilnya nanti. Kami juga akan memanggil Diego sendiri untuk menanyakan perihal terjadinya pemutusan kontrak sepihak dengan Pelita Jaya,” tutur Hario. Mengenai adanya perpecahan, Hario langsung membantahnya. Dia berdalih, pertemuannya dengan Lalu Mara atas izin Gordon selaku atasannya. “Ini jangan diartikan BOPI berbeda pendapat soal masalah Pelita Jaya dengan Diego. Untuk pertemuan dengan Pak Lalu Mara, saya juga telah meminta izin kepada Pak Gordon,” pungkas Hario. (yuslan)

Pelita Jaya Kontrak Diego Sampai 31 Januari 2014 JAKARTA (Waspada): Pelita Jaya mengklaim, bek Timnas U-23 Diego Michiels, tetap sebagai pemain mereka karena ikatan kontraknya masih sangat panjang. “Kontrak Diego sampai 31 Januari 2014. Hingga saat ini, Diego masih sah sebagai pemain kami,” klaim Manajer Pelita Jaya Lalu Mara Satriawangsa lewat rilisnya, Kamis (5/1). Lalu Mara pun membeberkan isi dari pasal 11 kontrak kerja yang telah disepakati Diego dan Pelita. Bunyinya adalah ‘Perjanjian ini hanya dapat diakhiri karena berakhir sesuai dengan jangka waktu perjanjian atau karena diakhiri berdasarkan kesepakatan tertulis para pihak dan kesepakatan tertulis tersebut ditembuskan atau diketahui pihak LIGA’. Diego secara mengejutkan mundur dari Pelita dan selanjutnya gabung Persija Jakarta yang berlaga di Indonesian Premier League (IPL). (vvn)

Jawa Timur. Untuk mengawal dan merilis KLB, forum itu juga membentuk Komite Penyelamat Sepakbola Indonesia (KPSI) dipimpin Tony Apriliani, anggota Komite Eksekutif (Exco) PSSI yang dipecat karena melanggar etika organisasi. Tono Suratman didampingi Ketua Umum PSSI Djohar Arifin Husin dan Sekjen Tri Goestoro, menilai usulan KLB tidak lebih dari masukan yang harus kembali dipelajari. Meski begitu, dirinya tidak sepakat sekiranya perselisihan antar-pengurus PSSI harus diselesaikan lewat KLB. “KONI akan memediasi agar semua bisa berjalan dengan baik, tapi kami butuh waktu. Karena itu, beri kami kesempatan untuk melakukan sesuatu. Kami menjamin keputusan nantinya tak akan merugikan pihak manapun selama sama-sama mau bekerja sama,” tandas Tono. Terkait upaya KONI melakukan mediasi, Djohar menga-

Waspada/Yuslan Kisra

KETUA KONI Pusat Tono Suratman (tengah) didampingi Ketua Umum PSSI Djohar Arifin Husin dan Sekjen Tri Goestoro memberikan keterangan pers di Kantor PSSI, Senayan, Jakarta, Kamis (5/1). takan sampai saat ini pihaknya masih membuka pintu bagi pengurus maupun klub yang bermain di kompetisi Indonesian Super League (ISL) untuk kembali ke rumah.

48 45 42 37 36 34 33 29 25 24 24 23 23 23 22 17 17 16 15 14

“Sampai saat ini, kami masih buka pintu bagi siapapun. Kami harap semua bisa kembali ke rumah (PSSI-red). Pintu selalu terbuka,” tegas Djohar. (yuslan)

memilikilagapentingselanjutnya pada akhir pekan di Piala FA menghadapi Blacburn,” papar Pardew. Manajer MU Sir Alex Ferguson juga mengaku, gol Ba serta Cabaye telah melumpuhkan pasukannya. Namun pelatih berumur 70 tahun itu menolak

untuk menyerah dalam upaya mempertahankan gelar juara. “Cerita pertandingan itu adalah mereka melesakkan dua gol fantastis yang membuat mereka memegang kendali dan mereka tidak akan melepasnya,” beber Sir Fergie. “Kami tidak biasanya me-

17 15 14 13 12 10

Robin van Persie (Arsenal) Demba Ba (Newcastle) Sergio Aguero (Man City) Wayne Rooney (MU) A. Yakubu (Blackburn) Edin Dzeko (Man City)

ngalami kekalahan beruntun seperti ini, tetapi poin plusnya adalah sejumlah pemain kami sudah kembali tampil. Ini bukan waktunya untuk panik, kami memiliki pengalaman untuk mengatasi situasi seperti ini,” katanya menambahkan. (m15/goal/afp/rtr)

Alasan Kiper Howard Tak Rayakan Golnya LONDON (Waspada): Kiper Everton Tim Howard (foto), mengungkapkan alasan dirinya tidak merayakan gol sensasionalnya ke gawang Bolton Wanderers saat klubnya kalah 1-2 pada matchday 20 Liga Premier. Ternyata, Howard tidak mau menambah derita kiper Bolton Adam Bogdan. “Saya langsung berbicara kepadanya saat itu dan memberitahunya bahwa saya merasakan apa yang dia rasakan. Itu bukan tempat yang baik baginya,” ujar Howard dalam Sky Sports, Kamis (5/1). Gol Howard ke gawang The Trotters di Goodison Park, Liverpool, Rabu (Kamis WIB), dia bukukan dari jarak 102 meter. “Saya pernah merasakan itu, beberapa waktu lalu. Itulah mengapa saya tidak merayakannya,” papar penjaga gawang Amerika Serikat tersebut. Dengan gol sensasional Howard itu menit 63, tuan rumah The Toffees sempat memimpin lebih dahulu. Namun hanya berselang tiga menit, Bolton mampu menyamakan kedudukan lewat gol David N’gog kemudian memastikan kemenangan melalui Gary Cahill menit 78. Hasil Rabu (Kamis WIB) “Saya sangat seEverton vs Bolton 1-2 nang bahNewcastle vs MU 3-0 wa kami Hasil Selasa (Rabu WIB) m e m i m pin dan berMan City vs Liverpool 3-0 harap bisa Tottenham vs West Brom 1-0 mendapatWigan vs Sunderland 1-4 kan tiga Hasil Senin (Selasa WIB) p o i n . Tapi itu Fulham vs Arsenal 2-1 bukanAston Villa vs Swansea 0-2 lah peBlackburn vs Stoke 1-2 rasaan QPR vs Norwich City 1-2 yang baik Wolves vs Chelsea 1-2 untuk pen-

jaga gawang, itu benar-benar mengerikan,” beber Howard. Mantan kiper Manchester United itu kini tercatat sebagai penjaga gawang keempat yang mampu mencetak gol lewat open play sepanjang sejarah Liga Premier. Sebelumnya Peter Schmeichel, Brad Friedel dan Paul Robinson, telah melakukan hal yang sama. “Untuk keempat bek dan kiper (Bolton), ada angin berputar yang mengerikan. Anda bisa melihat semua orang salah memperhitungkan waktu. Bek salah membuang bola yang biasa mereka lakukan di lapangan,” kata Howard. “Saya rasa angin adalah kondisi tersulit untuk bermain. Salju, hujan, dan matahari tak masalah, namun angin benar-benar memainkan trik untuk Anda,” tambah kiper berumur 32 tahun tersebut. (m15/vvn/sky)



WASPADA Jumat 6 Januari 2012

A11 Gol Zulkarnain Untuk Novi MEDAN (Waspada): Sebuah gol dari Zulkarnain (foto) di menit 55 menjadi momentum kebangkitan PSMS Medan saat tertinggal dua gol dari Pelita Jaya dalam lanjutan Indonesian Super League (ISL) di Stadion Singaperbangsa, Karawang, Kamis (5/1) malam. Gol yang mengubah kedudukan menjadi 2-1 tersebut dipersembahkan Zulkarnain bagi rekannya yang juga palang pintu Ayam Kinantan, Novi Handriawan. Pasalnya, Novi merayakan hari jadinya ke-26, sehari sebelum pertandingan. “Gol yang saya ciptakan adalah hadiah kado ulang tahun bagi Novi,” ucap Zulkarnain sesaat setelah pertandingan berakhir. Ditambahkan, gol tersebut juga dipersembahkan bagi seluruh pendukung Ayam Kinantan yang tak pernah berhenti memberi dukungan dan doa. Sementara itu, hasil seri yang dipetik PSMS juga bermakna ganda bagi pelatih Raja Isa. Hasil ini dikatakan pelatih asal Malaysia itu juga sebagai kado ulang tahun putrinya ke-11 yang jatuh pada 11 Januari mendatang. “Hasil seri ini cukup bermakna bagi saya. Selain sebagai pembuktian bahwa Medan mampu berbuat di kancah sepakbola nasional, hasil ini juga saya hadiahkan untuk kado putri saya yang berulangtahun ke-11 nanti,” papar mantan pelatih Persiram Raja Ampat dan Persipura Jayapura tersebut. (m17)

Waspada/Austin Antariksa

Satu Poin Penyuntik Motivasi PSAP Tahan Persib 1-1 Waspada/Austin Antariksa

SEMANGAT pantang menyerah dari In Kyun Oh (7) dan kawan-kawan sukses membawa PSMS Medan mencuri poin dari Pelita Jaya dalam lanjutan ISL di Stadion Singaperbangsa, Karawang, Kamis (5/1) malam.

PSMS Pantang Menyerah Imbangi Pelita Jaya 2-2 KARAWANG (Waspada): Sempat tertinggal dua gol, PSMS Medan berhasil mengejar ketertinggalan dan mencuri poin hasil bermain imbang 2-2 saat dijamu Pelita Jaya dalam lanjutan Indonesian Super League (ISL) di Stadion Singaperbangsa, Karawang, Kamis (5/1). Turun dengan formasi 4-23-1 di mana lini belakang mengandalkan kuartet Rahmad, Sasa Zecevic, Novi Handriawan dan Wawan Widiantoro, PSMS langsung dikejutkan gol cepat Safee Sali di menit pertama. Tertinggal, tim tamu mencoba bangkit lewat usaha Osas Saha di menit ketiga. Sayang,

tendangan striker asal Nigeria itu masih melenceng dari gawang I Made Wardana. Peluang PSMS kembali hadir di menit 18 lewat tendangan keras Choi Dong Soo yang masih melebar. Usaha Choi selanjutnya yang memanfaatkan umpan terobosan Inkyun Oh pun masih mampu diselamatkan kiper

lawan. Hujan deras yang turun sepanjang babak pertama juga membuat permainan mononton memanfaatkan bola-bola panjang. Di babak kedua, kejadian serupa di awal babak pertama terulang lagi. Semenit 45 menit kedua berjalan, skor berubah menjadi 2-0. Kali ini, giliran Alekasandar Bajevski menaklukkan Markus sekaligus menggandakan keunggulan tuan rumah. Unggul dua gol praktis membuat Pelita Jaya mengubah pola dengan lebih banyak bertahan. Kondisi ini berhasil dimanfaatkan PSMS dengan balik menekan dan menerapkan pressure ketat. Gol yang diharap-

Jawara Olimpiade Tersisih SEOUL (Waspada): Markis Kido/Hendra Setiawan (foto) gagal melanjutkan langkah mereka di Korea Terbuka Premier Super Series 2012, Kamis (5/1). Juara Olimpiade 2008 itu tersingkir di 16 Besar kala menghadapi pasangan Jerman, Michael Fuchs/Oliver Roth. Kido/Hendra menyerah 17-21, 19-21. Kekalahan dari duet peraih medali emas Asian Games 2010 ini melengkapi kegagalan ganda putra menyi-

sakan wakilnya setelah Alvent Chandra/Hendra A Gunawan juga kandas di tangan wakil tuan rumah, Lee Yong Dae/Jung Jae Sung, 21-16,21-19, 21-13. Di ganda putri, Meiliana Jauhari/Greysia Polii sukses maju ke babak delapan besar. Unggulan kedelapan ini mengalahkan Line Damkjaer Kruse/Marie Roepke (Denmark) 21-10, 21-14. Dengan begitu, Meiliana/ Greysia akan menghadapi ujian lebih berat karena bertemu


Problem Catur


Hitam melangkah, mematikan lawannya dua langkah.

Jawaban di halaman A2 8







1 A





unggulan pertama Shu Cheng/ Pan Pan (China) atau unggulan keempat asal Korsel, Jung Eun Ha/Ming Jung Kim. Ganda putri lainnya, Vita Marissa/Nadya Melati, akhirnya tersingkir. Pasangan peringkat 12 dunia itu dikalahkan Jung Kyung Eun/Kim Ha Na (Korsel), peringkat 11 dunia, dengan tiga set 21-16, 19-21, 9-21. Di pertandingan lainnya, Tantowi Ahmad/Liliyana Natsir juga berhasil menjaga peluang merebut gelar di nomor ganda campuran. Melawan Noriyasu Hirata/Miyuki Maeda asal Jepang, Tantowi/Liliyana menang 21-14, 21-12. Selanjutnya, ganda campuran terbaik Indonesia itu akan menghadapi Lee Yong Dae/Ha Jung Eun. Ganda asal Negeri Ginseng ini menyingkirkan Shintaro Ikeda/Reiko Shiota (Jepang) 21-15, 21-15. Wakil Indonesia ketiga yang lolos bertahan adalah Simon Santoso (tunggal putra). Unggulan kedelapan itu sukses membalas kekalahan Taufik Hidayat dari Rajiv Ouseph (Inggris) berkat kemenangan 21-18, 21-13. (m33/ant)




kan skuad Raja Isa pun hadir di menit 55. Kejelian Zulkarnain melepaskan tendangan jarak jauh berhasil memperkecil ketertinggalan sekaligus menjadi momentum kebangkitan Ayam Kinantan. Permainan cepat dikombinasi pressure ketat membuat anak-anak Pelita Jaya frustrasi menembus pertahanan Sasa cs. Keberhasilan PSMS mencuri poin juga hasil kejelian Raja Isa menarik Saha di menit 61 dengan memasukkan Arie Supriatna. Selang semenit Arie menginjakkan kaki di lapangan, pemain bernomor 21 tersebut menyelamatkan timnya dari kekalahan. Sayang, aksi kepahlawanan Arie berakhir di menit 78 setelah menerima kartu kuning kedua.

Hasil Kamis (5/1) Pelita Jaya vs PSMS Persib vs PSAP Persipura vs Persidafon Persiwa vs Deltras

2-2 1-1 3-1 2-1

BANDA ACEH (Waspada): Setelah melakoni dua laga kandang tanpa poin, PSAP Sigli akhirnya memperoleh poin perdana pada partai ketiga dalam lanjutan Indonesian Super League (ISL) 2011/2012. Laskar Aneuk Nanggroe sukses menahan imbang Persib Bandung 1-1. Tampil di Stadion Si Jalak Harupat, Bandung, Kamis (5/1), PSAP yang mendapat promosi gratis itu sukses menahan Maung Bandung tanpa gol sepanjang babak pertama. Jala PSAP yang dikawal Fahrurrazi akhirnya jebol pada menit 51. Berawal dari tendangan pojok, bola berhasil membentur tiang gawang PSAP. Di sini, Fahrurrzai tak mampu menghalau bola liar tersebut hingga Maman Abdurrahman berhasil memanfaatkan bola tersebut hingga tercipta gol. Kedudukan 1-0 bagi keunggulan Persib. Setelah tertinggal, PSAP meningkatkan tensi serangannya. Masuknya Sayuti menggantikan

Ferry Komul membuat serangan PSAP lebih hidup. Tenaga baru dari Sayuti juga mampu menjaga motivasi rekan-rekannya. Alhasil, Wook Jin You berhasil menyamakan kedudukan pada menit 76. Ia berhasil merebut bola di dekat kotak terlarang. Bek PSAP itu langsung menendang bola menyusur datar ke arah pojok kanan gawang Jendry Pitoy yang telah salah langkah. Kepada Waspada, Pelatih PSAP Arman menyatakan satu poin di Bandung sangat berarti bagi skuadnya dalam melakoni laga selanjutnya. “Meski mereka punya nama besar, anak-anak optimis dan berhasil mencuri poin,” katanya. Menurut Arman, hasil satu poin di partai luar kandang ini akan terus memotivasi M Ali cs dalam menghadapi partai lanjutan. “Kami berharap rasa percaya diri anak-anak akan lebih meningkat lagi,” ujar Arman. (b07)

Usai pertandingan, Raja Isa dan jajaran manajemen menyambut keberhasilan pemainnya mencuri poin atas Pelita Jaya. Dalam temu pers, Raja Isa mengatakan hasil seri tersebut berkat kerja keras tim. “Keberhasilan mencuri poin di kandang Pelita Jaya yang bermaterikan pemain bintang berkat kerja keras semua elemen tim serta dukungan masyarakat Medan. Beruntung saat tertinggal dua gol, kami bisa memanfaatkan kelengahan tuan rumah yang over confidence,” ucap Raja Isa. (m17/m33)

Arema Pecat Wolfgang Pikal MALANG (Waspada): Gagal meraih kemenangan dari empat laga perdana,Wolfgang Pikal kehilangan jabatannya sebagai pelatih Arema Indonesia versi Indonesian Super League (ISL). Pemecatan mantan asisten pelatih timnas di era Alfred Riedl itu disampaikan manajer tim Arema, Sunavip Ra Indrata, Kamis (5/1). “Secara resmi kontrak pelatih Pikal sudah diputus. Kita akan memenuhi pembayaran kontraknya,” terang Indra dalam jumpa pers. Menurut Indra, satu poin yang diraih Arema dari empat laga menunjukkan kegagalan Pikal dalam menangani Singo Edan. Pemecatan ini memang mendadak. Karena itu, Arema belum memiliki calon pelatih baru hingga saat ini. Pikal tak menyangkal kegagalannya bersama Arema dan tak akan mempermasalahkan jika memang manajemen memecatnya. Namun ia menegaskan klub harus membayar sisa kontraknya. “Saya tidak akan lari dari tantangan. Tapi kalau dipecat, kontrak harus dibayar penuh selama semusim,” katanya. (m33/ini)


PENYERANG Persib Moses Sakyi (10) ditahan bek PSAP Arifin Gununi (5) pada laga Indonesia Super League (ISL) di Stadion Jalak Harupat, Soreang Kabupaten Bandung, Jawa Barat, Kamis (5/1).

PSSB Tekad Tekuk Pro Duta BANDA ACEH (Waspada): PSSB Bireuen bertekad mematok poin penuh ketika menjamu Pro Duta FC dalam lanjutan kompetisi Divisi Utama di Stadion H Dimurthala, Banda Aceh, Jumat (6/1). Pelatih PSSB, Bachtiar Djuli, menyebutkan skuadnya sudah siap melakoni partai kedua di grup I Divisi Utama PSSI musim 20112012. “Target kita poin penuh, apalagi kita bermain di kandang,” ujarnya kepada Waspada, Kamis (5/1). Musim ini, Laskar Bate Kureng diperkuat pemain belia Aceh berusia rata-rata 19 tahun yang 3,5 tahun ditempa di Paraguay. Pada laga perdana (18/12) lalu, PSSB ditahan PSBL Langsa. Pro Duta FC yang dibesut Roberto Bianchi sangat optimis mampu mencuri poin di Bireuen. Seperti dikutip dari situs klub, optimisme itu tak terlepas dari hasil positif selama melakukan ujicoba baik di Medan maupun Jakarta. (b07/cb02)


Sudoku Mendatar

1. Sebutan populer untuk pertengahan bulan setelah Rajab (dua kata, tulis tanpa spasi), disunatkan menambah amal ibadah karena Allah turun pada malam itu (dari HR Ibnu Majah). 7. Juru dakwah. 8. Nama di belakang MZ, da’i sejuta umat yang meninggal Juli 2011. 10.Merasa kurang senang melihat kelebihan orang lain; Cemburu. 11. Bulan Hijriah saat ini, yang dianggap sejumlah orang sebagai bulan malapetaka. 13.Bantuan; Pertolongan; ____ Allah artinya bantuan Allah. 14.Al-_______, surat ke 45 Al Quran, menyatakan bahwa semua manusia berlutut di hadapan Allah pada hari peradilan. 16.Orang yang beriman; Al- ____ Surat ke-40 Al Quran. 18.Salah satu ketentuan hukum syari’at = ja’iz, boleh pilih. 19.Ucapan “bismillah”, kependekan dari Bismillahir-rahmanir-rahim. 22.Huruf ketiga dalam abjad Arab. 24.Malapetaka. 25.Ilmu ghaib untuk berbuat jahat. 26.Sperma. 27.Epilepsi atau sawan, penyakit yang akan membawa penderitanya ke surga jika

bersabar (HR Bukhari). 28.Patuh.


1. Kaul; Janji akan melakukan sesuatu jika terpenuhi suatu hal. 2. Penyekutuan Allah dengan yang lain. 3. Penyiksaan, hukum siksa. 4. Keturunan; Dinasti. 5. Anjuran (petunjuk, peringatan, teguran) yang baik. 6. Mengelilingi Ka’bah sebanyah tujuh kali. 9. Tidak bicara; ___ itu emas. 12.Orang yang mahir; Orang yang termasuk dalam suatu kaum; ___bait. 14.Hari ke masjid mendengarkan khutbah dan shalat. 15.Nama suatu kabilah Arab yang tinggal di Yaman sekarang, kisah kaumnya disebut dalam QS ke-33. 16.Manfaat, faedah, kebaikan, kegunaan. 17.Makhluk ghaib diciptakan dari cahaya, mempunyai sayap. 20.Kepercayaan dasar; Keyakinan pokok, berasal dari kata ‘aqada. 21.Orang yang selalu mematuhi dan melaksanakan segala perintah Allah. 23.Huruf ke-18 abjad Arab.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat sulit (****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.


1 7 2

5 6 4 8

8 2 1 7


6 4 5 2 4


7 3 9 4

8 1 6 *****13

Sport A12 Nowitzki Tembus Angka 1000 DALLAS, AS (Waspada): Dirk Nowitzki berhasil mencetak 20 angka dalam pertandingan ke-1000 yang dilakoninya selama berkiprah di pentas NBA untuk mengantarkan juara bertahan Dallas Mavericks menang 98-89 atas Phoenix Suns, Kamis (5/1). Akibat prestasi tersebut, Nowitzki tercatat sebagai pemain ke-98 di NBA yang sanggup menembus 1000 laga. Selain itu, pertandingan di American Airlines Center itu juga menjadi partai ke-975 di mana pebasket Jerman itu sebagai starter. Power forward berusia 33 tahun itu sudah 13 tahun malang-melintang di NBA dan kariernya hanya dihabiskan di Mavericks, sehingga tak heran Nowitzki juga pemegang berbagai rekor bagi Dallas, termasuk poin terbanyak.


WAJAH Dirk Nowitzki terlihat di layar raksasa American Airlines Center ketika sukses melakoni 1,000 game di pentas NBA, Kamis (5/1). Selain Nowitzki, pemain lain yang tampil apik adalah Jason Terry yang menyumbang 18 poin dan Lamar Odom yang ikut mengemas 15 angka. Dari kubu Suns, Marcion Gortat

menjadi top skor dengan 22 angka dan 15 poin 12 assist disumbangkan guard andalan Suns, Steve Nash. Dengan kemenangan turut ini, juara bertahan Mavericks mencatat rekor 3-4 dan masih

berada di posisi sembilan Wilayah Barat. Suns sendiri berada dua tingkat di bawahnya atau posisi 11 dengan rekor 2-4. Di Auburn Hills, Chicago Bulls membukukan lima kemenangan beruntun kala mem-

bungkam tuan rumah Detroit Pistons 99-83. Kendati bermain di kandang lawan, kualitas Bulls masih jauh di atas Pistons. Kemenangan ini membuat catatan rekor Bulls menjadi 61 dan mantap memimpin klasemen Divisi Tengah. Sebaliknya, Pistons terpuruk sebagai juru kunci dengan rekor 2-4. Top skor Bulls adalah Charles Boozer yang mencatat 19 angka disusul Derrick Rose yang menoreh 17 poin 10 assist. Di Miami, absennya Dwayne Wade tidak berpengaruh bagi tuan rumah Heat. Pasalnya, tuan rumah tetap menang telak 118-83 atas Indiana Pacers berkat 33 poin 13 assist dari LeBron James. Dalam laga ini, Wade absen karena menderita robek kaki kiri saat menghadapi Charlote Bobcats. Hasil lainnya, Orlando Magic vs Washington Wizards 103-85, Toronto Raptors vs Cleveland Cavaliers 92-77, Charlotte Bobcats vs NY Knicks 118-110, Memphis Grizzlies vs Minnesota T’wolves 90-86, Philadelphia 76ers vs New Orleans Hornets 101-93, San Antonio Spurs vs GS Warriors 101-95, Denver Nuggets vs Sacramento Kings 110-83, LA Clippers vs Houston Rockets 117-89, Boston Celtics vs New Jersey Nets 89-70. (m33/ap)

WASPADA Jumat 6 Januari 2012

Schiavone Jadi Unggulan Teratas BRISBANE, Australia (Waspada): Petenis Italia Francesca Schiavone sukses melewati hadangan Jelena Jankovic (Serbia) untuk meraih tiket semifinal Brisbane International, Kamis (5/1). Di semifinal, unggulan ketiga itu akan menantang Kaia Kanepi (Estonia). Berkat kemenangan Kanepi atas Andrea Petkovic (Jerman) yang notabene unggulan kedua, Schiavone pun menjadi unggulan teratas yang tersisa. Selain Schiavone, unggulan lainnya adalah petenis Belgia Kim Clijsters (5). Melawan Jankovic, jawara Prancis Terbuka 2010 itu dipaksa memeras keringat lebih banyak sebelum menang 5-7, 7-6 (2), 6-3. Sementara itu, Kanepi tampil gemilang untuk mencatat kemenangan straight set atas Petkovic 6-1, 9-7. Semifinal lainnya mempertemukan Clijsters dengan Daniela Hantuchova (Slovakia). Bila Clijsters menumbangkan Iveta Benesova (Rep Ceko) 6-3, 6-2, maka Hantuchova menang tanpa bertanding menyusul mundurnya Serena Williams akibat cedera. Di tunggal putra, unggulan kedua Gilles Simon (Prancis) memastikan satu tempat di semifinal setelah mengalahkan Santiago Giraldo (Kolombia) 7-6 (2), 6-4. Petenis yang berpeluang menghadang kans juara

Simon adalah Andy Murray (Skotlandia). Piala Hopman Dari Perth, Tim Prancis berhasil melaju ke final Piala Hopman 2012. Hasil itu didapat setelah mengandaskan Spanyol 2-0 di laga pamungkas Grup B. FinalisWimbledon 2007, Marion Bartoli, membawa Prancis unggul 1-0 dengan menundukkan Anabel Medina Garrigues 6-1, 6-2. Richard Gasquet memastikan Prancis menjuarai grup de-

ngan mengalahkan Fernando Verdasco. Dalam waktu 78 menit, Gasquet memenangi pertarungan 6-2, 6-4. Ini adalah pertama kali bagi Prancis mencapai final kompetisi tim campuran internasional itu sejak 1998. Namun, Mary Pierce dan Cedric Pioline kalah dari Slovakia. Lawan Prancis akan ditentukan Jumat (6/1) ini antara Republik Ceko yang diperkuat Petra Kvitova dan Tomas Berdych dengan Denmark yang mengandalkan Caroline Wozniacki dan Frederik Nielsen. (m33/ap)


PENUNDAAN KEWAJIBAN PEMBAYARAN UTANG SEMENTARA P.T. GANDA SARIBU UTAMA (DALAM PKPUS), SEKALIGUS UNDANGAN RAPAT KREDITUR Dengan ini diumumkan bahwa : Majelis Hakim Pengadilan Niaga pada Pengadilan Negeri Medan telah memeriksa perkara Permohonan Penundaan Kewajiban Pembayaran Utang (“PKPU”) terhadap PT. GANDA SARIBU UTAMA beralamat di Jl. Raya Medan-Binjai Km 12,5, Kelurahan Puji Mulyo, Kec. Sunggal, Deli Serdang, Sumatera Utara (“Termohon PKPU/Debitor”) yang diajukan oleh PT. BANK PERMATA Tbk selaku Pemohon PKPU/Kreditor, dalam hal ini memilih domisili hukum di kantor kuasa hukumnya pada kantor Ricardo Simanjuntak & Partners beralamat di Gedung Wirausaha Lt. 2, Jl. H.R. Rasuna Said, Kav. 5C Kuningan, Jakarta Selatan. Majelis Hakim tersebut telah memutus dalam Putusan No. 15/PKPU/2011/PN.NIAGA.MEDAN, yang diucapkan dalam sidang terbuka untuk umum pada Senin, 2 Januari 2011 dengan amar Putusan berbunyi sebagai berikut : 1. Mengabulkan permohonan Pemohon PKPU; 2. Memberikan Penundaan Sementara Kewajiban Pembayaran Utang kepada Pemohon PKPU untuk waktu selama 45 (empat puluh lima) hari terhitung sejak tanggal 2 Januari 2012; 3. Menunjuk Sdr. SUHARTANTO, SH, MH, Hakim Niaga pada Pengadilan Niaga/Negeri Medan sebagai HAKIM PENGAWAS 4. Mengangkat Sdr. DENI PURBA, SH, LL.M beralamat di Jl. Setia Budi Bisnis Point, Blok BB No. 7, Medan, dan Sdr. WILLING LEARNED, SH, beralamat pada Law Firm WILLING LEARNED & PARTNERS, Jl. Madrasah Komplek Taman Gandaria Kav. 8, Cipete, Jakarta Selatan, sebagai PENGURUS yang bersama-sama dengan Debitor mengurus harta debitor; 5. Menetapkan hari persidangan berikutnya pada hari: Kamis tanggal 16 Februari 2012 pukul 09.00 WIB, bertempat di ruang sidang Pengadilan Niaga pada Pengadilan Negeri Medan, Jalan Pengadilan No. 8, Medan; 6. Memerintahkan Pengurus untuk memanggil debitor dan para kreditor yang dikenal melalui surat tercatat atau melalui kurir untuk menghadap dalam persidangan yang telah ditetapkan pada angka 5 di atas; 7. Menangguhkan penentuan besarnya biaya pengurusan harta debitor termasuk imbalan jasa bagi Pengurus sampai berakhirnya tugas kepengurusan yang dilakukan oleh Pengurus; 8. Menangguhkan putusan mengenai ongkos perkara sampai dengan berakhirnya Penundaan Kewajiban Pembayaran Utang; Berdasarkan Putusan tersebut di atas dan dengan memperhatikan ketentuan Pasal 225 ayat (4) jo Pasal 226 UU No. 37 tahun 2004 tentang Kepailitan dan PKPU serta merujuk kepada Penetapan Hakim Pengawas No. 01/HP/15/PKPU/2011/PN.NIAGA MEDAN, tertanggal 5 Januari 2012, maka dengan ini kami mengundang Para Kreditor dan Debitor PT. Ganda Saribu Utama (dalam PKPU Sementara) serta pihak-pihak yang berkepentingan untuk : 1. Menghadiri Rapat Kreditur Pertama yang akan diselenggarakan pada Senin, 16 Januari 2012, pukul 09.00 WIB; 2. Menghadiri Rapat Verifikasi/Pencocokan Piutang yang akan diselenggarakan pada Senin, 30 Januari 2012, pukul 09.00 WIB ; 3. Menghadiri Pembahasan Rencana Perdamaian (Pengumuman Suara/Voting) yang akan diselenggarakan pada Senin, 6 Februari 2012, pukul 09.00 WIB; 4. Menghadiri Sidang Permusyawaratan Majelis Hakim yang akan diselenggarakan pada Kamis, 16 Februari 2012, pukul 09.0 0 WIB; Yang keseluruhan rapat-rapat tersebut pada butir 1,2,3,4 dan 5 di atas akan dilaksanakan di : Pengadilan Niaga pada Pengadilan Negeri Medan, Jl. Pengadilan No. 8, Medan 5. Para Kreditor dimohon untuk menyampaikan tagihan-tagihannya dengan disertai dokumendokumen yang cukup (menunjukkan asli) dengan map merah selambat-lambatnya Rabu, 25 Januari 2012, pukul 15.00 WIB kepada Pengurus di :

Kantor Kurator dan Pengurus Deni Purba, SH, LL.M Setia Budi Bisnis Point Blok BB No. 7, Jl. Setia Budi, Medan Telp. 061-8226187, Fax. 061-8214795, email: email: Pengumuman ini berlaku pula sebagai panggilan/undangan bagi debitur, para kreditur dan pihak lain yang berkepentingan. Medan, 6 Januari 2012

Pengurus P.T. Ganda Saribu Utama (dalam PKPU Sementara) dto


Deni Purba, SH, LL.M

Willing Learned, SH

R A L AT Pengumuman Lelang No. PMN-LK/01/I/2012 yang diterbitkan di Harian Waspada hari Kamis tanggal 05 Januari 2012 pada halaman A12 Rekening KPKNL Medan Tertulis : Seharusnya : Demikian ralat ini kami sampaikan untuk diketahui. Perbaungan, 06 Januari 2012 PT. Pamina Adolina Dalam Likuidasi MAHYUZAR MAIMUN Likuidator


PERUSAHAAN DAERAH AIR MINUM TIRTANADI JL. SM. RAJA NO. 1 * TELEPON (061) 4571666 * FACSIMILE (061) 4572771 * E-Mail : * PO.BOX 1273 Medan 20212

PENGUMUMAN PELELANGAN UMUM NOMOR : 01/PENG–PU/PT–PDAM/I/2012 I. U M U M Perusahaan Daerah Air Minum Tirtanadi Provinsi. Sumatera Utara akan mengadakan Pelelangan Umum dengan Pasca Kualifikasi bagi Penyedia Barang / Jasa dengan Penjelasan sebagai berikut : NO








831.875.0 0 0,-








II. SYARAT PENDAFTARAN : 1. Menyerahkan Photo Copy SIUP, TDP, SKITU, dan SBU sesuai dengan Sub Bidangnya yang masih berlaku dengan menunjukkan Aslinya. 2. Bagi Penyedia Barang/Jasa yang diwakilkan Pendaftarannya harus dilengkapi Surat K u a s a Pimpinan Perusahan yang dibubuhi materai Rp. 6.000.- dan cap Perusahaan. 3. Menandatangani Pakta Integritas oleh Pimpinan Perusahaan yang namanya yang tercantum dalam Akte Pendirian Perusahaan atau Perubahannya, dan cap Perusahaan. III. PENDAFTARAN & Hari / tanggal Waktu Tempat Pendaftaran

PENGAMBILAN DOKUMEN PELELANGAN/ KUALIFIKASI : SENIN, 09 JANUARI 2012 s/d RABU, 18 JANUARI 2012 : 10.00 s/d 14.00 Wib : Sekretariat Panitia Pelelangan PDAMTirtanadi Provinsi Sumatera Utara Jln. S.M. Raja No. 1 Medan 20212

IV. LAIN – LAIN 1. Dapat dilihat di website : 2. Papan Pengumuman di Kantor Pusat PDAM Tirtanadi Provinsi Sumatera Utara Jln. S.M. Raja No. 1 Medan 2012 3. Keterangan lebih lanjut dapat berhubungan langsung ke Sekretariat Panitia Pelelangan PDAM Tirtanadi Provinsi Sumatera Utara. MEDAN, 06 JANUARI 2012


Sumatera Utara

WASPADA Jumat 6 Januari 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:32 12:46 12:33 12:40 12:40 12:37 12:33 12:29 12:36 12:35

‘Ashar 15:56 16:08 15:57 16:03 16:03 16:01 15:57 15:53 15:59 15:58

Magrib 18:31 18:41 18:31 18:36 18:36 18:39 18:32 18:28 18:34 18:32



Shubuh Syuruq


19:44 19:55 19:45 19:50 19:50 19:52 19:46 19:42 19:48 19:46

05:02 05:19 05:03 05:13 04:11 05:02 05:02 04:58 05:05 04:06

05:12 05:29 05:13 05:23 05:21 05:12 05:12 05:08 05:15 05:16

L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan12:30 P. Siantar 12:31 Balige 12:31 R. Prapat 12:28 Sabang 12:46 Pandan 12:32

06:33 06:49 06:33 06:43 06:42 06:33 06:32 06:28 06:35 06:37

Zhuhur ‘Ashar 16:01 15:55 15:54 16:06 15:55 15:55 15:55 15:52 16:08 15:57





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:34 18:30 18:29 18:40 18:32 18:30 18:31 18:28 18:40 18:33

19:48 19:44 19:43 19:54 19:46 19:44 19:45 19:42 19:54 19:47

05:11 05:01 05:01 05:13 04:56 05:00 04:58 04:55 05:19 04:59

05:21 05:11 05:11 05:23 05:06 05:10 05:08 05:05 05:29 05:09

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:32 12:33 12:43 12:36 12:33 12:40 12:28 12:38 12:31 12:31

18:33 18:33 18:39 18:36 18:31 18:36 18:27 18:37 18:32 18:29

19:47 19:47 19:52 19:50 19:45 19:50 19:41 19:51 19:46 19:43

04:59 05:02 05:16 05:04 05:03 05:11 04:57 05:08 04:58 05:00

05:09 05:12 05:26 05:14 05:13 05:21 05:07 05:18 05:08 05:10

Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:29 Parapat 12:31 GunungTua 12:29 Sibuhuan 12:28 Lhoksukon 12:38 D.Sanggul 12:32 Kotapinang 12:27 AekKanopan 12:28

06:41 06:32 06:31 06:44 06:26 06:30 06:29 06:25 06:49 06:29

15:57 15:57 16:06 16:00 15:57 16:03 15:52 16:02 15:56 15:54

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:29 06:32 06:46 06:34 06:33 06:41 06:27 06:38 06:29 06:30

Zhuhur ‘Ashar 15:54 16:01 15:58 15:53 15:55 15:53 15:53 16:01 15:56 15:51 15:53




Shubuh Syuruq

18:32 18:39 18:34 18:28 18:31 18:30 18:31 18:34 18:33 18:28 18:28

19:45 19:53 19:48 19:42 19:45 19:44 19:44 19:47 19:46 19:42 19:42

04:54 05:00 05:02 04:59 05:00 04:55 04:54 05:10 05:00 04:54 04:56

05:04 05:10 05:12 05:09 05:10 05:05 05:04 05:20 05:10 05:04 05:06

06:24 06:31 06:32 06:29 06:30 06:25 06:24 06:40 06:30 06:24 06:27

Antisipasi Pelarian Petrus Dari Aceh, Polres Langkat Sweeping P. BRANDAN (Waspada): Untuk mengantisipasi pelarian pelaku penembak misterius dari Provinsi Aceh ke Sumatera Utara, Polres Langkat menggelar sweeping terhadap kenderaan bermotor di Jalinsum Brandan Barat, Kamis (5/1). Sweeping dipimpin Kapolres AKBP Mardiyono. Pantauan di lapangan, aparat kepolisian memeriksa dengan cermat barang bawaan penumpang, baik penumpang mobil pribadi mau pun bus angkutan

umum yang melintas dari Aceh tujuan Medan. Pemeriksaan berlangsung ekstra ketat. Namun sampai menjelang siang, petugas belum menemukan senjata api

Alumni SMAN I Lubukpakam Buka Sekretariat LUBUKPAKAM (Waspada): Ikatan Alumni SMA Negeri I/223 Lubukpakam dibentuk 10 Oktober 2010, kini membuka sekretariat baru di Jalan Diponegoro 20 Lubukpakam, di rumah Syafrullah (alumni 1975) dengan tujuan untuk mempermudah para alumni berhubungan. Ketua Ikatan Alumni SMA Negeri I/223 Lubukpakam Ifan Rizham didampingi sekretaris Baginda Manurung mengatakan, Kamis (5/ 1), sekretariat ini didirikan sebagai tempat para alumni untuk mencari teman-teman semasa SMA. ”Juga sebagai sarana promosi produk yang dibuat para alumni dan info lowongan kerja bagi alumni dan masyarakat sekitarnya,” kata Ifan. Sekretariat juga menyiapkan souvenir berupa baju kaos dan gantungan kunci berlogo Ikatan Alumni sehingga diharapkan sekretariat mampu membiayai sendiri operasionalnya. Bahkan dapat menambah kas Ikatan Alumni untuk kegiatan sosial seperti membantu Siswa SMAN I Lubukpakam kurang mampu untuk melanjutkan sekolah ke jenjang lebih tinggi. Untuk itu sangat diharapkan peran aktif seluruh alumni untuk membesarkan Ikatan yang terbentuk atas kemauan bersama para alumni sejak pertama berdiri bernama SMA Daswita, SMAN 223, SMU Negeri dan sekarang SMAN I Lubukpakam. “Kami mengundang para alumni untuk dapat memberikan bantuannya baik materil maupun moril, termasuk informasi lowongan kerja, produk dan sebagainya,” jelas Ifan.(ihn)

atau barang terlarang lainnya. Razia tidak hanya difokuskan terhadap pengendara mobil pribadi atau bus umum, tapi pengemudi sepeda motor yang melintas juga diperiksa STNK, termasuk Surat Izin Mengemudi (SIM).Bagipengemudiyangtidak melengkapi surat-surat, langsung ditilang. Sweeping yang digelar sejak pagi diikuti sejumlah periwa di antaranya Kasat Narkoba, AKP SR Tambunan, Kasat Bimas AP Zainudin Lubis, Kapolsek P. Brandan, AKP HM. Kosim Sihombing, Kanit Reskrim Polsek Besitang, Ipda Abdul Rahman, SH dan sejumlah periwira dari Polres Langkat. AKBP Mardiyono ditemui

Waspada disela kegiatan sweeping menyatakan, razia terhadap kenderaaan bermotor akan terus ditingkatkan, baik siang mau pun di malam hari guna mengantisipasi kaburnya pelaku penembakan misterius (Petrus) dari Aceh ke Sumut. Saat ini, lanjutnya, aparat di Aceh sedang intensif memburu pelaku. Ditanya apakah ada informasi atau indikasi bahwa para pelaku petrus telah kabur ke Sumut, Kapolres menyatakan, kemungkinan itu bisa saja karena posisi mereka saat ini sudah semakin terjepit sehubungan gencarnya perburuan aparat di Aceh. Mengingat Kab. Langkat berbatasan langsung dengan Aceh, maka antisipasi keamanan

perlu terus ditingkatkan. Mardiyono menjelaskan, secara umum wilayah Kab. Langkat masih tetap aman. “Alhamdulilah wilayah hukum kita masih tetap kondusif,” ujarnya seraya mengimbau masyarakat untuk turut berpartisipasi menjaga keamanan dan ketertiban, jika ada orang mencurigakan segera lapor ke aparat terdekat. Aparat kepolisian masih terus mendalami serta memburu aktor yang melakukan serangkaian penembakan di Aceh yang telah mengambil korban jiwa antara lain, tiga pekerja perkebunan warga Bahorok, Kab. Langkat dan pekerja galian kabel dari Jember, Jawa Timur.(a02)


Tunawisma Meninggal Mendadak Di Trotoar

APARAT Kepolisian Polres Langkat dibantu personil Polsek P. Brandan dan Besitang melakukan sweeping di Jalinsum Brandan Barat.

TEBINGTINGGI (Waspada): Mr. X berusia sekira 60 tahun, ditemukan meninggal di trotoar jalan KHA Dahlan, Kel. Pasar Baru, Kec. T. Tinggi Kota. Dari sejumlah keterangan, Kamis (5/1), beberapa jam sebelumnya korban masih terlihat segar bugar. Tapi sekira pukul 09:00 pria tua itu mengerang sakit dan merebahkan badannya di lembaran karton untuk tidur. Kemungkinan tunawisma yang sering mangkal di lokasi itu meninggal mendadak. Mengetahui ada tunawisma meninggal, pihak kepolisian langsung turun ke lokasi kejadian dan mengevakuasi jasad korban. Dari hasil pemeriksaan tidak ditemukan tanda-tanda mencurigakan di tubuhnya. Mayat Mr X itu dikirim ke kamar jenazah RSUD Dr. H. Kumpulan Pane. Ciri-ciri Mr X itu, diperkirakan berusia 60 tahun, tinggi sekira 160 Cm, kulit sawo matang, tubuh kurus. Memakai celana hitam, jaket hitam dan baju kemeja kotak coklat. “Bagi warga merasa punya keluarga ciri-ciri demikian, segera mengambil jasadnya ke RSU,” imbau aparat kepolisian.(a09/a11)

Peringati Hari Jadi Ke-2

Re-Prophecy Club Indonesia Gelar Khitan Massal SIBIRU-BIRU (Waspada): Menyambut hari jadi yang ke-2, ReProphecy Club Indonesia menggelar kegiatan sosial bertema ‘Sedikit Perhatian Kepada Saudara-saudaraku’ dengan mengadakan khitanan massalkepada125anakkurangmampudiDesaCandiRejo,Kecamatan Sibiru-biru, Deliserdang. Ketua Umum Re-Prophecy Club Indonesia, Andry Kesuma, SE kepada wartawan mengatakan, kegiatan digelar belum lama ini tersebut sebagai wujud kepedulian sosial terhadap masyarakat kurang mampu. Selain itu, kegiatan itu merupakan wujud syukur Re-Prophecy selama memasuki usia yang kedua. “Syukuran hari jadi kami wujudkan dengan kegiatan sosial. Ini dirasa lebih berarti dibanding kegiatan hura-hura,” ujar Andri, kemarin. Sementara itu, Ketua Panitia kegiatan, Rian Aulia, SH menambahkan, kegiatan yang digelar di Mushalah Al-Ikhlas itu diharapkan bisa menjadi kegiatan yang bisa diterima masyarakat luas. Rian juga mengharapkan, khitanan massal juga bisa membantu kehidupan masyarakat kurang mampu di sekitar kawasan Sibiru-biru. Rian juga berharap Re-Prophecy Club Indonesia bisa terus melakukan kegiatan yang bersifat sosial di waktu-waktu ke depan. “Mudah-mudahan ini bisa menjadi contoh tauladan bagi kawula muda lainnya untuk bisa memperhatikan kondisi saudara-saudara kita,” ujar Rian. Prophecy Club Indonesia sendiri merupakan komunitas seni yang sudah berkecimpung dalam dunia seni di Kota Medan. Namun komunitas itu membentuk regenerasi dari komunitas yang lama. Hingga akhirnya mengubah nama menjadi Re-Prophecy Club Indonesia pada tanggal 20 Desember 2009. Selain menggelar khitanan massal, komunitas itu juga pernah menggelar kegiatan donor darah.(m41)


BEBERAPA anak mengikuti khitan massal yang digelar ReProphecy Club Indonesia di Desa Candi Rejo, Kecamatan Sibirubiru, Deliserdang.

Ketua Mahkamah Agung Di Langkat

Peradilan Beri Kepastian Hukum STABAT (Waspada): Lembaga peradilan dibentuk bukan untukmasalahkalahdanmenang, tapi memberi kepastian hukum danpenegakanhak-hakseseorang di masyarakat, kata Ketua Mahkamah Agung Republik Indonesia, Harifin A. Tumpa dalam pertemuan bersama Forum Komunikasi Pimpinan Daerah (FKPD) Kabupaten Langkat, alim ulama dan tokoh masyarakat, di SerambiJenteraMalayrumahdinas Bupati di Stabat, Kamis (5/1). Harifin A.Tumpa, yang hadir bersama istri mengungkapkan rasa bangganya terhadap pelaksanaan hukum di Kabupaten Langkat berjalan baik. “Kebersamaanyangtelahditunjukkanagar terus dipertahankan,” katanya. Sebelumnya, Bupati Langkat H. Ngogesa Sitepu, SH diwakili Sekda Surya Djahisa menyampaikan ucapan selamat datang serta menyampaikan salam Bupati Ngogesa yang berhalangan hadir. “Kehadiran bapak merupakan hadiah jelang Hari Jadi Langkat tahun ini,” katanya. Bupati menyatakan terima kasih atas kesediaan Ketua MA mengunjungi Bumi Langkat, dan berharap memberi kekuatan bagi peningkatan koordinasi antar FKPD yang ada. Selain itu dengan diprakarsainya ruang sidang

ramah anak dan telekonfrens oleh Ketua PN Stabat, Hj. Diah SulastriDewi,SH,MHmerupakan bagian dari keinginan untuk mewujudkan Langkat sebagai kabupaten yang mengakomodir hak-hak anak. Ketua PN Stabat, Hj. Diah Sulastri Dewi, SH, MH yang juga memberikan sambutan, mengungkapkan rasa bahagia atas kunjungan Ketua MA.“Terhadap apa yang telah kami perbuat seluruhnya merupakan dukungan rekan-rekan FKPD dan masyarakat,” katanya.

Hadir sejumlah FKPD di antaranya Ketua DPRD Rudi Hartono Bangun, Kapolres AKBP H. Mardiyono, Kajari Stabat H. Faturrahman, Ketua Pengadilan Agama Syafruddin, para Komandan Satuan, Kepala SKPD, tokoh masyarakat dan lainnya. Sebelumnya Ketua MA Harifin A. Tumpa meninjau Gedung PN Stabat didampingi Ketua PN Stabat Hj. Diah Sulastri Dewi, dan mengadakan pertemuan intern dengan aparat di lingkungan PN tersebut.(a01)

Semarak Hari Jadi Sergai Ke-8

Ribuan PNS Dan Warga Gerak Jalan SEI RAMPAH (Waspada): Tidak kurang dari 2015 peserta mengikuti lomba Gerak Jalan yang berlangsung meriah di lapangan bola kaki Desa Firdaus Kecamatan Sei Rampah, Kabupaten Serdang Bedagai, Kamis (5/12). Perlombaan ini merupakan salah satu dari berbagai rangkaian kegiatan menyambut dan memeriahkan Hari jadi Kabupaten Serdang Bedagai (Sergai) ke-8, pada 3 - 5 Januari 2012. Gerak Jalan Beregu putra/putri yang dilepas Bupati Sergai Ir. HT. Erry Nuradi, M.Si diwakili Sekdakab Drs. H. Haris Fadillah, M.Si, diikuti 1.400 pesertaperwakilandaritiapSatuanKerjaPerangkat Daerah (SKPD) Pemkab Sergai, perwakilan kecamatan, para guru dan perwakilan siswasiswi dari sekolah se Kabupaten Sergai. Dari 2015 peserta lomba gerak jalan, sisanya adalah peserta lomba Gerak Jalan Santai yang diikuti berbagai kalangan masyarakat, para PNS dan pejabat di lingkungan Pemkab Sergai. Memeriahkan perlombaan ini, disela-sela acara dibagikan nomor undian lucky draw dengan berbagai hadiah menarik seperti televisi. Hadiah diserahkan langsung oleh Bupati Sergai Ir. HT. Erry Nuradi, M.Si kepada para pemenang undian. Usai menghadiri acara perlombaan gerak jalan, Bupati Sergai Erry Nuradi didampingi Sekdakab Drs. H. Haris Fadillah, M.Si dan para Kepala SKPD meninjau pelayanan gratis pengabdian masyarakat yang diselenggarakan di RSU Sultan Sulaiman. Pelayanan yang digelar yakni sunat massal, pemeriksaan mata untuk

penjaringan katarak (skrining test), pemeriksaan gigi, pelayanan KB, pemeriksaan kadar gula darah dan golongan darah, serta donor darah. Panitia pengabdian masyarakat dari RSU SultanSulaimanmelaporkankepadaBupatiSergai, antusias masyarakat atas kegiatan ini sangat tinggi dilihat dari jumlah pendaftar untuk masingmasing layanan kesehatan. Sunat massal diikuti 124 peserta, layanan KB diikuti 112 kaum Ibu, pemeriksaan kadar gula darah dan golongan darah diikuti 92 orang. Kemudian pemeriksaan gigi diikuti 28 orang danskriningtestkataraksudahmendaftar77orang. Khusus untuk layanan skrining test katarak masih dibuka untuk hari Jumat (6/12) dan Senin (9/12). Masih dalam rangka menyambut HUT Sergai yang diperingati 7 Januari setiap tahun, Bupati Sergai Ir. HT. Erry Nuradi, M.Si membuka festival Pantun Telangkai memperebutkan trophy bergilir Bupati Sergai Ir. HT. Erry Nuradi, M.Si yang diselenggarakan di arena Gelanggang Olah Raga dan Seni ‘Istana’, Kecamatan Perbaungan diikuti 46 peserta dari berbagai daerah seperti Kota Binjai, Medan, Tebingtinggi, Deli Serdang, Langkat, Batubara dan peserta dari Kabupaten Sergai sebagai tuan rumah lomba. Di hari yang sama juga digelar perlombaan menjala ikan dibukaWabup Sergai Ir. H. Soekirman di Sungai Rampah Kecamatan Sei Rampah, diikuti 16 regu yang masing-masing terdiri dari 2 (dua) orang peserta yang sehari-hari berprofesi sebagai nelayan.(a08)

Polisi Tangkap Tersangka Curanmor TEBINGTINGGI(Waspada):Tersangkapelaku pencurian sepeda motor diciduk aparat Polsek Rambutan dari kediaman orangtuanya di Jalan Deblod Sundoro, Gang Tusam, Kel. Bagelen, Tebingtinggi. Pelaku tertangkap karena mencuri sepeda motor milik adik iparnya sendiri yang tinggal di Jalan Bakti, Gang Bakti LKMD, Lk I, Kel. Lalang, Kec. Rambutan, Tebingtinggi. Tersangka AZ alias Aboy, 31, kini mendakam di tahanan Polsek Rambutan. Dua hari sebelum tertangkap, istri pelaku yang saat ini sudah pisah ranjang melihat sepeda motor adiknya Zumi Riadi, 24, Honda Beat BK 5936 NAA berada di rumah orang tua pelaku. Ketika itu istri pelaku, Andika Syahdewi alias Dewi, 25, sedang bertandang ke rumah mertuanya.

Menyadari sepeda motor itu milik adiknya yang hilang sebulan lalu, wanita yang berprofesi sebagai penyanyi keyboard ‘Ratu’ itu langsung menelepon Zumi. Tak lama Zumi yang juga bekerja sebagai pemain keyboard datang, sayangnya pelaku tak di rumah. Akhirnya ia membawa pulang sepedamotornya. Seharikemudian,korbanmemberitahuPolsek Rambutan, sepedamotor yang pernah hilang dan pernah dilaporkannya ke Polsek Rambutan sudah ditemukan, dan pencurinya abang iparnya sendiri. Menerima laporan itu, petugas langsung menangkap pelaku, Rabu (4/1) pagi sekira pukul 04:00. Kapolres Tebinginggi, AKBP Andi Rian, S.Ik melalui Kapolsek Rambutan, AKP M. Simarmata membenarkan tertangkapnya pelaku.(a11)

PMI Sumut Kunjungi Markas Sergai

Waspada/Ibnu Kasir

KETUA Mahkamah Agung RI, Harifin A. Tumpa menerima cenderamata dari Sekda Langkat, Surya Djahisa.

Kapolres Langkat Khawatir Generasi Mendatang Tak Tahu Mangrove P. BRANDAN (Waspada): KapolresLangkat,AKBPMardiyono, mengaku khawatir suatu saat generasimendatangtidakmengetahui apa itu namanya pohon mangrove. Ketidaktahuan generasi mendatang pasti akan terjadi jika tidak ada upaya bersama untuk melestarikan keberadaan pohon mangrove yang terancam punah. Pernyataan itu disampaikan AKBPMardiyonopadaacaragerakan penanaman 20.000 batang pohon mangrove yang dilakukan Koperasi Serba Usaha Bahagia Keluarga Bahari (KSU-SUBKB), bekerjasamadenganPTSalamander Energy dan LSM Jelajah Orientasi Bumi (JOB), di wilayah pesisir P. Brandan, Kamis (5/1). “Suatu saat anak-anak dan cucu kita tidak mengetahui apa itu mangrove, apa itu penyu dan seterusnya kalau tidak ada upaya pelestarianhutan,”ujarnyaseraya menambahkan, mangrove sangatbesarfungsidanmanfaatnya untuk menjaga keseimbangan

Waspada/Eddi Gultom

BUPATI Serdang Bedagai HT. Erry Nuradi bersama masyarakat joget ceria usai mengikuti gerak jalan santai menyambut HUT ke-8 Hari Jadi Pemkab Sergai.

ekologi karena itulah Kapolres sangat mendukung gerakan penanamannya. Kapolres menyatakan, apabila ada perusakan atau penjarahantanamanmangrove,laporkan dan pelakunya akan ditindak. “Mudah-mudahan apa yang sedang kita lakukan hari ini, bermanfaat bagi generasi mendatang,” ujar Mardiyono sembari menambahkan, tidak ada alasan untuk tidak mendukung kegiatan mulia ini. Menjawab Waspada terkait maraknya alih fungsi hutan mangrove di Langkat, Mardiyono menyatakan, pihaknya sedang berupaya memanggil saksi ahli. Menurut dia, Kapoldasu Irjen Pol Drs Wisjnu Amat Sastro sendiri sudahmengambillangkahinisiatif untuk mempertemukan semua pihak terkait. Untuk mencegah ekspansi alih fungsi hutan mangrove, KSUSUBKB menggalang dukungan dari berbagai kalangan termasuk Pertagas, Salamander, Pertamina

UP-2 Dumai. “Kita berharap, sebagiandaridanaCSRperusahaan dapatdisisihkanuntukpelestarian alam wilayah pesisir,” ujar Ketua KSU, Azhar Kasim didampingi aktivis lingkungan, Tajrudin Hasibuan dan M. Iqbal. Dia menjelaskan, pada 2011 pihaknya telah melakukan gerakan penanaman 150.000 pohon mangrove. 2012 ini, KSU bekerjasama dengan KNTI, JOB, Walhi akan membuka lahan pembibitan ribuan pohon cemara laut di kawasan Pulau Sembilan, Kec. Pangkalansusu sekaligus membuka lokasi penangkaran penyu. Sementara Tajruddin Hasibuanmenyatakan,lajukerusakan hutanmangrovediLangkatsudah sangat masif. Untuk meminimalisir laju kerusakan kawasan diperlukan kemauan, kerja keras dan usaha bersama dari berbagai lembaga yang peduli lingkungan, termasuk warga pesisir yang menerima dampak kerusakan hutan.(a02)

Medan(Waspada):RombonganPalangMerah Indonesia (PMI) Provinsi Sumatera Utara dipimpin DR. H. Rahmat Shah, pekan lalu berkunjung ke Markas PMI Kabupaten Serdang Bedagai di desa Firdaus, Jalan Negara Medan-Sei Rampah. Kedatangan rombongan PMI Sumut disambut Pengurus PMI Serdang Bedagai di antaranya sekretaris dr. Chaidir, Wakabid Organisasi Drs. JhoniWalker Manik, Dra. DewiYani dan pengurus lainnya serta KSR, PMR dan para relawan. Turut hadir beberapa tokoh dari desa siaga yang pada saat itu melakukan donor darah sukarela. Dalam kata sambutannya Ketua PMI Serdang Bedagai yang diwakiliWakabid Organisasi, Jhoni Walker Manik, menyatakan bahwa dengan peningkatankegiatanyangdilakukanPMISerdang Bedagai guna mewujudkan misi Palang Merah Indonesia yang senantiasa membantu/ meringankan beban masyarakat sekaligus meningkatkan kesadaran masyarakat, maka dibutuhkan markas yang representatif, dan kami bersyukur bisa mendapatkan markas yang baru ini, sehingga masyarakat semakin mudah mendapatkan akses pelayan PMI.

“Kami merasa markas lama sudah kurang representatif dalam hal pelayanan PMI, sehingga kami mencari dan akhirnya mendapatkan tempat ini sekarang yakni ruko, yang terpenting adalah akses yang mudah bagi masyarakat yang akan dilayani oleh PMI. Hari ini juga kami melakukan kegiatan donor darah yang diikuti pegawai negeri sipil di lingkungan Pemkab Sergai, juga ada beberapa pendonor suka rela dari desa siaga yang merupakan mitra Dinas Kesehatan Sergai dan PMI Sergai. Kami sangat senang Bapak DR. H. Rahmat Shah bersama beberapa pengurus PMI Sumut serta Duta PMI, berkenan datang ke markas kami beserta rombongan, dan beliau juga memberikan arahan, masukan yang positif guna meningkatkan kinerja dan menambah semangat kami,” ujar Jhoni. Ketua PMI Sumatera Utara DR. H. Rahmat Shah dalam bimbingannya menyatakan mendukung langkah dan kebijakan pengurus PMI Sergai yang mampu menyesuaikan kebutuhan dengan kondisi yang berkembang di daerah, terutama dalam hal pelayanan PMI kepada masyarakat.(m08)


KETUA PMI Sumatera Utara DR. H. Rahmat Shah memberi bimbingan saat berkunjung ke markas PMI Serdang Bedagai.

WASPADA Jumat 6 Januari 2012

Medan Metropolitan


Puluhan Lapak PKL Pajak Bengkok Dibongkar MEDAN (Waspada): Muspika Percut Seituan (Kecamatan, Koramil, Polsek) bersama Tim Gabungan Dishub Pemkab Deliserdang dan Satpol PP, membersihkan terminal Aksara (Pajak Bengkok) simpang HM Yamin – Letda Sujono – Willem Iskandar – Aksara (Desa Medan Estate), Kamis (5/1). Pembersihan itu dengan membongkar puluhan lapak pedagang kaki lima (PKL) yang terbuat tenda plastik. Sedangkan pimpinan Tim Gabungan Plt Kadishub Pemkab Deliserdang Anda Subrata didampingi Camat PS Tuan Darwin, Danramil Kapten Inf K Aritonang dan Kapolsek Kompol M Simanjuntak. Menurut Darwin, sebelum pembongkaran paksa tersebut, sudah diberikan peringatan bahkan telah ada pertemuan yang menghasilkan kesepakatan masing-masing PKL akan membongkar sendiri kios lapaknya. ‘’Pembongkaran ini guna membersihkan kawasan Terminal Aksara/Pajak Bengkok dari

para PKL,’’ katanya. Penertiban dan pembongkaran lapak/kioskios PKL di terminal tersebut sebelumnya juga sudah pernah dilakukan, namun para PKL kembali lagi ke lokasi tersebut. Pantauan Waspada, saat berlangsung pembongkaran nyaris terjadi kericuhan karena beberapa kaum ibu PKL melakukan protes supaya kios mereka tidak dibongkar. Bahkan, salah seorang sempat membuka pakaiannya tanda protes, namun berhasil diamankan aparat. Menurut salah seorang PKL Sirait, dia sudah berjualan di lokasi itu sejak tahun 1980, yakni kawasan itu masih kebun pisang dan diketahui sebagai wilayah Kota Medan. Sedangkan PKL lainnya mengatakan, mereka bukan menolak dilakukan pembongkaran lapaknya, cuma saja hendaknya ada penampungan. Sementara, bangunan kios permanen yang mulai dibangun di belakang terminal itu dinilai mahal karena DP (uang muka) Rp21 juta dan cicilan per bulan Rp8 juta.(m34)

Harlah Ke-39 PPP Sumut

Wujudkan Masyarakat Adil, Makmur Dan Sejahtera LAPAK PKL di dalam Terminal Aksara/Pajak Bengkok, Desa Medan Estate, Kec. Percut Sei Tuan, dibongkar, Kamis (5/1) .

Waspada/Feirizal Purba

Dana Talangan 2012, Tidak Cukup Tutupi Utang MEDAN (Waspada): Tahun 2012, Dinas Kesehatan Sumut menerima anggaran Rp12 miliar sebagai dana talangan program Jaminan Pemeliharaan Kesehatan (JPK). Namun, anggaran tersebut tidak cukup untuk menutupi utang pembayaran klaim pelayanan kesehatan tahun 2011 di sejumlah rumah sakit provider.

“Untuk pembayaran klaim pelayanan di RSUP H Adam Malik saja sampai November 2011 mencapai Rp12,612 miliar. Klaim yang diajukan RSU Dr Pirngadi Medan Rp2,5 miliar, RSU Imelda Rp348,134 juta, RS Haji Mina Rp98,524 juta, RS Mitra Medika Rp7 juta, RS Estomihi Rp28,59 juta, RS Sari Mutiara Rp43,201 juta, RS Sufina Aziz Rp11,996 juta. Sedangkan RS Helvetia dan RS Bandung yang juga provider dana talangan,

tidak ada melakukan pelayanan. Jadi, klaim mereka tidak ada,” kata Kepala Seksi Penyusunan Program di Dinkes Sumut Sugianto, Kamis (5/1). Sebenarnya, lanjut Sugianto, anggaran 2012 ini untuk menutupi klaim pelayanan pada 2011. Pasalnya, anggaran 2011 sebesar Rp7 miliar sudah digunakan untuk pembayaran klaim pada 2010. Sisa anggaran pada 2011 berkisar Rp300 juta. “Pada 2011, kita sudah meminta tam-

Isteri Dokter Diharapkan Ikut Sukseskan Pembangunan Kesehatan MEDAN (Waspada): Plt Gubsu Gatot Pujo Nugroho mengharapkan peran serta isteri-isteri dokter agar ikut menyukseskan pembangunan kesehatan di Sumut. Hal ini akan mendukung visi misi Pemprovsu di bidang kesehatan yakni Rakyat Tidak Sakit. Demikian dikatakan Plt Gubsu dalam sambutan tertulis dibacakan Kadis Kesehatan Sumut dr Candra Syafei, SpOG pada puncak peringatan Hari Ulang Tahun (HUT) ke-57 Ikatan Isteri Dokter Indonesia (IIDI) yang digelar IIDI Cabang Medan di Garuda Plaza Hotel Medan,

Kamis (5/1). ‘’Pemprovsu mengucapkan terima kasih kepada IIDI Medan yang telah melakukan berbagai kegiatan sosialisasi, penyuluhan dan pelayanan kesehatan kepada masyarakat,’’ tuturnya. Turut hadir Kadis Kesehatan Kota Medan dr Edwin Effendi, MSc; Ketua IIDI Cabang Medan Ny Fahrizar Iskandar Hasibuan; Ketua Panitia Ny T Erna Edwin Effendi sejumlah pengurus IDI Sumut dan Medan serta undangan. Sebelumnya, Ketua IIDI Cabang Medan Ny Fahrizar Iskandar Hasibuan dan Ketua Panitia

HUT ke-57 IIDI NyT Erna Edwin Effendi mengatakan, tema kegiatan ini adalah ‘’Peran Aktif IIDI Mensosialisasikan Pola Hidup Bersih Menuju Masyarakat Sehat Jasmani dan Rohani’’. Berbagai kegiatan telah dilaksanakan IIDI Cabang Medan diantaranya mensosialisakan Prilaku Hidup Bersih dan Sehat (PHBS) bagi siswa SDN di Medan Tembung, berbagai perlombaan seperti lomba balita sehat, dialog interaktif, penyuluhan KB dan lainnya di desa binaan IIDI Cabang Medan di Kelurahan Ladang Bambu Baru, Kec. Medan Tuntungan.(m46)

Waspada/Surya Efendi

HUT IIDI: Kadis Kesehatan Sumut dr. Candra Syafei, SpOG dan Kadis Kesehatan Medan dr. Edwin Effendi, MSc diabadikan bersama sejumlah pengurus IIDI Cabang Medan pada perayaan HUT ke 57 IIDI di Garuda Plaza Hotel Medan, Kamis (5/1).

bahan pada perubahan APBD. Tapi, permintaan kita tidak berhasil sehingga utang pelayanan tahun 2011, menjadi tanggungan di anggaran 2012,” ucapnya. Seluruh klaim utang itu akan dibayar jika anggaran 2012 sudah bisa dimanfaatkan pada triwulan pertama tahun ini. “Tentunya, masih ada utang pelayanan. Utang itu tetap akan dibayar. Dananya akan diminta dari P-APBD tahun ini. Sesuai rekomendasi LHP BPK, minusnya program ini bisa menjadi skala prioritas dalam SILPA di PAPBD nanti, selain penyertaan modal dan program utama di SKPD,” ungkap Sugianto. Meski dana talangan 2012 tidak mencukupi untuk pemzbayaran 2011, katanya, secara kebijakan untuk program dana talangan Pemprovsu tidak ada masalah. Program ini tetap berlanjut. Pasien miskin tidak tersentuh pelayanan Jamkesmas dan Jamkesda yang dirujuk ke provinsi, akan tetap ditanggung. “Pada prinsipnya, eksekutif dan legislatif Sumut sepakat program ini tetap lanjut. Minimnya anggaran terjadi karena pagu anggaran untuk kesehatan masih belum maksimal. Tahun ini memang ada kenaikan anggaran untuk Dinas Kesehatan menjadi Rp92 miliar. Anggaran ini naik Rp5 miliar dari tahun lalu yang hanya Rp87 miliar untuk seluruh program di Dinkes Sumut. Kenaikan anggaran Rp5 miliar itu, kita masukkan ke program dana talangan, makanya anggaran dana talangan tahun ini menjadi Rp12 miliar,” jelas Sugianto. Menurut Sugianto, program ini merupakan prioritas, karena bersentuhan langsung dengan masyarakat. Anggota legislatif dan eksekutif sepakat untuk tetap melanjutkan programnya. Malah, Komisi E meminta agar mereka juga bisa merekomendasikan pasien untuk mendapatkan pelayanan dengan dana talangan. “Selama ini, rekomendasi

pasien yang mendapatkan dana talangan dari bupati atau wali kota. Ada usulan, agar Komisi E DPRDSU juga bisa merekomendasikan, karena masih banyak warga yang tidak ada akses untuk mendapatkan rekomendasi kepala daerah,” katanya. Bahkan, menurut Sugianto, Fraksi PKS DPRDSU mengusulkan bagaimana agar pasien yang berobat itu tidak perlu rekomendasi, cukup dengan membawa KTP. Pada prinsipnya kami setuju, asalkan anggaran untuk program ini mencukupi. Paling tidak anggaran dari Pemprovsu Rp100 miliar, karena pertimbangannya dari 13, 8 juta penduduk Sumatera Utara, yang belum mendapat jaminan pemeliharaan kesehatan — Jamkesmas, Jamkesda, Askes dan asuransi kesehatan lainnya- sekitar 6 juta orang. Jika perhitungan premi per orang Rp5000 per bulan, maka satu tahun per orang Rp60 ribu. Jadi, setidaknya untuk total coverage di Sumut harus ada anggaran Rp360 miliar. Jumlah ini, jika dibagi dengan 33 kabupaten/kota di Sumut, maka tanggungjawab provinsi menyediakan anggaran Rp100 miliar. Dia mengakui masih ada kabupaten/kota yang belum menganggarkan Jamkesda. Lagi pula, anggaran provinsi saja masih sangat minim. Karena itu, kelanjutan program masih tetap dengan sistem lama, perlunya rekomendasi dan persyaratan lain. (h02)

MEDAN (Waspada): “Partai Persatuan Pembangunan (PPP) sebagai partai berazaskan Islam tetap komit serta memiliki tugas dan tanggungjawab untuk menegakkan kebenaran dan memperkuat silaturahmi,” kata Ketua DPW PPP Sumut Fadly Nurzal, SAg pada syukuran peringatan Hari Lahir (Harlah) ke-39 partai politik tersebut di Masjid Al-Amin Jln. Prof. HM Yamin, SH, Rabu (4/1) malam. Sebagai partai politik, lanjut Fadly, PPP juga memiliki tugas pengabdian untuk mewujudkan masyarakat yang adil, makmur dan sejahtera. Dipilihnya masjid sebagai lokasi acara peringatan Harlah PPP bertujuan untuk memperkuat eksistensi PPP sebagai partai Islam serta lebih mendekatkan diri kepada umat. Selain tempat beribadah, masjid juga menjadi tempat bermusyawarah baik untuk kepentingan ekonomi maupun politik secara positif yang bermuara kepada Ukhuwah Islamiyah membangun Islam. Harus diakui, banyak berdiri masjid yang megah namun jamaahnya begitu minim terutama pada pelaksanaan shalat fardhu. “Melalui peringatan Harlah ke-39 PPP ini, mari kita makmurkan masjid dengan berbagai kegiatan seperti pengajian, majelis taklim dan sebagainya,” ujar Fadly seraya mengingatkan meski banyak aliran-aliran Islam, tapi kita tidak ingin menukar-nukar kiblat dan

lebih memperkuat kebersamaan. Ketua Panitia Andi Jaya Matondang melaporkan, rangkaian kegiatan peringatan Harlah Ke-39 PPP Sumut yaitu halqah alim ulama di Madina pada (6/1), kemudian tabligh akbar menghadirkan ustadz kondang dari Jakarta HM Arifin Ilham di Tapsel (7/1) dan jalan santai di P. Sidimpuan (9/1) difokuskan di Pantai Barat. PPP lahir pada 5 Januari 1973. Memasuki usia ke-39, PPP sebagai parpol telah banyak berkiprah di lingkungan pemerintahan terutama dalam mengusung calon KDH dan mampu memposisikan diri sebagai partai Islam yang dipercaya masyarakat. Sedangkan tausyiah disampaikan ustadz Drs. H. Kamidin Selian. Dia mengharapkan, agar peringatan ini dijadikan momentum untuk memperbaiki diri. Kiranya, PPP sebagai partai Islam semakin bermanfaat bagi masyarakat. Turut hadir Plt Gubsu H. Gatot Pujo Nugroho, Kamenag Sumut Drs. H. Abdul Rahim, Ketua MUI Kotas Medan Prof. HM Hatta, Ketua PPP Kota Medan Haja Syahri, SAg, PAC, Ranting PPP Se Sumut, kaum muslim jamaah Masjid Al-Amin, ArRahman. Diawali dengan pembacaan Alquran oleh Drs. H. Fadhlan Zainuddin, SAg. Pada kesempatan itu, DPW PPP Sumut menerima bantuan satu unit mobil ambulans dari anggota DPRDSU (FPPP) H. Ali Jabar Napitupulu. (m24)

Gatot Ajak Hendrik Sitompul Bangun Sumut MEDAN (Waspada) Plt Gubernur Sumatera Utara (Sumut) Gatot Pujo Nugroho menghadiri acara Open House Tahun Baru 2012 di kediaman Drs Hendrik Halomoan Sitompul, MM di Jln. Sei Bahbolon Medan, Selasa (3/1). Acara dirangkai dengan perayaan Hari Ulang Tahun (HUT) istri Hendrik Sitompul Ir. Rospita T Br Marpaung, MM. Gatot hadir bersama Sekda Pemprovsu Drs Nurdin Lubis, sejumlah Asisten Pemprovsu diantaranya Drs Hasiholan Silaen, MM; Ir Djaily Azwar, MSi; Drs Naimuddin, MP serta John Piter Marpaung, SE, Pelaksana KTU Dispendasu Samsat di Tarutung. Hadir juga anggota DPRDSU Drs Guntur Manurung, Kaden Gegana Brimob Poldasu Kompol Adarma Sinaga, serta sejumlah relasi bisnis baik dari Sumut dan Jakarta. Gatot mengajak serta mengingatkan Hendrik Sitompul agar tidak lupa membangun Sumut, meski sudah sukses di Jakarta. Hal itu sangat berkaitan dengan apa yang dicanangkan mantan Gubsu alm Raja Inal Siregar

dengan konsep Martabe (marsipature hutana be). “Saya berharap kepada Hendrik Sitompul, agar tetap membawa nama Sumut serta mengangkat potensi yang ada di daerah ini ke manapun berkiprah,” ujarnya. Plt Gubsu juga mengingatkan kembali rekam jejak Hendrik Sitompul ketika berkiprah di Sumut, mulai memimpin LSM yang getol menyuarakan anti korupsi dan sekarang aktif di pengurus pusat Partai Demokrat hingga menjadi pengusaha sukses di Jakarta. “Jadi, potret kepemimpinan Hendrik Sitompul ini patut ditiru,” kata Gubsu. Suasana semakin akrab ketika Plt Gubsu menyempatkan diri berbaur dan foto bersama seluruh keluarga besar Hendrik Sitompul termasuk orangtua tercinta Binsar Sitompul (Parisma, 71) dan P. Br. Tobing. Bahkan, Gatot mempersembahkan lagu Batak yang antara lain Inang, Anakhon Hi Do Hamoraon Di Au dan Uju Ni Ngolukon. “Ini memang lagu kesayangan saya, sedikit banyaknya dalam lagu ini terkandung pesan orangtua bahwa kesuksesan seorang anak itu tak terlepas dari bimbingan dan doa restu orang tua,” kata Gatot.(m08)

Tiga Preman Rusak Mobil MEDAN (Waspada): Mobil Honda Acoord warna hitam BK 4 VI milik Kepala Dinas (Kadis) Pariwisata Deliserdang Haris Binar Ginting, dirusak tiga preman yang mengendarai sepedamotor, Selasa (3/1) malam. Selain bumper, kap mesin, atap mobil yang rusak, pengemudinya Anca Ginting, putra Kadis Pariwisata Deliserdang, juga mengalami cedera di kening. Akibat kejadian itu, korban mengalami kerugian sekitar Rp30 juta. Dalam pengaduan Anca di Polsek Delitua, Kamis (5/1) mengatakan, peristiwa tersebut terjadi sekira pukul 21:00 setelah pulang dari doorsmeer di Jalan Jamin Ginting Simpang Selayang. Setibanya di Jalan M Purba, Anca mengklakson mobil angkot yang ada di depan mobilnya, sehingga terjadi cekcok antara Anca dan si sopir angkot. Namun, tiba-tiba datang tiga pria tidak dikenal mengendarai sepedamotor marah-marah dengan korban. Setelah itu ketiga preman itu merusak mobil yang dikendarai Anca. Akibat pengrusakan itu, dahi korban mengalami cedera karena terbentur atap mobil yang penyok diinjak-injak pelaku. Kapolsekta Delitua Kompol SP Sinulingga melalui Kanit Reskrim AKP S Sembiring ketika dikonfirmasi membenarkan adanya laporan korban tersebut.(m40)


PLT Gubsu Gatot Pujo Nugroho bersama Asisten Pemprovsu di antaranya Drs Hasiholan Silaen, MM; Ir Djaily Azwar, MSi; Drs Naimuddin MP serta John Piter Marpaung SE Pelaksana KTU Dispendasu Samsat di Tarutung; anggota DPRDSU Drs Guntur Manurung yang juga pengurus DPD Partai Demokrat Sumut diabadikan bersama keluarga besar Drs Hendrik H Sitompul, MM pada acara Open House dan HUT Ir Rospita Br Marpaung.

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana

Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David

Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

4 Pemuda Pesta SS Ditangkap RANTAUPRAPAT (Waspada): Dua warga Kisaran, Kab. Asahan dan dua warga Rantauprapat, ditangkap petugas kepolisian dalam kondisi ‘play’ di sebuah perumahan Jalan Aek Tapa, Rantauprapat, Selasa (3/1). Hal itu dikatakan Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan SIK melalui Kasat Narkoba AKP Sugeng saat dihubungi Waspada, Kamis (5/1). Menurut Sugeng, penangkapan terhadap empatorangyangsedangasikberpestanarkobajenissabuitudilakukan oleh tim dari Sat Narkoba Polres Labuhanbatu. “Informasiyangdiperolehdarimasyarakatlangsungditindaklanjuti petugas dan melakukan penyelidikan ke lokasi yang disebutkan masyarakat.Kemudianpetugasmelakukanpenggrebekandanberhasil menangkap 4 orang laki-laki sedang mengkonsumsi narkoba jenis sabu. Dari keempat orang yang tertangkap itu, dua diantaranya adalah warga Kisaran, Kab. Asahan yakni, MYS alias Unan, 31, warga Jl. Prof M Yamin Gang Manggis, Kisaran dan RS, 29, juga warga Jl. Prof MYaminGangManggis,Kisaran.Sedangkanrekannyayangtertangkap keduanya warga Rantauprapat yakni, AR alias Awal, 32, penarik betor, warga Jl. Siringo-ringo dan RRPH, 23, Satpam, warga Jl. KH Dewantara. Sugengmenambahkan,daripenangkapantersebutselainkeempat orang itu, polisi juga berhasil mengamankan barang bukti dari TKP berupa dua bungkus sabu-sabu seberat 1,05 gram, satu buah bong, satu tabung kaca pirek serta satu buah mancis. Selanjutnya, para tersangkadanbarangbuktikinidiamankandikomandogunapenyidikan lebih lanjut. (a17)

WASPADA Jumat 6 Januari 2012

Sungai Parmerahan Tercemar Limbah PKS SEIKANAN (Waspada): Ratusan ekor ikan di Sungai Parmerahan, Dusun Parmerahan, Desa Sabungan, Kec. Seikanan, Kab. Labuhanbatu Selatan (Labusel), Rabu (4/1) sore mendadak mabuk dan bermatian. Mabuknya ikan di sungai itu didugakarenaairsungaitercemar limbah Pabrik Kelapa Sawit (PKS) PT.SumberTaniAgung(STA)yang terletak lebih kurang 5 Km di hulu sungai. Rahmad Harahap, 33, warga Langgapayung yang ditemui di sungai itu kepada Waspada mengatakan, matinya ikan-ikan itu diketahui warga sekira pukul 17:00. Kematian ikan-ikan tersebut juga disertai berubahnya warna air sungai dan berbau. Diduga bau dan keruhnya air dicemari limbah PT. STA yang mengalir menuju arah sungai yang selama ini menjadi sumber penghidupan masyarakat setempat. Akibat pencemaran itu, warga desa menjadi resah. “Ini sungai digunakan warga sebagai sumber hidup,” katanya. Peristiwa itu, kata dia, telah disampaikan warga kepada aparat desa setempat dan Badan Lingkungan Hidup Pemkab Labusel. Warga berharap, PT. STA bertanggungjawabataspencemaran itu. Warga juga mengaku menjadi khawatir kalau bak limbah PT. STA kembali melimpah ke sungai. Pantauan Waspada, Rabu (4/ 1) malam, banyaknya ikan yang mabukdanmatiakibatkeracunan

air sungai dimanfaatkan warga untukmenangkapikan.Sejumlah warga dari Desa Sabungan dan Kelurahan Langgapayung berdatangan ke sungai untuk menjala ikan. “Kami dapat info tadi sore, banyak ikan mabuk, ya kami kemarilah,kanenakikannyamudah ditangkap,” kata Rahman, warga Langgapayung yang ditemui sedang menjala ikan. Kepala Badan Lingkungan Hidup, Effendy Tanjung yang dikonfirmasi, Kamis (5/1) membenarkan pihaknya juga menerima laporan terkait pencemaran sungai Parmerahan tersebut. Namun kata dia, pihaknya belum mengambil sampel air dan ikan yang mati karena warga melaporkankejadianitumalamhari.“Tapi tadikitasudahbuatsurat,dansiang ini tim turun, mudah-mudahan dalam waktu dekat sudah diketahui hasilnya,” kata Tanjung. Menurutnya, jika hasil penelitian terhadap sampel air itu nantinya terbukti terjadi pencemaran,makapihaknyaakanmeminta pertanggungjawaban pihak PT. STA bahkan menyampaikannya keaparatberwenang.“Kitabelum bisa berikan sanksi langsung karena perangkat pengawas lingkungan kita belum lengkap,” katanya.

Humas PT. STA, Tanwin Nasution didampingi KTU PT. STA, Arif Panjaitan yang dikonfirmasi mengakui memang ada keteledoran karyawannya dalam kasus tersebut. Menurutnya,pencemaranair sungaiParmerahankarenaterjadi kebocoranpipasaatkar-yawannya melakukan penggan-tian pipa pada, Selasa (3/1) sore. Karena kebocoranitu,airlimbahdariPKS yang harusnya dikirim ke kolam penampunganairlim-bahmengalir ke sungai. “Namun hal itu bukan unsur kesengajaan,” katanya. Begitupun lanjut dia, pihak perusahaan sudah bertemu dengan masyarakat dan berdamai, serta membuat kesepakatan. Dalam kesepakatan itu katanya, ada beberapa poin yang diajukan masyarakat terkait pencemaran itu dan sudah setujui pihak perusahaan. “Perjanjian yang kita sepakati itu penggantian 10 ribu bibit ikan nila untuk dimasukkan ke sungai, pencucian sungai sepanjang 1,5 Km dibersihkan 1 Km ke hulu 0,5 Km ke hilir, pembuatan teras masjid, memperbaiki sumur bor umum serta tangga pemandian,” katanya. Informasi yang dihimpun, pencemaran sungai Parmerahan akibat limpahan limbah PT. STA bukanterjadikaliinisaja,pada2007 lalu kasus serupa juga terjadi, air sungai tercemar karena waduk penampunganairlimbahdipabrik itujebol.“Memang2007jugaterjadi begini, namun kita sudah ada solusinyasaatitu,”kataTaswin.(c18)

Barang Alkes Disimpan Di RSUD KUALAGUNUNG, Batubara (Waspada): Panitia pengadaan barang & jasa Alkes Dinas Kesehatan Kab. Batubara dituding sepele, karena meletakkan barang-barang bernilai miliaran di RSUD di Kubah Kwalagunung, Limapuluh yang belum siap dan kurang pengamanannya “Kitasesalkantindakanpanitia pengadaan barang/jasa yang semberono meletakkan barangbarang alokasi kesehatan (Alkes)

Diskes bernilai miliaran di RSUD belum siap, dan minim petugas keamanan,”kataIrmawanMuchlis Ketua DPD- LSM ‘ACI’ Batubara, Selasa (3/1). Apalagi dikaitkan dengan seringnyaterjaditindakankejahatan, di mana lokasi RSUD di Kubah Kwalagunung sepi. Seyogianya barang-barang berharga Dinkes itudisimpanditempatlebihaman. Irmawan mengisyaratkan, bahwadanamiliaranalokasidana

2011 untuk Dinkes Batubara sebagai menyahuti kebutuhan masyarakatBatubarauntukmendapatkan pelayanan kesehatan. Karena itu pihak terkait diminta jangan anggap enteng, barang berharga keperluan RSUD perlu dijamin pengamanannya. Kadiskes Batubara Dr Kubri yang dihubungi via ponsel, Selasa (3/1) pukul 13.30 untuk mendapatkan konfirmasi tidak memberi jawaban.(a12)

Lokasi Kantor Desa Belum Jelas, Kades Dikhawatirkan Bebani Warga LIMAPULUH (Waspada): Belum jelasnya lokasi pembangunan kantor Desa Titi Merah hasil pemekaran Desa Bulan – bulanKec.Limapuluh,Kab.Batubara setelah enam bulan dimekarkan, dikhawatirkanakanmemberatkan warga setempat yang harus menyediakan lahan kantor. Pemerhati Pembangunan di Kab. Batubara, Moeis Chandan Pamesha,kepadaWaspada,Rabu (4/1), mengingatkan pihak-pihak terkait agar jangan membebani masyarakat dalam penyediaan lahan pertapakan untuk pembangunan Balai Desa Titi Merah. Sebabwacanauntukmembebani masyarakat itu telah mengemuka dalam acara reses salah seorang anggota DPRD Batubara beberapa waktu lalu di desa tersebut. “Saat itu Pjs Kades Titi Merah, Hamidah saat menjawab pertanyaan warga sangat mengharapkan partisipasi masyarakat untukpenyediaanlahantersebut. SebabmenurutHamidah,hingga saatinibelumadakepastiantentang lahan pertapakan untuk pembangunanbalaidesaitu,”kataMoeis yang juga warga desa setempat. Moeis berharap agar penyediaan lahan itu tidak dibebankan kepada masyarakat, walaupun alasannya sekedar partisipasi. Sebab saat ini kehidupan masyarakat sudah sangat sulit. “Setahu saya pemekaran atau pembentukan desa baru itu tujuannya untuk mensejahterakan masya-

rakat.Tapibelumapa-apakoksudah ‘nodong’ rakyat,” tambahnya. Moeis juga mengaku merasa heran dengan sikap Pjs Kades Titi Merah, Hamidah, yang sangat antusias dalam hal penyediaan lahantersebut.Padahalpenyediaan lahan pertapakan balai desa bukanlahbagiandaritugaspokok dan fungsi (Tupoksi) seorang Pjs Kades. “Setahu saya tugas Pjs itu hanya dua, yakni menjalankan roda pemerintahan dalam hal pelayanankepadamasyrakat,dan menyiapkan pelaksanaan pemilihan kepala desa (Pilkades). Ada kepentingan apa Pjs sehingga begitu ngotot dalam penyediaan lahan itu. Dikhawatirkan, karena energi Pjs terlalu terkuras dalam

penyediaanlahansehinggatugastugas pokoknya malah jadi terbengkalai,” katanya. Secara terpisah Pjs Kades Titi Merah Hamidah yang dihubungi melalui ponsel membantah tudingan pertapakan kantor desa belum jelas, dan ia membantah pernah mengatakan soal itu dalam sebuah acara reses. Ia juga menepis ada kontroversi soal pertapakan kantor desa. “Jangan dengarkan ucapan – ucapan wargayangsepertiitu.Pertapakan kantor itu sudah ada dihibahkan oleh pak Ridwan, surat – suratnya juga sudah ada tinggal pembangunan kantornya saja,” kata Hamidah. (c05)

Artis Ibukota Meriahkan Tahun 2012 Di Batubara BATUBARA (Waspada) Artis ibukota tergabung dalam ‘Trio Zebra’ akan menggoyang Batubara memeriahkan pergantian tahun 2011 ke 2012 berlokasi di Lapangan Pesons Bahary, Jalan Besar Simpang Empat, Desa Mesjidlama Talawi, Batubara, Sabtu (7/1) ini. Menurut Mhd Nur Fauzan, EO Band CV Cungek, Rabu (4/ 1), pagelaran Trio Zebra ex Trio Macan diprakarsai CV Cungek Production bertema ‘Gebyar

Dangdut Goyang Batubara’ sebagai upaya memberikan hiburan kepada masyarakat. Artis Trio Zebra terdiri dari Engel Emythasari, Aryariesta, dan Ayu Octavia yang diharapkan penampilan mereka memuaskan, dan berkesan di awal tahun baru ini. Kepada pengunjung hanya dipasang tarif rata-ra ta Rp10 ribu /orang, dan dijadwalkan dua kali show, Sabtu (7/1) pukul 14.00 18.00danpukul20.00-23.00.(a12)

Waspada/Armansyah Abdi

BUPATI dr H Tigor Panusunan Siregar SpPD ketika menyematkan Satya Lencana Pengabdian 25 tahun dari Presiden RI kepada salah seorang PNS Kantor Kemenag Kab.Labuhanbatu.

HAB Kemenag RI Di L. Batu RANTAUPRAPAT (Waspada): Mari perbaiki lingkungan di setiap jajaran Kementerian Agama dengan menciptakan suasana yang mendukung bagi terlaksananya program pencegahan dan pemberantasan korupsi. Jauhkan lingkungan yang terkait dengan sikap atau sistem yang dapat mengarahkan kita pada perbuatan koruptif. Demikian Bupati Labuhanbatu dr H Tigor Panusunan Siregar selaku inspektur upacara saat membacakan Amanat Menteri Agama RI H SuryadharmaAlipadaPeringatanHariAmalBhakti (HAB) ke-66 Tahun 2012 di Lapangan Ika Bina, Rantauprapat, Selasa (3/1). Dikatakan, sekuat apapun niat dan kapabilitas moral seseorang, jika berada dalam lingkungan yang tidak mendukung bagi terciptanya tata kelola pemerintahan yang bebas dari korupsi hampir dapat dipastikan akan dapat menggoyahkannya. Selain itu Menag mengungkapkan, perma-

salahan yang belakangan ini dihadapi kemenag adalah munculnya sikap memaksakan kehendak tanpa menghiraukan keharmonisan hubungan antarumatberagamayangtelahterpeliharaselama inidanpemanfaatanisuagamauntukkepentingan yang sebenarnya bertentangan dengan nilai luhur agama itu sendiri. Usai upacara HAB Kemenag yang bertema “Memperteguh Komitmen unrtuk Membangun Kementerian Agama yang Bebas dari Korupsi” itu, dilanjutkan dengan resepsi di halaman Kantor Kemegag L.Batu. Pada saat itu juga Kepala Kantor Kemenag L.Batu Drs H Azaman Harahap didampingi KTU Drs H Darajat Siregar M Pd dan Ketua Panitia Pelaksana Drs Pengadilan MAg memberikan hadiah kepada para pemenang berbagai perlombaan/pertandingan yang digelar dalam rangkaian HAB Kemenag ke-66 Kab. L.Batu. (a18)

Oknum Satpol PP Dibui Kasus Penipuan Tenaga Honorer TANJUNGBALAI (Waspada): Seorang Pegawai Negeri Sipil (PNS) Satuan Polisi Pamong Praja Kota Tanjungbalai harus mendekam dibui (sel) karena diduga melakukan penipuan terhadap korbannya. Informasi dihimpun Waspada, tersangka AA alias Ali, 43, warga Jalan Seibalai, Kel. Pasarbaru, Kec. Seitualang Raso, dilaporkan Sugeng Prihayu, 32, warga Jalan DI Panjaitan, Kel. Sejahtera, ke polisi 3 Januari 2011 lalu. Korban merasa tertipu karena lebih dari setahun tidak juga dipanggil bekerja sebagai tenaga honorer Satpol PP. Padahal, Sugeng telah menyerahkan berkas lamaran berikut uang tunai sebesar tiga juta lima ratus ribu rupiah pada pertengahan April 2010 sebagai pelicin dengan harapan diterima sebagai honor di kantor penegak Perda itu.Namun,impianmenjadihonorerPolPPternyata harus kandas di tengah jalan, dan parahnya lagi, uang yang diserahkannya tak pernah kembali. Tersangka yang sempat diwawancara Waspada di kantor kepolisian mengaku dirinya tidak mampu memasukkan orang lain sebagai tenaga

honorer.DiajugamengatakanSatPolPPtakpernah membuka lowongan pekerjaan dan menerima tenaga honorer sejak 2010 sampai sekarang. Menurut Ali, selain Sugeng, dirinya juga pernah menerima uang dari delapan korban lainnya dengan jumlah uang bervariasi antara tiga sampai tiga juta lima ratus ribu rupiah. Kesembilan korban itu juga dijanjikanbekerja di Satpol PP, namun sampai saat ini tidak pernah menjadi kenyataan. “Sebagian uangnya telah saya kembalikan,” ujar Ali sembari mengatakan bahwa Sugeng tak bukan adalah keponakannya sendiri. KapolresTanjungbalai AKBP EP Sirait melalui Kasubbag Humas AKPY Sinulingga didampingi Kanit Idik II Ipda Darsono membenarkan. Dikatakan,tersangkaterlibatdalamkasuspenipuan dan dikenakan Pasal 378 KUHP dengan ancaman 4 tahun penjara. “Setahun kita mengejar tersangka, dan baru ditangkap tiga hari lalu, karena setiap petugas mendatangi ke rumahnya, Ali tidak pernah ada di tempat,” tutur Darsono. (a32)

Pembunuhan Warga Batubara Diduga Karena Dendam LIMAPULUH (Waspada): Peristiwa pembunuhan Mustakin, 21, penduduk Jalan Jenderal Sudirman,KelurahanPangkalanDodek,Kec.Medang Deras, Kab. Batubara diduga bermotif dendam. Sedangkan pemulangan jenazah akan diupayakan warga Indonesia di Malaysia dan diperkirakan sampai ke tanah air nanti malam atau besok pagi (Jumat 6/1-red) melalui Bandara Polonia Medan, selanjutnya dibawa ke kampung halaman untuk dikebumikan. Hal itu dikemukakan anggota DPRD Batubara, Al-As’ari, SAg, MSi dan Camat Medang Deras, Drs Ramlis, SH dihubungi Waspada, Kamis (5/1). Pembunuhan itu diduga bermotif dendam, karena korban berhubungan cinta dengan mantan istri dari salah seorang pelaku, dan diduga sebagai provokasiterjadinyapengroyokanatauperkelahian. ‘’Ini keterangan sementara yang kita terima dari rekan seperantauan korban di Malaysia,’’ sebut Al-As’ari, SAg, MSi, anggota dewan berasal dari daerah pemilihan Kec. Medang Deras, sekaligus mengklarifikasi TKP sebelumnya yang disebut di kawasan Penang, namun ternyata di Klang Selangor Malaysia, Selasa dinihari (3/1).

Awalnya korban didatangi si pelaku bersama komplotannya yang juga warga Indonesia, setelah sebelumnya mereka terlibat berkelahi pada satu tempat. Begitu keduanya terlibat percakapan di antara pelaku menyerang dari arah belakang menggunakansenjatajenisclurit.Akibatnyakorban roboh bersimbah darah dan tewas seketika. KasusinikataAl-As’ari,dalampenangananpolisi setempat, bahkan dikabarkan sudah mengetahui gambaran si pelaku. Sedangkan jenazah korban dibawauntukdiotopsidirumahsakit,sampaisekarang masihberadadiHospitalTengkuAmpuanRahima, Klang, Selangor menunggu dilakukan evakuasi pemulangan ke tanah air. Camat Medang Deras Drs. Ramlis, SH mengatakan sebelumnya Pemkab Batubara dan kecamatan berusaha membantu mengurus kelengkapansyaratadministrasidibutuhkanKedubes RI, terkait pemulangan jenazah sebagaimana permintaan sang ibu Toibah dan keluarga. Namun di balik itu ada warga Indonesia bersedia membantu memulangkan dan jenazahnya diperkirakan sudah sampai nanti malam atau besok pagi di Bandara Polonia Medan. (a13)

Dermaga Dan Listrik Mulai Dirasakan Masyarakat Pesisir Labuhanbatu SETAHAP demi setahap, pembenahan pembangunan untuk kawasan pesisir Kab. Labuhanbatu,yakniKec.Panai Hulu, PanaiTengah dan Panai Hilir, sudah mulai dirasakan

masyarakat setempat. Pembenahanpembangunan itu, paling tidak sudah dirasakan masyarakat pesisir pada tahun 2011 ini, yakni dermaga telah dibangun Pemkab L. Batu di

Labuhan Bilik (Kec. Panai Tengah), dan listrik di permukiman warga sudah terang-benderang berkat tersedianya pembangkit listrik tenaga diesel berkekuatan 2x2,5 MW.

Waspada/Armansyah Abdi

Bupati L.Batu dr H Tigor Panusunan Siregar SpPD dan Ketua TP PKK Ny Hj Fitra Laila TP Siregar disambut dengan pengalungan bunga dara cilik setempat ketika mendarat di dermaga Labuhanbilik, Kec. Panai Tengah.

Infrasruktur berupa dermaga dan penerangan listrik yang memadai itu merupakan janji politikdrTigorPanusunanSiregar SpPD-Suhari Pane SIP (BupatiWakil Bupati L.Batu) kepada masyarakat pantai sewaktu kampanye Pilkada lalu. Atas terwujudnya kedua infrastruktur itu, masyarakat pesisir L.Batu melaksanakan syukuran dengan mengupah-upah TigorSuhari dan Ketua TP PKK L.Batu Hj Fitra Laila TP SpTHT di Loods Pekan Labuhanbilik, Kec. Panai Tengah, Kamis (29/12). Tigor dalam kesempatan itu menyampaikan, dalam janji politik beberapa tahun lalu, dirinya mengatakanrakyatjangan bodoh, jangan sakit dan jangan lapar. Jangan bodoh termasuk di dalamnya menyediakan listrik yang baik kepada warga. “Bagaimana anak-anak kita dapat belajar dengan baik di waktu malam kalau listrik di sini pukul 20:00 saja sudah mati,” kata Tigor. Dibangunnya pembangkit listrik di Labuhanbilik ini merupakankerjasamayangbaikdengan pihak PT PLN. Dia telah melobby General ManagerWilayah Sumut dan Dirut PT PLN yang saat itu

di pimpin Dahlan Iskan. “Alhamdulillah ternyata diresponPLNdenganmemasang generator di Labuhanbilik ini,” tambahnya seraya menjelaskan, salah satu yang disampaikan beliau kepada Dirut PT PLN bahwa pada tahun 1924 telah ada listrikdiLabuhanbilikyangdikelola oleh Belanda. Ditegaskan, dengan dibangunnya dermaga dan sudah terang-benderangnya kawasan pesisir L.Batu, diharapkan akan membawa pengaruh terhadap peningkatan kemajuan masyarakat pantai. Camat Panai Tengah Mora A Parapat S Sos dalam sambutannya mengatakan, pembangunan yang dilakukan Pemkab L.Batu benar-benar telah dirasakan manfaatnya oleh masyarakat pesisir L.Batu khusunya Panai Tengah. “Atas upaya yang gigih dari bapak bupati dan wakil bupati untuk merubah taraf hirup masyarakat di daerah ini kami patut berterima kasih dan mewujudkan rasa syukur itu dengan mengupah-upah bapak berdua,” kata Mora Parapat. Senadadengancamat,Tokoh

masyarakat Labuhanbilik H Rustam Effendi juga menyampaikan,apayangdiidamidamkan masyarakat pesisir L.Batu kini sudah tercapai, yakni tersedianya dermaga dan penerangan yang memadai. “Karena terima kasih sekalilagikepadaTigor-Suhari,” tandasnya. Sementara Manajer PT PLN Cabang Rantauprapat Abdul Haris Nasution mengatakan, generator yang saat ini terpasang di Labuhanbilik hanya akan bertahan 2-3 tahun. Oleh sebab itu, masyarakat diminta untuk dapat berhemat dalam pemakaian listrik agar generator yang ada dapat bertahan lama. Kepadamasyarakat,Abdul Haris meminta agar dalam mewujudkan rasa terima kasih kepada PLN dengan melakukan pembayaran tagihan listrik tepat waktu. “Kami minta para pelanggan PLN di daerah ini dapat mewujudkan rasa terima kasihnya dengan membayar tagihan listrik tepat waktu,” ujarnya. * Armansyah Abdi

Sumatera Utara

WASPADA Jumat 6 Januari 2012


Mantan Bupati Simalungun Tersangka Kasus Korupsi PEMATANGSIANTAR (Waspada): Mantan Bupati Simalungun periode 2005-2010 Drs. HTZD, MM ditetapkan Tim Tipikor Sat Reskrim Polres Simalungun sebagai tersangka kasus dugaan korupsi, karena diduga terlibat dalam kasus tindak pidana korupsi dana APBD Pemkab Simalungun TA 2006 hingga negara mengalami kerugian Rpl.385.278.011. “Dalam waktu dekat, kasusnya akan digelar di Polres Simalungun,” ungkap Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik melalui Kasubbag Humas AKP H. Panggabean, SH dan Kasat Reskrim AKP M. Adenan AS, SH, SIK,MHkepadawartawandiMapolres Simalungun, Rabu (4/1).

Menurut Adenan, penetapan mantan Bupati Simalungun itu sebagai tersangka sesudah dilakukan proses penyelidikan dan penyidikan terhadap Ny. Sug, mantan Bendaharawan Umum Daerah (BUD) Pemkab Simalungun berkaitan dalam kasus korupsidikantorBupatiSimalungun

Honorer Pemkab Labusel Ujian Seleksi Kontrak Kerja KOTAPINANG (Waspada): Sebanyak 657 tenaga kerja kontrak (tenaga honorer) di jajaran Pemkab Labuhanbatu Selatan (Labusel), Kamis (5/1) pagi, mengikuti ujian seleksi perpanjangan kontrak kerja tahunan yang digelar di SMAN 1, Kotapinang. Bagi honorer yang gagal, terancam akan kehilangan pekerjaan. Pengamatan Waspada di lokasi ujian, sejumlah honorer sudah memasuki lokasi ujian sejak pukul 08:00. Setiap peserta dibedakan ruangannya berdasarkan instansi tempatnya bekerja. Sebagian besar peserta ujian sudah bekerja sebagai honorer rata-rata 5 tahun. Asisten III Pemkab Labusel yang juga Koordinator Tim Seleksi Honorer, Rajo Makmur Siregar kepada Waspada mengatakan, setelah mengikuti seleksi tertulis, seluruh honorer juga akan mengikuti tes bakat dan kemampuan yang digelar di Aula Pemkab Labusel. Menurut Rajo, hasil seleksi ini akan digunakan sebagai bahan pertimbangan untuk keikutsertaan sebagai tenaga kontrak pada 2012. “Ini pertama kali dilakukan. Sesuai kontrak, tiap tahun akan diperbaharui.Padapenerimaansebelumnyamerekainitidakdiseleksi,” katanya. Dia mengatakan, jumlah honorer di Labusel jumlahnya mencapai 800 lebih. Sebagian di antara honorer tersebut telah mengikuti seleksi sebelumnya. Pada seleksi lalu, kata dia, ada beberapa tenaga honor yang diputus kontraknya di antaranya empat pegawai sekretariat, beberapa orang di bagian kebersihan dan beberapa sopir yang tidak aktif. “Jadi hasil ujian ini menentukan kontrak mereka diperpanjang atau tidak,” katanya. Sementara itu sejumlah honorer yang mengikuti seleksi mengaku resah khawatir kontraknya tidak diperpanjang. Bahkan ada honorer yang mengaku telah mengeluarkan uang puluhan juta untuk dapat bekerja sebagai tenaga honorer melalui perantara calo. “Kalau sampai kami tidak lulus, kami akan demo dan beberkan semua praktik sogok-menyogok saat masuk honorer dulu,” kata seorang honorer yang enggan namanya dituliskan. (c18)

Masyarakat Apresiasi PLN Nias GUNUNGSITOLI (Waspada): Masyarakat di Kepulauan Nias memberikan apresiasi positif atas kinerja PT PLN Cabang Nias dalam mengutamakan pelayanan maksimal terhadap penerangan listrik, terlebih-lebih pada perayaan Hari Natal dan Tahun Baru. DemimemaksimalkanpelayananpublikkhususnyapadaPerayaan Hari Natal danTahun Baru untuk kebutuhan listrik di Kepulauan Nias, Manajer PLN Cabang Nias, Ayyanes Santra Girsang bahkan rela tidak berkumpul dengan keluarga dan menunda untuk pulang kampung. Selama bulan Desember 2011 kemarin, PLN Cabang Nias secara rutin melakukan patroli untuk mengantisipasi terjadinya gangguan jaringan yang bisa mengakibatkan padamnya listrik. Kepala Cabang PLN Nias, Ayyanes Santra Girsang yang dihubungi wartawanbelum lama ini membenarkan seluruhpetugas di jajarannya tidak diizinkan untuk pulang kampung guna memberikan pelayanan kepada masyarakat secara maksimal untuk merayakan Natal dan Tahun Baru tanpa terjadinya pemadaman listrik. “Kami merasa bahwa pengabdian kepada masyarakat Kepulauan Nias lebih penting daripada sekadar melakukan acara pergantian tahun dengan keluarga,” tegasnya. Selain itu, Santra Girsang mengungkapkan, dalam mengantisipasi terjadinya gangguan jaringan pada detik-detik dan pasca pergantian tahundiKepulauanNias,diabersamaKepalaRantingPLNGunungsitoli maupun Telukdalam langsung turun lapangan serta mengerahkan seluruh personil PLN melakukan patroli secara bergantian. Ketua DPRD Kota Gunungsitoli, Sowa,a Laoli, SE , Rabu (4/ 1) mewakili masyarakat menyampaikan apresiasi dan terimakasih kepada seluruh jajaran PLN Cabang Nias yang telah melakukan pengabdian walaupun harus merelakan tidak dapat berkumpul dengan keluarga Hal ini dilakukan tentunya dengan keikhlasan demi memberikan rasa aman bagi seluruh masyarakat yang merayakan Natal dan Tahun Baru di Kepulauan Nias. (a25)

saat masih di Jalan Asahan, Km 3,4, Nagori Pamatang, Simalungun,Kec.Siantartahun2006lalu. TimTipikorSatReskrimPolres Simalungun yang dipimpin Kasat Reskrim secara maraton melakukan proses pemeriksaan terhadap Ny. Sug, diawali pemeriksaan 62 saksi termasuk Drs. HTZD, MM, seorang saksi ahli dari BPKP, satu orang ahliTata NegaradariUSUdanbarangbukti berupa 27 bundelan item surat yang berhubungan dengan perkara. Selanjutnya, sebut Adenan, sesudah memproses cukup lama, kemudian Polres Simalungun menetapkan Ny. Sug sebagai tersangka dan melim-

pahkankasusnyakeJaksaPenuntut Umum (JPU) pada 13 Desember 2011 lalu untuk disidangkan, karena berkasnya sudah lengkap (P-21). Sesuaidenganyangdisangkakan kepada Ny. Sug, kepada mantan Bupati Simalungun itu tidak jauh berbeda yakni dugaan tindak pidana korupsi (tipikor) dari APBD Pemkab Simalungun TA 2006 sebesar Rpl miliar lebih pada Desember 2005 sampai 20 Januari 2006. “Keduanya secara bersama sama telah mencairkan dana dari kas daerah tidak sesuai prosedur dan tidak tersedia anggarannya pada APBD tahun 2006 dan penggunaanya bukan merupa-

kan beban dan atas pelaksanaan APBD tahun 2006,” terang Adenan. Karenanya, imbuh Adenan, tersangka Drs. HTZD, MM diduga melakukan pelanggaran dalam UU dan PP nomor 105 tahun 2000 tentang Pengelolaan dan PJKD Kepmendagri nomor 29 tahun 2002, UU RI nomor l tahun 2004 tentang Perbendaharaan Negara serta Pasal 2 dan 3 dari UU RI nomor 3l tahun 1999 yang sudah dirubah dengan UU nomor 20 tahun 200l. Menjawab pertanyaan, Adenan menyebutkan sesudah gelar perkara di Mapolres, tersangka Drs. HTZD, M akan dipanggil dan akan diperiksa sebagai tersangka. (a30)

APBD Disetujui Rp422 M

Aspirasi Pembangunan Nias Belum Semua Terakomodir GUNUNGSITOLI (Waspada): Bupati Nias , Drs. Sokhiatulo Laoli, MM, mengakui, berbagai aspirasi maupun usul-usul pembangunanyangberkembang di tengah-tengah masyarakat belum semuanya terakomodir sesuaidenganapayangdiharapkan. “Keadaan itu bukan berarti mengesampingkannya atau mengurangi tingkat urgensinya, melainkan semata-mata karena keterbatasan kemampuan keuangan daerah yang dimiliki saat ini baik yang bersumber dari Pendapatan Asli daerah, Dana Perimbangan maupun bersumber dari BantuanKeuangandaripemerintah provinsi atau pemerintah lainnya.Kondisiinimengingatkan semua pihak untuk lebih mengarahkan perhatian sumber-sumber PAD baru pada tahun-tahun mendatang, sehingga dapat memberi kontribusi yang memadai terhadap percepatan pembangunan daerah,” ujar Bupati Nias, belum lama ini. Bupati mengatakan, dengan disetujui Rancangan APBD Nias tahun anggaran 2012 maka rancanganperaturandaerahKab. Niastahunanggaran2012dengan teknispenyusunananyaberpedoman pada Permendagri Nomor 21Tahun2011tentangperubahan kedua Permendagri No. 13Tahun 2006Tentang Pedoman Pengelolaan Keuangan Daerah dan Permendagri No. 22 Tahun 2001

TentangPenyusunanAPBDTA2012. Penyusunan APBD KabupatenNiasTA2012inidisusun melalui pendekatan Anggaran Berbasis Kinerja dan selanjutnya merupakan landasan operasional penatausahaan, pelaporan dan pertanggungjawaban keuangan daerahpadatahunanggaran2012 mendatang. Ranperda Kabupaten Nias tentang APBDTA 2012 yang telah disetujui bersama, sudah tentu tidakdapatmemberikandampak terhadap kepentingan daerah apabilatidakdiikutidengantindak lanjut pelaksanaannya secara optimal. Karenaitu,BupatiNiasmengharapkan dukungan dari legislatif serta kepada semua pihak untuk berperanaktifdalammemberikan dukungan terhadap pelaksanaan APBD TA 2012 ini ke depan, termasukdukungandanparti-sipasi dari segenap lapisan masyarakat. Bupati Nias mengharapakan kepada seluruh Kepala SKPD dan UnitKerjadiLingkunganPemkab Nias agar mengambil langkah persiapan dalam pelaksanaan program atau kegiatan serta bertanggungjawab dalam pengelolaan dan pelaksanaan APBD tersebut. Hal ini dimaksudkan untuk memberhasilkan seluruh program melalui peningkatan kinerja maupun koordinasi dengan segenap unsur yang terkait sehingga dapat memberikan

kepastian terhadap pelaksanaan APBD secara tepat guna, sasaran, waktu dan tepat pertanggungjawabannya. DPRD Kabupaten Nias melalui Rapat Paripurna menyetujui Rancangan Peraturan Daerah (Ranperda) tentang Anggaran Pendapatan Belanja Daerah (APBD)Kab.NiasTahunAnggaran 2012 sebesar Rp422 miliar. Persetujuan Ranperda TentangAPBDKab.NiasmelaluiRapat Paripurnatersebutbelumlamaini dipimpinKetuaDPRD,Sokhizanolo Zai,SEdidampingiparaWakilKetua dandiikutiseluruhanggotaDPRD Kabupaten Nias. Pada Rapat Paripurna itu dihadir Bupati Nias, Drs. Sokhiatulo Laoli, MM,Wakil Bupati Nias, ArosokhiWaruwu,SH,MH,Sekda Kab Nias, O’ozatulo Ndrha, BE, ST,MAPsertaparaunsurMuspida dan para pimpinan SKPD di Lingkungan Pemkab Nias. Rapat Paripurna terlebih dahulu diawali dengan Pendapat Akhir masingmasing fraksi yang seluruhnya menyetujui Ranperda APBD Kabupaten Nias TA 2012 sebesar Rp422 miliar. Ranperda APBD Kabupaten Nias Tahun Anggaran 2012 yang disetujui DPRD melalui rapat paripurna tersebut berjumlah Rp422 miliar dengan rincian Belanja Langsung Rp269 miliar dan belanja tidak langsung Rp152 miliar. (a25)

Banyak Program Pemkab Simalungun Belum Terealisasi PAMATANG RAYA (Waspada):BupatiSimalungun,JRSaragih mengungkapkan, pada 2011, masih banyak program kerja PemkabSimalungunyangbelum terealisasi. “Saya mengajak seluruh komponenyangadauntuksamasama bergandengan tangan agar program kerja yang tidak bisa terlaksanaan pada tahun 2011 dapat dilanjutkan pada tahun 2012 sesuai dengan kemampuan anggaran yang ada, terutama dalam memenuhi target PAD (Pendapatan Asli Daerah) tahun 2012,” ujar JR Saragih pada acara syukuran Natal 2011 di rumah dinas Bupati Simalungun di Pematanagraya, belum lama ini.

Acara syukuran Natal dihadiri para Muspida, anggota DPRD Simalungun, para pejabat di jajaran Pemkab Simalungun, tokoh agama, tokoh masyarakat, tokoh adatdanmasyarakat.Kedatangan para undangan diterima Bupati Simalungun, JR Saragih bersama istri Ny. dr. Erunita JR Saragih. Bupati Simalungun JR Saragih, dalam acara itu mengucapkanselamatNataldanTahunBaru 2012 sekaligus menyampaikan permohonan maafnya kepada seluruh masyarakat Simalungun. “Sejak saya dipercaya masyarakat sekitar 1 tahun 4 bulan memimpin daerah ini, tentu banyak kesalahan maupun kekhilafantelahterjadi.Karenanya,atas

nama pemerintah dan keluarga saya mohon maaf kepada seluruh masyarakat Kabupaten Simalungun,” kata Saragih. Kepada DPRD, Bupati mengharapkan dukungannya dalam melaksanakan semua program kerja yang telah direncanakan oleh Pemkab Simalungun pada tahun 2012. Apalagi pada tahun 2012, sekitar 60 % kewenangan Pemkab Simalungun telah dilimpahkan kepada kecamatan, hal ini diharapkan dapat merealisasikan PAD yang telah ditargetkanpada2012,sehinggabeberapa programpemerintahyangbelum dapat dilaksanakan pada tahun 2011 dapat terealisasi pada 2012 mendatang. (a29)

Ketua MA Nikmati Keindahan TSR Di sela-sela kunjungan kerja di Kabupaten Tanah Karo, Ketua Mahkamah Agung (MA) DR. Harifin Andi Tumpa. SH, MH menyempatkan diri menikmati pemandangandenganpesonaeksotis alam pegunungan serta memanjakan mata dengan melihat keindahan Danau Toba. “Saya sangat senang melihat orang nomor delapan di Republik Indonesia, datang ke tempat wisata Taman Simalem Resort (TSR) untuk menikmati alam pegunungan, serta memanjakan diri dengan berpose bersama keluarga, dan pejabat Kabupaten Tanah Karo yang menyambut hangat kedatangan ketua MA,” terang pegusaha TSR, Tamin Sukardi kepada Waspada, kemarin. Dikatakan Tamin, yang terus mempromosikan TSR seluas 206 Ha hingga go Internasional, ketua MA beserta istri dan rombongan akan bermalam di hotel, dengan leluasa melihat aluran air sungai tepat di sisi kamar. “Saya juga sudah mengatakan kepada ketua MA, agar TSRdapatsecepatnyadike-tahui oleh warga asing, dengan cara mempromosikan ke mancanegara atau go Internasional. Agar mereka dapat mengetahui,kalauKab.TanahKaro,kaya dengantempatpesonawisata,“ kata pemilik hotel Sibayak. Kedatangan Ketua MA

danrombongankeKabTanahKaro dalam kaitan kunjungan kerja antaralainpelepasanwisudaKetua Pengadilan Tinggi Sumut. “Saya ke sini dalam rangka kunjungan kerja, pelepasan wisuda ketua Pengadilan Tinggi Sumut, jadi saya sempatkan berkunjung ke kota wisata KabupatenTanah Karo, sekaligus memantau kinerja pengadilan di setiap kabupaten di Sumut,” terang Harifin di Kantor Bupati Tanah Karo, Jl. Djamin Ginting, Kabanjahe, Rabu (5/1). Amatan Waspada Ketua MA beserta istri dan rombongan hanya meluangkan waktu ke kantor Bupati, T. Karo sekira 30 menit. Para wartawan yang menunggu orang nomor 8 RI, untuk melakukan konfirmasi kedatangannya ke Kab. Tanah Karo tidak banyak bisa berbincang. Disebabkan, dihalang dengan pengawal pribadi, serta Humas PN Kabanjahe, Hakim Tobing, yang merasa takut akan pertanyaan wartawan tentang kebobrokan PN Kabanjahe, dalam melakukan persidangan, sertamemilahsidangyangberbau dengan kepentingan pribadi. “Padahal saya mau menanyakan kepada ketua MA, terkait sidang judi yang tidak pernah dihadirkan, atau disidangkan di PN Kabanjahe. Terutama ketua PN Kabanjahe, yang tertutup kepada wartawan, dan melemparkan semua pertanyaan kepada Humas. Jadi apa fungsi Ketua PN, kalau dia tidak mengetahui apa

yangterjadidiPNtersebut,”terang John Ginting kepadaWaspada. Dengan mobilVellifire hitam RI 8, ketua MA dengan dikawal ketat, dari Polres T. Karo, beserta Bupati Kena Ukur Karo Jambi Surbakti, Wakil Bupati, Terkelin Berahmana, Humas Bupati, Jhonson, Kakan Perijinan, Ramos Perangin– angin, serta staf Pemda

T. Karo langsung menuju tempat wisata Taman Simalem Resort, Desa Sikondon – kondon, Kec. Merek, yangtelahdiperomosikan hingga go internasional. Usai menikmati pemandangan kota wisata di Kab. Tanah Karo, Ketua MA DR. Harifin Andi Tumpa. SH, MH berkunjung ke Pengadilan Negeri Kabanjahe,

Jl. Djamin Ginting Kabanjahe, Kamis (5/1) pagi, di dalam PN Kabanjahe, orang RI 8 tidak banyak meluangkan waktu. Dari Tanah Karo, ketua MA dan rombongan, bergegas menuju Kota Stabat, Kab. Langkat, untuk melakukan kunjungan kerja berikutnya. * Dede Basri Hasibuan


WABUP Simalungun, Hj. Nuriaty Damanik melakukan dialog dengan pedagang saat mengunjungi lokasi wisata Karang Anyer di Kecamatan Gunung Maligas.

Wabup Minta Aparatur Tingkatkan Disiplin SIMALUNGUN (Waspada): Wakil Bupati Simalungun, Hj. Nuriaty Damanik menekankan kepada aparatur pemerintah di kecamatan maupun nagori (desa) untuk tetap meningkatkan disiplin dalam melaksanakan tugas dan memberikanpelayananprimakepadamasyarakat. Harapan tersebut disampaikan, Nuriaty Damanik di hadapan para aparatur pemerintah di Kecamatan Gunung Maligas saat melakukan absensi kehadiran para pegawai ketika melakukan kunjungan kerja di daerah itu, Rabu (4/1). Dikatakan, disiplin bukan hanya sebatas tepat waktu untuk hadir, tetapi dalam melakukan penandatanganan dalam daftar hadir juga harus sesuai dengan waktunya. “Jangan ditandatangani absensi sampai seminggu, ini kan tidak disiplin namanya dan bila ada kepentingan yang memang tidak bisa untuk ditinggalkan saat melaksanakan tugas, tinggalkan pesan kepada temannya agar tidak terjadi miscomunication, komunikasi dan koordinasi sesama pegawai kita pegang terus agar terjadi administrasi yang baik,” kata wabup. Selain itu, Wakil Bupati dalam arahannya meminta kepada aparatur kecamatan agar tetap memberikan pelayanan yang baik kepada masyarakat terutama dalam pelaksanaan elektronik Kartu Tanda Penduduk (e-KTP) dan tugas-tugas pelayanan lainnya. Himbau masyarakat untuk melakukan pengurusan KTP karena hal ini berkaitan dengan data kependudukan untuk melaksanakan pemilu, tambanya. Seusai memberikan arahan, selanjutnya Wabup minta penjelasan tentang pelaksanaan

Program Nasional Pemberdayaan Masyarakat Pengembangan Infrastruktur Sosial Ekonomi Wilayah (PNPM-PISEW ) tahun 2011 yang dilaksanakan di wilayah Kecamatan Gunung Maligas. Kepala seksi Pemberdayaan Masyarakt Nagori (PMN) M. Rasyid Sinaga menjelaskan bahwa, PNPM-PISEW tahun 2011 yang ada di wilayah Kecamatan Gunung Maligas sebanyak 36 paket dan kegiatan yang dilakanakan antara lain untuk pembuatan parit pasangan. Menanggapi pejelasan Kasi PMN tersebut, Wabup memintah agar pelaksanaan PNPMPISEW ini dikerjakan sesuai dengan peraturan danketentuanyangberlakubaiksecaraadministrasi maupun di dalam pelaksanaan kegiatan, sehingga dapat lebih bermanfaat untuk kepentingan masyarakat. Usai melakukan pertemuan dengan aparatur pemerintah di Kecamatan Gunung Maligas,Wakil Bupati Simalungun didampingi sekretaris dan para kepala seksi kecamatan, serta pelaksana PNPM-PISEW meninjau beberapa titik pelaksanaan PNPM-PISEW dan selanjutnya meninjau objek wisata Karang Anyer. Di objek wisata Karang Anyer ini,Wakil Bupati melakukan dialog dengan beberapa pengusaha yang ada di lokasi objek wisata . Wakil Bupati meminta agar lokasi ini dikelola dengan baik dan diciptakan citra yang baik, apalagi lokasi ini banyak dikunjungi anak-anak. “MarikitajagaanugerahAllahSWTinisehingga dapat memberikan manfaat bagi masyarakat yangpadagilirannyaakanmembantupeningkatan kesejahteraan masyarakat,” tandasnya. (a29)

HUL Ke-2 Tuan Guru Simalungun Syekh Abdurrahman Rajagukguk PEMATANGSIANTAR (Waspada): Pondok Persulukan Babut Taubah Serambi Babussalam Silsilah ThariqatNaqsyabandiyahYayasan Majelis Zikrullah Al Munawwaroh Desa Jawa Tongah, Kec. Hatonduhan, Kab. Simalungun akan mengadakan HUL ke 2 Tuan Guru Syekh Abdurrahman Rajagukguk, Sabtu (7/1). Menurut Tuan Guru Syekh Haji Ahmad Sabban Al Rahmniy Rajagukguk, Sag, MA pewaris kemursyidan, pelaksanaan HUL ini bertujuanuntukmengenangkembali “spirit riligiutas” Syekh Abdurrahman Rajagukguk serta meneladai sikap keulamaannya dalam membangun nilai-nilai Islam dalam kehidupan. Syekh Abdurrahman Rajagukguk seorang ulama sufistik yang sejak kecil dikenal dengan kealiman dan kewarakannya. Beliau sangat cinta dan sungguh-sungguh mendalami ilmu-ilmu agama dan ketuhanan. Bahkan, seluruh hartanya diperuntukkan untuk perjuangan menuntut ilmu ketuhanan dengan semata-mata mengharap

rahmat dan ridha Allah SWT. “Beberapa tempat dan guru murysid yang disinggahinya untuk mendalami ilmu thariqat adalah Tapsel dengan Syekh Abdul Manan Siregar,MedandenganSyekhAbdul Majid Nasution, Siantar Syekh Ramadhan Siregar dan terakhir memperoleh ijazah mursyid dari Basilam Langkat dari Syekh Abdul Mu’in Al Wahab Rokan Al Kholidi Naqsyabandi, sekitar tahun 1970an,” katanya. Peringatan HUL itu direncanakan dihadiri Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho, ST sekaligus menjadi keynote speaker tentang Peran Spiritual Dalam Pembangu-nan Sumatera Utara. Selain gubernur, Dr H Rahmat Shah anggota DPD/MPR RI, Bupati Simalungun dan jajaran, Prof Dr H Syahrin Harahap, para ulama dan tokoh SumateraUtaradanribuanundangandanjamaah thariqat Naqsyabandiyah direncanakan kehadirannyauntukberhikmatmenyelenggarakan kegiatan spiritual HUL ini. (m41)

Wabup DS Tutup Expo I Demokrat Bakti Negeri PANCURBATU (Waspada): Wakil Bupati Deliserdang H. Zainuddin Mars menutup Expo IDemokratBaktiNegeriperayaanNataldanTahun Baru 2012, ditandai penyerahan berbagai bentuk hadiah perlombaan di Lapangan Bolakaki Pancurbatu, Rabu (4/1) malam. Meski diwarnai hujan gerimis, namun acara yang berlangsung sukses dan meriah itu juga dihadiri anggota DPR RI Ir. Anditimu Pangerang, anggota DPRD Sumut Nurhasanah, S.Sos, Ketua DPRD Deliserdang Hj. Fatmawati Takrim, Wakil Ketua TP PKK Ny. Hj. Asdiana Zainuddin, Asisten II Setdakab Ir. Agus Ginting M.Si, Kadis Perindag Ir. Artini S Marpaung, Camat Pancurbatu Drs. Suryadi Aritonang, M.Si beserta Muspika, sejumlah Camat jajaran Pemkab Deliserdang serta ribuan warga dari berbagai pelosok Kecamatan Pancurbatu. Wabup H. Zainuddin Mars berharap penyelenggaraan Expo Bakti Negeri ke depan menjadi kalender tetap tahunan sebagai upaya membantu

masyarakat.Danharuslebihberkembangmenjadi event besar yang benar-benar mampu menjawab tuntutan seiring tingginya volume kebutuhan yang harus dipersiapkan warga dalam perayaan Natal dan Tahun Baru, khususnya menyiapkan berbagai kebutuhan bahan pokok yang harganya relatif murah dan terjangkau. Sebelumnya anggota DPR RI Ir. Anditimu Pangerang menyampaikan terima kasih dan bangga atas terselenggaranya acara ini. Kegiatan Expo sangat membantu dalam menyediakan berbagai kebutuhkan di saat warga akan merayakan Natal dan Tahun Baru. Sementara Ketua DPRD Deliserdang Hj. Fatmawati Takrim yang juga Ketua panitia menjelaskan acara Christmas and happy new years Expo I Demokrat Bakti Negeri dalam rangka perayaan Natal danTahun Baru 2012, berlangsung 21 Desember 2011- 4 Januari 2012, bertujuan mensinerjikan 3 pilar kekuatan yaitu pemerintah, pengusaha dan masyarakat.(a06)

HAB Kemenag Batubara Meriah

Waspada/Dede Basri Hasibuan

KETUA Mahkamah Agung,DR.Harifin Andi Tumpa.SH,MH (kedua dari kiri) sedang melakukan dialog tentang pemandangan eksotis di puncak Danau Toba, tepatnya di Taman Simalem Resort (TSR) Kec. Merek, Kab. Tanah Karo, dengan pengusaha TSR, Tamin Sukardi.

LIMAPULUH (Waspada): Peringatan Hari Amal Bhakti (HAB) Kementerian Agama (Kemenag) RI ke 66 Kabupaten Batubara berlangsung meriah di lapangan Kantor Bupati, Jl. Perintis Kemerdekaan Limapuluh, Selasa (3/1). Peringatan ditandai dengan upacara bendera diikuti lebih dari 5.000 peserta, diantaranya pelajar, guru dan kepala Madrasah se Batubara, mulai tingkat RA, MI, MTs dan MA baik negeri maupun swasta. Turut hadir Kepala Kantor Kemenag Batubara H Ahmad Hanfi, pimpinan, karyawan, staf kantor se jajaran

Kemenag setempat. Bertindak sebagai Inspektur Upacara Bupati Batubara H OK Arya Zulkarnain,SH MM. Dalam amanatnya OK Arya membacakan sambutan tertulis Menteri Agama RI. Berbagai kegiatan perlombaan dilaksanakan dalam rangka memeriahkan HAB Kemenag di Batubara. Diantaranya pertandingan olah raga dan perlombaan seni antar siswa madrasah maupun staf dan karyawan. Pengumuman dan penyherahan hadiah lomba berlangsung pada acara resepsi HAB yang dilaksanakan usai upacara di halaman MAN Limapuluh.(c04)

Sumatera Utara


WASPADA Jumat 6 Januari 2012

Massa MPC PP Madina Dan Satpol PP Nyaris Adu Jotos PANYABUNGAN (Waspada): Kedatangan ratusan massa MPC Pemuda Pancasila (PP) Kabupaten Mandailing Natal (Madina) untuk menyampaikan aspirasi ke Kantor Dinas Kesehatan (Dinkes) dan Kantor Bupati Madina, Kamis (5/1), sempat ricuh. Pantauan Waspada di lapangan, kedatangan massa MPC PP mendapat pengawalan ketat daripihakPolresdanSatuanPolisi Pamong Praja (Satpol PP) Madina. Namun, aksi dorong dan adu

argumen antara pendemo dengan petugas sempat terjadi karena salah seorang anggota PP kena pukulan senjata pentungan diduga dilakukan Satpol PP. Tak ayal, anggotanya men-

Waspada/Sukri Falah Harahap

BUPATI Tapsel, Syahrul M Pasaribu (3 dari kanan) dan Kaban PMD juga Ketua IKPTK, Rustam E Hasibuan, diabadikan bersama 4 Praja IPDN asal Tapsel.

Bupati Tapsel Terima Kunjungan Empat Praja IPDN P.SIDIMPUAN (Waspada): Bupati Tapanuli Selatan, Syahrul M Pasaribu, menerima kunjungan audensi empat putera daerah yang kini sedang menjalani pendidikan (Praja) di Institut Pemerintahan Dalam Negeri (IPDN), Selasa (3/12). Wasana Praja AhmadYunan Lubis, Madya Praja Armadan Rezeki Harahap, Madya Praja Resi Gustoni Hutasuhut, Madya Praja Fauzi Hutasuhut,sedangdalamcutibelajardanpulangkekampunghalaman. Bupati Tapsel didampingi Kepala Badan PMD Rustam Effendi, Kadis Dukcapil Hotma Dalid Harahap, dan Kabag Humas Ahmad Fauzi M Ritonga, menyambut baik dan memberikan nasehat-nasehat kepada keempatnya.“Kalian putera terbaik Tapsel yang merupakan calon pemimpin masa depan daerah ini ke depan. Giatlah belajar dan jangan kecewakan orangtua, karena tidak mudah untuk bsia masuk belajar di IPDN. Hargai itu,” katanya. Selain itu Syahrul juga berpesan kepada Praja IPDN asal Tapsel untuk tetap menjaga nama baik daerah. Tunjukkan jati diri sebagai orang Tapsel yang bermartabat dan patuhi segala peraturan yang ada, sehingga dapat lulus dengan baik dan tepat waktu. Mewakili keempat Praja,Wasana Praja AhmadYunan Lubis pada kesempatan itu bermohon kepada Bupati Tapsel agar membantu para Praja dari segi biaya pendidikan. Yakni dengan menampung tunjangan belajar di APBD. (a27)

HAB Kemenag Di Tapteng Ajang Silaturahmi MEDAN (Waspada): Peringatan Hari Amal Bakti (HAB) ke66 Tahun dilaksanakan Kementerian Agama Kabupaten Tapanuli Tengah, Selasa (3/1), sekaigus menjadi ajang silaturrahmi. Kegiatan dipusatkan di Kapangan MAN Pandan diikuti berbagai elemen dan SKPD Pemkab Tapteng serta Muspida Plus, Ormas dan tokoh agama. “Kegiatan HAB sangat menyentuh karena dihadiri BupatiTapanuli Tengah, Raja Bonaran Situmeang,SH,M.Hum sekaligus membacakan pidatoMenteriAgamaRISuryadharmaAli,”kataKepalaKantorKementerian Agama Tapteng, Drs H Sarmadan Nur Siregar,MPd, Kamis (5/1). Disebutkannya,MenteriAgamaRIdalamsambutannyadibacakan Bupati Tapanuli Tengah menyebutkan, melalui peringatan HAB juga diharapkan seluruh jajaran Kementerian Agama memperoleh tambahan energi positif dan semangat yang baru untuk meningkatkan peran aktifnya dan memberikan kontribusinya secara nyata . “Kegiatan itu sekaligus sebagai jalinan silaturrahmi dengan seluruh SKPD Pemkab Tapteng dan Bupati. Intinya, sebagai Kakan Kemenag Tapteng, saya akan mendukung program kerja bupati terutama dalam mewujudkan daerah ini menjadi negeri wisata sejuta pesona danTapteng semakin mempesona, dikenal oleh daerah lain,” ujarnya. Dijelaskan, dalam ajang silaturahmi itu dia menyampaikan kepada bupati keinginan orangtua siswa di MAN Pandan, MTs Bahriyatul Ulum dan MIS Bahriyatul Ulum, agar mengizinkan Angkutan Umum (Angkot) membuka line ke pesantren saat akan masuk sekolah dan saat pulang. (m37)

dapat perlakuan seperti itu, Ketua MPC PP Madina, Syahriwan alias Kocu langsung turun tangan. Dia malah mengajak Satpol PP adu jotos. Situasiakhirnyaterkendalikan setelah Kasat Reskrim Polres Madina, AKP. Sarluman, SH turun langsung ke tengah-tengah pengunjuk rasa dibantu beberapa orang pejabat teras dan Polres dan Pemkab Madina. Dalam orasinya, Tan Gozali bersama kordinator aksi, Aswardi Nasution dan koordinator lapangan Samsul Hidayat serta Armen Nasution menyampaikan, sebaiknya Kadis Kesehatan, Dr.Sakdiah dan beberapa staf terkait dievaluasi dan diganti saja. Jika tidak, nama dan citra bupati akan rusak. Mereka mendesak pejabat ini diganti karena pelayanan dan kepemimpinan Kadis Kesehatan mereka nilai bertolak belakang dengan visi dan misi bupati di bidang kesehatan. Hal tersebut, menurut mereka, bisa dibuktikan dengan terjadinya dugaan KKN dalam pengangkatan Bidan PTT tahun lalu bila ingin lulus harus membayar Rp30 juta.

Kemudian,dugaanKKNlainnya diduga terjadi pada program Jamkesmas dan Jampersal 2011 untuk Madina Rp4.072.849.000 dengan rincian untuk dana JamkesmasRp2.317.800.000 dandana jampersal Rp1.755.049.000. Dana sekira Rp4 miliar tersebut disalurkan ke-26 Puskesmas se-Madina. Namun dalam penyalurannya terindikasi ada penyelewengan dana seperti pengklaiman pasien oleh bidan, menerima bayaran dari pasien Jamkesmas dan Jampersal. Bahkan, pegawai pengelola keuangan Jamkesmas dan Jampersal di kecamatan tidak mengetahui jumlah dana, dan pemotongan dana dari dinas kesehatan kabupaten. Indikasi KKN lainnya diduga terjadi dalam program NICE tentang program perbaikan gizi dengan alokasi dana Rp150 juta/ desa untuk 166 desa di Madina. Ditambah dengan fasilitator pendamping 83 orang yang dalam perekrutannya diduga pihakDinkesmemintauangRp15 Juta/orang. Menurut mereka, masih banyak lagi dugaan praktik KKN

lainnya meliputi kendaraan dinas sepedamotor untuk pegawai Puskesmas, serta pengadaan alat kesehatan (alkes), serta dugaan KKN lainnya. Atas dasar itu, MPC PP Madina meminta Kapolres, Kejaksaan, dan Kejatisu segera memperoses dugaan KKN pada Dinas Kesehatan Madina dalam menciptakan pemerintahan yang bersih. Menyangkut perusahaan panas bumi PT.OTP Gheotermal, MPC PP Madina meminta bupati supaya meninjau serta mengevaluasi perizinan/bentuk MoU dengan PT Sorik Marapi Geotermal Power yang ada sebelumnya. Danmerumuskannyakembali dengan memenuhi segala aspekbaikhukum,sosial,budaya, serta aspek lainnya secara bijak dan transparan. Perusahaan juga dimintamemenuhisegalaaspirasi maupun kewajibannya sesuai undang-undang berlaku. Massa MPC PP akhirnya bubar dengan tertib setelah perwakilan PP duduk bersama dengan melakukan dialog di ruangan Asiten III dihadiri Asisten 1dan II, yang dimediasi Polres Madina. (c14)

Suksesi Wali Kota P. Sidimpuan, PKS Ingin Pemimpin Muda PADANGSIDIMPUAN (Waspada): Partai Keadilan Sejahtera (PKS) ingin berkoalisi dengan partai lain, untuk mencari figur yang cocok didukung menjadi orang pertama di Kota Padangsidimpuan priode 2012-2017, yang prosesnya dijadwalkan pertengan 2012. Staf Daerah Dakwah II DPW PKS Sumut Khoiruddin Rambe (foto) juga anggota DPRD Kota Padang-simpuan mengatakan hal itu, ketika berkunjung ke Kantor Perwakilan Waspada Padangsidimpuan Selasa (3/1). “Dalam seleksi nanti, kita akan mencari sosok yang sudah diketahui track record-nya, sehingga masyarakat tidak meragukan. Selain itu, mengingat kondisi Padangsidimpuan yang kini cenderung stagnasi, calon pemimpin ke depan, sebaiknya muda danenergikserta berpengalaman karena dibutuhkan terobosan– terobosan yangsangatberanidan apabila salah bisa diingatkan,” ujarnya. KhoiruddinRambeyangselama ini dikenal sangat santun menyuarakanhatirakyatdidewan menjelaskan, saat ini partai sedang memproses pembetukan tim, tinggal menunggu SK dari DPW, sehingga daerah bisa bekerja. Ia mengatakan, Kota Padangsidimpuan saat ini sedang mengalami stagnasi, perlu terobosan di semua lini. “Kita prihatin melihat kondisi yang semakin suram, padahal potensi sebagai kota jasa dan pendidkan cukup banyak. Karena, jika kita menoleh

ke belakang, sebenarnya orang Padangsidimpuan itu lebih banyak berlatar belakang bisnis/ pedagang, sekiranya pemerintahan kota mengucurkan dana dengan porsi lebih besar diserta pembinaan. Kita yakin Padangsidimpuan akan menjadi pusat perdagangan di Sumatera bagian selatan,” ujarnya. “Apa sih susahnya jika kita gelontorkan dana APBD Rp10 miliar per tahun anggaran, untuk ekonomi mikro, termasuk pengerajin, dibuat pembinaan secarakontinusertapengawasan, karena dalam tubuh mereka mengalir darah bisnis. Saya optimis ini akan berhasil, dengan catatan, bantuan tersebut jangan digerogoti oknum, kemudian perizinan mereka dipermudah, lokasi mereka ditentukan, sehingga semua tertata,” katanya lagi. Selain itu, dijelaskannya, di Kota Padangsidimpuan ada dua perguruan tinggi, yang selama ini luput perhatian pemerintahan kota, padahal Padangsidimpuan

sebagai kota pendidikan, yakni Universitas Graha Nusantara yang didirikan Pemkab Tapsel tahun 1986. Universitasinisudahmemiliki sarana prasarana lengkap, serta sudah memenuhi persyaratan menjadi perguruan tinggi negeri, namun karena keberadaannya tidak menjadi perhatian akhirnya penegerian tersendat. Padahal, jika statusnya berobah, sudah dapat dipastikan, calon mahasiswa dari berbagai penjuru Indonesia akan berdatangan, sehinga berdampak positif bagi perekonomian kota. “Demikian juga STAIN Padangsidimpuan, yang para pengelolanya terus berjuang meningkatkanstatusnyamenjadi universitas, namun terkendala masalah pertapakan, mengakibatkan prosesnya juga tersendat, toh kesulitan pengelola STAIN ini untuk mendapat tanah tidak mendapat perehatian Pemko,” ujar Khoiruddin Rambe. Berpedoman kepada beberapa indikator tersebut, lanjut dia, sekiranyaKotaPadangsidimpuan yang sudah ditabalkan sebagai ibukota Provinsi Sumatera Tenggara itu, dikelola orang yang pas, tidak diragukan lagi masyarakatnya akan sejahtera. Ketika ditanya mengenai nama calon yang sudah beredar, apakah sudah ada sesuai kriteria yangakandiusung PKS,Khoiruddin mengatakan ada, namun bila adakualitasyanglebihunggulapa salahnyadidukung.“Karenapartai terbuka bagi siapa saja, asal sesuai ketentuan.” (a26)

P. Sidimpuan Stagnan, Gebrakan Wakil Wali Kota Ditunggu DILIHAT dari berbagai sudut pandang, pemimpin birokrat di Padangsdimpuan nyaris tidak melakukan apa punsepanjang2011. Sehingga, kesannya,kota bukan berjalan di tempat, tapi stagnan. Fakta yang terdata di tahun 2010 sama sekali tidak menunjukkanperubahanperbaikanberarti di tahun 2011, tapi sebaliknya. Semakin buruk. Walikota PadangsidimpuanDrsZulkarnainNasution bersama jajarannya, seperti bersikap masa bodo, seperti tidak menghiraukan keluhkesah rakyatnya , sehingga nama besar yang dulu disandanya sebagai tokoh krismatik, terkesan luntur. Kini, keagungannya semakin terpuruk, bahkan belakangan jarangmunculdidepanpublik. Jangankan acara rakyatnya, kegiatan Muspida pun dia jarang terlihat. Melihan kondisi Kota Padangsidimpuanyangmakin merana, demi masa depan kota, serta menjaga nama baik wali kota, sebenarnya Wakil Walikota Padangsidimpuan Drs.Maragunung Harahap yang masih energik harus mampu tampil berperan memotivasi para SKPD serta memberikan petunjuk kerja, sehingga mereka lebih maksimal melaksanakan tugas. Gebrakan Wawa ditunggu. Kondisi yang stagnan tersebut sesuai fakta dan pengamatan di lapangan , dapat dilihat dengan kasat mata lewat beberapa sampel, antaralain, jalan kota yang makin kupakkapik, seperti pintu masuk dari Pal XL arah kota jelang Simpang Balakka Nalomak, dengan lubang-lubang me-

ngangamenunggukorban.Bukan itusaja, masihjurusanyangsama, dari Kelurahan Batang Ayumi hingga ke galon minyak Sitamiang, panjangnya sekira 200 meter, benar – benar babak belur, apalagi saat musim hujan seperti sekarang ini. Kerusakan jalan di Kota Padangsidimpuanhampirdisemua lini, hanya tingkat kerusakan yang berbeda. Jika dibanding tahun lalu, kondisinya jauh lebih parah. Beberapa contoh, Jalan Imambonjol, Jalan SM Raja, Jalan Baru 1dan2dipusatkota,jalanmenuju SMA 6 Sadabuan. Bukan itu saja. Drainase tumpat. Bila hujan sedikit saja, air melimpah sehingga badan jalan tergenang atau menganak sungai. Kondisi demikian dapat kita saksikan pada setiap sudut kota. Sampel paling mudah, jika dariTerminal Pijorkoling menuju pusat kota, titik-titik paling sering tergenang alias banjir, sekitar Akper Suhada, Desa Sihitang, Padangmatinggi, Tugu Siborang, pusat pasar. Sebenarnya kurang masuk akal bila Kota Padangsidimpuan yang memiliki kemiringan itu, begitu mudah mengalami banjir. Tetapikarenarioltidakdibersihkan bertahun-tahun, sudah pasti tersumbat, menyebabkan air muncrat ke atas. Lebih memprihatinkan, penutup riol banyak yang bolong, bila tidak hati-hati pejalan kaki akan mudah terperosok . Memburuknya infrastruktur ini, karena Pemko terlalu pelit membelanjakan anggaran untuk pembangunan, hal ini dapat kita lihat dalam setiap APBD Kota Padangsidimpuan , belanja pegawaijauhlebihtinggidibandingkan pembangunan. Persentasenya paling tinggi 70:30 persen, jumlah yang minim itu tidak utuh ke

pembangunan. Selainitu,pengawasanterlalu lemah, sehingga dana yang diangarkan bagaikan hilang ditelan bumi, banyak bangunan yang begitu selesai sudah rusak, seperti bangunan irigasi Manunggang tahun anggaran 2011 berbiaya Rp 400 juta lebih. Beberapa minggu setelah selesai dikerjakan, jebol. Rehab jalan-jalan Kota Padangsidimpuan juga anggaran 2011, menurut pengumuman tender menelan anggaran Rp1,5 M.Volume pekerjaan tidak jelas, karena papan nama proyek tidak ada. Namun yang lebih memprihatinkan,begituditempelbeberapa hari, sudah muncul lagi lubang. Visi dan misi wali kota menjadikan Kota Padangsidimpuan sebagai kota perdagangan dan

jasa, bagaikan dilupakan. Karena, bila melihat kenyataan, peran ekonomi kerakyatan juga seperti kurang perhatian. Jika saat berdirinya kota, berjualan di kaki lima,hinggasekarangmasihtetap demikian. Karena ketiadaan modal serta pembinaan, mereka terus mempertahankan usaha demi sesuap nasi. Ahirnya, pusat pasar penuh denganpedagangkakilima,hingga membludak ke badan jalan, mengakibatkan kemacetan lalu lintas, mengakibatkan pengguna jalan sering saling ejek, yang bisa berujung saling maki. Hal ini membuat tanda tanya besar dalam hati masyarakat, apakah wali kota sudah jenuh, karena sudah sepuluh tahun memimpin Padangsidimpuan, belum dihitung sebagai walikota

administratif, atau faktor usia yang semakin renta. Kondisi Kota Padangsidimpuan ini terkesan hanya sebagai tontonan,. Anggota DPRD yang memiliki fungsi pengawasan, hanya sebagian kecil yang mau bersuara lantang,padahalsaat-saattertentu suara mereka sangat lantang ingin membela dan memperjuangkan rakyat banyak. Begitu juga sejumlah wartawan dan LSM seperti tumpul, malah tokoh agama dan tokoh adat sebagai benteng moral nyaris tidak bersuara sehingga terkesan mendukung keadaan. Ahirnya, masyarakat di akar rumput hanya bisa merintih dalam hati. * Sy.Nasution

Waspada/Sarmin Harahap

MASSA MPC PP Madina nyaris adu jotos dengan Satpol PP saat melakukan unjukrasa di Dinas Kesehatan dan Kantor Bupati Madina.

Pelantikan MPC PP Tapsel Dihadiri Yapto Dan Aweng P. SIDIMPUAN (Waspada): Kepengurusan Majelis Pimpinan Cabang (MPC) Pemuda Pancasila (PP) Kab. Tapanuli Selatan masa bakti 2011-2015 dijadwalkandilantik Jumat (13/12) di lapangan PTPN III Kebun Batangtoru, Desa Aek Pining, Kec. Batangtoru, Tapsel. Ketua Umum PP, Yapto Suryo Sumarno, dan Ketua MPWPPSumut,Anuar‘Aweng’ Shah, direncanakan turun langsunguntukmengukuhkan sekaligus melantik pengurus MPCPPTapselhasilMusyawarah Cabang (Muscab) 30 Mei 2011 di Tor Sibohi Nauli Hotel Sipirok, kemarin. “Proses pelantikan sudah 80 persen kita siapkan,” kata Ketua MPC PP Tapsel, Damris Nasution, didampingi Ketua Panitia, O.K. Hazmi Usman Siregar, Sekretaris Panitia, Hamzah Batubara, danWakil Ketua MPO, Drs. HM Yunan Nasution SH. MM, di secretariat mereka, Jalan Imam Bonjol, Kota Padangsidimpuan, Kamis (5/12). Unsur pimpinan inti MPC PP Tapsel yang akan dilantik itu antara lain, Ketua, Damris Nasution, Sekretaris, O.K. Hazmi Usman Siregar, Bendahara, Muhammad Syukur Siregar, Waspada/ist Ketua Majelis PermusyawaraKETUA MPC PP Tapsel, Damris Nasution (tengah), Sekretaris tanOrganisasi(MPO),Ir.Aldinz Rapolo Siregar, Wakil Ketua, O.K Hazmi Usman Siregar (kiri) dan Bendahara Muhammad Drs. HM.Yunan Nasution SH. Syukur Siregar, unsur pimpinan PP Tapsel yang akan dilantik MM, Edi Giri, Aswin Efendi Ketua Umum PP,Yapto S, dan Ketua MPW PP Sumut, Anuar ‘Aweng’ Siregar, dan Rahmat Nasution, Shah (latar) pada 13 Januari nanti di Batangtoru. S.Sos. Damris Nasution menambahkan, pelantikan mendorong konsep kepemimpinan di daerah ini akan dihadiri 180 unsur pengurus ranting PP dalam mewujudkan kesejahteraan rakyat. “Konsep SARASI (Syahrul M Pasaribu – Aldinz yang ada di 14 Pimpinan Anak Cabang (PAC) seTapsel. Kemudian, ratusan undangan yang terdiri Rapolo Siregar) sudah teruji kebenarannya dalam daripejabatpemerintahandaerah,instansivertikal, mewujudkan Tapsel yang sejahtera. Karena itu OKP, Ormas, tokoh agama, tokoh masyarakat, MPC PP Tapsel berkewajiban mendukung dan mendorong perwujudannya. Tapi jika ternyata dan unsur masyarakat lainnya. Ditanya konsep seperti apa yang akan tidak terealisasi di lapangan, maka PP siap berada dijalankannya dalam memimpin MPC PP Tapsel digarda terdepan untuk mengingatkan SARASI ke depan. Damris yang menjabat ketua MPC PP akan perwujudan konsepnya itu,” kata O.K Hazmi. KenapapelantikannyadiBatangtoru?Katanya, untuk periode kedua kalinya ini mengatakan, ada sebuah paradigma baru yang akan dijalankan Batangtoru merupakan daerah kecamatan yang saat ini dilirik banyak investor, sehingga sangat bersama pengurus di periodesasi ini. “Kita akan mengubah ‘O3’-nya. Yakni dari membutuhkan pengawalan dan pengawasan. Otot, Omong, dan Otak, menjadi Otak, Omong, Karenanya,dipandangsangatperlumenunjukkan dan Otot. Jadi setiap anggota PP itu tidak lagi kepada para investor, PP ada dan hadir sebagai dicitrakan sebagai seorang preman, tetapi sebagai organisasi masyarakat yang siap mengawal dan anggota Ormas yang kehadirannya memiliki mengawasi segala kegiatan mereka di wilayah itu. SedangkanWakil Ketua MPO PP Tapsel, HM kegunaan fleksibel di tengah masyarakat,” jelasnya. Ketua Panitia O.K. Hazmi menambahkan, Yunan Nasution, menyebut unsur kepengurusan pelantikan MPC PP Tapsel ini bertema; ‘Mendo- MPC PP Tapsel yang akan dilantik ini berasal dari rong dan Mendukung Konsep Pembangunan berbagai kalangan masyarakat.Yakni mulai dari SARASI di Pemkab Tapanuli Selatan’. Acara diisi politisi, pengusaha, birokrat, aktivis, akademisi, penyerahan tali asih dan penghargaan kepada tokoh agama, masyarakat biasa, anak jalanan, pinisepuh dan sesepuh PP se-Tapsel. Kunjungan dan juga preman. “Saya melihat pengurus MPC PPTapsel masa ke Lembaga Pemasyarakatan (LP) Sipirok, dan bakti 2011-2015 ini sebagai sebuah bentuk kesatumenyantuni anak yatim piatu. Ditanya kenapa harus mengambil thema an dari keberagaman profesi dan latar belakang tersebut pada pelantikan ini. Menurut O.K. Hazmi, masyarakat Tapsel. Saya yakin dengan keberPP adalah organisasi yang berasal dari rakyat dan agaman ini, PP di Tapsel akan semakin maju dan untuk rakyat. Sehingga sudah menjadi abadi,”kataYunanyangjugamantanKepalaBadan kewajibannya untuk mengawal, mengawasi, dan Pertanahan Nasional Tapsel. (a27)

Bupati Palas Minta PT VAL Tuntaskan Lahan Eks Transmigran HUTARAJA TINGGI (Waspada): Bupati Padanglawas (Palas) meminta agar PTVictorindo Alam Lestari (PT. VAL) segera menuntaskan permasalahan lahan dengan warga Desa Ujung Batu SP 3, Kecamatan Hutaraja Tinggi yang menurut kesepakatan masih mengalami kekurangan untuk 41 kepala keluarga (KK) atau 71,75 ha. Masalah ini diharap segera diselesaikan dengan melibatkan pemerintah dan DPRD Palas. Demikian Bupati Palas, H. Basyrah Lubis, SH melalui Sekda Drs. H. Gusnar Hasibuan, Kamis (5/1). Karena, sejak tahun 1983 mulai diserahkan dan dibangun hingga sekarang permasalahan lahan eks warga transmigran Kecamatan Hutaraja Tinggi itu masih belum tuntas. Padahal dari awal perjanjian, pihak PT VAL sebagai perusahaan bapak angkat akan memberikan kebun plasma kelapa sawit kepada warga 2 ha per KK. Sehingga, 250 KK warga Ujung Batu SP 3 menyerahkan lahan usaha I dan lahan

usaha II g bersertifikat kepada pihak perusahaan. Ironisnya, seperti disampaikan warga peserta plasma Desa Ujung Batu SP 3, telah sekian tahun lahanusahawargabesertasertifikatnyadiserahkan kepada pihak manajemen PTVAL, tetapi sampai saat ini masih ada 41 KK yang belum mendapat pembagian dari kebun plasma masyarakat. Sekda mengungkapkan, Pemkab Palas sangat kecewa terhadap sikap perusahaan bapak angkat PT VAL yang terus mengulur waktu penyerahan lahan kepada warga peserta plasma berikut sertifikat sesuai objek lahan. Hal senada juga disampaikan anggota DPRD dari F. PPP H. Erwin Hamonangan Pane. Sebagai wakil rakyat, dia dengan tegas menyampaikan, PT VAL selaku perusahaan bapak angkat jangan main-main dengan hasil mediasi dengan unsur muspida plus belum lama ini, bahkan ditindaklanjuti surat Menteri Tenaga Kerja dan Transmigrasi. (a33)

Distan Kembangkan Jeruk Keprok Maga


PINTU masuk ke terminal Hutaimbaru sejak dibangun tidak pernah berfungsi. Terminal ini dibangun dengan uang rakyat miliaran rupiah.

PANYABUNGAN (Waspada): Jeruk keprok maga sejak puluhan tahun menghilang akibat serangan virus CVPD, kini kembali dikembangkan Pemkab Madina melalui Dinas Pertanian (Distan), dengan cara menanam kembali ribuan batang jeruk di atas lahan 50 ha, di Desa HutatinggiHuta Namale, Kecamatan Puncak Sorik Merapi. Demikian disampaikan Kadis Pertanian Madina, Taufik Zulhandra di damping Sekretaris, Jhon Amriadi, Kamis (5/1) di kantornya usai meninjau kebun jeruk di Hutatinggi. Dijelaskan, jeruk keprok maga yang harum wanginya dan manis rasanya, menjadi buah unggulan nasional sesuai keputusan Menteri Pertanian Tahun 2003. Karena itu, sesuai implementasi Kepmenpan

dan Bupati Madina, Hidayat Batubara dalam meningkatkan mutu dan kuantitas tanaman holtitulkura di Madina, Dinas Pertanian mengembangkan jeruk keprok. Program ini berjalan sejak 2011 mulai dari pembersihan lahan, pelobangan sampai ke penanaman, sampai tahap menunggu proses pembibitan dimulai sejak 9 bulan lalu. Program itu diharapkan bisa membantu ekonomi warga. “Tahun 1980-an, warga tidak membuat kebun khusus jeruk keprok maga kecuali hanya sebagai hiasan pemukinan yang berjumlah hitungan jari. Tapi pohon jeruk yang rindang dan berumur 50 tahunan bisa menghasilkan 200 kg per batang, dengan harga mencapai Rp25.000/kg. (c14)


B5 Mencari Ikon Kota Medan

WASPADA Jumat 6 Januari 2012


Prediksi SBY Suhu Politik Memanas 2012 Realistis


epertinya tidak ada angin tidak ada hujan saat Presiden Susilo Bambang Yudhoyono (SBY) membuat pengakuan kalau suhu politik tahun ini memanas. Tapi, hal itu realistis dan kalau ada pihak yang menyalahkan SBY terkait dengan memanasnya suhu politik penyebabnya tidak lepas dari besarnya ketergantungan dirinya selaku presiden pilihan rakyat pada parpol-parpol koalisi (Setgab) pimpinan Aburizal Bakrie. Kalau SBY saja sudah memprediksi tahun 2012 akan diwarnai dinamika politik yang sangat cepat dan berpotensi memunculkan gesekan-gesekan apabila tidak dikelola dengan baik. Konon pula orang lain. Apalagi di kubu oposisi dan pihak yang termajinalkan. Sebelumnya, sejumlah lembaga survei memperlihatkan penurunan tajam tingkat popularitas dan elektabilitas orang nomor satu itu. Bahkan, menurut Lingkaran Survei Indonesia (LSI) kepuasan publik terhadap pemerintah SBY jilid kedua merosot dan hanya mencapai 37,7 persen saja. Sebanyak 44,7 persen publik menyatakan tidak puas dan sisanya tidak tahu. Kondisi itulah yang menjadikan kabinet SBY pasca reshuffle menjadi beban pemerintah dan Presiden SBY tidak bisa buang badan lagi. Andai situasi itu terus berlangsung, sulit bagi pemerintah untuk mendapatkan kepercayaan rakyat lagi sehingga tidak tertutup kemungkinan muncul upaya melengserkan SBY di tengah jalan, terkena impeachment, jika rakyat sudah tidak sabar menunggunya lebih dua tahun lagi. Gonjang-ganjing panggung politik sudah terlihat dalam tiga bulan belakangan ini dan dipastikan semakin memanas dalam bulan-bulan mendatang. Masalahnya tahun ini merupakan barometer keberhasilan parpol dalam menghadapi Pemilu dan Pilpres 2014. Jika tahun 2012 ini ada parpol masih lengah, belum menggerakkan program pencitraannya maka dapat dipastikan parpol seperti itu, hanya ogah-ogahan, bakalan ditinggal masyarakat. Adalah fakta dan realistis.Setiap menjelang Pemilu dan diikuti dengan Pilpres, suhu politik menghangat dan bisa sangat panas menimbulkan ëíkorsletingíí di kalangan elite politik dan kekuasaan. Sebagai presiden Intisari seharusnya SBY tidak perlu mengungkapkan situasi yang semakin memanas dengan Presiden SBY hendaknya mengaitkannya pada akrobat para politikus dan media massa karena kalau Kepala Negara melakukan introspeksi saja sudah berbicara seperti itu maka di kalangan diri terkait dengan im- bawah dapat dipastikan semakin cepat melakukan reaksi. Sebaiknya masyarakat tenang bauannya agar para po- saja, melihat dulu sepak terjang para elite politik litikus tidak membuat ke- dan kekuasaan dalam menjalankan fungsi dan tanggung jawabnya. Sebab, kedua belah pihak gaduhan di tahun 2012 memberi kontribusi besar terjadinya gonjangganjing politik di dalam negeri saat ini dan ke depannya. Presiden SBY menjelang pergantian tahun 2011/2012 mengeluarkan ajakan agar seluruh elite politik menjaga kestabilan politik, juga dengan media jangan memanasmanasi. Para politikus diminta tidak membuat kegaduhan politik yang bisa mengganggu kestabilan politik nasional, ekonomi, keamanan. Hemat kita, walaupun ajakan itu mendasar, namun tidak selamanya orang-orang politik yang memicu kegaduhan panggung politik. Sedangkan media hanya berperan menyampaikan situasi yang terjadi. Tidak ada upaya memanas-manasi situasi. Masalahnya, orang-orang birokrat di pemerintahan pun, termasuk para menteri SBY, juga berkontribusi ëímengacaukaníí situasi menjadi tidak kondusif dengan kebijakan-kebijakannya yang mendua. Di satu sisi mereka mengaku berpihak pada rakyat namun barang-barang impor terus membanjiri pasar domestik. Di satu sisi mengaku menjalankan penegakan hukum namun faktanya kasus korupsi merajalela di lembaga yang dipimpinnya. Bahkan, gedung wakil rakyat di Senayan sulit dimasuki rakyat yang menuntut keadilan. Petani, nelayan dll acapkali melakukan aksi unjuk rasa ke DPR RI namun sambutan wakil rakyat terlihat dingin. Rakyat menjahit mulut tanda keprihatinan atas matinya penegakan hukum terkait kasus tanahnya diambil konglomerat menjadi perkebunan kelapa sawit namun tidak ditindaklanjuti. Kalau baik-baik menyampaikan aspirasi tidak didengar, wajar saja kalau terjadi aksi kekerasan, pendudukan pelabuhan yang berbuntut anarkis. Oleh karena itu semua pihak, baik eksekutif dan legislatif, termasuk Presiden SBY sebaiknya melakukan mawas diri, jangan terlalu banyak bicara tanpa bukti karena hanya menimbulkan kritik balik dari lawan-lawan politiknya. Lakukan perubahan dengan lebih banyak bekerja untuk rakyat, hindari polemik dan komentar-komentar yang ëíasbuníí karena hanya akan menimbulkan gonjang-ganjing politik belaka, sangat tidak produktif. Walaupun tahun 2012 diramalkan suhu politik tinggi, semakin mendekati Pemilu dan Pilpres akan semakin mengkhawatirkan. Namun jangan sampai mengganggu stabilitas politik nasional dan merusak tatanan kehidupan rakyat. Jangan sampai menimbulkan kerusuhan yang tidak diinginkan karena semua itu hanya membuat rakyat semakin menderita nantinya. Mari sama-sama kita introspeksi diri. Jangan saling menyalahkan. Jika anda menunjuk orang dengan telunjuk pada hakikatnya tiga jari menunjuk diri anda.+


Faks 061 4510025


+6281361970409 Krue seumgat,hari senin 26 des 2011, 7 tahun yg lalu 26 des 2004, mata dunia tertuju ke bumi ISKANDAR MUDA, manusia menagis dgn gelombang air yg tinggi menyapu apa yg ada,Tsunami nama yg resmi abadi di sanubari, apa pertanda, MUSIBAHKAH, COBAANKAH, PERINGATANKAH mungkin KUTUKAN atau RAHMAT dgn Tsunami,ACEH DAMAI terjadi, renungan 7 tahun tsunami mari koreksi diri mohon pada ILAHI semoga Aceh/Indonesia umumnya jauh dr bencana, mari brzikir/ berdoa mendekat dari padaNYA semoga tentram bumi ini, REJA FC, JK ALUE BIE/Shop Helsinki mengucapkan Selamat Renungan 7 tahun Tsunami, +6285359039474 Kepada BPK - RI ACEH untuk dapat kiranya mengaudit dana keamanan pilkada di polres gayo lues senilai Rp. 2 milyar dari dana bantuan pilkada, karena indikasinya telah di habiskan, sementara pilkada masih belum jelas. +6285222920309 Perekonomian suatu negara bukan cuma di lihat dari pendapatan penduduknya, tapi juga nasib penduduknya yg tlh mati. coba baqaimana BANDINGKAN !!! DRAKULA, di Eropa: memakai baju jas mewah, rambut rapi, berpendidikan&tinggal di kastil megah,. . Vampir di Cina: memakai baju adat bangsawan cina, pakai perhiasan seperti kalung dan giok, tinggal di kuil atau istana,. KUNTILANAK di Indonesia: cuma pake daster putih oblong, lingkaran mata hitam &muka pucat karena bertahun2 nggak makan, rambut panjang nggak terurus, tinggal di gudang2 tua, atau lorong2 gelap, BETAPA MISKINNYA NEGARA KITA SAMPAI2 PARA HANTU PUN BEGITU MIRIS NASIBNya. . . +6285261172936 Dalam pengertian bahasa Arab Sayyidina itu artinya pemimpin setingkat lurah atau penghulu _ maka dialih kan orang pengertiaanya jadi penghulu seluruh para nabi nabi_ kalau setingkat raja disebut Amir_ kalau penguasa disebut Malik _ kalau penguasa yg merangkap pemimpin agama (islam) disebut khalipah dan memang tidak ada hadits yg mengatakan kalau selawat itu tidak boleh pakai sayyidina _ Hanyasanya nabi mencontohkan kepada kita mengucapkan sélawat tidak pakai sayyidina dan di Al Qur’an pun tidak ada gelar Nabi pakai sayyi dina _ duh rendahnya pangkat nabi setingkat lurah (sayyidina)_ atau nabi setingkat sahabat _ sayyidina Abu Ba kar, sayyidina Ali, sayyidina Umar, syaidina Usman _ sampai sekarang pun 2011 gelar raja raja Arab tidak ada pakai sayyidina karena seting kat penghulu _ kadang penghulu diartikan tuan kadi_hindari saja perkataan atau ucapan yg nabi sendiri tidak pernah méngucapkan sayyidina pada dirinya _ Wassalam gedung johor +6285371087167 Dalam rangka Ulang tahun, Selain Road to Dakwah, Waspada juga hendaknya memasyarakatkan penggunaan Dinar dan Dirham yang dewasa ini mulai banyak dibicarakan para ekonom muslim untuk mengatasi krisis ekonomi global. Waspada bisa membuka gerai dinar-dirham misalnya untuk mahar nikah serta penggunaan lainnya, dan keuntungannya bisa membantu ummat, melalui program peduli ummat Waspada sekarang ini.

Oleh Budi Agustono Mengingat Kesultanan Melayu pernah menjadi orientasi peradaban di wilayah ini, ada yang mengajukan Istana Maimon menjadi ikon kota Medan. Namun karena problem kultural dan historikal, maka banyak yang menentang.


kon adalah lambang atau logo berupa orang, bangunan, simbol, dan gambar yang yang mempunyai ikatan emosional yang dirasakan warga dari masa tertentu dalam sejarah. Logo, orang, simbol atau gambar bukan bukan sesutu yang sembarangan, tetapi ia memiliki keterkaitan dengan keterkenalan atau popularitas, kualitas ekspresi visualnya, dan tempatnya dalam memori kolektif warga. Sebuah ikon kota merupakan pertanda pertautan kelampauan dan kekinian. Dengan mempertautkan kelampuan dan kekinian ini sebuah masyarakat tampak mengalami kontinuitas dalam menapaki kehidupan bermasyarakat. Ada kalanya masyarakat kehilangan diskointinuitas dengan masa lalunya karena ada bagian masa lalu dengan sengaja dihilangkan dan pada saat yang sama ingin mempertahankan bagian lain dari masa lalu itu sehingga melahirkan fragmentasi masyarakat. Oleh karena itu kehadiran sebuah ikon dalam masyarakat menjadi penting sebagai penanda masyarakat. Penanda dapat menghubungkan kelampauan dan kekinian sekaligus menjadi pengingat untuk agar sebuah kota mudah dikenal publik. Ikon kota memiliki makna bersama, dirasakan bersama, dan menjadi simbol bersama sekaligus menjadi dorongan mendukung terciptanya identitas kota. Karena itu pencarian ikon kota sering terkait dengan sejarah dan budaya setempat atau ingatan bersama masyarakat. Dengan lain kata, ikon kota tidak dibentuk dan diciptakan hanya sematamata mendasarkan diri pada kekinian, tetapi selalu dihubungkan dengan kelampauan. Di belahan dunia lain kota besar selalu memiliki ikon kota, an urban icon, yang membuat kota menjadi dikenal publik (mancanegera). Ikon kota besar dunia selalu terkait dengan bangunan bersejarah, patung, dan menara yang mempunyai ikatan dengan sejarah dan budaya masyarakatnya. Banyak gedung (bersejarah) memiliki a civic function, tetapi tidak semua gedung dapat menjadi ikon kota. Ikon kota dapat men-

cerminkan dan membentuk identitas masyarakatnya. Amerika Serikat mempunyai statue of liberty sebagai ikon kota, Paris memiliki Menara Eiffel, China memiliki Tembok Besar, Singapura ada Patung Singa, dan Jakarta ada Monas yang yang menjulang tinggi. Ikon kota besar ini hampir semuanya terkait dengan bangunan bersejarah dan tidak ada yang diciptakan terlepas dari aspek kesejarahan dan kultural masyarakatnya. Sama seperti dengan kota besar lainnya, ikon kota yang tersebar di nusantara ini, digali dan diciptakan dari khasanah kelampauan. Ikon kota Surabaya Tugu Pa h l a w a n , Pontianak ada Tugu Khatulistiwa, Tanjung Pinang ada Monumen Fisabililah, Yogyakarta ada TuguYogyakarta, Ambon ada Patung Pattimura, dan sebagainya. Jika disimak dari ikon kota besar din nusantara ini sebagian besar berbentuk patung atau monumen yang memuat aspek sejarah dan budaya masyarakat. Medan sebagai ibukota Provinsi Sumatera Utara sampai sekarang ini tidak memiliki penanda (ikon) kota. Tiadanya ikon kota Medan lebih disebabkan keberagaman masyarakat. Dalam masyarakat yang beragam seperti kota Medan, setiap kelompok etnik memiliki tidak saja tokoh sejarah yang mempunyai kontribusi dalam mengusir kolonialisme, tetapi juga pada pasca kemerdekaan karena kontribusi tokoh etnik etnik ini. Kelompok etnik ini berkompetisi mengajukan tokoh sejarahnya agar disematkan dalam ruang pu-

blik seperti nama jalan, gedung, dan perguruan tinggi. Di samping itu ada pula mengabadikan tokoh sejarah kelompok etnik ini dalam bentuk patung dan monumen yang tersebar di penjuru kota Medan. Tidak mengherankan sewaktu ada nama tempat, jalan atau gedung hendak diberi nama, setiap kelompok etnik akan berupaya mengajukan tokoh sejarahnya. Akibatnya, di antara kelompok etnik ini saling berkontestasi agar nama tokoh sejarahnya diabadikan di ruang publik. Kontestasi kelompok etnik yang ingin mewarnai ruang publik inilah yang membuat sulitnya mencapai kesepakatan bersama dalam membentuk ikon kota Medan. Lintas etnik Situasi yang demikian ini semakin sulit mencari kesepakatan dalam menentukan ikon kota Medan ketika banyak tokoh publik yang anti sejarah. Sikap anti sejarah ini diperlihatkan dengan sikap resistensinya terhadap bangunan bersejarah sebagai peninggalan (warisan) kolonial. Salah satu contoh sikap anti sejarah itu diperlihatkan ketika patung Nienhuys, seorang pelopor industri perkebunan yang kemudian mempunyai sejarah kelam di Sumatera Utara, dibongkar dan dihancurkan dari pelataran Kantor Pos. Demikian pula dengan bangunan bersejarah yang didirikan bersamaan dengan dimulainya pembangunan kota Medan menjadi kota metropolitan kolonial pada pertengahan atau menjelang akhir abad kesembilan belas sampai perempat abad keduapuluh seperti bangunan yang sekarang masih berdiri tegak di sekitar Esplanade (Lapangan Merdeka) antara lain Balai Kota, gedung Bank Indonesia, Hotel Darma Deli, Kantor Pos, gedung Bank Mandiri, Gedung Lonsum, Kesawan, rumah besar Tjong A Fie, gedung Badan Kerja Sama Perkebunan, Masjid Raya, Istana Maimon, Taman Sri Deli, dan Menara Ajer Beresih (Air Bersih) adalah bangunan bersejarah

peninggalan kolonial, yang tidak pernah mendapat perhatian serius untuk dilindungi. Di beberapa tempat di sekitar Medan beberapa bangunan bersejarah warisan kolonial dirubuhkan Pemko Medan dan sebagai gantinya berdiri gedung perkantoran modern, hotel atau pusat perbelanjaan modern. Jika penciptaan ikon kota terkait dengan ikatan emosional sejarah yang dirasakan bersama maka salah satu bangunan warisan kolonial ini dapat diciptakan menjadi ikon kota Medan. Mengingat kesultanan Melayu pernah menjadi pemegang kekuasaan dan orientasi peradaban di wilayah ini ada yang mengajukan Istana Maimon menjadi ikon kota Medan. Namun karena problem kultural dan historikal dari kesultanan Melayu di masa lalu maka banyak yang menentang Istana Maimon menjadi ikon kota Medan. Begitu juga dengan Masjid Raya yang dibangun para baron perkebunan dan bantuan Tjong A Fie, salah seorang taipan terkaya di Asia Tenggara pada masanya, jika dijadikan ikon kota Medan kurang memberi energi bagi pluralitas masyarakat Medan. Dengan memerhatikan karakteristik masyarakat Medan yang plural tak pelak jika mencari ikon kota adalah sesuatu yang tidak mempunyai ikatan dengan kelompok etnik tertentu. Ikon kota seharusnya memancarkan lintas etnik. Tetapi ia, ikon kota itu mempunyai historical and cultural bonds kelampauan di wilayah ini. Bila di kota besar ikon kota selalu berbentuk patung, monumen, menara, dan gedung yang melambangkan kebesaran dan sekaligus pengingat glorifikasi masa lalu, maka jika Medan ingin mempunyai ikon yang dapat diterima publik adalah se-suatu yang lintas etnik yang memiliki ikatan kelampauan dengan wilayah ini. Di sekitar jantung kota terdapat bangunan bersejarah semisal Balai Kota, gedung Bank Indonesia, Kantor Pos atau Menara Ajer Beresih. Gedung dan menara air ini perlu dipertimbangkan menjadi ikon kota Medan. Meski merupakan warisan kolonial, tetapi bangunan bersejarah ini tidak saja memiliki arsitektur yang menawan dan berkelas dunia seperti yang ditunjukkan studi Cor Passchier, tetapi juga terlepas dari nuansa agama dan etnisitas. Dengan mengusung nuansa yang lintas etnik dan budaya bangunan bersejarah ini dapat dipertimbangan dalam pencarian dan penciptaan ikon kota Medan. Penulis adalah Staf Pengajar Jurusan Sejarah Fakultas Ilmu Budaya USU.

Petrus ‘Bunga-Bunga’ Pilkada Aceh Oleh Sofyan Harahap Situasi di Aceh saat ini memang masih terbilang‘amanaman’saja karena aksi petrus yang terjadi dalam sebulan terakhir ini langsung mendapat perhatian dari Mabes Polri dan Polda Aceh.


aminan sudah diberikan Mabes Polri bahwa pelaksanaan Pilkada Gubernur Aceh pada 16 Februari mendatang berlangsung aman. Namun begitu, banyak pihak tetap khawatir dengan situasi panas terkait maraknya aksi ‘petrus’ (penembak misterius) yang sudah memakan banyak korban tewas maupun luka-luka dari kalangan warga pendatang khususnya dari P. Jawa. Sekalipun sudah ada statement dari pihak terkait bahwa aksi petrus di Aceh tidak ada kaitannya dengan Pilkada Gubernur Aceh dan Pilkada Walikota maupun Bupati di Aceh, namun fakta menunjukkan pada publik bahwa rangkaian penembakan membabi-buta itu bersamaan dengan mencuatnya polemik antar-elite politik di Aceh terkait Pilkada yang semakin mendekat. Sehingga muncul hipotesis bahwa situasi politik di Aceh memanas bukan kriminal murni menjadi fakta empiris. Masih sulit menduga-duga siapa dalang di balik munculnya aksi penembakan brutal di Aceh menjelang Pilkada Gubernur Aceh maupun Pilkada Bupati dan Walikota saat ini. Kalau melihat sasarannya adalah orang-orang Jawa yang mencari makan di Aceh sepertinya meniru modus pada masa konflik bersenjata antara GAM dengan ABRI/TNI/Polri di masa Orde Baru yang baru enam tahun selesai di masa pemerintahan Presiden Susilo Bambang Yudhoyono danWapres Jusuf Kalla dengan kesepakatan damai diteken di Helsinki, Finlandia, pada15 Agustus 2005. Jadi inspirasi pejuang Moro Tidak hanya rakyat Aceh dan tokohtokoh nasional kita saja yang gembira dengan kemajuan yang dicapai Aceh saat ini, tapi juga dunia internasional, termasuk PBB. Bahkan, keberhasilan GAM menuntut otonomi seluas-luasnya di Aceh menjadi inspirasi dan pemicu semangat juang bagi pemimpin pemberontak Front Pembebasan Islam Moro (MILF) untuk memperoleh hak otonomi yang sama. Jikalau meraih kemerdekaan bagi bangsa Moro terlalu berat digapai setidaknya otonomi khusus bisa dirasakan warga Muslim di sana seperti halnya warga Aceh saat ini. Tuntutan rakyat Aceh agar kekayaan alamnya yang melimpah dikembalikan dalam jumlah besar sampai 70 persen bagi kemakmuran rakyat Serambi Makkah dan kurang dari 30 persen saja yang dibawa ke pusat kini menjadi dambaan bagi para pejuang bangsa Moro di Pulau Mindanao. Wa-

laupun pemerintah Filipina sudah menjanjikan sebuah ‘otonomi yang lebih asli’ namun pejuang MILF/Moro tetap waspada dan untuk sementara menolak karena khawatir itu hanya janji dan trik militer untuk memberangus kekuatan militer MILF. Front Pembebasan Nasional Moro yang dipimpin Nur Misuari, yang beberapa tahun lalu menjadi gubernur pertama di Mindanao, dalam keterangannya kepada wartawan Iinternasional mengatakan pihaknya berusaha bisa seperti bangsa Aceh. Perjuangan GAM meski banyak menelan korban akhirnya sudah dihargai dengan ditekennya MoU Helsinki. Dengan demikian kemakmuran bagi rakyat Aceh hanya tinggal waktu jika dikelola dengan benar. Memang pada saat ini pimpinan GAM yang dulu disebut pemberontak dan kaum separatisme mencapai kejayaan dengan memegang tampuk kekuasaan di level gubernur (provinsi) hingga kabupaten dan kota.Hal itu bisa mereka raih berkat kekompakan eks pejuang GAM dalam memenangkan Pemilu dan Pilkada sehingga eks petinggi GAM mampu menduduki posisi penting di eksekutif dan legislatif. Menurut saya, perjuangan bangsa Moro di Mindanao atau Filipina Selatan tinggal selangkah lagi dengan berlanjutnya perundingan damai di Malaysia dan tawaran proposal saling menguntungkan yang coraknya hampir sama dengan Aceh. Misalnya terkait dengan tawaran baru pada masalah pendapatan dan penggunaan sumber daya alam di selatan Filipina yang dapat memastikan kesinambungan otonomi dan masa depan wilayah potensial itu. Di dalamnya memang ada poin mengenai penghancuran senjata, pelucutan senjata, demobilisasi, rehabilitasi kombatan, dan proses mengarah ke penegakan hukum, seperti yang berlaku di Aceh hemat saya harus dikawal oleh lembaga dan tokoh kredibel di level global. Tawaran dari delegasi pemerintah Filipina itu jelas mengakui identitas bangsa Moro dan sejarahnya mengingat mayoritas penduduk di Mindanao Muslim. Tawaran ini menghadirkan kemungkinan sebuah otonomi yang lebih berdaulat, lebih bisa bekerja, dan juga lebih asli di daerah bangsa Moro, demikian pernyataan Kantor Penasihat Presiden Filipina untuk Proses Perdamaian (OPAPP) dalam sebuah rilis, Xinhua. Kantor berita Cina ini menyatakan, daerah otonomi untuk Muslim Mindanao (ARMM) memungkinkan seka-

rang ini berdasarkan pemahaman yang seimbang atas evaluasi kegagalan-kegagalan di masa lalu. Seperti diketahui krisis di Mindanao membuat terbentuknya gerakan pejuang Moro, seperti layaknya GAM mereka berjuang dengan senjata dan militan sekalipun menghadapi persenjataan berat dari militer Filipina yang dibantu AS. Bunga-bunga Pilkada Situasi di Aceh saat ini memang masih terbilang‘aman-aman’ saja karena aksi petrus yang terjadi dalam sebulan terakhir ini langsung mendapat perhatian dari Mabes Polri dan Polda Aceh. Walaupun para pelakunya belum tertangkap, juga modusnya belum diketahui, namun diperkirakan aksi serupa sudah dapat diantisipasi oleh polisi sehingga kemungkinan timbul situasi ‘chaos’ sangat tidak mungkin terjadi jika polisi siaga satu. Kelompok penentang Pilkada sendiri sudah mengeluarkan pernyataan tidak terlibat dalam kasus penembakan yang terjadi selama ini. Lagi pula, kalaupun mereka ingin mengacau dipastikan tidak akan efektif. Sebab, kekuatan mereka sendiri sudah terpecah dalam beberapa kelompok di antaranya berada di pihak Irwandi dan Nazar selaku incumbent Gubernur danWakil Gubernur Aceh. Secara hukum kedaulatan mutlak sekalipun putusan MK-lah yang menjadikan jalannya pilkada dan kekhususan Aceh sebagaimana termuat dalam Undang-Undang Nomor 11 Tahun 2006 tentang Pemerintahan Aceh menjadi polemik di kalangan elite politik dan kekuasaan di sana. Tapi jika kita merujuk UU No 11/ 2006 maupun kesepakatan damai (MoU) yang diteken di Helsinki maka ‘gugatan’ Partai Aceh punya dasar kuat dan benar. Sebab, calon perseorangan dalam pilkada secara jelas disebutkan hanya berlaku untuk satu kali saja, yaitu pada Pilkada Gubernur Aceh 2006 yang dimenangkan pasangan Irwandi Yusuf dan M. Nazar. Karena hanya sekali maka untuk seterusnya tidak dibolehkan lagi. Jika merujuk ke situ maka Irwandi tidak hanya gagal mencalonkan diri dari Partai Aceh tapi juga melalui jalur perseorangan. Upaya kubu Irwandi meminta fatwa ke MK ternyata membuahkan hasil sehingga siapa saja boleh mencalonkan diri asal mengikuti prosedur baku dan memenhi syarat yang dibuat Komisi Independen Pemilihan (KIP) Aceh. Putusan MK membatalkan ketentuan Undang-Undang Nomor 11 Tahun 2006 tentang Pemerintahan Aceh dan nyata-nyata tidak sejalan dengan MoU Helsinki dinilai cacat hukum oleh Partai Aceh. Itu sebabnya mereka memboikot dengan tidak mendaftarkan calonnya dalam Pilkada Gubernur Aceh. Padahal peluang Zaini Abdullah dan Muzakkir Manaf cukup besar memenangkan pilkada. Keduanya bukan takut kalah

tapi semata-mata menuntut kebenaran. Jika kemudian muncul sikap pro dan kontra terkait putusan MK yang berkekuatan hukum tetap, termasuk aksi petrus maka anggaplah itu semua hanya‘bungabunga’ menjelang pilkada dan waktulah yang akan menjawab: siapa benar, siapa salah, siapa yang merekayasa. Penutup Yang pasti, situasi politik di Aceh saat ini semakin memanas. Korban sudah berjatuhan, stabilitas keamanan pun sedikit terusik. Kalau semula banyak pihak berpendapat dengan keluarnya putusan MK masalah berakhir. Ternyata tidak. Konflik seputar regulasi Pilkada Aceh terus berlanjut di kalangan rakyat Aceh yang sudah melek hukum. Hal ini membuat KIP Aceh dan KIP Kabupaten/ Kota menjadi dilematis. Ibarat pepatah: diteruskan mati ibu, tak diterusklan mati bapak. Pilihan berat, tapi putusan harus ada. Pilkada Gubernur Aceh berikut Pilkada Wali Kota dan Bupati se-Aceh sebaiknya jangan sampai ditunda. Sebab, dampak negatifnya bisa jauh lebih besar. Dan tidak ada jaminan kalau jadwal Pilkada ditunda masalah yang muncul dan me-nimbulkan delik hukum bisa diselesaikan. *** Penulis adalah wartawan Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.


Plt Gubsu targetkan masalah tanah selesai Mei 2012 Jangan yakin kali pak! Komunikasi tak baik, pejabat Pemko Medan mundur Mending mundur, daripada stroke, he...he...he DPRDSU menduga terjadi masalah di Crystal Square Pantesan terbengkalai!


D Wak

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window


Gran Max Pick Up 1.3 DP 9 Jt-an Angs. 2 Jt-an Gran Max Minibus 1.3 DP 14 Jt-an Angs. 3 Jt-an Luxio D DP 18 Jt-an Angs. 4 Jt-an All New Xenia 1.0 M DP 24 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 28 Jt-an Angs. 4 Jt-an Sirion 1.3 D DP 24 Jt-an Angs. 4 Jt-an Hub: ERWIN HP. 0812 6315 4132 - 061.77402067


DAIHATSU Xenia XI Sporty 1300cc Thn. 2007. BK Medan, 1 tangan dari baru, silver. Hub. 081.2646 3852


Beli Honda CRV/Freed Hadiah langsung sepeda motor tanpa diundi. CRV DP 60 Jt-an, Freed DP 40 Jt-an Hub. TEGUH 0812 6077 7755

HYUNDAI Atoz Tipe GLS Thn. 2000. Mulus complit. Original. Harga 60Jt/ Nego. Hub. 0852 62 53 7479 MITSUBISHI Pajero Sport 4x2, Eceed ‘10, AT/ Tiptronic, Turbo Diesel, Jok klt asli, Htm, Ban bsr, MP3, CD, Subwoofer, TOT, DP 75Jt, Angs: 7,7 Jt Hub. 0852.7690.3900 MERCY E230 ‘96 Hijau Met, Km Low, Mulus, BK Mdn, Int. Original, Sprt baru, Sound system, VCD Multi, DVD, MP3, RT, DP 36,5 Jt Angs. 4,2Jt x 23 Hub. (061) 7670.0979 MERCY C180 ‘94 Silver Met, Jok klt, VR 16”, ABS, Airbag, PW, PS, Alarm, BK 333, DP 25 Jt, Angs: 2,76 Jt x 23 Hub. 0852.7507.6512 / Kanda



COKY NISSAN 0812 6378 6388 SUZUKI JIMNI LONG BRI TH. 90 Putih Mutiara, Ban 31” Extreem Mulus. Hub. DENNY. Jl. Sakti Lubis No. 80 (Simp. Limun) Medan

5 CM 6 CM

Rp. 65.000 Rp. 78.000

7 CM 8 CM

Rp. 91.000 Rp. 104.000


SUZUKI Baleno Merah Maroon Pemakaian Th. 99 sgt mulus dan orisinil, Siap pakai. Hrg. 67Jt Nego. Hub. 0812 64 777088

PURBA : 0813 9789 4633

SUZUKI Katana Thn. 90, hitam, 5 speed, AC, VR, Tape cantik. Serius Hub. 0853 6181 8738

TOYOTA Starlet 89, merah, jok recaro, AC, VR, siap pakai (cantik). Hub. 0852 7574 6742 Bpk. Suhar.

SUZUKI Carry Real Van Tahun ‘97.Warna Ungu, lengkap, mulus, siap pakai. Harga Rp. Nego. 0813 7041 3399

OPEL Blazer ‘97 DOHC LT, Hitam, lengkap, pemakai, TP. Hub. (061) 771 95 177

SUZUKI Esteem Th. 92/93 dijual. Warna hijau. Mobil cantik, 85%. Ban Bagus AC Dingin, BK Panjang. Hub. 0812 6590184


SUZUKI Futura Real van Thn. 95, hijau metalik, kondisi mulus, lengkap, AC, Tape, ban baru, Rp. 43Jt/Nego. Hub: 0853 6230 0613


1. Toyota Pick-Up Bensin 98, Hitam 2. Toyota M. Bus Super Std. A/C 96, 1800cc. Biru. Kondisi terawat. Hub. 0812 6367000 TOYOTA Kijang LX Up Thn. 2004, 1,8 Asli Mdn. AC DB, RT, VR 16” Import, PS, PW, CL, W. Hitam Meth. Cat asli, sgt mulus, jrg. pakai. Hub. 0813 6084 0653 Khs. Pemakai TP.






SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

TOYOTA Kijang Kapsul SGX Dijual. Tahun 2001. BK Medan Pajak Panjang. Hub. HP. 0852 7788 0592 Tanpa Perantara. Harga Nego. DIJUAL 1 Kijang Capsul SGX Bensin Thn. 97/98. BK Asli Mdn P. Steering, AC DB, P. Window. C. Lock, Alarm Remot, 5 Speed. Pajak Baru, H. 85Jt. Mobil mulus, cantik, orisinil luar dalam. Hub. Dr. Cuming HP. 061.7624 7369 - 0852 9641 9233 (maaf SMS TP)

TOYOTA Kijang Kapsul Model LGX New Bensin 1,8 Th. 2003. Hitam Met, Sgt mulus, VR, BR, PS, PW, CL, RMT, E. Miror. AC DB, Full sound pake TV 3 Unit, Hrg. 135Jt. Nego. Hub.0821 6312 2295

9 CM Rp. 126.000 10 CM Rp. 140.000

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab

PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih SEPEDA MOTOR


DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA Rp. 1.350.000,Jok (model press) + Alas

YAMAHA Vega, Thn. 2006. W. Silver, Siap pakai. Tahun pertama. 0853 6000 3773

BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

TOYOTA Twincam 1.6 Hitam Met Th. 90. Asli Medan. Hrg. 44Jt. Nego. Hub. 0821 6246 7871

DANA CEPAT Jaminan BPKB: Mobil, Sp. Motor, Betor, Angkot dan Taksi. Proses cepat. Syarat lengkap 1 jam cair. Hub.0821 68811333 - 0812 6081 3010

TOYOTA Kijang Capsul Matic GLX Th. 2000. S. Mulus. Double Blower Metalik 2000cc. Pajak s/d Des 2012. Bensin. Harga 103Jt. Nego. Hub. 0852 77222585


TOYOTA Kijang 1.8 LX ‘00 Model LSX, Biru Dongker, AC dgn, Tp, CD, PS, VR, BR, DP 17 Jt, Angs. 2,85 Jt Hub. 0852.7507.6512/ Kanda TOYOTA Kijang Kapsul LGX 1.8 EFI Thn. 2000. W. biru metalik Plat BK. Lengkap, aC DB, Tape, VR, BR, PW, PS, CL. Jok asli mulus, siap pakai. BU. Hub. HP. 0812 6021 2106 Mdn.





IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat


Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

11 CM Rp. 165.000 12 CM Rp. 180.000


HUB: 0812 643 7095



Asli Sertifikat Hak Milik No. 38, Desa Kedai Durian. Kecamatan Deli Tua Kabupaten Deli Serdang, terletak di Jalur Eka Surya Lingkungan VII. Seluas 957M2. Atas nama HASANLUDIN

Jumat, 6 Januari 2012


TERCECER 1 BPKB Asli BK 1793 JA a/n. PUTRAYADI ST. Toyota Vios Thn. 2007

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput








1. Pemasangan Depot Air Minum Sistem Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll

N a m a : Karo Jenni Br. Purba (Pr) Baju Batik Merah U m u r : 61 Tahun Tinggi : 190 Cm, Kuning Langsat, Rambut Pendek, Keterbelakangan Mental Hubungi: - 0812 653 8687 - 0813 7575 0812 Jl. Haji Mhd. Said No. 1 Medan (D/H Jl. Durian) Segala Biaya - biaya diganti


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410



ALAT MUSIK DIJUAL 2nd, Amp BMB 55 + Spk Delta 10” (5.0), 1 set BMB DA J7 (c) + Spk. BMB 5x2 (3.5) Power: QSC 850W, Yamaha 1000W, Ramsa 800W, Sound S. 3600W. Effect Yamaha, EQ=dod 830 USA (1.5). dod 231 USA (2.0), Amp. BMB DAX 1,2, 11, 21, Terima Visa 0% Jl. Indragiri 25. 061-7345487


Ingin Promosikan Produk Anda Harian

Surat Sertifikat Hak Milik Tanah No. M.803 Tahun 2003 A/n. HARNIE RAHAYU yang terletak di Komp. TASBI I Blok XX No. 17 Lingkungan VII Kel. Asam K u m b a n g K e c . M e d a n WASPADA Selayang luas tanah 281m2. Media Bagi yang menemukan/yang yang Tepat mengetahui surat tersebut untuk hub. Bpk. WIDARYONO Iklan Anda 0812 604 7947



TERIMA LAPTOP DLL (Dijemput) Menjual Laptop Seken Bergaransi 0821 6868 5346





SERVICE: AC, Kulkas, NSN, Cuci, TV, CCTV, Parabola, Bngkr Pasang, bergaransi Hub. 061-77913537 / 0813 7553 3375






0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi


821 9951

Jl. Setia Budi No. 2


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188






Keterangan lebih lengkap silahkan hubungi: TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

Ekonomi & Bisnis

WASPADA Jumat 6 Januari 2012

2011, Pendapatan PPN Meleset JAKARTA (Waspada): Pendapatan negara dari pajak pertambahan nilai (PPN) pada 2011 belum mencapai target. Meskipun demikian pencapaian target yang belum sampai ini dikatakan telah tumbuh jauh dibandingkan tahun sebelumnya. Dirjen Pajak Kementerian Keuangan Fuad Rahmany (foto) menjelaskan pada 2011 pencapaian target PPN hanya 93 persen dari target namun angka ini naik tipis dari tahun sebelumnya yang hanya di bawah 90 persen. “Tapi ada peningkatan, karena memang ada beberapa kebijakan kebijakan dan inisiatif dan perbaikan di dalam kinerja aparat Dirjen Pajak sehingga capaiannya lebih tinggi,” ungkap Fuad dalam konferensi pers di Gedung Kemenkeu, Jakarta, Kamis (5/1). Fuad juga mengatakan, tingkat pertumbuhan PPn sudah tumbuh 20 persen namun belum cukup tinggi untuk mencapai target PPN yang ditetapkan pemerintah sebelumnya. “Ada dua sisi karena PPN sangat terkait transaksi ekonomi seharinya. Saat satunya tingkat kepatuhan, tertib WP (Wajib Pajak) belum optimal sebagaimana yang kita harapkan,” tambahnya Selain itu menurut Fuad, jauhnya capaian target PPN dari target juga disebabkan karena adanya sektor-sektor bertransaksi yang tidak melaporkan atau menyetor PPN. “Ini sektor informal yang kita sulit kontrol. Tapi upaya meningkatkan cakupan kita memasukkan sektor informal ke sistem perpajakan kita sudah mulai, walaupun belum optimal. Ini kenapa kita perlu perbaikan kemampuan administrasi perpajakan untuk tingaktkan kepatuhan WP dari sektor informal,” jelasnya. Kemudian faktor lain yang menjadi penyebab jauhnya capaian target adalah kurangnya kepatuhan dan kesadaran dari pengecer untuk membayar PPN nya. “Ke depannya kita akan perbaiki sistem IT kita, dan juga di dalam metode pencatatan, perekaman. Ke depannya kita akan lebih lagi menegakkan, atau mewajibkan electronic SPT,” tutupnya. (okz)



Baby Sitter, K. Asuh, Perawat Jompo Medis/ Non Medis, Jl. Pintu Air I Sp. Pos No. 15 HP. 0821.7366.7780



Beberapa Orang Jujur, Masak Sate dan Penjual Sate, Berpengalaman, Muslim dan Belum Menikah (Lajang), Bersedia ditempatkan didaerah Kuala Simpang dan Langsa 0852.7003.0007 - 0878.9066.8383


- Diutamakan yang bersedia tinggal di Klinik - Diutamakan yang belum berkeluarga Lamaran ditujukan ke: KLINIK PAUL G.M.M Jl. Yos Sudarso 191E P. Brayan Medan 20116


PERUSAHAAN AMERIKA Membutuhkan orang-orang dinamis dan bermotivasi tinggi sebagai: KONSULTAN INDEPENDENT (P/F/ 5 - 10 Juta) Serius hubungi: Tengku Rahmah S.Ag 0812.6056.2302 Yanuarlin Lubis, SE 0812.6477.875


Tenaga kerja/ Karyawan diperbengkelan bersedia ditempatkan di Pasar Merah, Pondok Kelapa, Jl. Setia Budi, Posisi sebagai: 1. Mekanik (Berpengalaman) 2. Pembantu Mekanik 3. Door smeer (Cuci mobil) 4. Mekanik AC mobil 5. Mekanik wayar 6. Tukang bubut 7. Kasir (Pembukuan) Bagi yg berminat lamaran diantar ke: Bengkel Star Servise) Jl. Setia Budi No. 435 Tanjung Sari Pasar 5 Medan

Pengusaha Desak BI Tekan Suku Bunga Jadi 8 Persen JAKARTA (Waspada): Kalangan pengusaha akan terus mendesak perbankan untuk menurunkan tingkat suku bunga khususnya kredit agar pertumbuhan industri tahun ini terus melaju. Karenanya, mereka mende-

Media yang Tepat untuk Iklan Anda

Syarat: SIM C, Kreta sendiri, Jujur, Perempuan utk jualan kue-kue, Syarat: Ada KTP, Jujur Hub. Bp. Abdur 0853.7206.7644 0857.6130.6644 Jl. Karya Pembangunan No. 20 Komplek BLPLP Asrama Haji Mdn


Dua pekerja menjahit salah satu bagian tas sebelum disusun menjadi tas dan dijual di sebuah industri rumahan pembuatan tas di Manggarai, Jakarta Selatan, Kamis (5/1). Sehubungan meningkatnya penjualan kamera DSLR, permintaan tas kamera rumahan tersebut ikut meningkat karena harganya yang murah dibanding tas keluaran pabrik dan tas tersebut dijual berkisar Rp50 ribu Rp350 ribu persatuannya sesuai ukuran dan model tas.


Umur 35 - 50 tahun Fasilitas: Makan siang ditanggung, Diutamakan memiliki sepeda motor Hubungi HP: 0812.6522.2919 - (061) 822.1757 Jl. Setia Budi No. 154B Medan



Ingin Promosikan Produk Anda Harian


- Supir mobil box muka/ belakang - Penjaga kos-kosan Diutamakan suami / istri - Bag. Administrasi tamatan SLTA Hub. 0853.7160.3030



- Mekanik - Lulusan SLTP untuk di didik menjadi Mekanik Syarat: - Pria, Usia max. 25 tahun Lamaran diantar ke:

DO RE MI Jok Mobil

Jl. S. Parman Blok DD No. 3-4 Petisah Medan (Depan Sekolah St. Thomas)


Dibutuhkan: 1. Supir Dengan kriteria sbb: a . Pria max. 35 thn b . Minimum tamatan SMA c . Memiliki SIM A/ SIM B1 d . Islam, jujur dan bertanggung jawab 2. Office boy/ Penjaga kantor a . Pria, max. 30 thn b . Minimum tamatan SMA c Islam, jujur dan bertanggung jawab Lamaran diantar langsung ke: PT. BINATAMA SENTRAFAJAR Jl. B. Katamso No. 23C Medan Telp. (061) 451.3802



sak perbankan agar memberikan bunga kredit delapan persen per tahun. “Tingkat suku bunga perbankan kita masih double digit, kalau pengusaha kita bisa menikmati suku bunga yang single digit yakni di angka enam sampai sembilan persen. Itu sangat membantu,” ujar Ketua Kamar Dagang dan Industri (Kadin) Suryo Bambang Sulisto dalam Roundtable Diskusi tentang Industri Maritim, di Me-


Berpengalaman professional


1. Umroh Reguler 9Hr, dan 2 Minggu/ 13hari 2. Umroh dan Arbain di Madinah 3. Umroh Plus Mesir 4. Umroh Plus Turkey 5. Umroh Plus Jordan Aqsha 6. Umroh Plus India Kashmir 7. Umroh Plus Dubai PEMBUKAAN MANASIK HAJI DILAKSANAKAN PADA FEBRUARI 2012 DAFTARKAN SEGERA KE:

KANTOR PUSAT MULTAZAM MEDAN JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. (061) 457.6116 - 7731.3385 HP. 0812.6495.8456 - 0813.6137.2321 - 0812.6481.828


PT. SUSTAINABLE LIFESTYLE Jl. K.H. Zainul Arifin No. 166 Medan 20112 Selambatnya seminggu setelah iklan ini

HOTEL MADINAH : AL-HARAM (5*) HOTEL MAKKAH : MAKARIM AJYAD (5*) HOTEL JEDDAH : AL AZHAR (5*) Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jama’ah Tertanggung ASURANSI DAFTAR SEGERA Kantor: Gedung Gelora Plaza Lt. 1 Jl. S. M. Raja No. 4/18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488

Uk. tanah 28x8m, Surat Sertifikat, Alamat Jl. Tritura Suka Tirta No. 15C disebelah Galon Minyak Pom Bensin di Jl. STM Desa Suka Maju Medan Hub. 0812.6373.8007


BIREUEN ( Waspada): Berdasarkan surat keputusan Gubernur Aceh dari Disperindagkop Aceh harga eceran tertinggi gas elpiji subsidi tabung 3 kg di Bireuen ditetapkan Rp 15 ribu per tabung. Bila ada pihak menjual melebihi dari harga tersebut maka telah men-jual diatas HET yang telah ditetapkan dan dapat dikenakan sanksi. Demikian disampaikan, Kepala Dinas Perindustrian, Perdagangan, dan Koperasi (Disperindagkop)BireuenAsnawi melalui Kasie Penga-wasan Barang dan Jasa Die Pelar kepada Waspada Kamis (5/1), terkait harga elpiji di Bireuen dikabarkan dijual dengan harga diatas HET. Sebelumnya, harga elpiji tabung seberat 12 kg dijual

Gatsu, Simp Jl. Kertas, min. 2 thn, Max 5 thn, Cocok utk Perkantoran 0821.6122.4974 - 0878.6908.3130

RUMAH MEWAH DIJUAL Ukuran 15x25m, di Jl. Karya Jaya/ Eka Wali Pribadi Medan Johor Hub. 0812.6080.602 - (061) 735.0194






Alternatif & Mengobati berbagai Penyakit spt: MIgren, maag, darah tinggi, kolesterol, stroke, dll Oleh: SINSE UST. IMDIM CHOW (KTWA BID. LN. AD DZIKRA) DENGAN BIAYA IKHLAS & BAROKAH 0853.5961.1888


Media yang Tepat untuk Iklan Anda



pedagang di Bireuen dengan harga Rp95 ribu-Rp100 ribu per tabung. Harga seperti itu menurut para konsumen agak memberatkan pembeli khususnya masyarakat yang ekonomi menengah kebawah. Maka, mereka meminta kepada peme-rintah untuk menetapkan HET tabung 3 kg supaya masyarakat tidak merasa berat. Menurut Die Pelar, dengan dikeluarkan surat keputusan gubernur oleh pihak Disperindagkop Aceh, maka pihaknya mengharapkan kepada distributor dan para pedagang di pangkalan dan di kios-kios supaya menjualnya dengan harga yang telah ditetapkan itu. (cb02)




biasa. Disebutkannya peminat sistem Listrik Pra Bayar (LBP) di Pidie Jaya sangat tinggi sejak diluncurkanSeptember2011lalu. “Memang listrik pra bayar diminati pelanggan di Pidie,” jelasnya seraya menambahkan penggunaanlistrikmeng-gunakan voucher itu memiliki banyak keuntungan dibanding sistem pascabayar. “Penggunaan listrik dengan cara prabayar jauh lebih menguntungkan, karena sudah bebas dari biaya abonemen (darurat) dan biaya keterlambatan atau biaya denda juga lebih hemat, karena PLN bisa mengawasilangsungpema-kaian listriksetiaphari,”terangnya.(b09)

Harga Elpiji 3 Kg Ditetapkan Rp 15.000 Per Tabung

Ingin Promosikan Produk Anda Harian


LT. 198m², LB. 135m². 2 LT, Keramik, 5 KT, 3 KM, Garasi, SHM, Jl. Setia Luhur Gg. Langsat 187C (300m dari Ringroad) Hub. 0852.6272.1500 Tanpa perantara

MEUREUDU (Waspada) : Hingga akhir 2011, tercatat 542 pelangganPLNdiKabupatenPidie Jaya (PiJay) beralih ke listrik prabayar. Data diperoleh di Kantor Ranting PLN Meureudu, Rabu (4/1) menyebutkan, sejumlah pelangganPLNdiKabupatenPidie Jaya meminati listrik pra-bayar, karena sistem terhadap penggunaan listrik di daerah itu sangat memudahkan dan meringankan pelanggan. Manajer Ranting PLN Meureudu Pidie Jaya Ridwan Daud kepada wartawan menyebut-kan sedikitnya sudah 542 dari 18.982 pelanggan PLN Ranting Meureudu beralih ke listrik prabayar, baik pemasangan baru atau pengalihan dari me-teran


DIJUAL RUMAH Villa Permata Indah Blok G No. 3, 800m dr Sp. Amplas serta isinya, 1300 W, AC, LT. 6x15m, KT 3, KM, LB. 65m², Harga 300 Jt/nego Hub. 0813.6157.1361

Siap huni, Uk. 10x20 (200m), Bangunan 8x16m, 2 Kamar, RT, RM, Alamat Pasar 2 Marelan Barat Gg. Arjuna Hub. 0813.7636.5768 (Yuni), Harga nego

542 Pelanggan PLN Beralih Ke Prabayar





Tumor/ Kanker/ Stroke/ Jantung/ Diabetes/ Reumatik/ Maag/ Impotensi/ Keputihan/ Miom/ Kista/ Obesitas dan penyakit kronis lainnya Jl. Amaliun No. 253A Telp. 735.2680 HP. 0812.9160.675

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) H P. 0 8 1 2 . 4 0 3 8 . 3 3 3



Informasi Pembaca Bursa Property

WULAN HP: 0813.7502.0767

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


HP: 0813.7014.3535


HP: 0852.9778.1350

BELIRA HP: 0852.6002.3389

MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201






Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


1. 10 orang INSTRUKTUR PERTANIAN a. Pria dan wanita b. Usia antara 25 - 35 tahun c. Minimal lulusan Sekolah Pertanian/ SMK Pertanian d. Bersedia kerja dilapangan 2. 30 orang KARYAWAN PERTANIAN a. Pria dan wanita b. Usia antara 25 - 50 tahun c. Pendidikan minimal SD d. Bersedia kerja dilapangan Lamaran ditujukan kepada:

UMKMyangbayarbungasampai 30 persen, itu tinggi sekali,” tambahdia.Adapunterkaitmasih rendahnya tingkat penyaluran kredit di industri perikanan dan kelautan di Indonesia, Suryo melihat bahwa beberapa hal seperti tingginya risiko penyaluran kredit di sektor maritim harus dihapuskan. “NIM (Net Interest Margin) perbankan kita itu masih tertinggi di dunia, ini yang harus diperhatikan,” tandasnya.(okz)

Kost VIP Jl. Laksana No. 102 Medan Kota, Lokasi Strategis banyak R. Makan, M. Market, Laundry, Sktr Kost, ±500m dari Yuki S. Raya/ Amaliun Foodcort. 2,5 Km dari Bandara Polonia, Mingguan & Bulanan Hub. 0811.631.234 0813.6221.3622/ 736.4014

LOWONGAN KERJA Kami perusahaan dibidang consumer goods membutuhkan segera SUPIR mobil BOX dengan syarat-syarat sbb: 1. Mempunyai SIM B1 2. Jujur, rajin, disiplin & bertanggungjawab 3. Usia 25 tahun - 40 tahun 4. Mampu bekerja keras Lamaran diantar langsung ke alamat: Jl. Alumunium Raya No. 46 Tanjung Mulia

nara Kadin, Jalan Rasuna Said, Kuningan, Jakarta, Kamis (5/1). Suryo memaparkan Kadin akan terus meminta perbankan dan juga berbicara kepada Bank Indonesia (BI), sebagai regulator, agar perbankan di Indonesia bisa mematok bunga kredit di angka delapan persen. “Kita usahakan terus, kita targetkanditahuninibungakredit di angka delapan persen. Ini juga masih lebih tinggi sedikit tetapi cukup, masa sekarang ada




Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari


Jl. Saudara Gg. Kelapa VII Simpang Limun, Uk. 10x19m, Rumah di Perumahan Kusi Indah Permai Blok I No. 1 Batang Kuis, Type 36, Luas Tanah 120m² Peminat Hub. 0821.1049.4978






Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

1. 2.

Pasang Iklan Mini

4. 5. 6.


Telp: 061 - 4576602

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu


7. 8.

FORUM KOMUNIKASI PARANORMAL DAN PENYEMBUHAN ALTERNATIF INDONESIA IZIN DEPKES. 448/15830 - IZIN KEJATI No. B270/DSP5.08 Gendam Asmaradhana (Solusi Kilat) Problem asmra dan rumah tangga Gendam pedotshih (pemutus hubungan asmara dan perselingkuhan PIL dan WIL) Puter Giling (menarik/ memanggil orang yang minggat, kabur) Insya Allah, Suami, Istri atau Pacar dalam waktu singkat akan kembali dengan cepat Asmara Gay/ Lesby/ Hypersex Susuk aura, pemikat, pemanis, pengasihan, kecantikan dan ketampanan Penglarisan dagang, kedai, rumah makan/ restoran jual beli tanah dgn cepat GARANSI Penyembuhan segala macam penyakit medis SAMPAI - non medis (kutukan, keturunan, bawaan dan guna-guna) TUNTAS Keluhan khusus pria (ejakulasi dini dan impotensi) Pengobatan/ penyembuhan bisa jarak jauh

BUKA TIAP HARI DARI PUKUL 08.00 Wib s/d 23.00 WIB Jl. Amaliun, masuk Jl. Nusantara No. 4 Medan (Belakang Hotel Madani SM. Raja di depan Kantor MUI) HP. 0813.6246.7777 0821.6397.9999


Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan

DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan H P. 0 8 2 1 . 6 6 5 5 . 1 2 2 2






Ekonomi & Bisnis


WASPADA Jumat, 6 Januari 2012

Panen Di Musim Hujan, Harga Gabah Anjlok LHOKSUKON (Waspada): Masa panen gabah di sejumlah desa di Kecamatan Tanah Pasir, Aceh Utara, bertepatan dengan musim hujan. Akibatnya gabah hasil panen rata-rata basah dan harganya pun lebih murah sekitar Rp500 dari harga normal. “Kalau gabahnya kering dibeli hingga Rp4.000 per kg. Sedangkan gabah basah hanya ditampung Rp3.500 per kg,” kata Idris, 35, petani gabah di Desa Alue, Kecamatan Tanah Pasir,

Kamis (5/1) siang. Menurut Idris, luas areal sawah yang sedang panen di Kecamatan Tanah Pasir, saat ini mencapai puluhan hektar. Sawah tersebut tersebar di sejumlah desa, antara lain, Desa Alue, Mee, Blang, dan Desa Paloh. Pengamat Pertanian Aceh Utara, JafaruddinYusuf SP (foto) yang juga mantan Ketua Badan Eksekutif Mahasiwa Fakultas Pertanian Unimal, menilai, fenomena miris yang dihadapi

petani gabah di Tanah Pasir, muncul karena perencanaan masa tanam atau masa turun ke sawah, tidak matang. “Dinas Pertanian, Penyuluh dan Kejruen Blang (Petugas Pengelola Distribusi Air ke Sawah) sejatinya bekerjasama sedini mungkin untuk mencegah masalah seperti ini. Jadwal masa tanam harus terkontrol. Sehingga masa panennya tidak berbenturan dengan musim hujan,”katanya.(b19)

Pertamina Region I Tunggu Pengaturan BBM Subsidi M E D A N ( Wa s p a d a ) : Pertamina Region I Sumatera sebagai salah satu operator pelaksana kegiatan distribusi Bahan Bakar Minyak (BBM) subsidi di Sumut tahun 2012, masih menunggu regulasi pemerintah tentang rencana pengaturan BBM subsidi seperti premium dan solar. Namun untuk pendistribusian BBM yang sudah memasuki tahun 2012 masih menggunakan kuota tahun 2011. “Rencana pengaturan BBM subsidi, kami masih menunggu regulasi pemerintah,” kata Manajer External Relation Pertamina Region I Fitri Erika kepada wartawan, Kamis (5/1), menjawab pertanyaan seputar kuota BBM subsidi dan sistem pengaturannya tahun 2012. Erika menyebutkan, sampai saat ini pihaknya belum mendapatkan jumlah kuota BBM untuk Sumut, pihaknya dalam pendistribusian BBM tersebut menggunakan angka kuota

sama pada Januari 2011 dan diperkirakan akan ada penambahan sebesar 5 persen dan sesuai dengan permintaan SPBUSPBU. “Sampai saat ini kita di awal tahun, mulai dari nol penyaluran tetap dilakukan ke SPBU-SPBU dan pengawasan juga tetap berjalan,” ujarnya seraya menyebutkan, salah satu pengawasannya akan dilakukan pembatasan bagi pembeli yang menggunakan jerigen. Mengenai, jumlah kuota BBM subsidi di Sumut pada 2011, Erika menyebutkan, tahun 2011 penggunaan BBM subsidi di Sumut mengalami over. Untuk BBM jenis premium kuota pada 2011 sebesar 1.426.455 kilo liter dengan realisasi 1.464.810 kilo liter atau over sebesar 3 persen. Sedangkan untuk solar kuota 1.013.433 kilo liter dengan realisasi 1.057.913 kilo liter atau over 4 persen. Dalam upaya menggalakkan mobil-mobil pribadi agar menggunakan BBM non

subsidi, pada 2012 pertamina mewajibkan bagi pengusaha yang akan mendirikan SPBU untuk tidak hanya menjual premium dan solar, tetapi juga harus menjual pertamax. Erika menyebutkan, di Sumut terdapat 302 SPBU, namun yang menjual pertamax baru 82 SPBU terdiri dari Medan ada 44 SPBU, Binjai 2, Tebingtinggi 2, Siantar 2, Asahan 1, Deliserdang 15, Karo 1, Labuhanbatu 3, Langkat 4, Tapanuli Selatan 1, Padangsidimpuan 1, Serdang Bedagai 4, Batubara 1 dan Labusel 1. Dia berharap, kedepannya setiap SPBU dapat menjual pertamax agar kebutuhan permintaan konsumen dapat terpenuhi. Erika menyebutkan, sejak 2003, pihaknya sudah melakukan pendekatan kepada pengusaha-pengusaha SPBU dan mengingatkan iklim bisnis ke depan mereka harus siap untuk menjual pertamax. (m41)

Pidie Belum Tetapkan HET Elpiji SIGLI (Waspada): Meskipun ketentuan penetapan Harga Eceran Tertinggi (HET) khusus elpiji ukuran tabung 3 kilogram sudah ditetapkan Provinsi Aceh sesuai Surat Keputusan (SK) Gubernur namun di Pidie belum ada penetapannya. Berbagai sumber yang berhasil dihimpun Waspada, Kamis (5/1), menyebutkan akibat belum adanya ketetapan HET elpiji 3 kilogram itu menyebabkan harga pembelian masyarakat sangat bervariasi dan tergolong tinggi, terkadang Rp25.000 hingga Rp30.000 per tabung 3 kilogram. “Kondisi ini sangat meresahkan masyarakat yang memiliki tabung gas 3 kg yang telah disubsidi pemerintah. Pemkab Pidie perlu segera menetapkan HET elpiji 3 kg ini, “sebut Muhammad, warga Beureunuen. “Hingga kini penetapan HET Elpiji 3 kg belum dilakukan. Pasalnya Pemerintah Aceh saja belum melakukan apa-apa,

sehingga Pemkab Pidie tidak punya acuan untuk menetapkan HET elpiji tersebut,” ungkap Asisten II Bidang Kesejahteraan Rakyat (Kesra) di Sekretariat Daerah Kabupaten (Setdakab) Pidie Syukri Yusuf kepada wartawan. Maka Dari itulah Pemkab Pidie tidak berani menetapkan HET Elpiji 3 kg sebelum adanya surat dari Gubernur Aceh, tambahnya lagi. Terkendala Menyangkut persoalan itu hingga kini masih terkendala dan belum bisa menetapkan HET elpiji 3 kilogram, sebelum ada petunjuk dari Pemerintah Aceh. “Jadi bukan kita (Pemkab Pidie-red) yang tidak menetapkan HET elpiji tersebut, “ jelasnya. Menurut Syukri, HET elpiji ukuran 3 kg secara nasional ditetapkan pemerintah Rp15.000 per tabung hingga radius 60 kilometer dari kota provinsi

(Banda Aceh), sementara harga dari agen ke pangkalan Rp13.500 per tabung. “Itu sesuai keputusan Gubernur Aceh Nomor 541/554/2011 tentang HET Elpiji, “ujarnya Sekarang yang menjadi kendala dan membuat Pemkab Pidie sulit menetapkan HET elpiji 3 kg, karena dalam SK Gubernur Aceh tidak ada petunjuk jelas untuk menetapkan HET ditingkat kabupaten/kota di Aceh. “Kita menunggu petunjuk dari provinsi sehingga tidak asal menetapkan HET elpiji 3 kg itu, “ ujar Syukri. Asisten Bidang Kesra Setdakab Pidie itu juga menambahkan, hingga sekarang harga eceran elpiji 3 kg di Pidie mencapai Rp20.000 hingga Rp25.000 per tabung. Namun pihaknya mengaku tidak bisa mengawasi atau mengatur harga penjualan dilakukan pedagang dan pangkalan, sebab tidak ada HET.(b09)


SEORANG Petani sedang memanen padi di Desa Alue, Tanah Pasir, Kamis (5/1) siang. Petani di desa ini terpaksa menjemur padi di jemuran buatan karena masa panen berpapasan dengan musim hujan.

Naikkan BBM Rp1.000, Pemerintah Hemat Rp36 T JAKARTA (Waspada): Jika pemerintah menaikkan harga Bahan Bakar Minyak (BBM) sebesar Rp1.000 per liter, diproyeksikan pemerintah menghemat beban subsidi sebesar Rp36 triliun. “Jika harga naik Rp1.000 per liter untuk premium bisa hemat Rp24 triliun dan solar bisa hemat Rp12 triliun. Jadi anggaran yang dihemat dapat mencapai Rp36 triliun,” ujar Pengamat Energi Priagung di Jakarta, Kamis (5/1). Menurut Priagung, dengan adanya pembatasan, maka pemerintah akan menghemat anggaran sebesar Rp42,23 triliun karena masyarakat dialihkan untuk memakai pertamax yang harganya dua kali lipat dari premium. “Potensi penghematan premium di Jawa dan Bali kirakira setara dengan Rp26,71 triliun atau setara dengan menghemat kuota sebanyak 7,63 juta kiloliter (kl). Untuk solar di Jawa Bali menghemat anggaran sebesar Rp15,52 triliun atau setara dengan 4,34 juta kl,” tegasnya. Dia menambahkan, dengan adanya potensi ketegangan yang akan semakin memburuk maka akan berpotensi melambungkan harga minyak dunia. “Sulit memperkirakan, tergantung seberapa intens

ketegangan itu akan memburuk. Tetapi, jika pun tidak sampai pecah perang tetapi ketegangan itu terus menerus ada, itu akan membuat harga minyak stabil di kisaran tinggi, paling tidak sama dengan di 2011 di kisaran 100 dolar AS-110 dolar AS per barel,” jelasnya. Untuk subsidi Realisasi anggaran digelontorkan untuk melakukan subsidi pada 2011 mencapai Rp294,9 triliun. Angka ini jauh diatas target pemerintah dalam APBNP 2012 sebesar 124,3 persen. Menteri Keuangan Agus DW Martowardojo mengatakan, angka realisasi subsidi 2011 tersebut naik dibandingkan tahun sebelumnya atau 2010 sebanyak Rp102,2 triliun. “Hal ini berkaitan dengan lebih tingginya beban subsidi listrik dan subsidi BBM serta pangan,” kata Agus di Gedung Kemenkeu, Jakarta, Kamis (5/1). Lebih lanjut dia menjelaskan, faktor lain penyebab menggelembungnya anggaran subsidi adalah tingginya realisasi

Selat Hormuz Bergejolak SBY Khawatir Suplai Minyak Terganggu


Penyerahan secara simbolis bantuan untuk 100 mata oleh Mario Arnaz Hidayat, salah satu direktur PT Sidomuncul yang diterima langsung Fajar Purnomo, Kepala Biro Perencanaan Polda Metro Jaya.

Sidomuncul Lanjutkan Bantuan Di Polda Metro JAKARTA (Waspada): Bertempat di Polda Metro Jaya, Kamis, lalu Sidomuncul bersama Perdami kembali memberikan bantuan operasi katarak kepada 40 pasien penderita buta katarak. Bantuan operasi untuk 12.000 pasien telah dimulai sejak awal Desember di beberapa rumah sakit di enam daerah yaitu RS Pelabuhan Palembang, Klinik Darma Usada Netral Pelabuhan Ratu, Puskesmas Mantigan Kabupaten Ngawi, Puskesmas Mojo Agung Jombang, BKMM Cilacap, dan Polda Metro Jaya dengan jumlah total

pasien sebanyak 268 orang. Ini merupakan bagian dari kegiatan Gerakan Penanggulangan Buta Katarak di Indonesia atas pencanangan gerakan penanggulangan katarak yg dimotori oleh SidoMuncul bersama Perdami dengan didukung oleh RS dan klinik mata di Indonesia. Hadir pada kesempatan tersebut Kepala Biro Perencanaan (Karorena) Polda Metro Jaya Fajar Purnomo, para pejabat Polda Metro Jaya, Kapolres jajaran Polda Metro Jaya dan salah satu direktur PT Sidomuncul Mario Arnaz Hidayat.

Mario Arnaz Hidayat berharap program operasi katarak bagi 12.000 pasien ini dapat menjangkau pasien penderita katarak di daerah-daerah pelosok sehingga bisa mengurangi jumlah para penderita warga kurang mampu. “Tentunya kami membutuhkan kembali bantuan banyak pihak agar dapat terealisasi di tahun mendatang.” Ketua Perdami Prof Nila F Moeloek menyatakan akan selalu mendukung dengan apa yang telah dilakukan bersama Sidomuncul dan menyambut baik program ini. (rel)

JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono (SBY) mengkhawatirkan adanya gangguan suplai minyak apabila memang terjadi gejolak di Selat Hormuz, Iran. SBY menambahkan, bila terjadi sesuatu di selat Hormuz, maka akan terjadi gejolak luar biasa pada minyak bumi. “Sekarang sudah kita rasakan dengan benturan militer di wilayah itu, minyak bumi terdongkak naik. Padahal dari suplai and demand tidak ada perubahan, jadi betul-betul khawatir kalau ada gangguan suplai,” kata SBY di Istana Presiden, Jakarta, Kamis (5/1). Menurutnya, bila ini terus berlanjut maka akan merugikan dunia. Walaupun apabila harga melonjak yang akan diuntungkan adalah negara-negara yang memproduksi minyak. “Tapi negara-negara berkembang yang tidak produksi akan dirugikan,” tutupnya. Seperti diberitakan sebelumnya, Wakil Presiden Iran Mohamed Reza Rahimi mengatakan negaranya akan menutup Selat Hormuz, memotong ekspor minyak, jika negara-negara Barat memberlakukan sanksi terhadap pengiriman minyak Iran. Amerika Serikat (AS), Inggris, dan negara-negara lain

mempertimbangkan sanksi terhadap Iran yang merupakan produsen minyak keempat terbesar, lebih dari kekhawatiran tentang program tenaga nuklirnya. Selat Hormuz, terletak di Teluk Persia, adalah salah satu rute tersibuk di dunia untuk pengiriman minyak mentah dengan sekira seperenam dari produksi minyak dunia. Jika kapal tanker tidak bisa menggunakan selat tersebut, maka mereka harus memakan waktu lebih lama yang rutenya lebih mahal untuk dapat mencapai tujuan mereka, yang kemungkinan akan meningkatkan harga minyak. Pada hari ini, harga minyak kembali naik akibat para pedagang membukukan keuntungan sebesar empat persen pada pembukaan perdagangan tahun ini. Pada perdagangan elektronik New York Mercantile Exchange (Nymex), patokan minyak mentah Amerika Serikat (AS) naik 26 sen dan ditutup pada 103,22 dolar AS per barel. Sementara minyak mentah Brent, yang digunakan untuk harga minyak asing yang diimpor oleh kilang AS, naik 1,57 dolar AS dan bertahan di 113,70 dolar AS per barel di perdagangan London. (okz)

harga ICP mencapai 111,6 dolar AS per barel. Sedangkan dalam asumsi APBN-P, harga ICP hanya 95 dolar AS per barel. “Hal ini juga karena tidak terpenuhinya rencana penggunaan energi input subsidi listrik dan adanya program raskin ke-13,” jelasnya Meski begitu, Agus menjelaskan, realisasi belanja pemerintah pusat pada 2011 mencapai Rp 878,3 triliun atau secara nominal naik sebesar Rp 181,0 triliun (25,9 persen) dari realisasi 2010 yang sebesar Rp 697,4 triliun. “Realisasi tersebut menunjukkan daya serap anggaran sebesar 96,7 persen dari pagu APBN-P 2011 sebesar Rp 908,2 triliun,” tutupnya. Solar Sementara guna menghemat anggaran subsidi pada 2012, pemerintah telah mene-

tapkan pembatasan penggunaan Bahan Bakar Minyak (BBM) bersubsidi jenis premium bagi mobil plat hitam di Jawa dan Bali pada April 2012 ini. Sedangkan untuk jenis solar, akan diterapkan pada Juli 2013. Menteri Keuangan Agus DW Martowardojo mengatakan, untuk premium, hanya berhak memakai dan membelinya adalah angkutan umum, kendaraan umum, dan sepeda motor. “Subsidi 2012 kebjiakan pembatasan konsumsi premium, Jawa Bali sudah mulai diimplementasikan, untuk solar Juli 2013. Premium hanya angkutan umum, kendaraan umum dan sepeda motor,” ungkap Agus dalam acara konferensi pers di Kantornya, Jakarta, Kamis (5/1). Sebelumnya, rencana pembatasan BBM bersubsidi

akan merogoh kocek pemerintah sebesar Rp900 miliar. Dana ini sudah termasuk converter kit yang diperlukan dalam peralihan konsumsi mobil yang sebelumnya menggunakan BBM beralih ke gas. “Bisa jadi dilihat kembali adakah di antara program terkait pengadaan converter kit. Tadi saya sudah bilang ke ESDM, Rp900 miliar anggaran untuk apa saja. Detail programnya tolong dicek ke ESDM,” ungkap Wakil Menteri Keuangan Anny Ratnawaty. Lebih lanjut Anny menjelaskan, program converter kit ini sendiri sudah pernah digarap Kementerian ESDM dan tinggal dirapikan saja. “Pada prinsipnya pemerintah berkomitmen konversi. Tahun lalu pernah ada pengadaan converter kit. Program di ESDM. Tahun ini dirapikan,” tambahnya. (okz)

Bireuen Masih Kekurangan Pupuk Urea Bersubsidi BIREUEN (Waspada): Para petani di 17 Kecamatan dalam Kabupaten Bireuen mengeluh. Pasalnya saat ini para petani sedang memasuki musim tanam Januari 2012 masih sulit untuk memperoleh pupuk urea bersubsidi. M Jafar salah seorang petani di Juli mengatakan penyaluran pupuk bersubsidi di kecamatan Juli memang ada tetapi masih minim tidak mencukupi kebutuhan petani bahkan masih banyak para petani yang tidak m e m b e r o l e h j a t a h u re a bersubsidi. Kepala Badan Pelaksana Penyuluhan dan Ketahanan Pangan Kabupaten Bireuen Sofyan Syah dikonfirmasi Waspada, Kamis (5/1) membenarkan para petani di Kabupaten Bireuen yang sedang memasuki musim tanam Januari 2012 masih keurangan pupuk urea bersubsidi. Dikatakan, untuk mengatasi

kekurangan pupuk urea bersubsidi pihaknya telah menyurati PT Pupuk Ikandar Muda Krueng Geukueh untuk menambah jatah pupuk urea bersubsidi kebutuhan petani sawah, perkebunan, perikanan dan holtikultura di Kabupaten Bireuen Menurut Sofyan Syah kebutuhan pupuk urea bersubsidi untuk Kabupaten Bireuen sebanyak 6.588 ton, untuk kebutuhan tanaman pangan sebanyak 4.269 ton selebihnya untuk kebutuhan perkebunan, perikanan, peternakan dan holtikultura. Karena itu PT PIM diharapkan dapat segera memproritaskan penambahan jatah pupuk urea bersubsidi ke Kabupaten Bireuen sebagai Kabupaten lingkungan pabrik Pupuk Iskandar Muda jangan sampai terlupakan, pinta Sofyansyah. Sementara Dirut PT PIM Mashudianto dalam keterangan kepada wartawan mengatakan,

stok persediaan pupuk urea bersubsidi untuk lima provinsi tahun 2012 di gudang curah PT PIM mencapai 52 ribu ton. Stok itu untuk sebagai jatah pendistribusian setiap bulan untuk Provinsi Aceh 7.000 ton per bulan, Sumbar 8.000 ton, Sumatera Utara 20 ribu ton per bulan, Riau 4.000 ton per bulan,dan kepulauan Riau 1.000 ton per bulan. Menurut Mashudianto, persediaan pupuk urea bersubsidi di masyarakat ridak akan mengalami kelangkaan karena persediaan di gudang curah PT PIM masih cukup dan pendistribusiannya sudah sesuai kebutuhan tiap daerah.. Sementara jika di lapangan masih terjadi kelangkaan pupuk urea bersubsidi, PIM akan menurunkan tim ke lokasi untuk meneliti penyebabnya, kalau kedapatan masih ada distributor nakal akan diambil tindakan tegas, ujarnya. (b12)

Petani Aceh Dapat Bibit Coklat Gratis BANDA ACEH (Waspada): Sedikitnya 300 hektar lahan pertanian milik petani miskin akan mendapat bibit kakao gratis. Petani penerima manfaat itu berada di tiga wilayah: Pidie, Aceh Utara dan Aceh Timur. Bibit disalurkan kemitraan Action Aid Australia (AAA) dan Yayasan Keumang yang tak lain bagian dari kerja ‘Program Kakao Aceh’ yang sedang dijalankan AAA – Keumang dalam project Aceh Economic Development Financing Facility (AEDFF), didanai Multi Donor Fund (MDF) bekerjasama dengan pemerintah.

Direktur Yayasan Keumang Yusri Yusuf didampingi Teuku Fadhla Ali, Monitoring dan Evaluation Program Officer, ketika ditanya Waspada, Kamis (5/1) menjelaskan, bibit tersebut nantinya ditanami di lahan baru petani sasaran yang telah disiapkan. Kata dia, pilot project bibit unggul untuk lahan baru kakao tersebut, diberikan untuk 564 petani miskindengan jumlah bibit sekitar 262.500 untuk 300 hektar lahan. Menurut Yusri, bibit dibuat dengan sistem cloning, dari tumbuhan induk yang bagus dan juga didatangkan dari Sula-

wesi. “Varietasnya adalah RCC 70, RCC 71, Sulawesi 1 dan Sulawesi 2,” sebut dia. Sebelumnya, sambung Teuku Fadhla Ali, penyiapan dan pembersihan lahan petani juga difasilitasi lembaganya. “Bibit yang diberikan dari varietas unggul dan bersertifikat,” ujarnya. Menurut dia, hal tersebut merupakan terobosan baru yang menjadi langkah awal dalam tujuan memperbaiki produktivitas kakao di Aceh, dengan penanaman bibit unggul yang tahan penyakit dan produksi tinggi.(b07)


WASPADA Jumat 6 Januari 2012

3 Jam Diguyur Hujan, Tapaktuan Tergenang Banjir

Muslim Hasballah

Waspada Tetap Terdepan Di Aceh SELAMA menjabat orang nomor satu di Kabupaten Aceh Timur, Bupati Muslim Hasballah (foto) menjadikan Harian Waspada satu-satunya media untuk memantau segala informasi, baik lokal, nasional ataupun mancanegara. Seperti belum semangat bekerja setiap hari jika belum membaca Waspada. Muslim Hasballah adalah sosok pejabat yang merakyat. Setiap hari dia memantau perkembangan wilayahnya melalui media Harian Waspada. Sebab baginya, kreatifitas dan keaktifan wartawanWaspada di Aceh Timur membuat dirinya lebih mengedepankan informasi yang diambil dari Harian Waspada, apalagi media ‘wajib’ baginya salah satunya adalah Waspada. Meski dianggap lengkap dalam bentuk penyajiannya termasuk di halaman Olahraga, tetapi dia tetap menyarankan agar Waspada tidak memuat gambar-gambar dari sisi sadisnya dan terus mempertahankan kolom-kolom agama serta menjaga keseimbangan dalam pemberitaan. “Sejak dulu hingga kini Harian Waspada tetap terdepan, apalagi era 80-an hanya Harian Waspada dikenal masyarakat Aceh,” kata Muslim seraya menandaskan, seiring dengan usianya 65 tahun diharapkan Harian Waspada tetap jaya dan profesional sesuai dengan visi dan misinya Demi Kebenaran dan Keadilan. Muslim menambahkan, ketika dirinya masih bergerilya dengan teman-teman TNA (sekarang jadi anggota KPA) pemberitaan di Harian Waspada terus dipantau dan menjadi rujukan perkembangan suhu politik di Aceh, lebih-lebih menjelang perdamaian antara Pemerintah RI-GAM di Helsinki 15 Agustus 2005. “Semoga Harian Waspada tetap jaya dan tetap teratas hingga kapanpun,” tandasnya. Muhammad H Ishak

Kapolres Aceh Timur AKBP RidwanUsman

Waspada Sudah Jadi Sarapan MESKI usia Harian Waspada sudah 65 tahun bertepatan 11 Januari 2012, namun Harian Waspada terus diminati dan ditunggutunggu pemberitaannya. Masyarakat luas khususnya di Aceh Timur sebagian besar menunggu berita di Waspada dan masih mengikuti setiap perkembangan, baik isu lokal, nasional atau internasional. Menurut Kapolres Aceh Timur AKBP Ridwan Usman, dia menjadikan Harian Waspada sebagai sarapan di setiap pagi. Sebelum berangkat bekerja, dia melihat setiap perkembangan, termasuk perkembangan dan suhu politik di wilayah hukumnya, sehingga merasa belum lengkap sarapannya sebelum membaca Waspada sejak dirinya ditugaskan di Polres Aceh Timur. Melihat halaman demi halaman di Harian Waspada dirasa cukup profesional dalam bentuk desainnya. Pemberitaan yang disajikan juga sangat singkat, padat dan jelas serta tidak terjadi pemborosan kalimat. “Pertahankan apa yang sudah dicapai, semogaWaspada tetap jaya sepanjang masa,” kata Ridwan Usman. Muhammad H Ishak

Kadis Pendidikan Aceh Timur Agussalim

Waspada, Media Pencerdas Anak Bangsa SEJARAH telah membuktikan bahwa sejak didirikan hingga kini usianya genap 65 tahun bertepatan 11 Januari 2012, Harian Waspada membawa pembaharuan di dunia pendidikan. Selain peduli pendidikan, Harian Waspada juga tergolong mampu mencerdaskan anak bangsa melalui berbagai kolom yang disediakan mengenai pendidikan. “Apalagi belakangan banyak menyajikan pemberitaan tentang sekolah, sehingga pelajar-pelajar sejak dini tertarik membaca Waspada,” papar Kepala Dinas Pendidikan Aceh Timur H Agus-salim. Baginya, Harian Waspada tidak bisa dipisahkan lagi dalam mengikuti setiap perkembangan khususnya dunia pendidikan, apalagi sejak Sekolah Dasar (SD) dirinya sudah membaca Harian Waspada. Agussalim (foto) menyarankan, agar halaman Aceh yang tersedia di Harian Waspada perlu penambahan, sehingga wajah Aceh di Harian Waspada lebih terlihat. “Dengan banyaknya halaman Aceh di Waspada hingga 5-7 halaman, maka sajian berita pendidikan akan lebih banyak lagi tertampung. “Semoga Waspada di usianya 65 tahun tetap jaya dan terus mencerdaskan anak bangsa khususnya dunia pendidikan,” tutur Agussalim. Semoga Waspada tetap terdepan dan terus diminati pembacanya di seluruh nusantara, Amin. Muhammad H Ishak

KPA: Independensi Waspada Perlu Dijaga INDEPENDENSI sebuah media tetap harus dijaga, karena itu hal yang paling utama dalam mempertahankan sebuah perusahaan media, termasuk Harian Waspada. Belakangan banyak media khususnya media lokal yang mengabaikan indepedensinya, sehingga terkesan media tersebut milik perseorangan. “Termasuk Harian Waspada harus terus menjaga independensinya dalam penyajian pemberitaan. Apa yang selama ini dilakukan perlu ditingkatkan ke arah lebih baik, sehingga Waspada tetap berada terdepan,” papar Ketua Komite Peralihan Aceh (KPA) Tgk Sanusi Muhammad yang akrab disapa Abu Sanusi. Mantan Panglima Gerakan Aceh Merdeka (GAM) itu meminta, Harian Waspada terus menjaga keseimbangan pemberitaan dan terus mendukung pelaksanaan Syariat Islam di Bumi Serambi Mekkah. “Jika pemberitaan seimbang dan tidak memihak, maka Harian Waspada akan terus bertahan hingga seratus ribu tahun lagi,” tuturnya. Sejak Aceh dilanda konflik hingga tahun 2005, Harian Waspada terus menjadi media yang mengikuti perkembangan di Aceh, sehingga para kombatan GAM saat itu juga mengikuti perkembangan di Aceh melalui surat kabar harian pagi itu. “Di usia yang ke-65 tahun ini semoga Waspada tetap jaya dan terus tumbuh dewasa sebagaimana harapan rakyat Aceh,” ujar Abu Sanusi. Muhammad H Ishak

Kepala BPBD

Halaman Waspada Ditambah Dan Dimulai Dari A3 KEPALA Badan Penanggulangan Bencana Daerah (BPBD) Aceh Timur, Muhammad Ikbal mengaku membacaWaspada sejak dirinya menduduki kursi SPK Langsa. Bahkan hingga kini dia tidak putus-putus berlanggganan dengan media Harian Waspada, baik ketika sebagai Camat Darul Aman ataupun sudah menjadi Kepala BPBD Aceh Timur. “Waspada sudah melekat di hati saya, bahkan salah satu media nasional yang menjadi rujukan saya ketika ingin mencari masukan untuk sebuah program di kecamatan, terutama dalam penanggulangan bencana banjir,” ujar Muhammad Ikbal. Dia menambahkan, selama ini Harian Waspada sudah sangat maksimal dan profesional dalam bahasanya. Hal itu terjadi tidak terlepas dari profesionalnya wartawan yang direngkrut di lapangan dan redaksinya yang sangat teliti dalam mengeluarkan sebuah informasi. “Penyajiannya sangat imbang dan profesional, apalagi gambar yang muncul juga mendukung pelaksanaan Syariat Islam (SI) di Aceh,” kata Muhammad Ikbal. Namun demikian, saran Ikbal, halaman yang dijadikan porsi berita Aceh ditambah dan dipindahkan dari halamana belakang ke halaman depan. “Artinya, halaman untuk berita Aceh dipindahkan ke A3 hingga seterusnya, jika memang tidak memungkinkan di halaman A2,” harap Ikbal seraya mengatakan, semoga Waspada di usianya 65 tahun tetap bersinar dan tetap bertahan hingga seribu tahun lagi. Muhammad H. Ishak

C1 TAPAKTUAN(Waspada) : Hujan lebat yang mengguyur wilayah Tapaktuan, Kabupaten Aceh Selatan selama tiga jam terus menerus, Kamis (5/1), sejak pukul 08:00 hingga pukul 11:00, membuat ratusan rumah di ibukota kabupaten penghasil komoditi pala menjadi tergenang banjir Kondisi ini terjadi karena muara Kuala Busuk, dangkal dan tersumbat. Diperburuk lagi dengan tersumbatnya saluran dan riolriol kecil yang bertaburan di sudut kota, akibat penuh onggokan sampah. Banjir terparah menggenangi perumahanwarga di Gampong Pasar, Padang Hilir, Lhok Bengkuang, Lhok Ketapang dan Tepi Air. Meski tidak ada warga yang mengungsi, namun warga menjadi repot karena air menggenangi rumah mereka setinggi 20 hingga 30 cm. Bahkan Jalan Merdeka, sebagai pusat kota, arus lalu lintas menjadi macat total karena jalan yang digenangi setinggi 50 cm ditutup. Hal itu dilakukan warga, guna menghindari terjadinya luapan banjir masuk ke pertokoan. Bupati Husin Yusuf yang melakukan moni-

Waspada/Muhammad H Ishak

BEBERAPA warga melihat kondisi longsor di jalan lintasan Peunarun – Lokop persisnya di kawasan Lengkong, Kecamatan Serbajadi, Kab. Aceh Timur, Kamis (5/1).

30 M Jalan PeunarunLokop Longsor Ribuan KK Terkurung, Camat Peunarun Terkurung Di Lokop LOKOP (Waspada) : Akibat guyuran hujan lebat yang melanda sebagian kawasan pedalaman Aceh Timur sejak Rabu (5/1) petang mengakibatkan sekitar 30 meter jalan lintas Peunarun – Lokop, Kecamatan Serbajadi, tertimbun tanah longsor, Kamis (6/1).

Eksesnya, ribuan jiwa di sejumlah desa di Kecamatan Serbajadi—Lokop, kini dalam kondisi terkurung. Bahkan, Camat Peunarun Jaman mengaku, dirinya bersama keluarga terkurung di Lokop, sehingga tidak bisa menghadiri Rapat Koor-

dinasi Pilkada di Mapolres Aceh Timur di Peudawa, Kamis kemarin. “Di Lokop tidak ada sinyal handphone, jadi sesampai di Lokop bersama keluarga saya tidak bisa turun lagi ke Peunarun tadi malam, sebab sepanjang 30 meter jalan tertutup longsor di atas badan jalan,” papar Camat Jaman seraya menambahkan, demi keperluan dinas dirinya terpaksa turun dengan berjalan kaki, itupun membutuhkan waktu hingga beberapa jam lebih melewati titik longsor hingga tiba di Kantor Camat Peunarun. Informasi yang diperoleh menyebutkan, tanah longsor kali ini menutupi badan jalan antara 30 centimeter hingga satu meter lebih. Jalan yang no-

tabenya tercatat lintas kecamatan itu hingga berita ini diturunkan melumpuhkan arus transportasi dan belum dapat dilalui kendaraan. Kawasan yang longsor terjadi persisnya di kawasan Buket Aneuk Manyak atau kawasan Lengkok (4 kilometer sebelum ibukota Lokop). Kepala Badan Penanggulangan Bencana Daerah (BPBD) Aceh Timur Muhammad Ikbal membenarkan adanya bencana longsor di kawasan Lekong (Lokop). Namun setelah mendapat laporan pihak kecamatan setempat, pihaknya dengan melakukan koordinasi dengan instansi terkait telah menurunkan alat berat ke lokasi membersihkan tanah longsor. (b24)

toring banjir didamping dinas terkait, segera mengerahkan backhoe guna menggali muara Kuala Busuk yang dianggap sebagai penyebab banjir nomor wahid. “Soalnya jika tidak segera ditanggulangi, Kota Tapaktuan bisa terendam sepanjang hari,”ucapnya kepada wartawan di sela-sela peninjauan tersebut seraya menyebutkan keprihatinannya terhadap kesadaran warga masih rendah dengan membuang sampah di sembarang tempat, seperti parit dan laut. HusinYusuf mengakui menyebutkan pembangunan riol-riol untuk membebaskan banjir dalam kota masih terkendala, karena sebagian warga kota merasa keberatan sebagian lahan perkarangannya dibuat parit tertutup. “Jika kesadaran masyarakat masih rendah, kita masih sulit bergerak ke arah kemajuan,”tambahnya. Pantauan Waspada, selain menggenangi ratusan rumah warga Tapaktuan, banjir ini juga menyebabkan hubungan darat TapaktuanBanda Aceh lumpuh beberapa saat, akibat sebagian badan negara di kawasan Labuhanhaji tergenang. (b30)

Empat Desa Di Simpang Mamplam Terendam Banjir BIREUEN (Waspada) : Sedikitnya empat desa di Kecamatan Simpang Mamplam, Kabupaten Bireuen, Rabu (4/1) terendam banjir. Air luapan dari saluran Tufah mulai meluap sekira pukul 22:30, namun kondisi kembali normal pada pagi harinya. Kendati demikian, kejadian ini membuat warga setempat panik. Camat Simpang Mamplam Jalaluddin, Kamis (5/1) mengatakan, hasil tinjauannya empat desa yang dilanda banjir luapan itu yakni Desa Ie Rhob Barat, Desa Ie Rhob Timu, Ie Rhob Babah Lueng dan Ie Rhob Geulumpang. Sebelumnya, kata Jalaluddin, banjir akibat meluapnya saluran pembuangan juga melanda empat desa itu dua kali. “Tapi banjir yang tadi malam airnya lebih tinggi dari sebelumnya. Ini ketinggian air mencapai 80 centimeter di dalam rumah,” terang Jalaluddin. Disebutkan, hal ini diakibatkan semakin sempit dan dangkalnya saluran. Begitupun, hasil pantauannya, dua rumpun bambu di saluran Lueng Tufah di Desa Ie Rhob Babah Lueng tersangkut di bawah jembatan, sehingga menghambat kelancaran aliran air. Di Kecamatan Pandrah Pada waktu bersamaan, banjir dadakan juga terjadi di kawasan Kecamatan Pandrah, bahkan, sehingga pasca itu warga di Desa Lancok Ulim,

Pandrah Janeng, Pandrah Kandeh, Nasee Mee, dan Gampong Blang, Kamis (5/1) sibuk membersihkan rumahnya dari lumpur. Meskipun airnya saat itu di desa-desa mereka hingga menjelang siang airnya masih setinggi 50 cm. Selain itu, bajir kiriman di kecamatan tersebut juga mengenangi puluhan hektar hektare padi terutama yang berada di Desa Laoncok Ulim yang baru ditanam beberapa waktu lalu. Keterangan yang dihimpun, banjir kiriman yang terjadi di Kecamatan Pandrah tidak ada yang menyangka sebelumnya. Pasalnya di kawasan tersebut sebelumnya tidak ada hujan, namun airnya tiba-tiba datang dan mengenagi desa-desa di beberapa desa di kawasan keamatan tersebut, sehingga warga siang kemarin terpaksa harus membersihkan rumahnya dari lupur air bah. Keuchik Desa Loncok Ulim, Tgk Abdul Jalil, mengatakan, banjir yang melanda kawasan desanya secera tiba-tiba, sehingga banyak warga yang rumahnya tergenag tidak sempat memindahkan barang seperti lemari dan perabotan rumah tangga lainnya sehingga banyak yang rusak.“Setiap datangnya musim hujan, puluhan hektar sawah di desa kami terendam, apalagi kali ini memang banjirnya langsung datang,” katanya yang diiyakan sejumlah warganya. (b17/ cb02)

Pintu Gerbang Aceh Timur Dijaga Ketat IDI (Waspada) : Untuk menghindari masuknya barangbarang haram seperti narkoba dan menghindari kaburnya pelaku kejahatan dari daerah lain, dua pintu gerbang masuk ke wilayah Aceh Timur kini dijaga ketat aparat keamanan, baik TNI/Polri. “Langkah yang kita lakukan dengan memperketat razia oleh petugas keamanan gabungan (TNI/Polri), sehingga kemungkinan kaburnya pelaku kejahatan dari daerah lain tidak terjadi,” papar Kapolres Aceh Timur AKBP Ridwan Usman didampingi Kapolsek Pantee Bidari Ipda Chandar Kirana kepada Waspada, Kamis (5/1) di Mapolres. Disebutkan, dua pintu gerbang darat yang dijaga ketat yakni pintu gerbang jembatan

AKBP Ridwan Usman

Panton Labu (perbatasan Aceh Timur – Aceh Utara) dan pintu gerbang perbatasan Aceh Timur – Kota Langsa. “Selain mem-

perketat razia gabungan, petugas juga melakukan patroli ke titik yang rawan aksi kriminal,” kata Ridwan Usman. Meski demikian, dia mengharapkan partisipasi dan dukungan masyarakat Aceh Timur menginformasikan setiap gerak-gerik orang tak jelas di wilayah hukumnya, sehingga kemungkinan yang tidak diinginkan tidak terjadi di Aceh Timur dan kedamaian tetap terjaga. Menyikapi kaburnya pelaku kriminal dari Aceh Utara ke Aceh Timur, AKBP Ridwan Usman mengaku hal tersebut tidak tertutup kemungkinan terjadi, apalagi secara geografis Aceh Timur daerah daratnya berbatasan dengan Aceh Utara, Bener Meriah, Blangkejeren, Aceh Tamiang dan Kota Langsa.(b24)

Pohon Kelapa Berbuah Di Usia Enam Bulan ANEH tapi nyata. Ratusan warga berkerumunan dan berdatangan serta mengabadikan pemandangan unik di Dusun Peutua Husen, Desa Keutapang Dua, Kecamatan Idi Timur, Aceh Timur. Hingga Kamis (5/1) petang warga masih tumpah ke lokasi melihat pohon kelapa berbuah di usia enam bulan di Jalinsum Banda Aceh – Medan.

Keunikan itu yakni 1 dari 10 bibit kelapa yang dilakukan pembibitan oleh Lahmuddin, 38, petani setempat terjadi pembuahan di saat usia 6 bulan. Pembuahan yang terjadi dinilai aneh, sebab kebiasaan kelapa berbuah di usia di atas 4 tahun. Tapi kali ini yang terjadi usianya baru 6 bulan dan belum dilakukan penanaman. Lahmuddin mengaku, dirinya mengetahui keanehan itu, Selasa (4/1). Kala itu, Lahmuddin hendak menanam seluruh bibit buah kelapa tersebut di belakang rumahnya, namun ketika dilihat salah satunya sudah berbuah dalam ukuran satu tandan dan dengan 10 biji dia memperlihatkan ke


BEBERAPA bocah sedang bermain sepeda di jalan yang terendam banjir di Desa Hagu, Kecamatan Matang Kuli, Kamis (5/1).

Kawasan Matangkuli Banjir Lagi LHOKSUKON (Waspada) : Tujuh desa di Kecamatan Matang Kuli, Aceh Utara, kembali dilanda banjir akibat meluapnya Krueng (sungai) Pirak dan Krueng Pantee, Kamis (5/ 1). Ratusan rumah terendam. Namun belum ada warga yang mengungsi. Ketujuh desa itu, masing-masing Desa Hagu, Alue Thoe, Cibrek, Lawang, Tanjong Tgk Ali, Siren,Tanjong Abah Krueng. Yang terparah Desa Alue Tho dan Desa Hagu. Ketinggian air di dua desa ini rata-rata mencapai lutut orang dewasa. Pantauan Waspada, selain merendam ratusan rumah warga, banjir juga menggenangi sejumlah ruas jalan desa, sehingga sulit dilalui, baik pejalan kaki maupun pengendara bermotor. Bahkan di beberapa titik, ketinggian air di atas badan jalan mencapai 60 centimeter. “Tanaman padi warga yang baru siap

tanam, juga ikut terendam. Air mulai meluap sekitar pukul 05:00 dan hingga kini airnya bertambah,” kata MuhammadYunus, 52, warga Alue Thoe, Kamis (5/1). Bahtiar, 30, warga Desa Hagu, menambahkan, banjir seperti itu rutin terjadi setiap kali musim hujan datang. Bahkan dalam setahun banjir melanda hingga tujuh kali. “Ini terjadi karena tidak ada bangunan tanggul di sepanjang bantaran sungai. Warga sudah lelah minta dibangun tanggul. Tapi pemerintah seperti cuek saja,” tandasnya. Kepala Bidang Operasi Taruna Siaga Bencana (Tagana) Aceh Utara, Sofyan, mengatakan, pihaknya masih memantau perkembangan banjir di Kecamatan Matang Kuli. “Jika memang tambah parah, kita akan membuat posko. Sejauh ini, kondisi banjir belum begitu mengkhawatirkan,” kata Sofyan. (b19)

Tanggungjawab Pengelola Pendidikan Sangat Berat

Waspada/Muhammad H Ishak

WARGA melihat keunikan terhadap pohon kelapa yang berbuah di usia 6 bulan di Dusun Peutua Husen, Desa Keutapang Dua, Kecamatan Idi Timur, Aceh Timur, Kamis (5/1). warga yang sedang nongkrong di sejumlah warung kopi. “Mulai hari itu warga berkerumunan dan sampai saat ini bibit kelapa ini sudah menyedot pengunjung di Kecamatan Idi Timur dan sekitarnya,” ujar Lahmuddin. Rencana Lahmuddin, bibit kelapa itu ingin dimasukkan ke dalam pot yang lebih besar agar bisa berbuah dan tumbuh sebagaimana kelapa lainnya. Namun dia mengharapkan pembuahan itu tidak gugur. “Kita

harapkan tidak gugur dan terus tumbuh,” katanya seraya mengatakan, jika ada yang membelinya dirinya siap menjual. Kepala Dinas Pertanian Aceh Timur Marwi Usmar mengaku belum menerima informasi itu, namun pihaknya mengaku jarang terjadi pembuahan di usia dini terhadap pohon kelapa. “Apalagi di usia 6 bulan, ini sebuah keajaiban, karena pembibitan dilakukan secara alami,” katanya. Muhammad H Ishak

LHOKSEUMAWE, (Waspada): Tugas para pengelola pendidikan sangat berat, karena harus bertanggungjawab dunia akherat. “Taiap tahun 30 persen dana alokasi umum (DAU), diarahkan Pemerintah untuk membiayai pendidikan, belum termasuk dana BOS/ BOSDA dan lain-lain. Karena itu para pengelola pendidikan harus mempertanggungjawab kinerjanya kepada negara dan yang lebih penting harus mampu bertanggungjawab dengan Allah,” kata Pj Bupati Aceh Utara, Drs HM Alibasyah, MM dalam pengarahannya pada silaturahmi dengan Majelis Pendidikan Daerah (MPD) Aceh Utara, di sekretariat MPD itu, Jl Samudera Lhokseumawe, Kamis (5/1). MPD, katanya sebagai mediator antara pengelola pendidikan dengan masyarakat dan stakeholder lainnya dalam meningkatkan mutu pendidikan dalam membela/menjaga para anak didik dari berbagai ancaman, seperti sekarang ini bahaya yang paling mengancam anak antaranya narkoba dan pornografi. Khusus untuk MPD Aceh Utara, Pemerintah daerah menyediakan dana operasional dan biaya rutin, termasuk biaya untuk melakukan supervisi, karena itu HM Ali Basyah mengimbau MPD selalu turun melakukan survey, supervisi

dan lain-lain apapun namanya, untuk mengawal jalannya pendidikan di kabupaten yang membawahi 27 tingkat kecamatan ini. “Tiap tiga bulan sekali sebaiknya institusi MPD melakukan pertemuan dengan para pengelola pendidikan. Dalam pertemuan itu dibahas temuan MPD atau hal-hal lain yang pada wujudnya saling tukar menukar informasi dan mencari jalan keluar permasalahan, demi kemajuan pendidikan di Aceh Utara. Sadar atau tidak, mutu pendidikan kita di kabupaten ini sangat memalukan. Bicara pendidikan, adalah bicara out come bukan out put,” tegas Pj Bupati Aceh Utara. Tahun 2012 pinta HM Ali Basyah, supaya dijadikan starting place (titik star kembali) terhadap perbaikan mutu pendidikan di daerah seluas 3.296,86 kilometer ini. “Mari kita kerja yang ditopang keikhlasan,memperbaiki segala aspek yang melatarbelakangi melorotnya mutu pendidikan di kabupaten ini,” pintanya. Sebelumnya, Dr Rajiman Musa, Ketua MPD Aceh Utara mengharapkan HM Ali Basyah dalam masa jabatannya yang singkat di kabupaten ini dapat meninggalkan suatu inovasi atau apapun namanya, seperti menyelesaikan RPJM untuk dipedomani oleh Bupati Aceh Utara definitif ke depan. (b13)



WASPADA Jumat 6 Januari 2012

Camat Muara Batu Jual Leges 1 Ribu, Rp 5 Ribu

62 Anak Yatim Terima Beasiswa Dari PKS LHOKSEUMAWE (Waspada): Sebanyak 62 anak yatim yang masih berstatus pelajar Sekolah Menengah Pertama (SMP) di Kota Lhokseumawe, Kamis (5/1) menerima bantuan beasiswa senilai Rp400 ribu. Dana beasiswa bersumber dari dana aspirasi anggota DPR-RI Raihan Iskandar, Lc. Secara simbolis bantuan diserahkan Fuadi Sulaiman, anggota DPRA dari Fraksi PKS. “Kita berharap, beasiswa yang jumlahnya tidak seberapa ini dapat meringankan beban orang tua wali dalam hal biaya pendidikan,” ucap Fuadi Sulaiman kepada Waspada kemarin. Lanjut Fuadi, bantuan beasiswa diberikan khusus kepada anak yatim dan kaum duafa yang dinilai rajin beribadah. Proses seleksi apakah pelajar tersebut rajin beribadah atau tidak ditentukan oleh Rohis yang ada di sekolah masing-masing. “Ini bukan beasiswa prestasi, tapi ini beasiswa untuk anak yatim dan duafa,” kata Fuadi. Raihan Iskandar, Lc, anggota DPR-RI Komisi X dari Fraksi PKS ketika dikonfirmasi Waspada via telepon, Kamis (5/1) membenarkan, kalau pihaknya telah mengusahakan bantuan beasiswa dari pusat untuk diserahkan kepada anak yatim dan duafa. bantuan itu diberikan untuk menyemangati pelajar untuk semangat dalam menimba ilmu. “Kita berharap, dengan adanya bantuan beasiswa ini anakanak yang terancam putus sekolah dapat melanjutkan sekolah dengan normal. Selama ini, banyak anak dari keluarga miskin dan duafa putus sekolah di tengah jalan. Jadi dengan adanya program beasiswa angka anak putus sekolah dapat diperkecil,” kata raihan Iskandar, Lc. (b18)

Situasi Aceh Jangan Hambat Aktifitas Intelektual LHOKSEUMAWE (Waspada): Situasi Aceh saat ini jangan dijadikan sebagai alasan penghambatan aktifitas intelektual, baik berkenaan dengan pendidikan maupun kesenian. “Kita bebas mengeluarkan pendapat kita dalam belajar, berkerja, dan berkarya. Kondisi Aceh yang saat ini tidak sehat jangan dijadikan hambatan, ini akan merugikan diri kita sendiri,” kata pengurus Forum Lingkar Pena (FLP) Lhokseumawe, Zahra Fona, Kamis (5/1). Zahra yang baru menyelesaikan pendidikan S2 di Jerman, yaitu di bidang Hydro Science an Engineering Universitat Dresden, berpendapat, Aceh masih sulit menerima perbedaan dan cara berpikir dari orang kebanyakan. Namun, kata dia, kerja intelektual tidak boleh diganggu, terlepas setuju atau tidak. Sebuah karya yang diciptakan anak bangsa ini, baik itu berupa lukisan, novel, ataupun buku ilmiah, tidak harus dimusuhi. “Suka tidak suka terserah pribadi orangnya, tapi janganlah sampai menghujat orang lain,” tegasnya.(b14)

KPA Dukung Penegakan Hukum BANDA ACEH (Waspada): Komite Peralihan Aceh (KPA) mendukung sepenuhnya upaya aparat penegak hukum untuk menuntaskan kasus-kasus kriminal yang terjadi di Aceh, agar tidak lagi merusak rasa aman di masyarakat. Hal tersebut sesuai dengan instruksi pimpinan KPA, seluruh jajaran KPA mulai dari hirarki tertinggi sampai terendah harus mendukung penegakan hukum terhadap semua pelaku kriminal, sebagaimana disampaikan jubir KPA Pusat, Muklis Abee, di Banda Aceh, Kamis (5/1). Menurut dia, KPA siap bekerja aktif mendukung aparat hukum demi tegaknya perdamaian dan meminta agar semua semua pihak berhenti berpolemik terhadap motif di balik semua kasus ini. “Kita harus memberi ruang bertindak bagi penegakan hukum, tanpa diganggu oleh opini macam-macam,” tegas Muklis. KPA berharap pengungkapan kasus ini akan meminimalisir kriminal yang membonceng memanasnya suhu politik di Aceh. “Kita berada di negara hukum, jadi semua harus percaya pada penegak hukum. Kalau tidak lagi percaya pada penegakan hukum, ya bagaimana kita bisa hidup bernegara dan bermasyarakat,” katanya. Dalam kasus kriminal, sebut Muklis, pihak kepolisian sudah memiliki ilmu untuk menanganinya. Sedangkan masyarakat, hendaknya ikut membantu kepolisian dalam penanganan kasuskasus kriminal, bukan cuma bisanya menghujat kepolisian. Untuk itu, dia mengajak seluruh masyarakat untuk dukung kepolisian dalam mengungkap kasus kekerasan di Aceh. Kalau pun tidak membantu, hendaknya jangan memperkeruh suasana dengan membuat statemen-statemen yang membingungkan masyarakat. (b04)

Sengketa Lokasi Peringatan Tsunami Berlatar Belakang Kecemburuan Sosial SEUNUDDON (Waspada) : Kabag Humas Pemkab Aceh Utara Azhari Hasan dan Camat Seunuddon M Dahlan HA menjelaskan, sengketa lokasi peringatan tsunami di kabupaten ini berlatar belakang kecemburuan sosial. “Sebelum acara peringatan tsunami ke-7, Senin (26/12), saya sudah mengadakan rapat dengan delapan Kades dan dua Imum Mukim untuk memilih beberapa titik lokasi. Namun, karena ini porsi acara berspektrum kabupaten, saya mengatakan pemilihan final lokasi pada hari ‘H’, tergantung Pj Bupati Aceh Utara, sehingga pada akhirnya lokasi itupun ditetapkan di Gampong Bantayan, kawasan wisata Ulei Rubek,” kata camat setempat, M Dahlan HA di ruang Kabag Humar Pemkab Aceh Utara, Rabu (4/1). Baik camat maupun Kabag Humas Pemkab Aceh Utara sangat menyesalkan informasi miring yang menyatakan Pj Bupati Aceh Utara memindahkan lokasi itu ke Gampong Bantayan. “Tanggal 25 Desember 2011 yaitu hari penetapan lokasi untuk acara perhelatan peringatan tsunami. Karenanya, terhadap informasi miring yang mendiskreditkan sangat disesalkan,” lanjut M Dahlan HA. (b13)

Waspada/Maimun Asnawi

FUADI Sulaiman, Anggota DPRA Fraksi PKS, Kamis (5/1) menyerahkan beasiswa kepada pelajar miskin tingkat SMP, anak yatim dan duafa. Terlihat seorang orang tua wali menerima beasiswa tersebut.

Tahun Ini Petani Aceh Dapat Rp100 Juta LHOKSEUMAWE (Waspada): Tahun ini petani di Aceh mendapatkan modal Pengambangan Usaha Agribisnis Pedesaan (PUAP) sebesar Rp100 juta per setiap Gabungan Kelompok Tani (Gapoktan). “PUAP merupakan bentuk fasilitas bantuan modal usaha bagi petani, baik petani pemilik, petani penggarap, buruh tani, maupun rumah tangga tani yang dikoordinasi oleh gabungan kelompok tani,” kata Ketua Kontak Tani Nelayan Andalan (KTNA) Kota Lhokseumawe, Rusli MS, Kamis (5/1).

Dikatakan bantuan ini bertujuan untuk meningkatkan kemampuan pelaku usaha, berkenaan dengan penyuluhan, penyelia mitra tani, juga memberdayakan kelembagaan ekonomi yang dikelola perorangan. Pengembangan usaha agribisnis dianggap penting, sebagaimana peningkatan kerja kelembagaan menjadi jejering atau mitra keuangan dalam hubungan akses ke permodalan. Bantuan langsung masyarakat berupa PUAP ini merupakan dana sosial untuk petani, kata Rusli. Dana ini untuk pengembangan usaha agribisnis di pedesaan yang disalurkan melalui Gapoktan dalam bentuk modal usaha sebesar Rp100 juta setiap Gapoktannya.

Melalui pelaksanaan PUAP, Rusli mengharapkan Gapoktan dapat menjadi kelembagaan ekonomi yang dimiliki dan dikelola sendiri. Dengan demikian dapat mengurangi angka kemiskinan dan pengangguran melalui pertumbuhan dan pengembangan kegiatan usaha agribisnis di pedesaan, sesuai dengan potensi wilayah yang ada. Rusli mengatakan pada 711 Desember mendatang Pemerintah Kabupaten/Kota telah mengirim 83 ketua Gapoktan se-Aceh untuk mengikuti pelatihan managemen pertanian khusus di bidang PUAP. “Kita berharap semuanya akan berjalan dengan lancar dan tidak ada kendala apa pun,” pungkasnya.(b14)

Isu JKA Tak Berlaku Lagi Beredar Di RSUD Cut Mutia LHOKSEUMAWE ( Waspada) : Ratusan warga Aceh Utara dan Kota Lhokseumawe mengaku resah beredarnya isu program Jaminan Kesehatan Aceh (JKA) tidak berlaku lagi di RSUD Cut Mutia Aceh Utara. “Banyak perawat di RSUD Cut Mutia bilang program JKA sudah tidak berlaku lagi. Isu tersebut membuat kami masyarakat resah. Apa benar pak wartawan, program JKA telah dihentikan seperti perawat-perawat itu bilang,” kata Mis, 40, salah seorang keluarga pasien kepada Waspada di RSUD Cut Mutia, Kamis (5/1). Kecemasan juga dialami Fatimah, 50, Abdul Hadi, 26, dan Nisa, 28. Mereka cemas karena saat keluarganya berobat di RSUD Cut Mutia menggunakan program JKA. Apalagi, para pasien banyak yang menggunakan kamar VIP. “Kalau benar program ini berakhir, berarti kami harus mengeluarkan uang banyak untuk bayar dokter, obat dan biaya kamar,” ucap Nisa. Muhammad Nurdin, Kepala Dinas Kesehatan Aceh Utara ketika dikonfirmasi Waspada, Kamis (5/1) membantah program JKA telah dihentikan. Terkait isu yang beredar di RSUD Cut Mutia, Nurdin juga mengaku telah mengkonfirmasi pihak Askes dan pihak Askes mengatakan, program JKA tetap

dilanjutkan. Karena hingga saat ini, belum ada petunjukkan program JKA dihentikan Gubernur Aceh.“Isu yang beredar di RSUD Cut Mutia itu tidak benar. Kita belum mendapatkan perintah dari Gubernur Aceh untuk menghentikan program tersebut. Masyarakat kami minta untuk tidak khawatir dan tidak perlu resah dengan isu yang sengaja dihembuskan oleh pihak yang tidak bertanggungjawab,” papar M Nurdin. Iskandar, Kepala Tata Usaha RSUD Cut Mutia juga membantah isu miring itu. Karena hingga Kamis (5/1) pukul 13:00, pihaknya belum menerima perintah dari Gubernur Aceh

untuk menghentikan program JKA. “Kalau memang sudah dihentikan, kami pasti tahu, tapi sampai kini kita belum menerima informasi itu dari Provinsi Aceh. Jadi program JKA tetap dilanjutkan sesuai aturan. Masyarakat tidak perlu khawatir,” kata Iskandar. Zainal Abidin Badar, Koordinator LSM Reuncong Aceh mengatakan, oknum perawat yang bertugas di RSUD Cut Mutia diminta untuk tidak sembarangan menyebar isu yang dapat menciptakan keresahan masyarakat. Pihak RS juga diminta untuk meluruskan persoalan tersebut dan meminta perawat untuk tidak ikut campur dalam persoalan kebijakan rumah sakit. (b18)

Seratusan Pelajar Ikuti Daurah A’dha’ I KAPMI IDI TIMUR (Waspada) : Seratusan pelajar SMP/SMA se-Aceh Timur mengikuti Daurah A’dha’ (Pelatiha Dasar) I yang digelar Kesatuan Aksi Pemuda Muslim Indonesia (KAPMI) Aceh Timur, Kamis (5/1) di Aula SKB Aceh Timur di Idi Timur. Ketua Panpel Daurah A’dha I, Zikrullah mengatakan, kegiatan berlangsung sejak 5-6 Januari 2012. Untuk peserta yang hadiri mencapai hampir 200 orang yang keseluruhannya dari kalangan pelajar SMP/SMA di Aceh Timur. Zikrullah menjelaskan, Daurah A’dha’ I adalah Pelatihan Dasar I yang digelar Organisasi Kepemudaan (OKP) KAPMI di Aceh Timur dalam merekrut pelajar dan pemuda untuk bergabung dalam organisasi tersebut. Ketua Umum KAPMI Aceh Timur Zaidan Zikri Malem mengatakan hal yang sama. Dia menambahkan, kegiatan tersebut diharapkan mampu membangkitkan semangat pemuda muslim dalam menghadapi perkembangan zaman yang semakin canggih.(b24)

KRUENG MANE (Waspada): Camat Kec. Muara Batu, Aceh Utara Drs Saiful Bahri menjual materai tempel (leges) seribu kepada guru pengurusan sertifikasi di kecamatan setempat Rp 5 ribu per lembar di kantornya. Harga leges milik Dipenda (DPKADred) Aceh Utara itu yang seharusnya dijual harga seribu. Penelusuran Waspada ke bebarapa sekolah di Kecamatan Muara Batu, tiga orang guru yang temui mengaku telah membeli leges sebutan akrab oleh guru-guru untuk materai tempel itu untuk keperluan perlengkapan berkas Waspada/Mustafa Kamal sertifikasi harganya bervariasi. SEORANG guru memperlihatkan berkas sertifikasi yang sudah “Saya baru saja membeli leges terterai materai tempel (leges) yang dibelinya Rp5 ribu untuk materai di Kantor Camat di ruang Rp1 ribu. Seksi Pemerintahan Rp3 rb untuk leges 1 ribu,” ungkap salah seorang guru berbicara secara terang-terangan, karena bisabisa kena imbas. Abang wartawan kan tau bagaiberinisial SB. Lanjut SB, tapi setau saya harga itu dijual mana sistem daerah kita,” urainya sambil terdi Dinas Pengelolaan Keuangan dan Aset Daerah senyum. Camat Kec. Muara Batu Drs Saiful Bahri (DPKAD) itu seharga Rp 1 ribu, tapi kenapa ini dijual sampai Rp5 ribu, paling tidak kalau mau sudah berkali-kali dihubungi Waspada tidak cari untung, janganlah sampai segitu harganya. berhasil melalui telepon selularnya. Informasi yang diterima di dua nomor HP-nya sedang tidak Dijual Rp1.500 atau Rp2 ribu, tidak terlalu masalah, tambah guru mata pelajaran sejarah itu. aktif. Dan melalui pesan singkat juga tidak Guru lain yang juga enggan disebut nama- masuk. Kepala Dinas Pengelolaan Keuangan dan nya, berinisial HS memperlihatkan berkas Aset Daerah (DPKAD) Aceh Utara Iskandar Nasri pengurusan berkas sertifikasi yang sudah tertera saat dihubungi Waspada mengatakan, tidak materai tempel itu. Dia mengaku kesal dengan boleh menjual di atas harga yang telah tertera sikap seorang camat yang tidak profesional. di atas materai. Kalau materai tertulis seribu, “Harga saya beli Rp5 ribu per lembar, kebu- aturannya dijual harga Rp1 ribu, tidak boleh tuhan saya berjumlah 12 lembar, kalikan saja Rp5 ribu. jumlahnya. Belum lagi hari ini ratusan guru yang Materai itu, jelas Iskandar, hanya dijual di urus sertifikasi,” sebutmnya. Dinas PKAD Aceh Utara, setiap Kantor Camat Kasus yang sama juga dikeluhkan guru lain. dan setiap kantor Unit Pembantu Teknis Daerah Namun guru berinisial M ini meminta kepada (UPTD) di setiap kecamatan. Harganya jelas dinas terkait untuk menindak setiap yang me- seperti yang tertera di materai, yakni Rp1 ribu nyalahi aturan. “Kami sebenarnya tidak berani untuk materai tempel Rp1 ribu. (cmk)

Anak Mandailing Pencipta Maket Rumah Aceh Yang Unik UNTUK menghasilkan karya seni yang elok, tentunya harus punya skill, ketelitian, dan kesabaran dalam membentuk dan mendesainnya agar bisa melahirkan kepuasan serta menarik perhatian. Begitu juga dengan Khoiruddin Amin, 44, warga Kampung Jawa Lama, Kecamatan Banda Sakti Kota LhokseuWaspada / Zainuddin Abdullah mawe, kesehariannya berprofesi sebagai penjaga toko KHOIRUDDIN memperlihatkan sebuah hasil karyanya Maket Rumah adat Aceh. kelontong. Namun pedagangan yang satu ini memiliki selesai. keunikan berbeda dengan orang lain karena Maket Rumah Aceh tersebut dibuat sedetidak pernah melepaskan hasil karya sendiri. mikian rupa penuh dengan indikasi adat daerah. Buktinya Khoiruddin tak tanggung-tanggung Maket berukuran luas 1.5x1.5m dan tinggi dari melakukan aksinya demi mewujudkan sebuah lantai sekitar 2 m itu dibuat dengan menggu“Mahakarya” yaitu maket Rumah Aceh. nakan bahan sederhana seperti kayu, ijuk, Khoiruddin memiliki sifat bagai pepatah tripleks dan kaca sebagai pelindung. ‘hemat pangkal kaya’, sehingga dia rela menyiTidak hanya itu, halaman Maket itu di hiasi sihkan waktunya dan menghabiskan uang dengan aneka pernak-pernik seperti vespa sampai jutaan rupiah demi menciptakan sebuah classic dan disertai lampu sehingga akan terlihat karya untuk mencerahkan masa depannya. jauh lebih indah. Disamping itu berjualan, ia Lelaki yang akrab disapa Amin tersebut ber- juga hobi memajang aneka gambar adat Aceh, darah Mandailing dari pasangan Almarhum seperti gambar rencong, tari saman dua dimensi Alibasyah Siregar dan Almarhumah Hj Rochi- serta kopiah khas Aceh ikut menghiasi ruko mah Harahap. Dia pindah ke Lhokseumawe tempat dia berjualan. sejak 2001 setelah menikahi perempuan se“Saya memang bukan orang Aceh, tapi saya tempat dan dikaruniai seorang anak yang seka- menyukai budaya dan adat Aceh”, katanya. Di rang duduk di kelas dua SMA. pertengahan 2011, Amin mengikuti kompetisi Khoiruddin mengaku dirinya memiliki ide mahakarya yang bertajuk “Ikon Aceh”. Acara membangun sebuah maket Aceh dipicu sejak diselenggarakan oleh sebuah perusahaan rokok. sering mengakses internet sampai mendapat Kemudian dia terpilih sebagai Juara I yang diikuti tawaran dari salah satu distributor rokok untuk oleh beberapa kabupaten dan kota yakni, Aceh mengikuti kompetisi mahakarya tentang Ikon Tamiang, Kota Langsa, Aceh Timur, Aceh Utara, Aceh. Kota Lhokseumawe, Bireuen, dan Takengen. “Setelah saya berpikir lama, akhirnya muncul Dia berharap kepada Pemerintah Aceh agar sebuah ide untuk membangun rumah adat Aceh lebih memerhatikan karya-karya seni adat yang cocok untuk diikutkan dalam perlombaan. daerah yang sekarang hampir punah karena Tidak ada salahnya kalau kita mencoba mem- generasi sekarang lebih mengidolakan budaya perkenalkan bentuk adat Aceh pada dunia,” barat ketimbang budayanya sendiri. Namun papar. bagi masyarakat yang punya minat dengan hasil Akhirnya ide kreatife Khoiruddin diimple- karyanya, Khoiruddin mengaku siap membuat mentasikan, namun dia tak sendirian dan dan menjual maket Rumah Aceh yang kini dibantu oleh lima rekannya untuk mempercepat terpajang di Lorong Mesjid Kampung Jawa, pekerjaanya. Alhasil, dalam waktu dua bulan Kecamatan Banda Sakti, Kota Lhokseumawe. sebuah mahakarya Maket Rumah Aceh pun Zainuddin Abdullah

Warga Seureuke Berselimut Duka Dan Trauma

Waspada/M Jakfar Achmad

KABAG Humas Pemkab Aceh Utara Azhari Hasan (kanan) dan Camat Seunuddon M Dahlan HA (kiri).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


TRAGEDI penembakan yang marak di Aceh belakangan ini membuat suasana Gampong Seureuke di Kecamatan Langkahan, Aceh Utara, masih berselimut duka dan trauma. Tak hanya sebatas duka, tapi juga masih diselimuti trauma bagi warga eks transmigrasi tahun 1980 itu. Tidak hanya di masa konflik, tapi pasca damaipun para petani ulet yang mengolah lahan subur di perbukitan ini, belum merasakan keamanan yang abadi. Hanya 6 tahun perdamaian terajut, gangguan keamanan kembali mengusik kawasan eks transmigrasi itu. Desa berhawa sejuk seluas 3.000 hektare ini, berpenduduk 855 kepala keluarga (KK) atau 2.952 jiwa, terpaut sekira 95 kilometer arah timur kota Lhokseumawe. Kondisi kehidupan masyarakat sangat rukun, aman dan damai, kendati Minggu (1/ 1) malam, mereka harus menyambut tahun baru 2012 di bawah cekaman ketakutan, aki-

Waspada/ M Jakfar Achmad

PJ BUPATI Aceh Utara H M Alibasyah (kanan), memetik buah coklat yang subur seraya menunjukkan kepada Komandan Korem 011/LW Kol Inf. Abdul Rachim Siregar, di salah satu hamparan kebun coklat milik warga eks trans Seureuke, Kec. Langkahan, Aceh Utara, Senin (2/1). Lokasi ini menjadi sasaran teror kelompok bersenjata api. bat orang yang tidak bertanggungjawab meneror mereka. Betapa tidak, sekonyongkonyong muncul komplotan penjahat bersenjata api. Tanpa basa-basi memuntahkan puluhan peluru, mengakibatkan

tewasnya seorang warga setempat bernama Suwalidi alias Bawon, 39, warga DusunVI Manggal, dengan meninggalkan seorang istri, dua anak. Pada malam naas itu, Bawon berada di warung kopi

milik Pak paimin, 60. Beberapa warga lain sedang nyerumput kopi di dalam warkop, cuma Bawon yang duduk di emperan bersama temannya, Edikaryawanto, 37. Akibat berondongan peluru secara membabibuta, Bawon rubuh dan tewas di tempat, sementara Edikaryawanto, jiwanya masih selamat dan sampai saat ini masih dalam perawatan intensif di Rumah Sakit Kesrem Lhokseumawe. Medio Oktober 2011, malapetaka serupa juga dialami warga eks trans yang bertetangga dengan Desa Seureuke, yaitu di Unit V Kec. Baktiya, seorang pengurus koperasi sawit tewas di tempat, namun apalagi senjata liar, sipelakunya juga belum tertangkap. Belum sampai tiga bulan berselang, peristiwa yang sebenarnya tidak layak dipertontonkan lagi, kembali mengusik ketenangan warga eks trans. Peristiwa di Desa Seureuke, lima hari lalu ini, nampaknya pihak keamanan serius menanggapinya. Warga mengharapkan, ini merupakan korban nyawa manusia yang terakhir atau tidak bisa dibiarkan lagi

oleh semua pihak yang bertanggungjawab terhadap keamanan, termasuk masyarakat untuk meningkatkan siskamling, memantau dan melaporkan kepada pihak berwajib, setiap melihat oknum-oknum yang dicurigai. Indikasi pihak keamanan semakin waspada, keesokan hari, Senin (2/1) pasca pemberondongan warga, pejabat Muspida Aceh Utara, turun ke TKP di Desa Seureuke (Langkahan). Selain Muspida, juga ikut serta Komandan Korem 011/LW, Kol Inf Abdul Rachim Siregar. Pj Bupati Aceh Utara H M Alibasyah menganjurkan warga untuk jangan mengabaikan kegiatan siskamling, karena tidak pantas lagi dibiarkan komplotan bersenjata api berseliweran di kampung-kampung. Konon wilayah pedalaman, seperti kawasan eks trans yang terasing dan jauh dari keramaian penduduk, bila di malam hari diusut orang-orang yang tidak dikenal, kalau didapati masuk kampong. Banyak poros jalan yang masuk ke kawasan eks trans, di semua pangkal jalan itu perlu dibangun satu pos pemeriksaan oleh warga dan

diback-up oleh personil keamanan yang selalu melakukan kegiatan ronda. “Polisi bersenjata lengkap memang sudah tampak siaga, kita harapkan ini terus berkesinambungan. Dalam rangka memberi rasa aman bagi masyarakat yang trauma,” kata Sekretaris Desa (Sekdes) Seureuke, Muda Sakti, Rabu (4/1) malam. Kapolres Aceh Utara AKBP Farid BE menyebutkan, pihaknya sudah menempatkan polisi di desa tersebut. Kecuali itu, polisi juga terus memburu komplotan pelaku yang disebutsebut berjumlah lima orang. Sejauh ini belum diketahui motif maupun tersangkanya. Kapolres menggambarkan, dari lokasi kejadian banyak sekali jalan-jalan kecil yang mudah digunakan pelaku untuk kabur keluar kawasan tersebut, termasuk akses ke Aceh Timur. Desa Seureuke terbagi tiga Blok, yaitu Blok A, B dan C. Kawasan ini berjarak 10 kilometer dari bendungan irigasi terbesar di Aceh, yaitu irigasi Jambo Aye/ Langkahan. M Jakfar Achmad


WASPADA Jumat 6 Januari 2012

C3 Petani Terpaksa Bajak Sawah Gunakan Tenaga Kerbau

Illiza Kagum Tuna Netra Aceh Kuasai Internet BANDA ACEH (Waspada) : Wakil Wali Kota Banda Aceh Hj Illiza Saaduddin Jamal menyatakan kekagumannya kepada penyandang disabilitas tuna netra di Banda Aceh yang mampu menguasai teknologi, informasi dan komunikasi (TIK). “Saya terkejut juga dengan tuna netra yang mampu menguasai komputer dan internet,” ujar Illiza Saaduddin Jamal saat menghadiri peusijuk Training Center Lembaga Pengembangan Sumberdaya Tuna Netra Aceh (Lampesta), Kamis (5/1) di Banda Aceh. Illiza mengakui tidak semua orang itu mampu menguasai komputer dan TIK ini. “Saya sendiri masih belum begitu mahir, ternyata penyandang disabilitas lebih maju dalam penguasaan TIK ini. Saya terus terang kagum,” katanya yang menyaksikan tuna netra mengoperasikan komputer. Ketua Umum Lempesta NurdinYacub menyebutkan, lembaga Lempesta yang dipimpinnya baru saja dibentuk dengan akte notaris. “Ini lembaga baru kita bentuk dan hari ini kita buka Training Center-nya di Jalan SA Johansayah, Neusu, Banda Aceh,” ujarnya. Lempesta dibentuk untuk mendorong tuna netra mandiri, tanggap, berdaya guna sekaligus berhasil guna sehingga tidak menjadi beban keluarga. “Misi kami adalah untuk pengembangan TIK, keagamaan, keterampilan, manajemen perekonomian dan kesehatan kepada tuna netra,” ungkap Nurdin. (b06)

SIGLI (Waspada) : Meski semakin canggih peralatan modern yang dimiliki sektor pertanian di zaman yang serba makin maju sekarang ini. Namun, mahalnya biaya yang diperlukan membuat sejumlah petani di Kabupaten Pidie terpaksa menggunakan tenaga lembu atau kerbau untuk mengolah sawah mereka. “Sebenarnya di zaman yang serba modern sekarang ini warga tidak perlu lagi repotrepot dan berlama-lama dalam mengolah tanah sawah mereka dengan menggunakan tenaga hewan peliharaan. Tapi, karena semua itu tergantung desakan ekonomi warga terutama para petani miskin,” ungkap M Syukri, seorang petani di Kecamatan Padangtiji, Kamis (5/1). Bisa dikatakan hal yang langka jika di zaman modern ini ternyata masih ada petani yang menggunakan sapi atau kerbau untuk membajak sawah. Padahal di daerah lain tidak ada lagi petani yang menggarap sawah dengan menggunakan tenaga kerbau. Inilah yang masih dilakoni beberapa petani dengan menggunakan bajak tradisional berupa lembu atau kerbau dan luku (bahasa Aceh: Langai). “Saya terpaksa menggunakan tenaga

Honorer Diminta Tingkatkan Disiplin SUBULUSSALAM (Waspada) : Para tenaga honorer dan tenaga bhakti di jajaran Pemko Subulussalam diminta meningkatkan disiplin. Bertindak indisipliner akan diberikan sanksi, seperti pemotongan honor. Permintaan itu disampaikan Wali Kota Subulussalam Merah Sakti pada agenda pertemuan pihaknya dengan perwakilan 1.559 tenaga honorer dalam jajaran Pemko Subulussalam, Kamis (5/ 1) di gedung Serbaguna Setdako Subulussalam. Di sisi lain Sakti mengingatkan kalau penetapan Kementerian Aparatur Negara RI terkait daerah (provinsi, kabupaten, kota) se-Indonesia tidak dibenarkan merekrut tenaga honorer menjadi salah satu indikator tenaga honorer harus lebih disiplin dan mematuhi semua aturan yang berlaku, tak terkecuali PNS. Dalam kesempatan itu, Sakti sempat mengusir salah seorang tenaga honorer dari ruang pertemuan karena dinilai tidak disiplin. Pasalnya, meski sebelum acara digelar semua peserta diminta menonaktifkan handphone, namun saat dirinya berbicara berdering handphone peserta pertemuan. Dengan nada keras, Sakti memerintahkan yang bersangkutan meninggalkan ruangan dan mengingatkan camat terkait agar menertibkan para staf.(b28)

RSUD Sangir Belum Miliki Status BLANGKEJEREN (Waspada): Hingga kini Rumah Sakit Umum Daerah Sangir Kabupaten Gayo Lues belum memiliki status, hal ini terkendala beberapa persyaratan yang harus dipenuhi. “Pada saat ini kita belum bisa memberikan pernyataan status RSUD Gayo Lues apakah mempunyai status atau belum, yang pasti kita sedang berusaha untuk menetapkan status rumah sakit ini minimal Kelas D, “ kata Direktur RSUD Sangir, dr Taufik Ririansyah, kamis (5/1) kepada Waspada. Dikatakan, beberapa hal yang masih menjadi kendala untuk mempunyai status, yakni jumlah dokter spesialis yang defenitif dan fasilitas lengkap ditambah dengan kualitas pelayanan baik dari sisi manajemen ataupun hal lain yang dianggap sangat perlu. Karena, kata Taufik selama ini RSUD Gayo Lues masih mengontrak dokter spesialis obstetri dan ginekologi (obgin) atau sering disebut dokter spesialis kebidanan dan penyakit kandungan yang bekerja fulltime (purna waktu), “ kita hanya mempunyai satu dokter defenitif yakni dr Linda, selain itu seperti dr. anak, kandungan, bedah dan lainnya, semua kita kontrak dari luar dengan anggaran Rp17 juta per dokter per bulan,” ungkap Taufik. Taufik juga berharap, bisa memiliki tenaga dokter spesialis kategori kecil yang membidangi radiologi, patonologi, dan anastesi,mengingat selama ini masih dilakukan Keperawatan. (cjs)

Waspada/Khairul Boangmanalu

BANGUNAN mushala di SMAN 1 Sultan Daulat yang terbengkalai. Foto direkam, Kamis (5/1).

Mushala SMAN 1 Sultan Daulat Terbengkalai SULTAN DAULAT (Waspada) : Bangunan mushala di SMAN 1 Sultan Daulat, Kec. Sultan Daulat, Subulussalam bantuan pemerintah 2009 kondisinya kini dibiarkan terbengkalai. Pihak sekolah berharap bangunan itu segera dirampungkan karena sangat dibutuhkan. Waka Kehumasan SMAN 1 Sultan Daulat Saidiman kepada wartawan, Kamis (5/1) menandaskan, meski tidak mengetahui pasti besaran anggaran untuk menyelesaikan bangunan itu, melalui APBK tahun ini rencananya akan dirampungkan. “Sudah turun anggota DPRK kemari, dan kabarnya akan diselesaikan tahun ini,” terang dia. Menjawab wartawan besaran anggaran program bantuan sosial APBNP 201 untuk pembangunan tiga ruang kelas belajar (RKB) dan satu unit laboratorium yang bersifat swakelola di SMA itu, Saidiman mengaku tidak mengetahui. (b28)

Waspada/Rusli Ismail

SEORANG petani sedang membajak sawah miliknya dengan menggunakan tenaga sapi. Foto direkam beberapa waktu lalu.


Pendidikan, Kesehatan Dan Infrastruktur Jangan Diganggu BANDA ACEH (Waspada) : Kepala Kejaksaan Tinggi Aceh menegaskan kepada pihak yang membidangi program kesehatan, pendidikan dan infrastruktur agar tidak menyelewengkan dan mengganggu program tersebut.

Tahun ini Kejaksaan Tinggi Aceh bersama jajaran dari Kejaksaan Negeri di Aceh akan memprioritaskan penanganan tiga bidang kasus yakni bidang pendidikan, kesehatan dan infrastruktur. “Tidak ada alasan lagi bagi Kejari di Aceh prioritas kerja tahun 2012 ini tidak berjalan dengan baik, karena akan ada evaluasi laporan kinerja para Kajari dan Kacabjari selama tahun 2011,” kata Kepala Kejaksaan Tinggi (Kajati) Aceh, Muhammad Yusni, Kamis (5/1) usai raker kejaksaan se-Aceh di Banda Aceh. MYusni menyebutkan, evaluasi merupakan perwujudan pertanggungjawaban dari para

Waspada/Gito Rolis

KAJATI Aceh M Yusni foto bersama pemangku jabatan atas amanah yang telah diberikan, diharapkan akan diketahui capaian keberhasilan atau kegagalan seluruh rangkaian proses kegiatan tugas yang dijalankan. Selama 2011, jajaran Kejaksaan Tinggi Aceh menyelamatkan kerugian negara dari kejahatan Pidana Khusus (Pidsus) sebesar Rp220.316.000 dari pelaku tindak pidana korupsi di Aceh. Uang negara yang diselamatkan Kejati sebesar Rp4.041.000. Kejari Langsa Rp216.275.000 uang tersebut ada yang dijadikan barang bukti dan sebagian disetorkan ke

Kasda Langsa. “Jumlah tersebut belum termasuk uang yang diselamatkan dari kasus Pidana Umum (Pidum), jika dijumlahkan bisa mencapai miliaran,” papar Kajati. Sementara jumlah uang pengganti yang sudah dibayarkan sebesar Rp148.090.000, dari Kejaksaan Negeri (Kejari) Lhoksukon Rp11.000.000, Kejari Tapaktuan Rp12.800.000, dan Kejari Blangkejeren Rp124.290.000. Sedangkan jumlah kasus yang ditangani sebanyak 67 perkara yang tersebar di kejaksaan seAceh. (cb01)

nya darimana ini, kok tega menciptakan situasi tidak sehat. Semalam langsung saya telepon Ketua KIP, Alhamdulillah beliau sehat,” kata salah seorang karyawan KIP. Ketika Hamidah masuk kantor, teman-temannya berebut menyalaminya. “Ada apa ini, Alhamdulillah saya masih sehat. Tidak ada masalah,” kata Hamidah. “Saya memang mendapat telepon dari berbagai pihak yang menanyakan keadaan saya. Namun setelah saya sebutkan kondisi saya sehat, mereka semuanya tenang.Yang penting sampai saat ini, saya

dapat menjalakan tugas yang sudah diamanahkan kepada saya,” kata Hamidah. Isu penembakan Ketua KIP Aceh Tengah, Selasa (3/1) malam cepat beredar. Namun Kapolres Aceh Tengah AKBP Edwin Rachmat Adikusumo mengakui belum mendengar keterangan itu. “Situasi Aceh menjelang Pilkada ini memang agak hangat. Kita harus waspada meneliti kebenaran isu, jangan langsung ditelan, tetapi saring dululah, cek and ricek ke-benarannya. (b32)

Kajari Blangpidie Pastikan Kasus Jamkesmas Dan KAT Masuk Pengadilan BLANGPIDIE (Waspada) : Penegakan hukum dan penanganan kasus tindak pidana korupsi di Kabupaten Aceh Barat Daya pada 2012 ini dipastikan segera berakhir ke pengadilan dan semua tersangka akan digiring ke meja hijau. Beberapa kasus lain yang sudah memasuki tahapan persidangan juga diharapkan segera tuntas, sehingga sejumlah kasus baru yang saat ini mulai antre dalam proses penyidikan juga segera berjalan. Penegasan dikemukakan Kepala Kejaksaan Negeri Blangpidie Umar Z kepada Waspada, Kamis (5/1). Menurut Kajari, pihaknya memastikan kasus tipikor yang masih ‘terutang’ akan masuk ke pengadilan pada Januari 2012 ini. Kasus itu di antaranya persoalan dana Jamkesmas (jaminan kesehatan masyarakat) yang menyeret Kepala Dinas Kesehatan Abdya berinisial K, serta bendahara Jamkesmas

‘dipromosikan’ sebagai tersangka dalam kasus tersebut. Selain kasus itu ada juga mantan Kepala Dinas Sosial dan Tenaga Kerja Abdya berinisial H serta sejumlah pejabat di dinas itu segera diproses akibat penyimpangan dengan membuat proyek fiktif dalam pelaksanaan proyek KAT (Kawasan Adat Terpencil). “Kita akui pada 2011 lalu agak sedikit kewalahan karena padatnya jadwal sidang di pengadilan, selain terbatasnya personil, jarak tempuh ke Tapaktuan dalam proses persidangan juga menjadi faktor yang menyebabkan dua kasus tersebut harus kita tangani di 2012 ini, namun kita pastikan pada tahun ini segera kita tuntaskan,” ujar Kajari Blangpidie. Dikatakan, proses penegakan hukum khususnya penanganan kasus korupsi di Abdya dilakukan secara sistem prioritas, di mana setiap kasus yang sudah lengkap akan lebih dida-

hulukan prosesnya tanpa harus menunggu penumpukan dengan kasus lainnya. Hal itu untuk memudahkan para jaksa menyelesaikan setiap kasus tanpa harus terbebani dengan kasus lain yang sedang berjalan. “Kita tidak mau menumpuk masalah, setiap kasus akan kita tangani satu demi,” tegas Umar. Barometer Dalam kesempatan itu Umar juga menyampaikan apresiasi kepada Harian Waspada yang dianggap cukup terdepan dan kritis dalam memberitakan kasus-kasus yang terjadi di Abdya. Pemberitaan Waspada dinilai menjadi barometer terhadap gambaran hukum di daerah dan kinerja aparatur negara termasuk para penegak hukum. “Di usia yang ke-65 tahun Kajari Blangpidie berharap Harian Waspada tetap konsisten dengan sikap kritis serta terus menyuarakan aspirasi rakyat.

Kantor Bupati Aceh Barat Terbakar, Dokumen Penting Ludes MEULABOH(Waspada):Sejumlah dokumen penting yang tersimpan ruang bagian keuangan dan pemegang kas kantor Bupati Aceh Barat, Rabu (4/1) sekira pukul 20:30 hangus terbakar. Tak ada korban jiwa dalam musibah itu, kerugian ditaksir ratusan juta. Bismi, petugas yang sedang piket pada saat insiden itu mengatakan, api mulai terlihat diruang keuangan dan merembet ke ruang pemegang kas. Disebutkan, saat itu empat petugas jaga sedang berada didepan teras kantor. “Saya dilantai dua. Karena kepulan asap mulai banyak saya turun memastikan, saat itu api sudah membesar,”kata Bismi kepada Waspada, Rabu (4/1) malam. Menurut Bismi, saat mengetahui api mulai menjilat seisi ruangan para petugas sempat berusaha memadamkan api dengan peralatan seadannya, namun api terlanjur membesar. “Saya naik turun juga dari lantai satu ke dua mencari timba. Sempat nyiram enam kali mobil pemadam tiba. Kami ada empat orang yang tugas piket,”katannya.

Empat unit mobil pemadam kebakaran dikerahkan kelokasi memadamkan api. Api berhasil dipadamkan sekitar satu jam kemudian. “Lantai dua termasuk atap kantor tidak sampai hangus, karena pembatas kedua tingkat itukan tembok,”katannya. Kapolres Aceh Barat AKBP Artanto, SIk mengatakan belum dapat memastikan sebabsebab terjadinya kebakaran. Hingga kini polisi masih melakukan penyelidikan. “Masih kita selidiki, ada unsur kesengajaan atau memang ada penyebab lain. Kita akan berkordinasi dengan labfor di Medan. Sejumlah BB masih di lokasi,”kata Artanto. Meski tak ada korban jiwa, namun kerugian ditaksir mencapai ratusan juta. Selain membakar dokumen dan arsip yang tersimpan dalam ruangan, seluruh mobiler ikut hangus. Kebakaran juga membuat Jalan Gajah Mada di depan kantor bupati ikut macet beberapa saat. Ramainya warga yang menyaksikan dari dekat kebakaran membuat petugas ekstra keras mengatur lalu lintas di jalan itu. (cb06)

Dewan Kecam Bupati Aceh Barat

Isu Penembakan Ketua KIP Aceh Tengah Meresahkan TAKENGEN (Waspada) : Isu penembakan Hamidah, Ketua Komisi Independen Pemilihan (KIP) Aceh Tengah membuat masyarakat resah. Waspada yang mendapat pertanyaan dari berbagai pihak tentang isu penembakan ini, menjelaskan duduk persoalan yang sebenarnya. Ketua KIP Aceh Tengah, Rabu (4/1) terlihat masih aktif melaksanakan tugas di kantornya. Sebelum Hamidah masuk kantor, kebetulan Waspada sudah berada di sana. Hampir seluruh personil KIP dan staf membicarakan isu penembakan Ketua KIP ini. “Sumber-

lembu untuk menggarap sawah karena pertimbangan ekonomi, menggunakan tenaga mesin (traktor) harus mengeluarkan biaya besar mencapai Rp800.000 per hektare,” ungkap Tgk Usman, 46, warga Gampong Pawod Laweueng, Kecamatan Muara Tiga, Kabupaten Pidie. Membajak sawah dengan menggunakan tenaga hewan memang punya daya tarik tersendiri bagi petani. “Meski diakui jika membajak sawah dengan tenaga sapi tidak efektif karena memakan waktu lama dan menguras tenaga, namun keistimewaannya semua tanah terbajak,” katanya. Selain itu, hal yang paling mendasar, kata Usman adalah karena pertimbangan keuangan untuk membayar ongkos menggarap sawah dengan traktor Rp800.000 per hektare. “Uang tersebut sangat tinggi baginya, saya tetap memilih membajak dengan sapi meski sedikit lamban dan capek,” jelasnya. Menurut beberapa petani tradisional itu, menggunakan traktor untuk membajak sawah tanahnya tidak seberapa bagus. Sebagian warga memang tidak memiliki sapi, sehingga memilih traktor untuk membajak sawah mereka. (b09)

MEULABOH (Waspada): Sejumlah Anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Barat, yang tergabung dalam fraksi bersama mengecam sikap bupati Aceh Barat Ramli MS yang tidak menghadiri rapat sidang paripurna pembahasan RAPBK tahun 2012 kabupaten itu. Kecaman disampaikan sejumlah anggota dewan yang tergabung dalam fraksi bersama yang diketuai Ramli, SE. Selain Ramli, SE hal yang sama juga disampaikan anggota dewan lain yakni Drs Meurah Ali Ketua Komisi B, Rizwan MA ketua komisi A, Drs Nasri Ketua Baleg dan Sekretaris Fraksi Abdul Kadir. Ramli, Ketua Fraksi Bersama mengatakan, pembahasan dan penepatan Kebijakan Umum Anggaran (KUA) dan prioritas Plafond Anggaran Sementara (PPAS) 2012, dilaksanakan berdasarkan rapat badan musyawarah yang diadakan 2 Januari lalu. Dikatakan, penetapan juga telah dikonsultasikan bersama Biro Hukum Pemprov Aceh dan DPRA, sehingga ketua DPRK Aceh Barat mengundang bupati untuk hadir. “Dalam konsultasi , kami diminta menetapkan jadwal pembahasan RAPBK tahun 2012 tapi bupati tidak hadir, padahal ini masalah rakyat, makannya meski tidak hadir rapat langsung ditetapkan ketua DPRK,”kata Ramli kepada wartawan, Kamis (5/12).

Menurut Ramli, kisruh internal di kalangan DPRK yang dijadikan alasan untuk tidak menghadiri sidang adalah alasan yang dibuatbuat. Sesuai ketentuan dan konsultasi dengan Kabid Evaluasi Anggaran Dinas Pengelolaan Keuangan Aceh tidak ada alasan bagi bupati tak menghadiri pembahasan RAPBK. “Kami sangat kecewa dengan sikap bupati. Tidak ada kisruh antara kami tapi hanya persoalan penyesuaian alat kelengkapan dewan sesuai PP tahun 2010. APBK inikan milik rakyat yang harus dibahas eksekutif dan legelatif,”kata Ramli. Ramli menuding ketidak hadiran Bupati Aceh Barat Ramli MS dilakukan dengan tujuan agar dapat mengeluarkan Peraturan Bupati (Perbub) tentang APBK tahun 2012. Ramli juga menyayangkan sikap anggota Tim Anggaran Eksekutif yang dinilai sengaja tidak memberikan pemahaman kepada bupati. “Ini sikap yang salah kaprah dan melanggar perundang-undangan yang dan akan merugikan rakyat Aceh Barat,”ujarnya. Pantauan Waspada, meski sempat tertunda beberapa kali karena ketidakhadiran eksekutif rapat badan musyawarah menetapkan jadwal KUA dan PPAS tahun 2012 Aceh Barat Kamis kemarin. Namun rapat tersebut hanya dihadiri 21 orang dari unsur muspida sementara Bupati Aceh Barat tidak tampak. (cb06)

Selama 2011, Kasus Kebakaran Tinggi Di Pidie SIGLI (Waspada) : Selama tahun 2011 kasus kebakaran menduduki angka tertinggi di Kabupaten Pidie dibanding tahun-tahun sebelumnya, yakni mencapai 53 kasus kebakaran. Keterangan yang diperoleh, Kamis (5/1) di Kantor Badan Penanggulangan Bencana Daerah (BPBD) Kabupaten Pidie menyebutkan, sejak Januari hingga Desember 2011 Kabupaten Pidie mengalami 53 kasus kebakaran yang disebabkan beberapa faktor. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Pidie Apriadi mengatakan, dari 53 kasus tersebut, penyebab terbanyak disebabkan arus pendek (korsleting) listrik mencapai 15 kasus, disusul akibat kompor, lilin dan mercon. Ditanya tentang kerugian yang diderita korban baik masyarakat maupun pihak lainnya, Apriadi tidak bisa menyebutkan kerugian yang

diderita itu juga cukup besar mencapai miliaran rupiah. Ia menyebutkan, kasus kebakaran terbesar sepanjang 2011 itu seperti yang terjadi di Gampong Puuek Aree, Kecamatan Delima. “Kasus kebakaran Puuek adalah kasus terbesar sepanjang puluhan tahun lalu di Pidie,” katanya. Kecuali itu, Apriadi menjelaskan, dari sejumlah kasus kebakaran yang terjadi di Pidie, kebakaran rumah penduduk merupakan kerugian terbanyak yang disebabkan arus pendek listrik, yakni mencapai 15 kasus. Menjawab tentang upaya apa yang bisa dilakukan untuk memperkecil kasus kebakaran di masa akan datang, Apriadi menyebutkan, ke depan pihaknya akan melakukan sosialisasi dan mewajibkan pihak swasta dan masyarakat untuk menempatkan racun api di setiap rumah dan tempat usaha. (b09)

Kades Mutiara Baru Agara Keberatan Dicopot


Kajari Blangpidie Umar Z terlihat serius membaca HarianWaspada di ruang kerjanya, Kamis (5/1). HarianWaspada yang telah berusia 65 tahun menurut Kajari dinilai menjadi barometer kinerja aparatur negara dan penegakan hukum karena berani memberitakan setiap kebijakan dan kritis terhadap persoalan yang terjadi di daerah. “Jangan pernah takut memberitakan kebenaran, saya sendiri mengagumi Waspada karena memang kritis dan berani

serta aspiratif,” tutur Kajari yang memiliki motto ‘Bersih dan tidak boleh ada yang tersisa dalam setiap pekerjaan’.(cb05)

KUTACANE (Waspada) : Kepala Desa hingga saya diberhentikan, tetapi tidak pernah Mutiara Baru, Kecamatan Babul Rahmah, Aceh diberi tahu apa kesalahan saya, baik secara lisan Tenggara Surdin Sordat Sinaga mengaku kebe- mau-pun tertulis. Saya merasa pemecatan ini ratan dan kecewa dengan sikap pemerintah didasari sikap arogansi kekuasaan, pasalnya, daerah, yang bertindak sewenang-wenang saya bersi-kap tidak mendukung rencana bupati mencopot jabatannya. saat ini maju calon kembali pada pilkada 2012 Zenal Abidin, Camat Babul Rahmah, Kamis ini,” kata Sodat. (5/1) membenarkan, soal pencopotan jabatan Wakil Bupati Agara H Samsul Bahri mengaKades Mutiara Baru yang dijabat Sodat. Dikata- ku belum tahu pasti soal kasus pencopotan kan, pencopotan jabatan kepala desa ini karena Kepala Desa Mutiara Baru ini, namun diakui yang bersangkutan terlibat kesalahan sejak 2010, wabup dia telah mendengar sekilas. (b25) walau telah berjanji berubah, namun Sodat diberhentikan dari jabatan pada Kamis (28/ 12). “Masyarakat bersama bersama PPK yang meminta diberhentikannya Sodat dari DIBUTUHKAN SEGERA jabatan di desa setelah dila� APOTEKER/PHARMACIST kukan dua kali pemanggilan SYARAT-SYARATNYA: 1. PENDIDIKAN LULUSAN APOTEKER diperiksa di kecamatan,” 2. PEREMPUAN/LAKI2 3. UMUR MAX 28 TAHUN kata Zenal Abidin. 4. BELUM MENIKAH 5. MENGUASAI MICROSOFT OFFICE & EXCEL Sodat membantah per6. SUDAH MEMILIKI SURAT PENUGASAN (SP) 7. MAMPU BEKERJA DIBAWAH TEKANAN DAN TEAM nyataan Camat Babul Rah8. PENGALAMAN KERJA LEBIH DIUTAMAKAN MINIMAL 1 THN Telp. 4528431 SURAT LAMARAN DILENGKAPI DENGAN : mah ini. Dikatakan, yang 1. FOTO COPY KTP 2. PAS PHOTO UKURAN 3X4 = 2 LEMBAR disampaikan itu merupakan HP. 3. FOTO COPY IJAZAH DAN DAFTAR NILAI 4. CV (CURRICULUM VITAE) kebohongan. Sodat mem5. SUDAH MEMILIKI SURAT PENUGASAN (SP) benarkan dirinya hadir me081370328259 LAMARAN DITUJUKAN / DIANTAR LANGSUNG KE ALAMAT PT. ENSEVAL PUTERA MEGATRADING, Tbk menuhi panggilan di kantor Email: JL. LAMPEUNEURUT PEUKAN BILUY GAMPONG camat. “Saya diterima oleh LAMPEUNEURUT UJONG BLANG KEC. DARUL IMARAH KABUPATEN ACEH BESAR Kasi Pemdes, disebutkan SELAMBAT-LAMBATNYA 1 MINGGU SETELAH TANGGAL IKLAN INI. UP. IBU EVA ada aduan masyarakat, se-

Pasang Iklan

Daftar Khatib Shalat Jumat

C4 MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl.Denai Gg. Pinang No. 12 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Rahmat Jl. Denai Gang I No. 2 Silaturrahim Jl. Emas No. 10 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati

Drs. Askolan Lubis, MA Drs. Ramli Nur, MA Kemal Fauzi Khoiruzzaman, S.HI, S.Pd.I Drs. M.Saleh Rambe Drs. H.M. Tambunan Drs. H. Abd. Sani Sinaga H. Ali Amran Zakaria, Lc H. Zulkifli Damanik Drs. H. Abd. Rahman Batubara Drs. H.M. Hafizd Ismail Ibrahim Yunan, S.Pd.I Drs. H. Ulumuddin Hamsyi H. Zulfiqar Hajar, Lc H. Jasmi Sayuti, Lc Drs. H. Efnedi Arief, MA Drs. Faisal Lubis Drs. H. Ridwan Hawari

MEDAN AMPLAS Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Shilaturrahim Jl. Garu III Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II

M. Yusuf Marpaung, S.HI Drs. H. Khairuman Arsyad,M.Hum H. Effendi Sadli, SE Drs. H. Syamsul Rijal Pulungan Drs. Abdul Azis Drs. Jamaluddin Rambe Drs. Ali Asri Drs. Sangkot Nasution Chairul Effendi Drs. H. Masran Drs. Sariman Alfaruq

MEDAN BARU Al-Amanah Jl. Diponegoro No.30-A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Iklab Jl. Letjend. Jamin Ginting Km. 1,27 MEDAN BARAT Asy-Syafiah Jl. Karya Dalam (Depan kantor Lurah) Al-Furqan Jl. Karya 2 Lingk. XI Kel. Berombak Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Muslimin Jl. Karya Lingk.XVII No.41 Karang Berombak Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan

Ahd. Faisal Nasution, MA Drs. H. Syamsuddin Hasan Alimin Lubis, S.Pd.I Zailani, S.Pd.I, MA Drs. Zakari Solemen Lubis, MA Rasoki Batubara Drs. H. Muchtar Baijuri Abdul Mutholib Daulay, MA DR. Zulheddi, MA Drs. Helmi Walid Hasan Nuddin H. Khaidir A.Wahab, Lc, MA

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan

H. Adnan Amars

MEDAN DELI Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Iklas Jl. Alumunium II Lingk. XII Tg. Mulia Al-Munawwarah Jl. Pulau Batam No. 1 Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia

Ibnu Sa’ud Drs. H. Juliardi Drs. Syahrin A.W. H. Syamsul Basri Bahadur Sinaga

MEDAN DENAI Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Al-Ansor Jl. Raya Medan Tenggara Gg. Anshor No. 11 Al-Ridha Jl. Jermal VII Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Mukhlishin Bromo Ujung Jl. Selamat Kel. Binjai Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Quba Jl. Rawa Kel. Tegalsari Mandala II Baiturrahman Jl. Medan Tenggara VII No. 42 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Raya Miftahul Iman Jl. Panglima Denai Jermal 7 Taqwa Jl. Jermal III No. 10 Taqwa Jl. Mandala By Pass No. 140

Drs. H. Fauzi Usman Drs. Nazamuddin Hutapea Drs. H. Zuhri Pulungan Drs. Ade Mustahdi Ali Nailus Said Nst., S.Ag, S.Pd.I Drs. Hasbullah Jakfar, MA M. Nuh, Lc Drs. H. Syahlan Harun Drs. H. Pandi Pilham Lubis Drs. M. Idris Ritonga, M.Pd Drs. Juntar Dongoran Burhanuddin Siagian, MA Dakka Juho S,. S.Pd

MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia An-Nur Jl. Budi Luhur No. 75-A As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Hasanah Jl. Setia No. 41 Tg. Gusta Al-Ikhlas Jl. Bakti Utara No. 21 Lingk. VI Kel. Tg. Gusta Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Al-Ikhas Jl. Teratai II Blok 18 Perumnas Helvetia Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah

Drs. A. Hafis Hasibuan Drs. H. Tamhid Harahap Drs. Zulkifli Fuji Rahmadi, S.Hi, M.Ag Drs. H. Ali Amnar, T. Chalid Chair Harahap, S.Ag Drs. M. Yamin DR. H. Zainal Arifin, Lc, MA Drs. H. Azhar Drs. Faisal Lubis, M.Ag

MEDAN JOHOR Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Al-Badaar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Al-Ikhlas Jl. Karya Kasih Baru Lingk. X Kel. P. Masyhur Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlisin Jl. Karya Sehati No. 14 Kel. P. Masyhur Al-Muhajirin Komp. Medan Permai Baiturrahmah Jl. Karya Jaya No. 101 Pangk. Masyhur

M. Nurdin Nasution, S.Pd.I Azman, S.HI Bukhori Muslim Lubis, S.Ag Drs. Zarlan Lubis Drs. H. Legimin Sukri Drs. H. Hamdan Yazid H. Arif Mhd. Erde, S.Pd.I M. Yusuf Siregar, SPiL Ismail Nasution Ahmad Syafii Harahap, S.Ag H. Ali Murthado, M.Hum H.M. Taufik H. Muhammad Syafriar, MA

Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Sholihin Jl. Karya Jaya No. 160-G Gedung Johor MEDAN KOTA Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Huda Jl. Kemiri III No. 28 Simpang Limun Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Al-Mutttaqin Jl. Amaliun/Panduan Tenaga Gg. Tengah Hikmah Hongkong Plaza Jl. Cerebon Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Ridho Bakti Jl. Air Bersih Lingk. IX, Kel. Sudirejo-I Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7 MEDAN LABUHAN Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Al-Muhajirin PTPN-IV Jl. Letjend. Suprapto No. 2 Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Nurul Muslimin Jl. Juanda (bundaran) Kel. Jati Thoyyibah Jl. Multatuli Lingk. V No. 64 MEDAN MARELAN Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Rahim Jl. Prof. H.M. Yamin SH No. 363 Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Ar-Ramlah Jl. Sejati No. 16 Al-Amin Jl. Prof. H.M. Yamin SH, 482 Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Al-Hurriyah Jl. M. Yakub No. 17 Al-Huda Jl. Malaka No. 117 Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Ikhwaniyah Jl. M. Yacub No. 3 Al-Muslimin Jl. Gerilya No. 1 Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Amana No. 5 Istiqomah Jl. Bambu Runcing/Pahlawan Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Ar-Ridhwan Jl. Abd. Hamid No. 28 Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Istiqamah Pasar Petisah Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Setia Al-Mukarram Jl. Sikambin Gg. Patimura No. 9 MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Assakinah Jl. Polonia (Starban) Komp. Perum TNI-AU Al-Hidayah Jl. Starban Kel. Sari Rejo Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 Dirgantara Lanud Jl. Imam Bonjol No. 52 Hanudnas III Polonia Komp. Kantor Hanudnas TNI-AU Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Al-Amri Jl. Nusa Indah Asam Kumbang Al-Furqon Jl. Setiabudi Pasar I Tg. Sari Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Al-Ikhlas Pasar 7, Padang Bulan Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Al-Muhtadun Jl. Karya Sembada No.179 Kom.Koserna Al-Munawwarah Jl. L.Putra No. 19-A Komp. Kejaksaan Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Jami’ Jl. Pasar I Lingk. VIII Kel. Tg. Sari Muslimin Jl. Setia Budi Kel. Tg. Sari Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan

Sofwan Harahap, S.Ag Devrival Lubis, S.Pd.I Riskil Asri, S.Pd.I Ahmad Syafi’i Harahap, S.Ag Ismail Hasyim, MA Nazri Nasution, S.Ag Drs. Ramli, AT Indra Budiman Drs. H. Sarikun Manurung Drs. Sofyan Daulay Ir. Abu Ismail Drs. Sunaryo H.M. Nurdin Amin, Lc, MA Drs. Bekhta Asky, MA Drs. H. Zainal Abidin Zen Drs. Zulkifli DR. H. Azhar Sitompul, MA H. Amrin Siregar Prof. DR. H. Hasyimsyah Nst. MA Drs. H. Sarakal Ahmadi Siregar Nazaruddin Rafdinal, S.Sos, M.AP Drs. Fahruddin, MA Mukhlis Muas, S.HI, S.Pd.I Drs. Abdi, HK Drs. Aidil Mawar Nasution H. Marajaksa Harahap, S.Ag Kusnadi, S.Pd.I H. Fajar Hasan, MA H. Sudirman Lubis, Lc Drs. Abd. Razak Abd. Kadir Zailani, BA H. Ali Imton Hasibuan Drs. H.T. Baharuddin Siregar Drs. H. Ramli Mansyur DR. Ir. H. Rafiqi Tantawi, MS Drs. H.M. Effendi Batubara Drs. H. Muhiddin Gurning Kondi Yasin Imamul Muttaqin, SH Drs. Jamaluddin Pohan, MA Drs. H. Ali Azmi Nasution, MA Syarwan Nasution, S.Ag Ma’sum Harahap, S.Sos.I Drs. M. Khayat Drs. Syahlul Amin DR. Sulidar, MA H.M. Nurdin Rustam, Lc Khalifah H. Nazaruddin Lubis Al Zuheri Lubis, S.Ag Drs. H. Rikhsan Hasan Maksum, M.Ag H. Marajaksa Harahap, MA Drs. Abdul Majid Syam Hendri Purnama, S.Sos H. Surianda Lubis, S.Ag Drs. Pangiutan Siregar Mawardi Drs. Zulkifli Drs. H. Adhlan Sirait Drs. H.A. Bangun Nasution, MA Syarwadi, S.Pd.I Prof. Dr. H. Nawir Yuslem, MA Khairun Nazri, S.Pd.I H. Abdul Rahim,S.Ag, S.Pd.I, L H. Ahyu, MA Drs. H. Nazaruddin Hasibuan Drs. M. Yusuf As’adi DR. K.H. Amiruddin MS, MBA, Phd Drs. Alamsyah Ahmad M. Lukman Hakim Hsb., S.Ag, MA M. Syukur Dalimuntthe Drs. H. Komaruddin, S.Ag H. Torang Rambe, S.Ag, M.Ag Drs. H. Muniruddin, M.Ag S. Muliono, S.Ag, M.Pd Drs. H.M. Nasib Selmi Abd. Hamid Harahap,S.Pd.I H. Syamsuddin, S.Ag H. Zahri Ichsan drg. H. Mhd. Iqbal Drs. A. Ghozali Rangkuti Drs. Arfinsyah Ahmad Ismail Manurung Drs. Lukman Hakim H. Jamaluddin, Lc H. Abdul Jamil M. Tintin Lingga

WASPADA Jumat 6 Januari 2012

Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 Taqwa Kampus II UMA Jl. Setia Budi No. 79-B

Drs. Hasunuddin Malik, S.Pd.I Drs. H. Zakaria Anshari Drs. Nazaruddin Ar. Lubis Prof. Dr. Lahmuddin Lubis, M.Ed

MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Jl. Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei.S. Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Badar Jl. Binjai Km. 6,8 Medan Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Raudotussuffah Jl. Pinang Baris Kel. Lalang Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Taqwa Sugeng Rejo

Irwansyah Daulay, S.Pd.I May Inf. Drs. Jalaluddin Dalimunthe Drs. Lili Suheri Drs. H.M. Syafruddin Bani Amin Pohan, S.Ag Jauhari Marpaung, S.HI Drs. Harmain Drs. Abdullah Drs. H. Irham Hasibuan H. Hamzah Fansyuri Drs. Muhidin Gurning Drs. Mahyuddin Daulay Drs. Sahroni M. Nasir, S.Ag Drs. H. Sudarno Drs. Zainal Abidin Drs. Kasmuda Siregar Drs. H. Asnan Ritonga Drs. H. Usman Matondang Bustami, HS Hasanul Arifin Drs. H.M. Arifin Umar, AR Dr. H.M. Yakub Amin, MA K.H. Munawar Khalil Drs. Bahrein Manik

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Kel. Gaharu Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa TNI-AD Glugur Hong Jl. Karantina Ujung Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Ubudiyah Jl. Bambu III Kel. Durian Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap MEDAN TEMBUNG Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hilal Jl. Belat No. 76-B Al-Ikhlas Lingk. II Kel. Bandar Selamat Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Al-Ishlah Jl. Pukat V Kel. Bantan Timur Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Jihad Jl. Besar Tembung Desa Tembung Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Kampus I UMA Jl. Kolam No. 1 Medan Estate Taqwa Jl. Letda Sudjono No. 15

Syah Kholid Nasution, MA H. Abdu Aziz, BA K.H. Moh. Abd. Syukur Drs. Abdul Roni Drs. H. Dasuki Simangunsong Ganda Maulana, S.Ag Drs. Sahnim Siregar Drs. Juanda Sirait M. Misranik, S.Pd.I DR. H. Ardiansyah, Lc, MA Drs. Parlaungan Hasibuan Drs. H. Hadi Syamharis, MA Drs. Abd. Rahim Harahap Drs. H. As’ad Marlan, M.Ag Drs. Bahari Ahmad Drs. Darwan Saudi H. Mhd. Tohir Ritonga, Lc Drs. H. Aspan Sianipar Drs. H. Ramli Asmuni Saiful Bahri, S.Ag Drs. Tanwir Siagian Drs. H. Nizar Idris Drs. Sarwo Edi Drs. H. Amhar Nasution, MA Marwan Nasution DR. H. Maratua Simanjuntak Drs. Satiman Awaluddin Pulungan, S.Ag Drs. Syarif Dongoran Drs. H. Bustami, HA Drs. H.M. Sinambela Drs. Ngadimin, K.R. Irwansyah, M.Ag Drs. H. Amir Saleh Nasution M. Abidin, S.Pd. Alwin Ramli Lubis Mahyuddin Lubis, SE Drs. H. Abu Saman Pulungan Robbie Fanreza, S.Pd.I Prof.Dr.H.A.Ya’kub Matondang, MA Samidi, S.Ag, M.Pd.

MEDAN TUNTUNGAN Ar-Rahman Griya Nusa 3 Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hikmah Kompleks R.S. Jiwa Propsu Jl. Tali Air Lk. IV Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Silaturrahim Jl. Kapas 13 No. 49 P. Simalingkar Taqwa Jl. Sawit Raya Perumnas Simalingkar DELI SERDANG Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC Al-Hafiz Hamparan Perak Kec. Hamparan Perak Al-Issyah Hakim Jl. Karya Jaya Kel. Deli Tua Al-Jihad Jl. Pembangunan No. 26 Al-Muhajir Jl. Rel Pasar X No. 06 Bandar Khalifah Al-Salam Jl. Raya Medan-Namorambe Kel. Deli Tua Jami’ Asysyakirin Jl. Besar Km. 11,5 Eli Tua Khairul Fatihin Dusun II Tj. Morawa-A Kec. Tj. Morawa Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Syuhada Kec. Galang Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

Drs. H. Zulkarnain Drs. Amrin Yunus Haidir Lubis, S.Pd.I Mar’an Sabukti Siregar Drs. M. Yusup Arhad Jaini, S.Ag Abdul Roni, S.Ag Drs. H. Hasbi Yunus Drs. H. Rajuddin Harahap H. Sudirman Lubis, Lc Drs. M. Rum Lubis Mhd. Sopian Pulungan, S.Pd.I Zulkarnaen, S.HI H. Zainal Yusuf Drs. Syaukani Drs. H. Syamsuddin Hasan M. Yunus, S.Ag Ali Nur, Lc Drs. H. Mukhtar Effendi Barus Bustian Zulfikar Husni, S.Pd.I Drs. H.M. Sakti Rangkuti, MA H. Surya Putra

Reaktualisasi Peran Jejak Ulama Dari Lorong Pinggiran (Refleksi HUL Ke - 2 Tuan Guru Syekh Abdurrahman Rajagukguk)

Oleh H Ahmad Sabban Rajagukguk MA Tuan Guru Persulukan Babut Taubah Silsilah Thariqat Naqsyabandiyah Simalungun


alam Islam, posisi strategis Ulama tidak diragukan lagi, bahkan Ulama berdasarkan pernyataan Rasul SAW merupakan hamba Allah yang dipilih menjadi pewarisnya ( al ‘ulama waratsatul anbiya’). Dengan kata lain, kehadiranUlama menjadi penyambung lidah para Nabi dan Rasul. Pesan penting dari makna ungkapan Rasul SAW ini adalah bahwa visikenabiaan(visiprophetic)tidakboleh berhenti dan ulamalah sebagai pewarisnya yang secara konsisten tetap memberikan pesan-pesan kebenaran keseluruh ummat. Ulama ibarat pelita ummat, benteng moral, penegak amar ma’ruf nahi munkar yang hanya takut kepada Allah SWT. Salah seorang sosok Ulama Batak yang bernama Tuan Guru Syekh Abdurrahman Rajagukguk (w) 12 Shafar 1431 H atau 28/01/2010. Beliau adalah seorang Ulama kharismatik yang berusaha meneladani perilaku Rasulullah SAW semampunya dan mendakwahkannnya kemudian dalam lingkungan masyarakat dan pergaulannya. Selain menjadi Ulama, tokoh agama pimpinan dan pengasuh Pondok Persulukan Babut Taubah Thariqat Naqsyabandiyah Serambi BabussalamHatonduhanSimalungun. Beliau juga dikenal sebagai orang tua banyak orang dan tokoh adat yang disegani dan dikagumi. Meminjam istilah Prof Dr Syahrin Harahap, bahwa sangat banyak ulama sumatera utara yang berjuang dan telah berhasil memainkan peran keulamaanya.Olehkarenanyasangatpenting agar potret wajah keulamaan dengan

berbagai kekayaan khazanahnya dapat kembali dicatat dalam dokumentasi sejarah untuk dijadikan teladan. Setiap ulama sekecil apapun perannya akan memberikan ibrah penting untuk pengembangan dakwah ke masa mendatang. Itulah yang menjadi signifikansi penulisan sosok Ulama sederhana ini sembari penulis dan tentunya kita ummat muslim sangat berterima kasih kepada media harian waspada, yang tetap konsern untuk memainkan peran dakwahnya, khususnya mengangkat bibliografi para Ulama dan tokoh Islam. MengenalSosokTuanGuruSyekh Abdurrahman Rajagukguk Syekh Abdurrahman Rajagukguk, Tuan Guru Persulukan Thariqat Naqsyabandiyah Tanah Jawa (sekarang menjadi kec Hatonduhan) Simalungun adalah Ulama Batak yang sangat bersahaja, wara’, zuhud dan dermawan. Beliau dilahirkan di Desa Jawa Tongah merupakan desa pinggiran yang berbatasan dengan kabupaten Asahan pada tanggal 17 Agustus tahun 1937. Di masa kecilnya sudah menjadi yatim, dengan memiliki sifat, karakter dan prilakujujur,sopansantun,penyanyang dan sangat suka menuntut ilmu-ilmu agama. Pendidikan umumnya hanya sebatas SR (sekolah rakyat pada zaman belanda), begitu juga pendidikan formal keagamaan hanya sebatas Sekolah Arab setingkat madrasah tsanawiyah. Namun pendidikan agama secara non formal digelutinya secara sungguhsungguh dengan mengunjungi para Guru-guru agama, Ulama-ulama, khususnya kepada guru-guru Mursyid

(masyhur) di masanya. Beliau sengaja menjual harta warisan yang tinggalkan orang tuanya untuk biaya belanja bermukim di beberapa daerah untuk menuntut ilmu-ilmu agama pada Ulama-ulama setempat. Beberapa daerah yang dikunjunginya dan bermukim yakni di Padang Sidempuan dengan Tuan Guru Syekh Abdul Manan Siregar, Tanjung Medan dengan Tuan Guru ZakariaMusa,MedandenganTuanGuru MadjidNasutiondanterakhirdiBasilam Langkat denganTuan GuruSyekh Fakih Tambah dan Syekh Abdul Mu’im Al Wahab sekitar tahun 1968. Konsistensi keulamaannya yang dikenal dengan kezuhudan, kewarokannyadankeistiqomahannyadalam menjalankan ajaran agama begitu kentara. Beliau berhasil mendirikan madrasahpengajiannonformaldanpondok persulukan dikawasan periperi ‘dar ‘al –amansebuahkawasanminoritasIslam dan melakukan relasi sosial yang rukun ditengah majority ummat lain. Keulamaannya menjadi perekat ummat dan simbol pluralisme dengan prinsip yang tegas dan jelas. Kepribadiannya yang bersahaja dan penuh zuhud menjadi cirikeulamaannyayangmenonjol. Bukti kezuhudannya terbukti ketika ada salah seorangPejabatyanginginmemberikan hadiah mobil baru sebagai wujud terimakasihatasdoanyayangmustajab. Namun, Tuan Guru Syekh Abdurrahman Rajagukguk dengan hati yang tulus menolaknya. Semasa hidupnya beliau sering mendapat kunjungan silaturrahmi dari berbagai kalangan, Pejabat, Gubernur, Bupati/Walikota, DPR, Pengusaha dan

Setiap ulama sekecil apapun perannya akan memberikan ibrah penting untuk pengembangan dakwah ke masa mendatang. berbagai lapisan masyarakat lainnya. Darisekianbanyakdaftarcatatanpejabat yang berkunjung kebeliau namun tidak satu pun diantara yang dimanfaatkan untuk kepribadi bahkan untuk pondok persulukannya.Halinidikarenakanlebih menjaga adab keulamaannya terlebih lagisebagaiUlamasufidanthariqatyang mengutamakan nilai-nilai eskatologis, kezuhadan dan kesucian jiwa. Sisi lain yang menarik dari keulamaan beliau kemampuan dan kegigihannya dalam memainkan peran jejak ulama dari kawasan pinggiran yang pengaruhnya menyebar kekawasan perkotaan. Hal ini dapat dilihat dari berbagai bentuk halqah majelis zikir pembinaan kerohanianyangtersebardiberbagaidaearah Sumatera Utara. Beberapa akademisi juga ada yang telah meniliti sosok keulamaan dan kepribadiannya. Prof Dr Syahrin Harahap MA, salah satu Ulama yang beberapa kali bertemu akrab denganTuanGuruSyekhAbdurrahman Rajagukgukdanmenuliskannyasebagai Ulama sufi, Mujahid Dakwah dan Tuan Guru Batak yang dekat dengan Allah. (Dikutip dari Pengantar Buku, Berdialog Dengan Tuhan, Ahmad Sabban rajagukguk, 2009: hal xvii) Refleksi HUL dan Reaktualisasi Peran Ulama HULke-2TuanGuruSyekhAbdurrahmanRajagukgukakandilaksanakan pada hari Sabtu, 7 Januari 2012 atau

bertepatan13Shafar1433H.TradisiHUL dalamkhazanahkesufiaanIsam,adalah sebuah tradisi mulia untuk mengenang kebaikan, perjuangan dan kegigihan para Ulama yang dicintai pengikutnya. Tradisiinisekaligusmembangunjalinan silaturrahmi jemaah dan melakukan mudzakaroh memperbincangkan halhal penting yang berkenaan dengan pembinaan keislaman. Pesan penting lainnyaadalahmerekatuliasasikanperan Ulama yang dicintainya itu dalam bingkaikekiniankehidupanparamurid. Pada sisi lain, tradisi HUL ini merefleksikanbahwagerakanaktualisasi peranUlama,sesungguhnyatidakharus berada disumbu kota sebagai kawasan majority ummat, tetapi juga tidak kalah pentingnya pada kawasan demarkasi minoritas. Peran Ulama pada kawasan marginal, lorong desa dan pinggiran sangat crusial mengingat biasa globalisasi perkotaan yang mewabah di desa tidak sebanding dengan tingkat daya tahan ummat dari segi immuniasasi iman dan intelaktual. Bahkan Ulama yang memulai basis keummatanyadarikawasanpinggiranadalah Ulama yang memiliki tingkat kepribadian yang tangguh. Artinya pesan moraldariketeladansetiapUlamadapat kembalikan direaktualisasikan dalam dimensi kehidupan kita. Pesan inilah yang selama ini terkesan hilang dalam kehidupan masyarakat kita.

Rasulullah Saw bersabda, “Ulama itu adalah orang-orang yang dipercaya oleh para Rasul, selama tidak mukhallathah(dikendalikan)olehpenguasa yangzalim,danselamatidakmenjadikan dunia sebagai tumpuan hidupnya. Apabila mereka dikendalikan para penguasa yang dzalim, maka sesungguhnya mereka telah berkhianat terhadap Rasul. Karena itu, jauhilah mereka itu,” (HR. Aqbali dari Anas). Pernyataan Rasul SAW ini menegaskan sesuatu yang paling prinsip pada pribadi seorang Ulama. Prinsip yang menjadi sikap fundamental dan esensialituadalahtingkatketakwaannya kepada Allah Swt dan tidak menjadikannya sebagai inferiority dalam spektrum kepentingan duniawi. Karena itu, Rasulullah Saw menganalogikan peran dan fungsi ulama seperti bintang yangmenjadipetunjukdalamkegelapan. Tamsilan yang mengagumkan itu dilukiskan indah dalam Sabdanya, “Gambaran ulama di muka bumi adalahsepertibintang-bintangdilangityang memberi petunjuk dalam kegelapan di darat dan di laut. Apabila bintangbintang itu terbenam, maka dikhawatirkan orang-orang akan tersesat jalannya,” (HR. Imam Ahmad). Secara umum, peran dan fungsi ulama biasa disebut dengan amar ma’ruf nahi munkar. Sedang rincian tugas ulama adalah: pertama, mendidik umat di bidang agamadanlainnya.Kedua,melakukankontrolterhadapmasyarakat.Ketiga,memecahkan problem yang terjadi di masyarakat. Keempat, menjadi agen perubahan sosial. Semua tugas ini melekat pada diri tiap ulama dan dijalankan sepan-

jang hidupnya, meski jalur yang ditempuhberbeda(MasykuriAbdillah,1999). Penulis melihat lebih jauh, bahwa reaktualisasi peran ulama pada masa era globalisasi ini, ketika dunia saat ini dilanda berbagai krisis menjadi lebih luasdankompleks.Perananulama,kiyai, maupun tokoh-tokoh dengan pemahaman keagamaan yang luas memiliki tantangan sekaligus tanggungjawab besar tidak hanya dalam lingkup kepentingankeagamaanyangbersifatlokal namun juga menyangkut kepentingan global, seperti: persoalan pemanasan global (global warming), terorisme dengan sentimen keagamaan, hingga isu krisis keuangan yang mengancam keberlangsungan hidup manusia secara keseluruhan sebagai satu komunitas penduduk bumi. Semua itu berpijak kepada satu tujuan yakni untuk kepentingan ummat. Inilah harapan ummat terhadap Ulama sebagai pewaris Nabi. Penutup HUL ke 2 Tuan Guru Syekh Abdurrahman Rajagukguk, kiranya reaktualisasi peranUlama dalam kehidupan kita semakin membumi. Ulama sebagai pewaris Nabi merupakan mata rantai penyambung lidah kebenaran, amar ma’ruf dan nahi munkar. Ulama di manapun berada dan sekecil apapun perannya adalah hamba Allah pilihan. Mereka hadir laksana pelita ummat, figur moral, perekat dan panutan publik,berwataksosialdandermawan,cinta kebijaksanaan, tidak duniawi serta menjadi suri teladan dalam kehidupan sehari-hari. Semoga para Ulama senantiasadilindungiAllahSWT. Wallahu a’lamu bis shawab.

Mimbar Jumat

WASPADA Jumat 6 Januari 2012

Ketika Ulama, Umaro, Qari, Dan Hafiz Berkumpul Ada yang tidak biasa di kediaman dinas Plt.Gubernur Sumatera Utara H Gatot Pujo Nugroho Minggu Malam silam. Mengawali tahun baru, puluhan orang yang berkumpul di sana terpekur mendengar lantunan merdu ayat suci Alqur’an dari para qari berprestasi. Hadirin pun

mendapat siraman rohani penyejuk jiwa dari Prof Dr Ahzami Samiun Jazuli, MA yang membawakan materi tentang Alquran dan perubahan menjadi yang lebih baik. Salah satu kebiasaan yang dilakukan dalam Haflah Alquran adalah Lailatul Mua’yadah

yang merupakan media “halal bi halal” para qurra dan huffaz dan seluruh kaum Muslimin dengan acara makan malam bersama dan selanjutnya diiisi dengan haflah Alquran baik dibacakan qari maupun hafizh Alquran. Lailatul Mua’yadah tersebut merupakan yang ke dua kalinya digelar setelah sebelumnya di

kediaman mantan Wali Kota Medan Abdillah. Plt.Gubsu berharap Haflah Alquran dapat dilaksanakan secara berkelanjutan, untuk menghidupkan kembali tradisi para orang tua sebagai media bertemunya para qari/qariah dan hafiz/hafizah. Hadir dalam kesempatan tersebut anggota DPD RI, DR Rahmadsyah, Ketua MUI Sumut Abdullah Syah, Kakanwil Kementerian Agama Sumut Abdul Rahim, SH,MHum, mantan Wali Kota Medan Abdillah Ak, MBA,

BERSAMA QARI : Plt Gubsu, H Gatot Pujo Nugroho ST menyalami Qari (pembaca Ayat Suci Alquran), dalam acara Haflah Alquran di kediaman Plt Gubsu akhir pekan lalu. Selain para qari, acara tersebut juga dihadiri sejumlah tokoh dan ulama Sumatera Utara, serta jajaran SKPD Pemprov Sumut.

Mantan Wali Kota Medan, Abdillah Ak, MBA menyalami Plt Gubsu, H.Gatot Pujo Nugroho STketika menghadiri acara Haflah Alquran di Kediaman Dinas Plt Gubsu Komp Tasbi, akhir pekan lalu.

SAMBUTAN : Plt Gubsu memberikan kata sambutan pada acara Haflah Alquran yang di laksanakan di Kediaman Dinas Plt Gubsu, Komplek Taman Setia Budi, pada Minggu (1/1) malam. Plt.Gubsu H Gatot Pujo Nugroho juga mengucapkan terimakasih kepada segenap warga Sumut yang telah bersama-sama menjaga situasi aman dan kondusif sepanjang tahun 2011.

Zikir Akbar di Masjid Agung Ketua Umum (Ketum) Majelis Zikir Tazkira Sumut Buya KH Amiruddin MS melakukan Safari Zikir dan Doa serta Tausiyah “Harus Berubah” di kawasan Jabodetabek dan Bandung sejak 25 Desember 2011 hingga 3 Januari 2012. Sedangkan tema yang diusung berupa “Harus Berubah” agar dalam pergantian tahun dari 2011 menjadi 2012 kehidupan umat Islam akan semakin baik, termasuk dalam kualitas beribadah kepada Allah SWT. Dalam Safari Zikir, Doa dan Tausiyah itu turut bersama rombongan Buya KH Amiruddin MS 8 orang. Di antaranya, Hj Siti Supiati, dr Yunita Wulandari,Denny Ardiansyah SH, dan Halimah. Buya KH Amiruddin MS dalam keterangannya kepada wartawan di Medan, kemarin, mengatakan, dalam tausiyahnya di beberapa tempat di kawasan Jabodetabek dan Bandung bertemakan “Harus Berubah” bermaksud, dalam memasuki Tahun Baru 2012, termasuk Tahun Baru Islam 1 Muharram 1433 H yang lalu, umat Islam harus melakukan “muhasabah” (introspeksi diri), apakah tahun ini lebih baik dari tahun yang lalu atau sama, bahkan lebih buruk. Karena, lanjutnya, dalam satu Hadis Rasulullah SAW menegaskan yang maknanya:”Jika seorang mukmin kehidupannya hari ini lebih baik dari hari kemarin, berarti dia beruntung. Apabila hari ini sama dengan

hari kemarin adalah merugi. Namun, jika hari ini lebih jelek dari hari kemarin, maka dia dilaknat Allah”. “Ini artinya, kehidupan umat Islam dari hari ke hari, bulan ke bulan dan tahun ke tahun harus semakin baik dan meningkat. Begitu juga kualitas amal dan ibadahnya harus juga semakin baik,” jelas Buya KH Amiruddin MS yang berdakwah sejak tahun 1976. Sementara itu, jamaah yang turut dalam rombongan Buya KH Amiruddin MS pada dasarnya melihat sosok Buya KH Amiruddin MS sebagai figur yang menasional. Apalagi, dalam kurun waktu dua bulan ini beliau dua kali Safari Zikir dan Tausiyah ke Jawa dan Sumatera. Seperti, dalam menyambut Tahun Baru Islam tahun 1433 H yang lalu juga ke Pulau Jawa dan Sumatera. Dalam Safari Zikir, Doa dan Tausiyah “Harus Berubah” dimulai dari Masjid Raya Teluk Jambi Perum Peruri Kerawang pada 25 Desember. Kemudian, Masjid Ulul Albab Hotel Bidakara Jakarta Selatan pada 30 Desember yang juga dihadiri mantan Kabareskrim Polri Komjen (Purn) Susno Duadji. Berikutnya Gedung Pasific Palace Jakarta pada 30 Desember usai Magrib, Kompleks Pesona Kayangan II Depok pada 31 De-sember dan diakhiri di Majelis Ta’lim Raudhatul Jannah kawasan BSM (Bandung Super Mall) Kota Bandung pada 1 Januari 2012. Sedangkan rombongan tiba di

unsur Forum Koordinasi Daerah Sumut, Danlantamal Belawan Laksamana I Bambang Soesilo, Sekda Provsu Nurdin Lubis, para asissten dan kepala SKPD jajaran Pemprovsu, para qari/qari’ah serta hafiz/hafizah. Plt Gubsu dalam kesempatan tersebut berkesempatan menghaturkan rasa terimakasih kepada segenap warga Sumatera Utara yang telah bersama-sama menjaga situasi aman dan kondusif sepanjang tahun 2011. Selain mengucapkan terimakasih, Plt. Gubsu sekaligus memohon maaf atas berbagai kekurangan Pemerintah Provinsi dalam melayani masyarakat Sumatera Utara. Selain memberikan apresiasi, Gatot juga memohon maaf kepada seluruh masyarakat Sumatera Utara, terhadap belum optimalnya tingkat pelayanan Pemprov Sumut. “Insya Allah, kita sama-sama berharap dan berusaha seoptimal mungkin, agar pada 2012 ini, semua dapat berjalan lancar dan lebih baik,” tegasnya. “Kita bertemu pada malam ini, di awal kerja pada tahun 2012 semoga memberi bermakna untuk mengawali dengan cinta yang bergelora yang siap berkorban, seperti cinta Rasul kepada umat. Mari kita bersamasama membangun keluarga, bangsa dan negara yang kita cintai ini,” imbuh Gubsu.(m28)

Medan pada Selasa sore (3/1). ZIKIR AKBAR Pada bagian lain keterangannya, Buya KH Amiruddin MS yang juga pendiri dan pembimbing Majelis Zikir Tazkira Sumut menjelaskan, pada hari Minggu (8/1), Majelis Zikir Tazkira Sumut akan menggelar Zikir Akbar berupa tausiyah, zikir dan doa di Masjid Agung Medan dimulai pukul 07.30 WIB. Ketika disinggung program kegiatan Majelis Zikir Tazkira dalam tahun 2012, menurutnya, dalam tahun ini kegiatan zikir akan lebih diintensifkan lagi. Yakni, pada Ahad kedua tiap bulan di Masjid Agung, maka pada Ahad ketiga di Masjid Raya Al-Mashun bergabung bersama Majelis Zikir Angkatan Muda Tazkira Sumut agar lebih efektif Di samping itu, katanya, dalam menyongsong Maulid Nabi Muhammad SAW 1433 H, pihaknya akan melaksanakan Safari Zikir dan Dakwah ke Pulau Jawa sekaligus berziarah ke Makam Walisongo dan Masjid Kubah Emas di Cinere Depok, Jabar pada 20-27 Fabruari serta pelaksanaan kursus kader muballigh Tazkira Sumut gelombang III dilaksanakan di Rumah Zikir Tazkira Sumut lantai 2 gedung PT New Takagama Tour & Travel Jalan Brigjen Katamso No 45 G (pertigaan traffig light depan Istana Maimoon) Medan.

I’TIBAR Alquran Pedoman Hidup H M Hafez Lc MA Rasulullah SAW bersabda: “Sebaik-baik kalian adalah yang belajar Alquran dan mengajarkannya” (al-hadits). Alquran sebagai kalamullah yang diturunkan kepada nabi Muhammad selama lebih kurang 23 tahun adalah kitab suci umat Islam yang merupakan sumber petunjuk dalam beragama dan pembimbing dalam menjalani kehidupan mereka di dunia untuk mencapai kebahagiaan akhirat. Bagi seorang Muslim berkewajiban untuk selalu berinteraksi aktif dengan Alquran, menjadikannya sebagai sumber inspirasi, berpikir dan bertindak. Membaca Alquran merupakan langkah awal dalam berinteraksi dengannya yang harus diteruskan dengan mentadabburinya yaitu dengan merenungkan dan memahami maknanya sesuai petunjuk Rasulullah SAW dan ulama salafus shalih, lalu mengamalkannya dalam kehidupan sehari-hari, dan dilanjutkan dengan mengajarkannya serta memperjuangkan nilai-nilai yang terkandung di dalamnya. Di samping itu, kita juga dianjurkan menghapalnya dan men-jaga hapalan tersebut agar jangan terlupakan, karena hal itu merupakan salah satu bukti nyata bahwa Allah SWT berjanji akan menjaga Alquran dari perubahan dan penyimpangan seperti ki-tab-kitab yang diturunkan sebelumnya. Dan salah satu bukti terja-ganya Alquran adalah tersimpannya di dada para penghapal Al-quran dari berbagai penjuru dunia, bangsa arab dan ajam (non arab). Tidak ada di dunia ini suatu kitab yang dihapal oleh ribuan dan puluhan ribu orang, di dalam hati mereka, kecuali Alquran ini, yang telah dimudahkan oleh Allah SWT untuk diingat dan dihapal. Maka tidak aneh jika kita menemukan banyak orang, baik itu laki-laki maupun perempuan, yang mampu menghapal Alquran. Ia juga dihapal oleh anak-anak kecil kaum Muslimin, dan mereka menghapalnya dengan sempurna sehingga tidak satu hurufpun yang terlewatkan dari Alquran itu. Umat kita pada abad-abad pertama telah berinteraksi dengan baik terhadap Alquran. Mereka berinteraksi baik dalam memahaminya, mengetahui tujuan-tujuannya, berlaku baik dalam mengimplementasikannya kandungan Alquran secara massif dalam kehidupan mereka, dalam bidang-bidang kehidupan yang beragam, serta berupaya mendakwahkannya. Kehidupan mereka telah diubah oleh Alquran dengan amat drastis dan revolusioner. Alquran telah mengubah mereka dari perilaku-perilaku jahiliyah menuju kesucian Islam, dan mengeluarkan mereka dari kegelapan ke dalam cahaya. Banyak sekali anjuran dan keutamaan membaca Alquran, baik dari Alquran maupun as-Sunnah, di antaranya : Pertama, menjadi manusia yang terbaik, Nabi SAW bersabda: “Sebaik-baik kamu adalah orang yang mempelajari al-Qur`an dan mengajarkannya.” Kedua, kenikmatan yang tiada bandingnya, Nabi bersabda: ‘Tidak boleh ghibthah (menginginkan sesuatu yang dimiliki orang lain) kecuali dalam dua hal: (pertama) orang yang diberikan Allah SWT keahlian tentang Alquran, maka dia melaksanakannya (membaca dan mengamalkannya) malam dan siang hari. Dan seorang yang diberi oleh Allah SWT kekayaan harta, maka ia infakkan sepanjang hari dan malam. Ketiga, Alquran memberi syafaat di hari kiamat, Rasulullah SAW bersabda: “Bacalah al-Qur`an, sesungguhnya ia akan datang pada hari kiamat memberi syafaat bagi ahlinya (yaitu orang yang membacanya, mempelajari dan mengamalkannya). Keempat, pahala berlipat ganda, ‘Rasulullah SAW bersabda: “Barangsiapa yang membaca satu huruf dari Alquran an maka untuknya satu kebaikan, dan satu kebaikan dilipatgandakan dengan sepuluh kali lipat. Saya tidak mengatakan ‘alif laam miim’ satu huruf, akan tetapi alif adalah satu huruf, laam satu huruf dan miim satu huruf.” Kelima, dikumpulkan bersama para malaikat, Nabi Muhammad SAW bersabda: “Orang yang membaca Alquran dan ia mahir dalam membacanya maka ia dikumpulkan bersama para malaikat yang mulia lagi berbakti. Sedangkan orang yang membaca Alquran dan ia masih terbata-bata dan merasa berat dalam membacanya, maka ia mendapat dua pahala”.

Muslim AS Hidup Terbuka Dengan Masyarakat Lain Mohamad Bashar Arafat P. hD, imam besar salah satu masjid di Amerika Serikat, melaksanakan tabligh ilmiah kepada ratusan mahasiswa IAIN SU di masjid Al Izzah Kampus II Jalan Willem Iskander Medan Estate, Senin (12/12). Kegiatan merupakan kerjasama Konsul Amerika di Medan dengan IAIN SU untuk menyampaikan beberapa perkembangan penting agama Islam di Negeri Paman Sam itu dihadiri Konsul AS di Medan Kathryn T Crockkart, koordinator dialog Drs. Ansari Yamamah, MA para dosen dan undangan lainnya. Konsul AS di Medan Kathryn T Crockart menyampaikan terima kasihnya atas jalinan kerjasama antara AS dan Indonesia yang selama ini berjalan sangat baik. “Imam di AS banyak berkunjung ke berbagai negara untuk menyampaikan bahwa di Amerika umat beragama maupun yang tidak berpegang pada keyakinan hidup berdampingan tanpa perbedaa,” ungkapnya dan menyampaikan pentingnya sinergi kuat AS dan Indonesia untuk mewujudkan perdamaian

dunia secara global. Dalam tabligh ilmiahnya Mohamad Bashar yang juga Presiden Civiliations Exchange & Cooperation Foundation menyampaikan, pengalaman masyarakat muslim Amerika yang hidup terbuka dengan masyarakat lainnya yang berbeda agama. “Masyarakat Amerika lebih mengedepankan nilai-nilai akademik dan ilmiah termasuk juga dalam agama, sehingga semua keyakinan dihargai dan mereka sangat menghargai umat yang menyampaikan agamanya dalam konteks ilmiah,” ungkap Bashar. Disampaikannya, umat Islam AS juga melakukan kerjasama sosial dan saling mengunjungi lintas agama untuk bersilaturahmi dan tukar pikiran. Oleh karenanya umat beragama harus dapat memahami keyakinan lainnya. “Hal ini sangat penting guna menghindari ‘truth claim’ atau klaim kebenaran kelompok,” ucap dia dan menawarkan imam masjid di Medan khususnya mengikuti program itu.

MTA Resmikan Gedung Baru Majlis Tafsir Alquran (MTA) meresmikan pemakaian gedung baru yang beralamat di Jalan Perhubungan No.17 Lautdendang Percut Seituan, Minggu (1/1). Gedung yang berada persis di depan gedung pengajian MTA ini merupakan hasil swadaya warga pengajian MTA sendiri. Dari mulai pengadaan pertapakan sampai pembangunan gedung dilakukan sendiri dengan penuh semangat kegotongroyongan warga pengajian MTA secara bahu-membahu penuh kekeluargaan. Hingga akhirnya gedung tersebut berdiri, semuanya dilakukan atas peran serta para warga MTA. Menurut Ketua MTA Perwakilan Sumatera Utara Al Ustadz Sarijo, SAg, dakwah tidak hanya memanajeman amal ibadah tapi juga meningkatkan kesejahteraan sosial ekonomi umat sesuai dengan sistem syariah. ‘’Dengan adanya gedung baru ini diharapkan dapat lebih meningkatkan pelayanan kepada umat khususnya warga pengajian MTA,’’ ujarnya saat peresmian pemakain gedung baru tersebut.



Foto bersama usai penyerahan kunci gedung dari pengurus MTA Wilayah Sumatera Utara kepada pengelola Lembaga Keuangan Mikro Syariah (LKMS) UB Amanah Syariah, pada acara peresmian pemakaian gedung baru MTA di Deliserdang, Minggu (1/1).

Bashar juga menyampaikan kekagumannya karena masyarakat muslim Indonesia adalah masyarakat yang berpikir terbuka, berwawasan, menghormati dengan toleransi tinggi. Kesan ini menjadikan saya seperti berada di negeri sendiri, aku Bashar alumni Damaskus University ini. Drs Ansari Yamamah kepada wartawan menyampaikan, saat ini merupakan abad kolaborasi antara satu negara dengan negara lainnya. Sebab tidak ada satupun bangsa di dunia ini yang dapat menyelesaikan masalahnya sendiri tanpa bantuan negara lain. Umat Islam Indonesia sebagai umat terbesar, meski masih dianggap sebagai bangsa ‘budak’ karena banyak mengirim tenaga kerja ke luar negeri. Tapi penting dicamkan bahwa hal demikian itu merupakan salah satu proses untuk menjadi suatu bangsa

yang besar, ungkapnya dan mencontohkan bangsa Mamluk mendirikan Dinasti Mamluk yang besar. Masyarakat Indonesia suatu saat akan memegang peranan penting bagi kebangkitan peradaban dunia, karena memiliki sosial kapital yang kuat, peradaban dengan pemikiran bijaksana serta menghargai pahlawan. Untuk membangun peradaban itu, kata Ansari yang juga Ketua Green Dai Indonesia ini, umat Islam wajib berkolaborasi dengan negara lain dalam perdamaian dunia, penghargaan HAM, cinta dan persaudaraan. Kita ingin meluruskan stigma yang beranggapan bahwa ‘Timur adalah Timur dan Barat adalah Barat’. “Stigma dikotomis ini harus dihapus dengan mengedepankan nilai-nilai keilmuwan bukan nilai teologis,” ucap Ansari. (m26)

Launching Lembaga LPPI Sha Sumut Dalam menyahuti dan turut serta memberikan kontribusi terhadap pemecahan dan solusi beragama persoalan keindonesiaan pada hari Pada hari selasa tanggal 20 Desember 2011 dilaksanakan launching Lembaga Penelitian Dan Pengkajian Ilmu-Ilmu Sosial Humaniora Dan Agama Sumatera Utara (LPPI SHA SUMUT ). Lembaga yang diusung didirikan oleh dosen-dosen muda IAIN SU punya motivasi yang kuat untuk melakukan pencerdasan dan gerakan yang sifatnya konstruktif terhadap persoalan kebangsaan, tegas ketua LPPI SHA SUMUT Ahmad Sempurna, MA didampingi sekjen Watni Marpaung, MA dan ketua Panitia Faisal Riza, MA. Launching dan seminar LPPI SHA SUMUT langsung dibuka oleh Rektor IAIN SU Prof Dr. N. Ahmad Fadhil Lubis, MA. Dalam kesempatan tersebut tokoh Sumut Gus Irawan (Dirut PT. BANK SUMUT) menjadi keynote speaker yang menyampaikan gagasan dan ide seputar ekonomi kerakyatan. Menurut Gus Irawan, bahwa semua lembaga, instansi atau apa pun yang membawa simbol Sumatera Utara (SUMUT) perlu memberikan kontribusi dan pencitraan yang baik dalam skala nasional maupun internasional. Oleh sebab itu, LPPI SHA Sumut salah satu komponen yang mesti punya peran strategis dalam dunia pendidikan dan bidang lainnya yang masuk pada kapasitas lembaga ini. Dalam hal ini, Lembaga LPPI SHA Sumut sbelumnya telah melakukan kegiatan yang sifatnya ilmiah dengan penerbitan jurnal, percetakan, dan penerbitan. Selanjutnya ke depan LPPI SHA Sumut akan melakukan kerja sama dengan berbagai pihak yang dapat sifatnya konstruktif dalam berbagai bidang mislanya terapi pshikologis, pendidikan, hukum, dan ekonomi yang diharapkan bermanfaat kepada sleuruh lapisan masyarakat, tegas Ahmad Sempurna, MA. (m38)

Mimbar Jumat


WASPADA Jumat 6 Januari 2012

Peran Mediasi Harian Waspada Kerja Keras Mencari Nafkah Dapat Menebus Dosa (1)

(Apresiasi Kepada Harian Waspada Dalam Rangka Ulang Tahun ke-65 Oleh H.M. Nasir Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara Wakil Sekretaris Dewan Fatwa Pengurus Besar Al Washliyah


ejak berdirinya Harian Waspada 11 Januari 1947 hingga sekarang – hanya beberapa hari lagi setelah tulisan ini diturunkan – 11 Januari 2012, genap berusia 65 tahun, sungguh merupakan usia yang cukup matang sebagai media nasional dalam memerankan mediasinya antara pemerintah dengan rakyat, antara sesama saudara sebangsa dan setanah air, antara pembaca dan penulis, dalam konteks mencerdaskan masyarakat dalam komunikasi dan pemberitaan yang berimbang sesuai visi yang disuarakannya “Demi kebenaran dan keadilan”. Usia yang mendekati tujuh dasawarsa tersebut dapat dipastikan bahwa “harian” yang telah mendapat tempat di hati umat ini, kaya dengan pengalaman dan sudah malangmelintang dalam menyampaikan/ menyuarakan kebenaran dan keadilan. Dan yang paling menarik untuk dicontoh adalah konsistensi dan independensinya dalam menjalankan visi dan misinya, meskipun pernah dibredel 4 kali dari tahun 1947 ke tahun 1949, namun Harian Waspada tetap eksis hingga di era reformasi ini (berita peristiwa 60 tahun Waspada hal.195). Di era reformasi yang begitu pesat ini, dimana masyarakat hingga anakanak sekolahpun dapat mengakses beritanya via internet, face book, twiter dan lain-lain dengan biaya yang relatif murah, ternyata Harian Waspada masih bertahan dan tetap diminati oleh masyarakat bahkan ditunggu kedatangannya, adalah suatu hal yang luar biasa, dan sebagai bukti bahwa pendirinya benar-benar ikhlas untuk menyuarakan kebenaran dan keadilan. Pepatah Arab ada mengatakan: mâ kâna lillâhi dâma waththashal wa mâ kâna lighairillâhi inqatha’a wanfashal (sesuatu yang digagas ikhlas karena Allah ia akan bertahan lama, dan sesautu yang digagas tidak karena Allah ia akan terhenti dan terputus). Oleh sebab itu, Harian Waspada sangat pantas untuk mensyukuri nikmat kepercayaan untuk menyuarakan suara umat ini, yang telah diberikan Allah Swt kepada pendirinya dan pelanjutnya karena menyuarakan kebenaran dan keadilan bahagian dari misi Ketuhanan dan Kerasulan yang tidak semua orang

menyadarinya apalagi menyanggupinya, karena menyuarakan kebenaran dan keadilan tidak terlepas dari berbagai konsekuensi dan resiko. Nabi Muhammad Saw bersabda: Katakanlah yanhg benar itu walapun pahit (alhadis). Sebaliknya, menyuarakan kebatilan atau memberitakan kebohongan adalah suatu perbuatan dosa, dan diminta pertanggungjawabannya kelak di akhirat. Ada seorang sahabat Nabi Muhammad Saw yang bernama Abi Lubabah, diutus oleh Nabi untuk melakukan perundingan dengan orang Yahudi yang telah melakukan pengkhianatan terhadap umat Islam dalam peperangan ahzab. Di saat orang-orang Yahudi bertanya kepada Abi Lubabah, jika mereka menyerahkan diri kepada Nabi Saw, apa

Di samping misinya menyuarakan kebenaran dan keadialn, Harian Waspada dapat menjadi jembatan perekat umat dan mencerdaskan intelektualitas umat lewat halaman Mimbar Jum’at dan jadwal khatib se-kota Medan dan sekitarnya. Lebih dari itu, tulisantulisan di Mimbar Jumat dapat menjadi bahan khutbah bagi khatib-khatib di luar daerah. Umat Islam khususnya dapat menambah wawasan keislaman dengan membaca tulisan-tulisan di halaman Mimbar Jum’at pada gilirannya akan dapat membentuk kecerdasan spiritual umat Islam. Tidak heran jika pada setiap hari Jum’at, koran Waspada cepat habis terjual karena banyak peminat yang ingin mendapatkannya. Dan inilah

…. Harian Waspada ikut berperan dalam berdakwah lewat tulisan dan menjaring ahli agama untuk ikut serta mengasah pena mereka menyadarkan umat ini untuk kembali ke jalan yang benar. yang akan diperlakukan oleh Nabi Saw kepada mereka. Abu Lubabah menjawab: Kalian akan dibunuh, dengan mengisyaratkan pedang ke lehernya. Padahal berita hukum bunuh kepada mereka tidak pernah sama sekali diucapkan Nabi Saw. Lalu Abu Lubabah sangat menyesal atas pemberitaannya yang tidak benar. Lalu ia bersumpah untuk menghukum dirinya dengan mengikat badannya di salah satu tiang di Raudhah Mesjid Nabawi dan bersumpah tidak akan melepas dirinya sampai Allah menerima taubatnya, dan ia tidak mengizinkan siapapun untuk melepaskannya terkecuali Rasulullah sendiri yang melepaskannya, dan anak perempuannya hanya dibolehkan untuk melepaskannya ketika mau melaksanakan shalat dan qadha hajat saja. Sampai hari keenam, barulah Nabi menerima wahyu dari Allah atas diterimanya taubat Abu Lubabah, dan sampai sekarang tiang tempat Abu Lubahah diikat tersebut diberi nama “Tiang taubat” sebagai pelajaran bagi orang sesudahnya. Sedemikian pentingnya menyuarakan kebenaran dan keadilan.

yang membedakan Harian Waspada dengan meda-media cetak lainnya, yaitu memberi porsi yang besar untuk kolomnis Mimbar Jum’at menyalurkan bakat menulis mereka, dan Mimbar Jum’at ini mempunyai daya tarik tersendiri bagi penulis dan penggemarnya. Jadi, peran Harian Waspada dalam hal ini tidak terbatas pada persoalan informasi yang berkembang di luar negeri dan dalam negeri, tidak pula hanya sebatas info bisnis dan dunia olahraga, akan tetapi Harian Waspada ikut berperan dalam berdakwah lewat tulisan dan menjaring ahli agama untuk ikut serta mengasah pena mereka menyadarkan umat ini untuk kembali ke jalan yang benar. Dalam munasabah-munasabah tertentu seperti pada musim haji, Harian Waspada tidak segan-segan memberikan porsi pemberitaan di halaman depan untuk pemberangkatan dan pemulangan jamaah haji. Terkadang dalam kondisi tertentu ditempatkan pada headline, dan ini merupakan apresiasi yang amat berharga bagi syiar Islam.

Terlebih melegakan umat Islam di dalam menampilkan tulisan-tulisan keagamaan, Harian Waspada tidak membatasi pada paham tertentu atau organisasi tertentu, meskipun yang berkaitan dengan persoalan khilafiah yang tidak ada kesudahannya. Namun kesempatan untuk mengekspresikan pendapat dan pemikiran-pemikiran terbuka lebar bagi para ustadz, cendikiawan, dan para pemikirpemikir Islam. Itu artinya, Harian Waspada mendidik pembacanya untuk berpikir kritis dan selektif bagi pembacanya, dan pada gilirannya fanatisme paham tertentu akan mencair dengan sendirinya. Dengan mengikuti tulisantulisan yang terbit pada hari Jum’at, penulis teringat dengan Harian al-Liwa al-Islami yang terbit pada setiap Jum’at di Mesir. Harian ini sangat diminati oleh para mahasiswa Islam yang ada di Mesir, karena memuat tulisan para ulama-ulama sehingga koran al-Liwa al-Islami menjadi mediasi antara ulama mereka, dan menjadi jembatan hati antara ulama dan umat. Harapan penulis kepada Harian Waspada dapat mempertahankan eksistensinya. Tidak terbatas pada tulisan, Waspada turut serta berdakwah ke daerah-daerah, seperti apa yang diinformasikan kepada kita menjelang mengakhiri tahun 2011 yang lalu, Waspada dengan para dainya memberikan pencerahan kepada umat Islam sampai ke pelosok-pelosok, dan kegiatan ini sangat bermanfaat karena Waspada tidak hanya go internasional tapi juga well come to kampung-kampung, sehingga Harian Waspada benar menjadi jembatan hati untuk memediasi pesan kebenaran dan keadilan antara pemerintah dan rakyat, antara ulama dan umat, antara penulis dan pembaca, antara bisnismen dan konsumen, dan seterusnya... Selamat berulang tahun, jayalah Harian Waspada. Wallahua’lam bil ash-shawab

Cintailah Lima Jangan Melupakan Lima Oleh As’ad Marlan Penulis adalah Guru MAL IAIN SU dan Dosen Fak. Tarbiyah IAIN SU


asulullah SAW dalam salah satu hadisnya pernah bersabda: “Akan datang kepada umatku suatu masa, mereka mencintai lima perkara dan melupakan lima hal. Mereka mencintai kedudukan dan melupakan kubur, mereka mencintai harta dan melupakan hisab, mereka mencintai dunia dan melupakan akhirat, mereka mencintai hidup dan melupakan mati, mereka mencintai dosa dan melupakan taubat.” ( HR.Atturmuzi ). Hadis diatas menunjukkan

adanya prediksi Nabi Muhammad SAW, terhadap sifat yang akan muncul bagi umat islam terhadap lima perkara yang menyebabkan manusia menjadi lupa terhadap lima hal berikut : Pertama, mereka mencintai kedudukan tetapi lupa kepada kubur dan kematian. Dengan pesona kekuasaan dan kedudukan orang bisa menjadi tebal muka, hilang rasa malu hingga hidupnya tak ubahnya seperti binatang ternak yang berkaki empat. Rasulullah SAW pernah mengingat-

Konsultasi Al-Quran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI ALQURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H. Yusdarli Amar), 082163203233 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Ustad, Saya mau bertanya mengenai do’a untuk orang tua, banyak ustad menggunakan kalimat kama robbayana shigharo, mana yang yang paling benar shigharo atau shghiro? Setahu saya dalam Al-qur’an kalimatnya shaghiro. Mohon penjelasan. Dari Juhari Selian. Jawab : Terimakasih atas pertanyaanya. Do’a yang sangat rutin kita baca dan merupakan suruhan Allah adalah “Robbirhamhuma kama robbayani shoghiro. (Al-isra’ : 24 ). Artinya Dan katakanlah Wahai Tuhanku sayangilah keduanya sebagaimana keduanya telah mendidik aku pada waktu aku kecil”. Inilah lafaz Al-qur’an. Lafaz dari Alqur’an ini kemudian kita jadikan lafaz do’a menjadi “Allahummaghfirlana Dzubnubana waliwa lidaina warhamhuma kama robbayana soghiro” Artinya: “Ya Tuhan, Ampunilah kami dan kedua orang tua kami dan sayangilah keduanya sebagaimana keduanya telah mendidik aku pada waktu aku kecil.”. Lihatlah perbedaan, Lafaz Al-qur’an tidak memakai “ighfirlana dzunubana wa liwa lidaina”. Kemudian, do’a ini “dimodifikasi” sesuai dengan tata bahasa arab, dan menjadi bunyinya adalah “Allhumaghfirlana dzunubana waliwa lidaina warhamhum kama robbauna shighoro, artinya Ya Tuhan kami, ampunilah dosa-dosa kami, dosa kedua orang tua kami dan sayangilah mereka sebagaimana mereka telah mendidik kami sewaktu kami kecil. Jadi terjadi perubahan dari “keduanya” menjadi “mereka”. Kedua lafaz itu benar dan diperbolehkan, yang penting jangan terjadi kekeliruan lafaz, misalnya warhamhuma kama robbayani sighoro, atau warhamhum kama rabbayani soghiro. Lafaz ini sudah bersalahan. maksudnya jika sudah memakai dhomir “hum” hendaklah selanjutnya disesuaikan dengan dhomir “hum”, ketika memakai dhomir “huma” pada lafaz selanjutnya juga disesuaikan dengan dhomir “huma” itu. Doa yang telah dimodifikasi semacam ini dapat saja digunakan, karena diperbolehkan kita untuk menyusun do’a, yang penting lafaz dan isi do’a nya bagus dan tidak meminta keburukan untuk diri dan orang lain. Diantara dua lafaz do’a diatas yang terbaik adalah sebagaimana dhomir yang diterakan Al-qur’an yaitu “Allahummaghfirlana Dzubnubana waliwa lidaina warhamhuma kama robbayana soghiro”, oleh karena itu, kalau ada lafaz do’a dari hadis-hadis Rasulullah, itu juga sangat baik sekali. (Lihat Al-azkar karangan An-Nawawi dan Pedoman Zikir dan Do’a karangan Hasbi Ash-Shiddieqy). Walluhu A’lam. Al-Ustadz H. Ismail Hasyim, MA

Di dunia ini penuh dengan hal-hal yang menyenangkan dan melalaikan, tapi dunia juga tempat beramal yang hasilnya kelak akan dinikmati di akhirat. kan kepada para sahabatnya. Apabila orang tidak ada rasa malu maka berbuatlah apa yang ia kehendaki. Demi meraih kedudukan atau kekuasaan orang cenderung lupa diri, apalagi tidak memiliki iman yang kokoh dan dilandasi dengan niat yang baik. Bahkan dengan kedudukan tersebut manusia banyak yang menyibukkan diri dengan saling berbangga-bangga dan bermegah-megahan. Mereka lalai dan lupa bahwa kedudukan titipan atau amanat Allah SWT. Allah SWT berfirman :”bermegah-megahan telah melalaikan kamu, sampai kamu masuk dalam kubur. Janganlah begitu, kelak kamu akan mengetahui akibat perbuatan itu, dan janganlah kamu begitu, kelak kamu akan mengetahui. Janganlah begitu, jika kamu mengetahui dengan pengetahuan yang yakin, niscaya kamu akan benar-benar melihatnya dengan ainul yaqin, kemudian kamu pasti akan ditanyai pada hari itu tentang kenikmatan (yang kamu megah-megahkan di dunia itu).” (QS. At-Takaatsur : 1-8). Sebagai upaya mengendalikan ambisi keduniaannya dan kekuasaannya, manusia dianjurkan untuk berziarah kubur. Karena ziarah kubur akan mengingatkan pada kematian dan kehidupan akhirat. Rasulullah SAW pernah bersabda dalam hal ini : “Dulu aku melarang kalian berziarah kubur, sekarang kalian berziarahlah. Sebab ziarah kubur itu akan menanamkan rasa zuhud terhadap duniawi, dan mengingatkan kalian kepada akhirat”. (HR. Muslim dan Abu Daud). Kedua, mereka mencintai harta tetapi melupakan hisab (perhitungan amal). Rasulullah SAW mengingatkan dalam hal ini : “Dari Anas bin Malik, jika anak Adam itu mempunyai suatu lembah yang berisi emas, maka ia akan menginginkan mempunyai dua lembah, tak akan ada yang bisa menyumbat mulutnya kecuali hanya tanah. Dan Allah menerima taubat orang-orang yang benarbenar taubat.” (HR. Anas Bin Malik). Seringkali pikiran manusia diperdayakan oleh harta. Demi harta, segala jalan dilaluinya, segala cara ditempuhnya, walaupun dengan

cara-cara yang haram. Harta merupakan alat untuk mencapai cita-cita. Harta adalah berharga, tetapi tidak lebih berharga daripada kehormatan diri, kemuliaan agama, keridhaan Allah, dan keluhuran budi pekerti. Harta untuk mengangkat derajat seseorang, bukan derajat yang mengangkat harta. Kita harus selektif dalam upaya mencari harta di dunia ini. Jangan sampai harta yang kita miliki bercampur dengan harta yang haram, meskipun sedikit. Sebab harta haram tidak berkah, menjerumuskan manusia ke dalam neraka, dan ditolak Allah SWT do’a-nya. Rasulullah SAW bersabda : “Buatlah makananmu yang baik-baik, niscaya do’amu akan dikabulkan”. (HR. Ath-Tabrani). Ketiga, mereka mencintai dunia tetapi melupakan akhirat. Di dunia ini penuh dengan hal-hal yang menyenangkan dan melalaikan, tapi dunia juga tempat beramal yang hasilnya kelak akan dinikmati di akhirat. Keempat, mereka mencintai hidup tetapi lupa pada kematian. Hidup ini memang indah dan nikmat. Karena nikmatnya itu, tidak sedikit orang tenggelam di dalamnya seolah – olah akan selamanya hidup di dunia ini. Sebenarnya, kematian bukanlah sesuatu hal yang harus ditakuti sebab kematian itu ialah kesempurnaan hidup, jika ketika hidupnya diisi dengan ketaatan dan ketundukan kepada Allah SWT. Kelima, Mereka suka berbuat dosa tetapi lupa atau lalai bertaubat kepada Allah SWT. “ Dan bertaubatlah kamu sekalian kepada Allah, hai orang – orang yang beriman supaya kamu beruntung.” (QS. An-Nuur : 31). Allah SWT menerima taubat dari hamba-Nya, merupakan sebuah anugerah dari-Nya, jika memang pertaubatan tersebut dilakukan sesuai dengan semua persyaratannya. Sebagian dari syarat diterimanya taubat adalah sebelum nyawa seseorang di tenggorokan. Rasulullah SAW bersabda : “ Sesungguhnya Allah yang Maha Mulia lagi Maha Agung akan menerima taubat sese-orang sebelum nyawanya sampai di tenggorokan.” (HR.Turmuzi) Wallahu A’lam.

Allah SWT menciptakan langit dengan segala isinya untuk kehidupan manusia sehingga memudahkan hambaNya untuk berjalan di muka bumi. Sekalipun bumi terlihat bulat namun air lautnya tidak tumpah saat dilayari, dan bijibiji emas serta minyaknya tidak meluber tatkala digali. Nah, dengan kemudahan yang seperti itu, maka sangat wajar dan masuk akal jika Allah SWT menuntut hambaNya untuk bekerja keras mencari rezeki halal, dan mencela orang yang bermalas-malasan, termasuk peminta-minta. Dalam satu ayat di surat Yaasin disebutkan yang artinya: ‘’Wa ja’alnaa (dan kami jadikan) fiihaa (di bumi) jannaatin (kebun-kebun) min nakhiilin ( kurma) wa a’naabin (dan anggur) wa fajjarnaahu (dan kami pancarkan) fiiha (darinya) min al ‘uyuun (mata air) liya’kuluu (agar mereka memakan) min tamarihi (dari buah-buah-annya) wa maa (dan dari apa saja) amilathu (yang dikerjakan) aidiihim (tangan-tangan mereka) afalaa (maka mengapakah tidak) tasykuruun (kamu bersyukur).’’ Ayat di atas membungkam orang-orang pemalas yang berdalih tidak ada pekerjaan untuknya. Ayat ini sekaligus mengingatkan bahwa kalau hamba berusaha maka Allah akan memperlancar usahanya. Ibaratnya jika kita membuka lahan untuk menghidupkan tanahnya, maka Allah akan mengalirkan airnya, menyuburkan tanah-tanahnya Dan selanjutnya banyaklah hadit-hadit Nabi SAW yang mendorong supaya kita bekerja kerassbb: ‘’”Tidak ada yang lebih baik bagi seseorang yang makan sesuatu makanan, selain makanan dari hasil usahanya. Dan sesungguhnya Nabiyullah Daud as, selalu makan dan hasil usahanya”. (HR. Bukhari). (Sumber: dikutip dari hadis shahih dan sumber lain online hadis bekerja keras)

Reaktualisasi Pemahaman Wakaf Suhrawardi K Lubis Dosen Universitas Muhammadiyah Sumatera Utara


emahaman masyarakat terhadap wakaf wasa ini uang bukan hanya berfungsi sebagai alat tukar umumnya masih bersifat konvensional. saja, akan tetapi sudah dianggap sebagai suatu benda Pelaksanaan amalan ibadah wakaf selalu dilakuyang dapat diperdagangkan. Bahkan melihat perkembangan zaman, uang merupakan salah satu variabel kan dalam bentuk benda tetap, lazimnya dalam bentuk dalam pembangunan ekonomi masyarakat. tanah atau bangunan dan digunakan untuk kuburan, Mengingat posisi strategis uang, sebenarnya sudah masjid/musalla dan madrasah. semenjak lama sebahagian ulama tidak ragu meneKonsekwensi pemahaman wakaf konvensional tapkan uang sebagai objek wakaf dengan istilah waqf seperti di atas, ibadah wakaf hanya dapat diamalkan oleh al-nukud. Misalnya Imam al-Zuhri, yang mengemuorang yang relatif memiliki kemampuan ekonomi yang kakan bahwa wakaf dinar boleh, yaitu dengan cara lumayan. Sedangkan yang memiliki kemampuan menjadikan dinar tersebut sebagai modal usaha, kemuekonomi cukup atau kurang, akan sulit mengamalkan dian keuntungan yang diperoleh dari usaha tersebut ibadah wakaf. Bahkan di daerah perkotaan, biaya yang disalurkan sesuai tujuan wakaf. Kemudian Abu Tsaur juga diperlukan untuk melaksanakan ibadah wakaf jauh lebih meriwayatkan bahwa Imam Al-Syafi’i juga membobesar daripada biaya melaksanakan ibadah haji ke tanah lehkan wakaf dinar dan dirham. Sedangkan Musuci Makkah. Padahal ibadah wakaf merupakan ibadah taqaddimin dari yang memiliki imulama Mazhab balan pahala berliHanafi membopat ganda dan ber..Tidak ada satu dalil hukum dalam Alquran lehkan wakaf disifat terus menerus nar dan dirham maupun Al-Hadis yang menyatakan secara mengalir tak persebagai pengecuanah berhenti, walimitatif bahwa objek wakaf hanya terbatas lian atas dasar ihlaupun pewakaf tihsan bil al-‘Urfi. sudah meninggal kepada tanah dan bangunan saja.. Di Indonesia, dunia. waqf al-nukud ini Kenapa ibadah diterjemahkan wakaf pahalanya terus menerus mengalir tak pernah dengan wakaf uang, ada juga yang menyebutnya dengan berhenti? Sebab ibadah wakaf merupakan sedekah jariah, wakaf tunai. Wakaf uang ini telah disepakati oleh para harta yang diwakafkan tidak boleh habis, barang/harta ulama Indonesia, hukumnya jawas (boleh). Kesepakatan yang diwakafkan harus tetap ada, hanya manfaat dan/atau ulama Indonesia membolehkan wakaf uang secara tegas, hasilnya saja yang boleh dipergunakan. Oleh karena itu, hal ini dinyatakan dalam fatwa Majlis Ulama Indonesia sepanjang harta wakaf itu ada dan bermanfaat atau yang dikeluarkan pada tanggal 11 Mei 2008. menghasilkan, maka sepanjang itu pula pewakaf Wakaf uang selain memiliki posisi strategis, juga memperoleh imbalan pahala berlipat ganda dari Allah Swt. memiliki kekhasan tersendiri dibanding objek wakaf Dengan demikian, ibadah wakaf memiliki keistimelainnya. Kekhasan itu disebabkan wakaf uang berwaan dibandingkan dengan ibadah lainnya yang berpeluang diamalkan oleh orang kaya maupun orang miskaitan dengan penyaluran harta. Keistimewaan itu disekin. Intinya dapat diamalkan oleh semua orang, baik babkan ibadah wakaf memiliki dimensi hablum min Alsecara perseorangan maupun secara berjamaah. Kemulah dan hablum min annas yang sifatnya terus menerus. dian, dapat pula diamalkan dengan uang yang jumlahKarena bersifat terus menerus, pewakaf memperoleh panya relatif besar maupun uang yang sedikit. Dengan hala yang terus menerus pula. Bahkan walaupun pewakaf demikian, wakaf uang membuka kesempatan kepada sudah meninggal dunia akan tetap memperoleh pahala semua orang untuk memperoleh pahala terus menerus. sepanjang harta yang diwakafkan itu memberi manfaat. Kemudian, selain reaktualisasi pemahaman Mengingat keunikan dan keistimewaan ibadah wakaf terhadap objek wakaf, juga perlu dilakukan reaktualiasi seperti dikemukakan di atas, perlu diadakan reaktulisasi pemahaman terhadap pemanfaatan dan pengelolaan pemahaman terhadap pelaksanaan ibadah wakaf, sehingharta benda wakaf. Apabila selama ini difahamkan ga ibadah wakaf dapat diamalkan oleh semua orang, baik bahwa pemanfataan harta benda wakaf hanya terbatas oleh orang kaya maupun yang miskin, karena orang kaya untuk tanah kuburan, masjid dan madrasah saja dan miskin sama-sama memiliki hak untuk mem-peroleh (bersifat konsumtif), selanjutnya diaktualisasikan pahala yang terus menerus mengalir dari Allah Swt. kepada pemanfataan yang lebih luas dan bersifat Reaktualisasi produktif. Dengan keunikan dan keistimewaan ibadah wakaf Pemanfaatan harta wakaf yang lebih luas seperti dikemukakan di atas, ibadah wakaf berpotensi maksudnya harta wakaf digunakan untuk besar digunakan untuk membangun umat. Ibadah wakemaslahatan umat yang lebih luas. Innovasi kaf dapat lebih diberdayakan membangun umat apabila pemanfaatan wakaf untuk kemaslahatan umat dilakukan reaktualisasi terhadap pemahaman sebenarnya sudah semenjak lama dilakukan, sudah konvensional yang menyelimuti masyarakat selama ini. banyak negara mendayagunakan ibadah wakaf untuk Reaktualisasi pemahaman tersebut utama sekali memenyokong program-program yang bertujuan untuk nyangkut objek wakaf dan pemanfaatan serta pekesejahteraan umum. Bahkan banyak negara yang ngelolaan harta wakaf. telah mengembangkan wakaf secara produktif, Reaktualisasi pemahaman terhadap objek wakaf misalnya Mesir, Turki, Yordan, Singapura telah perlu dilakukan, mengingat umumnya masyarakat memanfaatkan wakaf untuk mengembangkan dan memahamkan bahwa yang dapat menjadi objek wakaf memajukan pendidikan, kesehatan, pengentasan ialah harta benda yang tidak bergerak, yaitu dalam kemiskinan, peningkatan ekonomi, penelitian dan bentuk tanah dan/atau bangunan saja. Padahal tidak aktivitas-aktivitas lain yang memberi manfaat besar ada satu dalil hukum dalam Alquran maupun Al-Hadis kepada umat Islam. Pemanfaatan wakaf seperti di atas yang menyatakan secara limitatif bahwa objek wakaf dapat dilakukan apabila pengelolaan wakaf hanya terbatas kepada tanah dan bangunan saja. dilaksanakan secara produktif. Dengan demikian, persoalan wakaf tergolong kepada Untuk pengelolaan harta wakaf secara produktif persoalan ijtihadiyah. Artinya persoalan yang dapat dilakukan dengan innovatif, misalnya wakaf dalam berpeluang dilakukan pengembangan dan innovasi bentuk bangunan yang tidak digunakan untuk masjid pemikiran untuk praktek pengamalannya. dan sekolah digunakan untuk swalayan mini, pertokoan, Oleh karena persoalan wakaf merupakan persoalan perbengkelan. Apabila wakaf tersebut dalam bentuk ijtihadiyah, dapat dilakukan reaktualisasi pemahaman tanah di kawasan strategis, dibangun sebagai tempatterhadap objek wakaf. Apabila selama ini pemahaman tempat kegiatan produktif, seperti pertokoan, ruang masyarakat umumnya bahwa objek wakaf hanya terbatas pertemuan, lahan perparkiran. Sedangkan yang tidak kepada harta dalam bentuk harta tetap/tidak bergerak berada di kawasan strategis dipergunakan untuk ke(tanah dan bangunan), kemudian diaktualisasikan giatan agrobisnis, peternakan dan perkebunan. Apabila sehingga meliputi seluruh harta tidak tetap/bergerak. Ini harta wakaf dikelola secara produktif, tentu harta wakaf sejalan dengan ketentuan yang terdapat dalam Undangakan dapat menjadi sumber pendanaan secara berteUndang Nomor 41/2004 tentang Wakaf yang mengerusan untuk keperluan kemaslahatan umat Islam. mukakan bahwa objek wakaf itu terdiri dari benda tidak Khusus dalam bidang ekonomi, dana wakaf dapat bergerak dan benda bergerak. dijadikan sebagai modal untuk berjamaah dalam keObjek wakaf benda bergerak dalam Undang-Undang giatan ekonomi. Apabila umat Islam berjamaah dalam tentang Wakaf, meliputi uang, logam mulia, surat berbidang ekonomi, tentu Allah swt akan memberikan harga, kenderaan, hak atas kekayaan intelektual, hak sewa, rahmat. Apabila kegiatan ekonomi mendapat rahmat dan benda bergerak lain sesuai dengan ketentuan syariah Allah swt tentu hasil yang diperolehpun akan berkah, dan peraturan perundangan yang berlaku. Khusus wakaf berkeadilan dan pada gilirannya akan melahirkan uang memiliki posisi yang sangat strategis, karena uang kesejahteraan kepada umat. Semoga!. berperan dalam lalu lintas perekonomian. Selain itu, de-

WASPADA Jumat 6 Januari 2012

Mimbar Jumat


Menatap Masa Depan Islam Indonesia

Safar Bulan Sial Versi Jahiliyah (3) Kita tidak boleh beramal dengan perkara-perkara ala jahiliyah karena pasti ditolak kerena termasuk bid’ah dhalalah. Maka beramal dengan perkara-perkara bid’ah dhalalah adalah haram hukumnya. Banyak kepercayaan dan amalan-amalan yang berkembang berkaitan dengan bulan Safar di berbagai daerah dan kaum-kaum tertentu semestinya ditinggalkan. Kita dalam beribadah wajib mengikuti Al-Quran dan hadis. Amal ibadah yang tidak diperintahkan dan dicontohkan Rasul tidak akan diterima oleh Allah SWT alias mardud (tertolak) sebagaimana sabdanya: “Barangsiapa membuat suatu perkara baru dalam agama kami ini yang tidak ada asalnya, maka perkara tersebut tertolak.” (HR. Bukhari dan Muslim). Adapun amalan yang tertolak itu termasuk khurafat (tahayul, mitos, dongeng). Khurafat adalah salah satu bentuk penyelewengan dalam akidah Islam. Salah satunya, khurafat berkenaan dengan bulan Safar yang dianggap negatif. Memang pada zaman jahiliyah, ada kepercayaan bahwa bulan Safar adalah bulan sial. Kepercayaan atau mitos/tahayul tersebut langsung dibantah oleh Rasulullah SAW. Salah satu amalan khurafat yang pernah muncul ialah “Pesta Mandi Safar”. Jika tiba bulan Safar, umat Islam di sejumlah daerah tertentu di Jawa mengadakan upacara mandi beramai-ramai dengan keyakinan hal itu bisa menghapuskan dosa dan menolak bala. Biasanya, amalan mandi Safar ini dilakukan pada hari Rabu minggu terakhir dalam bulan Safar yang diyakini merupakan hari penuh bencana. Amalan mandi Safar untuk tolak bala dan menghapus dosa itu merupakan kepercayaan penganut agama non-Muslim sehingga tidak perlu ditiru. (Dikutip dari berbagai sumber hadis shahih).

Misi Alquran Dan Harian Waspada Dalam Mencerdaskan Masyarakat Oleh Watni Marpaung, MA Dosen Fakultas Syariah IAIN-SU Medan


acalah dengan menyebut nama tuhan-Mu siyah mengindikasikan bahwa tradisi baca tulis yang telah menciptakan(Qs. Al-Alaq: 1). Surat di kalangan umat Islam sudah berlanjut deal-Alaq di atas merupakan wahyu pertama kali ngan baik yang pada saat itu dunia Barat yang yang diturunkan Allah kepada Muhammad Rasu- dikenal dewasa ini sebagai pusat ilmu pengelullah Saw. Suatu hal yang cukup apresiatif bahwa tahuan masih dalam kegelapan. Dalam rentetan kitab thabaqat seputar kehidupan Alquran membawa misi pencerdasan dan mengenpara ulama klasik yang masyhur terkait dengan taskan kebodohan seluruh umat manusia. Iqra’ ada-lah kata pembuka pada surat al-Alaq produktivitas membaca dan menghasilkan karyatersebut, yang memerintahkan untuk memba- karya besar, misalnya, ibn Taymiyah, ibn khaldun, ibn ca. Senada dengan itu, Waspada sebagai se- Hajar al-Asqalani dan banyak ulama-ulama lainnya buah media massa nomor wahid di Sumatera yang jika dibandingkan dan dihitung umur mereka Utara yang telah berkiprah selama 65 tahun, se-ti- dengan hasil karya-karya yang mereka hasilkan daknya telah mengambil peran strategis dari mi- terkadang tidak cukup umur mereka untuk mengsi Alquran yang cukup mendasar terhadap ke- hasilkan karya-karya monumental tersebut. Namun, cukup disayangkan belakangan terjadi butuhan hidup manusia. Dikatakan Waspada mengambil peran strategis tingkat penurunan di kalangan umat Islam dalam Alquran tidak dapat dipungkiri atas kontribusi Was- menyikapi tradisi baca tulis yang semestinya terus pada yang telah memberikan pencerahancerdasan dikembangkan dan dijaga. Sementara itu, dunia Barat terhadap masyarakat mulai dari pemberitaan yang cukup signifikan melakukan penelitian, perbukuan, penerbitan, desifatnya umum ngan mengemsampai pada perbangkan semabincangan dan Satu pesan yang perlu ditangkap dari ngat baca tulis diskusi agama yang sekali lagi dalam kolom serefleksi Hut Waspada 65 pada momen perlu ditegaskan tiap hari jum’at. ini adalah dengan mengintrospeksi diri merupakan spirit Bahkan, Waspada dari Alquran. Di telah mampu mekita masing-masing sejauh maka tengah-tengah lakukan sti-mulus kecintaan pada tradisi membaca masyarakat mibagi masyarakat salnya, para usmuslim khu-sustadz, muballigh, nya dengan artikel keagamaan dalam melihat realitas kera-gaman penceramah dan sebagainya lebih cenderung dengan pendapat dan pemahaman dalam Islam untuk budaya oral (penyampaian dengan lisan) saja. Memang dalam rentetatan ulama di Indonesia selanjutnya menyadarkan harus punya kemampuan untuk melihat perbedaan pendapat bukan misalnya hanya beberapa orang saja yang mampu sebuah hal yang jelek dan ditakuti tetapi meru- mengembangkan agama ini dengan budaya oral pakan khazanah yang perlu dipelihara dan dikem- sekaligus tulis misalnya Hamka, Endang Saifuddin bangkan dalam membangun peradaban yang Anshari, Abdul Halim Hasan Al-Binjai, Arsyad Thalib Lubis, dan sebagainya. Padahal, Alquran mecerdas dan dinamis. Oleh karena itu, setidaknya, pesan Alquran yang nuntun menggabungkan mengembangkan dakwah cukup urgen dalam ayat di atas memberikan catatan Islam tidak hanya dengan budaya oral tetapi juga penting bahwa dunia surat kabar, perbukuan dan dengan tulisan. Satu pesan yang perlu ditangkap dari refleksi Hut sejenisnya satu hal yang sangat menentukan bagi kelanjutan dan perkembangan suatu peradaban. Waspada 65 pada momen ini adalah dengan Tingginya Peradaban Yunani dengan para filosofnya, mengintrospeksi diri kita masing-masing sejauh peradaban Cina, Mesir, dan sebagainya terus eksis maka kecintaan pada tradisi membaca. Jika ada katasehingga diketahui umat manusia belakangan kata bijak “buku adalah jendela dunia”, tidak salah dikarenakan tercatat dalam untaian buku sejarah. Jika kiranya menyebut “surat kabar adalah jendela dunia” tidak, dapat dipastikan setinggi apa pun suatu karena setidaknya menekankan urgensitas dan maha peradaban hanya bersemayam dalam pikiran orang- pentingnya membaca dalam kehidupan ini. Jika ingin mengetahui sejarah dunia yang cukup orang tertentu tidak akan bertahan dan berkesinamtua ini dengan beragam pengalamannya dari mulai bungan sampai dewasa ini. pergantian generasi umat, ilmu pengetahuan, toMotivasi AlquranDalam Membaca Setidaknya, dalam surat al-Alaq ayat 1-5 yang koh, kejadian-kejadian yang maha dahsyat dan diturunkan pertama kali terdapat dua kata yang perlu sebagainya kuncinya terletak pada bacaan kita madirenungkan untuk menunjukkan Alquran datang sing-masing. Setinggi apa pun gelar akademis yang tidak saja untuk mengubah sebuah perilaku diperoleh seseorang sampai profesor (guru besar) masyarakat jahiliyah secara akidah, dan akhlak tanpa terus membaca akan menjadi menurun tingterhadap Tuhan, tetapi lebih jauh lagi untuk mengen- kat kualitasnya baik dalam pengayaan khazanah, taskan kebodohan tidak pandai baca, dan menulis. analisis, perspektif, dan sebagainya. Oleh sebab itu, perlu ditumbuh kembangkan Dalam literatur sejarah masyarakat Arab pada saat itu memang banyak yang ‘ummi” tidak pandai baca budaya minat baca kita pada semua lapisan mulai dari anak-anak sampai orang tua, terlebih lagi pada dan menulis. Dua kata pada rangkaian ayat di atas adalah masa-masa sekolah. Semakin membaiknya tingkat kata “iqra’” dan kata “al-qalam”. Iqra’ adalah kata minat baca tentunya punya pengaruh baik pula yang menuntut untuk membaca, sedangkan al- kepada pengembangan Sumber daya manusia qalam maknanya pena, yang secara eksplisit dalam (SDM) masyarakat Indonesia. Mungkin lebih khukonteks kekinian alat yang digunakan untuk me- sus bagi insan akademis mahasiswa, dosen dan nulis. Setidaknya, dari dua kata tersebut sudah sa- sebagainya perlu menginventaris buku yang menngat jelas sekali bagi siapa pun yang membaca Al- dukung dalam pengembangan keilmuan berapa quran khususnya umat Islam untuk memberikan banyak yang dapat dibeli setiap bulannya, dan apresiasi yang cukup tinggi dengan konsep yang bukan sebaliknya mencukupkan yang sudah lama dibawa Alquran dengan menggiatkan tradisi mem- dan terus produktivitas dalam menuangkan gagasan briliannya untuk dunia. baca dan menulis. Pada hakikatnya pesan Alquran yang cukup Kesimpulan tinggi tersebut telah ditangkap dan diaplikasikan Surat al-Alaq di atas dalam kaitannya dengan dengan baik Rasulullah, para sahabat, sampai para tabi’in. Penulisan Alquran, penulisan Hadis Rasul, peranan Waspada yang telah berkiprah 65 tahun penulisan kitab-kitab dalam berbagai disiplin ilmu, dalam pencerdasan masyarakat merupakan momisalnya, fikih, ilmu kalam, tasawuf, tafsir, dan men penting untuk kembali menyadarkan kepada yang lainnya merupakan bukti nyata bahwa ge- seluruh masyarakat betapa pentingnya tradisi memnerasi awal dapat menangkap pesan Alquran sepu- baca dalam kehidupan. Semoga Waspada terus tar tradisi baca tulis. Bahkan, pendirikan pustaka eksis mengusung misi pencerdasan dan penceraksasa Bait al-Hikmah pada masa Dinasti Abba- rahan umat yang menjadi misi Alquran.

Oleh Azhari Akmal Tarigan Dosen Fakultas Syari’ah IAIN.SU.


eberapa waktu yang lalu, saya dikirimi email dari senior saya di Fakultas Syari’ah IAIN.SU. untuk lebih jelasnya, email dari Dr Zainul Fuad tersebut saya kutipkan seperti di bawah ini. Keislaman Indonesia (Komaruddin Hidayat). Sebuah penelitian sosial bertema “How Islamic are Islamic Countries” menilai Selandia Baru berada diurutan pertama negara yang paling Islami di antara 208 negara, diikuti oleh Luxsemburg di urutan kedua. Sementara Indonesia yang mayoritas penduduknya muslim menempati urutan ke 140. Adalah Scheherazade S Rehman dan Hossein Askari dari The GeorgeWashington University yang melakukan penelitian ini. Hasilnya dipublikasikan dalam “Global Economy Journal” (Berkeley Electronic Press, 2010). Pertanyaan dasarnya adalah, seberapa jauh ajaran Islam dipahami dan memengaruhi perilaku masyarakat muslim dalam kehidupan bernegara dan sosial ? Adapun yang dijadikan indikator dalam penelitian tersebut adalah, Pertama, ajaran Islam mengenai hubungan seseorang dengan Tuhan dan hubungan sesama manusia. Kedua, sistem ekonomi dan prinsif keadilan dalam politik serta kehidupan sosial. Ketiga, sistem perundang-undangan dan pemerintahan. Keempat, hak asasi manusia dan hak politik. Kelima, ajaran Islam berkaitan dengan hubungan internasional dan masyarakat non muslim. Setelah ditentukan indikatornya, lalu diproyeksikan untuk menimbang kualitas keberisalaman 56 negeri Muslim yang menjadi anggota OKI, yang ternyata rata-rata berada di urutan ke 139 dari sebanyak 208 negara yang disurvei. Tidak kalah menariknya adalah, sahabat saya tersebut juga menuliskan tentang pengalaman UIN Jakarta. UIN Jakarta melakukan kerjasama dengan kedutaan besar Jepang di Jakarta. Kerjasama yang telah berlangsung selama enam tahun tersebut bentuknya adalah mengirim para ustaz dan Kiai ke Jepang untuk melihat kehidupan masyarakat di sana. Bagi mereka kehidupan masyarakat Jepang sesungguhnya jauh lebih Islami walaupun masyarakatnya tidak beragama Islam. Beberapa yang dijadikan indikasi adalah kebersihan, ketertiban, kedisiplinan, etos kerja dan sebagainya. Email yang dikirimkan sabahat

saya tersebut menjadi topik diskusi kami di fakultas. Tentu saja ada yang setuju dengan penelitian tersebut dan ada yang menolak dengan berbagai argumentasi. Mulai dari sisi metodologi sampai muatan ideologis dibalik dari penelitian tersebut. Jauh sebelumnya, berbagai penelitian tentang Islam Indonesia juga pernah dilakukan. Mulai dari persoalan demokrasi, HAM, Gender sampai kepada isu-isu yang berhubungan dengan ekonomi Islam. Hasilnya tidak menggembirakan sama sekali. Bagi saya masalah kita sekarang bukan memperdebatkan hasil-hasil

salah yang melingkupinya. Pernyataan ini tidak bermaksud menafikan apa yang telah dilakukan oleh sebagian umat Islam yang sungguhsungguh dengan agamanya. Mereka dengan kesadaran penuh selalu berupaya untuk menginternalisasikan nilai-nilai agama ke dalam perilaku kesehariannya. Mereka adalah orang yang kata dan perbuatan menyatu di dalam kehidupannya. Sayangya, jumlah mereka tidak signifikan. Akibatnya, suara kebenaran yang mereka pancarkan tidak memberi pengaruh yang kuat terhadap kehidupan sosial umat. Suara keikhlasan yang mereka

.. Islam Indonesia masih berhadapan dengan beragam masalah, mulai dari kemiskinan dan kebodohan, kekerasan, radikalisme agama, perilaku koruptip, dan disharmonisasi kehidupan dengan umat lain. penelitian yang telah dipublikasikan tersebut. Adalah lebih bijaksana jika kita mempelajari dan menela’ah penelitian tersebut dengan cermat. Kita bisa mengujinya, apakah hasil penelitian tersebut menggambarkan realitas kehidupan umat yang sebenarnya atau hasilnya hanya sekedar imajinasi peneliti yang memang bermaksud untuk mendiskriditkan umat Islam Indonesia. ‘Ala kulli hall, Islam Indonesia sesungguhnya sampai saat ini belum dapat tampil sebagai kekuatan moral dan spiritual dalam mendorong pembangunan Indonesia yang lebih bermartabat dan beradab. Sebaliknya Islam Indonesia masih berhadapan dengan beragam masalah, mulai dari kemiskinan dan kebodohan, kekerasan, radikalisme agama, perilaku koruptip, dan disharmonisasi kehidupan dengan umat lain. Ada kesan kuat Umat Islam Indonesia, keberagamaannya masih sebatas ritual peribadatan semata. Islam Indonesia tampak dalam upacara-upacara keagamaan dari yang bersifat nasional sampai ketingkat yang paling rendah seperti desa dan dusun. Islam Indonesia belum menjelma menjadi karakter diri umat yang tangguh. Nilai-nilai Islam belum menyatu dan selanjutnya belum pula membentuk perilaku kesehariannya. Realitas inilah yang membuat Islam Indonesia seolah-olah tak bisa keluar dari ma-

suarakan seolah tenggelam dengan suara-suara kemunafikan. Merekapun tidak berhasil mempengaruhi kekuasaan untuk istiqamah di jalan kebenaran. Demikianlah, disebabkan dengan beragam masalah tersebut, Islam Indonesia belum sepenuhnya fokus untuk membangun umat ini. Lembaga-lembaga keagamaan atau yang berlabelkan agama, sepertinya disibukkan dengan urusannya sendiri. Mereka bekerja untuk kelompoknya. Definisi umat dalam konsepsi mereka hanya terbatas kepada orangorang yang memegang kartu anggota saja. Di luar itu bukanlah umat yang harus diperhatikan dan diberdayakan. Sampai di sini, apa yang harus kita lakukan buat masa depan ? Masa depan Islam Indonesia, akan ditentukan oleh umat Islam itu sendiri. Tidak ada yang bertang-gungjawab termasuk pemerintah sekalipun terhadap masa depan umat Islam. Tidak pada tempatnya jika umat Islam menyerahkan na-sibnya pada orang atau kekuatan di luar dirinya. Hal yang penting kita lakukan saat ini adalah membangun visi bersama, visi besar keummatan dan visi kebangsaan. Keislaman dan Keindonesiaan harus integral dalam visi besar umat Islam Indonesia. Membangun visi besar keislaman itu artinya kita juga sedang membangun visi besar keindonesiaan. Bagi Umat Islam Indonesia, meme-

lihara dan membangun negara ini adalah amanah ilahiah yang harus tetap terjaga. Lembaga-lembaga keagamaan, khususnya MUI harus mengambil peran strategis. MUI sejatinya harus menjadi rumah besar umat Islam. Rumah bagi semua aliran dan golongan. MUI kendatipun pengurusnya memiliki subjektifitasnya sendiri, namun sikap organisasinya tetaplah harus menjunjung nilai-nilai kebersamaan tersebut. Keberpihakan MUI bukan pada golongan atau aliran apa lagi pada mazhab pemikiran, fikih, kalam atau tasawuf. Keberpihakan MUI pada kebenaran dan selalu harus mengacu pada kemaslahatan bangsa secara bersama-sama. Peran MUI inilah yang diharapkan dapat menyatukan gerak langkah kehidupan umat Islam Indonesia. Selanjutnya, konsepsi pembangunan umat Islam Indonesia harus lahir dari perguruan tinggi agama atau bisa juga dari non agama. Namun dalam hal ini, perguruan tinggi agama harus menjadi garda terdepan untuk melahirkan konsep dan kebijakan setrategis. Alasan yang paling mendasar dikarenakan Islam itu bukanlah agama dalam artinya yang paling sempit, yang berkenaan dengan urusan ibadah ritual semata. Islam adalah sebuah agama yang syumul (melingkupi segala aspek) dan komprehensif. Konsep pembanguan ekonomi umat atau kesejahteraan umat harus bisa dilahirkan oleh perguruan tinggi agama, apakah UIN, IAIN.SU atau juga STAIN dan lain-lain. Kerja selanjutnya adalah bagaimana mengimple-mentasikan konsep tersebut dalam bentuk program yang nyata dan berkelanjutan. Disebabkan keterlibatan umat Islam menjadi niscaya, maka upaya-upaya yang berkaitan dengan penyadaran umat menjadi penting untuk selalu diprioritaskan. Sikap dan perilaku keberagamaan tidak akan lahir tanpa sebab. Satu-satunya faktor yang dapat membuat perilaku umat sesuai dengan apa yang dikehendaki agamanya, adalah melalui pendidikan. Sama ada pendidikan yang formal ataupun yang non formal. Bagi saya, tanpa ada upaya-upaya yang konkrit untuk membangun umat Islam ini, rasanya sulit kita menatap masa depan Islam Indonesia dengan rasa penuh percaya diri. Semoga.

Orang Jepang Mengamalkan Banyak Ajaran Islam (Refleksi Exposure Visit di Jepang) OlehProf. Dr. H. Ramli Abdul Wahid, MA


ulisan ini tidak bermaksud memperinci hasil kunjungan Exposure Visit,17-22 Desember 2011 lalu ke Jepang, tetapi akan mengungkap sisi lain kehidupan seharihari orang Jepang yang ternyata banyak yang sesuai dengan ajaran Islam. Jepang adalah Negara yang berpenduduk 120 juta jiwa, letaknya di di Asia Timur, tapi kemajuannya seperti negara-negara Eropa barat. Meskipun bangsa Jepang mayoritas beragama Budha, tapi perbuatan mereka sehari-hari banyak yang serupa dengan ajaran Islam. Misalnya tentang kejujuran, kebersihan, disiplin waktu, kesopanan, kepatuhan pada peraturan, rasa malu, kerja keras dan perfect, rasa tanggung jawab, dan perhatian pada pendidikan anak. Ada tiga filsafat hidup orang Jepang yang mereka tanamkan pada anak-anak mereka secara serius, yaitu jujur, taat peraturan, dan tidak menyusahkan orang lain. Ini semua jelas adalah ajaran Islam. Nabi pernah bersabda yang artinya, “Jangan berdusta.” Dalam Alquran diperintahkan agar orang Mukmin menunaikan amanah dan jangan mengkhianati amanat. Dalam sabdanya Rasul berkata yang artinya, “Orang Muslim adalah orang-orang Islam yang selamat dari lidah dan tangannya.” Sebagai contoh dari kejujuran orang Jepang adalah ketika delegasi hendak mengambil taksi untuk sembilan orang, taksi kecil yang muatnya hanya empat orang menolak sambil mengisyaratkan agar mengambil taksi yang besar yang muat tujuh orang penumpang sedang ongkosnya sama. Orang Jepang tidak hanya jujur pada orang lain, tapi juga jujur pada dirinya dengan segala resikonya. Orang Jepang juga memiliki rasa malu dan tanggung jawab yang tinggi. Karena itu, bila mereka gagal dalam menjalankan suatu amanah jabatan, mereka melepaskan jabatan itu. Bahkan dalam bentuk kejujuran ekstrem dan fatal tidak sedikit terjadi pada orang Jepang. Jujur, amanah, malu, tanggung jawab, bekerja keras dan

perfect (bekerja secara sempurna), semuanya ajaran Islam yang sejak dini telah diajarkan dalam masyarakat Islam. Dalam sebuah hadis disebutkan yang artinya, “Apabila seseorang dari kamu beramal, maka hendaklah ia menyempurnakan amalnya.” Ini adalah perintah untuk berbuat secara perfect (sempurna).

man, kareta nya tidak ribut seperti kereta di Indonesia, jalannya mulus seperti tak terasa bergerak. Jadwalnya tepat pada setiap stasiun. Tidak seperti di Indonesia, jadwal pesawatnya pun selalu ditunda. Pembelian tiket kereta api semua melalui alat automatik dan pemeriksa tiket pun semua melalui alat sen-

..Orang Jepang belajar dari semut. Orang Islam mempunyai surat an-Naml (semut) di dalam Kitab Sucinya Alquran, tapi tidak belajar dari kehidupan semut. Orang Jepang tidak mempunyai surat an-Naml. Taat peraturan menjadi fenomena dalam masyarakat Jepang. Lampu merah, baik untuk kenderaan maupun pejalan kaki tidak pernah dilanggar sehingga semua berjalan dengan tertib. Kebersihan fenomena lain. Jalan, trotoar, stasiun kereta api, terminal-terminal, hotel, swalayan, kedai, dan sungai-sungai semua bersih. Hal menarik lain, bahwa di hotel atau restoran, pembeli atau tamu sendiri yang mengumpul piringnya di tempat bekas piring dipakai, dan meletakkan sampah pada tempatnya. Ini mungkin dalam kaitannya dengan filsafat hidup Jepang tidak menyusahkan orang lain Jalan dan lalu lintas di Jepang sangat lancar dan tertata dengan baik. Penduduk kota Tokyo 25 juta jiwa, tapi jalan-jalan di kulit bumi lancar dan tidak pernah macet. Rupanya orang Jepang berkeliaran di dalam perut bumi dengan kereta api. Stasiun kereta api di Tokyo itu mempunyai jaringan rel berlapis-lapis dan berlingkar-lingkar di dalam perut bumi seperti jalan-jalan semut. Untuk mendapatkan jalur kereta api menuju kota tertentu, penumpang harus naik lewat 33 anak tangga atau turun sampai 400 meter. Tapi semua bersih, rapi dan informasi lengkap secara tertulis, baik pada tembok stasiunnya maupun di dalam gerbongnya. Satu kereta bisa menarik sampai 14 gerbong dan selalu penuh. Kereta apinya jalan cepat bisa mencapai 360 km perjam. Tapi, penumpang merasa nya-

sor automatik. Di Tokyo tidak ada angkot, tidak ada becak, tidak ada busway. Bus kota pun tidak banyak. Kendaraan jalan di kulit buminya banyak taksi, tapi geraknya lancar. Nampaknya orang Jepang belajar dari semut. Orang Islam mempunyai surat an-Naml (semut) di dalam Kitab Sucinya Alquran, tapi tidak belajar dari kehidupan semut. Orang Jepang tidak mempunyai surat an-Naml, tapi belajar dari jalan semut melalui ayat-ayat kauniyah (ayatayat kosmos) Seharusnya anak cucu Adam berusaha mengolah bumi menjadi seperti sorga. Nabi Adam disinggahkan ke sorga agar mengetahui tugasnya membangun bumi menjadi sorga. Di sorga hidup nikmat karena penuh dengan fasilitas dan kemudahan. Agar bumi menjadi sorga, manusia harus menciptakan berbagai kemudahan dan fasilitas di bumi, termasuk jalan dan sistem lalu lintas. Orang Jepang telah menjalankan sebagian tugasnya sebagai khalifah untuk menciptakan sorga dunia. Orang Islam, termasuk yang tinggal di kota Medan yang penduduknya hanya dua juta jiwa belum melakukan tugasnya dengan baik. Di Tokyo tidak ada orang yang merokok dan makan sambil jalan. Kalau hendak merokok, orang berhenti di pojok-pojok. Itu pun tidak banyak orang yang merokok, Di sana juga tidak ada kelihatan orang pacaran. Pergaulan laki-laki dan perempuan tampak sopan. Kalau hendak paca-

ran ada tempat khusus. Di siaran televisi juga sepanjang pengamatan penulis tidak ada acara peluk-pelukan atau cium-ciuman antara laki-laki dan perempuan. Penampilan orang Jepang sangat berbeda dengan orang Eropa dan juga dengan orang Indonesia. Orang Jepang banyak yang naik sepeda. Trotoar banyak sepeda parkir. Berbagai sudut di Kampus Tokyo University banyak sepeda parkir. Beda dengan kampus-kampus di Indonesia, tidak kelihatan sepeda karena mahasiswanya malu naik sepeda. Orang Jepang juga suka jalan sampai tiga dan empat Kilometer. Orang Jepang mengambil teknologi barat, tetapi tidak mengambil pergaulan bebasnya. Orang Jepang berusaha mempertahankan kesopanan dan tradisi ketimurannya. Perkawinan di Jepang pun masih ada yang dijodohkan keluarga. Dalam usaha mempertahankan filsafat ketimuran ini orang Jepang tidak tanggung-tanggung. Seorang ibu tidak boleh bekerja sebelum anaknya tamat SMA. Di Jepang, pendidikan anak dikembalikan kepada orang tua. Sekolah hanya pendukung. Ibu-ibu berkumpul mendidik dan menanamkan nilai-nilai ketimuran. Karena itu, perempuan yang mengutamakan karir memilih tidak kawin atau kawin dengan laki-laki yang siap tidak mempunyai anak. Akibatnya, pertumbuhan penduduk Jepang menurun sehingga diperkirakan pada tahun 2020 akan ada Perguruan Tinggi yang tutup karena kurangnya orang Jepang yang usia mahasiswa pada waktu itu. Untuk mengantisipasi itu dan dalam rangka internasionalisasi Perguruan Tinggi di Jepang, Pemerintah Jepang me-nyediakan banyak beasiswa bagi orang asing, terutama di bidang kedokteran dan teknik. Orang Jepang telah banyak melaksanakan tugas kekhalifahannya, orang Islam masih sibuk dengan perpecahannya, korupsinya, paham sesatnya, kebodoh-annya, dan kemiskinannya. Orang Jepang mengamalkan banyak akhlak dan muamalah Islam, sementara orang Islam mengabaikannya.

Mimbar Jumat


WASPADA Jumat 6 Januari 2012

Operasi Cesar Dalam Kepustakaan Awal Islam Kepustakaan Arab berasal dari Al-Biruni yang meninggal pada tahun 1048 pada usia 78 tahun. SEJUMLAH sejarah-wan medis pada pertengahan abad lalu keliru mencatat bahwa operasi cesar dilarang keras di kalangan Muslim. Opini tersebut berulangkali diungkapkan tanpa meneliti keb-naran atau keabsahannya. Pada tahun 1863, salah seorang sejarahwan C. Rique menulis tentang peraturan medis di Arab. Dia menyebutkan operasi cesar dilarang keras oleh Sidi Khalif, yang pendapatnya sangat dipatuhi di kalangan umat Muslim. Rique tidak perduli tentang latar belakang Sidi Khalif, yang tidak dikenal dalam kepustakaan Arab. Sayangnya, pendapat Rique ini sering dikutip untuk mewakili kisah sejarah medis Arab. Penelitian yang dilakukan atas sejumlah sumber kuno Arab yang ada malah mengantarkan kita pada bukti yang sangat bertolak belakang dengan pendapat para sejarahwan tersebut. Para ilmuwan Islam pada abad pertengahan, kenyataannya, merupakan pihak pertama yang bukan hanya menulis tentang proses operasi cesar tapi juga mengilustrasikan dalam bentuk gambar dan menjabarkannya dalam puisi. Mengingat proses operasi tersebut termasuk kuno untuk masa sekarang, tidak pas untuk membandingkan dengan proses operasi modern, namun apa yang mereka capai harus diakui dan dihargai. Sebenarnya untuk mempelajari sejarah medis masa itu penting untuk diingat bahwa kita bicara tentang periode lebih setengah abad sebelum Kebangkitan Eropa. Profesor Ullmann, seorang penulis sejarah medis Arab mengungkapkan “Medis Islam adalah disiplin ilmu yang diterapkan di masa tidak mengenal kebangkitan dan pencerahan,

jadi tidak seharusnya diperbandingkan dengan sejarah disiplin ilmu Eropa’. Pandangannya itu semakin kuat ketika operasi cesar ternyata menjadi hal kontroversial di Eropa sampai abad ke 18, Dan operasi cesar pertama berhasil dilakukan di Inggeris pada tahun 1793. Karena kurangnya sumber informasi – karena buku-buku tentang sejarah medis kuno Arab jumlahnya langka dan tidak digali , sejumlah sejarahwan membuat tulisan berdasarkan sejarah medis yang tidak ada kaitannya. Kepustakaan yang relevan tentang sejarah medis Arab bukan hanya sedikit jumlahnya, tapi juga berserakan, dan tidak diterbitkan. Namun terlepas dari kekurangan-kekurangan ini, jika kita benar-benar meneliti ilmu yang berkembang di periode awal kejayaan Islam, kita akan sampai pada bukti meyakinkan tentang operasi cesar ini. Bukti ini memaksa kita untuk mengulas argument dan sampai pada kesimpulan bahwa operasi cesar sudah dikenal di Arab, dan mereka menulis tentang itu dan mempraktekkannya. Bukti Dari Sumber Sejarah Islam Bukti paling penting, paling berharga dan paling jelas tentang operasi cesar dalam kepustakaan Arab berasal dari Al-Biruni yang meninggal pada tahun 1048 pada usia 78 tahun. Dia adalah pengarang banyak buku tentang sejarah, medis dan filosopi. Salah satu naskahnya yang unik dikenal berjudul AL-Athar al-Baqiyah ‘an al-Qurun al-Khaliyah. Naskah tersebut terdapat di Universitas Edinburgh. Naskah tersebut diterbitkan dan diterjemahkan ke dalam bahasa Jerman dan Inggeris oleh Profesor E. Sachau pada tahun 1879. Dalam kronologi sejarah negara, Al-Biruni membuat tiga referensi tentang operasi cesar.

Satu halaman dari Shahnama karya Firdousi memperlihatkan kelahiran seorang bayi lewat operasi cesar. Dia menulis bahwa Kaisar Augustus lahir lewat operasi cesar. Al-Biruni juga menyebutkan bahwa Ahmad Ibnu Sahl, seorang pemimpin revolusi melawan penguasa Samanid, Nasr II, lahir lewat operasi cesar. Satu bukti yang paling penting dan unik ditemukan dalam satu dari 24 gambar pada naskah tersebut. Gambar ini memberi gambaran jelas tentang operasi cesar dan

merupakan buku ilustrasi pertama yang diketahui menjelaskan operasi itu. Pada periode yang sama, Firdousi (935 -1025), seorang penyair Persia yang terkenal, merampungkan Sahnama. Dalam epik terdiri dari 60.000 bait itu dia dengan jelas menggambarkan proses operasi cesar. S elain member ikan gambar an ber war na dan menar ik

tentang operasi ini, dia juga meny ebutkan penggunaan anaesthesia (pembiusan) dalam operasi itu. Bukti Tak Jelas Banyak referensi keagamaan yang masih murni dikumpulkan oleh seorang pengarang asal Jerman dalam makalah singkat yang mendukung pendapat bahwa operasi cesar tidak per nah dilarang oleh penguasa Muslim. Referensi

paling penting yang dikutip pengarang ini berasal dari Abu Hanifa (699-767), seorang ahli hukum Islam yang sangat dihormati, yang menyatakan operasi cesar diijinkan untuk dilakukan pada wanita hamil yang masih hidup atau pun sudah meninggal dunia. Dar i penjelasan di atas, pendapat sejumlah pengarang yang menyatakan operasi cesar dilarang di masa kejayaan

Islam dibuat berdasarkan bukti yang tidak bisa dipercaya. Penelitian terhadap kepustakaan yang telah diterbitkan dan diterjemahkan mendukung pandangan bahwa penguasa Muslim dan ilmu medis di saat itu merupakan yang pertama kali menyebutkan tentang operasi cesar dalam bentuk teks dan puisi dan bahkan mengilustrasikannya dalam bentuk gambar. - Syafri/Muslimhc

Catatan Road To Dakwah 65 Tahun Waspada Di Lhokseumawe Kegiatan Catatan Road To Dakwah 65 Tahun Waspada kali ini digelar di Masjid Agung Islamic Center Lhokseumawe Kamis (9/12) siang. Hadir dalam kesempatan itu Pemimpin

Umum Harian Waspada Dr Hj. Rayati Syafrin, Wali Kota Lhokseumawe Munir Usman. Hadir juga Ketua Litbang Waspada H.Amkal AZ, anggota H. Syarufiddin El-Hayat, dan

Hj.Erma Tarigan serta panitia lokal di Aceh. Tausyiah agama disampaikan Tgk H Jamaluddin. Menurut Bustami. Berikut reka-man lensa kegiatan dakwah tersebut. Foto-fotoWaspada/ Muhammad Faisal

Ekspresi anak-anak.

Kegiatan tabligh akbar Road To Dakwah 65 Tahun Waspada. Para anak yatim berbaris berdiri sebelum menerima bingkisan dalam kegiatan Road To Dakwah 65 Tahun Waspada.

Anggota tim Litbang Waspada H.Syarifuddin ELhayat didampingi Ka Litbang H.Akmal AZ menyalami penerima bingkisan Road To Dakwah 65 Tahun Waspada.

Foto bersama Pemimpin Umum Harian Waspada Dr Hj.Rayati Syafrin bersama rombongan tim Litbang Waspada dan perwakilan masjid penerima bingkisan dari Harian Waspada Medan.

Pemimpin Umum Harian Waspada bersama rombongan ketika disambut sebelum memasuki masjid tempat pelaksanaan tabligh akbar Road To Dakwah 65 Tahun Waspada.

Waspada, Jumat 6 Januari 2012