Page 1

Shalat Jumat Di Mana? Masjid Raya Medan

Lihat hal. C4 Dan C5

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Wage, 29 Juni 2012/9 Sya’ban 1433 H

No: 23910 Tahun Ke-66

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,-

ITALIA-SPANYOL DI FINAL WARSAWA (Waspada): Mario Balotelli! Itulah aktor utama bagi kesuksesan Italia menumbangkan Jerman sekaligus memastikan tiket final Euro 2012. Di laga semifinal yang digelar di Warsawa, Jumat (29/6) dinihari, Gli Azzurri menang 2-1. Dengan demikian, Italia menang atas Der Panzer untuk ke-15 kali. Kemenangan terakhir Jerman atas Gli Azzurri terjadi 17 tahun silam dalam laga persahabatan di Zurich, pada 21 Juni 1995. Saat itu, Jerman menang dengan dua gol tanpa balas. Namun ceritanya berbeda di pentas Euro 2012. Tanpa diduga sebelumnya, keperkasaan Jerman dipatahkan oleh Balotelli yang memang tampil lain dari biasanya. Kali ini, Balotelli bermain gemilang dan menjawab kritik yang kerap ditujukan dengan dua gol ke gawang Manuel Neuer. Semua mata tertuju kepada Balotelli begitu penyerang Manchester City ini mencetak gol pertama di menit 20. Keasyikan menyerang, pertahanan Jerman lengah. Hal itu kemudian dimanfaatkan Italia untuk lebih dulu mencetak gol. Lolos dari penjagaan Holger Badstuber, Balotelli langsung menyambar bola hasil umpan Antonio Cassano dengan sundulan keras .

Setelah nyaris mencetak gol, Jerman justru kecolongan gol kedua kali. Kali ini, serangan balik cepat yang dibangun Riccardo Montolivo membuat Philipp Lahm sendiri mengawal Balotelli. Umpan panjang Montolivo pun dikuasai Balotelli yang lolos offside untuk kemudian melepaskan tendangan keras ke pojok kiri atas Neuer. Terus menyerang tanpa kenal lelah, Jerman akhirnya mendapatkan gol penghibur dari titik putih di masa injury time.Wasit Stephane Lannoy menganggap Federico Balzaretti handsball, sehingga Der Panzer mendapat hadiah penalti. Sayang, gol Mesut Ozil terkesan percuma karena sisa waktu dua menit tidak cukup bagi Jerman mengejar ketinggalan. Di final yang akan digelar di Kiev pada Senin (2/7) dinihari, Italia sudah ditunggu juara bertahan Spanyol. Sebelumnya, Iker Casillas cs lolos berkat kemenangan adu penalti atas Portugal. (m33)

L-300 Masuk Jurang Danau Toba 8 Orang Tewas, 2 WN Malaysia

BINTANG Italia, Mario Balotelli (kanan), mencetak dua gol ke gawang Jerman yang dikawal Manuel Neuer dalam semifinal Euro 2012 di Warsawa, Jumat (29/6) dinihari WIB.-Reuters-

Dua Kapal Nelayan Disandera

TNI AL Tembak Mati Gembong Lanun Di Perairan Pulau Pandan TANJUNGBALAI (Waspada) : Dua kapal nelayan penangkap kepiting KM Asahan Indah dan KM Anugerah I masingmasing bertonase 6 gross ton (GT) dirompak dan disandara kawanan bajak laut (lanun) di Perairan Pulau Pandan, Rabu (27/6). Tidak ada korban jiwa maupun luka-luka dari anak buah

kan itu tentunya diperlukan dukungan dari seluruh masyarakat dengan mencintai dan membeli hasil produk dalam negeri,” kata Bayu saat membuka Pameran Produk Dalam Negeri Regional dan Pangan Nusa ke7 Tahun 2012 di Lapangan Merdeka Medan, Kamis (28/6). Dijelaskan Bayu, 2011 konsumsi rumah tangga menyumbang 54,6 persen atau Rp7.427,1 triliun ke Produk Domestik Bruto (PDB), sehingga kontribusi konsumsi rumah tangga terhadap perekonomian

meresahkan dan target operasi TNI AL, Polair dan Polres dari Aceh hingga Tanjungbalai. Kedua temannya M Nur, 34 dan M Taufik, 27, warga Kuala Tanjung, Batubara selamat dan menjalani pemeriksaan intensif di Mako Lanal TBA Baganasahan. Komandan Pangkalan TNI Angkatan Laut TanjungbalaiAsahan (Dan Lanal TBA) Letkol (P) Horas Wijaya Sinaga, Kamis (28/6) menjelaskan kronologi kejadian berawal saat sejumlah nelayan beraktivitas sebagaimana biasa.Waktu itu, kapal dengan 10 orang ABK sedang mencari kepiting di wilayah Perairan Pulau Pandan, Selat Malaka. Tiba-tiba, sebuah sampan dengan sejumlah orang mendekat ke KM Asahan Indah yang sedang menarik jaring. Tiga orang, dua di antaranya dilengkapi senjata api jenis pistol rakitan melompat ke KM Asahan Indah dan menyikat seluruh barang berharga. Para perompak memaksa nakhoda KM Asahan Indah mendekati KM Anugerah I untuk melakukan perompakan berikutnya.

Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 1

kapal (ABK), tetapi beberapa peralatan radio dan GPS sempat dirampok. Sementara, di saat upaya penyelamatan oleh TNI Angkatan Laut Lanal Tanjungbalai Asahan, seorang dari tiga perompak bernama Robot warga Marelan, Medan, tewas tertembak. Robot, 33, asli Aceh itu disinyalir gembong perompak yang

Medan Agar Bentuk Atase Perdagangan Antardaerah Waspada/Rolike Napitu

SEORANG warga memperhatikan mayat korban penumpang mobil L300 yang hancur berkeping-keping akibat jatuh ke jurang Batu Gantung, Danau Toba, Parapat. PEMATANGSIANTAR (Waspada): Delapan orang tewas, dua di antaranya warga Malaysia, empat lainnya luka berat dan ringan ketika mobil penumpang Taxi Kita Bersama (TKB) jenis Mitsubishi L300 BK 1170 XO terjun ke jurang sedalam 150 meter dan tersangkut di tepi Danau Toba di Desa Sibaganding, Kec. Girsang Sipanganbolon, Kab. Simalungun Kamis (28/6) pukul 05:00. Informasi dihimpun Waspada, termasuk dari saksi mata, di antaranya Sahat Mangapul

Manik, warga setempat, kecelakaan itu terjadi ketika mobil naas itu melaju dari arah Parapat menuju Pematangsiantar dengan kecepatan tinggi mencoba mendahului satu mobil pribadi di depannya. Namun, dari arah berlawanan muncul kendaraan lain hingga pengemudi membanting stir ke kiri. Ternyata, ban mobil menabrak gundukan sirtu (pasir batu) setinggi lebih

Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Wakil Menteri Perdagagangan (Wamendag) Bayu Krisnamurthi meminta seluruh lapisan masyarakat untuk memajukan produk dalam negeri, terutama produk-produk untuk konsumsi rumah tangga. “Total impor barang untuk konsumsi rumah tangga seperti furniture, kosmetik dan alatalat rumah tangga hanya 8 persen. Artinya, produk dalam negeri menguasai 92 persen pasar dalam negeri untuk konsumsi rumah tangga. Namun, jumlah itu harus ditingkatkan lagi menjadi 95 persen. Untuk mewujud-

Kesaksian Kulit Oleh Tgk. H. Ameer Hamzah Dan ingatlah ketika musuh-musuh Allah digiring ke neraka lalu mereka dikumpulkan (semuanya) Sehingga apabila mereka sampai ke neraka pendengaran, penglihatan dan kulit mereka menjadi saksi terhadap mereka tentang apa yang telah mereka kerjakan. (QS. Fushshilat:19—20)

Lanjut ke hal A2 kol. 2

Pemukul Mengaku Tak Senang Dengan Irwandi BANDAACEH (Waspada): Polresta Banda Aceh, Rabu (27/6) malam, menangkap tersangka pemukul mantan Gubernur Aceh Irwandi Yusuf di kawasan Kelurahan Peuniti, Kota Banda Aceh. Tersangka, Mtr, 47, alias Kumis, warga Peulimbang, Kab. Bireuen ditangkap tanpa perlawanan kemudian diboyong ke Mapolresta. Kapolda Aceh Irjen Pol Iskandar Hasan kepada wartawan, Kamis (28/6), menjelaskan, dari keterangan tersangka, aksi pemukulan tersebut tidak ada


KEDEKATAN H. Amri Tambunan dengan masyarakat mulai dari anak-anak sampai orangtua.

Amri Tambunan Dinilai Rangkul Semua Etnis LUBUK PAKAM (Waspada) : Komite Nasional Pemuda Simalungun Indonesia (KNPSI) Kab. Serdang Bedagai (Sergai) mendukung keputusan politik H Amri Tambunan yang tampil sebagai salah satu kandidat Cagubsu pada Pilgubsu 2013. Lanjut ke hal A2 kol. 3

JAKARTA (Waspada): Imam Masjid Al-Fara New York, AS, Feisal Abdul Rauf, mengakui masyarakat AS takut dengan Islam karena dianggap memiliki nilai-nilai yang berlawanan dengan AS. Namun, menurut Imam Feisal, perspektif ini perlahan menghilang seiring dengan waktu. “Mungkin sebelumnya banyak warga AS yang takut dengan Islam. Mereka menganggap nilai-nilai yang terkandung dalam Islam berbeda dengan yang dianut AS. Namun, pada kenyataannya keduanya memiliki persamaan,” ujar Imam Feisal di Jakarta, Kamis (28/6). Pernyataan tersebut disampaikan oleh Feisal ketika menghadiri diskusi bertema What’s Right with Islam is What’s Right

Lanjut ke hal A2 kol. 3

kaitan dengan apapun dan siapapun. “Kasus ini murni hanya permasalahan pribadi antara pelaku dengan Irwandi, yang dilakukan spontanitas,” terangnya. Jenderal bintang dua itu menyatakan, tersangka dijerat pasal 351 tentang penganiayaan biasa. Saat ini pelaku ditahan sampai ada putusan di pengadilan. “Saya juga telah bicarakan dengan Kajati terhadap kasus ini, dalam seminggu kami akan

Lanjut ke hal A2 kol. 3

Ada-ada Saja

Warga AS Takut Dengan Islam

Al Bayan

BICARA masalah kulit bagaikan tak habis-habisnya. Orang yang punya kulit hitam, ingin menjadi kulit putih, yang kulit putih ingin kulitnya kuning. Kulit pembalut tulang, ada yang putih ada yang hitam, ada yang kuning langsat, gelap dan ada juga yang kemerah-merahan. Manusia sangat sayang kepada kulitnya. Bila kulit terluka, kena penyakit, seperti panu, puru, kudis mereka berusaha mengobatinya. Kulit yang bersih dan indah dambaan setiap manusia. Kulit bagi manusia adalah kehormatan, aurat yang perlu ditutup dan dipelihara. Kulit wanita tidak boleh nampak kecuali kulit muka (wajah) dan dua telapak tangan. Kulit lakilaki yang tidak boleh dipamerkan antara pusar dan lutut.

Waspada/Gito Rolies

PELAKU pemukulan terhadap Irwandi Yusuf saat sedang memberikan keterangan kepada wartawan usai diperiksa di Mapolda Aceh.

Gara-gara Buang Angin


TERSANGKA pengedar dan penyimpan uang palsu DPW, 28, warga Aekkorsik, Bilahulu, Kec. Labuhanbatu, terbaring tak berdaya di RSUD Kisaran.

Pengedar Upal Diamuk Massa MERANTI, Asahan (Waspada): Seorang pengedar uang palsu (Upal) babak belur diamuk massa setelah aksinya diketahui saat membeli rokok di satu kios, Kamis (28/6) sekitar pukul 14:00. Informasi dihimpun Waspada, awalnya DPW,28, warga

Lanjut ke hal A2 kol. 1

GARA-gara buang angin (kentut), seorang pensiunan asal Amerika Serikat mengancam akan menembak tetangganya yang buang angin di luar rumahnya. Pensiunan itu tak segan-segan menggunakan pistol berjenis revolver untuk menghabisi orang yang tak disu-kainya. Daniel Collins Jr, ditangkap karena mengacungkan

Lanjut ke hal A2 kol. 1

Serampang - Feeling gajah kalah sama gurita - He...he...he...

Siapa Khatib Shalat Jumat Anda ? Lihat Hal. C4-C5

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

z zNo: 23910 * Tahun Ke-66

JUMAT, Wage, 29 Juni 2012/9 Sya’ban 1433 H

L-300 Terjun Ke Danau Toba

WASPADA Demi Kebenaran Dan Keadilan

z Terbit 28 Halaman (A1-12, B1-8, C1-8) zHarga Eceran: Rp 2.500,z


PEMATANGSIANTAR (Waspada): Delapan orang tewas, dua di antaranya warga Malaysia, empatlainnya luka berat dan ringan ketika mobil penumpang Taxi Kita Bersama (TKB) jenis Mitsubishi L300 BK 1170 XO terjun ke jurang sedalam 150 meter dan tersangkut di tepi Danau Toba di Desa Sibaganding, Kec. Girsang Sipanganbolon, Kab, Simalungun Kamis (28/6) pukul 05:00. Informasi dihimpun Waspada, termasuk dari saksi mata, di antaranya Sahat Mangapul Manik, warga setempat, kecelakaan itu terjadi ketika mobil naas itu melaju dari arah Parapat menuju Pematangsiantar dengan kecepatan tinggi mencoba mendahului satu mobil pribadi di depannya. Namun, dari arah berlawanan muncul kendaraan lain hingga pengemudi membanting stir ke kiri. Ternyata, ban mobil menabrak gundukan sirtu (pasir batu) setinggi lebih kurang 20 Cm hingga sopir kehilangan keseimbangan dan mobil meluncur ke kiri jalan, menghantam tembok pengaman jalan, kemudian terjun ke dalam jurang kemiringan 90 derajat. Ketika meluncur, mobil terhempas di batu di dasar

jurang hingga bodimobil sebelah kiri remuk. Namun, mobil tidak juga berhenti dan masih berguling menuju arah danau. Sesudah berguling dan terhempas beberapa kali, mobil akhirnya tertahan pohon yang tumbuh di dasar jurang. Salah seorang penumpang yang hanya mengalami luka ringan adalah Sarno, 42, anggota TNI warga Medan dan seorang anak Maymanur, 10. Keduanya terlempar dari dalam mobil yang berguling. Saat itu, Maymanur berteriak meminta tolong berkalikali. Warga yang mendengar secara gotong-royong berhasil membawa empat korban yang masih hidup keluar dari dalam jurang. Informasi tentang kecelakaan itu sampai ke pihak Lanjut ke hal A2 kol 6

Simpatisan Kelompok Tertentu Ancam Warga Miskin Ir M Fakhruddin : Saya Membantu Ikhlas Lillahi Ta’ala, Tak Ada Kepentingan Pencitraan

Waspada Rolike Napitu

SEORANG warga memperhatikan mayat korban penumpang mobil L300 yang hancur berkeping-keping akibat jatuh ke jurang Batu Gantung, Danau Toba, Parapat, Kamis (28/6).

Dua Kapal Nelayan Disandera

TNI AL Tembak Mati Gembong Lanun Di Perairan Pulau Pandan TANJUNGBALAI (Waspada): Dua kapal nelayan penangkap kepiting KM Asahan Indah dan KM Anugerah I masing-masing bertonase 6 gross ton (GT) dirompak dan disandara kawanan bajak laut di Perairan Pulau Pandan, Rabu (27/8). Tidak ada korban jiwa maupun luka-luka dari anak buah kapal (ABK), tetapi bebe-

Waspada/Gito Rolies

PELAKU pemukulan terhadap Irwandi Yusuf saat sedang memberikan keterangan kepada wartawan usai diperiksa di Mapolda Aceh.

Pemukul Ngaku Tidak Senang Dengan Irwandi BANDAACEH (Waspada): Polresta Banda Aceh, Rabu (27/6) malam, menangkap tersangka pemukul mantan Gubernur Aceh Irwandi Yusuf di kawasan Kelurahan Peuniti, Kota Banda Aceh. Tersangka, Mtr, 47, alias Kumis, warga Peulimbang, Kab. Bireuen ditangkap tanpa perlawanan kemudian diboyong ke Mapolresta. Kapolda Aceh Irjen Pol Iskandar Hasan kepada wartawan, Kamis (28/6), menjelaskan, dari keterangan tersangka, aksi pemukulan tersebut tidak ada kaitan dengan apapun dan siapapun. “Kasus ini murni hanya permasalahan pribadi antara pelaku dengan Irwandi, yang dilakukan spontanitas,” terangnya.

Jenderal bintang dua itu menyatakan, tersangka dijerat pasal 351 tentang penganiayaan biasa. Saat ini pelaku ditahan sampai ada putusan di pengadilan.“Saya juga telah bicarakan dengan Kajati terhadap kasus ini, dalam seminggu kami akan serahkan berkas ke Kejati dan selanjutnya dilimpahkan ke pengadilan,” ujar Kapolda didampingi Kabid Humas Kombes Gustav Leo dan Kapolresta Banda Aceh Kombes Movan. Menurut Kapolda, Gubernur dan Wagub Aceh menyesalkan kejadian ini. “Beliau merasa kecewa dan meminta maaf kepada semua pihak,” urainya. Lanjut ke hal A2 kol 5

210 TKW Terancam Hukuman Mati JAKARTA (Antara): Jumlah tenaga kerja wanita Indonesia (TKW) yang saat ini terancam eksekusi mati di luar negeri berjumlah 210 orang, kata Ketua Subkomisi Pemantauan Komnas Perempuan, Arimbi Heroepoetri. “Ini berdasarkan data dari Kementerian Luar Negeri hingga Desember 2011,” ujar Arimbi saat menjadi pembicara pada diskusi media di kantor Komnas Perempuan, Jakarta, Kamis (28/6). Berdasarkan data tersebut, Arimbi mengungkapkan, 146 kasus terjadi di Malaysia, 45 kasus di Arab Saudi, 15 kasus di China, 2 kasus di Singapura, dan 1 kasus masing-masing di Iran dan Brunei Darussalam. “Puncak dari kekerasan yang dialami perempuan pekerja migran adalah saat Ruyati dieksekusi mati di Arab Saudi pada Juni tahun lalu,” kata dia.

rapa peralatan radio dan GPS sempat dirampok. Sementara, di saat upaya penyelamatan oleh TNI Angkatan Laut Lanal Tanjungbalai Asahan, seorang dari tiga perompak bernama Robot warga Marelan, Medan, tewas tertembak. Robot, 33, asli Aceh itu disinyalir gembong perompak yang meresahkan dan target operasi TNI AL, Polair dan Polres dari Aceh hingga Tanjungbalai. Kedua temannya M Nur, 34 dan M Taufik, 27, warga Kuala Tanjung, Batubara selamat dan menjalani pemeriksaan intensif di Mako Lanal TBA Baganasahan. Komandan Pangkalan TNI

Imam New York Akui Warga AS Takut Dengan Islam JAKARTA (Waspada): Imam Masjid Al-Fara New York, AS, Feisal Abdul Rauf, mengakui masyarakat AS takut dengan Islam karena dianggap memiliki nilai-nilai yang berlawanan dengan AS. Namun, menurut Imam Feisal, perspektif ini perlahan menghilang seiring dengan waktu. “Mungkin sebelumnya ada banyak warga AS yang takut dengan Islam. Mereka menganggap nilai-nilai yang terkandung dalam Islam berbeda dengan yang dianut AS. Namun, pada kenyataannya keduanya memiliki persamaan,” ujar Imam Feisal di Jakarta, Kamis (28/6). Pernyataan tersebut disampaikan oleh Feisal ketika menghadiri diskusi bertema What’s Right with Islam is What’s Right with America: Discussing Islam in the United States, yang merujuk pada salah satu buku yang ditulisnya. Terkait dengan kehidupan Muslim di AS, Imam Feisal mengatakan, penting bagi warga Muslim AS untuk membangun Islam di negeri mereka. Hal ini, kata Imam Feisal dapat membangun perspektif positif tentang Islam. “Diskriminasi secara alami terjadi di mana saja. Itu disebabkan, mereka tidak memahami dengan baik. Karena itu penting untuk membangun Islam di AS,” tegas Imam Feisal. Lanjut ke hal A2 kol 3

Kesaksian Kulit

MEDAN (Waspada):Kondisi republik ini terpuruk karena pemimpin saat ini terkesan belum menjadi pemimpin rakyat, malah korupsi. Di samping itu, demokrasi di Indonesia belum berjalan secara utuh, masih bersifat teaterikal.

MERANTI, Asahan (Waspada): Seorang pengedar uang palsu (Upal) babak belur diamuk massa setelah aksinya diketahui saat membeli rokok di satu kios, Kamis (28/6) sekitar pukul 14:00. Informasi dihimpun Waspada, awalnya DPW,28, warga Aekkorsik, Bilahulu, Keb. Labuhanbatu, membeli rokok di satu kios di Dusun IX, Desa Serdang, Kec. Meranti, Kab. Asahan, dengan selembar uang Rp 50 ribu. Sebelumnya pemilik kios tidak curiga dengan uang itu. Namun, beberapa setelah diraba, ia menduga ada keanehan pada uang tersebut. Sedangkan, DPW telah meninggalkan kios rokok tersebut.

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 2

Oleh: H. Ameer Hamzah

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 2

Para perompak memaksa nakhoda KM Asahan Indah mendekati KM Anugerah I untuk melakukan perompakan berikutnya. Diterangkan Danlanal didampingi Pasops Kapten (P) Feldiansyah, para perompak kemudian pindah ke KM Lanjut ke hal A2 kol 1

PBNU-HTI Tolak Kampanye Kondom JAKARTA (Waspada): Lembaga Persahabatan Ormas Islam (LPOI) merasa kaget dengan program kampanye kondom yang digaungkan Menteri Kesehatan Nafsiah Mboi. Program pembagian kondom dinilai hanya akan melegalkan seks bebas, utamanya di kalangan remaja. Menurut Ketua Umum Pengurus Besar Nahdlatul Ulama (PBNU) yang juga Ketua LPOI Said Aqil Siradj, program tersebut tidak akan menjadi jalan keluar bagi upaya pengurangan atau pencegahan menyebarnya HIV/AIDS. “Kami terus terang 13 ormas sangat kaget dengan kampanye Menkes bagi-bagi kondom,” kata Said Aqil dalam siaran persnya,di Jakarta, Kamis (28/6). Said Aqil menjelaskan, program pembagian kondom justru hanya akan menimbulkan masalah baru, yakni semakin meluasnya seks bebas. Lanjut ke hal A2 kol 4


Ny NURAINI, 37, salah seorang warga miskin dan baru melahirkan anaknya yang ketiga, mendapat intimidasi dari sejumlah oknum pendukung kelompok tertentu karena dianggap menerima dana dari calon lainnya.

Konflik Mahasiswa Aceh Berakhir BANDA ACEH (Waspada): Mahasiswa Aceh Tengah dan mahasiswa Aceh Selatan yang sebelumnya bersiteru hingga berujung pada pembakaran puluhan sepeda motor akhirnya berdamai di Kodim 0110/ Aceh Besar, Rabu (27/6) malam. Di hadapan Dandim Aceh Besar Letkol Triadi Murwanto, kedua pihak berikrar untuk tidak saling serang dan menahan diri, seperti yang terjadi Rabu (27/6) dini hari di arena PKA Taman Ratu Safiatuddin, Lamprit, Kecamatan Kuta Alam, Banda Aceh. Selain para mahasiswa, dalam pertemuan itu hadir sejumlah tokoh masyarakat dua kabupaten yang berdomisili di Banda Aceh, seperti Taf Haikal dari Aceh Selatan, tokoh

Anhar Gonggong Di USU

Soal Tortor, Jangan Gunakan Otot

masyarakat Gayo, Jauhari Samalanga dan Sofyan Griantara. Turut hadir 500 mahasiswa yang berasal dari dua kelompok, mahasiswa Aceh Tengah dari dua kubu yang bentrok di PKA. “Alhamdulillah yang penting damai dulu, bagaimana dengan sepeda motor saya bicara dengan Dandim Aceh Tengah dan Dandim Aceh Selatan untuk mendorong dua bupati untuk duduk bersama membicarakan ganti rugi akibat insiden itu,” ungkap Triadi Murwanto. Dandim juga menyampaikan sudah berbicara dengan Bupati Aceh Tengah Mohd Tanwir dan mendesak bupati segera menyelesaikan insiden Lanjut ke hal A2 kol 1

Ada-ada Saja

Pengedar Upal Diamuk Massa

Al Bayan

Dan ingatlah ketika musuh-musuh Allah digiring ke neraka lalu mereka dikumpulkan (semuanya) Sehingga apabila mereka sampai ke neraka pendengaran, penglihatan dan kulit mereka menjadi saksi terhadap mereka tentang apa yang telah mereka kerjakan. (QS. Fushshilat:19—20)

Angkatan Laut TanjungbalaiAsahan (Dan Lanal TBA) Letkol (P) Horas Wijaya Sinaga, Kamis (28/6) menjelaskan kronologi kejadian berawal saat sejumlah nelayan beraktivitas sebagaimana biasa. Waktu itu, kapal dengan 10 orang ABK sedang mencari kepiting di wilayah Perairan Pulau Pandan, Selat Malaka. Tiba-tiba, sebuah sampan dengan sejumlah orang mendekat ke KM Asahan Indah yang sedang menarik jaring. Tiga orang, dua diantaranya dilengkapi senjata api jenis pistol rakitan melompat ke KM Asahan Indah dan menyikat seluruh barang berharga.

BLANGPIDIE (Waspada) : Mengutip sebuah pesan Rasulullah seperti diriwayatkan Abu Hurairah berkata, Nabi SAW bersabda : ”Menyantuni janda dan orang miskin laksana perjuangan fisabilillah atau orang yang shalat sepanjang malam atau orang yang berpuasa sepanjang hari”. HR-Al bukhari, dimana secara tegas memperkuat bahwa setiap kaum muslim sudah seharusnya memperhatikan nasib saudaranya yang lainnya. Atas dasar tersebut diakui H Munir H Ubit kepada Waspada, Kamis (28/6) yang menggerakkan dirinya bersama Ir M Fakhruddin memberikan bantuan kepada salah seorang warga miskin di Kecamatan Babahrot, Aceh Barat Daya yang mereka temui dalam kondisi yang memprihatinkan. “Sungguh sangat tidak berperikemanusiaan bila sampai kita menutup hati dan mata ketika melihat nasib saudara kita yang sangat memprihatinkan itu dan kita memiliki kemampuan untuk membantunya, jadi rasanya sungguh tragis dan memalukan jika sampai saudara kita yang miskin itu diintimidasi serta diancam hanya karena persoalan politik,” ungkap H Munir H Ubit, tokoh masyarakat Abdya saat menyambangi seorang rumah warga miskin di Desa Gunung Samarinda, Kecamatan Babahrot. Kedatangan rombongan H Munir H Ubit yang datang langsung bersama M Fakhrudin yang juga Calon Bupati

Gara-gara Kentut

GARA-gara kentut, seorang pensiunan asal Amerika Serikat (AS) mengancam akan menembak tetangganya yang buang angin di luar rumahnya. Pensiunan itu tak segan-segan menggunakan pistol berjenis revolver untuk menghabisi orang yang tak disukainya. Daniel Collins Jr, ditangkap Waspada/ist

KEDEKATAN H. Amri Tambunan dengan masyarakat mulai dari anak-anak sampai orangtua.

Tanjungbalai Tak Bisa Dipisahkan Dengan H. Amri Tambunan TANJUNGBALAI (Waspada): Berharap pola dan gerakan pembangunan yang digagas Drs. H. Amri Tambunan dalam memimpin Deliserdang dapat diterapkan di Sumut, berbagai elemen masyarakat dari berbagai kabupaten Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 5

Serampang - Gunakan otak .... - He.... he....he....

Berita Utama

A2 TNI AL Tembak ....

Anugerah I, dan meninggalkan KM Asahan Indah. Namun, salah seorang seorang ABK sempat mengirim sinyal dan laporan kepada TNI AL bahwa sedang terjadi perompakan di Perairan Pulau Pandan. Tak berapa lama, satu kapal patroli dipimpin Kapten (P) Feldiansyah tiba di lokasi. Upaya persuasif dengan berkomunikasi melalui radio dan pengeras suara agar perompak membebaskan sandera dan bersedia menyerahkan diri tidak ditanggapi. Sehingga, diberikan tembakan peringatan tiga kali ke udara. Namun, hal itu tidak juga diperdulikan. Langkah selanjutnya, anggota TNI AL terpaksa mengarahkan tembakan ke posisi yang tidak fatal. Sebelum menembak, para ABK diperintahkan terjun ke laut menyelamatkan diri. Ternyata, para perompak membalas tembakan dan terjadi baku tembak selama beberapa saat.

Soal Tortor ....

“Ini fakta, kita lihat tidak sedikit, pemimpin republik produk saat ini keluar masuk penjara karena korupsi, bukan karena membela bangsa ini,” kata sejarawan nasional Anhar Gonggong kepada Waspada, Kamis (28/6), seusai berbicara dalam seminar publik: “Cross Cultural Fertilization (penyerbukan silang antarbudaya) Sebuah Strategi Kebudayaan” yang digelar Nabil Society di Fakultas Ilmu Sosial dan Politik Universitas Sumatera Utara (USU). Selain, Anhar, tampil juga Budi Agustono. Katanya,menjadi seorang pemimpin, tidak sekadar cerdas, dan terdidik. Tapi yang terpenting pemimpin itu harus tercerahkan atau punya hati. Dia mencontohkan, pemimpin seperti duet proklamator RI Soekarno dan Mohammad Hatta. Kedua pemimpin itu rela keluar masuk penjara dan bahkan dibuang Belanda demi memperjuangkan bangsa ini. Padahal kalau mereka menerima tawaran Belanda, kehidupan keduanya dipenuhi kemewahan dan kenyamanan. Tapi, itu tidak mereka lakukan karena keduanya punya hati nurani. Berbeda dengan pemimpin saat ini, banyak yang terdidik tetapi krisis hati nurani. Anhar memberi contoh

Konflik Mahasiswa .... tersebut dengan Bupati Aceh Selatan Husin Yusuf. Perdamaian yang terjadi di Kodim Aceh Besar tersebut merupakan pertemuan ketiga setelah sebelumnya Dandim bertemu dengan masing-masing kelompok yakni mahasiswa Aceh Tengah dan mahasiswa Aceh Selatan. “Saya melihat masih belum tuntas, maka saya hadirkan kedua pihak ke Kodim,” ungkap Triadi. Sebelumnya kerusuhan kedua kelompok mahasiswa itu bermula dari saling ejek antar pendukung pada saat pertandingan sepakbola Popda Aceh XII/2012 antara tim Aceh Tengah berhadapan dengan Aceh Selatan di SHB Lhong Raya, Senin (25/6), yang

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. BdxGd6+, c7xB. 2. Gd4+mat. (Jika 1. ....., Rb7. 2. Mxa6+mat).

Jawaban TTS: TTS Topik

Mimbar Jumat

Jawaban Sudoku:

2 1 6 5 4 9 3 7 8

5 8 9 6 3 7 1 4 2

3 7 4 8 2 1 6 5 9

7 9 3 4 1 8 5 2 6

6 5 1 2 9 3 4 8 7

4 2 8 7 5 6 9 3 1

1 4 5 9 7 2 8 6 3

8 3 7 1 6 5 2 9 4

9 6 2 3 8 4 7 1 5

DAN Lanal TBA Letkol (P) Horas Wijaya Sinaga memperlihatkan sebilah sangkur terbuat dari besi putih beserta alat komunikasi hasil rampokan di Mako Baganasahan, Kamis (28/6).

pemimpin saat ini, begitu dilantik mereka langsung dilimpahkan kemewahan berupa mobil dinas seharga Rp1,3 miliar per unit atau fasilitas mewah lainnya. “Bagimana mereka bisa mensejahterakan rakyat,” tegasnya. Menurut dia, pemimpin sekarang lebih banyak membohong rakyat daripada memikirkan nasib rakyat. Sementara itu, Anhar mengatakan Malaysia mengklaim budaya Indonesia karena rendah diri karena budaya kita lebih hebat dari mereka “Apa rupanya budaya Malaysia, Melayu dari Riau, Batak dari Sumut. Nah jangan gunakan

otot, tapi otak,” katanya. Dia menyatakan salah satu syarat menyatakan sebuah budaya itu milik Indonesia daftarkan ke UNESCO dan tidak berhenti begitu saja, tapi terus dilestarikan melalui keratifitas. “Kebiasaan buruk kita, begitu orang lain mengklaim budaya Indonesia milik mereka , kita rebut, sedangkan kita sendiri tidak melesatarikan budaya itu,” tegasnya. Anhar mengatakan agar budaya Indonesia tetap aman dan berkembang, bangsa ini perlu belajar banyak dengan negara Korea dan Jepang. Kedua negara ini sangat begitu menghargai budaya mereka.

“Contoh kecil, bagaimana kedua Negara itu menghargai waktu,. Pemerintah dan masyarakat Indonesia sangat lentur menghargai waktu,” tegasnya. Katanya, kebudayaan memiliki peran sangat penting dalam memajukan atau menurunkan kualitas hidup suatu bangsa, untuk itu Indonesia dinilai perlu menerapkan konsep penyerbukan silang antarbudaya. Artinya saripati-saripati budaya lokal yang berkualitas dan memiliki nilai dorong kemajuan dapat diserbukkan dengan nilai-nilai budaya lain, baik yang terda-

pat di bumi Indonesia, maupun dari mancanegara. Diharapkan dengan menerapkan konsep tersebut indonesia akan memiliki kebudayaan baru yang unggul dan tampil percaya diri menjadi bangsa besar yang disegani oleh bangsa-bangsa lainnya. Menurut dia, Indonesia perlu belajar dari negara-negara Asia Timur seperti China, Jepang dan Korea yang mampu menjadi bangsa disegani, justru karena memanfaatkan secara optimal unsur-unsur positif yang terkandung dalam budaya mereka. (m49)


Pengedar Upal ....

Saat bersamaan polisi datang dan mengamankan tersangka dengan membawanya ke RSUD Kisaran untuk menjalani perawatan. Selanjutnya, polisi membawa tersangka memeriksa rumah kostnya di Jl. SM Raja, Gang Subur.Dari dalam rumah itu, polisi menemukan uang palsu pecahan Rp50 ribu delapan lembar, Rp20 ribu 10 lembar serta mesin printer. Kapolres Asahan AKBP Yu s t a n A l p i a n i , y a n g dikonfirmasi Waspada, melalui Kasat Reskrim AKP Fahrizal, membenarkan penangkapan itu.’’Saat ini kita masih proses penyelidikan,’’ kata Kapolres. (a15)

Karena, program itu akan menimbulkan dampak negatif berupa dorongan psikologis, dukungan dan legitimasi kepada masyarakat. “Khususnya para remaja yang berniat melakukan perzinaan,” ujarnya. Said Aqil mengusulkan agar pemerintah melakukan program-program pencegahan dalam bentuk pendidikan, pencerahan dan pembinaan akhlak budi pekerti. Menteri Kesehatan Nafsiah Mboi sendiri menegaskan tidak pernah mengatakan mau meningkatkan kampanye kondom di kalangan umum, siswa-siswa dan remaja. “Tetapi tetap kami kampanyekan kondom ke setiap pelaku hubungan seks berisi-

ko. Karena itu adalah salah satu indikator MDG,” kata dia, Rabu lalu. Sementara itu, ratusan anggota Hizbut Tahrir Indonesia (HTI) Jember, Jawa Timur, Kamis (29/6), menggelar aksi demo, menolak program sosialisasi kondom yang digelar Menteri Kesehatan Nafsiah Mboi. Penolakan disampaikan dalam bentuk yel-yel dan orasi di sepanjang jalan protokol yang dilalui barisan HTI. Sosialisasi kondom, ucap Ustad Hadi, merupakan bagian dari upaya melegalisasi adanya seks bebas. Ini bisa merusak generasi muda mendatang. Sikap HTI Jember, secara tegas menolak program kondom Menteri Kesehatan. (vvn/m13)

Feisal yang lahir di Kuwait, selama ini aktif mencetuskan solusi-solusi inovatif demi menyelesaikan berbagai konflik antara komunitas-komunitas Muslim dan Barat yang dapat mengancam keamanan lokal dan global. Membantu Pemahaman Sementara, Dubes AS Scot Marciel mengatakan, pihaknya sengaja mendatangkan Imam Feisal ke Indonesia agar dapat membantu meningkatkan pemahaman antarkedua negara (AS-Indonesia). “Kunjungan Imam Feisal ke Indonesia dan acara diskusi ini dapat membantu mening-

Imam New York ....

katkan pemahaman masyarakat kedua negara. Apa yang tengah terjadi di AS, juga saling berbagi informasi terkait apa yang tengah terjadi di Indonesia. Ini baik bagi hubungan kedua negara,” kata Dubes Marciel. Feisal Abdul Rauf dikenal sebagai Imam dari Masjid AlFara yang berlokasi 12 blok dari World Trade Centre (WTC) di New York. Selama ini Imam Feisal gencar menyerukan perdamaian dan saling memahami di masyarakat tanpa membedakan latar belakang, ideologi politik bahkan kewarganegaraan. Selain dikenal sebagai

Simpatisan ....

ancam dan intimidasi, negara ini ada aturannya, kedatangan kami dalam acara silaturrahmi juga legal dan resmi dengan memanfaatkan agenda dialogis yang telah ditentukan KIP dan Panwas Abdya. Jadi tidak benar tudingan seperti money politik itu dan kita juga sesalkan tindakan intimidasi terhadap warga miskin itu,” tutur Munir yang juga mantan anggota DPRK Abdya dari PKB. Terhadap persoalan tersebut, M Fakhruddin menyatakan keprihatinannya atas sikap sejumlah orang yang dinilai terlalu ‘picik’ dalam menyikapi kondisi yang terjadi di masyarakat saat ini. Dirinya juga mengaku melakukan aktivitas silaturrahmi ke beberapa lokasi selama ini tanpa ada unsur paksaan dalam rangka pencitraan politik,

namun dengan turun secara langsung dapat diketahui kondisi yang real (nyata) di lapangan. “Saya tidak ingin terlalu menanggapi berlebihan atas kehebohan yang mereka lakukan, hari ini saya langsung turun kembali menyambangi mereka untuk memperjelas semuanya dan saya juga berkomitmen siap membantu ibu yang memiliki anak bayi itu dengan bergotong-royong membangun rumahnya yang memang sungguh memprihatinkan, kalaupun saya tidak terpilih, InsyaAllah saya juga akan membantunya, karena saya membantu ikhlas lillahi ta’ala, tidak ada kepentingan pencitraan politik,” tegas M Fakhruddin, calon bupati yang juga putra asli Abdya asal Desa Alue Pade, Kecamatan Kuala Batee. (cb05)

Al Bayan ....

dipandang orang adalah dosa, menonton kulit perempuan juga dosa, menyentuh kulit lawan jenis semakin banyak dosa. Semua itu dilarang dalam agama. Allah SWT telah memberi amanah kepada kulit manusia untuk merekam semua aktivitas manusia di dunia ini. Hari akhirat nanti kulit akan bersaksi dan membenarkan semua yang dituduh Allah kepada manusia tersebut. Bila seseorang tidak patuh terhadap peraturan Allah, hari akhirat nanti si kulit akan tidak bersahabat lagi dengan manusia tersebut. Dalam neraka nanti kulit akan naik saksi dengan apa yang dikerjakan oleh manusia bersangkutan di dunia ini. Ketika kulit membuka aib si manusia tersebut, manusia menyesal dan marah kepada

kulitnya. Dalam Fushshilat ayat 21 Allah ber firman: “Mengapa kamu menjadi saksi terhadap kami?” Kulit mereka menjawab: Allah yang menjadikan segala sesuatu pandai berkata telah menjadikan kami pandai (pula) berkata, dan Dialah yang menciptakan kamu pada kali yang pertama dan hanya kepada-Nyalah kamu dikembalikan”. Jika Anda tidak ingin dipecundangi oleh kulit Anda sendiri, maka jagalah dirimu dari berbagai larangan Allah tertutama membiarkan kulit Anda nampak dipandang orang. Tutuplah kulit sebagaimana anjuran Allah dalam Alquran. Tinggalkan profesi Anda dalam acara-acara yang menjual aurat. Takutlah kepada kulit yang akan memberi kesaksian nanti bahwa Anda pernah berbuat dosa.

berakhir dengan kedudukan 4-1 untuk keunggulan Aceh Selatan. Seusai pertandingan, kedua tim bentrok di luar stadion yang mengakibatkan seorang pendukung Aceh Selatan, Feri, mengalami luka di pergelangan tangan.Puluhan sepeda motor milik mahasiswa Aceh Tengah dibakar oleh kelompok lawan. Kapolresta Banda Aceh Kombes Pol Movan menyatakan, proses hukum terhadap pelaku pembakaran sepeda motor milik mahasiswa Aceh Tengah di Taman Ratu Safiatuddin Banda Aceh tetap berlanjut. (b08/b04/cb01)

Abdya terkait munculnya kehebohan akibat intimidasi serta ancaman dari sejumlah simpatisan dari kelompok tertentu pasca kunjungan M Fakhrudin sehari sebelumnya, Rabu (27/6) yang dituding telah melakukan upaya ‘moneypolitik’, tindakan intimidasi terhadap warga miskin itu dinilai sebagai bentuk prilaku yang tidak manusiawi, semestinya kelompok tertentu itu diharapkan tidak bersikap berlebihan serta dapat membedakan antara ukhuwah dengan kepentingan politik. “Dengan sikap mereka yang kasar terhadap warga miskin seperti itu, maka semakin memperlihatkan bahwa mereka tidak memiliki visimisi yang pro terhadap rakyat, khususnya rakyat miskin, bukan zamannya lagi main Bicara masalah kulit bagaikan tak habis-habisnya. Orang yang punya kulit hitam, ingin menjadi kulit putih, yang kulit putih ingin kulitnya kuning. Kulit pembalut tulang, ada yang putih ada yang hitam, ada yang kuning langsat, gelap dan ada juga yang kemerahmerahan. Manusia sangat sayang kepada kulitnya. Bila kulit terluka, kena penyakit, seperti panu, puru, kudis mereka berusaha mengobatinya. Kulit yang bersih dan indah dambaan setiap manusia. Kulit bagi manusia adalah kehormatan, aurat yang perlu ditutup dan dipelihara. Kulit wanita tidak boleh nampak kecuali kulit muka (wajah) dan dua telapak tangan. Kulit lakilaki yang tidak boleh dipamerkan antara pusar dan lutut. Membiarkan kulitnya nampak

Jumat 29 Juni 2012

Pedagang Buku Lapangan Merdeka Akan Dipindahkan

Tak beberapa lama kemudian, para penyamun itu mengangkat kain putih tanda menyerahkan diri. Robot ternyata tertembak di bagian kaki dan perut, dua lainnya selamat. Ketiganya langsung dievakuasi ke daratan melalui Pos Kamla Baganasah, kemudian dibawa ke RSUD Kota Tanjungbalai.Namun, Robot tewas dalam perjalanan. Barang bukti yang disita, kata Dan Lanal, sebilah sangkur, alat komunikasi kapal (radio) hasil rampokan, GPS dan tas milik perompak. Sedangkan pistol rakitan diduga dibuang perompak ke laut sebelum menyerahkan diri. Secara terpisah, seorang warga Baganasahan mengaku temannya Imul dan Sadek menjadi korban kawanan penjahat laut itu di sekitar Pulau Pandan. Namun, rekan satu kampungnya itu beserta ABK nya selamat berkat bantuan TNI Angkatan Laut Tanjungbalai Asahan. (a32)

Namun, pedagang kecil itu tak mau rugi.Ia pun mengejar pengedar Upal tersebut dan mengembalikan uangnya. DPW menukar uang itu dengan uang asli. Perbuatan itu diperhatikan warga, apalagi tersangka adalah orang asing. Setelah itu, pemilik kios berteriak, bahwa tersangka membawa uang palsu dan menarik perhatian warga. DPW mencoba melarikan diri, namun dia telah dikepung massa dan dipukuli. Setelah tak berdaya, massa memeriksa tubuh korban dan menemukan sepucuk soft gun yang diselipkan di pinggannya.


Waspada/Rasudin Sihotang

Imam, Feisal menjabat ketua dari Cordoba Initiative: proyek independen internasional yang bekerjasama dengan pemer intah dan LSM guna mempromosikan hubungan baik antara Muslim dan Barat. Feisal juga aktif menulis buku. Sejumlah buku yang ditulisnya antara lain, A Search for Meaning, Islam: A Sacred Law (What Ever y Muslim Should Know About Syria) dan What’s Right With Islam: An New Visin for Muslims and the West. (ok/r-m10)

Pemukul Ngaku ....

Mtr mengaku ikut memukul Irwandi karena melihat massa yang terlebih dahulu meramaikan mantan Gubernur Aceh itu. “Saya marah kepada Irwandi Yusuf karena selama ini kurang peduli dengan kami, banyak uang anak yatim dan korban konflik tidak jelas,” tutur Mtr singkat dengan wajah ditutupi sebo di Mapolda Aceh. Mantan panglima dan pendiri Gajah Keng Tgk Hamzah yang juga wakil sekretaris PA pusat membantah tuduhan atas dirinya terlibat dalam pemukulan Irwandi Yusuf. “Saya sebagai keamanan di lokasi itu dan saat kejadian saya berada di teras gedung utama DPRA menunggu Doto Zaini dan Mualem keluar dari ruangan, waktu itu saya sempat melihat Irwandi keluar dan berlalu ke arah pintu keluar, di sana beliau diramaikan massa,” terangnya. (cb01)

Ada-ada Saja ....

karena mengacungkan pistolnya ke tetangganya yang berusia 47 tahun. Menurut kepolisian, konfrontasi terjadi antara Collins dan tetangganya di apartemen, setelah tetangga Collins kedapatan membuang gas saat berjalan melewati pintu ruangan Collins. “Saya akan membuat lubang dikepalamu!” ujar Detektif Andrew McGurr yang meniru suara Collins, seperti dikutip Orange, Kamis (28/6). Collins mengatakan pada detektif itu, dia mendengar ada suara di dalam apartemennya. Tetangga Collins pun langsung menelpon polisi. Collins akhirnya didakwa atas tindakan penyerangan, kepemilikan senjata api tanpa izin. Dirinya juga didakwa atas penggunaan senjata untuk tindakan di luar hukum, dan ancaman teror. (ok/rzl)

MEDAN (Waspada): Setelah digusur dari kawasan Titi Gantung Medan beberapa tahun lalu, kini seluruh pedagang buku yang menempati kios di kawasan Lapangan Merdeka Medan depan Stasiun Besar Kereta Api Medan, akan dipindahkan ke Pasar Mandala Medan. Hal itu dilakukan karena areal tersebut bakal dijadikan lahan parkir City Check In di Stasiun Kereta Api. “City Check In dalam waktu dekat akan beroperasi, jadi terpaksa seluruh pedagang buku dipindahkan. Kawasan itu akan menjadi lahan

parkir. Kios pedagang buku yang baru itu kita bangun secara permanen juga,” kata Wali Kota Medan Rahudman Harahap kepada Waspada, Kamis (28/6). Diungkapkan Rahudman, Pemko Medan bekerjasama dengan PT Kereta Api Indonesia (KAI) membangun sejumlah kios di atas lahan milik PT KAI di Jl. Mandala By Pass Medan. “Itu sebagai solusi relokasi para pedagang buku di areal Lapangan Merdeka. Jadi, kita bukan asal pindahkan, namun tetap memikirkan usahanya,” ujar Rahudman. Bila hal ini berjalan baik,

tambahnya, para pedagang buku itu bukan saja dapat menjual bukunya, juga bisa membuka usaha lain. “Untuk apalagi mereka berdagang buku, sedangkan buku saat ini sudah banyak bantuan dari pemerintah dan diberikan secara gratis,” sebutnya. Sedangkan Pemko Medan sudah melakukan sosialisasi kepada seluruh pedagang agar dapat memakluminya. “Sosialisasi sudah beberapa kali ,tinggal pertemuan sekali lagi. Kita harapkan seluruh pedagang buku tersebut bisa memakluminya,” ujarnya. (m50)

8 Tewas ....

Sementara, jenazah para korban bisa dievakuasi satu persatu ke pinggir Danau Toba dan dibawa dengan speedboat ke Pantai Sosor Pasir. Jenazah tidak bisa dievakuasi ke atas jurang, karena medannya sangat sulit dilalui. Dari pantai Sosor Pasir, jenazah korban tewas dievakuasi ke RSUD DR. Djasamen Saragih, Kota Pematangsiantar untuk divisum. Evakuasi jenazah korban yang dilakukan sejak pukul 07:00, selesai dilaksanakan pukul 14:30. Kasat Lantas yang dihubungi menyebutkan belum semua identitas korban didapat, karena tanda pengenal mereka sudah berserakan di lokasi mobil terjatuh. Identitas korban yang berhasil didapat yakni pengemudi mobil Parlindungan Harahap, 28, warga Jl. Sei Mencirim, Desa Paya Geli, Kec. Sunggal, Kabupaten Deliserdang, Zulkifli Bin Basir, 54, dan Zaidan, keduanya warga negara Malaysia. Pedianur warga Pakantan, Natal, Kab. Mandailing Natal (Madina), Mushud, dan isterinya yang belum diketahui identitasnya, warga Sijantung, Natal, Madina, Eva dan ibunya

Ismaniah, warga Pasar I, Natal, Madina, Sedangkan, korban luka ringan dan berat yakni Maymanur, 10, Sakti Awi, keduanya cucu Pedianur, Marwan, 23, sopir dua mobil penumpang naas itu dan Sarno. Korban luka berat dan ringan dibawa ke RSU Vita Insani, Pematangsiantar untuk perawatan. Menjawab pertanyaan, Kasat Lantas menyebutkan sesuai informasi, mobil naas itu berangkat dari Natal, Madina dengan membawa 12 penumpang pada Rabu (27/6) siang tujuan Medan. Di Balige, Kab. Toba Samosir, sopir berganti membawa mobil saat babak kedua pertandingan sepakbola piala Eropa. “Kuat dugaan, pengemudi mengantuk hingga kecelakaan terjadi.” Pada kesempatan itu, Kapolres mengucapkan terimakasih kepada anggota TNI AD dari Yonif 126/KC, PT Aqua Farm yang membantu evakuasi terhadap kecelakaan tunggal itu dan termasuk media yang turut berada di lapangan membantu tugas polisi saat evakuasi dilaksanakan hingga evakuasi berjalan lancar. (a30/a29/crn)

Tanjungbalai ....

Pematangsiantar, bupati Simalungun, gubernur muda Sumut, Gubernur Jambi dan Kaban Litbang Depdagri. Selain merupakan putra daerah Tanjungbalai H. Amri Tambunan dalam memimpin roda pemerintahan, pembangunan dan kemasyarakatan sudah teruji. Terbukti laju dan percepatan pembangunan di daerah yang dipimpinnnya berbagai pola dan gerakan pembangunan yang digagasnya telah memberikan arti bagi masyarakat Deliserdang. “Pola kebersamaan yang digagas Pak Amri dalam memimpin Deliserdang dengan mengandalkan tiga pilar kekuatan pembangunan (kemampuan pemerintah yang terbatas, peran aktif masyarakat serta dukungan sektor swasta- red) terbukti sangat efektif dalam memacu percepatan pembangunan”. Menurut masyarakat Tanjungbalai ini, mereka membaca di berbagai mass media dan penghargaan yang diraih dari presiden, berbagai hasil pembangunan di Deliserdang cukup signifikan, sehingga seluruh masyarakat di berbagai pelosok desa mengakui telah merasakan nikmat pembangunan itu. Karenanya untuk percepatan pembangunan Sumut yang merupakan salah satu provinsi yang memiliki potensi besar sangat dibutuhkan sosok pemimpin yang

mampu menata kebersamaan serta melahirkan berbagai inovasi dan terobosan. “Untuk hal ini kemampuan Pak Amri tidak diragukan lagi, beliau telah membuktikannya dalam memimpin Deliserdang yang sangat heterogen,” ujar mereka. Selain itu, pria yang dalam jiwa dan tubuhnya mengalir darah pejuang, juga memiliki berbagai inovasi dan terobosan untuk percepatan pembangunan daerah yang dipimpinnya seperti melalui GDSM pada sektor infrastruktur CERIA pada sektor kesehatan, CERDAS pada bidang pendidikan. Bahkan Amri Tambunan juga merupakan pemimpin yang peduli kepada masyarakat bawah. Terbukti, sejak tahun 2011 beliau melahirkan satu program yang merupakan gerakan moral dan kemanusiaan yang dikenal dengan program “Baru Yakin” (Bedah rumah masyarakat miskin/kurang mampu). Seperti diketahui, diawal kepemimpinannya di Deliserdang tahun 2004, kondisi keuangan daerah cukup memprihatinkan dimana APBD Deliserdang termasuk Serdang Bedagai yang baru dimekarkan hanya Rp 616,4 miliar lebih dan di tahun 2005 hanya Rp533 miliar lebih. Namun pada tahun 2012 APBD Deliserdang melonjak menjadi Rp2 triliun lebih. (a06/m13)

kepolisian, yang ditindaklanjuti jajaran Polres Simalungun. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik, Kasat Lantas AKP Baginda Sitohang, Kapolsek Parapat AKP Rico Sidabutar, SH, S.Ik, Kanit Laka Iptu Alsem Sinaga dan personil Sat Lantas dan Polsek segera mendatangi lokasi kejadian. Pantauan Waspada, lokasi jatuhnya mobil naas itu sulit dilalui hingga personil kepolisian, Basarnas dan anggota TNI dari Yonif 122/KC, terpaksa turun ke lokasi menggunakan tali yang diikatkan ke satu unit mobil derek. Sedangkan, mobil naas itu juga diikat pakai tali guna mengantisipasi jika pohon penahannya tumbang, mobil tidak terguling ke dalam danau. Sedangkan para korban tewas terlihat terlempar di luar mobil bersama pakaian dan barang-barang mereka, dan ada yang terjepit di dalam mobil. Mereka diduga tewas akibat benturan berkali-kali hingga tulang tangan, kaki dan pinggang patah dan ada wajah korban yang hancur.

dan kota terus memberikan dukungan atas pencalonannya menjadi salah satu kandidat bakal calon (Balon) Gubsu. Be r b a g a i b e n t u k d u kungan dan doa terus mengalir agar Bupati Deliserdang itu ditetapkan menjadi salah satu calon dan berhasil memenangkan pertarungan pada pesta demokrasi melalui pagelaran Pilgubsu 2013. Seperti dikemukakan masyarakat Tanjung Balai di antaranya Ketua PD Muhammadiyah H. Djufri Syahlan dan Ketua Aisyiah Hj Zainimar, baru-baru ini, menyatakan rasa bangga atas tampilnya Drs. H. Amri Tambunan yang bagi masyarakat Tanjungbalai memiliki ikatan benang merah yang tak dapat terpisahkan sebagai salah satu balon Gubsu. Putra sulung pasangan (Alm) H. Djamaluddin Tambunan dengan (Almh) Hj Nurbanun Siregar ini, merupakan putra Tanjungbalai karena beliau dilahirkan 23 Januari 1949 di kota ‘kerang’ Tanjungbalai. Sebagaimana diketahui, orang tua H. Amri Tambunan selain dikenal sebagai pejuang kemerdekaan yang pernah menduduki jabatan bupati militer daerah Asahan dan Labuhanbatu, juga pernah menjabat sebagai Wedana di Tanjungbalai, Patih di Asahan, bupati Labuhanbatu, walikota

Berita Utama


WASPADA Jumat 29 Juni 2012

Anhar Gonggong Soal Tortor:

Malaysia Rendah Diri Waspada/Rasudin Sihotang

DAN Lanal TBA Letkol (P) Horas Wijaya Sinaga memperlihatkan sebilah sangkur terbuat dari besi putih beserta alat komunikasi hasil rampokan di Mako Baganasahan, Kamis (28/6).

TNI AL Tembak... Diterangkan Danlanal didampingi Pasops Kapten (P) Feldiansyah, para perompak kemudian pindah ke KM Anugerah I, dan meninggalkan KM Asahan Indah. Namun, salah seorang seorang ABK sempat mengirim sinyal dan laporan kepada TNI AL bahwa sedang terjadi perompakan di Perairan Pulau Pandan. Tak berapa lama, satu kapal patroli dipimpin Kapten (P) Feldiansyah tiba di lokasi. Upaya persuasif dengan berkomunikasi melalui radio dan pengeras suara agar perompak membebaskan sandera dan bersedia menyerahkan diri tidak ditanggapi. Sehingga, diberikan tembakan peringatan tiga kali ke udara. Namun, hal itu tidak juga diperdulikan. Langkah selanjutnya, anggota TNI AL terpaksa mengarahkan tembakan ke posisi yang tidak fatal. Sebelum menembak, para ABK diperintahkan terjun ke laut menyelamatkan diri. Ternyata, para perompak membalas tembakan dan terjadi baku tembak selama beberapa saat. Tak beberapa lama kemudian, para penyamun itu mengangkat kain putih tanda menyerahkan diri. Robot ternyata tertembak di bagian kaki dan perut, dua lainnya selamat. Ketiganya langsung dievakuasi ke daratan melalui Pos Kamla Baganasahan, kemudian dibawa ke RSUD Kota Tanjungbalai. Namun, Robot tewas dalam perjalanan. Barang bukti yang disita, kata Dan Lanal, sebilah sangkur, alat komunikasi kapal (radio) hasil rampokan, GPS dan tas milik perompak. Sedangkan pistol rakitan diduga dibuang perompak ke laut sebelum menyerahkan diri. Secara terpisah, seorang warga Baganasahan mengaku temannya Imul dan Sadek menjadi korban kawanan penjahat laut itu di sekitar Pulau Pandan. Namun, rekan satu kampungnya itu beserta ABK nya selamat berkat bantuan TNI Angkatan Laut Tanjungbalai Asahan.(a32)

Pengedar Upal... Aekkorsik, Bilahulu, Keb. Labuhanbatu, membeli rokok di satu kios di Dusun IX, Desa Serdang, Kec. Meranti, Kab. Asahan, dengan selembar uang Rp 50 ribu. Sebelumnya pemilik kios tidak curiga dengan uang itu. Namun, setelah diraba dan diterawang, ia menduga ada keanehan pada uang tersebut. Sedangkan, DPW telah meninggalkan kios rokok tersebut. Namun, pedagang kecil itu tak mau rugi.Ia pun mengejar pengedar Upal tersebut dan mengembalikan uangnya. DPW menukar uang itu dengan uang asli. Perbuatan itu diperhatikan warga, apalagi tersangka adalah orang asing. Setelah itu, pemilik kios berteriak, bahwa tersangka membawa uang palsu dan menarik perhatian warga. DPW mencoba melarikan diri, namun dia telah dikepung massa dan dipukuli. Setelah tak berdaya, massa memeriksa tubuh korban dan menemukan sepucuk soft gun yang diselipkan di pinggangnya. Saat bersamaan polisi datang dan mengamankan tersangka dengan membawanya ke RSUD Kisaran untuk menjalani perawatan. Selanjutnya, polisi membawa tersangka memeriksa rumah kostnya di Jl. SM Raja, Gang Subur.Dari dalam rumah itu, polisi menemukan uang palsu pecahan Rp50 ribu delapan lembar, Rp20 ribu 10 lembar serta mesin printer. Kapolres Asahan AKBP Yustan Alpiani, yang dikonfirmasi Waspada, melalui Kasat Reskrim AKP Fahrizal, membenarkan penangkapan itu.’’Saat ini kita masih proses penyelidikan,’’ kata Kapolres. (a15)

Ada-ada Saja.... karena mengacungkan pistolnya ke tetangganya yang berusia 47 tahun. Menurut kepolisian, konfrontasi terjadi antara Collins dan tetangganya di apartemen, setelah tetangga Collins kedapatan membuang gas saat berjalan melewati pintu ruangan Collins. “Saya akan membuat lubang dikepalamu!” ujar Detektif Andrew McGurr yang meniru suara Collins, seperti dikutip Orange, Kamis (28/6). Collins mengatakan pada detektif itu, dia mendengar ada suara di dalam apartemennya. Tetangga Collins pun langsung menelfon polisi. Collins akhirnya didakwa atas tindakan penyerangan, kepemilikan senjata api tanpa izin. Dirinya juga didakwa atas penggunaan senjata untuk tindakan di luar hukum, dan ancaman teror.(ok/rzl)

Albayan... Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. BdxGd6+, c7xB. 2. Gd4+mat. (Jika 1. ....., Rb7. 2. Mxa6+mat).

Jawaban TTS: TTS Topik

Mimbar Jumat

Jawaban Sudoku:

2 1 6 5 4 9 3 7 8

5 8 9 6 3 7 1 4 2

3 7 4 8 2 1 6 5 9

7 9 3 4 1 8 5 2 6

6 5 1 2 9 3 4 8 7

4 2 8 7 5 6 9 3 1

1 4 5 9 7 2 8 6 3

8 3 7 1 6 5 2 9 4

9 6 2 3 8 4 7 1 5

Membiarkan kulitnya nampak dipandang orang adalah dosa, menonton kulit perempuan juga dosa, menyentuh kulit lawan jenis semakin banyak dosa. Semua itu dilarang dalam agama. Allah SWT telah memberi amanah kepada kulit manusia untuk merekam semua aktivitas manusia di dunia ini. Hari akhirat nanti kulit akan bersaksi dan membenarkan semua yang dituduh Allah kepada manusia tersebut. Bila seseorang tidak patuh terhadap peraturan Allah, hari akhirat nanti si kulit akan tidak bersahabat lagi dengan manusia tersebut. Dalam neraka nanti kulit akan naik saksi dengan apa yang dikerjakan oleh manusia bersangkutan di dunia ini. Ketika kulit membuka aib si manusia tersebut, manusia menyesal dan marah kepada kulitnya. Dalam Fushshilat ayat 21 Allah berfirman: “Mengapa kamu menjadi saksi terhadap kami?” Kulit mereka menjawab: Allah yang menjadikan segala sesuatu pandai berkata telah menjadikan kami pandai (pula) berkata, dan Dialah yang menciptakan kamu pada kali yang pertama dan hanya kepada-Nyalah kamu dikembalikan”. Jika Anda tidak ingin dipecundangi oleh kulit Anda sendiri, maka jagalah dirimu dari berbagai larangan Allah tertutama membiarkan kulit Anda nampak dipandang orang. Tutuplah kulit sebagaimana anjuran Allah dalam Alquran. Tinggalkan profesi Anda dalam acara-acara yang menjual aurat. Takutlah kepada kulit yang akan memberi kesaksian nanti bahwa Anda pernah berbuat dosa.

MEDAN (Waspada): Sejarawan nasional Anhar Gonggong berbicara dalam seminar publik: “Cross Cultural Fertilization ( penyerbukan silang antarbudaya). Sebuah Strategi Kebudayaan” yang digelar Nabil Society di Fakultas Ilmu Sosial dan Politik Universitas Sumatera Utara (USU), Kamis (28/6). Selain, Anhar, tampil Budi Agustono. Menyinggung tentang tari Tortor dan Gordang Sambilan yang diklaim Malaysia, Anhar Gonggong mengatakan, Ma-

laysia mengklaim budaya Indonesia karena rendah diri karena budaya kita lebih hebat dari mereka. “Apa rupanya budaya Malaysia, Melayu dari Riau, Batak dari Sumut. Nah jangan gunakan otot, tapi otak,” katanya. Dia menyatakan salah satu syarat menyatakan sebuah budaya itu milik Indonesia daftarkan ke UNESCO dan tidak berhenti begitu saja, tapi terus dilestarikan melalui kerativitas. “Kebiasaan buruk kita, begitu orang lain mengklaim bu-

daya Indonesia milik mereka, kita rebut, sedangkan kita sendiri tidak melesatarikan budaya itu,” tegasnya. Anhar mengatakan agar budaya Indonesia tetap aman dan berkembang, bangsa ini perlu belajar banyak dengan negara Korea dan Jepang. Kedua negara ini sangat begitu menghargai budaya mereka. “Contoh kecil, bagaimana kedua negara itu menghargai waktu. Pemerintah dan masyarakat Indonesia sangat lentur menghargai waktu,” tegasnya. (m49)

Dr RE. Nainggolan Soal Tortor:

Apresiasi Sikap Masyarakat MEDAN (Waspada): Sekalipun klaim Malaysia terhadap tari Tortor dan Gordang Sambilan sangat meresahkan, namun masyarakat Sumut tetap tenang dengan tidak memberikan reaksi berlebihan. Tokoh masyarakat Sumut, Dr RE. Nainggolan, MM mengapresiasi sikap mayoritas warga Sumut yang bisa dengan bijak menanggapi kontroversi pemberitaan tentang klaim itu. “Kita akan mengikuti perkembangannya dengan menunggu hasil klarifikasi yang dilakukan pemerintah. Kami harap klarifikasi bukan hanya lisan, tetapi dalam bentuk tulisan agar menjadi dokumen yang dapat dipertanggungja-

wabkan, serta memberikan kepastian bagi Indonesia,” kata RE Nainggolan, kemarin di Medan. Menurut RE.Nainggolan, jika Malaysia hanya ingin mengapresiasi budaya asli Indonesia di negara mereka sebagai bentuk penghormatan dan pengakuan terhadap budaya warga minoritas, itu sah-sah saja dan harus dihargai. Bagaimanapun juga, akulturasi dan penyerapan budaya antar bangsa tidak dapat dielakkan. “Tapi, jika Malaysia sampai mengklaim, tentu merasa prihatin dan akan berjuang mempertahankan peninggalan budaya nenek moyang yang berasal dari Tanah Mandailing tersebut. Masyarakat kebuda-

yaan internasional perlu saling menghargai, seperti masyarakat Indonesia yang kerap menikmati pertunjukan Ba-rangsoi tanpa pernah mengklaimnya sebagai budaya asli Indonesia,” kata RE.Nainggolan. Dikatakan, pemerintah Indonesia bersama pemerintah daerah dan segenap elemen masyarakat, perlu segera melakukan inventarisasi seluruh warisan kebudayaan dan kesenian asli Indonesia untuk selanjutnya diregistrasi ke UNESCO. Karena UNESCO merupakan badan PBB yang menangani pendidikan, ilmu pengetahuan, dan kebudayaan sebagai warisan dunia.(m07)

Pemukul Mengaku...

meramaikan mantan Gubernur Aceh itu. “Saya marah kepada IrwandiYusuf karena selama ini kurang peduli dengan kami, banyak uang anak yatim dan korban konflik tidak jelas,” tutur Mtr singkat dengan wajah ditutupi sebo di Mapolda Aceh. Mantan panglima dan pendiri Gajah Keng Tgk Hamzah yang juga wakil sekretaris

PA pusat membantah tuduhan atas dirinya terlibat dalam pemukulan. “Saya sebagai keamanan di lokasi itu dan saat kejadian saya di teras gedung utama DPRA menunggu Doto Zaini dan Mualem keluar dari ruangan, waktu itu saya sempat melihat Irwandi berlalu ke arah pintu keluar, di sana dia diramaikan massa,” terangnya. (cb01)

membangun perspektif positif tentang Islam. “Diskriminasi secara alami terjadi di mana saja. Itu disebabkan, mereka tidak memahami dengan baik. Karena itu penting untuk membangun Islam di AS,” tegas Imam Feisal. Feisal yang lahir di Kuwait, selama ini aktif mencetuskan solusi-solusi inovatif demi menyelesaikan berbagai kon-

flik antara komunitas-komunitas Muslim dan Barat yang dapat mengancam keamanan lokal dan global. Membantu pemahaman Sementara, Dubes AS Scot Marciel mengatakan, pihaknya sengaja mendatangkan Imam Feisal ke Indonesia agar dapat membantu meningkatkan pemahaman antarkedua negara (AS-Indonesia). (ok/r-m10)

hang, Kapolsek Parapat AKP Rico Sidabutar, SH, S.Ik, Kanit Laka Iptu Alsem Sinaga dan personil Sat Lantas dan Polsek mendatangi lokasi kejadian. Pantauan Waspada, lokasi jatuhnya mobil itu sulit dilalui hingga personil kepolisian, Basarnas dan anggota TNI dari Yonif 122/KC, terpaksa turun ke lokasi menggunakan tali yang diikatkan ke satu unit mobil derek. Sedangkan, mobil naas itu juga diikat pakai tali guna mengantisipasi jika pohon penahannya tumbang, mobil tidak terguling ke dalam danau. Sedangkan para korban tewas terlihat terlempar di luar mobil bersama pakaian dan barang-barang mereka, dan ada yang terjepit di dalam mobil. Mereka diduga tewas akibat benturan berkali-kali hingga tulang tangan, kaki dan pinggang patah dan ada wajah korban yang hancur. Jenazah para korban bisa dievakuasi satu persatu ke pinggir Danau Toba dan dibawa dengan speedboat ke Pan-tai Sosor Pasir. Dari pantai Sosor Pasir, jenazah dievakuasi ke RSUD DR. Djasamen Saragih, Pematangsiantar untuk divisum. Evakuasi jenazah yang dilakukan sejak pukul 07:00, selesai dilaksanakan pukul 14:30.

Identitas korban yang berhasil didapat yakni pengemudi mobil Parlindungan Harahap, 28, warga Jl. Sei Mencirim, Desa Paya Geli, Kec. Sunggal, Kabupaten Deliserdang, Zulkifli Bin Basir, 54, dan Zaidan, keduanya warga negara Malaysia. Pedianur warga Pakantan, Natal, Kab. Mandailing Natal (Madina), Mushud, dan istrinya yang belum diketahui identitasnya, warga Sijantung, Natal, Madina, Eva dan ibunya Ismaniah, warga Pasar I, Natal, Madina, Sedangkan, korban luka ringan dan berat yakni Maymanur, 10, Sakti Awi, keduanya cucu Pedianur, Marwan, 23, sopir dua mobil penumpang itu dan Sarno. Korban luka berat dan ringan dibawa ke RSUVita Insani, Pematangsiantar untuk perawatan. Menjawab pertanyaan, Kasat Lantas menyebutkan sesuai informasi, mobil naas itu berangkat dari Natal, Madina dengan membawa 12 penumpang pada Rabu (27/6) siang tujuan Medan. Di Balige, Kab. Toba Samosir, sopir berganti membawa mobil saat babak kedua pertandingan sepakbola piala Eropa. “Kuat dugaan, pengemudi mengantuk hingga kecelakaan terjadi.” (a30/a29/crn)

rakatan, warga Simalungun juga memiliki ikatan “benang merah” dengan keluarga besar H Amri Tambunan. Dimana, orang tua beliau H Djamaluddin Tambunan pada 1959 menjabat sebagai Bupati Simalungun.Bahkan sebelum menjabat Bupati Simalungun, pada 1957 menjabat sebagai Wali Kota Siantar. Karenanya, ikatan “benang merah” yang dulu sudah terjalin harus dirajut dan ditumbuh kembangkan kembali. Apalagi, Pak Amri selama memimpin Deliserdang terlihat mampu menjadi perekat dan sangat menghargai pluralisme. ‘’ Semua etnis dirangkul dengan baik sehingga tidak pernah terdengar ada gesekan-gesekan,’’ katanya. Erick memberi contoh pembangunan jembatan Sungai Ular sepanjang 240 meter di Desa Denai Kuala Kec. Pantailabu, Deliserdang yang menghubungkan Desa Kotapari, Pantaicermin, Sergai yang dananya murni dari APBD Deliserdang 2011-2012, adalah contoh bahwa H.Amri Tam-

bunan ingin menjalin silaturahmi antara dua kabupaten yang diputuskan oleh sungai. Bahkan, melalui berbagai terobosan dan gerakan pembangunan yang didukung elemen masyarakat seperti GDSM yang ditindaklanjuti oleh Ir. Faisal selaku Kepala Dinas PU Deliserdang melalui pola swakelola, Konsep Cerdas, “Ceria” dan gerakan moral “Baru Yakin” (Bedah rumah masyarakat miskin/kurang mampu ) percepatan pembangunan di Deliserdang berlangsung luar biasa. Untuk percepatan pembangunan Sumut yang merupakan salah satu provinsi yang memiliki potensi besar sangat dibutuhkan sosok pemimpin yang mampu memenej kebersamaan serta melahirkan berbagai inovasi dan terobosan. ‘’ Karenanya, KNPSI Kab. Serdang Bedagai melihat, sosok H Amri Tambunan merupakan salah satu figur yang paling tepat memimpin Sumut 5 tahun ke depan, ‘’ demikian Erick Purba. (a06)

serahkan berkas ke Kejati dan selanjutnya dilimpahkan ke pengadilan,” ujar Kapolda didampingi Kabid Humas Kombes Gustav Leo dan Kapolresta Banda Aceh Kombes Movan. Mtr mengaku ikut memukul Irwandi karena melihat massa yang terlebih dahulu

Warga AS Takut ... with Islam is What’s Right with America: Discussing Islam in the United States, yang merujuk pada salah satu buku yang ditulisnya. Terkait dengan kehidupan Muslim di AS, Imam Feisal mengatakan, penting bagi warga Muslim AS untuk membangun Islam di negeri mereka. Hal ini, kata Imam Feisal dapat

L-300 Masuk.... kurang 20 Cm hingga sopir kehilangan keseimbangan dan mobil meluncur ke kiri jalan, menghantam tembok pengaman jalan, kemudian terjun ke dalam jurang kemiringan 90 derajat. Ketika meluncur, mobil terhempas di batu di dasar jurang hingga bodimobil sebelah kiri remuk. Namun, mobil tidak juga berhenti dan masih berguling menuju arah danau. Sesudah berguling dan terhempas beberapa kali, mobil akhirnya tertahan pohon yang tumbuh di dasar jurang. Seorang penumpang yang hanya mengalami luka ringan adalah Sarno, 42, anggota TNI warga Medan dan seorang anak Maymanur, 10. Keduanya terlempar dari dalam mobil yang berguling. Saat itu, Maymanur berteriak meminta tolong berkalikali. Warga yang mendengar secara gotong-royong berhasil membawa empat korban yang masih hidup keluar dari jurang. Informasi tentang kecelakaan itu sampai ke pihak kepolisian, yang ditindaklanjuti jajaran Polres Simalungun. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik, Kasat Lantas AKP Baginda Sito-

Amri Tambunan... Sosok kepemimpinan H. Amri Tambunan, kini bupati Deliserdang, putra sulung H Djamaluddin Tambunan (alm) yang pernah menjabatWali Kota Siantar dan Bupati Simalungun, juga seorang pejuang sudah cukup teruji sehingga pantas menduduki jabatan “Sumut 1” untuk 5 tahun ke depan. “ Sebagai generasi muda bangsa kami tahu benar, bagaimana pola kepemimpinan Pak Amri yang merupakan putra pejuang itu dekat dengan rakyatnya sehingga mampu menciptakan rasa kebersamaan dalam memacu percepatan pembangunan” tegas Ketua KNPSI Kab.Serdang Bedagai Erick Sandy Purba didampingi Gintor Sipayung beserta dua rekannya Ucok Dalias Sinuhaji serta Sangana Ginting, kemarin. Erick Purba, keturunan Raja Sordang mengatakan selain berbagai keberhasilan yang sudah dibuktikan dalam memimpin roda pemerintahan, pembangunan dan kemasya-


PULUHAN warga Kutalimbaru dan Pancurbatu saat melakukan aksi demo di Dusun III, Desa Silebo-lebo.

Warga Kutalimbaru Tolak Galian C MEDAN (Waspada): Ratusan warga Desa Gunung Tinggi, Kec. Pancurbatu dan Desa Silebo-lebo, Kec. Kutalimbaru, Kamis (28/6) berdemo menuntut ditutupnya usaha penambangan Galian C di Dusun III, Desa Silebo-lebo. Dalam aksi tersebut warga menyandera dua unit dump truk (DT) yang membawa material Galian C dari pukul 13:00 hingga pukul 18:00 agar disita oleh Dinas Cipta Karya melalui petugas Sat Pol PP yang turun di lokasi. Namun, Kabid Pengawasan Dinas Cipta Karya menolak dengan alasan tidak ada perintah dari atasan. Akibatnya warga dan kelompok pengusaha Galian C nyaris bentrok, namun dapat diredakan aparat kepolisian dan Muspika setempat yang turun ke lapangan. Untuk mengantisipasi massa dua desa yang kian memanas, hampir seratus petugas dari Sat Pol PP Deliserdang, Dinas Cipta Karya dan Pertambangan Deliserdang serta

Muspika dan Polsek Pancurbatu, Polsek Kutalimbaru dan satu peleton Dalmas Polresta Medan bersenjata laras panjang dan TNI turun ke lokasi. Bahkan, Kapolsek Kutalimbaru AKP Robinson Surbakti, Kanit Reskrim Kutalimbaru Ipda Manis Sembiring, Kapolsek Pancurbatu AKP Darwin Sitepu dan Kanit Reskrim Pancurbatu Iptu Gunawan SH serta petugas TNI, menenangkan massa. Pada kesempatan tersebut sebagian warga dari kaum ibu serta para pemuda diantaranya membawa senjata tajam sempat bersikeras dengan petugas segera menahan satu unit alat berat dan dua unit dump truk yang membawa material galian dari lokasi pertambangan. Menurut Ketua DPD LSM Perkasa Deliserdang Zulfan Surbakti alias Upeng, aksi itu menuntut Pemkab Deliserdang segera menutup seluruh lokasi Galian C tanpa izin tanpa pilih kasih.

Upeng juga menuntut Dinas Cipta Karya dan Pertambangan Deliserdang segera mengumumkan berapa lokasi usaha pertambangan Galian C di Deliserdang yang resmi mengantongi izin dari Bupati. Sementara, Kabid Pengawasan Dinas Cipta Karya dan Pertambangan Deliserdang Iwan Januara yang turun ke lokasi bersama Muspika dan petugas sehubungan tuntutan warga mengatakan pihaknya tidak melakukan penyitaan. Dia hanya diperintahkan Kepala Dinas Cipta Karya dan Pertambangan untuk mengkonfirmasi pengusaha Galian C di Dusun III, Desa Silebolebo, Kec. Kutalimbaru. Namun, tak dirincikan bagaimana bentuk konfirmasi itu. Kanit Reskrim Polsek Pancurbatu Iptu Gunawan, SH juga mengatakan, lokasi pertambangan Galian C di wilayah hukum Kutalimbaru berbatasan dengan Pancurbatu dan melibatkan warga dua kecamatan tersebut.(m40)

Medan Agar Bentuk... Indonesia pada tahun itu mencapai Rp4.053,4 triliun. Jumlah ini bisa bertambah lagi apabila produk dalam negeri merajai pasar dalam negeri. Untuk itu, Bayu mengajak produsen Indonesia untuk benar-benar memanfaatkan pasar dalam negeri. Dengan jumlah penduduk mencapai 240 juta jiwa, tentunya ini merupakan pasar yang sangat besar. Jika peluang ini tidak dimanfaatkan, maka peluang itu dipastikan akan direbut pengusaha asing. Diakuinya, saat ini banyak pengusaha luar yang sadar dengan potensi pasar domestik Indonesia. Atas dasar itulah, Bayu mengajak untuk mendorong agar terus mempromosikan 10 produk dalam negeri untuk konsumsi rumah tangga yakni pangan segar, pangan olahan, kuliner, jamu atau produk herbal, kosmetika, furnitur, alas kaki, alat-alat rumah tangga, pakaian serta tekstil. Di samping itu, dia pun berharap agar ke depan produk dalam negeri dan produk kuliner Indonesia dapat dikenal dan bersaing di pasar internasional. Guna meningkatkan hasil produk dalam negeri, Bayu dalam kesempatan itu mengusulkan dibentuknya atase perdagangan antardaerah. Salah satu kota yang seharusnya sudah memiliki atase perdagangan antardaerah itu adalah Kota Medan, sebab ibukota provinsi Sumut ini memiliki banyak sekali produk. Dengan adanya atase perdaganan ini akan memu-dahkan produk dari Medan untuk dipasarkan di daerah seluruh Indonesia. Wali Kota Medan Rahud-

Waspada/Surya Efendi

PRODUK DALAM NEGERI: Wakil Menteri Perdagangan Bayu Krisnamurthi didampingi Wali Kota Medan Rahudman Harahap dan Wakil Wali Kota Dzulmi Eldin mencicipi makanan dan minuman produk asli Kota Medan ketika meninjau stand usai pembukaan pameran Produk Dalam Negeri Regional 2012 di Lapangan Merdeka Medan, Kamis (28/6). man Harahap mengungkapkan, Usaha Mikro Kecil dan Menengah (UMKM) sangat penting kedudukannya dalam perekonomian Kota Medan. Di samping itu memegang peranan dominan dalam penyerapan tenaga kerja. Berdasarkan data Badan Pusat Statistik (BPS), proporsi jumlah pengusaha UMKM mencapai 90% dari total pengusaha yang ada. Artinya, jumlah UMKM mencapai 500 kali lipat dari jumlah usaha besar. Meski demikian kontribusi UMKM terhadap total PDRB Kota Medan

baru mencapai 39,8 persen. Hal ini menunjukkan masih besarnya produktifitas antara UMKM dan pengusaha besar. Dipaparkan Rahudman, UMKM di Kota Medan sampai 2011 berjumlah 222.133 pelaku usaha dengan jenis usaha perdagangan jasa, industri kerajinan dan aneka usaha. Untuk memberdayakan UMKM, Pemko Medan menerbitkan Perda No.14 Tahun 2009 tentang pengembangan UMKM. Salah satu terobosan perda itu adalah penghapusan biaya pengurusan izin bagi UMKM.(m50)

WASPADA Jumat 29 Juni 2012

Medan Metropolitan


Mantan Wadir Narkoba Dituntut 1 Tahun Penjara MEDAN (Waspada): Mantan Wakil Direktur (Wadir) Reserse Narkoba Polda Sumut AKBP ABR, yang menjadi terdakwa dalam kasus menyalahgunakan psikotropika jenis pil happy five dituntut dengan hukuman 1 tahun penjara oleh Jaksa Penuntut Umum (JPU), dalam persidangan di Pengadilan Negeri Medan, Kamis (26/5). Selain itu, terdakwa dikenakan pidana tambahan berupa denda Rp10 juta subsider 3 bulan kurungan. “Terdakwa terbukti secara sah dan meyakinkan melanggar Pasal 60 ayat 5 jo Pasal 71 UU No5 /1997 tentang Psikotropika,” kata JPU Nilma Lubis didampingi Dwi Melly Nova, dalam persidangan yang dipimpin majelis hakim Asban Panjaitan. Dalam kasus tersebut, jaksa menyatakan, terdapat sejumlah hal yang memberatkan terdakwa, di antaranya terdakwa adalah anggota Polri yang seharusnya memberi contoh kepada masyarakat. Berdasarkan dakwaan JPU, terdakwa AKBP ABR tersandung kasus narkoba setelah petugas Direktorat Narkoba merazia Diskotek D’Core di Jln. Putri Merak Jingga, Medan, Sabtu (11/2). Ketika itu, petugas menangkap Sri Agustina dan Jhonson Jingga dengan barang bukti 8 butir pil happy five. Didasarkan pada pengakuan Sri Agustina dan Jhonson Jingga, polisi menangkap Ade Hendrawan, pelayan Diskotek D’Core, keesokan harinya. Dia dituduh sebagai pemasok pil haram tersebut. Namun, keterangan Ade Hendrawan bertentangan dengan tuduhan Sri Agustina dan Jhonson Jingga. Dia justru mengaku disuruh ABR untuk mengambil pil happy five dari atasannya yaitu Jhonson Jingga. Berdasarkan pengakuan itu, ABR pun dicopot dari jabatannya demi netralitas penanganan kasus. Selanjutnya, dia diperiksa sebelum dinyatakan sebagai tersangka. Setelah mendengarkan tuntutan jaksa, majelis hakim menyatakan sidang ditunda dan akan dilanjutkan pada Selasa (3/7) dengan agenda pembelaan terdakwa. Seusai sidang, penasihat hukum ABR, Marudut Simanjuntak menyatakan, pihaknya keberatan dengan tuntutan jaksa. Menurutnya, kliennya tidak layak dituntut dengan hukuman serupa dengan terdakwa Jhonson Jingga. (m41)

Gatot Respon Reuni SMPN 4 MEDAN (Waspada):Plt Gubsu H Gatot Pujo Nugroho ST, merespon positif kegiatan reuni alumni SMP Negeri 4 Medan diwarnai dengan seminar anti Narkoba. Ketua Umum Reuni Temu Kangen Alumni SMP Negeri 4 Medan tahun 1960 sampai 2011 Ferlin H Nainggolan SH, mengemukakan hal itu kepada wartawan, Kamis (28/6). Ferlin yang juga Kepala Biro Organisasi Pemprovsu mengemukakan, Plt Gubsu diharapkan berkenan hadir sekaligus memberikan bimbingan dan arahan. Didampingi Sekretaris Panitia Mahmuddin, Ferlin menjelaskan, Temu Kangen digelar Sabtu 30 Juni 2012 pukul 10:00 sampai selesai di Halaman SMP Negeri 4 Jalan Jati 3 Nomor 118 Medan. Pada kesempatan ini nanti selain melepas kangen juga digelar Seminar Bahaya Narkoba bagi Generasi Muda dan Pelajar dengan narasumber dari BNN Provinsi Sumut, serta Ceramah Keberadaan Geng Motor dan dampak sosialnya bagi pelajar dengan narasumber dari Polda Sumut. Juga akan dilakukan penyerahan kenang-kenangan dari alumni, penyerahan buku untuk perpustakaan, dan penyerahan cenderamata untuk guru-guru. Diharapkan alumni hadir pada acara tersebut (m28)

Waspada/Ismanto Ismail

KANIT Reskrim Polsek Sunggal AKP Victor Ziliwu, SH, SIK, (kanan) sedang menginterogasi tersangka perampok disaksikan petugas juper Reskrim Polsek Sunggal Aiptu Jhoni Tarigan, SH.

Waspada/Andi Aria Tirtayasa

AIPTU Sudarso, anggota Reskrim Polsek Medan Timur menginterogasi tersangka MIL.

Polsek Sunggal Tangkap Residivis Tabrak Mobil, Perampok Dihajar Massa MEDAN (Waspada): Tim khusus Reskrim Polsek Sunggal dipimpin AKP Victor Ziliwu, SH, SIK menangkap seorang residivis yang terlibat berbagai aksi perampokan di wilayah hukum Polresta Medan, Kamis (28/6) malam. Tersangka BM, 32, penduduk Jln. Multatuli, Lorong IV, Lingkungan III, Kelurahan Hamdan, Kecamatan Medan Maimun ditangkap di pelataran parkir salah satu rumah sakit di Jln. TB Simatupang. Polisi juga menyita barang bukti berupa sepedamotorYamahaVega R BK 4331 UQ dan senjata tajam. Informasi diperoleh Waspada di lapangan, tersangka BM merupakan salah seorang pelaku kejahatan yang sudah masuk dalam Daftar Pencarian Orang

(DPO). Kemudian, tim khusus yang dipimpin Kanit Reskrim Polsek Sunggal AKP Victor Ziliwu, SH, SIK, dibantu Panit I Reskrim Aiptu B Sebayang, SH melakukan perburuan terhadap tersangka. Polisi melacak keberadaan tersangka melalui nomor handphone milik Eka Puspika, 36, perawat RSU Haji Adam Malik, yang menjadi korban perampokan pada 15 Juni 2012. Saat itu, korban bersama temannya mengendarai sepedamotor melintas di Jln. Sukamaju, Desa Sunggal Kanan, Kecamatan Sunggal, Kabupaten Deliserdang. Kemudian, tersangka merampas sepedamotor Honda Beat BK 3221 ABF warna merah milik tersangka. Tersangka juga mengambil tas milik korban

berisi dua handphone, STNK sepedamotor, buku tabungan Bank Buana, ATM Bank Buana, KTP dan sejumlah uang. Beberapa hari kemudian, korban mencoba mengurus nomor handphone atas nama dirinya ke salah satu operator seluler. Setelah itu, pihak operator memblokir nomor handphone tersebut dan melakukan pemeriksaan data komunikasi. Hasilnya, nomor handphone milik korban telah digunakan tersangka untuk menghubungi seseorang di wilayah Pematangsiantar. Selanjutnya, polisi melakukan pengembangan dan menghubungi nomor handphone yang pernah dihubungi tersangka. Akhirnya, polisi mendapatkan informasi tentang keberadaan tersangka. Sebelum melakukan penangkapan, polisi terus mengamati kediaman tersangka selama tiga hari. Tersangka diringkus saat membawa istrinya yang hendak melahirkan ke salah satu rumah sakit di Jln. TB Simatupang. Kanit Reskrim Polsek Sunggal AKP Victor Ziluwu, SH, SIK, mengatakan, tersangka merupakan residivis yang telah berulangkali melakukan aksi perampokan. “Tersangka yang selalu membawa senjata tajam ini sudah masuk dalam DPO polisi,” ujarnya. Berdasarkan catatan polisi, tersangka bersama tiga temannya pernah terlibat perampokan Ido Supermarket di Desa Tanjung Selamat, Kecamatan Sunggal, Kabupaten Deliserdang. Tersangka juga terlibat dalam perampokan mobil boks Dihajar Massa Di tempat terpisah, seorang perampok dihajar massa usai beraksi di Jln. MT Haryono depan Uniland, Kec. Medan Timur, Kamis (28/6) sekira pukul 18:00. Sedangkan temannya berinisial LS alias Liki, 24, warga Jln. Sentosa Lama, Kel. Sei Kera Hulu, Kec. Medan Perjuangan, melari-

kan diri. Dalam kondisi babak belur, tersangka berinisial MIL, 26, warga Jln. Pahlawan Gang Istirahat, Kel. Pahlawan, Kec. Medan Perjuangan, diserahkan petugas Sat Lantas Polresta Medan ke Polsek Medan Timur. Informasi yang diperoleh di lokasi kejadian, sore itu korban Maria Lumbantobing, 23, warga Jln Sering, Kec. Sidorejo, Kec. Medan Tembung, baru saja ke luar dari tempatnya bekerja di Jln. Cirebon. Selanjutnya, korban berjalan kaki menyeberang ke Jln. MT Haryono. Saat menunggu angkutan kota, tiba-tiba dua pria mengendarai sepedamotor Suzuki Smash BK 2214 MZ merampas tas korban. Usai merampok, kedua pe-

laku langsung tancap gas ke arah Jln. Cirebon. Sedangkan korban terus berteriak minta tolong. Tak lama kemudian, korban melihat ada dua pengendara sepedamotor terjatuh karena menabrak mobil di Jln. Cirebon. Begitu mengetahui kedua pria yang terjatuh di tengah jalan itu pelaku perampokan, spontan Maria berteriak. Spontan massa menghajar tersangka MIL. Sedangkan temannya Liki melarikan diri. Petugas Sat Lantas Polresta Medan yang melihat peristiwa itu langsung menangkap tersangka MIL dan menyerahkannya ke Polsek Medan Timur. Saat ditanya apakah tersangka MIL kenal dengan tersangka UK yang sebelumnya di-

tangkap karena terlibat sejumlah kasus perampokan di kawasan Jln. Prof HM Yamin, dia mengaku kenal namun tidak termasuk dalam sindikat perampokan tersebut. “Saya kenal UK tapi tak pernah bergabung dengannya dalam aksi penjambretan,” sebutnya. Kapolsek Medan Timur Kompol Patar Silalahi melalui Kanit Reskrim AKP Ridwan Daniel menjelaskan, tersangka MIL masih menjalani pemeriksaan, sedangkan temannya berinisial LS alias Lilik masih diburon. Dijelaskan Ridwan, selain menahan tersangka MIL, pihaknya juga menyita sepedamotor yang dikendarai oleh kedua pelaku dan tas milik korban sebagai barang bukti. (m36/h04)

Waspada/ME Ginting

WALI KOTA Medan Rahudman Harahap didampingi Kadis Kesehatan dr Edwin Effendi dan Kadis Pendidikan Kota Medan Muhammad Rajab Lubis meninjau posko kesehatan yang dibuka di lokasi kebakaran di Kel. Bagan Deli.

Pasca Kebakaran Di Belawan

Dinkes Buka Posko Kesehatan MEDAN (Waspada): Dinas Kesehatan (Dinkes) Kota Medan mengambil inisiatif untuk memberikan pertolongan awal terhadap korban kebakaran di Lingkungan III Lorong Proyek, Kel. Bagan Deli, Kec. Medan Belawan, Senin (25/6). Kepala Dinas Kesehatan Kota Medan dr Edwin Effendi MSc, menginstruksikan kepada semua jajaran unit pelayanan kesehatan di Kota Medan, wajib memberikan pelayanan pengobatan kepada semua korban bencana kebakaran tanpa ada pungutan biaya. “Saya telah tekankan kepada semua instansi kesehatan seperti rumah sakit, klinik, Posyandu, dan Puskesmas yang berada di sekitar lokasi kebakaran yang terjadi wajib memberikan pelayanan kesehatan kepada korban semaksimal

mungkin. Jangan sampai ada rumah sakit menolak bila ada korban musibah hendak mendapat perobatan,” sebutnya. Dikatakan Edwin, posko kesehatan dibuka di lokasi kebakaran sejak Senin (25/6) hingga seminggu ke depan pasca kebakaran. Untuk memaksimalkan pelayanan kepada para korban kebakaran, pihaknya menurunkan enam dokter dan puluhan perawat. Posko itu tetap dibuka sampai kondisi kesehatan korban kebakaran benar benar telah pulih. “Warga yang datang berobat rata-rata menderita penyakit infeksi saluran pernafasan dan luka-luka bakar ringan. Semuanya telah kita berikan pengobatan secara baik. Kita akan terus melayani warga yang hendak mendapat perobatan, dan menginstruksikan personel

untuk melayani semaksimal mungkin,” tuturnya. Kata dia, dari korban kebakaran ada satu orang yang dirujuk ke rumah sakit. Hal itu dikarenakan korban tersebut membutuhkan perawatan khusus. “Ada satu orang sudah kita rujuk ke RS karena membutuhkan penanganan lanjutan karena ada gangguan jantung,” ucapnya. Dia mengimbau seluruh donatur maupun lembagalembaga lainnya yang hendak memberikan pelayanan kesehatan, supaya memberikannya kepada posko kesehatan yang telah dibuka. “Semua bantuan pelayanan kesehatan dikoordinir oleh Dinas Kesehatan Kota Medan. Jadi, jangan sampai masing-masing lembaga buka posko pelayanan kesehatan di lokasi kebakaran. Hal ini bertujuan untuk memberikan pelayanan yang merata terhadap para korban kebakaran,” ujarnya. Sementara itu, Wali Kota Medan Rahudman Harahap saat meninjau posko kesehatan menegaskan kalau Pemko Medan sudah menangani korban kebakaran dengan mempersiapkan posko. “Mereka (korban kebakaran) sudah kita tangani baik dari kesehatan juga makanannya. Karena kita sudah menyiapkan posko. Itulah merupakan langkah awal,” katanya. Untuk selanjutnya, apakah nanti rumah mereka akan dibangun kembali itu nanti dikaji ulang. Apakah mereka layak ditampung kembali, sebab Pemko punya Rusunawa, dan mereka dapat menempatinya agar terhindar dari peristiwa kebakaran. “Yang terpenting saat ini kita tangani kesehatan warga. Mulai dari vitamin, obat-obatan kita berikan secara gratis. Posko ini kita tutup sampai kesehatan warga korban kebakaran benarbenar sudah pulih,” sebut Rahudman. (m50)

Medan Metropolitan


WASPADA Jumat 29 Juni 2012

Poldasu Incar Sejumlah Lokasi Penimbunan CPO Ilegal MEDAN (Waspada): Tim Palm Toba 2012 telah memegang sejumlah data lokasi penampungan dan penimbunan crude palm oil (CPO) ilegal di Medan serta sejumlah wilayah lainnya di Sumut. Beberapa lokasi yang menjadi incaran tim, berada di kawasan Medan Belawan, Labuhanbatu, Tebingtinggi, dan Asahan. “Setelah penggerebekan gudang CPO ilegal di Kabupaten Dairi, sejumlah lokasi lainnya juga akan digerebek. Kita sudah punya data lokasi gudang-gudang ilegal CPO, tinggal menunggu waktunya saja,” kata Wakil Direktur Dit Reskrimum Polda Sumut AKBP Mashudi kepada wartawan di Mapoldasu, Kamis (28/6). Dia mengatakan, pasca


BONGKAR MUATAN: Satu truk pengangkut semen curah membongkar muatannya di salah satu proyek pembangunan rumah toko (ruko) di Jln. Thamrin Medan, Kamis (28/6) siang. Kendati sudah ada aturan yang melarang truk masuk inti kota pada siang hari, namun sopir truk tersebut tidak menghiraukannya. Petugas Sat Lantas Polresta Medan dan Dinas Perhubungan Kota Medan terkesan tidak mampu menertibkan truk yang masuk kota pada siang hari. Padahal, keberadaan truk tersebut menjadi salah satu pemicu kemacatan lalulintas.

Gerakan Pemuda Banuhampu Karena Tidak Laksanakan Perintah Wali Kota Gelar Sunatan Massal MEDAN (Waspada): Gerakan Pemuda/Pelajar Banuhampu Kota Medan menggelar sunatan massal gratis di Rumah Gadang Banuhampu Jln. Sutrisno No 137 Medan, Minggu (1/7). “Kegiatan bertema “Rang Mudo Bakumpua, Rang Mudo Bakreasi” dimulai pukul 08:00 WIB dan dijadwalkan dibuka Plt Gubsu Gatot Pujo Nugroho,” kata Ketua Panitia Mustafa Kamal didampingi Sekretaris Weny Zahra, di Sekretariat Rumah Gadang Banuhampu Medan, Senin (24/6). Menurut Mustafa, kegiatan sunatan massal menargetkan sebanyak 100 orang warga Banuhampu dan warga Kota Medan sekitarnya. “Target kami 100 orang dan bekerjasama dengan Bulan Sabit Merah Indonesia,” ujarnya seraya menambahkan, panitia juga akan memberi tas, alat-alat tulis sekolah, dan kain sarung. Selain menggelar sunatan massal, panitia juga menggelar berbagai perlombaan yakni lomba busana muslim, hafalan surat pendek, lomba mewarnai, dan menyanyikan lagu Minang dengan peserta usia SD hingga SMA. “Kami ingin mengisi hari libur sekolah dengan berbagai kegiatan positif sehingga kreativitas tersebut mampu dipersembahkan pemuda/pelajar Banuhampu kepada masyarakat luas,” kata Mustafa menjelaskan, bagi calon peserta dapat menghubungi sekretariat Banuhampu Medan dengan kontak person 085761311757, 081360027023 dan 083199661279. Ketua Yayasan Banuhampu Drs Zulfan Iskandar didampingi sekretaris dan bendahara H Syaiful dan Ir H Hidayat menyambut baik kegiatan yang digelar pemuda/pelajar Banuhampu Medan. Sebab, menurutnya, kegiatan itu sebagai wujud solidaritas membantu sesama dan mengembangkan kreativitas para anak muda ketika liburan sekolah. (m26)

Bedah Buku Pancasila 1 Juni Dan Syariat Islam MEDAN (Waspada): Baitul Muslimin Indonesia (Bamusi) Sumatera Utara yang merupakan sayap partai PDI Perjuangan menggelar acara bedah buku Pancasila 1 Juni dan Syariat Islam di Asrama Haji Pangkalan Masyhur Medan, Senin (25/6). Ketua Panitia Pelaksana Drs. H. Syahrul Efendi Siregar mengatakan, bedah buku ini bertujuan untuk membumikan isi kandungan Pancasila. Sebab, Pancasila merupakan alat pemersatu bangsa sesuai dengan sila-sila yang ada di dalamnya. “Setelah memahami isi Pancasila dan Syariat Islam, maka kita semua dapat berbuat sesuai dengan amanah dari Pancasila yang dirumuskan Presiden Soekarno,” harap Syahrul Siregar yang juga bakal calon Wakil Gubernur Sumatera Utara periode 2013-2018. Jika kita mempedomani kandungan Pancasila dengan sebenarsebenarnya, lanjut Syahrul, Insya Allah bangsa ini akan makmur dan sejahtera. Rakyatnya hidup aman dan tentram, tanpa ada perpecahan antara kelompok dan golongan serta terhindar dari perbuatan korupsi sebagaimana yang terjadi saat ini. Tampil sebagai narasumber Prof. Dr. Hamka Hag, MA selaku penulis buku “Pancasila 1 Juni dan Syariat Islam, pembanding Prof. Dr. H. Syahrin Harahap, MA dan Prof Dr. H. Asmuni MA. Turut hadir para tokoh masyarakat serta berbagai elemen ormas Islam yang ada di Sumatera Utara, Kadis Pendidikan Sumatera Utara. Sebelumnya PDI Perjuangan Sumatera Utara mengadakan Rapat Kordinasi yang bertujuan memajukan pendidikan dan kebudayan keagamaan, serta menciptakan peningkatan hubungan antar umat beragama di Sumatera Utara.(m25)


SUASANA bedah buku Pancasila 1 Juni dan Syariat Islam di Asrama Haji Pangkalan Masyhur Medan, Senin (25/6).

DPRD Sesalkan Disperindag

MEDAN (Waspada): DPRD Medan melalui Komisi C menyesalkan sikap Disperindag Kota Medan yang tidak melaksanakan perintah wali kota untuk menutup industri pengolahan semen curah di Jln. Irian Barat/Jln. Jawa. Padahal industri tersebut jelas-jelas tidak memiliki izin dan telah menimbulkan dampak polusi (pencemaran) udara, serta memicu kemacatan lalulintas. Ketua Komisi C DPRD Medan A Hie, Kamis (28/6) berpendapat, seharusnya Disperindag tidak hanya sekadar mengeluarkan surat peringatan. Mereka tinggal melaksanakan perintah Wali Kota Medan Drs Rahudman Harahap untuk menutup industri pengolahan semen curah yang tidak memiliki izin. Namun kenyataannya Disperindag Kota Medan tidak memiliki nyali untuk bertindak te-

gas terhadap industri pengolahan semen curah tersebut. Hal ini terbukti dari masih terus beroperasinya industri pengolahan semen curah tersebut hingga saat ini. Padahal, surat perintah penutupan Wali Kota Medan memiliki legalitas hukum yang kuat apabila dijalankan oleg Disperindag, karena industri pengolahan semen curah tersebut telah banyak membuat pelanggaran, selain izin beroperasi yang dikeluarkan oleh Disperindag. Menurut A Hie, pihaknya tetap optimis akan ada jalan keluar terbaik terhadap permasalahan tersebut. Meski Disperindag terkesan lamban dalam menjalankan perintahWali Kota Medan, namun Disperindag tidak bisa mengelak karena keberadaan industri pengelolahan semen curah di inti kota tidak bisa dibenarkan karena

telah mengganggu kepentingan publik. Seperti udara yang tercemar dan lalulintas yang macat. Dalam waktu dekat pihak Komisi C akan memanggil Disperindag Kota Medan, lurah dan camat serta PT Kreasibeton Nusapersada (Kraton) selaku pemilik industri pengolahan semen curah di Jln. Irian Barat/ Jalan Jawa. “Yang kita inginkan adalah mediasi yang terbaik agar kepentingan semua pihak terakomodir,” sebutnya A Hie. Pantauan Waspada, industri pengolahan semen curah awalnya dibangun untuk memasok pembangunan Hotel JW Marriott. Industri tersebut sudah lama beroperasi dan pihak Pemko Medan cq Disperindag termasuk lurah dan camat kecolongan dengan aktivitas PT Kraton tersebut yang terus beroperasi hingga saat ini tanpa adanya izin dari Disperindag. (m30)

DPRDSU Dorong PT TPL Terus Sempurnakan Proses Produksi MEDAN (Waspada): DPRDSU terus mendorong manajemen PT. Toba Pulp Lestari (TPL) terus menyempurnakan proses produksinya. Karena perusahaan yang bergerak di bidang industri pulp ini sangat rentan terhadap lingkungan. Ketua Komisi D DPRDSU Yan Syahrin mengatakan itu kepada wartawan melalui telefon selular, Kamis (28/6). Dorongan itu disampaikan dewan saat melakukan rapat dengar pendapat dengan manajemen PT TPL di Hotel Inna Parapat, Rabu (27/ 6). Pertemuan kali ini tidak dilaksanakan di gedung dewan, karena Komisi D sedang mengadakan kunjungan kerja ke beberapa kabupaten di Sumut. Saat bertemu dengan manajemen PT TPL, menurut Yan Syahrin, seluruh hal yang berkaitan dengan masalah pencemaran lingkungan dipertanyakan anggota dewan. Seperti masalah limbah yang berasal dari gas berbau khas industri pulp, limbah cair dan limbah padat yang dihasilkan industri itu. Dewan juga mempertanyakan masalah tumpang tindih konsesi, reboisasi yang tidak memenuhi standar, pengangkutan

yang tidak merusak jalan serta melindungi keselamatan pemakai jalan lainnya, distribusi dana CSR dan sebagainya. Disebutkan Yan Syahrin, dari jawaban yang diberikan manajemen perusahaan pada rapat itu, dewan memberikan apresiasi kepada PT TPL. Disimpulkan kalau perusahaan secara konsisten terus melakukan pembenahan baik dalam operasionalnya maupun dalan pengelolaan limbah. Direktur PT TPL Juanda Panjaitan, kepada Komisi D menjelaskan, limbah cair dan padat yang dihasilkan perusahaan ini telah diolah dengan menggunakan teknologi terbaru, seperti scrubber, Electrostatic Precipitator (ESP) dan incinerator. Hasil dari teknologi ini cukup memuaskan dan tidak merusak lingkungan. Baku mutu yang dihasilkannya berada pada Nilai Ambang Batas (NAB) yang ditetapkan pemerintah. ‘’Pengakuan perusahaan, mereka juga secara rutin diaudit oleh Sucofindo,’’ kata Yan Syahrin. Menyangkut tumpang tindih lahan dengan perusahaan lain, Juanda Panjaitan mengatakan, telah diselesaikan dengan

baik. Yakni PT TPL rela mengeluarkan 81 ribu hektare lahan dari konsesi. Pemerintah sebelumnya memberikan konsesi kepada PT TPL 269.060 hektare, kini berkurang menjadi 188.055 hektare. Menyangkut Corporate Social Responsibility (CSR), manajemen PT TPL mengatakan, pemanfaatannya ditangani beberapa Pemkab yang berada di sekitar wilayah kerja perusahaan. Hanya di Kab. Tobasa yang CSR-nya masih dikelola sebuah yayasan. Sedangkan di bidang kemitraan, PT TPL telah menjalin kerjasama dengan 362 perusahaan lokal yang mempekerjakan 5.330 orang, dengan nilai transaksi pada tahun 2011 Rp1 triliun lebih. SelainYan Syahrin, personel Komisi D DPRDSU yang hadir dalam pertemuan itu yakni Zulkifli Effendi Siregar, Biller Pasaribu, M. Yusuf Siregar, Enda Mora Lubis, Guntur Manurung, Jamaluddin Hasibuan, Marahalim Harahap, Ajib Shah, Budiman Nadapdap, Analisman Zalukhu, Amsal Nasution, Zulkarnain, Maratua Siregar, Nurul Azhar Lubis dan Restu Kurniawan Sarumaha. (m12)

penggerebekkan gudang CPO ilegal di Dusun Sitinjo, Kec. Sitinjo, Kab. Dairi, oleh Tim Palm II Toba (CPO), Selasa (26/6) malam, beberapa lokasi lainnya seperti di Belawan menjadi target berikutnya. “Kemarin kita telah mengamankan enam orang, termasuk truk dan drum- drum berisi CPO diduga hasil curian. Tetapi selain di Dairi, masih banyak gudang-gudang penampungan CPO ilegal yang masih beroperasi di Sumut, dan akan segera ditindak,” sebutnya. Kata Mashudi, pihaknya tidak akan main-main dalam memberantas tindak kejahatan penyelundupan dan pencurian CPO. “Minyak sawit mentah merupakan komoditi andalan Sumut dan salah satu penda-

patan daerah, sehingga perlu pengamanan serius untuk memberi kepercayaan kepada pengusaha sawit dan stake holder (pemegang keputusan). Dengan begitu, akan menguatkan produksi CPO Sumut yang muaranya untuk kesejahteraan rakyat,” ujar dia. Kapoldasu Irjen Pol. Wisjnu Amat Sastro sebelumnya juga mengatakan telah memiliki data lokasi daerah rawan tindak kejahatan penyelundupan dan pencurian CPO, mulai dari Kabupaten Labuhanbatu, Asahan, Tebing Tinggi, Sergaim dan Belawan. “Sudah kita pegang data lokasinya. Polres terkait diminta bekerja serius menuntaskan kasus yang meresahkan para pengusaha CPO itu,” kata Wisjnu.(m27)

Sepedamotor Pelajar SMP Dirampok Korban Dituduh Tabrak Adik Pelaku MEDAN (Waspada): Tiga pria mengendarai Yamaha Mio merampok sepedamotor yang dikendarai pelajar SMP dengan modus menuduh korban menabrak adik pelaku, di Jln. Puri Medan, Kamis (28/6). Akibat peristiwa ini, korban Rino Suwandi, 14, warga Jln. Puri Gang Kaleng, kehilangan Honda Supra X 125 BK 2564 AAH. Kasus tersebut sudah dilaporkan orangtua korban Elvita, 44, ke Polsek Medan Area. Sedangkan ketiga pelaku sampai saat ini masih diburon. Menurut korban, peristiwa itu terjadi sekira pukul 10:00. Pagi itu korban bersama adiknya keluar dari rumah mengendara sepedamotor bermaksud menjemput ibunya yang jualan

di Jln Puri. Setibanya di Jln Puri depan Gang Irama, korban dicegat pelaku yang berboncengan tiga mengendarai sepedamotor Mio. Salah seorang di antara pelaku menuduh korban telah menabrak adiknya. Tuduhan itu dibantah korban. Pelaku kemudian mengajak korban untuk menemui adiknya yang ditabrak. Korban yang merasa tidak ada menabrak mau saja diajak pelaku. Selanjutnya korban diajak pelaku naik sepedamotornya, sedangkan adiknya ditinggal. “Saya diajak keliling sama pelakunaiksepedamotorhinggasampai di Jalan Laksana,” kata Rino. Menurut korban, pelaku yang membawa sepedamotor

sedangkan dirinya dibonceng. Setelah itu aku disuruh menunggu di sepedamotor dan kuncinya dipegang pelaku. Mereka bertiga terlihat berbincangbincang, setelah itu aku diajak naik sepedamotor menuju ke Gang Amal Bhakti yang sepi. Di lokasi yang sepi itu, pelaku menyuruh korban turun dan mengancam akan melakukan penganiayaan. “Begitu saya turun, pelaku terus membawa lari sepedamotor ku,” kata Rino. Kanit Reskrim AKP J Banjarnahor yang dikonfirmasi Waspada membenarkan korban telah membuat pengaduan ke Polsek Medan Area. “Korban didampingi orangtuanya masih membuat laporan pengaduan,” katanya. (m39)

Dua Bandar Togel Ditangkap MEDAN (Waspada): Dua tersangka bandar judi toto gelap (togel) ditangkap petugas Subdit III unit Judi Dit Reskrimum Polda Sumut, dari dua lokasi berbeda. Kedua tersangka AMS, 32, warga Desa Nagori Huta Parit, Kec. Ujung Padang, Simalungun, dan M, 41, warga Jalan Malaka, Medan. Kanit Judi Dit Reskrimum Poldasu Kompol Saptono kepada wartawan, Kamis (28/6) mengatakan, kedua tersangka

ditangkap Rabu (27/6) malam. Tersangka AMS ditangkap tidak jauh dari kediamannya. Dari dia diamankan barang bukti 14 blok kupon togel, 1 HP, 2 kalkulator dan 2 buku rekap. Sedangkan tersangka M ditangkap di kawasan Jln. Malaka persimpangan Jln. Pintu Padang. Dari dia diamankan barang bukti 4 HP, 1 kalkulator, 1 buku tafsir mimpi dan 1 catatan omset togel. Menurut Saptono, kedua

bandar togel itu menjalankan bisnisnya melalui HP. “Pemasangan nomor togel melalui HP,” kata dia menyebutkan, setiap hari omset keduanya mencapai puluhan juta rupiah. Sementara, tersangka AMS kepada penyidik mengaku menjalankan bisnis togel karena kebutuhan ekonomi. “Pendapatan saya dari berdagang tidak mencukupi, sehingga menjalankan bisnis togel,” sebutnya.(m27)

Pecahkan Kaca Angkot Dihajar Sopir MEDAN (Waspada): Tersangka A, 35, warga Jln. Tangguk Bongkar Mandala, babak-belur dihajar sopir angkot karena memecahkan kaca mobilnya saat menunggu lampu merah di persimpangan Jalan Mandala, Kamis (28/6). Selanjutnya tersangkan diserahkankePolsekPercutSeituan. Tapi karena kejadiannya di wilayah Polsek Medan Area tersangka

diserahkan ke polsek tersebut. Informasi di Polsek Percut Seituan, peristiwa berawal saat korban M Salim, 33, sopir angkot Medan bus 48 jurusan AmplasPinang Baris berhenti di persimpangan Jalan Mandala karena lampu merah. Tiba-tiba pelaku datang menghampiri angkot korban dengan membawa batu ditangannya. Setelah dekat lang-

sung melemparkan batu tersebut ke kaca sebelah kanan mobil korban hingga pecah. Melihat itu, korban bersama temannya langsung turun dari angkot menghampiri tersangka dan menghajarnya hingga babak-belur. Tersangka kemudian dibawa ke Polsek Percut Seituan dan akan diserahkan ke Polsek Medan Area karena lokasi kejadian di wilayah Medan Area. (m39)

Camat Sesalkan Pengrusakan Pagar Lapangan Mandala MEDAN (Waspada): Camat Medan Denai Edi Mulia Matondang, SSTP menyesalkan kasus pengrusakan pagar seng Lapangan Mandala di Kelurahan Tegal Sari Mandala I, yang dilakukan orang tidak dikenal, Kamis (28/6) dinihari. Kepada wartawan, Kamis (28/6), Edi menjelaskan, tindakan pengrusakan ini sama halnya dengan mengganggu program pemerintah kota dalam rangka pengembangan usaha mikro kecil dan menengah (UMKM) di kawasan itu. Selama ini, kawasan tersebut menjadi kumuh karena banyaknya pedagang liar berjualan hingga ke badan jalan. Melalui kerjasama dengan PT. Kereta Api Indonesia (KAI), kata Edi, maka di lokasi eks lapangan sepakbola ini akan

dibangun kawasan MPR (Mandala Pasar Rakyat), sebagai upaya merelokasi padagang setempat serta pedagang buku dari Titi Gantung dan lapangan Merdeka. Selain itu, PT.KAI akan membangun stasiun kecil di kawasan tersebut. Sampai saat ini, lanjut Edi, Lapangan Mandala itu merupakan milik PT.KAI. Belum ada pihak yang datang ke kantor camat untuk memperlihatkan surat kepemilikan atas tanah itu. “Yang saya tahu, tanah itu milik PT KAI.Warga hanya pinjam pakai berjualan di areal itu, selama belum digunakan PT. KAI. Bahkan kalau ada kegiatan, warga meminta izin kepada PT KAI untuk pemakaian lapangan itu, bukan kepada oknum tertentu,” ujarnya. Camat mengingatkan, apa

yang dilakukan pemerintah semata-mata untuk kemaslahatan atau kepentingan warga. Kalau ini berhasil dibangun, tentu warga Medan Denai patut merasa bangga karena memiliki tempat jajanan dan taman rekreasi yang nyaman. “Harapan saya, kiranya warga tidak terprovokasi untuk melakukan tindakan anarkis. Kasus pengrusakan pagar ini telah dilaporkan PT. KAI ke polisi,” tambahnya. Sementara itu, Ketua KNPI Medan Denai Romi Ahmad Lubis, Ketua PAC PP Medan Denai Pardomuan Sitanggang, Sekretaris AMPI Medan Denai Juanda Ikbal, Ketua Angkatan Muda Ka’bah (AMK) Zoelfikar menyatakan dukungannya terhadap upayaPemkoMedandanCa-mat Medan Denai membangun sarana bisnis bagi UMKM itu.(m22)

Medan Metropolitan

WASPADA Jumat 29 Juni 2012


Anggota DPRDSU Dan Kakanwil PT Pos Sumut-Aceh Dituntut 18 Bulan MEDAN (Waspada): Anggota DPRDSU dari Fraksi Partai Demokrat berinisial PN dan Kakanwil PT Pos Indonesia Sumut-Aceh berinisial Sup dituntut dengan hukuman 18 bulan penjara oleh Jaksa Penuntut Umum (JPU) di Pengadilan Negeri Medan, Kamis (27/6). Dalam persidangan yang dipimpin Ketua Majelis Hakim ET Pasaribu, kedua terdakwa dinyatakan bersalah melakukan tindak pidana perjudian bersama dua orang lainnya, yaitu Fah dan HS. Mereka didakwa melanggar Pasal 303 Bis ayat 1 ke (1) KUHPidana tentang PerWaspada/Ist

ADIK kandung Chairuman Harahap, Hj Tetty Derlina Harahap (kiri) menyaksikan penyerahan bantuan hati ke hati dari Chairuman untuk korban kebakaran 39 rumah nelayan di lingkungan IV Lorong Proyek Kel.Bagandeli Kec. Medan Belawan.

Chairuman Bantu Korban Kebakaran Belawan MEDAN (Waspada): Bakal Calon (Balon) Gubernur Sumut Dr H.Chairuman Harahap, SH, MH menyalurkan bantuan hati ke hati kepada korban kebakaran 39 rumah nelayan di lingkungan IV Lorong Proyek Kel. Bagandeli, Kec. Medan Belawan, Selasa (26/6). Chairuman yang sedang menjalankan tugasnya sebagai anggota DPR RI di Jakarta mewakilkan kehadirannya kepada adik kandungnya Hj. Tetty Derlina Harahap. “Kehadiran kami ini merupakan bentuk solidaritas dan kekeluargaan antara Bapak Chairuman Harahap dengan masyarakat di Kelurahan Bagandeli yang sedang mengalami musibah ini,” kata Hj Tetty didampingi ajudan Chairuman Dedy Humala Siregar SE. “Beliau menitip salam kepada korban yang kena musibah, semoga tabah dan tetap semangat dalam menjalani hidup ini. Karena setiap cobaan pasti memiliki hikmah. semoga korban tetap tabah dan semangat,” sebutnya. Menerima kehadiran rombongan, para keluarga korban mengucapkan terima kasih yang mendalam kepada Chairuman Harahap. “Alhamdulillah, syukur terima kasih atas bantuan bapak Chairuman, semoga bapak dimurahkan rezekinya dan tambah sukses,” ujar Abdul Majid keluarga korban yang meninggal dunia. Dia berharap apa yang telah diberikan oleh Chairuman pada hari itu semoga mendapat balasan yang setimpal dari Tuhan Yang Maha Esa. Dia juga berharap agar pemberian tersebut dapat dimanfaatkan dengan sebaik-baiknya. “Mewakili masyarakat di sini, saya mengucapkan banyak berterimah kasih kepada bapak Chairuman dimana beliau sudah menyumbangkan rezekinya untuk kita di sini, rakyat yang sedang mengalami musibah kebakaran. Mudah-mudahan sumbangannya ini bisa mengurangi masalah yang dialami para korban,” kata tokoh masyarakat Syafrizal. Chairuman Harahap memang merupakan tokoh masyarakat yang peduli dengan penderitaan sesama. Ia selalu tampak hadir dalam setiap musibah yang dialami masyarakat dengan memberikan bantuan kepada para korban. Bantuan tersebut sebagai wujud empati yang diberikan dari hati ke hati.(m07/rel)

PAN Bantu Korban Kebakaran Belawan BELAWAN (Waspada): Pengurus dan kader Partai Amanat Nasional (PAN) Sumut memberikan bantuan kepada warga pemilik 38 rumah yang terbakar di Lorong Mesjid dan Lorong Proyek, Lingk. III dan IV, Kel. Bagan Deli, Rabu (27/6). Bantuan diserahkan Ketua DPW PAN Sumut Syah Affandin alias Omdin kepada koordinator Posko Kebakaran PAN Belawan disaksikan anggota DPRD Kota Medan Fraksi PAN Ahmad Arif, dan sejumlah kader PAN Belawan. Syah Affandin mengatakan, bantuan 1 ton beras ditambah 100 kotak mi instan itu merupakan sumbangan kader PAN Sumut. “Bantuan ini sebagai bentuk kepedulian PAN terhadap masyarakat pinggiran terutama nelayan dan dikumpul secara spontan tidak lama setelah kita tahu ada kebakaran ini,” katanya. Omdin yang juga Ketua Himpunan Nelayan Seluruh Indonesia (HNSI) Sumut tersebut, berharap Pemko Medan membantu pembangunan kembali rumah milik korban kebakaran agar mereka tidak terlalu lama menderita di tenda-tenda penampungan . “Melalui Fraksi PAN DPRD Medan, kita akan mendesak Pemko membangun rumah korban karena jika terlalu lama ditenda penampungan mereka bisa sakit,” sebut calon Gubsu dari PAN itu. Saat meninjau lokasi kebakaran, Omdin bertemu dengan ibu kandung Rahayu, korban tewas dalam kebakaran itu, dan spontan memberikan bantuan kepadanya. “Kami turut prihatin dengan yang ibu alami dan semoga keluarga sabar dan tabah menghadapinya,” kata Omdin sambil menyalami ibu korban. (h03)

PLN Gelar Donor Darah BELAWAN (Waspada): Sebagai wujud amal bhakti demi kemanusiaan, karyawan PLN (Persero) Sektor Pembangkitan Medan melaksanakan donor darah di kantor PLN Kel. Paya Pasir, Kec, Medan Marelan, Rabu (27/6). Manager PLN Sektor Pembangkitan Medan Seger melalui Asmen Engineering Rizal Hasan Lubis mengatakan, kegiatan tersebut merupakan bagian dari upaya memenuhi kebutuhan stok darah di Medan. Sebab saat ini, Medan masih tercatat minim stok darah terutama darah golongan AB. Untuk itu, pihaknya merasa terpanggil untuk menggelar bhakti sosial yang digagas oleh Badan Kesejahteraan Karyawan (BKM) bersama Serikat Pekerja (SP) diketuai Suryadi. Antusias karyawan mendonorkan darah cukup tinggi, tercatat 60 orang karyawan turut ambil bagian dan mereka ditangani tim dokter dari PMI Cabang Medan dipimpin dr Randy. Mengingat manfaat mendonor darah memberikan dampak kesehatan jantung serta mendeteksi penyakit, kedepan PLN Sektor Pembangkitan Medan berencana akan melaksanakan donor darah itu secara berkesinambungan, minimal 6 bulan sekali. (h03)

Waspada/ Rustam Effendi

KARYAWAN serta unsur Serikat Pekerja PLN (Persero) Sektor Pembangkitan Medan mendonorkan darah dalam upaya amal bhakti kemanusiaan.

judian. “Keempat terdakwa dinyatakan secara sah melanggar Pasal 303 Bis ayat 1 ke (1) KUHPidana tentang perjudian,” kata Jaksa Penuntut Umum (JPU) Marina Surbakti. JPU memaparkan, PN bersama Sup dan dua terdakwa lainnya diringkus polisi pada 5 Mei 2012 sekitar pukul 20:00 saat bermain judi jenis joker karo. Penangkapan bermula dari informasi mengenai adanya perjudian di sebuah rumah makan di Lapangan Golf Martabe, Medan Tuntungan. Berbekal informasi itu, petugas langsung turun ke lokasi dan melakukan pengintaian.

Setelah diintai selama 15 menit, petugas langsung melakukan penggerebekan. Dalam penangkapan itu, petugas menyita uang tunai Rp1,1 juta dan dua set kartu joker dari meja yang digunakan para terdakwa. Keempatnya langsung diboyong ke Polresta Medan untuk dimintai keterangan. Mereka tidak ditahan, namun perkaranya berlanjut ke pengadilan. Atastuntutantersebutterdakwa dan kuasa hukumnyaWarinson Sinaga akan menyampaikan (pledoi)pembelaan.Setelahmendengar tuntutan dari JPU, Ketua Majelis Hakim ET Pasaribu menyatakan, sidang akan dilanjutkan Senin (2/7). (m41)

Tiga Pengedar Narkoba Diringkus MEDAN (Waspada): Tiga pengedar sabu-sabu asal Provinsi Aceh, diringkus petugas Sat Res Narkoba Polresta Medan, di Jalan Kasuari, Kec. Medan Sunggal, Kamis (28/6) sekira pukul 01:00. Dari ketiga tersangka, polisi menyita 50 gram sabusabu sebagai barang buktinya. Informasi yang diperoleh di kepolisian, ketiga tersangka berinisial Nas alias Abi, 30, An, 35, dan Za, 39, baru saja tiba di Medan setelah seharian menumpang bus dari Aceh. Setibanya

di Medan, ketiga tersangka langsung menyewa kamar di penginapan Sabena Jalan Kasuari. Polisi yang mendapat informasi keberadaan ketiga penggedar narkoba itu, langsung menuju penginapan tersebut melakukan penggerebekan. Ke tiga tersangka yang sedang istirahat tersebut tidak berkuti saat polisi menemukan 5 paket sabu-sabu dalam kemasan plastik seberat 50 gram. Kepada petugas, tersangka Nas alias Abi mengakui sabu

tersebut milik mereka dan hendak dijual di Medan, sisanya lagi akan dikonsumsi. “Sabu-sabu itu akan dijual dan sisanya akan dikonsumsi bersama,” ujarnya. Kanit Idik II Narkoba Polresta Medan Iptu Tina Pulitawati saat dikonfirmasi wartawan, membenarkan penangkapan tiga pengedar narkoba tersebut. “Ketiga pengedar SS tersebut ditangkap di Penginapan Sabena dan kini masih menjalani pemeriksaan dan pengembangan,” ujar Tina. (h04)

Hari Ini, Hatta Radjasa Kunjungi Andalas Fair MEDAN (Waspada): Menteri Koordinator Perekonomian Hatta Radjasa dijadwalkan akan mengunjungi pameran dan taman hiburan rakyat Andalas Fair 2012 di arena Pekan Raya Sumatera Utara (PRSU), Tapian Daya, Jln. Gatot Subroto, Medan, hari ini (Jumat 29/6). Rencana kedatangan Hatta Radjasa disampaikan Pemimpin Umum/Pemimpin Redaksi Harian Andalas Iskandar ST didampingi Ketua Panitia Andalas Fair Zulham Effendi Parinduri, pada pembukaan Andalas Fair, Kamis (28/6). “Kita sangat gembira dan bersyukur karena Andalas Fair mendapat sambutan positif dari pemerintah pusat. Hal ini dibuktikan dengan rencana kedatangan Pak Hatta Radjasa ke Andalas Fair,” ujar Iskandar. Menurutnya, kedatangan Menko Perekonomian merupakan wujud besarnya perhatian

pemerintah pusat terhadap perkembangan kehidupan perekonomian di Sumatera Utara, khususnya Kota Medan. Melalui Andalas Fair yang merupakan ajang transaksi, promosi dan rekreasi, dapat diperoleh gambaran tentang perkembangan kemajuan pembangunan di Sumatera Utara terutama Kota Medan. Dalam hal ini, seluruh pemerintah daerah di Sumut, baik provinsi maupun kabupaten/kota juga turut berpartisipasi meramaikan Andalas Fair dengan membuka stan. “Selain meninjau ke stanstan pameran, Pak Hatta Radjasa juga dijadwalkan melakukan dialog dengan para pengusaha terutama pelaku usaha mikro kecil menengah dan koperasi yang meramaikan Andalas Fair,” jelas pemilik Star Media Group tersebut. Selain menyemarakkan


PENGURUS MPW PP Sumut diabadikan saat menyerahkan bantuan ke Panti Asuhan Bani Adam.

PP Bantu Yatim Piatu MEDAN (Waspada): Majelis Pimpinan Wilayah Pemuda Pancasila (MPW PP) Sumatera Utara (Sumut) menyerahkan bantuan ke Panti Asuhan Bani Adam, Jln. Mangaan 2 Mabar, Kamis (28/6). Bakti sosial bertajuk Menuju Sumut Sehat ini, menurut Ketua MPW PP Sumut Anuar Shah, SE, merupakan kegiatan rutin yang terus dilakukan organisasi Pemuda Pancasila dalam membantu masyarakat kurang mampu terutama anak yatim piatu di Panti Asuhan. Di Panti Asuhan Bani Adam ini, PP menyerahkan bantuan 75 karung beras dan 60 kotak mi instan serta sejumlah uang. Bantuan tersebut diserahkan Sekretaris MPW PP Sumut H. Firdaus Nasution didampingi Ketua Bidang Ketahanan Nasional Mbelgah Tarigan dan Ketua BidangPerananWanitasertasegenap pengurus MPW PP Sumut. Sekretaris MPW PP Sumut H. Firdaus Nasution mengatakan, kondisi panti asuhan ini sangat prihatin. Ini menjadi alasan utama bagi PP untuk memberikan bantuan. Sementara itu, Pimpinan Panti Asuhan Bani Adam Nursyafriana didampingi para santri mengucapkan terima kasih atas bantuan yang diberikan Pemuda Pancasila. “Bantuan seperti ini sangat dibutuhkan para santri untuk memenuhi kebutuhan hidup,” ungkapnya. Selain yatim piatu, anakanak yang menghuni panti asuhan tersebut juga berasal dari keluarga kurang mampu. Mereka datang dari berbagai daerah di Sumatera Utara.(m08)

HUT ke-7 Harian Andalas yang jatuh pada 14 Juli dan memeriahkan HUT ke-422 Kota Medan pada 1 Juli, kata Iskandar, Andalas Fair digelar sebagai bentuk sumbangsih Harian Andalas membantu program pemerintah dalam mendorong perekonomian masyarakat di Sumut lewat konsep pameran dan taman hiburan rakyat. “Kami berharap penyelenggaraan Andalas Fair ini benarbenar memberikan manfaat positif kepada pemerintah, pelaku usaha dan seluruh masyarakat di Sumatera Utara, terutama Kota Medan,” katanya. Sementara itu, Ketua Panitia Andalas Fair Zulham Effendi Parinduri menambahkan, dari 350 stan yang disediakan panitia, lebih dari 95 persen terisi peserta pameran yang terdiri dari pelaku UMKM dan koperasi, BUMN/BUMD, perusahaan swasta nasional, berbagai lembaga, instansi pemerintah dan lainnya. Selain menjadi ajang promosi dan transaksi berbagai produk barang dan jasa, Andalas Fair juga menyuguhkan beragam acara dan wahana hiburan. Diantaranya funland, yakni wahana permainan dan hiburan yang khusus didatangkan dari Batam, seperti octopus, musik dance, frog hopper, merry go round, mini train, mini octopus, mini swing, air plane, horse go round, jet 12, cat and elephant dan banyak lagi. Andalas Fair juga diramaikan dengan kehadiran dua ekor gajah yang didatangkan dari Badan Konservasi Sumber Daya Alam.(m25)

Waspada/Amir Syarifuddin

KADIS Kominfo Sumut DR H Asren Nasution,MA (kiri) menyerahkan pala bergilir Gubsu kepada Kadis Kominfo Medan Ir H Zulkifli Sitepu SH, MM, atas keberhasilan tim binaan Pemko Medan meraih juara I Lomba Obrolan Pembangunan Kelompok Informasi Masyarakat (KIM) didampingi Kabid SKDI Diskominfo Sumut Hj Rosmidar SAg, MPd (kanan).

Plt Gubsu: Gali Kearifan Lokal Melalui KIM MEDAN (Waspada): Plt Gubsu H Gatot Pujo Nugroho ST, perintahkan Kadis Kominfo Sumut intensif menggali kearifan lokal melalui berbagai sarana komunikasi, termasuk media kelompok informasi masyarakat (KIM). “Kearifan lokal asli Sumut cukup luas dan banyak. Harus dihidupkan kembali agar mewarnai pola sikap dan perilaku berbudaya masyarakat,” kata Gatot di AulaYPAC Medan, Rabu (27/6) sore. Di hadapan pemangku amanah informasi dan komunikasi se-Sumut pada penutupan Lomba Obrolan Pembangunan KIM tingkat Sumut, Gatot dalam sambutan dibacakan Kadis Kominfo Sumut DR H Asren Nasution MA, perintahkan jajaran komunikasi khususnya Kadis Kominfo Sumut menggali kearifan lokal itu melalui komunikasi produktif. Plt Gubsu memberi apresiasi Lomba Obrolan Pembangunan KIM yang berbentuk media

komunikasi tradisional berbasis kearifan lokal. Dia berharap KIM harus lebih diaktifkan di seluruh kabupaten dan kota. Pada lomba kali ini, Kota Medan melalui kelompok informasi masyarakat Sanggar Generasi binaan Dinas Kominfo Medan, berhasil meraih juara I dan piala bergilir Gubernur Sumut dalam lomba yang digelar Dinas Kominfo Sumut tersebut. Kadis Kominfo Kota Medan Ir H Zulkifli Sitepu SH, MM didampingi Kabid TI Ir H Tajuddin MSi, dan Kabid Data Drs Harunsyah, MAP merespon positip dan bersyukur atas prestasi ini. “Memang komitmen Wali Kota Rahudman Harahap, Medan sudah siap bersaing dan mampu mensejajarkan diri dalam bidang teknologi informasi dan komunikasi, baik media modern maupun media tradisional termasuk pengembangan KIM berbasis kearifan lokal,” ujarnya. Dikemukakannya, Medan telah menerima ICT Award dari Menkominfo atas keberhasilan

teknologi informasi dan komunikasi, PEGI Award atau Pemeringkatan Electronics Governments Indonesia pada 16 Juni 2012 yang merupakan satusatunya di luar Pulau Jawa. Kabid SKDI Kominfo Sumut Hj Rosmidar SAg, MPd didampingi Kasi Komunikasi Sosial Dra Mahernita Tarigan, sebelumnya melaporkan lomba diikuti 25 peserta dari kabupaten dan kota di Sumut. Dewan juri DR Amir Purba, Drs Suyadi San MPd, dan Nina Siregar MA melaporkan, juara II dan III yakni KIM Sanggar Cermin Serdangbedagai dan KIM Palipi Samosir. Sedangkan juara Harapan I, II dan III yakni KIM utusan Pematangsiantar, KIM Sejahtera Tebingtinggi dan KIM Tanjungbalai. Kadis Kominfo Sumut DR H Asren Nasution MA, menyatakan bangga terhadap kelompok kesenian yang memeriahkan even ini dan jika ada tingkat nasional dia memotivasi juara I bersiap-siap diutus mewakili Sumut. (m28)

Telkom Kucurkan Dana PKBL Rp1,5 M MEDAN ( Waspada): PT Telekomunikasi Indonesia, Tbk Community Depelopment Sub Area (CDSA) Medan mengucurkan dana sebesar Rp1,5 miliar kepada mitra binaan untuk Triwulan II tahun 2012. Dana tersebut merupakan Program KemitraandanBinaLingkungan(PKBL) untuk membina para pelaku usaha kecil menengah (UKM). Koordinator CDSA Medan Ben Sugito mengatakan, Kamis (28/6), bantuan yang diberikan Telkom bertujuan agar para pelaku UKM memiliki modal untuk mengembangkan usahanya. “CDSA Medan mengucurkan dana bantuan usaha kepada 58 mitra binaan Telkom yang totalnya mencapai Rp1. 580.938.000 untuk wilayah Kabupaten Langkat, Deliserdang, Medan, Binjai dan sebagian Kabupaten Serdangbedagai,” ujarnya. Menurut Ben, CDSA Medan telah membina sekitar 600 mitra binaan UKM. Pada triwulan I, dana yang dikucurkan kepada 55 mitra binaan sebesar Rp1,7 miliar, dengan target Rp10 miliar pada akhir 2012. Sehingga total bantuan yang dikucurkan dari CDSA Medan pada 2012 sebesar Rp3,2 miliar. Untuk wilayah Sumatera, lanjut Ben, total bantuan yang dikucurkan Telkom pada Triwulan II mencapai Rp13 miliar. Telkom tidak hanya memberi

bantuan berupa modal, tapi juga membina dan mengikutsertakan para mitranya di berbagai pameran. Telkom menilai sangat penting membantu pertumbuhan UKM melalui program kemitraan dan bina lingkungan sebagai bagian program kepedulian perusahaan terhadap masyarakat. Mengenai pertumbuhan bina kemitraan Telkom, kata Ben, sebanyak 35 pelaku UKM mendapat bantuan kembali. Sisanya 23 pelaku UKM merupakan wajah baru yang menda-

pat bantuan permodalan dari Telkom. Banyaknya pelaku UKM yang mendapatkan bantuan kembali tersebut, membuktikan tingkat keberhasilan pembinaan yang dilakukan Telkom CDSA Medan cukup baik. “Jumlah tersebut cukup baik. Artinya, mereka yang mendapatkan pinjaman kembali telah berhasil menjalankan usahanya dan mengembalikan uang yang dipinjam pada periode sebelumnya,” tambah Ben.(cdu)


KOORDINATOR CDSA Medan Ben Sugito menandatangani kontrak kesepakatan dana pinjaman bergulir dengan salah satu pelaku UKM binaan Telkom.



CMNP Sumbang Pembangunan Gedung KPK

PDIP Sadari Terjadinya Pelemahan Politik JAKARTA (Waspada): Partai Demokrasi Indonesia Perjuangan (PDIP) menyadari sepenuhnya telah terjadi suatu proses pelemahan politik (merosotnya pamor politik), sebagai akibat dari pendalaman pragmatisme dalam kehidupan berbangsa dan bernegara. Karena itu, PDI Perjuangan sebagai salah satu partai politik melakukan pendidikan kader untuk menghadapi tantangan itu. “ Pelemahan politik akibat pendalaman pragmatis kita hadapi dengan pendidikan kader untuk meningkatkan kualitas pengabdian partai kepada rakyat, bangsa dan negara, “ ujar Sekjen PDI Perjuangan Tjahjo Kumolo, disela-sela Pendidikan Kader pendidik Angkatan VI PDIPJakarta, Kamis (28/6). Pengabdian yang digerakkan oleh semangat kebangsaan yang jauh dari kalkulasi untung rugi, tegas Tjahjo, merupakan pengabdian yang tulus kepada Ibu Pertiwi. “ Kita harapkan, pendidikan kader PDI Perjuangan akan menjadi jalan bagi hadirnya politik sebagai bentuk pengabdian kepada rakyat, bangsa dan negara,” tandasnya. Bagi seluruh kader PDI Perjuangan, tegas anggota Komisi I DPR ini, pilihan untuk hadir di tengah rakyat, merupakan bagian dari pilihan metodologi pendidikan, dimana suatu proses belajar yang tidak memisahkan antara peristiwa dalam pembelajaran. “PDI Perjuangan bertekad untuk menempatkan kadernya secara langsung dekat dengan rakyat. Kader PDI Perjuangan harus hadir dan menjadi bagian dari penyelesaian atas masalah-masalah yang dihadapi rakyat. “ Penididkan kader adalah proses pembelajaran sehingga kader partai mampu menyelami kehidupan rakyat dan pada gilirannya mampu memperjuangkan apa yang menjadi aspirasi dan kepentingan rakyat,” tutup Tjahjo Kumolo. (aya)

Larangan Pengeboran Tidak Beralasan JAKARTA (Waspada): Sepanjang keluarga Bakrie melalui PT Minarak Lapindo Jaya (PT MLJ) terus berkomitmen menyelesaikan pembayaran kepada warga korban lumpur Sidoarjo, tidak ada alasan untuk melarang PT Lapindo Brantas, apa lagi BP Migas sudah memberikan izin. “Kita prihatin jika ada larangan pengeboran dari Gubernur Jawa Timur ini. Izin sudah keluar dari BP Migas. pembayaran kepada warga juga telah dilakukan dan akan tuntas tahun ini, jadi dasarnya apa?” kata Ketua Komisi D DPRD Jatim, Hasan Irsyad, Rabu (27/6). Dia meminta pihak Pemda tidak mempersulit dan menghalangi rencana PT Lapindo Brantas untuk melakukan pengeboran kembali sumur gas lama di Desa Kalidawir. Apalagi keluarga Bakrie melalui PT MLJ terus melakukan pembayaran. Pembayaran yang dimaksud GubernurJatim Soekarwo telah dilakukan Bakrie, meski secara hukum baik putusan final MA maupun kesimpulan DPR sudah menyatakan bahwa semburan lumpur adalah karena bencana alam, bukan akibat pengeboran. Menurutnya, kurang tepat kalau dikatakan biaya pengeboran bisa dialokasikan bagi pembayaran korban. Sebaliknya dengan pengeboran di Desa Kalidawir, maka Lapindo Brantas akan bisa lebih produktif dalam membantu para korban lumpur Sidoarjo. Kepala Pusat Studi Bencana dan Kebumian ITS, Dr Wahyudi mengatakan, rekomendasi BP Migas yang mengizinkan PT Lapindo Brantas melakukan pengeboran kembali sumur gas lama di Desa Kalidawir bisa dijadikan pegangan dan perusahaan yang akan mengebor tetap memperhatikan dan menjalankan Standard Operating Prosedur (SOP). Humas Badan Penanggulangan Lumpur Sidoarjo (BPLS) Akhmad Kusairi mengatakan pengeboran yang dilakukan Lapindo merupakan prioritas izinnya dari BP Migas, sementara BPLS hanya berada dalam wilayah area penanggulangan Lumpur Sidoarjo. Soal ancaman geologi yang berada di area pengeboran, Kusairi menambahkan, sesuai hasil kajian Tim Terpadu Bentukan Dewan Pengarah BPLS bahwa area tersebut (Desa Kalidawir) tidak masuk dalam wilayah bahaya geologi. (aya)

Buah Dan Sayur Impor Bawa 19 Penyakit TEMENGGUNG (Antara)” Telah ditemukan sebanyak 19 jenis penyakit pada buah dan sayur impor dalam dua tahun terakhir, demikian kata pelaksana tugas Dirjen Pengolahan dan Pemasaran Hasil Pertanian, Kementerian Pertanian, Banun Harpini. “Pengendalian impor produk hortikultura tersebut dilakukan dengan mengurangi pintu masuk impor buah dan sayur dari delapan menjadi empat pintu masuk, yakni Surabaya, Belawan, Makassar, dan Bandara Soekarno-Hatta,” katanya usai pembukaan Gelar Promosi Produk Hortikultura Jateng 2012 di Soropadan, Temanggung, Kamis(28/6). Ia mengatakan, mulai 19 Juni 2012 impor buah dan sayuran hanya bisa melalui empat pintu masuk tersebut. “Sebanyak 19 jenis penyakit itu belum sampai masuk ke konsumen karena sudah ketahuan saat di pintu masuk. Produk impor tersebut kemudian dimusnahkan karena mengandung penyakit golongan satu,” katanya. Banun mengatakan pengendalian impor tersebut, bukan untuk membatasi volume impor melainkan untuk mencegah masuknya penyakit bersamaan dengan produk impor. Selain itu, pemerintah berkeinginan bisa meningkatkan daya saing produk hortikultura lokal dari sisi harga dan kualitas melalui kebijakan tersebut. Untuk melindungi konsumen dalam negeri, katanya, pemerintah juga akan memperketat pengawasan keamanan pangan yang masuk. “Sebelumnya hanya 38 jenis yang diatur, nanti ada 100 jenis yang harus lulus uji keamanan pangan, seperti batas ambang residu, kandungan logam berat, dan formalin,” katanya. Ia mengatakan, produk yang masuk ke dalam negeri aman karena melalui telah melalui pengujian yang ketat saat di karantina.

Jumat 29 Juni 2012

Menag: Haji Non Kuota Jangan Lolos Di Imigrasi


JAKARTA (Waspada): Sumbangan masyarakat ke KPK untuk pembangunan gedung baru terus mengalir. Kepedulian publik kali ini, datang dari manajemen dan karyawan pengelola jalan tol, PT Citra Marga Nusaphala Persada Tbk (CMNP) sebesar Rp10,035 juta. Sumbangan yang dikumpulkan secara spontan langsung diserahkan ke KPK disaksikan Komisaris CMNP Shadik Wahono beserta pucuk pimpinan perusahaan pengelola jalan tol terkemuka tersebut. Direktur Utama CMNP HM Jusuf Hamka menyatakan selain dana sumbangan spontan tersebut, manajemen berniat menyerahkan tambahan sumbangan, apabila uang senilai US$2 juta yang berasal dari hak tagih Negotiable Certificate of Deposit Unibank (NCD) Unibank bisa dilakukan. “Apabila hak tagih atas NCD tersebut bisa dilakukan, kami bermaksud menyerahkan tambahan sumbangan dari hasil tagihan sehingga bisa dimanfaatkan untuk keperluan pembangunan gedung baru KPK,” kata Jusuf Hamka kepada pers di gedung KPK, Kamis siang (28/6). Ketua Mahkamah Konstitusi Mahfud MD menyatakan tidak ada aturan perundangan yang melarang publik, mulai dari pedagang kaki lima, hingga pengusaha, maupun perusahaan untuk menyumbang pembangunan gedung baru KPK. “Jadi silakan saja jika publik, termasuk pedagang kali lima, ingin menyumbang pembangunan gedung KPK,” kata Mahfud MD melalui sambungan telepon pada dialog interaktif di sebuah stasiun televisi swasta di Jakarta, Selasa(26/6) malam. Sementara itu, Indonesia Corruption Watch (ICW ) mengingatkan, jumlah sumbangan ke KPK bakal dibatasi maksimal Rp10 juta. Apabila lebih dari Rp10 juta maka sumbangan akan dikembalikan. Sumbangan bisa ditransfer masyarakat ke rekening ICW di BNI Melawai, dengan nomor rekening 0056124374. Koalisi juga membuka bantuan dalam bentuk barang. (aya)


JAKARTA (Antara): Menteri Agama Suryadharma Ali menegaskan, haji yang tidak melalui jalur resmi (haji non kuota) tak akan lolos di imigrasi dan akan diatur pada musim haji kali ini. “Haji non kuota jangan sampai lolos dari imigrasi, itu akan diatur sedemikian rupa,” tegas menteri agama di Kompleks Istana Kepresidenan Jakarta, Kamis (28/6). Untuk itu, ia meminta kepada masyarakat agar tidak terbujuk untuk berangkat haji dari orang-orang yang tidak Antara

KOIN UNTUK KPK: Seorang pengendara mobil memasukan uang ke dalam kotak sumbangan yang dibawa aktivis dari Komite Penyelidikan Pemberantasan Korupsi, Kolusi, dan Nepotisme (KP2KKN), saat berlangsung penggalangan dana “Koin untuk KPK”, di Semarang, Jateng, Kamis (28/6). Uang sumbangan tersebut akan digunakan untuk membangun gedung baru KPK yang selama ini anggaran pembangunannya tak kunjung disetujui DPR sejak diusulkan tahun 2008.

PDIP Dan Ketua MPR Tidak Setuju Saweran Pembangunan Gedung KPK JAKARTA (Waspada): Partai Demokrasi Indonesia Perjuangan (PDI Perjuangan) dan Ketua MPR RI Taufiq Kiemas tidak setuju ada penggalangan dana masyarakat untuk membangun gedung KPK. “Kami tak setuju dengan model saweran yang dilakukan KPK. KPK adalah lembaga resmi. Pemerintah harus ada anggaran biaya,” kata Sekretaris Jenderal PDI Perjuangan, Tjahjo Kumolo Di Gedung DPR RI, Jakarta, Kamis (28/6). Menurut Tjahjo, saweran atau sumbangan yang digalang oleh sejumlah elemen masyarakat untuk pembangunan gedung baru KPK dapat menimbulkan pembiasan persoalan. Namun, politisi PDI Perjuangan ini tidak menyalahkan akan gerakan saweran tersebut. “Hal itu adalah sah-sah saja karena merupakan gerakan masyarakat atau gerakan akan kepedulian terhadap KPK,” katanya. Sementara Ketua MPR RI Taufiq Kiemas meminta masyarakat untuk tidak melakukan saweran bagi pembangunan gedung KPK, karena tata

keuangannya akan sulit. Taufiq juga mengkritik KPK yang ‘ngotot’ meminta pembangunan gedung baru. Seharusnya, kata politisi senior PDI Perjuangan ini, harusnya jajaran KPK lebih dulu menunjukkan hasil kerjanya dalam pemberantasan korupsi dengan menyelesaikan kasus -kasus besar sebelum meminta pembangunan gedung baru. “Saya rasa kerja baik dulu, baru bikin gedung,” ujar Taufiq di gedung DPR Jakarta, Kamis (28/6). Taufiq pun lebih tidak setuju jika KPK justru menggalang dana dari masyarakat. “ Ini menyangkut tata kelola negara dan keuangan. “Saweran ngak pas,” ujar politisi PDIP tersebut. Ditempat yang sama, Presiden Partai Keadilan Sejahtera (PK) Luthfi Hasan Ishaaq belum berencana ikut menyumbang dana untuk pembangunan gedung baru KPK. “Masih banyak orang miskin yang harus kita sawer,” kata Luthfi. Berstandar Ganda Sedangkan anggota Komisi III dari Fraksi Gerakan Indone-

sia Raya (F Gerindra) Martin Hutabarat menilai sikap DPR RI berstandar ganda karena tidak juga menyetujui anggaran pembangunan gedung baru KPK . Sementara, pada sejumlah anggaran pembangunan gedung, DPR terkesan dengan mudahnya dibahas di komisi dan kemudian paripurna menyetujui. “Rakyat ini kan melihat, dana Wisma Atlet Rp 250 miliar begitu gampang, Hambalang Rp 2,5 triliun begitu gampang, kita membuat standar ganda dan menghambat KPKsaja,” ujar Martin Hutabarat saat menjadi pembicara pada Dialektika Demokrasi Wartawan Unit MPR/DPR RI di Jakarta, Kamis (28/6). Martin menambahkan gedung DPR yang sempat dianggarkan hingga Rp1,8 triliun dengan mudah disetujui. Sementara gedung KPK hanya sekitar Rp 200 miliar masih tergantung. “ DPR seharusnya mendukung pembangunan gedung baru KPK itu, sehingga citra DPR tidak sampai terpuruk di mata rakyat,”ujarnya.(ant/aya)

Rp1.210,60 Triliun Realisasi Pendapatan Negara TA 2011 JAKARTA (Waspada): Realisasi Pendapatan Negara dan Hibah pada Tahun Anggaran (TA) 2011 meliputi penerimaan Pajak, Penerimaan Negara Bukan Pajak (PNBP) dan Penerimaan Hibah sebesar Rp 1.210,60 triliun . “Realisasi Pendapatan Negara dan Hibah pada TA 2011 ini meningkat 21,64 persen dibandingkan realisasi TA 2010,” papar Menteri Keuangan saat membacakan Keterangan Pemerintah mengenai Pokok-pokok Rancangan Undang-Undang tentang Pertanggungjawaban atas Pelaksanaan APBN Tahun 2011 di hadapan Rapat Paripurna DPR RI di Gedung DPR RI, Jakarta, Kamis (28/6). Menurut Agus, peningkatan realisasi Pendapat Negara dan Hibah tersebut menunjukkan berhasilnya kebijakan pemerintah di bidang pendapatan negara untuk mendukung pertumbuhan ekonomi nasional, termasuk cukup efektifnya fiskal pemerintah dalam meningkatkan penerimaan sumber daya

alam, adanya peningkatan kualitas pelayanan Kementerian/ Lembaga kepada masyarakat dan penyempurnaan tarif PNBP pada Kementerian/Lembaga. Dijelaskannya, ralisasi Penerimaan Pajak TA 2011 sebesar Rp 873,87 triliun, 0,55 persen lebih rendah dari target APBNP sebesar Rp 878,68 triliun. Penerimaan pajak ini terdiri dari Pajak Dalam Negeri sebesar Rp 819,75 triliun dan Pajak Perdagangan Internasional sebesar Rp 54,12 triliun. Realisasi PNBP TA 2011 sebesar Rp 331,47 triliun, yang berarti 15,67 persen lebkih tinggi dari target APBNP sebesar Rp 286,57 triliun. Sementara, realisasi Penerimaan Hibah TA 2011 sebesar Rp 5,25 triliun, 12,69 persen lebih tinggi dari APBN-P sebesar Rp 4,66 triliun. Selain itu realisasi Belanja Negara dalam TA 2011 sebesar Rp1.295 triliun, yang berarti mencapai 98,05persen dari APBNP sebesar Rp1.320,75 triliun. Berdasarkan realisasi Pendapatan Negara dan Hibah

dan Belanja Negara tersebut, terdapat Defisit Anggaran sebesar Rp84,40 triliun yang berarti 44,05 persen lebih rendah dari APBN-P sebesar Rp150,84 triliun. Realisasi pembiayan untuk menutup defisit anggaran sebesar Rp130,95 triliun, dijelaskan Agus berasal dari sumbersumber Pembiayaan Dalam Negeri sebesar Rp1248,75 triliun dan Pembiayaan Luar Negeri sebesar minus Rp17,80 triliun. Agus juga menyampaikan bahwa RUU tentang Pertanggungjawaban atas Pelaksanaan APBN TA 2011 yang merupakan Laporan Keuangan Pemerintah Pusat (LKPP) telah diperiksa oleh BPK dan BPK memberikan opini “Wajar Dengan Pengecualian (WDP). Opini LKPP Tahun 2011 ini masih sama dengan opini LKPP Tahun 2010, namun terdapat peningkatan kualitas yang ditunjukkan dengan menurunnya permasalahan yang menyebabkan pengecualian atas kewajaran LKPP Tahun 2011. (aya)

CBB Prakarsai Festival Karya Cipta Lagu Batak Tingkat Nasional JAKARTA (Waspada): Maraknya pembajakan kaset-kaset DVD dan CD makin mempersulit artis Batak di Ibukota Jakarta mendapatkan produser. Akibat maraknya pembajakan kaset ini, bukan hanya menghambat munculnya artis-artis Batak pendatang baru, tetapi juga menjadi kendala bagi pencipta lagu untuk memunculkan lagu ciptaannya, sehingga bebarapa tahun terakhir ini tidak ada muncul lagu Batak yang bisa melegenda. “ Pembajakan membuat produser khawatir mengalami kerugian. Bagaimana tidak, begitu kaset DVD dan CD sudah diedarkan, hanya hitungan hari sudah ada kaset bajakannya diperjualbelikan dengan harga yang jauh lebih murah dari aslinya,” ujar Koordinator Umum Festival Karya Cipta Lagu Batak dan Vocal Grup Tingkat Nasional Tahun 2012, Joe Harlen Simajuntak kepada Waspada di Jakarta, Rabu (27/6). Dulu, jelas artis Batak senior ini, masih banyak produser yang pro aktif mencari pencipta lagu.

Bahkan produser yang akan menyeleksi artis yang pas membawakan lagu itu. Tapi sekarang, artislah yang susah payah mendapatkan produser,“ ujarnya Berangkat dari keprihatinan itu, Joe Harlen yang juga personil Trio Ambisi ini, mengajak beberapa artis Batak melakukan terobosan melalui Cinta Budaya Bonapasogit (CBB), menggelar Festival Karya Cipta Lagu Batak dan Vocal Grup Tingkat Nasional. “ Kita berharap melalui festival ini nantinya akan muncul lagu-lagu Batak yang baik dan harapan lagu itu juga akan melegenda, “ ujar pria kelahiran kota turis Parapat ini. Dijelaskannya, untuk mendapatkan hasil yang diinginkan melalui Festival Karya Cipta Lagu Batak dan Vocal Grup Tingkat Nasional, maka panitia mempersiapkan juri yang netral, independen dan berpengalaman. “ Hingga saat ini sudah 90an lagu baru yang diciptakan putra-putri Batak dari seluruh Indonesia yang masuk ke pa-

nitia, “ tandasnya. Joe Harlen menambahkan, setelah lagu yang masuk ke panitia diseleksi, maka akan dipilih 20 lagu terbaik untuk diperlombakan dan diperdengarkan kepada masyarakat Batak di Jakarta yang dijadwalkan Oktober mendatang. “ Festival ini, juga salah satu upaya para artis untuk turut berperan melestarikan dan mengembangkan budaya Batak. Lebih dari itu, melalui festival ini kita berharap makin mempererat keakraban masyarakat Batak yang ada di Jakarta, “ ujar Joe Harlen Simajuntak optimis. Hadiah yang disediakan pada Festival Karya Cipta Lagu Batak dan Vocal Grup Tingkat Nasional 2012 yakni hadiah I Rp150.000.000 ditambah Piala Citra, hadiah II Rp100.000.000 ditambah Piala Citra, hadiah III Rp50.000.000 ditambah Piala Citra, hadiah IV (favorite) Rp25.000.000 ditambah Piala Citra. Sementara 20 Finalis masing-masing mendapatkan Rp5.000.000 dan Piala Citra. (aya)

bertanggungjawab. Ia mengatakan, penyelenggara haji, sesuai dengan UU No 13/2008 adalah pemerintah (haji reguler) dan perusahaan swasta yang telah mendapatkan izin dari Kementerian Agama (haji khusus). Dan sampai saat ini, menurut Menag, pemberangkatan haji secara resmi tersebut tidak pernah terjadi penelantaran. “Uang mereka terima dan diberangkatkan,” katanya. Ia mengatakan, kuota haji saat ini sebesar 210 ribu jamaah dengan komposisi 17 ribu haji khusus (yang diberangkatkan

perusahaan swasta) dan 193 ribu diberangkatkan oleh pemerintah. Namun demikian, pemerintah Indonesia telah meminta tambahan kuota sebanyak 30 ribu jamaah. “Namun biasanya yang dikabulkan itu 10 ribu,” katanya. Sementara itu, ia menambahkan, rancangan peraturan pemerintah (RPP) untuk haji 2012 telah selesai, namun belum disahkan. “Tidak tahu (RPP disahkan), pokoknya buat musim haji ini RPP-nya sudah selesai. Siap dipakai,” katanya.

Penyelenggara Haji Brunei Tertarik Dengan Siskohat JAKARTA (Waspada): Penyelenggara ibadah haji Brunei Darussalam mengaku tertarik untuk mengetahui lebih jauh mengenai Sistem Informasi Haji Terpadu (Siskohat) Indonesia yang dikelola Kementerian Agama (Kemanag). Mekipun tidak sebanyak mengurus jamaah haji Indonesia, penyelenggara ibadah haji Brunei Darussalam mengaku tertarik dan ingin mengetahui lebih jauh tentang Siskohat yang dikelola Kementerian Agama. “ Pada masa ini di Brunei Darussalam sedang membangun sistem bagi jamaah haji, karena itu kami melawat ke Indonesia untuk mempelajari bagaimana Indonesia yang sudah membangun sistem online. Insya Allah kami mulai tahun 2013,” kata Awang Haji Abdullah bin Haji Mohammad, ketua rombongan Projek Sistem Pengurusan Haji (SPH) Brunei Darussalam kepada wartawan, disela-sela lawatannya ke kantor Kementerian Agama,Jakarta. Kunjungan delegasi SPH Brunei Darussalam, kemarin di kanor Kemenag, diterima Sekjen Kemenag H. Bahrul Hayat yang didampingi Sekretaris DirekturJenderal Penyelenggaraan Haji dan Umrah H. Cepi

Supriatna, Direktur Pengelolaan Dana Haji Kemenag H. Syariful Mahya Bandar, Direktur Pelayanan Haji Kemenag Hj.Sri Ilham Lubis dan Direktur Pembinaan Haji Kemenag H.Ahmad Kartono. Sedangkan ketua delegari Brunei Darussalam, Awang Haji Abdullah didampingi Awang Haji Isa bin Haji Mohd Tahir, Awang Haji Jahari bin Haji Isah dan Awang Haji Sulong bin Haji Sawal. Awang Haji Abdullah mengaku sangat gembira setelah memperoleh penjelasan tentang perhajian di Indonesia, termasuk penerapan Siskohat

untuk mengurus jamaah haji. “Selepas pertemuan ini kami mendapati bahwa pengurusan haji di Indonesia amat baik sekali. Baik sekali dapat mengurus secara sistematik bagi jamaah,” tuturnya. Awang Haji Abdullah menjelaskan, selaku penyelenggara haji, Brunei Darussalam ingin mempelajari bagaimana pengurusan haji di Indonesia berjalan baik, aman dan lancar. “ Penduduk negara kami tidak sebanyak Indonesia, jamaah haji Brunei kurang lebih 1.300 orang,” terang Abdullah.(j06 )

Parpol Islam Harus Sentuh Masalah Aktual Demi Gaet Suara JAKARTA (Antara): Presiden Partai Keadilan Sejahtera (PKS) Luthfi Hasan Ishaaq mengakui, rendahnya elektabilitas partai-partai Islam karena tak mengedepankan masalah aktual di masyarakat. “Selama ini partai-partai Islam menyentuh persoalan aktual seperti pendidikan dan lapangan kerja, tidak hanya soal nilai-nilai. Seharusnya kombinasi antara nilai dan masalah aktual,” kata Luthfi di Gedung DPR RI, Jakarta, Kamis (28/6).

Bagi PKS, kata dia, hasil survei Lembaga Survei Nasional (LSN) merupakan sebuah peringatan agar lebih meningkat kinerja sehingga elektabilitas PKS tetap tinggi. “Itu sebuah peringatan yang bagus bahwa selera publik tak cocok dengan partai Islam. Termasuk bagi PKS,” kata Luthfi. Kata Luthfi, faktor lain rendahnya elektabilitas parpol Islam karena tokoh-tokohnya kurang peduli terhadap masalah ekonomi.

Laporan ke: 4

DOMPET PEDULI UMMAT WASPADA Setiap sedeqah yang kita salurkan di jalan Allah akan menjadikan pelindung kita dari api neraka. Salurkan Zakat, Infaq dan Shadaqah Anda ke lembaga yang Amanah, Profesional & Transparan Transfer via bank, AC. Peduli Ummat Waspada

Infak/Sedekah BMI 211.00044.15 BSM 006.0008321 BNI 005.7504808 Bank Sumut Syariah 611.01.04.000024.0 BRI 0693-01-000055-30-9

Zakat BMI 211.00002.15 BSM 006.0022407 BCA 022.1750828 BNI Syariah 0092687629 Bank Mandiri 106.0002203803 ZIS terpublikasi s/d laporan 3

Rp 43.376.214



Rp 15.000.000 169. M. Idayat Lintang, ST 170. Sudarma B. Lessan, SP 171. Efendi Akbar, SP 172. Rukiman 173. H. Yance Maramis, SmHk 174. Achmad Fadly 175. Ir. Eltavip M.Hasibuan 176. Buhari Muslim, SP 177. Luli A. Gozali, SP 178. Saindra H.P. Nasution, SE 179. Sudarman 180. Mhd. Sahid 181. Suswanto, SE, Qia 182. H. Hasanul Arifin Nasution, ST 183. Budi Susilo. SP 184. Ir. Seno Adji 185. Eman Siswanto, SP 186. Muntashir Masril, ST 187. Yunita Nasution, SH 188. Sri Rahayu, S.Psi, Psi 189. Hj. Iswita Lubis 190. H. Affan Safiq, SP 191. H. Jaya Bakti, SE 192. Drs. Jasir Swondo, MM, Qia 193. Syamsurizal Sirait, ST

Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000 Rp 600.000

194. Muhammad Iwan Ma’sum 195. Ahmad Diponegoro, B.Sc, M.Ec 196. Wawan Irawan, SE, M.Sc 197. Ir. Deny Mulyawan, MT 198. Suyani 199. Wawan Fahrizal Lubis, SH 200. Maulidani Hidayat, ST 201. Idham Haryadi, SE 202. Suyono 203. Hendra, ST 204. Junaidi Sunardi 205. Barita Pakpahan 206. Surianto, SP 207. Syahrudi A. Sinaga, SP 208. Suhartono 209. H. Bunyamin Siregar, SP 210. Ir. Raiswan 211. Irwanda Harahap, SP 212. Suryaman 213. Ardiansyah, SE 214. Hadisaputra, Sp 215. Ihsan Sawal Sinuraya, SP 216. Febryandi Bangun 217. Ir. Eka Zulfria Nasution 218. Drs. Soritua Siregar, M.MA

Rp 600.000 Rp 550.000 Rp 550.000 Rp 550.000 Rp 550.000 Rp 550.000 Rp 550.000 Rp 550.000 Rp 550.000 Rp 550.000 Rp 400.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000 Rp 300.000

Rp 25.150.000

Jumlah laporan ke: 4




1. Partisipasi untuk Sanggar Perkasa, Jl. Kp. Aur No. 18 Medan Rp 2. Bantuan pendidikan Nurasiah Tanjung, Jl. Air Bersih Gg. 1 No. 16 Medan Rp 3. Bantuan Pendidikan Syuja Fitri Avanii, Jl. Bajak V Gg. Bahagia medan Rp 4. Bantuan pendidikan Dwi Ayutianingsih, Jl. Bromo Lr. Syarif No. 15 Medan Rp 5. Bantuan pendidikan M. Rivai Lubis, Jl. Badik Gg. Tengah No. 40 Medan Rp 6. Bantuan Rutin bulan Desember 2011 Rp 7. Honor Dai bulan Desember 2011 Rp 8. Honor Pesonil SPUW di STM Hulu Tiga Juhar Desember 2011 Rp 9. Program : Tarbiyah Masjid di Kab. Karo ( Honor Bulan Desember 2011 ) Rp 10. Operasional Rp Jumlah

200.000 350.000 260.000 300.000 290.000 1.830.000 2.500.000 4.100.000 1.250.000 13.434.000


Penerimaan dan Pemanfaatan Dana




Periode 1 Januari s.d lap. 4




Keterangan: Seluruh donatur adalah staff PTPN III untuk pendebetan bulan Jan 2011 - Des 2011

Konsultasi Zakat Bersama Ustadz M. Nuh Abdul Muis SMS: 08126526295 e-mail :

Hubungi Kami : Lembaga Amil Zakat Propinsi Sumatera Utara Peduli Ummat Waspada Jl. Brigjen Katamso No. 1 Medan telp. 061-4511936 Fax. 061-4511936 E-mail : Khusus Kodya Medan, ZIS diatas Rp.500,000,- kami siap menjemput (4511936 - 08126375062)

Ekonomi & Bisnis

WASPADA Jumat 29 Juni 2012


25 Persen Koperasi Di Indonesia Nonaktif JAKARTA (Waspada): Peranan koperasi diperlukan guna meningkatkan pertumbuhan ekonomi Indonesia. Sayangnya, saat ini 25 persen koperasi di Indonesia dinyatakan tidak aktif. Menteri Koperasi dan UKM, Syarifudin Hasan, menjelaskan memang pasti ada koperasi yang tidak aktif. Meski demikian, pemerintah akan terus berupaya mendorong agar koperasi tersebut bisa kembali meyokong perekonomian bangsa. “Itu kan wajar, ada yang tak

aktif, muncul yang aktif. Yang penting kita terus mendorong agar mereka bisa aktif kembali,” ungkap dia usai membuka seminar Tantangan dan Peluang Perekonomian Nasional, di Hotel Crowne, Jakarta, Kamis (28/6). Syarief menambahkan,

MEDAN (Waspada): Pemerintah Malaysia mengharapkan kerjasama antar koperasi Malaysia dan Indonesia, khususnya di Sumatera Utara (Sumut) dapat terjalin. Kerjasama tersebut diperlukan mengingat banyak produk-produk dari koperasi di dua negara ini memiliki nilai ekonomi yang tinggi. Executive Chairman Suruhanjaya Koperasi Malaysia (SKM), perkumpulan koperasi di Malaysia, Datuk Hj MD Yusof Bin Samsudin mengatakan, beberapa waktu lalu menteri koperasi dari Malaysia telah bertemu dengan menteri koperasi Indonesia untuk menyiapkan memorandum of understanding (MoU) tentang kerjasama tersebut. “Kami juga berharap ada MoU antara koperasi Malaysia dan Indonesia,” jelasnya dalam pertemuan antara pelaku koperasi Malaysia dan Sumut di Gedung Dinas Koperasi dan UKM Sumut Jl. Gatot Subroto Medan, Kamis (28/6). Perte-

muan tersebut dihadiri Kadis Koperasi dan UKM Sumut Ir Jonni Pasaribu, jajaran Dinas Koperasi dan UKM Sumut serta pelaku koperasi Sumut dan Malaysia. Datuk Hj MD Yusof Bin Samsudin menyebutkan, peluang kerjasama antara koperasi Malaysia dan Indonesia, khususnya Sumut, sangat terbuka lebar. Hal ini terutama menyangkut produk-produk yang dihasilkan koperasi dari masingmasing negara. “Seperti di bidang jasa keuangan dimana kami memiliki Koperasi Bank Rakyat yang bergerak di bidang gadai syariah. Atau dari koperasi Sumut yang bergerak di bidang pembuatan pakan ternak. Artinya ada hubungan yang saling membutuhkan dari masing-masing koperasi,” jelasnya sambil menambahkan, saat ini di Malaysia terdapat lebih dari 9.500 koperasi. Kadis Koperasi dan UKM Sumut Ir Jonni Pasaribu mengatakan, kerjasama antar koperasi

pihaknya akan terus mendorong agar koperasi tak aktif untuk bangkit kembali. Menurutnya, hingga tahun 2014, tidak akan lebih dari 10 persen koperasi yang tidak aktif, dan diperkirakan pertumbuhan koperasi berada pada kisaran 9,6 persen per tahun. “Akan ada pengurangan koperasi yang sudah tak aktif lagi,” tutup Syarief. Diberitakan sebelumnya, pertumbuhan Koperasi di Indonesia pada 2011 telah meningkat 20,1 persen ketimbang

2008. Jumlah koperasi mencapai 186.907 koperasi, dibandingkan Desember 2008 sebesar 154.964 unit. Sementara, kegiatan ekonomi yang bersinggungan dengan Koperasi juga mengalami peningkatan mencapai 29,63 persen. Pertumbuhannya mencapai Rp93,7 triliun, meningkat 28,83 triliun dibandingkan Desember 2008 sebesar 68,4 persen. Selain itu, anggota koperasi juga mengalami peningkatan mencapai 11,5 persen. (okz)

ini sangat perlu dilakukan. Berbagai potensi yang ada di Malaysia maupun di Sumut dapat lebih maksimal tergali jika kerjasama tersebut terwujud. “Dinas Koperasi dan UKM Sumut sendiri terus aktif melakukan pembinaan terhadap koperasi dan usaha mikro, kecil dan menengah (UMKM) di Sumut. Saat ini, terdapat 10.745 unit koperasi dan 2,4 juta usaha mikro dan kecil di Sumut,” jelasnya. KoordinatorWilayah Sumatera DPP Himpunan Pengusaha Muda Indonesia (HIPMI) Said Aldi Al Idrus mengatakan, koperasi di Sumut harus secepatnya menangkap peluang yang ditawarkan pihak Malaysia. “Peluang ini harus segera diwujudkan karena akan sangat bermanfaat bagi pengembangan koperasi di Sumut. Terlebih pihak Malaysia juga menawarkan kerjasama dalam banyak bidang, seperti pemasaran, pendidikan dan pelatihan, kerjasama investasi dan sebagainya,” tegas Said yang juga Ketua Umum Rempala Indonesia tersebut. Said Aldi Al Idrus juga mengingatkan, pada tahun 2015 per-

janjian Asean Community akan dilaksanakan. Hal ini akan membuat pelaku usaha di suatu negara di Asean bebas berusaha di negara Asean lainnya. “Karena itu, kesempatan ini harus kita manfaatkan, sehingga saat Asean Community berjalan di 2015, kita sudah siap menghadapinya,” ungkapnya.

Malaysia Harapkan Kerjasama Koperasi

Tertekan, Rupiah Masih Bertahan Di Level Rp9.400-an JAKARTA (Waspada): Nilai tukar rupiah berakhir di Rp9.480an per dolar AS. Mata uang RI ini masih tertekan isu global. Dalam risetnya, Head of Research Treasury Division BNI Nurul Eti Nurbaeti mengatakan, jelang digelarnya EU Summit, pergerakan yang masih fluktuasi diprediksi berlanjut menyelimuti domestic market. Meski, dukungan penguatan bursa global dan regional semalam membuka peluang berlangsungnya rally di pasar saham Asia. Di sisi lain, rupiah pun terindikasi mampu mempertahankan posisinya di Rp9.400-an di tengah ekspektasi pasar atas pengawalan ketat BI terhadap rupiah demi hindari level psikologis Rp9.500 jelang akhir bulan dan berakhirnya kuartal II. Walau, rentannya kondisi Eropa dan rendahnya ekspektasi positif terhadap solusi penanganan krisis utang dalam pertemuan Brussel bakal jadi penghadang laju apresiasi Asian currencies, termasuk valuta Garuda. Rupiah, Kamis (28/6) berada di level Rp9.480 per dolar AS. Melemah dibandingkan periode perdagangan hari sebelumnya Rp9.475. Bloomberg menyebutkan rupiah berada di level Rp9.485. Sementara menurut yahoofinance, rupiah berada di level Rp9.445 per dolar AS. Di mana kisaran perdagangan harian ada di Rp9.477-Rp9.507. (okz)

Krisis Utang Eropa Sebabkan Emas Sulit Berkilau SINGAPURA (Waspada): Harga emas bergerak naik dalam kisaran sempit menjelang pertemuan puncak Uni Eropa. Pertemuan yang disinyalir tidak akan menemukan langkah-langkah baru untuk mengatasi krisis utang dan dapat mendorong investor beralih ke dari dolar Amerika Serikat (AS). Harga emas menyentuh rekor sekira 1.920 dolar AS per troy ons pada 2011, ketika investor memilih logam ini sebagai tempat aset safe haven, selama krisis utang di Eropa. Namun, tahun ini penurunan di pasar telah menyebabkan investor terpaksa menjual emas untuk menutup kerugian. Hal ini membuat harga emas mencapai level terendah dalam empat bulan sejak Mei dan berada di kisaran 1.527 dolar AS per troy ons. Harga emas jenis Spot sedikit berubah pada 1,573.99 dolar AS per troy ons, setelah sempat naik di atas 1.581 dolar AS per troy ons. Sementara emas berjangka AS Comex Gold untuk pengiriman Agustus turun 3,60 dolar AS menjadi 1.574.80 dolar AS per troy ons. Sentimen negatif datang dari pernyataan Kanselir Jerman, Angela Merkel, yang menolak usulan Prancis dan Italia pada pertemuan puncak Uni Eropa. Akibatnya, euro juga melemah karena permintaan emas dari India, konsumen terbesar di dunia dari logam mulia, dan Indonesia, pembeli lain Asia terkemuka, karena pedagang juga mendukung kas kekhawatiran atas memburuknya krisis zona euro. Sementara Spot silver naik 4 sen ke 26,95 dolar AS per troy ons, Spot Platinum naik 7,10 dolar AS menjadi 1.411,25 dolar AS per troy ons, Spot Palladium naik 28 sen menjadi 573,03 dolar AS per troy ons. Sementara Comex Silver untuk pengiriman Juli turun 6 sen menjadi 26,89 dolar AS. (okz)

Pameran Koperasi Pada kesempatan itu, Datuk Hj MDYusof Bin Samsudin juga mengajak kalangan koperasi di Sumut untuk berpartisipasi mengikuti pameran koperasi di Malaysia pada tanggal 13-15 Juli di Kuala Lumpur. “Pameran ini dilakukan dalam rangka memperingati hari Koperasi di Malaysia. Kegiatan ini akan dihadiri lebih dari 100.000 ahli koperasi di Malaysia dan juga koperasi serta UKM dari seluruh negara di Asean,” jelasnya. Jonni Pasaribu menyambut baik tawaran untuk mengikuti pameran itu. Jonni juga mengatakan, selama ini pelaku koperasi dan UKM di Sumut aktif mengikuti berbagai pameran di Malaysia, seperti Pesta Pulau Penang, maupun pameran handycraft di Kuala Lumpur. (m41)


TERUS NAIK: Seorang pedagang tampak melayani pembeli di Pasar Sukaramai Medan, Kamis (28/6). Kurangnya pasokan sayur dari sentra penghasil sayuran di Berastagi Tanah Karo, mengakibatkan harga sayur di sejumlah pasar tradisional merangkak naik, seperti halnya harga wortel merangkak ke Rp 6.000 hingga Rp 7.000 perkilogram yang sempat sebelumnya Rp 3.000 hingga Rp 4.000 perkilogramnya.

BI Pakai Acuan PBI Bahas Hasil RUPSLB MEDAN (Waspada): Dalam membahas hasil Rapat Umum Pemegang Saham/Rapat Umum Pemegang Saham Luar Biasa (RUPS/RUPSLB), Bank Indonesia (BI) tetap memakai acuan Peraturan Bank Indonesia (PBI) bukan Perseroan Terbatas (PT). Deputi Kabid Ekonomi dan Moneter BI Perwakilan IX (Sumut-Aceh) Mikael Budisatrio mengatakan, BI tetap memakai acuan PBI dalam membahas hasil RUPS/RUPSLB PT Bank Sumut yang telah diserahkan ke BI pada Rabu (27/6) sore.“Kami tidak bisa menyebutkan be-

Kemenkeu: Laju Inflasi Relatif Terkendali JAKARTA (Antara): Wakil Menteri Keuangan Mahendra Siregar mengatakan, laju inflasi hingga menjelang pertengahan tahun masih terkendali dan sesuai dengan perkiraan pemerintah. “Saya rasa inflasi kita relatif terkendali dalam arti pelemahan dari beberapa komoditas utama termasuk energi dan di lain pihak juga memang ada pergolakan di rupiah,” ujarnya di Jakarta, Rabu (28/6) malam. Namun, Mahendra mengingatkan perekonomian global saat ini sulit diprediksi dan dampaknya dapat mempengaruhi pertumbuhan serta asumsi makro lainnya dalam APBN-Perubahan, termasuk laju inflasi. “Secara menyeluruh saya melihat masih baik, tapi lagilagi kita jangan lengah, kalau dalam situasi sulit seperti ini berat lah nanti,” ujarnya. Sebelumnya, Menteri Keuangan Agus Martowardojo mengatakan laju inflasi pada akhir tahun bisa di bawah angka lima persen dan tidak melampaui asumsi yang ditetapkan dalam APBN Perubahan sebesar 6,8 persen. Menurut dia, hal tersebut dapat terwujud karena inflasi Mei tercatat sebesar 0,07 persen sehingga inflasi tahun kalender baru mencapai 1,15 persen dan secara tahunan (year on year) 4,45 persen. “Semoga ini bisa tetap dipertahankan, sehingga kita bisa mencapai inflasi di bawah lima persen,” kata Menkeu. Menkeu mengatakan rendahnya angka inflasi tersebut dikarenakan masyarakat mulai memahami bahwa penyesuaian harga Bahan Bakar Minyak

Waspada/Surya Efendi

GARUDA BUKA RUTE BARU DARI MEDAN: Dua karyawati Garuda Indonesia di kantor Jl. Mongonsidi Medan sedang memeriksa pesanan tiket konsumen lewat komputer online, Selasa (26/6). Tahun 2012 ini, manajemen PT Garuda Indonesia membuka rute penerbangan baru yakni Medan-Batam, Medan-Padang, Medan-Pekan Baru, Medan-Palembang, MedanBandung, Medan-Surabaya, Medan-Ujung Pandang dan Medan-Denpasar. Konsumen dari Medan tidak perlu transit lagi ke Jakarta.

(BBM) bersubsidi tidak jadi dilakukan dan daya beli terjaga. Menteri Perencanaan Pembangunan Nasional/Kepala Bappenas Armida S Alisjahbana juga mengatakan apabila tren inflasi seperti ini maka akhir tahun inflasi bisa mencapai angka kisaran 5,3 persen. Namun, apabila tidak ada kebijakan untuk menaikkan harga BBM bersubsidi maupun listrik maka beban inflasi akan berkurang sehingga laju inflasi bisa tercatat dibawah lima

persen. Pemerintah menetapkan asumsi laju inflasi dalam APBNPerubahan 2012 sebesar 6,8 persen, dengan perkiraan terjadi kenaikan harga Bahan Bakar Minyak (BBM) bersubsidi. Sementara Bank Indonesia memutuskan untuk mempertahankan BI Rate sebesar 5,75 persen yang dinilai masih konsisten dengan prakiraan inflasi yang tetap rendah dan terkendali di kisaran 3,5-5,5 persen pada 2012-2013.

Lowongan 700 PNS Bagi S1 Dan ABK JAKARTA (Waspada): Sekretaris Jenderal Kementerian Keuangan Kiagus Ahmad Badaruddin mengungkapkan tahun ini kementeriannya membuka lowongan Calon Pegawai Negeri Sipil (CPNS) sebanyak 700 orang. CPNS tersebut nantinya diperuntukkan bagi Anak Buah Kapal (ABK) di Direktorat Jenderal Bea dan Cukai dan sarjana Strata Satu (SI) untuk Direktorat jenderal lainnya, khususnya di Direktorat Jenderal Pajak. “Kami ingin meningkatkan penerimaan negara sehingga lebih banyak ditempatkan di Pajak dan Bea Cukai,” katanya di Gedung DPR, Jakarta, Kamis (28/6). Kiagus mengatakan, pendaftaran akan dibuka Agustus dan seleksi digelar September. Proses seleksi tersebut melalui dua tahap, yaitu tes pengetahuan umum yang soal ujian dibuat oleh konsosrsium 10 perguruan tinggi. “Kami cuma menyediakan fasilitas ujian dan memeriksa saja,” katanya. Sedangkan tahap kedua adalah tes potensi CPNS untuk ditempatkan sesuai dengan kebutuhan. “Kemudian psikotes, wawancara, dan tes kebugaran fisik. Itu bagian dari Kemenkeu,” katanya. Secara keseluruhan Kemenkeu mendapat jatah CPNS baru pada tahun sebanyak 2.307 orang. Calon itu terdiri dari 1.607 lulusan Diploma satu (D1) dan D3, 300 lulusan S1, dan sisanya dari akademi, sarjana muda pelayaran atau ABK. “Ini untuk kapal-kapal patroli,” katanya. (vvn)

RI Bantu Suntik IMF Rp9,4 Triliun JAKARTA (Waspada): Menteri Keuangan Agus Martowardojo mengungkapkan, pemerintah Indonesia hanya menganggarkan dana maksimal sebesar 1 miliar dolar AS (Rp9,4 triliun) guna menyehatkan likuidasi modal Dana Moneter Internasional (IMF). Komitmin tersebut menurut Agus dilakukan sebagai bentuk kepedulian Indonesia akan pemulihan krisis global khususnya yang terjadi di kawasan Eropa saat ini. “Proses pinjaman internasional ke IMF, bertujuan sebagai kekuatan ekonomi dunia, supaya jangan memburuk dan malah membahayakan semua,” ujar Agus di Gedung DPR, Jakarta, Kamis (28/6). Seperti diketahui, IMF membutuhkan suntikan dana sebesar 430 miliar dolar AS guna memperkuat permodalannya. Karenan itu Agus berharap, selain fokus pada pemulihan krisis, IMF juga dapat memerhatikan negara-negara berkembang lainnya yang masih memiliki kesulitan finansial. Kemudian, dengan suntikan dana ini, posisi Indonesia dalam IMF akan lebih kuat. Dari awalnya sebagai negara kreditur, menjadi negara yang berpartisipasi dalam menyehatkan lembaga keuangan internasional tersebut. “Karena Indonesia juga pernah pinjam IMF di 2006 kita sudah kembalikan. Dan kalau sekarang kita bisa berikan pinjaman ke IMF, kita sedang ada di posisi yang lebih baik,” ujarnya. Sebagai informasi, dalam pertemuan negara G-20 yang dilakukan pekan lalu, telah menyepakati untuk menyelesaikan seluruh komitmen suntikan dana ke-14 tersebut paling lambat saat pelaksanaan pertemuan tahunan IMF dan Bank Dunia 2012 pada oktober mendatang di Tokyo, Jepang. (vvn)

rapa lama pembahasan itu akan selesai. Laporan RUPS/RUPS sekarang berada di bagian pengawasan BI,” ujarnya kepada wartawan di Medan, Kamis (28/6). Mikael mengatakan, hasil keputusan RUPS/RUPSLB PT Bank Sumut akan ditentukan oleh BI Jakarta yang sebelumnya direkomendasikan oleh BI Medan terlebih dahulu. Ditanya apakah tindakan BI selanjutnya, jika hasil RUPS/RUPS bank daerah itu tidak mengacu kepada PBI, Mikael belum bisa mengatakan sanksi serta tindakan BI. “Lihat nanti bagaimana. Saya belum baca hasil RUPS/RUPSLB karena ada pada pengawasan BI,” ujarnya. Sementara itu pengamat ekonomu dari Universitas Negeri Medan (Unimed) Muhammad Ishak menegaskan, BI harus berani menegur pemegang saham PT Bank Sumut jika hasil RUPS/RUPSLB yakni dalam mengangkat dan memilih jajaran direksinya tidak sesuai dengan PBI. “BI harus berani menegur, Apakah teguran bisa melalui tulisan. Terlepas dari itu

semua, terlepas dari Plt atau tidak, dan coba dipisahkan dari urusan politik,” ujarnya. Menurut Ishak, BI juga harus di depan dalam mengawal operasional bank karena belum ada penunjukkan Dirut secara sah sesuai PBI, kecuali satu komisaris independen yang sudah melalui fit and proper test. Sebab itu, katanya, BI bersama pemegang saham juga harus duduk bersama agar bagaimana bank tersebut tetap beroperasional. Bagaimanapun, lanjutnya, Plt Bank Sumut yang telah diputuskan melalui RUPSLB tidak akan bisa menjalankan fungsinya secara maksimal, terlebih lagi diketahui bahwa belum melalui fit and proper test. “Dan dikhawatirkan tingkat kesehatan bank akan menurun,” katanya. Muhammad Ishak juga menyebutkan, seandainya hasil RUPS/RUPSLB PT Bank Sumut tidak sesuai PBI, misalnya seperti mekanisme pemilihan di jajaran dirutnya tanpa melalui fit and proper test terlebih dahulu, dan BI memberikan keri-

nganan dengan alasan bank dalam kondisi sehat, dikhawatirkan pihak lain dan bank-bank lainnya akan menuntut diperlakukan sama. “Caretaker harus ada SK. Teman-teman anggota dewan juga harus dilibatkan, karena uangnya bank sumut dari APBD. Anggota dewan harusnya punya pertimbangan, siapa yang layak menjadi Dirut,” ujarnya. Menanggapi soal acuan yang digunakan dalam RUPS/ RUPSLB, jelasnya, di dunia perbankan PBI sangat mempengaruhi dibanding UU PT. Sementara Kalau di ranah hukum UU PT memang lebih tinggi namun perbankan juga memiliki UU Perbankan. “Di BI kan ada divisi hukumnya. Persoalan bagaimana keputusan BI terhadap hasil RUPS/RUPSLB, pro kontra itu standard selama ada peraturan. Kalau pemegang saham keliru menafsirkan peraturan selama ini, BI-lah yang harus menerangkan dan menjelaskan mengingat BI juga ada divisi hukumnya,” pungkasnya. (m41)

Mei, Penyaluran KUR Capai Rp9 T JAKARTA (Waspada): Kementerian Koperasi dan Usaha Kecil Menengah (UKM) menyatakan realisasi Kredit Usaha Rakyat (KUR) hingga Mei mencapai Rp9 triliun. Artinya, penyaluran KUR hingga Mei mencapai 36 persen dari target sebesar Rp25 triliun. “Hingga Mei tahun ini dana KUR yang sudah tersalurkan senilai Rp9 Triliun,” ungkap Menteri Koperasi dan UKM, Syarifudin Hasan, usai membuka seminar tantangan dan peluang perekonomian nasional di Hotel Crowne, Jakarta, Kamis (28/6). Menurutnya Syarief pada 2013, pemerintah menargetkan dana penyaluran KUR sebesar Rp30 triliun. “Setiap tahun kita targetkan adanya kenaikan,” tutup dia. Sebelumnya, Menteri Koordinator Bidang Perekonomian Hatta Rajasa menjelaskan, ber-

kaca dari realisasi KUR 2011 yang mencapai 145 persen, dia optimisitis KUR 2012 akan melebihi target. “50 Persen diserap BRI, BRI akan meningkatkan kredibilitas, meningkatkan kantor masuk pedesaan. Namun untuk realisasi akan melebihi target seperti 2011,” ungkap Hatta. Dia mengatakan, pelaksanaan KUR 2011 jauh di atas target yang mencapai Rp29 triliun, jauh melampaui target sebesar Rp20 triliun. Hatta menambahkan, nasabah KUR juga mengalami peningkatan kualitas hidup. Di mana 600 ribu masyarakat telah naik peringkat menjadi komersial, dari yang sebelumnya masih nonbankable. Pada 2012, Hatta mengatakan akan terus mengembangkan linkage KUR hingga masuk ke komunitas komunitas daerah dan akan terus menjaga suku bunga KUR di bawah 22 persen. (okz)

BI Tetapkan Rabu Sebagai Hari Menabung JAKARTA (Waspada): Untuk meningkatkan akses keuangan (financial inclusion) masyarakat, Bank Indonesia mencanangkan hari Rabu pekan pertama sebagai “Hari Menabung” untuk masyarakat. BI akan mendatangi pusat keramaian seperti sekolah dasar, pasar, dan pos layanan masyarakat agar bisa menabung. Gubernur Bank Indonesia, Darmin Nasution, mengatakan, BI terus memperluas akses keuangan agar banyak masyarakat menikmatinya. Terlebih, program perluasan akses keuangan ini telah menjadi komitmen negara yang tergabung dalam G-20, termasuk Indonesia. BI juga menjalin kerja sama dengan beberapa kementerian, di antaranya Kementerian Kelautan dan Perikanan, Kementerian Pendidikan dan Kebudayaan dan Badan Pertanahan Nasional untuk memperluas edukasi. “Kami juga akan

menyelenggarakan olimpiade perbankan untuk mengedukasi perlindungan konsumen dalam bentuk kampanye ke masyarakat,” kata Darmin di JCC, Jakarta, Rabu kemarin. Menurut dia, untuk meningkatkan program layanan jasa dan perluasan akses keuangan, diperlukan empat pilar sebagai landasan. Di antaranya perluasan kegiatan edukasi, peningkatan layanan keuangan, penyediaan fasilitas media, dan perluasan distribusi keuangan serta teknologi. “Kami akan berkoordinasi dengan tenaga kerja dalam negeri, dalam hal pemahaman jasa keuangan,” ujar dia. Program tabungan murah “Tabunganku” yang selama ini telah diluncurkan telah menambah kepemilikan rekening menjadi 2,5 juta dengan nilai Rp2,7 triliun pada Mei 2012. Program itu dinilai cukup dijangkau masyarakat. (vvn)

Cuaca Panas Di Abdya, Petani Semangka Terancam Rugi BLANGPIDIE (Waspada) : Cuaca panas selama hampir satu bulan terakhir di wilayah Aceh Barat Daya membuat sejumlah sumber pengairan di daerah-daerah sentral produksi pertanian menjadi terbatas dan bahkan kering. Akibat dampak tersebut sejumlah lahan semangka di beberapa lokasi mengalami kekeringan sehingga terancam gagal panen. Seperti dilaporkan sejumlah petani semangka dari Desa Meurandeh, Kecamatan Lembah Sabil dan Desa Tengah, kecamatan Manggeng kepada Waspada Rabu (27/6) yang mengaku resah melihat puluhan hektar tanaman Semangka mereka terancam gagal panen akibat cuaca panas tersebut, tanaman semangka sudah berumur lebih 1 bulan kini banyak yang layu dan kemudian secara berlahan mati, bahkan tanaman yang mulai berbuah juga banyak mengalami pembusukan. Salah seorang petani semangka, Iskandar, 33, menjelaskan, tanaman semangka miliknya

juga diserang hama akibat dampak cuaca panas yang melanda daerah itu selama setengah bulan belakangan ini, para petani sempat mengira serangan hama tersebut adalah serangan hama biasa yang terjadi selama ini, namun ternyata terus merambat pada tanaman semangka lain sehingga para petani menjadi kerepotan untuk memberantasnya. “Yang sangat parah terjadi di Desa Tengah, puluhan hektare mati akibat tidak adanya air, para petani terpaksa harus menyiram secara langsung karena irigasi di areal persawahan kering total, jadi petani bisa-bisa terancam rugi dengan keadaan seperti ini,” ujarnya. Kadis Pertanian dan Peternakan Abdya Zainuddin, SP mengaku sudah menerjunkan Pengawas Hama dan Penyakit (PHP) untuk melihat langsung ke lapangan, dirinya menegaskan, penyebab banyaknya semangka mati dan membusuk karena iklim panas dan membuat tanaman dipenuhi jamur yang dibawa oleh hama lalat buah. (cb05)

Luar Negeri


WASPADA Jumat 29 Juni 2012

Dari Konferensi ICGR:

Seputar ASEAN

Myanmar Harus Hentikan Kekerasan Atas Muslim BANGKOK (Waspada): Tindak kekerasan atas warga Muslim — terutama dari etnis Rohingya yang tinggal di kawasan Barat Daya Myanmar — terus meningkat sejak awal bulan lalu. Komunitas pegiat Hak Asasi Manusia (HAM) dunia menyerukan agar Pemerintah Myanmar secepatnya menghentikan aksi kekerasan itu. Seruaninidisampaikandalam pertemuanInternationalConcern Group for Rohingyas (ICGR) selamaduaharidiBang-kok,Thailand, sekaligus mengajak dunia international mengintervensi Pemerintah Myanmar agar mengakhiri konflik etnis di negara itu. “Pertemuan ini menyerukan kepada Pemerintah Myanmar secepatnya menghentikan kekerasan dan konflik etnis di Barat Daya Myanmar,” kata Eksekutif Secretary ICGR, Muhammad Adli Abdullah dalam siaran pers Kamis (28/6). Muhammad Adli Abdullah yang merupakan aktivis HAM dari Indonesia dalam pertemuan tersebutmengatakan,pihakinternasional perlu segera mengirim bantuan kemanusian seperti makanan, obat obatan, air bersihdan kebutuhan Mandi Cuci Kakus (MCK) kepada korban kekerasan di Myanmar. Menurutnya ribuan korban kini sangat membutuhkan bantuan darurat, disamping solusi politik dan pemenuhan hak-hak asasi manusia serta pengakuan kewarganegaraan bagi etnis Rohingya sesuai dengan Deklarasi Umum HAM. “Kita menyerukan kepada anggota ASEAN pro aktif mencari solusi politik di Myanmar sebagai

bagian dari kepedulian sebagai masyarakat ASEAN,” sebut lelaki asal Aceh itu. Kekerasan terbaru terhadap muslimRohingyadinegarabagian Rakhine, baratdaya Myanmar telahmenyebabkandelapanwilayah dari 17 wilayah terimbas konflik etnis yang diprovokasi oleh para militer dimana rumahrumah ikut dibakar. “Akibat kekerasan itu sumber perekonomianmasyarakatdisana hancurdanpengungsiandimanamana,”jelasAdliAbdullahyangjuga dosenFakultasHukumUniversitas Syiah Kuala Banda Aceh itu. Pihaknyamencatatdiwilayah Akyab, sekitar 6.000 sampai 8.000 unitrumahdibakarberikut 50.000 warga kini terpaksa mengungsi. Di wilayah Buthidaund ada sekira 8.000 warga mengungsi, di Rathi Daung tercatat 1.200 rumah warga etnis Rohingya dibakar dan 15.000 orang harus mengungsi. Sementara di Kauk Taw tercatat 200 rumah warga Rohingya dibakar dan 2.500 orang mengungsi, di Pauk Taw ada 600 rumah dibakar dan 6.000 orang mengungsi. Di Ponaa Shun tercatat ada 800 rumah Rohingya dibakar 800danlebihdari9.000mengungsi. Di wilayah Ram Bree tercatat 100 rumah terbakar dan 1.500 orang mengungsi. Masjid tempat

Hamas: Seorang Anggota Militan Dibunuh Di Damaskus GAZA CITY (AP): Hamas mengatakan Kamis (28/6) bahwa salah seoranganggotamilitannyatelahdibunuhdirumahnyadiDamaskus, ibukota Syria. Seorang pejabat di gerakan militan Palestina itu mengatakan Kamal Ghanaja adalah mantan seorang pembantu Mahmoud al-Mabhouh, seorang panglima senior yang juga dibunuh di Dubai tahun 2010 lalu. Pejabat tersebut mengatakan Hamas telah diberitahu bahwa satu kelompok orang memasuki rumah Ghanaja, membunuhnya dan mengambil sejumlah file dari tempat itu. Dia mengatakan seorang anggota senior gerakan tersebut telah pergi ke Damaskus untuk melakukan penyelidikan resmi. Dia berbicara tanpa ingin disebutkan namanya karena masalah itu amat sensitif. Hamas dalam satu pernyataannya yang dikirimkan melalui websitenya mengatakan pihaknya kini berusaha mengenali jatidiri pembunuh Ghanaja tersebut. Sementara itu, Menteri Luar Negeri Israel Ehud Barak menolak untuk membenarkan atau membantah keterlibatan Israel dalam pembunuhanGhanajadalamwawancaranyadenganbeberapastasiun radio Israel Kamis. Hamas segera menuding, badan intelijen Israel (Mossad),beradadibalikaksipembunuhanini.NamunoposisiSuriah justrumenuduhPresidenBasharalAssadyangmelakukanpembunuhan. Fraksi oposisi Syria mengklaim, Presiden Bashar Assad yang bertanggung jawab atas pembunuhan Ghanaje. Assad dikabarkan memerintahkan seseorang untuk membunuh Ghannaje pada Rabu malam. Menurut fraksi oposisi Syria, Ghannaje disiksa terlebih dulu sebelum dibunuh. Pembunuhan itu pun dinilai sebagai pesan politik Assad kepada Hamas. Oposisi Syria mengatakan bahwa Hamas mulai menentang Pemerintah Suriah karena Hamas tak setuju, Pemerintah Syria memerangi fraksi oposisi. (m10)

Turki Kerahkan Tentara Ke Perbatasan Syria ANKARA (Antara/Reuters): Satu konvoi terdiri dari kira-kira 30 kendaraan militer termasuk truk yang mengangkut baterai-baterai rudal, bertolak dari kota pantai Iskenderun, Provinsi Hatay menuju perbatasan Syria sejauh 50km, kata media Turki Kamis (28/6). Kantor berita pemerintah Anatolia mengatakan, kendaraan lapis baja militer juga dikirim ke instalasi-instalasi militer di Sanliurfa, di tengah perbatasan Turki dengan Syria dan Hatay, satu provinsi yang menonjol ke dalam Syria. Anatolia mengatakan ada laporan kendaraan-kendaraan itu digelar di sepanjang perbatasan itu. Beberapa kendaraan militer bergerak secara terpisah ke satu garnizun Militer di kota perbatAsan Reyhanli di Hatay. Laporan-laporan itu muncul kurang dari seminggu setelah Syria menembak jatuh sebuah jet pengintai Turki di perairan Mediterenia yang memicu kecaman keras dari Ankara yang mengatakan tindakan itu harus dihukum.

ibadah umat Muslim di sana juga turut menjadi korban dari konflik agamayangberkecamukdinegeri junta militer itu. SelainAdliyangmewakiliaktivis HAM dari Indonesia, pertemuan berlangsung 26-27 Juni 2012 ini juga dihadiri Staffan Bodemar(aktivisHAMSwedia),Emranul Chowdhury (Bangladesh), Dr. Asghar Ali Engineer (India), Dr.YunusYasin (Malaysia), NihmathMusthafa(Bangladesh),Walied Hatamleh (Jordan) dan Dr Abdus Sabur (Thailand).

Dutabesar Malaysia untuk Bangkok, Dato’ Nazirah Hussein yang hadir dalam pertemuan itu menyampaikan rasa keprihatinan mendalam atas berlarut-larutnya konflik etnis di Myanmar. DiamengajakPemerintahASEAN untuk membantu persoalan di Myanmar. JI kecam pembantaian Muslim Dari Lahore dilaporkan, pemimpin Jamaah Islamiyah (JI) Munawar Hasan memprotes insidenpembantaianwargaMuslim

di Arakan, Myanmar. Munawar mengatakan, dalam waktu beberapa pekan kekerasan sektarian di Myanmar sudah menyebabkan ribuan warga Muslim tewas dan ratusan lainnya kabur ke Bangladesh. Munawar juga mengecam Perserikatan Bangsa-Bangsa (PBB) yang mengkategorikan warga Muslim di Arakan sebagai pengungsi yang paling tertindas. Namun PBB tidak pernah melakukan apa-apa untuk menyelamatkan nyawa mereka. Selain itu,

AS Paksa Myanmar Putuskan Hubungan Dengan Korut

media di dunia ini juga dinilai menutup mata terkait insiden pembantaian warga Muslim Myanmar itu. Pimpinan Jamaah Islamiyah itu juga mendesak Sekjend Organisasi Konferensi Islam (Sekjen OKI)EkmelledinIhsanogluuntuk mengambil tindakan mengenai isu tersebut. Isu penutupan pintu perbatasan yang dilakukan oleh Bangladesh juga menuai kecaman dari Jamaah Islamiyah. Demikian, seperti diberitakan The News, Kamis.(ok/ap/m10)

WASHINGTON (Waspada): Amerika Serikat mendesak Myanmar agar memutuskan hubungan diplomatik dengan Korea Utara (Korut). Pemutusan hubungan dengan negeri komunis itu pun dijadikan syarat untuk menormalisasikan hubungan bilateral AS dan Myanmar. “Kami sudah cukup khawatir dengan kurangnya transparansi mengenai hubungan militer Myanmar dan Korut,” ujar calon Dutabesar AS untuk Myanmar Derek Mitchell, seperti dikutip Yonhap, Kamis (28/6). Diplomat veteran itu siap menegaskan, hubungan bilateran Negeri Paman Sam dengan Myanmar tidak akan pernah bisa diperbaiki, kecuali bila Myanmar benar-benar menghentikan hubungan diplomatik dengan Korut. Selama ini Mitchell selalu aktif mengkoordinasikan kebijakan-kebijakan AS untuk negara yang sempat dipimpin junta militer itu. Desakan yang serupa diutarakan pula oleh seorang Senator ASMitchMcConnellpadaJanuarilalu.McConnellmenilai,reformasi demokratis di Myanmar harus dilakukan bersamaan dengan pemutusan hubungan bilateral Myanmar dan Korut. Selama ini, Pemerintah Myanmar dituduh mengekspor beras dansejumlahkomoditasagrikulturkeKorut,sebagaigantinya,negeri komunis itu memberikan senjata ke Myanmar. Menurut memo dari kawat diplomatik AS yang dirilis oleh situsWikileaks 2010 lalu, Myanmar menggelar kerja sama nuklir dengan Korut. Meski demikian, Pemerintah Myanmar sudah menyatakan bahwa negaranya tidak tertarik untuk memproduksi senjata nuklir. Isu nuklir Myanmar pun turut menjadi pembahasan penting oleh salah seorang Senator AS. (ok)

Rangkaian Ledakan Bom Di Baghdad, 9 Tewas


PROTES KAUM SALAFI. Pemimpin Sunni Salafi Ahmad al-Assir (membaca suratkabar) dikelilingi oleh para pendukungnya ketika

seorang pendukungnya yang lain (kanan) memasang tenda dalam satu aksi duduk mereka di Sidon, selatan Lebanon, Kamis (28/6). Para pemrotes Salafi memasang tenda dalam satu protes terbuka yang diserukan al-Assir guna menentang senjata non-pemerintah

Ledakan Keras Guncang Damaskus DAMASKUS (AP): Satu ledakan keras mengguncang Damaskus sehingga asap hitam mengepul di atas udara ibukota Syria itu Kamis (28/6). Televisi pemerintah mengatakan ledakan itu terjadi di lapangan parkir Istana Pengadilan, satu kompleks yang terdiri dari beberapa gedung pengadilan. Asal ledakan Kamis itu belum diketahui pasti. Syriatelahmengalamigelombang ledakan massal dalam beberapa bulan terakhir, yang menewaskanpuluhanorang.Hampir semua ledakan ditujukan pada badan-badan keamanan Presiden Bashar Assad, yang berjuang untuk mengakhiri pergolakan menentang kekuasaannya yang telah berlangsung 15 bulan.

Bulan lalu, satu ledakan yang ditujukanpadakompleksintelijen militer di selatan Damaskus menewaskan 55 orang. Ledakan itu merupakan yang paling mematikan di Syria. Banyak kekerasan yang melanda Syria sejak dimulainya pergolakan telah ditumpas oleh pemerintah dengan menindak parapembangkang.Namunpara pejuang pemberontak melancarkan serangan mematikan terhadap sasaran rezim yang berkuasadanbeberapaseranganbunuhdiri tahun ini menunjukkan al Qaida atau kaum ekstrimis lainnya bergabung dalam serangan tersebut. Kelompok oposisi Dewan NasionalSyriaKamismenyatakan tidak akan bergabung dalam

pemerintah sementara kecuali Presiden Bashar mundur setelah diplomat mengatakan utusan khusus Kofi Annan mengusulkan gagasan itu. “OposisibelummenerimarincianusulAnnanitudantidakdapat menjawabnya,” kata jurubicara DewanNasionalSyria(SNC)George SabrakepadaAFPmelaluitelefon. Sementara itu, Menteri Luar Negeri Italia GiulioTerzi, yang sedangberkunjungkeLebanon,Rabu,menyatakankekhawatirannya bahwakrisisSyriadapatmerembet kenegaratetangga,demikianlaporan National News Agency (NNA). Dengan mengutip pernyataan Terzi — yang bertemu dengan PM Lebanon Najib Miqati diBeirut, NNAmelaporkansituasi diSyriamengkhawatirkan‘bukan

hanya akibat kerusuhan yang tak pernah terjadi sebelumnya dan takbisadibiarkan,tapijugakarena sifat krisis tersebut.’ Terzi khawatir krisis di Syria melintasiperbatasandanmencapai negara lain.”Lebanon mesti stabil, sebab kestabilan adalah unsur utama bagiTimurTengah,” kata Menteri Luar Negeri Italia sebagaimana dikutip Xinhua. “Tanggung jawab terletak padamasyarakatinternasionalguna menghindari merembetnya masalah ini ke Lebanon dan guna memastikankelangsunganhidup di Lebanon jauh dari krisis ini, sebab Lebanon sudah menghadapi bermacam krisis pada 1908an dan 1990-an. Lebanon tak boleh terlibat dalam peristiwa baru-baru ini,” kata Terzi. (m10)

Istri Presiden Mesir Tolak Disebut Sebagai Ibunegara KAIRO (Waspada): Biasanya, istri para presiden di sebuah negara secara otomatis menyandang predikat‘Ibunegara.’Tetapi tidak demikian dengan Naglaa Mahmoud (foto), istri presiden Mesiryangbaruterpilih,Mohammed Moursi. Meskipun kini telah menjadi istri pemimpin Mesir, wanita berjilbab ini menolak disebut ‘Ibunegara’ seperti para pendahulunya. “Jika saya harus punya nama panggilan, saya lebih suka disebut

abdi Mesir, Um Ahmed (ibunya Ahmed), atau Hajjah,” kata Nagla, seperti dikutip Al Arabiya Rabu. Naglaa punya alasan sendiri untuk nama-nama yang dipilihnya. Dia lebih suka disebut abdi Mesir,karenamerasarakyatMesir adalahsatubangsa.NamaUmAhmeddipilihnyakarenamerujukpadastatusnyasebagaiibudariputra sulungnyayangbernamaAhmed. Sementara Hajjah merupakan sebutan yang disematkan pada Muslimah yang telah menjalankan ibadah haji di Makkah, ibadah yang telah dijalaninya. “Ajaran Islam tidak membedakan satu wanita dengan wanita lainnya,” kata Naglaa. Naglaa sadar bahwa jilbab yang dikenakannya memicu perdebatan di Mesir. Sebab, sepanjang sejarah pemerintahan modern di Mesir, dialah istri pemimpin negara pertama yang mengenakan jilbab. Berbeda dari istri

para pendahulu suaminya, yang dikenal mengikuti tren fesyen dan sangat bergaya. Belum diketahui seperti apa peranan yang akan dijalankan Naglaa sebagai ibunegara baru mengingat sedikitnya informasi tentangnyayangdiketahuipublik. Mungkin hal ini akan terungkap seiring dengan berjalannya pemerintahan sang suami. Menurut The NewYork Times Kamis (28/6), Naglaa Ali Mahmoud mengenakan penutup kepala (selendang) yang menutupi sampai ke lututnya, tidak mengikuti pendidikan tinggi dan tidak pernah mengambil nama belakang suaminya, karena itu adalah konvensi Barat bahwa hanya sebagian kecil orang Mesir mengikuti cara tersebut. Dia juga menolak gelar ibu negara, mendukung AhmedhanyaUm,namapanggilantradisionalyangmenunjukkan dirinya sebagai ibu dari Ahmed,

anak sulungnya. Kini Mesir memiliki pemimpin baru, Moursi, presiden pertama yang berasal dari organisasi berakarIslam,IkhwanulMusli-min. Danistrinyayangberusia50tahun selalutampildengangayastandar wanitaMesir.Diajauhbedadengan parapendahulunya,SuzanneMubarak dan Jihan Saddat, yang memiliki standar hidup wanita Barat karenaasalataupendidikanmereka. (nyt/ok/m10)

Berlusconi Terhindar Kasus Korupsi, Terjerat Skandal Seks


PEMOGOKAN PEKERJA BANGUNAN. Seorang pekerja bangunan (tengah) dan rekan-rekannya ambil bagian dalam satu pemogokan di Seoul Pusat, Korea Selatan, Kamis (28/6). Kira-kira 29.000 pekerja konstruksi yang tergabung dalam serikat buruh yang memulai pemogokannya Rabu telah ikut ambil bagian dalam rapat umum yang diselenggarakan oleh Konfederasi Serikat Buruh Korea (KCTU) di Seoul Kamis untuk menuntut hak buruh yang lebih baik, termasuk peningkatan upah, demikian menurut media lokal.

ROMA (Waspada): Mantan PM Italia Silvio Berlusconi bebas dari dakwaan penggelapan dana, yang membuatnya terseret ke pengadilan. Namun tampaknya Berlusconi masih harus berhadapan dengan dakwaan skandal seks. Kasus penggelapan dana itu melibatkansejumlahperusahaan media milik Berlusconi. Putra Berlusconi, Pier Silvio dan Frank Agrama, yang tak lain adalah seorang produser dan sutradara film, ikut terseret, demikian di-

beritakan ANSA, Kamis (28/6/ 2012). Namun hakim menyatakan, Berlusconi tidak bersalah dalam kasus tersebut, karena minimnya bukti-bukti yang terkait dengan keterlibatan Berlusconi. Namun Berlusconi belum dapat dikatakanbebasdarisejumlahdakwaan lainnya. Saat ini, Berlusconi masih berhadapan dengan dakwaan skandal seks di pengadilan Kota Milan. Berlusconi dituding melakukan hubungan seks dengan

seorang gadis di bawah umur. Namun Berlusconi mengatakan, segala bentuk tuduhan yang dilayangkan kepadanya bermotif politik. Februari lalu, Berlusconi juga diklaim membayar seorang pengacara Inggris untuk melanggar sumpahnya. Berlusconi pun terancam hukuman tiga tahun delapan bulan penjara karena tidak mau membayar pajak. Pengadilan terkait kasus tersebut akan digelar pada Juli mendatang. (ok/r-m10)

BAGHDAD (AP): Polisi mengatakan serangkaian ledakan bom di Baggdad, ibukota Irak, Kamis (28/6) menewaskan sekurangkurangnya sembilan orang dan mencederai lebih dari 40 lainnya. SeranganmematikanituterjadiKamisfajardikawasanpenduduk Sunni diTaji, di utara Baghdad. Para pejabat mengatakan dua mobil meledak di luar satu kantor pemerintahan, yang merusak rumahrumah di dekatnya dan menewaskan lima orang dan mencederai 18lainnya.Beberapajamkemudian,satupatrolikepolisianmengenai satu bom jalanan di kawasan penduduk Syiah di selatan Baghdad. Polisi dan para pejabat rumah sakit mengatakan, satu orang tewas dan enam lainnya cedera. Dan pada tengah hari, satu bom mobil meledak di luar satu pasar di satu kawasan penduduk Syiah di barat Baghdad. Pihak berwenang mengatakan tiga orang tewas dan 17 cedera. Rangkaian ledakan itu terjadi setelah PM Nuri al-Maliki menyerukan pemilihan umumsegeradalamsebuahpernyataannyaRabusetelahserangkaian krisis memuncak pada seruan-seruan bagi pendongkelan dirinya. “Ketika pihak lain menolak duduk di meja dialog dan mendorong kebijakan yang menyulut krisis terus-menerus dalam satu cara yang menyebabkan kerugian serius pada kepentingan utama rakyat Irak, maka perdana menteri terpaksa menyerukan pemilihan umum segera,” kata pernyataan di situs PM Irak itu. Pemilu parlemen yang akan datang seharusnya berlangsung pada 2014. Menurut Pasal 75 Konstitusi, parlemen bisa dibubarkan dengan suara mayoritas mutlak. Proses itu bisa dimulai dengan dua cara, melalui permintaan sepertiga anggota parlemen atau permintaan perdana menteri setelah terlebih dulu disetujui oleh presiden. (m10)

Carter: Obama Pembunuh Bayaran WASHINGTON (Waspada): Presiden Amerika Serikat ke-39 Jimmy Carter menilai, pemerintahan AS yang dipimpin Barack Obama kerap melakukan pelanggaran hukum, termasuk pembunuhan terhadap warganya. Mereka juga dituduh sering menahan warga AS yang dianggap mengancam. Carter membuat tulisan di suratkabar NewYork Times tentang pemerintahan Obama. Tulisan itu berjudul Sebuah Catatan Kejam dan Luar Biasa. Dalam tulisannya, Carter kerap mengkritisi catatan HAM AS di bawah kepemimpinan Obama. Carter menganggap Obama selalu terlibat dalam aksi pembunuhan yang sangat bertentangan dengan moral. Sebelumnya,mantanPresidenCarterpernahmenuduhpemerintah AS melanggar sanksi yang‘luas penyalahgunaan hak asasi manusia’ danmengesahkanseranganpesawattakberawakdalamusahamembunuh tersangka teroris, namun dalam kenyataannya kebanyakan yang jadi korban adalah warga sipil. Dia menuduh pemerintahan Obama ‘jelas melanggar’ 10 dari 30 artikel Deklarasi Universal Hak AsasiManusiadandiamenulisbahwa‘AmerikaSerikattelahmeninggalkan perannya sebagai kampiun global HAM.’ “Pemberitahuan yang menyebutkan bahwa para pejabat tinggi AS melakukan pembunuhan terhadap warganya di luar negeri, adalah bukti yang cukup mengganggu. Ini menjadi tanda adanya eskalasi pelanggaran HAM di AS,” ujar Carter dalam tulisannya, seperti dikutip New York Times, Kamis (28/6). Mantan presiden AS yang sempat berkecimpung dalam proses perdamaian Mesir dan Israel itu menyinggung Undang-Undang National Defense Authorization Act (NDAA), yang dinilainya sebagai undang-undang kontroversial yang ditandatangani Obama 31 Desember 2011. Lewat undang-undang ini, Pemerintah AS dapat menahanseluruhwargayangditudingaktifdalamtindakanterorisme. Selainpenahanandanpembunuhan,Cartermenyorotikebijakan Obamadalamoperasipesawatpengebomtakberawakyangditujukan untuk memburu kelompok militan. Carter mengatakan, operasi itu justruseringmenewaskanwargasipildananak-anakyangtidakberdosa. Tulisan Carter muncul di saat Dutabesar Pakistan untuk AS mengecam serangan pesawat pengebom tak berawak itu di negaranya. Menurutnya, sejak 2010 lalu, operasi pesawat itu sudah menewaskan 957 warga Pakistan. Isu penjara Guantanamo di Kuba juga menjadi perhatian Carter. Menurutnya, 169 tahanan di penjara tersebut tidak diberikan kebebasan yang cukup. Mereka juga disiksa dengan metode penyiksaan yang cukup kejam yaitu, waterboarding. Selain itu, kekerasan seksual pun menjadi senjata yang digunakan oleh sipir penjara terhadap para tersangka. (nyt/ok/m10)

China Ingin Masuk OKI BEIJING (Waspada): China merasa penting untuk masuk ke dalam Organisasi Konferensi Islam (OKI) karena Beijing saat ini banyak menghadapi masalah dengan masyarakat Muslim Uighur. Deputi Menteri Luar Negeri China Jhaa Jane menyoroti pentingnya keeratan hubungan antara negaranya dan sejumlah negara Islam di dunia ini dan menyatakan ingin menjadi anggota dari organisasi Sekjend OKI Ekmeleddin Ihsanoglu mengadakan pertemuan dengan Jhaa Jane di Beijing, China, Rabu (27/6). Dalam pertemuan itu, Ihsanoglu dan Jane membahas keeratan hubungan antara OKI dan Negeri Panda. Pada saat bertemu dengan PM China Wen Jiabao, Ihsanoglu menekankan pentingnya peningka-tan hubungan yang strategis antara OKI dan China. Jane juga menilai, penting bagi China untuk meningkatkan hubungan kultural dan perdagangan dengan OKI. Jane meminta OKI menyediakan informasi mengenai kriteria yang harus dipenuhi suatu negara untuk menjadi‘negara pengamat’ diOKI.Janepunberharap,Chinabisamendapatkankeanggotaannya di OKI, lewat Konferensi Dewan Menteri Luar Negeri OKI di Djibouti. Ihsanoglu pun turut mendesak Kementerian Luar Negeri China agar berperan aktif dalam menyelamatkan warga Muslim Rohingya di Myanmar. Rohingya adalah kelompok minoritas yang sangat tertindas di negaranya. Mereka terpaksa lari ke Bangladesh ketika negaranya dilanda konflik antar-agama. Meski demikian, mereka terkadang justru dipulangkan kembali ke negaranya. Selain isu Rohingya, Ihsanoglu juga mengajak China untuk memperhatikan isu yang berkembang di salah satu kotanya, yakni Kashgar. China diharapkan bisa membantu pembangunan di Kashgar, yang mayoritas penduduknya adalah umat Muslim. (ok/)


WASPADA Jumat 29 Juni 2012


Pemprovsu Tunggu Arahan Mendagri Pencairan Anggaran KONI Sumut Terganjal Permendagri MEDAN (Waspada): Pemerintah Provinsi (Pemprov) Sumatera Utara mengaku, belum bisa mencairkan anggaran hibah Komite Olahraga Nasional Indonesia (KONI) untuk keperluan kontingen Pekan Olahraga Nasional (PON) 2012 Sumatera Utara. “Kan itu (anggaran PON) sama seperti hibah lain, memang belum ada yang cair terkait Permendagri Nomor 32/2011,” kata Kepala Biro Keuangan Setdaprov Sumut Mahmud Sagala melalui telepon, Kamis (28/6). Dijelaskannya, berdasarkan Permendagri No 32/2011, setiap

bantuan hibah sebelum dianggarkan harus memenuhi beberapa kriteria dan jenjang persyaratan. Dalam pasal 8 ayat satu disebutkan bahwa pemerintah, pemerintah daerah lainnya, perusahaandaerah,masyarakatdan organisasi kemasyarakatan dapat menyampaikan usulan hibah

secara tertulis kepada kepala daerah. Lalu pada ayat kedua, kepala daerah menunjuk satuan kerja perangkat daerah (SKPD) terkait untuk melakukan evaluasi usulan sebagaimanadimaksudpadaayat satu. Ayat ketiga mengharuskan KepalaSKPDterkaitsebagaimana dimaksud pada ayat dua menyampaikanhasilevaluasiberupa rekomendasi kepada kepala daerah melalui Tim Anggaran Pemerintah Daerah (TAPD). “Penganggaran bantuan hibah pada APBD 2012 tidak melalui jenjang dimaksud, karena masih menggunakan aturan yang lama. Pemprov Sumut baru

menerima Permendagri 32/2004 tersebutsaatpembahasananggaran sudah berlangsung bersama DPRD Sumut,” papar Mahmud. Ditambahkannya, Pemprov Sumut sudah berinisiatif mengirim surat ke Menteri Dalam Negeri untuk konsultasi terkait permasalahan yang dihadapi. Dengan harapan ada arahan dan petunjuk dari Mendagri, anggaran hibah mana saja yang bisa didahulukan pencairannya. “Jikabelumadapetunjukdan arahan Mendagri, Pemprov Sumut tidak akan mencairkannya karenakhawatirmenjaditemuan. Sudah dua minggu kami kirim suratnya, kita tunggu dululah

Bisa Menjadi Sejarah Terburuk Sumut “Terlebih karena persiapan atlet sudah harus segera dilakukan. Jika tidak, jangan pernah kita berharap bisa meraih prestasi maksimal,” kata Raja Pane di Kantor KOI, Senayan, Jakarta, Kamis (28/6). Ditambahkan,pejabatpublik yangmemimpinSumutmestinya menjadikan kebutuhan dan kepentingan atlet sebagai prioritas. “Tanpaharusmelihatsesuatudan lain hal, apalagi jika tidak ada hubungannya dengan prestasi dan peningkatan olahraga,” pinta Raja. Ditegaskannya, Sumut akan mencatat sejarah terburuk jika tidak mengirim atletnya di PON 2012 Riau. “Jangan sampai Plt Gubsu mencatatkan namanya dengan tinta hitam dalam sejarah yang akan diingat seumur hidup, sebab saat di tangan dia lah terjadi

kemunduran prestasi olahraga Sumatera Utara,” papar Raja. “Jika saja ini terjadi, benarbenar menjadi citra buruk bagi dia (Plt Gubsu-red). Di sisi lain, ini tentu awan kelam bagi perkembangan olahraga Sumatera Utara, karena akan berimbas kepada pembinaan dari atas sampai bawah,” katanya lagi. Atal Depari, mantan Ketua Siwo PWI Pusat, bahkan melontarkan komentar lebih pedas. “Dari awal saja sudah seperti itu,bagaimanajadinyakalaunanti dia yang memimpin Sumut. Habislah prestasi olahraga kita,” ucap pria asal Karo tersebut. “Karena itu, sudah semestinyamenjadiperhatian,khususnya bagi kalangan masyarakat olahraga di Sumut. Saya hanya murni membela kepentingan olahraga Sumut, juga demi kejayaan tanah

LA Lights Streetball 2012

Dok.Waspada leluhur di pentas nasional maupun internasional,” tambahnya. Hal sama juga disampaikan wartawanseniorasalToba,Sarluhut Napitupulu. “Masalah pencairan dana APBD untuk kontingen Sumuttidakperlumenjadipolemik, sekiranya Plt Gubsu bisa bersikap lebiharifdanbijaksana,sertatidak mencampur-adukkan masalah politik dan olahraga,” pungkas Sarluhut. (yuslan)

M Fadly Masih Terbaik Biliar H2 Nine Ball Competition MEDAN (Waspada): M Fadly kembali membuktikan diri sebagai yang terbaik di Sumut, terutama di nomor bergengsi nine ball setelah menjuarai turnamen biliar bertajuk H2 Nine Ball Competition di Heaven Hell Medan, Kamis (28/6). Pebiliar yang dipersiapkan mengikuti PON 2012 di Riau itu tampil juara setelah di final menaklukkan Lamhot 7-5. Kemenangan Fadly sendiri tidak diraih dengan mudah, di mana Lamhot memberi perlawanan ketat. Pada break pertama hingga ketiga, Fadly memimpin 3-0, tetapi Lamhot mampu mengejar hingga kedudukan 5-6 masih untuk keunggulan Fadly. Di saat posisi 5-6, Lamhot sebenarnya

di atas angin bisa menyamakan skor sebab dia yang sedang memainkan bola. Namun faktor mental menjadi penentu laga kedua pemain. Bola sembilan yang tinggal satusatunya di atas meja, gagal dimasukkan oleh Lamhot. Moment itu tidak disia-siakan oleh Fadly untuk mengakhiri pertandingan dengan skor akhir 7-5. Sebelumnya di babak semifinal, Fadly mengalahkan Dino 7-4 dan Lamhot unggul atas Budi Tambunan 7-2. Dengan hasil tersebut, Fadly berhak atas uang tunai Rp8 juta dan Lamhot Rp4 juta.UntukjuaraIIIdanIVmasingmasing mendapat Rp2 juta. “POBSI Sumut berterima kasih kepada pihak H2 yang tetap komit menggelar turnamen biliar


M FADLY (kanan) menerima hadiah yang diserahkan Sekum POBSI Sumut, Hendy Ong, usai menjuarai ajang H2 Nine Ball Competition di Heaven Hell Medan, Kamis (28/6). dengan hadiah yang sangat menggiurkan. POBSI Sumut berharapagarkedepanH2tetapkonsis-

ten mendukung pembinaan biliar Sumut,” ujar Sekum POBSI Sumut, Hendy Ong. (m42)

KONI Berharap Sosok Peduli Pimpin PSSI Medan MEDAN (Waspada): Ketua Umum KONI Medan, Drs Zulhifzi Lubis, berharap Pengkot PSSI Kota Medan dipimpin oleh sosok peduli sepakbola. Juga sosok yang mempunyai kemampuan mengembangkan dan menggairahkan sepakbola, serta rela berkorban baik waktu, tenaga, dan materi. “KONI Medan menyambut positif wacana digelarnya musyawarah cabang Pengkot PSSI Medan, setelah ketua lama Drs HM Darwin Syamsul memimpin Pengprov PSSI Sumut,” kata pria yang akrab disapa Opunk Ladon ini di Sekretariat KONI Medan, Kamis (28/6).

Dia juga meminta kepada peserta Muscab PSSI Medan dapat memilih sosok figur yang tepat dalam arti jangan salah memilih. Kota Medan, lanjut Opunk, adalah barometer perkembangan sepakbola di Sumut. Ini ditandai dengan berbagai kegiatan dan kejuaraan sepakbola didominasi oleh atlet-atlet asal Kota Medan. Salah satu faktor yang patut diperhitungkan adalah kompetisi. Ketiadaan kompetisi menjadikan pembinaan sepakbola jalan di tempat. Kompetisi adalah sarana dalam membentuk karakter atlet, di mana kompetisi sebuah sasaran antara yang sekaligus

Problem Catur


Putih melangkah, mematikan lawannya dua langkah.

Jawaban di halaman A2 8







1 A





kemajuan atlet atau sebuah klub. “Besar harapan KONI Medan supaya Muscab PSSI Kota Medan berjalan lancar dan tidak ada kekisruhan,” tambah Opunk. KONI Medan, lanjut Opunk, memiliki programprogram nyata dengan harapan Kota Medan menjadi Kota Atlet sesuai dengan harapan Wali Kota Medan, Drs H Rahudman Harahap MM. Menurut Opunk, KONI Medan yang menggelar Pekan Olahraga Kota Medan setiap tahunnya turut mempertandingkan cabang sepakbola. Ini tentunya sebagai langkah mencari bibit atlet sepakbola andal.




(Binsos). “Sedangkan dalam aturan yang baru, verifikasi harus dilakukan sebelum bantuan hibah ditampung di R-APBD. Bantuan hibah juga diserahkan ke SKPD terkait dan tidak lagi ditampung seluruhnya di Biro Binsos,” pungkas Mahmud. Mahasiswa UISU Kecam Pemprovsu Terkait belum cairnya dana untuk PON 2012 tersebut, Mahasiswa Universitas Islam Sumatera Utara (UISU) Kampus Al Munawwarah mengecam Pemprovsu yang terkesan memperlambat pencairannya. Presiden Mahasiswa UISU

“Katanya olahraga merupakan salah satu sarana untuk membangun bangsa, tapi di Sumatera Utara ini pemerintah justru mengabaikan olahraga. Kalau dananya sudah ada, untuk apa ditahan-tahan, lebih bagus dicairkan saja,” ujar Fadli. Dia pun mengharapkan agar pengurus KONI Sumatera Utara berperan aktif mendesak pencairan dana itu sekaligus menelusuri kendalanya. “Pengurus KONI Sumut jangan takut, kalau Pemprovsu salah, kami sebagai mahasiswa tidak akan tinggal diam,” tegasnya. Bahkan bila keterlambatan pencairan dana itu disebabkan faktor politik atau kepentingan pribadi, pihaknya siap turun ke jalan untuk memperjuangkan aspirasi para atlet Sumatera Utara. (m28/m15)

Tantangan Streetballer Medan

Siwo PWI Pusat: JAKARTA (Waspada): Belum adanya kejelasan pencairan dana APBD untuk KONI Sumatera Utara hingga membuat keberangkatan kontingen PON 2012 Sumut terancam gagal, memantik reaksi keras dari Ketua Seksi Wartawan Olahraga (Siwo) PWI Pusat, Raja Parlindungan Pane (foto). Pria asal Sipirok ini mengaku tidak habis pikir atas sikap Pemerintah Provinsi Sumatera Utara menahan pencairan dana itu, mengingat persiapan atlet sudah harus dilakukan. Apalagi waktu pelaksanaan multi event olahraga bergengsi di tanah air itu, sudah semakin dekat. “Dana untuk PON dari APBD di setiap daerah sudah dianggarkan jauh-jauh hari. Karena itu, tidak ada lagi alasan Pemprovsu untuk menahannya.”

jawaban Mendagri seperti apa,” dalih Mahmud Sagala. Pemprov Sumut juga telah menyiapkanrencanaagarseluruh bantuanhibahyangtelahdisetujui dalam APBD 2012 untuk dicantumkan kembali dalam APBD Perubahan (APBD-P) 2012 dengan mengikuti persyaratan Permendagri No 32/2011. “Kita tunggu di APBD-P 2012 lah untuk pencairannya,” katanya menambahkan. Selama ini diakuinya, mekanisme penganggaran bantuan hibahbarudiverifikasisetelahanggaran ditampung dalam APBD dansemuanyadiserahkankeBiro Bina Kemasyarakatan dan Sosial

Kampus Al Munawwarah, Fadli Qahfy, Kamis (28/6) mengatakan, keterlambatan pencairan dana itutentunyaakanmempengaruhi persiapan Kontingen Sumatera Utara,sehinggatargetmasuktujuh besar seperti yang digadang-gadang kian sulit untuk tercapai. “PON tinggal dua bulan lagi, sementara dana persiapan belum ada, bagaimana atlet-atlet kita bisa berprestasi,” sesal Fadli. “Padahal, persiapan PON membutuhkan dana yang bukan sedikit, mungkin sulit bagi pengurus KONI Sumut untuk menanggulanginya,” ujarnya lagi. Fadli sangat kecewa dengan kondisi sekarang ini. Pemprovsu dinilainya tidak memperhatikan dunia olahraga, padahal olahraga merupakan salah satu aspek untuk pembangunan daerah.

“Untuk tahun 2012 ini, Porkot juga akan mempertandingkan cabang sepakbola,” ujar Opunk yang turut membina sepakbola melalui sekolah sepakbola. Ketua Umum Pengprov PSSI Sumut, Drs HM Darwin Syamsul, sudah mengeluarkan surat keputusan untuk melaksanakan Muscab Pengkot PSSI Medan yang diketuai Nanda Ramli dan Sekretaris Halim Panggabean. Menanggapi pelaksanaan Muscab, Halim Panggabean yang dikonfirmasi menyebutkan pelaksanaan digelar dalam waktu dekat ini. “Tanggalnya belum dipastikan,” tegas Halim. (m18)


MEDAN (Waspada): Setelah melalui tiga gelaran open run, Malang (12-13 Mei), Bandung (23 Juni), dan Jakarta (9-10 Juni) lalu, open run LA Lights Streetball 2012 kinimerambahKotaMedanpada Sabtu-Minggu (30/6-1/7) di Universitas Dharma Agung. Streetballer Medan mendapat tantangan besar untuk mematahkan point breaker city record Jakarta yang berhasil mencetak 117 point breaker dan 36 dunk serta telah mengungguli dua kota sebelumnya, Malang dan Bandung. Demikian disampaikan Brand Manager LA Lights, Maya Shintawati, dalam keterangan persnya, Kamis (28/6). KotaMedantergolongspesial karena turut menyumbang dua All Stars 2011 dengan posisi handler, yaitu Rahmad Edi aka Invisible dari Ice Cream dan Lana aka Money Man dari Universal. Selain itu, beberapa komunitas streetball Medan yang memang patut diperhitungkan karena jumlah dan kualitasnya yang semakin meningkat seperti Universal, Polonia Ball Star, Ice Cream Streetball, dan Ka-mu Ballers. Bagi jajaran streetballer Medan,pemecahanpointbreaker city record Kota Jakarta menjadi sebuah tantangan yang cukup berat. Tentunya, mereka tidak akan tinggal diam. Kredibilitas Medansebagaikotapencetakstreetballer andal tanah air dipertaruhkan. Tidak hanya Kota Medan, point breaker city record merupakan tantangan kepada streetballer pada setiap kota penyelenggara open run di tahun


SALAH satu streetballer memperagakan slam dunk pada pagelaran di Jakarta 3 Juni lalu. ini untuk mendapat point breaker sebanyak-banyaknya. Pertandingan LA Lights streetball lebih mengedepankan skill basket seorang pemain ketimbang permainan tim semata. Jika seseorang mampu memahami dan pintar dalam memainkan trik, maka akan menjadi sebuah keuntungan baginya dalam menghasilkan poin.

“Berbeda dengan perhitungan poin dalam pertandingan basketkonvensional,perhitungan poin dalam LA Lights streetball dikenal dengan sebutan point breaker, yakni jika seorang streetballer berhasil melakukan trik dengan sempurna pada saat berhadapan atau melewati pemain lawan. Point breaker juga memiliki bobot nilai yang ber-

beda-beda,” tambah Baswan aka Brother J, juri senior LA Lights Streetball. Di tahun ini terdapat penambahan ide-ide baru seperti diberlakukannya 3secondbox,starzone, akumulasi point breaker, point breaker city record, 5 second violation, serta penambahan sejumlah gimmick dan kontes individual skill. (m18)

Tim AMS Pertamina Fastron Bidik Hasil Lebih Baik MEDAN (Waspada): Tim-tim balap Medan tak mau kalah mempersiapkan diri menghadapi gelaran kejurnas Seri II Sergai Rally 2012 yang berlangsung di kawasan kebun Rambong Sialang, Kab Sergai, 6-8 Juli mendatang. Adalah Anugerah Motor Sport (AMS) Pertamina Fastron Rally Team Medan yang menyatakan siap tampil dalam kejuaraan Sergai Rally 2012 memperebutkan trofi Bupati Sergai dengan start dan finish di lapangan replika Sultan Serdang di Jalinsum, Perbaungan. Manajer AMS Pertamina Fastron Rally Team, Faisal Siregar, mengatakan mereka menerjunkan dua pasangan pereli dengan target menembus hasil yang lebih baik dari Langkat Rally 2012 sebagai seri I kejurnas, April lalu. Dikatakan,timAMStetapmengandalkanDanielPasaribubersama AdheTeguh (navigator) di kelompok GR 2 mengandalkan kendaraan Suzuki SX4. Sedangkan jagoan tim satu lagi adalahWinner Limbong/ Norman Omen di kategori grup N-15 juga bersama Suzuki SX4. “Tim telah mempersiapkan diri sejak dini guna membidik prestasi terbaik, di mana Daniel Pasaribu diharapkan merebut podium teratas di kelas GR 2.2, sekaligus masuk 10 Besar kejuaraan umum. Memang tidak mudah, tetapi kita optimis,” ucap Faisal didampingi Chief Mekanik, Allan, di markas tim Jl Sei Serayu No 62, Medan, Kamis (28/6). Pada seri I Langkat Rally 2012 lalu, Daniel tampil sebagai runnerup kelas GR 2.2 (mobil penggerak dua roda 2.000 cc). UntukWinner Limbong, diharapkan merebut gelar N-15 yang tertunda, mengingat


1. Budi pekerti (Kelakuan yang baik sesama manusia, berat timbangannya, menurut HR Thabrani). 3. Nama nabi yang berbudi pekerti agung, menurut QS Al Qalam ayat 4. 6. Tulus hati (Amal seseorang yang diterima oleh Allah hanya yang mengharap ridhoNya. HR Abu Dawud dan Nasa’i). 8. Ganjaran Allah atas perbuatan baik (Ditulis 10 sampai 700 kali kebaikan. HR Bukhari-Muslim). 9. Singkatan Subhana Wa Ta’ala. 10. Yang Akbar. 11. Indra untuk melihat, yang disebut oleh hadis dapat berzina. 13. Jumlah rakaat shalat Subuh. 14. Putih, bersih (Arab); Sa’i dari ____ ke Marwa. 15. Bab atau bagian (1/30) dari Al Quran. 16. Penggabungan shalat, baik takdim maupun takhir. 17. Singkatan di belakang nama nabi-nabi. 19. Jaiz; Tiada dosa atau pahala apabila dilakukan. 20. Orang-orang lemah (ekonominya dsb). 21. Ahli. 22. Al-______, Yang Melindungi, Yang Menjaga, Yang Memelihara, salah satu

Asma’ul-Husna. 24. Yang Waspada (Asma’ul-Husna). 26. Unsur di dalam jasad membuat manusia hidup. 28. Yang Maha Besar (Asma’ul-Husna). 29. Kota suci di Arab Saudi.

Waspada/Armansyah Th

PASANGAN pereli AMS Pertamina Fastron, Daniel Pasaribu/ Adhe Teguh (kanan), bersama manajer dan chief mekanik foto bersama di markas tim, Kamis (28/6). seri I lalu sempat memimpin sebelum kemudian posisinya melorot pada hasil akhir. Daniel Pasaribu sendiri optimis target yang diusung tim bisa dicapai. “Di seri I, kita akui memang kurang maksimal, salah satu di antaranya karena terkendala kurangnya stok ban untuk lintasan basah. Tetapi kali ini semuanya sudah komplit sehingga kami yakin bisa memberikan yang terbaik dalam membela nama Sumut di ajang nasional,” terang Daniel. (m47)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.


1. Saleh; Berilmu (dalam hal agama Islam). 2. Perbuatan baik yang mendatangkan pahala. 4. Daya upaya; Ikhtiar. 5. Orang yang baru masuk Islam. 7. Siti____, istri Nabi Adam a.s. 9. Khitan. 10. Al-_____, Surat ke-33 Al Quran, artinya Persekutuan. 11. Terkabul; Tercapai. 12. Berjalan mengelilingi Ka’bah tujuh kali sambil berdoa. 14. Huruf ke-4 abjad Arab. 15. Batu kecil; Tugu untuk dilempari dalam ibadah haji. 16. Nama neraka dasar. 18. Bulan Hijriah 29 hari. 20. Perbuatan terlarang terhadap orang tua. 22. Sangat marah. 23. Imam terakhir Syiah yang disebut “Imam Zaman”. 25. Khair. 27. Benar; Kebenaran.

6 5




7 4 4

7 9

1 8 5 9

1 4


6 8

8 1

2 6


4 7




WASPADA Jumat 29 Juni 2012

Jerman-Italia Sama Saja DONETSK, Ukraina (Waspada): Entrenador Spanyol, Vicente del Bosque, mengaku skuadnya sudah siap meladeni siapapun pada final Piala Eropa 2012 di Kiev, 1 Juli mendatang. Apalagi menurutnya, Jerman maupun Italia sebagai calon lawan, sama saja sebagai tim spesialis turnamen. “Setiap semifinal merupakan laga yang menarik begitu juga final. Kami tidak peduli siapa yang menjadi lawan kami nanti,” klaim Del Bosque, Kamis (28/6). Spanyol memastikan diri menembus partai puncak, setelah mengalahkan Portugal

4-2 (0-0) dalam drama adu penalti pada semifinal di Donbass Arena, Donetsk, Ukraina. Del Bosque mengakui, skuadnya mendapat perlawanan sengit dari Seleccao das Quintas, sehingga dia memaksimalkan pergantian pemain untuk meningkatkan daya juang El Matador. Termasuk pergantian playmaker Xavi Hernandez dengan Pedro Rodriguez

Nasri Minta Maaf PARIS (Antara): Samir Nasri (foto) meminta maaf atas ulah mulut kasarnya kepada seorang jurnalis Prancis, setelah Les Bleus ditaklukkan Spanyol 02 pada perempatfinal Euro 2012 pada 23 Juni lalu. “Suporter, terutama para anak-anak, saya meminta maaf atas ucapan saya yang mungkin mengejutkan kalian. Saya cinta tim, sepakbola dan saya menghormati suporter,” tulis Nasri, seperti dikutip dari The Sun, Kamis (28/6). Namun bintang ManchesAP ter City itu tidak meminta maaf kepada jurnalis tersebut. “Saya akan menjelaskan lebih lanjut jika waktunya tepat,” dalih Nasri, yang turun sebagai pemain pengganti dalam duel tersebut. Sebelumnya, pelatih Laurent Blanc dan Federasi Sepakbola Prancis (FFF) telah mengecam ulah Nasri tersebut. Akibatnya, dia pun diancam skorsing di tim nasional. Nasri juga bergaya tidak sopan saat melakukan selebrasi gol ke gawang Inggris pada partai perdana penyisihan Grukp C, sembari meneriakkan “tutup mulutmu” dalam bahasa Prancis. Lalu dia melakukan gerak (menutup bibir dengan jari) untuk menyuruh jurnalis diam. “Memang ada masalah antara Nasri dengan media massa. Itu kenyataan,” beber Blanc.

Final Minggu, 1 Juli Di Kiev : Spanyol vs Jerman/Italia *RCTI Live Senin dinihari pkl 01:45 WIB

18:45 GMT

Semifinal Rabu, 27 Juni Di Donetsk

: Portugal vs Spanyol 0-0 (pen 4-2)

Semifinal Kamis, 28 Juni Di Warsawa

: Jerman vs Italia


Calon Top Skor 3 Gol : Mario Gomez (Jerman), Cristiano Ronaldo (Portugal), *Mario Mandzukic (Kroasia), *Alan Dzagoyev (Rusia) 2 Gol : Xabi Alonso, Cesc Fabregas, Fernando Torres (Spanyol) di menit 87. “Xavi bermain gemilang. Tetapi dia lelah dan kami ingin gerak yang lebih gesit di lapangan. Pedro dan (Jesus) Navas lebih aktif dan memberi suntikan serangan yang lebih agresif,” jelasnya. “Kami ingin menambah pemain yang punya kecepatan dan kami menciptakan banyak ancaman kepada mereka. Pemain kami semakin matang dari menit ke menit,” tambah Del Bosque. Sama seperti sang bos, gelandang Xabi Alonso juga lega dengan kemampuan timnya menjinakkan perlawanan Cristiano Ronaldo cs. “Kami kembali melangkah ke final dan ini hadiah yang luar biasa. Apapun yang terjadi, kami harus bangga,” ujarnya. “Di laga seperti ini, Anda harus tetap tenang. Sekarang, kami ingin membawa trofi pulang ke rumah,” tekad Alonso, yang ga-gal menyarangkan gol ke gawang kiper Rui Patricio saat dirinya menjadi algojo pertama Spanyol. “Untuk penalti yang saya ambil, kiper melakukan penyelamatan bagus, namun rekanrekan saya berhasil memperbaikinya. Pada akhirnya, me-

mang harus ada yang menang dan keberuntungan memihak kami,” tegas gelandang Real Madrid tersebut. Menurut striker Alvaro Negredo, laga Spanyol-Portugal berjalan sangat buruk. “Ada banyak bola udara, bentrokan, tekel, dan saya harus berjuang setiap inchi dalam membuat lawan keluar membawa bola,” ungkapknya kepada Soccerway. “Saya sangat senang, akhirnya kami mencapai apa yang kami inginkan. Ini merupakan hasil yang sangat memuaskan lewat laga yang sangat ketat. Kami harus bangga meskipun mencapainya bukan dengan gaya kami sebenarnya,” tutur Negredo. Saat melawan Portugal, striker Sevilla itu diturunkan sebagai starter oleh Del Bosque. Dalam empat laga Spanyol sebelumnya di Euro 2012, posisi ujung tombak itu secara bergantian diisi Cesc Fabregas dan Fernando Torres. “Saat tahu saya menjadi starter, saya sangat terkejut. Saya butuh beberapa saat untuk sadar, sebab saya tahu ini kesempatan langka dan saya harus melakukan yang terbaik,” pungkas Negredo. (m15/vvn/uefa/sw)

Waspada/Arianda Tanjung

MARNI, warga Medan yang sangat rajin menyaksikan acara pengundian kuis Bigmatch Harian Waspada, mendapat kesempatan mengundi kupon lima pemenang hadiah uang tunai Rp500 ribu.

Waspada/Arianda Tanjung

SUNARYO, warga Medan, membacakan hasil undian hadiah kedua senilai Rp1 juta yang dicabutnya di Kantor Harian Waspada.


WARGA Spanyol melampiaskan kegembiraan dalam acara nonton bareng di Madrid, Rabu (Kamis WIB), setelah La Furia Roja memastikan maju ke final usai mengalahkan Portugal 4-2 dalam drama adu penalti di Donbass Arena, Donetsk, Ukraina.

Ramos Laki-laki Sejati DONETSK ( Waspada): Kiper sekaligus kapten Spanyol, Iker Casillas, memuji aksi berani rekannya, Sergio Ramos (foto), saat mengeksekusi penalti ke gawang Portugal di semifinal Euro 2012. Tampil sebagai algojo keempat Spanyol saat skor 2-2 dalam drama 12 pas pada perempatfinal di Donbass Arena, Donetsk, Ukraina, Rabu (Kamis WIB), Ramos justru melakukan tendangan penalti ala legenda Cekoslowakia, Antonin Panenka. “Penalti Sergio Ramos, itu benar-benar membutuhkan keberanian untuk menendang ala Panenka. Ramos telah menunjukkan dia seorang laki-laki sejati, lewat aksi yang dia tunjukkan,” sanjung Casillas dalam laman UEFA, Kamis (28/6). Bek serba bisa Real Madrid itu memang laki-laki sejati, karena justru dia sendiri yang mengajukan diri sebagai eksekutor, setelah El Matador ditahan Portugal 0-0 selama 120 menit. “Saya ingin sekali menjadi penendang penalti. Terlebih setelah pengalaman buruk di semifinal Liga Champions bersama Real Madrid,” jelas Ramos. Saat melawan Bayern Munich di semifinal Liga Cham-

Dody Pemenang Utama Periode III Pengundian Kuis Bigmatch Euro 2012 MEDAN (Waspada): Dody Alfiter Sipahutar, penduduk Sei Gunting, Blok I-B, Kec. Sunggal, Deliserdang, memenangkan hadiah utama kuis Bigmatch Euro 2012 periode III pada pengundian di pelataran parkir Kantor Harian Waspada, Jl Let-

jen Suprapto/Brigjen Katamso No.1 Medan, Kamis (28/6). Dody berhak atas uang tunai senilai Rp1,5 juga, setelah kuponnya dicabut oleh Manajer Iklan PT Harian Waspada, Hj Hilda Mulina. Seperti biasa, acara pengundian disaksikan puluhan

warga yang juga turut diberi kesempatan untuk mengundi. Untuk dua hadiah masingmasing uang tunai Rp1 juta diraih Fajrul Islam Adeliza, Jl Bromo Gg Pukat II No.8 dan Muhammad Alfian Nasution, Jl Selam 1 Gg Saudara No 25 Kel. Tegal

Sari Mandala 1. Selain tiga pemenang tersebut di atas, juga terdapat lima pemenang hadiah masing-masing uang tunai Rp500 ribu dan 10 pemenang hadiah t-shirt timnas peserta Euro 2012 (lihat daftar pemenang periode III). Sekretaris Panitia, Erwinsyah SE, mengatakan panitia selama periode III (lima hari) menerima kupon masuk total ku-

rang lebih 120.000 lembar. Namun kupon dengan jawaban benar hanya sekira 40% dari jumlah total kupon masuk. “Bagi para pemenang sudah dapat mengambil hadiah di Kantor Harian Waspada setiap jam kerja mulai Selasa (3/7). Pemenang harus menyerahkan fotokopi identitas diri sesuai yang tertera di kupon pemenang,” ujar Erwinsyah.

Daftar Pememang Periode III 1 Pemenang Rp1,5 juta -Alfiter Sipahutar, Sei Gunting, Blok I-B, Kec. Sunggal, Deliserdang. 2 Pemenang @Rp1 juta -Fajrul Islam Adeliza, Jl Bromo Gg Pukat II No.8 -M Alfian Nst, Jl Selam 1 Gg Saudara Kel. Tegal Sari Mandala 1 5 Pemenang @ Rp500.000 -Harianto, Jl Kemudi No.8 Lk F Kel Tanah 600 Medan -Hj Sakiman, Jl Binjai Km 10,3 Gg Jadi–Payageli -Japantas Saragih SP, Jl Garu III Gg Makmur No.145 Medan -T Alfian Helmi, Jl Perjuangan No.1 Tanjung Pura–Langkat -M Yadi Rangkuti, Jl B Zein Hamid Gg Pandan Tinggi, Titi Kuning

Waspada/Arianda Tanjung

MANAJER Iklan PT Harian Waspada, Hj Hilda Mulina, mengundi kupon hadiah utama kuis Bigmatch Euro 2012 periode III di Kantor Harian Waspada, Jl Letjen Suprapto/Brigjen Katamso No.1 Medan, Kamis (28/6).

10 Pemenang T-shirt -Hamid Budiman, Jl Seser Lk. I Medan -Hamzah Hanafi, Jl Karya Gg Suka Damai Medan -Arief Tarmizi, Jl Utama Gg T Yunan Medan -M Idham Surya, Jl Bersama Gg Jaya Baru Medan -Khairul Ahmadi, Jl Medan Bt Kuis Gg Semar -Ambri Handoko, Dusun VIII Mawar L. Dendang Percut Sei Tuan -Nursaelan Lubis, Jl SM Raja Gg Syahrudin No.31 A Medan -Yudhi Isyanto, Jl Jermal IV No.12 Medan -Muhammad Taris Siregar, Jl Taud/Suka Ria No.95 Tembung -Sunaryo Alamsyah ST, Jl. Flamboyan Raya No.108 A

pions 2011-12, Mei lalu, tendangan bek yang memiliki 12 tato di tubuhnya itu melambung di atas mistar gawang kiper Manuel Neuer. Dia ternyata ingin membayar kegagalan itu dengan membobol gawang Seleccao di Donetsk. Aksi dan kesuksesan Ramos itu persis seperti yang dilakukan Andrea Pirlo, yang memenangkan Italia 4-2 atas Inggris lewat adu penalti di perempatfinal Euro 2012 ini. “Sergio Ramos tahu bahwa Rui Patricio akan bergerak ke satu arah untuk semua penalti. Itulah mengapa dia memutuskan meniru tendangan yang Pirlo buat di laga sebelumnya,” ucap Vicente del Bosque, entrenador La Furia Roja. Gol penalti Ramos sekaligus memulihkan keunggulan sang juara bertahan, setelah tendangan algojo pertama Xabi Alonso dengan brilian ditepis Patricio. Casillas langsung membalasnya dengan menepis bola tendangan Joao Moutinho. Andres Iniesta sebagai algojo kedua Spanyol dan Kepler Pepe selaku eksekutor kedua Portugal, sama-sama berhasil menunaikan tugasnya. Begitu pula algojo ketiga, Gerrard Pique (Spanyol) dan Luis Nani (Portugal). Ramos kemudian dengan mudah mengecoh Patrico, se-

Spanyol Xabi Alonso (gagal) Iniesta (gol) Pique (gol) Ramos (gol) Fabregas (gol)

Skor 0-0 1-1 2-2 3-2 4-2

dangkan tembakan eksekutor keempat Portugal, Bruno Alves, membentur keras tiang gawang Casillas. Penendang terakhir Spanyol, Cesc Fabregas, mampu menyelesaikan tugasnya dengan baik sekaligus memastikan kemenangan 4-2 Spanyol. “Saya senang dengan performa tim hari ini, meskipun


Portugal Moutinho (gagal) Pepe (gol) Nani (gol) Alves (gagal) Ronaldo (batal)

Portugal membuat kami kesulitan. Yang terpenting, kami berhasil mencapai final,” tukas Ramos. Laga final dijadwalkan berlangsung pada 1 Juli 2012 di Kiev, Spanyol masih menunggu pemenang laga semifinal lainnya antara Jerman versus Italia di Warsawa. (m15/ant/uefa/espn)


WASPADA Jumat 29 Juni 2012


Ronaldo Setuju Saja Nomor 5 DONETSK, Ukraina (Waspada): Cristiano Ronaldo (foto) mengaku, dia menurut saja saat ditawari menjadi algojo penalti terakhir di semifinal Piala Eropa 2012 saat melawan Spanyol.


“Pelatih bertanya pada saya, ‘apa kamu mau jadi nomor lima?’ dan saya jawab ‘ya’. Kadang saya di urutan pertama, kedua, atau ketiga. Kali ini saya setuju menjadi nomor lima,” beber Ronaldo dalam Sky Sports, Kamis (28/6). Sebagai kapten dan ‘jimat’ Seleccao das Quintas, Ronaldo diperkirakan menjadi algojo pertama dalam drama adu tendangan 12 pas di Donetsk tersebut. Namun gilirannya tak kunjung tiba saat Joao Mountinho dan Bruno Alves gagal mencetak gol, sehingga Portugal harus bertekuk lutut 2-4. “Sekarang saya harap Spanyol bisa jadi pemenang, karena sayapunyabanyaktemandisana. Saya juga bermain di sana dan tentu itu akan jadi final yang sulit bagi mereka,” tutur Ronaldo. “Saya merasa biasa saja bermain melawan pemain Real

DFB Peringati Pacar Khedira

Terlalu Seksi Dukung Jerman WARSAWA (Waspada): Asosiasi Sepakbola Jerman (DFB) memberi peringatan kepada pacar Sami Khedira, Lena Gercke, karena dianggap berpakaian terlalu seksi saat hadir untuk menonton pertandingan Der Panzer di Piala Eropa 2012. Menurut tabloid Jerman, Bunte, sebagaimana dikutip Kamis (28/6), cara berpakaian Lena dikhawatirkan DFB dapat menyulut api cemburu istri dan kekasih (WAGs) pemain Jerman lainnya, sehingga menimbulkan pertengkaran yang berujungpadaperpecahantim. DFB pun memperingatkan model cantik berusia 24 tahun itu untuk tidak datang menemui Khedira ke markas latihan, juga di stadion dengan pakaian yang terlalu mengundang. Lena memang dikenal sebagai model yang kerap berpenampilan seksi. Dia malah hanya mengenakan hot pants tipis saat menonton laga Jerman kontra Portugal pada laga pembuka penyisihan Grup B, 9 Juni lalu. Pose Khedira-Lena pun sempat menjadi ‘buah bibir’ saat mereka berdua menjadi

Madrid. Di lapangan kami lawan, di luar lapangan kami kawan,” katanya menambahkan. Dalam duel di Donbass Arena, Rabu (Kamis WIB) tersebut, Portugal berhasil menyulitkan sang juara bertahan selama 120 menit. Tapi saat adu penalti, tim Samba Eropa itu sepertinya keliru dalam penyusunan komposisi eksekutor. Bruno Alves yang gagal menaklukkan kiper Iker Cassilas, bahkan sempat salah langkah. Dia terlanjur maju mengambil bola pada kesempatan ketiga, padahal gilirannya pada urutan keempat. “Penendang kelima seharusnya Ronaldo. Dan kami memiliki urutan ini sejak awal, Moutinho, Pepe, Nani, Alves, lalu Ronaldo,” ungkap pelatih Portugal, Paulo Bento. “Itu sudah direncanakan, sayangtidakberjalandenganbaik. Sepakbola juga tergantung pada faktor keberuntungan. Jika skor 4-4 maka dia akan menendang, dan kita tidak membicarakan lagi hal ini,” katanya menambahkan. Portugal Bangga Bento juga diliputi perasaan sedih namuntetapbangga,sebab skuadnya tampil menjanjikan dalam90menitawal.Merekame-

lorot pada babak tambahan waktu dan puncaknya di babak adu penalti. “Perasaan saya diliputi kesedihan. Kalah di semifinal melalui adu penalti selalu terasa pedih. Tapi, penalti seperti judi, yang lebih beruntung dialah yang menang,” ratap Bento. “Kalausayabisamemilihcara kalah, saya akan memilih cara seperti ini. Spanyol bagus dan kami bisa pergi dengan bangga.

Kini para pemain bisa berlibur, mereka patut mendapatkan itu. Mulai September, kami akan mempersiapkan diri untuk Piala Dunia 2014,” ujarnya lagi. “Kamitentusajasangatsedih. Kami ingin terus melaju ke final, tapi sayangnya gagal,” timpal striker Nelson Oliveira, yang masuk menggantikan Hugo Almeida pada babak kedua. “Kami sedih, tapi di waktu yang sama tetap berbangga hati,

dari tiga penendang Spanyol dengan tepat meski akhirnya tetap kemasukan.PatriciodanpunggawaPortugallainpunharusmengakui keunggulan Spanyol 2-4. Bernama lengkap Rui Pedro dos Santos Patrício, sang kiper kelahiran Leiria, 15 Februari 1988 ini adalah penerus Ricardo dibawahmistargawangPortugal. Meski namanya tidak ter-lalu santer terdengar, Portugal patut berterima kasih berkat kegemilanganPatricio-lahmerekamampu melaju ke semifinal Euro. Di musim 2007/2008 setelah Ricardo hengkang ke La Liga untuk bergabung dengan Real Betis, Patrício memenangi kepercayaan pelatih sekaligus menyingkirkan Tiago dan Vladimir Stojkovic di Sporting. Pada 27

November 2007, Patricio melakoni debut Liga Champions saat Sporting kalah 1-2 dari Manchester United di fase grup. Akibat menyulitkan Ryan Giggs cs mencetak gol, kubu Manchester United pun dikabarkan mengincar Patricio untuk menggantikan Edwin van der Sar yang akan pensiun. Sayang, tawaran United ditolak dan pilihan Sir Alex Ferguson beralih kepada kiper muda Atletico Madrid, David De Gea. Digadang-gadang sebagai penerus kiper legendaris Portugal, Vitor Baia, jelas kalimat itu tidak berlebihan. Pasalnya, penampilan apik yang diperlihatkan Patricio di klub dan timnas mengundang decak kagum. (m33/afp/uefa)

Kepala Patricio Tetap Tegak

model sampul sebuah majalah dewasa pada 2011. Saat itu Lena tampil tanpa busana dengan Khedira menutupi sebagian tubuhnya. Gadis cantik berambut blonde ini sepertinya menuruti peringatan DFB, sehingga berencana untuk menjaga penampilan saat mendukung Khedira cs di stadion. Daily Star melansir, Lena bahkan berniat untuk menghindari sorotan kamera dengan penampilan biasa-biasa saja, layaknya supporter lain. Model yang juga host televisi ini tak ingin lagi mengalihkan perhatian para penonton, yang sejatinya me-

nyaksikan pertandingan. Dia juga mempertimbangkan sindiran pelatih Jerman, Joachim Loew, yang menyebutkan Lena selalu tampil lebih memesona dibanding WAGs armada Panser lain. Loew cemas, WAGs akan berlomba-lomba mencuri perhatian public, sehingga muncul persaingan internal dalam Der Panzer. “Kehadiran para wanita pendamping bisa memberi dampak positif sekaligus negatif bagi pemain,” jelas Loew, seraya menegaskan tidak ingin WAGs mengganggu keutuhan skuadnya. (m15/goal/bunte)

KENDATI timnas Portugal harus tersingkir dari pentas Euro 2012, Rui Patricio (foto) tetap bangga. Bahkan penjaga gawang Seleccao ini menjadi pemain paling bersinar dalam laga antara Portugal melawan Spanyol di Donbass Arena, Donetsk, Kamis (28/6). Ketenangan Patricio di bawah mistar membuat gawang Portugal tetap perawan selama 120 menit. Beberapa kali kiper Sporting Lisbon itu melakukan penyelamatan gemilang. Total lima peluang emas Spanyol berhasil dimentahkan Patricio danmenjadipemaindengannilai Castrol EDGE Index tertinggi. Dua penyelamatan fantastis Patricio terjadi di babak tambahan waktu. Peluang Andres Iniesta dari jarak dekat berhasil dihalau Patricio. Penyelamatan kedua dilakukannya kala menahan sepakan Jesus Navas. Meski tak termasuk dalam hitungan Castrol, Patricio juga berhasil menghalau tendangan penalti pertama Spanyol yang dilakukan Xabi Alonso.Tak hanya itu, ia juga membaca arah bola

Peraih Medali Olimpiade Banjir Bonus JAKARTA (Waspada): Kabar gembira bagi atlet Indonesia yang akan bertarung di Olimpiade London, Inggris, 27 Juli-12 Agustus mendatang. Sejumlah bonus akan mereka terima, sekiranya mampu membawa pulang medaliketanahair.Apakahitumedali perak, perunggu terlebih emas. Selain bonus, asuransi jaminan hari tua atlet serta bea siswa untuk melanjutkan pendidikan ke jenjang lebih tinggi, pekerjaan begitu pensiun pun sudah menanti. Bank Negera Indonesia (BNI) melalui Direktur Utama Gatot M Suwondo, bahkan sudah menyiapkansejumlahbonuskepada para atlet Indonesia tersebut. “Bea siswa dan jaminan kerja menjadi salah satu konsentrasi kami dalam mendukung perjuangan atlet Indonesia di Olimpiade London nanti,” jelasnya. “Semuanya akan kita lihat sesuai dengan kebutuhan para


PARA pendukung Portugal menutup acara nontong bareng dengan kesedihan di Porto, Rabu (Kamis WIB), setelah Cristia-no Ronaldo cs disingkirkan Spanyol melalui drama adu penalti pada partai semifinal di Donetsk, Ukraina.

atlet.Yangjelas,kamiberkomitmen untuk membantu atlet berprestasi,” tambah Gatot dalam jumpa pers usai penandatangan kerjasama dengan KOI di Kantor KOI, Senayan, Jakarta, Kamis (28/6). Memberi pekerjaan kepada atlet berprestasi, tambahnya, bukan hal baru bagi perusahan yang dia pimpin. Sebab selama ini, beberapa atlet sudah direkrut menjadi karyawan BNI yang ditempatkan di seluruh wilayah Indonesia. “Ini semua diharapkan bisa menjadi pelecut semangat bagi atlet junior yang ada di daerah. Sebab dunia kerja tidak begitu sulit asalkan mampu mencatat prestasi internasioonal,” tandas Gatot. Chef De Mission Kontingen Indonesia untuk Olimpiade London 2012, ErickThohir, mengaku cukup senang dengan adanya komitmen dukungan dari BNI. Sebab hal ini semakin menabah

Pertahankan Prestasi Karate Medan (Waspada): Karate merupakan salah satu cabang olahraga (cabor) andalan kebanggaan Kota Medan. Demikian dikatakan Ketua Umum KONI Medan, Drs H Zulhifzi Lubis, saat meninjau latihan atlet karate Medan di Lapangan Merdeka Medan, Kamis (28/6). “Saya selalu membangga-banggakan cabang karate dalam berbagai kesempatan, sebab prestasinya selama ini memang cukup baik,” kata Zulhifzi dalam acara yang turut dihadiri Ketua Pengcab Forki Medan, Ir Palti Simanjuntak. Zulhifzi, akrab disapa Opunk Ladon, berharap prestasi karate bisa dipertahankan dan tidak kalah dari daerah lain. Dikatakan, KONI Medan selalu berharap karateka Medan bisa mendominasi berbagai kejuaraan yang akan diikuti. Sebab itu, Zulhifzi berharap agar para karateka dan pelatih meningkatkan disiplin dalam berlatih. Dalam kesempatan tersebut, Ketua Umum KONI Medan menanyakan langsung kepada atlet karateka dan pelatih mengenai jalannya persiapan dan pelatihan selama ini. “Saya berharap karate Medan tetap bisa menjadi barometer, sehingga kalian harus mampu menjadi juara dalam berbagai kejuaraan yang diadakan,” kata Zulhifzi. Ketua Forki Medan, Ir Palti Simanjuntak, menyatakan terima kasih atas kunjungan KONI Medan yang dianggapknya akan meningkatkan motivasi atlet. Para karateka yang merupakan hasil penjaringan Porkot Medan berlatih rutin di Lapangan Merdeka ditangani pelatih Mariana, Harini, Junaidi, Dedi Sucipto, dan Rawi Chandra. Selain itu, Forki Medan melaporkan keberhasilan dua atlet karate asal Medan, Azhary Medio dan Dwi Fadilla, menjuarai seleksi karate O2SN 2012 yang baru berlangsung di Tanah Karo dan mewakili Sumut dalam O2SN tingkat nasional. (m47)

dukungan kalangan dunia usaha untuk para atlet Indonesia dalam upaya mengibarkan Merah Putih di pentas dunia. “Sangat diharapkan, kehadirandandukungandarikalangan usaha ini bisa menambah mo-

tivasi bagi para atlet kita untuk tampil maksimal di Olimpiade London nanti. Dengan begitu, harapan mempersembahkan prestasi membanggakan bisa terlaksana,” ucap Erick. (yuslan)

karena kekalahan kami penuh martabat. Kami bermain baik dan bisa mengimbangi Spanyol. Sedihnya, kami gagal menuai kemenangan yang kami inginkan,” katanya menambahkan. Menurut striker Helder Postiga, Portugal telah memperlihatkan keinginan besar untuk menang. Postiga yang terpaksa absen melawan Spanyol akibat hukuman akumulasi kartu, menyayangkan laga mesti ditentu-

kanlewatadupenalti.“Kamitidak beruntung saat ini, tetapi kami tetap bangga karena semua pemain telah mengerahkan segenap tenaganya untuk menjaga nama baik Portugal,” klaimnya. “Hasil ini seharusnya membuat rakyat Portugal bangga. Sekarang saatnya memulihkan diri dan mulai memikirkan rencana untuk tantangan selanjutnya,” pungkas Postiga. (m15/ant/sky/uefa)


Karier Klub 2006Sporting Lisbon (Portugal) Karier Timnas 2006-2007 Portugal U-19 2007-2010 Portugal U-21 2009 Portugal U-23 2010Portugal (senior) Debut vs Spanyol (17 Nov 2010) 16 caps/0 gol

Voli Putri Deliserdang Kampiun Popdasu X MEDAN(Waspada):Timbola voli pelajar putri Kabupaten Deliserdang menjuarai Pekan Olahraga Pelajar Daerah Sumatera Utara (Popdasu) Ke-X tahun 2012 di Lapangan SMK Wiliam Iskandar Panyabungan, Kab. Mandailing Natal (Madina), Kamis (28/6). Putri Deliserdang merebut medali emas setelah di final menaklukkan Kota Medan dengan skor telak 3-0 (25-22, 25-23, 2521). Diperkuat Dina Ayunita, Maharani, Mia Faradita, Indah, Fitri, Ariska, Fitri Risdayanti dkk, Deliserdang tampil dengan perfor-

ma terbaik. Penampilan libero Deliserdang,Devaniyangmenjaditulang punggung di lini pertahanan tampil cemerlang. Hal itu membuat serangan yang dibangun anak-anak Kota Medan dengan sigap bisa digagalkan. “Ini merupakan hasil terbaik kami dan sekaligus revans. Pada dua kejuaraan sebelumnya, yakni Kejurda Remaja dan Kejurda Junior, kami hanya tampil sebagai runner-up,” ujar Pelatih Deliserdang,SudariantodanSusiloIndrio. Menurut Sudarianto, Deliserdang melaju ke babak final

setelah di semifinal menundukan regu Kabupaten Asahan. Medan sendiri ke final usai menaklukkan Labuhanbatu. Di bagian putra, pertandingan baru akan memasuki babak 8 Besar dan regu Deliserdang akan berhadapan dengan Kabupaten Batubara. Kabid Binpres PBVSI Sumut, Elpian, memberikan selamat sekaligus apresiasi kepada tim putri Deliserdang yang sukses menjadi tim terbaik di arena Popdasu. “Popdasu merupakan pesta olahraga atlet pelajar Sumut dan di cabang bola voli merupakan

ajang seleksi pemain yang akan memperkuat Sumut pada Pekan OlahragaPelajarWilayah(Popwil), sebelum akhirnya tampil di Popnas,” ucap Elpian. Dikatakan, pada gelaran Popnas dua tahun lalu di Provinsi Riau, tim putra Sumut sukses meraih medali perak dan merupakan satu sejarah bagi olahraga voli daerah ini. “Maka sudah menjadi tugas kita untuk bisa meraih kembali predikat tersebut, atau bahkan meraih prestasi yang lebih baik, yakni juara Popnas,” ucap Elpian. (m42)



WASPADA Jumat 29 Juni 2012

Penutup Manis PSMS ● Kalahkan

PSAP 2-1

MEDAN (Waspada): PSMS Medan menutup laga kandang di Stadion Teladan dengan menambah tiga poin dalam lanjutan Indonesian Super League (ISL), setelah dua gol Osas Saha mengantarkan Ayam Kinantan menang atas PSAP 2-1, Kamis (28/6) malam. Namun kemenangan ini belum mengangkat posisi PSMS dariurutan14,karenanilai36yang telah dikumpulkan masih kalah dari Arema Indonesia yang unggul satu angka. Bahkan, kemenangan tersebut sempat dikotori ulah tim PSAP Sigli yang meninggalkanlapangansebelum pertandingan berakhir di masa injury time.

Adapun segenap pemain tim tamu enggan melanjutkan permainan karena tidak menerima keputusan wasit Setiyono yang membatalkan gol kedua mereka. Saat itu, wasit menganulir gol Abu Bakar karena dianggap offside. Sebelumnya, PSAP unggul terlebih dahulu lewat gol Sekou Camara di menit 28 memanfaatkan umpan bola dari Fakhrurrazi.

Sebelum menaklukkan Edi Kurnia, Camara terlebih dahulu melewatipenjagaanSasaZacevicdan Novi Handriawan. PSMS, mengawali pertandingan dengan lamban, baru mengalami peningkatan setelah ketinggalan. Dua menit jelang babak pertama berakhir, Osas Saha menyamakan kedudukan memanfaatkan tendangan penjuru Nastja Ceh. Memasuki babak kedua, kedua tim meningkatkan tempo sehingga pertandingan menarik untuk ditonton. Menit 67, seisi Stadion Teladan kembali bersorak setelah Saha melanjutkan tendangan bebas Ceh ke gawang kiper pengganti, M Sahbani, yang menggantikan Fakhrurazi akibat cedera.

Manajer Tim PSMS, Drs Benny Tomasoa, mengatakan pihaknya bersyukur bisa memetik poin penuh di laga kandang terakhirnyamusimini.Bennyjuga memuji semangat Zulkarnaen cs yang tidak kenal lelah dan tetap gigih hingga akhir permainan. “Kami puas dengan hasil ini, apalagi anak-anak sepanjang pertandingan begitu semangat mengejarkemenangan,”katanya. Sekretaris Tim PSAP, Husni Imran, mengatakan pihaknya merasa puas, namun kecewa dengan kepemimpinan wasit yang dinilainya sering salah mengambil keputusan salah dan memancing emosi pemainnya. Husni juga mengakui tindakan yang dilakukan timnya meninggalkan lapangan salah. Namun hal itu dilakukan karena sudah keputusan manajemen. “Kami akui itu salah, itu memang sudah keputusan kami,” katanya. (m17)


OSAS Saha menjadi bintang kemenangan PSMS Medan atas PSAP dalam lanjutan ISL di Stadion Teladan, Kamis (28/6) malam.

Spies Terbaik Hari Pertama ASSEN, Belanda (Waspada): Rider AS dari tim Yamaha, Ben Spies (foto), berhasil membukukan catatan waktu terbaik di sesi free practice hari pertama MotoGP Belanda di Sirkuit Assen, Kamis (28/6) malam. SesipelatihanbebasMotoGP Belanda berlangsung sehari lebih cepat, karena merupakan satusatunya grand prix yang berlangsung di hari Sabtu. Spies, tampil impresif sepanjang pelatihan,

mencatat waktu 1 menit 34,866 detik di sesi kedua guna mengungguli pebalap tim satelit Yamaha, Cal Crutchlow, yang terpaut 0,006 detik. Sesi pelatihan bebas kedua berlangsung ketat di mana beberapa rider sempat mencatat waktu terbaik, termasuk andalan Ducati Nick Hayden. Namun, di saat-saat akhir sesi, Spies melakukan putaran terbaiknya guna membukukan best lap sekali-

gus menggeser Hayden ke tempat ketiga. Posisi keempat dan lima masing-masing diisi dua rider Spanyol, Alvaro Bautista (Honda) dan pemimpin kejuaraan dunia, Jorge Lorenzo. Pebalap Yamaha ini menjadi pemegang best lap di sesi pelatihan bebas pertama. Performa buruk justru ditampilkan juara dunia Casey Stoner karena hanya menempati posisi 10 di belakang rekan setim-

Murray Jaga Harapan AP

Si Cantik Bertahan LONDON (Waspada): Ratu tenis dunia, Maria Sharapova (foto), meraih tiket babak ketiga Wimbledon 2012, Kamis (28/6). Meski harus bekerja keras dan dipaksa bermain tiga set, si cantik asal Rusia ini melewati hadangan Tsvetana Pironkova (Bulgaria) 7-6 (3), 6-7 (3), 6-0. Duel Sharapova dengan Pironkovainimerupakanlanjutan pertandingan yang tertunda akibat buruknya penerangan saat laga memasuki game keempat set kedua. Di set pertama, Sharapova sempat berada dalam kondisi kritis, setelah tertinggal 2-5. Tetapi, mental yang kuat membuat petenis dengan desahan kerasnya itu bangkit dan memaksa tiebreak. Di set kedua, Sharapova berada dalam situasi yang sangat bagus untuk menyelesaikan pertandingan.Sayang,lagainiditunda akibat gangguan teknis. Begitu permainan berlanjut, Pironkova yang menjadi semifinalis 2010 berbalik mengalahkan Sharapova lewat tiebreak. Namun pada set penentu, Sharapova tak terbendung lagi. Tekanan-tekanan yang diberikan membuat Pironkova sulit mengembangkanpermainandan harus menelan kekalahan telak 0-6. Selanjutnya, Sharapova yang baru menjuarai PrancisTerbuka, akan bertemu Hsieh Su-Wei

(China Taipei) untuk memperebutkan tiket babak 16 Besar. Serena Williams juga melangkah ke babak ketiga. Unggulan keenam asal Negeri Paman Sam itu menang 6-1, 6-4 atas MelindaCzink(Rumania).Lawan Serena nantinya adalah petenis China, Zheng Jie. Sebelumnya, Zheng meraih tiket babak 32 Besar usai mengalahkan Aleksandra Wozniak (Kanada) 6-4, 6-2. Zheng dan Serena pernah bertemu di semifinal Wimbledon 2008.Waktu itu, Zheng harus mengakui keunggulan mantan petenis nomor satu dunia tersebut, yang akhirnya menjadi juara. Padahal waktu itu, Serena tampil memanfaatkan fasilitas wildcard. Mantan petenis nomor satu dunia, Ana Ivanovic, lagi-lagi mengikuti jejak Sharapova cs. Ivanovic mendampingi para unggulan berkat kemenangan 63, 7-6 atas Katrina Bondarenko (Ukraina). Berbeda dengan Zheng, Li Na justru mengalami kekalahan menyusul gagal meladeni Sorana Cirstea (Rumania) yang unggul 3-6, 4-6. Sementara itu, Agnieszka Radwanska (Polandia) melanjutkan langkahnya diWimbledon dengan menghentikan Elena Vesnina (Rusia) 6-2, 6-1. Di babak ketiga, unggulan ketiga itu akan menghadapi Heather Watson. (m33/ap)

LONDON (Waspada): Harapan publik All England menanti petenis negerinya sendiri menjuarai Wimbledon terjaga setelah Andy Murray (foto) meraih kemenangan di babak kedua, Kamis (28/6). Namun kemenangan diraih Murray dengan susah payah. Pasalnya, Ivo Karlovic (Kroasia) memberi perlawanan sengit terhadap petenis harapan Britania Raya itu. Beruntung, Murray mengatasi tekanan dan unggul 7-5, 6-7, 6-2, 7-6. Sebelumnya, unggulan teratas Novak Djokovic sukses menyisihkan Ryan Harrison (AS) dengan pertarungan 6-4, 6-4, 6-4 di Center Court. Dengan demikian, petenis Serbia tersebut menyusul Roger Federer yang sebelumnya telah lolos ke babak ketiga. Di babak ketiga, Djokovic akan menghadapi Radek Stepanek. Petenis Ceko ini menyelesaikan perjuangan Benjamin Becker (Jerman) dengan pahit setelah menang 6-2, 7-6, 6-3. Di laga lain, David Ferrer menemui jalan terjal sebelum akhirnya melaju ke babak ketiga. Melawan Daniel Brown (AS), petenis Spanyol itu menang 7-6, 6-4, 6-4. Ferrer, datang sebagai ung-


gulan ketujuh, membutuhkan waktu hampir dua jam untuk menghabisi Brown. Inkonsistensi Brown yang sering melakukan kesalahan sendiri membuat Ferrer leluasa memenangi pertandingan. Selanjutnya, Juan Monaco (Argentina) juga mampu mengatasi lawannya di babak kedua. Jeremy Chardy (Prancis) dikalahkan Monaco 3-6, 6-2, 6-3, 7-6, sedangkan petenis belia

asal Kanada, Milos Raonic, mengungguli Santiago Giraldo (Kolombia) 6-4, 6-4, 6-4. Unggulan delapan Janko Tipsarevic bangkit dari ketertinggalan satu set untuk mengalahkan petenis AS, Ryan Sweeting. Kemenangan 5-7, 7-5, 6-4, 6-2 pun dipetik petenis Serbia itu. Petenis tuan rumah, Jamie Baker, gagal bertahan akibat ditaklukkan Andy Roddick (AS) 7-6, 6-4, 7-5. (m33/ap)

nyadiRepsolHonda,DaniPedrosa. Bahkan, Stoner juga kalah cepat dari jagoan Ducati asal Italia, Valentino Rossi. Sebelumnya, sesi pembuka dikuasai Lorenzo dengan mengungguli Pedrosa dan Stoner. Dalamsesiitu,Lorenzomencatatkan waktu 1 menit 35,106 detik yang dicetaknya di lap 15. Di belakang Lorenzo ada Pedrosa yang mencetak 1 menit 35,126 detik untuk mengalahkan Stoner . Di sini, Spies sendiri masih menempati posisi keempat dengan Hayden melengkapi posisi lima besar dan Rossi berada di urutan 10. (m47/ap)


EURO 2012

WASPADA Jumat 29 Juni 2012


LIMA ALASAN SPANYOL LOLOS 1. Iker Casillas Seberapa besar usaha tim lawan untuk membuat masalah di depan gawang Spanyol, kiper Iker Casillas selalu mampu mengamankannya. Tak sendiri, Casillas pun dibantu barisan pertahanan yang siap ‘menghalau’ keluar lawan. Casillas adalah pemain pertama dengan rekor lebih dari 100 kali laga internasional bersama timnya. Laga semi final melawan Portugal merupakan laga ke-136. Sebelum kebobolan gol Antonio Di Natale saat bermain imbang 1-1 dengan Italia pada partai perdana penyisihan Grup C Euro 2012, Casillas punya rekor bermain selama 419 menit tanpa kebobolan. Dia pun mampu secara brilian menghalau semua ancaman di depan gawangnya. 2. Mental Baja Spanyol asuhan Vicente del Bosque memang punya mental baja untuk mengatasi tekanan sekaligus cerdik mengambil kesempatan. Pada drama adu penalti melawan Portugal, Sergio ‘Panenka’ Ramos mampu mengangkat percaya diri kompatriotnya. Dengan skor sementara imbang 2-2, Ramos dengan percaya diri mencungkil bola dari titik dua belas pas dan tendangannya mengelabui kiper Rui Patricio. Tekanan berat pun ada di pundak Bruno Alves, algojo Portugal selanjutnya. Namun tendangannya terlalu keras membentur mistar gawang Casillas. 3. Kekuatan Serangan Spanyol punya kelebihan yang tak dipungkiri lagi, barisan pemain dengan kemampuan menguasai lapangan tengah yang mumpuni. Sebagai contoh, ketika berusaha keras menciptakan banyak kesempatan dan membangun pertahanan yang solid, Del Bosque mampu melihat kesempatan dengan memasukkan pemain yang mampu menambah kekuatan El Matador di lapangan. Pedro dan Jesus Navas adalah para pemain pengganti yang selalu mampu menambah kekuatan serangan Spanyol. 4. Iniesta Inspirator Satu hal yang kurang dari sosok Andres Iniesta hingga melewati semifinal Euro 2012 adalah mencetak gol. Maestro Barcelona itu mampu mengatur tempo bermain timnya. Terbukti, saat Spanyol melawan Prancis di perempatfinal, dia mampu mendikte tempo permainan Les Bleus. Iniesta juga telah menciptakan 13 tendangan tepat sasaran dalam lima pertandingan La Furia Roja. Ketika pemain Spanyol lainnya secara bergantian tampil sebagai pemain utama, Iniesta selalu dimainkan dan diutamakan. Dia pun mampu mengirim umpan-umpan akurat kepada rekan setimnya, Iniesta memang sosok yang sangat dibutuhkan Spanyol. 5. Dewi Fortuna Spanyol mungkin beberapa kali mengizinkan tim lawan mengobrak-abrik pertahanan dan membuat ketar-ketir Casillas, namun itu jarang terjadi. Kalau pun hal itu sering terjadi, tim lawan tak mampu mengeksekusinya dengan sempurna. Sebagai contoh ketika Ronaldo gagal memanfaatkan tiga kesempatan emas ketika laga semifinal. Sementara Ivan Rakitic, gelandang serang Kroasia, bahkan tak mampu menyundul masuk bola ke dalam gawang Casillas. Dewi fortuna tampaknya selalu berpihak kepada sang juara bertahan, mungkin begitu pula pada partai puncak di Kiev, 1 Juli mendatang. (m15/goal)


PARA pemain Spanyol merayakan sukses menembus final Euro 2012, Rabu (Kamis WIB), setelah di perempatfinal mengatasi Portugal 4-2 melalui drama adu penalti di Donbass Arena, Donetsk, Ukraina.

Sejarah…Sejarah… DONETSK, Ukraina (Waspada): Spanyol berpeluang mencatat sejarah sebagai tim pertama yang sukses mempertahankan gelar juara Euro. Juga sejarah lainnya sebagai negara pertama yang memenangi tiga kejuaraan secara beruntun, setelah sukses menjuarai Piala Eropa 2008 di AustriaSwiss dan Piala Dunia 2010 di Afrika Selatan. “Kami telah membuat sejarah. Kami masih akan membuatnya,” tekad kiper Iker Casillas, pahlawan utama Spanyol saat menyingkirkan Portugal pada semifinal Euro 2012 di Donetsk, Ukraina. “Kami berharap semua orang mengingat ini selamanya, karena hal yang telah kami capai

Firasat Fabregas Memang Terbukti DONETSK (Waspada): Cesc Fabregas (foto) mengaku, punya firasat akan mencetak gol kemenangan bagi Spanyol lewat tendangan penalti ke gawang Portugal pada laga semifinal Piala

Eropa 2012. Firasat itu akhirnya terbukti dalam drama adu penalti di Donbass Arena, Donetsk, Ukraina, Rabu (Kamis WIB). Sebagai eksekutor kelima, Fabregas men-

cetak gol penentu kemenangan 4-2 El Matador, setelah laga bertahan tanpa gol selama 120 menit. Bintang Barcelona itu berarti mengulang sejarah empat tahun lalu, ketika tendangan penaltinya juga jadi penentu kemenangan Spanyol atas Italia pada perempatfinal Piala Eropa 2008. “Saya mengatakan padaToni Grande (asisten pelatih), saya yakin bisa mengulang momen (saat lawan Italia). Mereka (pelatih) menyuruh saya untuk mengambil penalti kedua, tapi saya tidak mau,” beber Fabregas, seperti dilansir Sky Sports, Kamis (28/6). Mantan kapten Arsenal berusia 25 tahun itu ngotot ingin menjadi penendang kelima. Permintaannya dikabulkan, dan dia lebih dahulu melakukan ritual dengan berbicara pada bola bahwa mereka memiliki tujuan yang sama, yaitu membobol gawang kiper Rui Patricio. “Saya mengatakan pada bola, kita harus membuat sejarah,” canda Fabregas. Entrenador Vicente del Bosque, membenarkan pengakuan

Portugal Vs Spanyol 0-0 (pen 2-4) Stadion Penonton Wasit Kartu Kuning

KIPER Iker Casillas ingin mengukir banyak sejarah bersama El Matador. sungguh unik,” tambah kiper Real Madrid itu kepada Telecinco, yang dikutip Kamis (28/6). Casillas cs memastikan lolos ke final Euro 2012, Rabu (Kamis WIB), setelah mengalahkan Portugal 4-2 melalui adu penalti di Donbass Arena. Kedua negara



0 (2) Skor Akhir 0(4) 43% Penguasaan Bola 57% 10 Tembakan Total 11 2 Tembakan Tepat 5 3 Penyelamatan 0 6 Sepak Pojok 7 2 Offside 3 31 Pelanggaran 21 5 Kartu Kuning 4 0 Kartu Merah 0 *Sumber ESPN Fabregas, yang secara personal meminta ijin kepadanya untuk menjadi algojo terakhir La Furia Roja. “Tentu saja, semua pemain yang menendang penalti ditawarkan untuk jadi urutan terakhir. Cesc mengatakan pada saya, dia ingin menjadi penendang kelima untuk menentukan kemenangan Spanyol,” ungkap Del Bosque. Menurut mantan pelatih Real Madrid itu, duel semi final melawan Portugal merupakan pertandingan luar biasa. Dia pun memberi selamat kepada Seleccao asuhan Paulo Bento, karena telah bermain secara fantastis. “Tapi kami beruntung kali ini,” klaim Del Bosque. (m15/sky/uefa)

bertetangga di Semenanjung Iberia itu bermain0-0 selama 120 menit, sehingga tiket ke partai puncak ditentukan lewat drama 12 pas. Empat eksekutor El Matador; Andres Iniesta, Gerard Pique, Sergio Ramos dan Cesc Fabregas, sukses menaklukkan kiper Rui Patricio. Hanya penendang pertama Xabi Alonso yang gagal, karena bola hasil terjangannya berhasil ditepis kiper tim Samba Eropa tersebut. Di kubu Seleccao das Quintas, cuma Kepler Pepe dan Luis


Nani saja yang berhasil menyarangkan bola ke gawang Casillas. Joao Moutinho dan Bruno Alves gagal, sehingga Cristiano Ronaldo batal menunaikan tugas sebagai algojo kelima Portugal. “Saya sangat senang, penalti ibarat lotere. Saya memiliki intuisi dalam tendangan penalti Portugal dan saya menghentikannya. Itu hal terbaik yang bisa saya lakukan,” jelas Casillas, pemain pertama yang mengukir 100 kemenangan dari 136 kali membela La Roja.

: Donbass Arena, Donetsk (Ukraina) : 48.000 Orang : Cuneyt Cakir (Turki) :Coentrao 45, Pepe 61, Pereira 64, Alves 86, Veloso 90; Ramos 40, Busquets 60, Arbeloa 84, Alonso 113 Portugal 1-4-3-3 Spanyol 1-4-3-3 12 Rui Patricio 1 Iker Casillas 2 Bruno Alves 3 Gerard Pique 3 Kepler Pepe 15 Sergio Ramos 5 Fabio Coentrao 17 Alvaro Arbeloa 21 Joao Pereira 18 Jordi Alba 4 Miguel Veloso/Custodio 106 16 Sergio Busquets 8 Joao Moutinho 14 Xabi Alonso 16 Raul Meireles/Varela 113 8 Xavi Hernandez/Pedro 87 7 Cristiano Ronaldo 6 Andres Iniesta 9 Hugo Almeida/Oliveira 81 11 Alvaro Negredo/Fabregas 54 17 Luis Nani 21 David Silva/Navas 60 “Kami sangat lelah dalam laga tadi, tapi itu berhasil. Sekarang kami memiliki hari untuk beristirahat dan mari lihat apa yang terjadi di partai final,” papar kapten Spanyol dan Real Madrid tersebut. Tiket mentas pada partai puncak di Kiev, 1 Juli mendatang, menandai final keempat La Furia Roja sepanjang sejarah Piala Eropa. Spanyol sebelumnya mentas di final 1964, 1984 dan 2008, hanya sekali saja mereka gagal pasca dipukul tuan rumah Prancis 28 tahun silam.

Menurut entrenador Vicente Del Bosque, pasukannya sangat beruntung bisa memenangkan laga menegangkan lawan sang tetangga. “Mereka (Portugal) superior dalam bertahan dan sangat seimbang,” ucap mantan pelatih Madrid itu. “Kedua tim sebenarnya tidak mendapat banyak peluang. Di babak tambahan waktu, kami sedikit berbeda dan kami lebih beruntung saat memasuki drama adu penalti,” pungkas Del Bosque. (m15/vvn/tlc/espn)

Sumatera Utara

B2 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:30 12:43 12:30 12:37 12:37 12:34 12:30 12:26 12:33 12:32

‘Ashar 15:57 16:10 15:57 16:05 16:04 16:00 15:57 15:53 16:00 15:59

Magrib 18:40 18:57 18:41 18:51 18:49 18:40 18:40 18:36 18:43 18:45



Shubuh Syuruq


19:55 20:12 19:56 20:06 20:05 19:55 19:55 19:50 19:58 20:00

04:45 05:55 04:46 04:50 04:51 04:54 04:47 04:43 04:49 04:46

04:55 05:05 04:56 05:00 05:01 05:04 04:57 04:53 04:59 04:56

L.Seumawe 12:36 L. Pakam 12:29 Sei Rampah12:28 Meulaboh 12:40 P.Sidimpuan12:27 P. Siantar 12:28 Balige 12:28 R. Prapat 12:25 Sabang 12:43 Pandan 12:29

06:17 06:27 06:18 06:22 06:23 06:25 06:19 06:15 06:21 06:18

Zhuhur ‘Ashar 16:03 15:56 15:55 16:07 15:53 15:55 15:55 15:51 16:10 15:56

WASPADA Jumat 29 Juni 2012




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:49 18:39 18:39 18:51 18:34 18:38 18:36 18:33 18:57 18:37

20:04 19:54 19:54 20:06 19:49 19:52 19:51 19:47 20:13 19:51

04:48 04:45 04:44 04:54 04:47 04:45 04:46 04:44 04:54 04:48

04:58 04:55 04:54 05:04 04:57 04:55 04:56 04:54 05:04 04:58

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:29 12:31 12:40 12:33 12:30 12:37 12:25 12:36 12:29 12:28

18:37 18:40 18:54 18:42 18:41 18:49 18:35 18:46 18:36 18:38

19:51 19:55 20:09 19:56 19:56 20:04 19:50 20:00 19:51 19:53

04:48 04:48 04:53 04:52 04:46 04:51 04:42 04:52 04:47 04:44

04:58 04:58 05:03 05:02 04:56 05:01 04:52 05:02 04:57 04:54

Panyabungan 12:26 Teluk Dalam12:33 Salak 12:31 Limapuluh 12:27 Parapat 12:29 GunungTua 12:26 Sibuhuan 12:25 Lhoksukon 12:35 D.Sanggul 12:29 Kotapinang 12:24 AekKanopan 12:26

06:20 06:16 06:15 06:26 06:19 06:17 06:18 06:15 06:26 06:20

15:55 15:57 16:08 16:00 15:57 16:04 15:52 16:02 15:55 15:55

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:20 06:20 06:25 06:23 06:18 06:23 06:14 06:24 06:19 06:16

Zhuhur ‘Ashar 15:52 15:59 15:57 15:53 15:55 15:52 15:51 16:02 15:56 15:50 15:52




Shubuh Syuruq

18:32 18:38 18:40 18:37 18:38 18:33 18:32 18:48 18:37 18:31 18:34

19:46 19:53 19:54 19:51 19:52 19:47 19:46 20:04 19:52 19:46 19:49

04:47 04:55 04:49 04:43 04:46 04:46 04:46 04:48 04:48 04:43 04:43

04:57 05:05 04:59 04:53 04:56 04:56 04:56 04:58 04:58 04:53 04:53

06:18 06:26 06:20 06:15 06:18 06:17 06:17 06:20 06:19 06:14 06:15

Hukum Rimba Berlaku Di TNGL LANGKAT (Waspada): Kepala Seksi Pengelolaan Taman Nasional (SPTN) Wilayah VI) TNGL menegaskan, hanya hukum rimba yang berlaku di TNGL (Taman Nasional Gunung Leuser). Kasus anarkisme perambah yang menyerang petugas TNGL, merusak mobil dinas dan penghancurankantorPolhuttermasuk kantorResortSekoci,telahdilaporkan ke Dirjen PHKA di Jakarta. “Aksi berutal para perambah yang mengancurkan aset negara secara resmi telah kami laporkan kepada Dirjen Perlindungan Hutan dan Konservasi Alam (PHKA),” ujar Kepala SPTN Wilayah VI, TR. Tarigan, kepada Waspada di kantornya Jl. MedanB.Aceh, Kel. Bukitkubu, Kec. Besitang, Rabu (27/6). Tarigan mengatakan, sampai

sejauhiniparapelakuvandalisme ini belum satu pun ditangkap. “Tampaknyahukumyangberlaku di kawasan TNGL hanya hukum rimba, sedangkan hukum negara tak berjalan,” katanya kecewa. Karena tidak berjalannya hukum, kini para petugas TNGL tidak dapat melaksanakan aktivitas pengawasan di kawasan hutan Resort Sekoci dan Resort Sei. Lepan. “Situasi di lapangan sangatrawandansepertinyatidak ada jaminan perlindungan keamanan dari aparat negara terhadap kami,” imbuh Tarigan. Pekan lalu, sambungnya,

Rumah Terbakar, Satu Terluka SEIRAMPAH (Waspada): Rumah semi permanen berdinding papan, triplek dan tepas, beratapkan seng berikut harta benda di Dusun IV, seberang rel, Desa Firdaus, Kec. Sei Rampah, Rabu (27/ 6) dinihari terbakar, Kerugian mencapai seratusan juta rupiah, sementara pemilik rumah, Sukarni, 38, lengan kirinya terbakar saat berusaha menyelamatkan harta benda. Ratusan warga sekitar berusaha memadamkan api, namun karena material rumah terbuat dari bahan yang mudah terbakar, akhirnya tidak berhasil sehingga rumah beserta isinya ludes terbakar. Api dapat dipadamkan setelah dua unit mobil pemadam dari BPBD Sergai turun ke lokasi. Korban, Sukarni kepada Waspada di lokasi kejadianmengatakandiatinggaldirumahbersamaduakeponakannya, Alkahfi, 23, dan MaulanaYusuf, 12, sedangkan rumah bagian depan disewakan kepada Rio Riadi, 21. Kapolres Sergai, AKBP Arif Budiman melalui Kasubbag Humas AKP ZN Siregar membenarkan peristiwa itu. “Perkiraan sementara api berasal dari hubungan arus pendek listrik,” terang ZN Siregar. (c03)

Swakelola Terbukti Bangun Infrastruktur Desa LUBUKPAKAM (Waspada): Warga tiga kecamatan, yakni Pantailabu, Beringin dan Lubukpakam menilai proyek dengan sistem swakelola telah mengubah wajah infrastruktur, khususnya jalan di pedesaan. “Sistem ini telah terbukti, pada saat warga mendesak agar jalan didesanyadilakukanpengerasanhinggapengaspalan,DinasPekerjaan Umum (PU) Deliserdang menjawabnya dengan sistem swakelola,” ujar Mak Ibed, warga Pantailabu, kemarin. Namun Mak Ibed yang juga kader Angkatan Muda Pembaharuan Pantailabu(AMPI)mengakukecewa,karenaKepalaDinasPUDeliserdang, Ir Faisal kini menjadi tahanan Kejaksaan Tinggi (Kejati) Sumut. Hal senada dilontarkan Lilik Gunawan, warga Kec. Beringin. “Saya sendiri merasakan bukti swakelola merupakan senjata ampuh menjawab desakan warga. Teranyar lihat jalan di Beringin, selain beraspal rawatannya juga berkesinambungan,” sebut Jay. Ismail, warga Jalan Masjid Desa Sekip Lubukpakam, juga menilai jalan protokol Lubukpakam-Pantailabu yang sebelumnya mendapat rawatan dari pelaksana proyek Bandara Kualanamu, kini sudah sedikit lancar karena diswakelola oleh Dinas PU Deliserdang. (m16)

LSM Gatwamtra Laporkan Dirut PTPN II Ke Polri BINJAI (Waspada): Lembaga Peningkatan Wibawa Hukum dan Kesejahateran (LSM Gatwamtra) Binjai melaporkan Dirut PTPN II kepada Kapolri, Kapoldasu dan Kapolres Binjai, disebabkan PTPN II diduga tidak punya izin usaha perkebunan di lahan 560 Ha Kel. Tunggurono, Kec. Binjai Timur. Direktur Eksekutif LSM Gatwamtra, Aminton Pakpahan, SH menjelaskan, Rabu (20/6), pihaknya melaporkan PTPN II ke Polri melalui surat No. 286/Gatwamtra/VI/2012, sebagai menjaga wibawa pemerintah dan institusi Polri untuk menegakkan supremasi hukum. Fakta hukum, PTPN II tidak punya izin perkebunan, berdasarkan SK BPN No. 42/2002, tentang perpanjangan HGU di Kab. Deliserdang. “Tanah dimohon perpanjangan untuk Hak Guna Usaha (HG) seluas 20.467,5143, Ha yang diberi izin kepada PTPN II yang berkedudukan di Tanjungmorawa, hanya 14.503,1100 Ha,” ujar Aminton. Dari data yang ada, menurut Aminton, kebun Timbang Lang-kat danTunggurono dengan luas 1.171,7010 Ha, sesuai sertifikat dan hasil pengukuran terdapat lahan seluas 1.234,1200 Ha, tidak lagi diberi HGU. Dan tanah seluas 560 Ha di Kelurahan Tunggurono dikeluarkan. Secara juridis PTPN II tidak punya hak lagi atas tanah 560 ha. Tanpa ada sertifikat, PTPN II tak akan bisa mengajukan izin perkebunan. Nyatanya PTPN II masih menguasai tanah tersebut dan melakukan aktivitas pena-naman tebu. “Bahkan disewakan kepada pihak ke tiga melalui KSO,” ujar Aminton.(a04)

Kel. Kenangan Baru Bakti Sosial PERCUT SEITUAN (Waspada): Dalam menyambut HUT Kab. Deliserdang yang ke-66 tanggal 1 Juli 2012, warga Kel. Kenangan Baru (Perumnas Mandala), Kec. Percut Seituan berpenduduk sekitar 25.000 jiwa dari 14 Kepling, melakukan bakti sosial gotong-royong massal, Sabtu (23/6) dan Minggu (24/6). Gotong-royong massal dilakukan kaur dan pegawai Kelurahan Kenangan Baru dipimpin Lurah Kenangan Baru M. Faisal Nasution, SSTP, MAP bersama masyarakat, sebagai ungkapan kebersamaan pemerintah dengan masyarakatnya. “Pembenahan ini dilakukan disamping menyambut HUT Kab. DS yang ke-66, juga sebagai wujud nyata pelaksanaan Program Gerakan Deli Serdang Membangun (GDSM) di Kelurahan Kenangan Baru, ini penting demi kemajuan bahagian dari wilayah Kec. Percut Situan yang berbatasan langsung dengan Pemko Medan,” sebut Plt. Lurah Kenangan Baru M. Faisal Nasution.(crul)

Pedagang Daging Resah Rencana Penambahan Kios TANJUNGPURA (Waspada): Pedagang daging sapi di pusat pasar tradisional Tanjungpura mengeluhkan rencana penambahan lapak dagangan di luar dari bangunan induk. Penambahan ini dianggap pedagangsangattidakrealistisditengahminimnyadayabelikonsumen. Pedagang menyatakan, kebijakan ini secara tak langsung membunuh kelangsungan hidup usaha pedagang daging resmi. Pedagang menyesalkan sikap Desperindag yang seakan melegalkan praktik dagang yang lokasinya di luar dari bangun induk pusat pasar. “Saya dari awal sudah protes tapi tak pernah didengar,” ujar Sabir Ali kepada Waspada, Senin (25/6). “Kami menyesalkan beberapa pedagang seenaknya membuat kios di luar dari lokasi yang diizinkan. Bahkan mengubah bangunan pembatas kios daging yang harusnya tidak dibolehkan,” ujarnya kecewa.(a02)

sejumlah petugas TNGL kembali diserang ratusan perambah saat turun ke lapangan, untuk membersihkan puing-puing kantor Polhut dan kantor Resort Sekoci yang dirusak perambah dan kondisnyanyarisratadengantanah. Pihak TNGL merasa mereka seperti ditinggalkan sendirian untuk menjaga kelestarian hutan, padahal tugas berat yang dijalankan ‘pahlawan konservasi’ ini bukanuntukkepentinganpribadi, melainkan untuk kepentingan

negara, yang esensinya buat kemasalahatan umat manusia di muka bumi. “Berdasarkan usulan pemerintahRI,hutaninitelahditetapkan UNESCO sebagai warisan dunia. Apakah warisan ini kita biarkan dirusakolehtangan-tanganorang takbertanggungjawabyanghanya untukmencarikeuntunganpribadi, tanpa memperhatikan ancaman ekologi,” ungkap Tarigan. Ia juga menyayangkan sikap kurang peduli dari NGO asing se-

laku mitra kerja TNGL. Seharusnya,kataTarigan,aktivislingkungan turut berkontribusi untuk menyelamatkan hutan, mengingat kawasan ini termasuk salah satu hutan hujan tropis yang berfungsi menjaga keseimbangan alam. Untuk mengatasi problem perambahan di TNGL, Kepala SPTNberharapdukungansemua pihak terutama aparat penegak hukum.Tanpa adanya dukungan tersebut, masa depan TNGL akan semakin terancam.(a02)

Kepengurusan FKDM Langkat Dikukuhkan STABAT (Waspada): Keberadaan Forum Kewaspadaan Dini Masyarakat (FKDM) merupakan wahana untuk mendeteksi secara dini setiap peristiwa atau fenomena yang akan terjadi di dalam tatanan kehidupan masyarakat. Karenanya peran dan fungsi FKDM demikian strategis di dalam tatanan masyarakat. Jaga perilaku dan moral dalam menjalankan tugas di masyarakat, kata Bupati Langkat H. Ngogesa Sitepu pada pelantikan dan pengukuhan pengurus FKDM Kab. Langkat periode 2011-2016, di Alun-alun Amir Hamzah, Stabat, Rabu (27/6). Bupati berpesan kepada para pengurus untuk mengembangkan sifat peduli dan tanggap terhadap fenomena dan peristiwa di lingkungannya. Para pengurus dan segenap anggota hendaknya bersikapsupeldanfleksibeldalam bergaul dengan semua lapisan masyarakat,danapabilamenghadapi kendala serta permasalahan dalam bertugas segera mengkomunikasikannya dengan pemerintah daerah, kata Bupati H. Ngogesa seraya menambahkan, agar FKDM segera melakukan konsolidasi organisasi agar dapat

Waspada/HM Husni Siregar

AL USTADZ Ahmad Al Habsyi menyampaikan tausyiah di hadapan ribuan masyarakat Deliserdang dalam peringatan Israk Miraj Nabi Muhammad SAW 1433 H, zikir dan doa serta menyambut hari jadi Deliserdang ke-66 dan bulan suci Ramadhan, di lapangan Segitiga Lubukpakam.

Al Ustadz Ahmad Al Habsyi Di L. Pakam:

Ribuan Umat Muslim DS Doa Dan Zikir Bersama

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH memberi ucapan selamat kepada para pengurus FKDM Kab. Langkat yang baru dilantik di alun-alun Amir Hamzah, Stabat. dengansegeramenjalankanfungsi dan tugasnya. Sebelumnya Ketua FKDM Provinsi Sumatera Utara Kolonel Purn Nurdin Sulistyo melaporkan, kepengurusan FKDM yang barusajadilantikmerupakanyang ke-3 setelah Kab. Sergei dan Tanah Karo. Untuk itu pihaknya mengimbau pengurus dan anggota dapat menjalankan amanah yang telah diberikan dengan baik dan bertang-gungjawab penuh

kepada pemerintah, atas informasi yang nantinya akan diberikan untuk dikon-sultasikan pemecahannya. Kepengurusan FKDM Langkat diketuai Rismandianto Karo-karo, Sekretaris Wiwin Yusrizal dan Bendahara Juliadi. Hadir Kapolres Langkat AKBP Eric L Bismo, Ketua MUI H Ahmad Machfud serta sejumlah tokoh masyarakat dan lainnya.(a01)

Bupati Lantik Anggota BPSK Sergai PERBAUNGAN (Waspada): Pertumbuhan ekonomi Kab. Serdang Bedagai yang cukup baik diiringi meningkatnya arus perdagangan barang dan jasa, memerlukan persiapan serta kesiapan seluruh elemen masyarakat baik pemerintah, pelaku usahadankonsumen.Begitupula dalam mengantisipasi begitu cepatnya perkembangan dan perubahan serta derasnya arus informasi saat ini. Meski UU No. 8 Tahun 1999 tentangPerlindunganKonsumen sudah cukup lama dilahirkan, namunkalanganduniausahadan masyarakat masih belum banyak mengetahui apa hak-hak sebagai konsumen dan bagaimana bentuk perlindungan yang dijamin undang-undang. Hal ini dikemukakan Bupati Sergai Ir. HT. Erry Nuradi, M.Si dalambimbingandanarahannya pada pelantikan dan pengambilan sumpah anggota Badan Penyelesaian Sengketa Konsumen (BPSK) Kab. Sergai periode 20122017, sekaligus membuka Sosialisasi Kemetrologian diWisma Amerta PTPN IV Kebun Adolina Kel. Simpang Tiga Pekan Kec. Perbaungan, kemarin. Hadir Wakapolres Sergai Kompol Zahrie, mewakili Kadis Perindag Provinsi Sumut Kepala

keimanan dan ketaqwaan tentu akan membawa perubahan kepada yang lebih baik serta solusi terhadap tantangan kehidupan akibat perkembangan zaman. Karenanya kita dituntut untuk terus belajar memaknai peristiwa Israk Miraj Nabi Muhammad SAW. Al Ustadz Ahmad Al Habsyi menyampaikan terima kasih kepada Bupati H. Amri Tambunan yang telah mempertemukannya dan memperkenalkan dengan masyarakat daerah ini seraya mengajak seluruh umat untuk selalu bertasbih memuji Allah serta bershalawat kepada Nabi Muhammad SAW, agar terhindar dari musibah serta memberkahi langkah-langkah pemimpin dan Allah akan memuliakan hidup kita. Ustadz Ahmad juga mengajak warga bersyukur, karena pemimpin yang ada di Deliserdang selalu memberi perhatian warganya. Hal ini dapat dilihat betapa pesatnya pembangunan sampai ke daerah pedesaan seperti pembangunan bidang pendidikan, kesehatan, infrastruktur jalan dan sektor lainnya. Ketua Panitia M. Taher Siagian, SE yang juga Kabag Kemasyarakatan Setdakab Deliserdang menjelaskan peringatan Israk Miraj bersama bertujuan meningkatkan silaturahmi di antara sesama umat dan antara umat Islam di Kab. Deliserdang.(a06)

Sukses Pimpin DS:

Masyarakat Tanjungbalai Dukung Amri Tambunan

Waspada/Eddi Gultom

BUPATI Sergai Ir. H.T. Erry Nuradi, MSi memberikan ucapan selamat kepada para anggota Badan Penyelesaian Sengketa Konsumen (BPSK) Kabupaten Sergai periode 2012-2017 usai dilantik di Wisma Amerta PTPN IV Kebun Adolina Kel. Simpang Tiga Pekan, Kec. Perbaungan. UPT Metrologi Tanto Kuntoyo, SE, MM para Asisten dan Staf Ahli Bupati, Kepala SKPD, Camat Perbaungan, para kepala desa/lurah, narasumber, KetuaYayasan LembagaKonsumenIndonesia(YLKI) Sergai, BUMN, BUMD dan BUMS serta peserta sosialisasi, Anggota BPSK 15 orang, di antaranya Kadis Perindagsar Sergai Drs. Indra Syahrin, M.Si dari unsur pemerintah, Asman Siagian, SH, MH dari unsur

konsumen dan Abdul Rahim, SH dari unsur pelaku usaha. Diharapkan BPSK mampu menjadi jembatan penyelesaian kasus antara konsumen dan produsen melalui prinsip musyawarah, cepat, murah dan adil serta diupayakantidaksampaimenempuh jalur hukum. Sehingga baik konsumenataupunpelakuusaha tidak ada yang dirugikan dan mendapat hak sesuai porsi dan menjalankankewajibannya.(a08)

Swasensor Harus Dibudayakan Menangkal Film Dan Televisi TEBINGTINGGI (Waspada): Swasensorharusmenjadibudaya di masyarakat dalam rangka menangkal pengaruh negatif media massa, khususnya televisi dan film. Karena tanpa swasensor masyarakat dan hanya mengandalkan institusi Lembaga Sensor Film, akan berakibat hilangnya karakter bangsa di tengah kian derasnya arus nilai-nilai luar memasuki lingkungan dan keluarga hingga kamar tidur. Pernyataan itu, sebagian dari kesimpulan pernyataan ‘Dialog Publik Lembaga Sensor Film Bekerjasama Dengan Pemko Tebingtinggi,’Kamis(28/6),diBalai Kartini. Kegiatan itu menghadirkan empat pembicara, yakni Prod. DR. M. Ridwan Lubis, MA dan Dra. Ernalem Bangun, MA (LSF) serta Drs. Safwan Hadi Umry,M.Hum(KetuaDKSU)dan Drs. Abdul Khalik, MAP (PWI Perwakilan Tebingtinggi). HadirWali Kota Tebingtinggi

LUBUKPAKAM (Waspada): Pemerintah Kab. Deliserdang menggelar peringatan Israk Miraj Nabi Besar Muhammad SAW 1433 H, zikir dan doa bersama, serta menyambut Hari Jadi Kab. Deliserdang ke-66 dan bulan suci Ramadhan 1433 H, dengan menghadirkan penceramah Al Ustadz Ahmad Al Habsyi dari Jakarta, di Lapangan Segitiga Lubukpakam, Selasa (26/6). Kegiatan yang diikuti 4.000 an warga muslim dari 22 wilayah kecamatan di Deliserdang, berlangsung sukses, hikmat dan meriah diawali doa dan zikir bersama, pembacaan ayat suci Alquran dihadiri Bupati Deliserdang Drs. H. Amri Tambunan,WabupH.ZainuddinMars,WakilKetua DPRD H. Dwi Andisyahputra Lubis, LC, unsur Muspida,Wakil KetuaTP PKK Hj. Asdiana Zainuddin, pimpinan SKPD, para Camat, PNS, pimpinan Parpol, Ormas Islam, tokoh agama, tokoh masyarakat dan lainnya. Bupati Deliserdang Drs. H. Amri Tambunan mengajak jamaah bersyukur karena masih diberi kebersamaan di daerah ini, dibarengi kokohnya sandaran moral dan tuntunan agama yang merupakan nikmat luar biasa. Hal ini tentu dapat menjadikan kehidupan harmonis dan mampu menghadapi tantangan dan permasalahan yang akhir-akhir ini semakin kompleks. Menurutnya, dengan tingginya tingkat

Ir.H.UmarZHasibuan,MM,Wakil Wali Kota H. Irham Taufik, SH, MAP, Ketua DPRD H. Syahrial Malik serta unsur Muspiko dan undangan dari tokoh dan aktivis kemasyarakatan. Guru Besar UIN Jakarta Prof. RidwanLubismengatakan,ketika prosesdeideologisasiberlangsung yang terjadi saat ini adalah proses pragmatisme, di mana orang mengejar hal-hal bersifat material dan mengabaikan nilai-nilai moral. Maka produk industri semisal film dan televisi mengalami hal sama. Kini, tambah Ridwan, ulamatidaklagisebagaipembimbing moral, tapi digantikan oleh media massa (film dan televisi). Sayangnya, proses bimbingan itu tidak sesuai dengan nilai-nilai agama. Dalam kondisi demikian, swasensordenganagamasebagai perisainya harus dibudayakan. Anggota LSF dari unsur Kementerian PertahananDra.Ernalem Bangun, MA menyoroti, ada-

nya kecenderungan perang bukan lagi menggunakan kekuatan senjata, tapi menggunakan kekuatan media. Pembicara ke tiga Drs. Abdul Khalik, MAP (PWI) menawarkan tiga langkah swasensor, yakni swasensor individual, di mana setiapdirimelakukansensorlangsung terhadap informasi yang masuk. Swasensor sosial (small group)berupaswasensorkeluarga hingga lingkungan, desa dan kab/kota melalui penguatan peraturan setiap level. Perlunya penguatan kelompok penekan (pressure group) terhadap industrifilmdantelevisi,gunamembatasi naluri liar para produser, pemodal dan insan perfilman/ pertelevisian itu sendiri. Sedangkan Ketua DKSU Drs. Safwan Hady Umri, M.Hum mengatakan, masyarakat harus memberikan referensi kepada dunia film dan televisi tentang kekayaan budaya bangsa. (a09)

LUBUKPAKAM (Waspada): Berharap pola dan gerakan pembangunan yang digagas Drs. H. Amri Tambunan dalam memimpin Deliserdang dapat diterapkan di Sumut, dukungan dari berbagai elemen masyarakat dan berbagai kabupaten/kota pun terus mengalir atas pencalonannya menjadi balon Gubsu. Mereka berharap Bupati Deliserdang memenangkan pertarungan pada pesta demokrasi rakyat melalui pagelaran Pilgubsu 2013. Seperti dikemukakan masyarakat Tanjungbalai, di antaranya Ketua PD Muhammadiyah H. Djufri Syahlan dan Ketua Aisyiah Ir. Hj. Zainimar, yang menyatakan bangga atas tampilnya Drs. H. Amri Tambunan, dimana bagi masyarakatTanjungbalai memiliki ikatan benang merah yang tak dapat dipisahkan sebagai salah satu balon Gubsu. Putra sulung pasangan H. DjamaluddinTambunan (alm) dengan Hj. Nurbanun Siregar (almh) itu, merupakan putraTanjungbalai. Beliau dilahirkan 23 Januari 1949 di kota ‘kerang’ Tanjungbalai. Orangtua Amri Tambunan selain dikenal sebagai pejuang kemerdekaan yang pernah menduduki jabatan Bupati Militer Daerah Asahan dan Labuhanbatu, juga pernah menjabatWedana di Tanjungbalai, Patih di Asahan, Bupati Labuhanbatu,Wali Kota Pematangsiantar, Bupati Simalungun, Gubernur Muda Sumut, Gubernur Jambi dan Kaban Litbang Depdagri. Selain putra daerah Tanjungbalai, Amri Tambunandalammemimpinrodapemerintahan, pembangunan dan kemasyarakatan sudah sangat teruji.Terbukti laju dan percepatan pembangunan di daerah yang dipimpinnya, memberikan arti bagi masyarakat Deliserdang. “Pola kebersamaan yang digagas pak Amri dengan mengandalkan tiga pilar kekuatan pembangunan (kemampuan pemerintah yang ter-

batas, peran aktif masyarakat serta dukungan sektor swasta-red), terbukti sangat efektif dalam memacu percepatan pembangunan”. “Kami membaca di berbagai media, berbagai hasil pembangunan di Deliserdang cukup signifikan, sehingga seluruh masyarakat di berbagai pelosok desa mengakui merasakan nikmat pembangunan itu,” kata kedua tokoh Muhammadiyah Tanjung Balai itu. Karenanya untuk percepatan pembangunan Sumut yang merupakan salah satu provinsi yang memiliki potensi besar, sangat dibutuhkan sosok pemimpin yang mampu memenej kebersamaan serta melahirkan berbagai inovasi dan terobosan. “Untuk hal ini kemampuan pak Amri tidak diragukan lagi, beliau telah membuktikannya dalam memimpin Deliserdang yang sangat heterogen,” aku kedua tokoh Ormas Islam itu. Selain itu, pria yang dalam jiwa dan tubuhnya mengalir darah pejuang, juga memiliki berbagai inovasi dan terobosan untuk percepatan pembangunan daerah yang dipimpinnya, seperti melalui GDSM pada sektor infrastruktur, “Ceria” pada sektorkesehatan,“Cerdas”padabidangpendidikan. Bahkan Amri Tambunan pemimpin yang peduli kepada “wong cilik”. Terbukti, sejak tahun 2011 beliau melahirkan program yang merupakan gerakan moral dan kemanusiaan, yang dikenal dengan “BaruYakin” (Bedah rumah masyarakat miskin/kurang mampu). Seperti diketahui, diawal kepemimpinannya di Deliserdang tahun 2004, kondisi keuangan daerah cukup memprihatinkan di mana APBD Deliserdang termasuk Serdang Bedagai yang baru dimekarkan hanya Rp616,4 miliar lebih danditahun2005hanyaRp533miliarlebih,namun pada 2012 APBD Deliserdang melonjak menjadi Rp2 triliun lebih.(a06)

Bendahara KCD Teluk Mengkudu Kemalingan, 100 Gram Emas Lewong TELUKMENGKUDU (Waspada): Rumah Bendahara Kantor Cabang Dinas (KCD) Pendidikan Kec. Teluk Mengkudu, Supratto, 56, di Dusun III, Desa Pematang Setrak, Kec. Teluk Mengkudu, Kab. Serdang Bedagai, disatroni pencuri di siang bolong, Rabu (27/6) sekira pukul 12:30. Pencuri menyikat perhiasan emas seberat 100 gram, bersama uang tunai jutaan rupiah. Menurut Kepala Dusun III, Nasir, 36, peristiwa terjadi ketika penghuni rumah sedang pergi. Pencuri masuk dengan mencongkel pintu dapur, kemudian mengobrak-abrik kamar korban dan ruang lainnya. Sementara istri korban Suhemi, 40, menuturkan, saat kejadian

dia bersama suami dan kedua anaknya ke Kota Tebingtinggi menjenguk orangtua yang sakit, dan rumah dikunci dari luar. Menurut Suhemi, mereka pulang sekira pukul 13:30 dan saat membuka pintu depan, pintu dapur sudah terbuka dan kunci rusak. Begitu juga kamarnya berantakan. Perhiasan dan uang hilang dari lemari. Korban Supratto ketika dihubungi, Rabu (27/6) malam mengatakan telah mengadu ke Polsek Teluk Mengkudu. Kerugian yang dialami berupa hampir 100 gram perhiasan emas dan uang tunai jutaan rupiah. KapolsekTeluk Mengkudu AKP Maimun yang dihubungi membenarkan peristiwa itu.(c03)

Sumatera Utara

WASPADA Jumat 29 Juni 2012


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

Polres L. Batu-TNI Berantas Penampungan CPO Ilegal RANTAUPRAPAT (Waspada): Jajaran Polres Labuhanbatu beserta unsur TNI siap memberantas segala bentuk lokasi penampungan Crude Palm Oil (CPO) ilegal, yang berada di wilayah hukumnya. Hal tersebut, sebagai wujud komitmen bersama dalam memberantas segala penampungan CPO ilegal serta penadahnya. “Komitmen bersama di jajaran Polri dan TNI tersebut, sebagai langkah untuk memberantas segala bentuk lokasi penampungan CPO hasil curian serta penadahnya,” tegas Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan SIK didampingiWakapolres KompolYusup Syapruddin SIK usai pelaksanaan rapat koordinasi dalam rangka Operasi Palm Toba II tahun 2012, Rabu (27/6) di Mapolres Labuhanbatu. Rapat koordinasi terkait pelaksanaan Operasi Palm Toba 2012 yang dilaksanakan Polres Labuhanbatuitu,dipimpinKapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan SIK, dihadiri Dandim 0209/LB Letkol Inf Dwi

Bagus Nugraha, Kasdim 0209/ LB Mayor Inf Razali Hasan,WakapolresKompolYusupSyapruddin, Danki 126/KC Rantauprapat Kapten Inf Sofyan Sukri Nasution, Danki 126/KC Damuli, Dan Sub Denpom Cikampak, Dan Sub Denpom Rantauprapat, Dan Denpomal Tanjung Balai, Kasat Reskrim AKP Wahyudi SIK, dan Kasat Intelkam AKP Mijer. Kapolres juga menegaskan, jajaran Polri khususnya Polres LabuhanbatubersamaunsurTNI akan bertindak tegas dalam menyikapi pencurian ataupun penggelapan CPO secara serius, serta mendukung pelaksanaan Operasi Palm Toba 2012 yang digelar selama satu bulan penuh

dengan target utama penampungan CPO hasil curian. Dikatakan Kapolres, dari kesimpulan rapat koordinasi dalam rangkapelaksanaanOperasiPalm Toba II tersebut antara lain, telah berkomitmen dan mendukung dalam pemberantasan mafia CPO di wilayah hukum Polres Labuhanbatu. Selanjutnya, tambah Kapolres, seperti apa yang disampaikan Dandim 0209/LB, antara lain TNI akan mendukung sepenuhnya dalam pemberantasan pencurianCPOyangterjadidiwilayah hukum Polres Labuhanbatu, sertaakanmenindaktegasapabila ada keterlibatan anggota. Kapolres juga menjelaskan, pelaksanaan dari Operasi Palm Toba antara lain juga bertujuan untuk menjaga mutu CPO tetap baikkarenamerupakantumpuan Indonesia sehingga harus diamankan, serta menghilangkan keresahan para sopir-sopir truk pengangkut CPO yang melintas diwilayah hukum Polres Labuhanbatu. (a17)

Drs. H. Sofyan, MM Pimpin PD MABMI Asahan KISARAN (Waspada): Drs. H. Sofyan, MM terpilih aklamasi sebagai ketua Umum Pimpinan Daerah Majelis Adat Budaya Melayu Indonesia (MABMI) Kabupaten Asahan periode 2012-2016. “Saya meminta PD MABMI dan keluarga besar melayu Asahan bisa turut mewarnai gerak pembangunan di Kab. Asahan denganmemberikansumbangan pemikiran yang positif demi kemajuan bersama,” ujar Sekjen PB MABMI Provinsi Sumut Prof. Dr. Wan Syaifuddin, saat pembukaan Musda VI PD MABMI Asahan, Kamis (28/6), di aula Pendopo Rumah Dinas Bupati Asahan. Sedangkan Bupati Asahan Drs. H. Taufan Gama Simatupang, MAP dalam sambutannya menekankan Pemkab Asahan banyak berharap dari lembaga seperti MABMI menggerakkan budaya kearifan lokal. “Kita rindu melihat anak-anak bermain congkak, enggrang, patok lele,

serta senandung dan tari gubang. Dan ini harus kita bangkitkan lagi demi menjaga budaya melayu” ujar Taufan. Taufan mengisyaratkan, pelantikan pengurus PD MABMI Asahan 2012-2016 dilaksanakan bukan pada acara Musda, tapi di waktu lain saat dimulainya pembangunan rumah besar melayu Asahan di lokasi cagar budaya. “Yang terpenting, MABMI bisa membantu pemerintah dalam melestarikan dan menjaga budaya melayu di Asahan, agar bisa dipelajari oleh generasi penerus sebagai sumber pendidikan,” kata Bupati. Ketua Panitia Musda VI MABMI Nurkarim Nehe, didampingi Sekretarisnya Surya Bakti dalam laporannya menjelaskan acara ini diikuti 14 pengurus cabangdan15peninjau.“Walautantangan cukup berat, alhamdulillahpanitiaberhasilmengantarkan Musda VI dan berjalan sesuai dengan rencana. Mengharung

jeram mudik jua ke hulu, patah dayung ku harungi jua. Biar badai datang menggunung terpecah ombak nampaklah ia. Takkan melayuhilangdaribumi,”kataNehe. Rumah Besar Melayu SementaraKetuaPDMABMI 2012-2016 terpilih Drs. H. Sofyan, MM didampingi tim formatur H. Zainal BS, Drs. Nahruddin Faqih, M.PD, Khairuddin Kasri, S.Ag, Mhd. Fadli, S.Ag menuturkan, sangat terhormat dipercayai sebagaiketuaPDMABMIAsahan. Untuk tahap awal dirinya beserta anggota lainnya akan berusaha secpetanyauntukmengurussurat tanah pertapakan tanah dan membangun rumah besar adat melayu,sehinggaaktivitasMABMI bisaberjalandenganbaikdanlancar. “Saya tidak bisa bekerja sendiri, sehingga perlu dukungan anggotalainnya,sehinggacita-cita danmembantupemerintahdalam pembangunanAsahanyangreligius, sehat, cerdas dan mandiri bisa tercapai,” ujar Sofyan. (a15)

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi:

KETUA PD MABMI Asahan yang lama Prof. Dr. Ir. H. Darma Bakti, MS (kiri) menyerahkan inventaris PD MABMI kepada Ketua PD MABMI 2012-2016 terpilih Drs. H. Sofyan.MM, saat Musda VI.

KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

Jasa Raharja Khitan Massal

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

PT LTS Dan Dinkes L.Batu Gelar Khitan Massal RANTAUPRAPAT (Waspada): PT Lingga Tiga Sawit (LTS) Desa Lingga Tiga, Kec. Bilah Hulu, Kab. Labuhanbatu bekerja sama dengan Dinas Kesehatan setempat menggelar khitanan massal di Masjid Nurul Iman di desa setempat, Sabtu (23/6). ManajerHumasPTLTSHYusranYunusaliasMasUlongdidampingi KTU T Amiruddin Noor SE dalam sambutannya pada acara itu menyampaikan, jumlah anak yang dikhitan sebanyak 50 orang yang berasal dari warga kurang mampu dari sekitar PT LTS termasuk dari anak-anak karyawan PT LTS. Dia mengatakan, kegiatan bakti sosial itu merupakan wujud kepedulian PT LTS kepada masyarakat Lingga Tiga yang telah bertahun-tahun mendukung dan menjaga keberadaannya hingga dapat tetap eksis hingga kini di tengah-tengah masyarakat. Contohnya kali ini, PT LTS yang bekerja sama dengan Dinas Kesehatan L.Batu menggelar bakti sosial berupa khitanan massal kepada 50 orang anak yang berasal dari keluarga kurang mampu. Sebelumnya, bertepatan dengan peringatan hari lingkungan hiudp baru-baru ini, PT LTS juga menyerahkan bantuan senilai Rp10 juta kepada masjid. Untuk itu, tambah Mas Ulong, diminta kepada masyarakat agar tetap memberikan dukungan dan menjaga PT LTS sebagai aset masyarakat desa yang berharga, agar ke depan PT LTS lewat program Corporate Social Responsibility (CSR)-nya dapat berbuat lebih baik dan lebih banyak lagi kepada masyarakat. Kepala Dinas Kesehatan L.Batu, diwakili dr Steven didampingi Kepala Puskesmas LinggaTiga drTri Kurnia menyampaikan, petugas medis untuk sunatan massal tersebut berasal dari Dinas Kesehatan dan Puskesmas Lingga Tiga. (a18)



KISARAN (Waspada): PT Jasa Raharja (Persero) Perwakilan Kisaran melaksanakan sunnat massal, di Rumah Sakit Umum Wira Husada Jl. Kartini, Kisaran, Asahan, Kamis (28/6). Kepala Perwakilan PT Jasa Raharja Kisaran TB Silalahi didampingi Bonar Ersa Harahap kepada Waspada menyatakan, kegiatansunatmassalinimerupakan program peduli lingkungan. Kegiatan mengambil tema ‘Kita sehatkan generasi Indonesia melalui Jasa Raharja peduli lingkungan’ ini mengkhitankan 100anakdarikecamatan-kecamatan se-Kab. sahan. “Jasa Raharja

bertujuan menyehatkan masyarakat yang kurang mampu melalui program Peduli Lingkungan,” ujar TB Silalahi. Panitia Pelaksana dr. Herwanto, Sp.B bersama dr. Diah Juliana Nasution menyatakan, kegiatan ini sangat positif dan membantu program menuju AsahanSehatMandiritahun2015. “Hendaknya perusahaan-perusahaan lainnya dapat melaksanakan kegiatan di bidang kesehatan melalui CSR perusahaan tersebut,” harap Herwanto yang jugaKadisKesehatanKab.Asahan. Darwin Samosir, 53, dari Kec. Simpang Empat yang dijumpai

Waspada menyatakan, sangat berterima kasih kepada Jasa Raharja perwakilan Kisaran yang mengadakansunatmassaldimasa liburan sekolah ini. Darwin yang membawa 10 anak-anak yang kurang mampu dari kecamatannya berharap untuk tahun mendatang jumlah anak yang akan dikhitan dapat ditambah. Sedangkan Fitri, 32, dari Kec. Kisaran Barat yang membawa dua keponakannya mengaku cukup terbantu dengan kegiatan sunat massal ini. Selain dikhitan anak-anak juga diberi bingkisan oleh pihak Jasa Raharja.(a31)


BUPATI Batubara H. OK. Arya Zulkarnain, MM menyerahkan 1 unit kapal pengawas kepada Dinas Perikanan dan Kelautan Kab. Batubara.

Bupati Serahkan Kapal Pengawas Ke Diskanla BATUBARA (Waspada): Bupati Batubara H. OK. Arya Zulkarnain, MM menyerahkan 1 unit kapal pengawas kepada Dinas Perikanan dan Kelautan Kab. Batubara, yang mana Bupati mengharapkan agar kapal pengawas dapat berfungsi untuk menjaga wilayah perairan Kab. Batubara yang memiliki panjang garis pantai + 62 km. Dikatakan,dengankondisipanjanggarispantai tersebut tentunya memiliki potensi yang besar untuk peningkatan ekonomi dari sektor kelautan danperikananKab.Batubara.Disisilain,mengingat jenis nelayan kita yang heterogen dan sebagian besar merupakan nelayan kecil sangat berpotensi menimbulkan konflik antar nelayan di laut. Keberadaan nelayan dari daerah lain di sekitar Kab. Batubara juga berpotensi menimbulkan persaingan dan tindakan pencurian hasil laut Kab.

Batubara. Salah satu dari kondisi dan situasi tersebut sudah merupakan tanggung jawab aparat Dinas Kelautan dan Perikanan dan seluruh masyarakat Kab. Batubara untuk menjaga potensi kelautan dan perikanan agar dapat dikelola secara maksimal sehingga dapat meningkatkan taraf perekonomian masyarakat Kab. Batubara. Dengan adanya Kapal Pengawas yang diberi nama kapal PARI MAS ini diharapkan aparat Dinas Kelautan dan Perikanan dan Kelompok Masyarakat Pengawas (POKMASWAS) dapat lebih meningkatkan kinerja pengawasan potensi kelautan dan perikanan. Hadir pada acara tersebut Ketua DPRD Kab. BatubaraH.SelamatArifin,SE,M.Si,AsistenIISosial dan Perekonomian Drs. TM Syafii, M. Pd, Kepala DinasKelautandanPerikananIr.Rinaldi,M.Sc,Tokoh Nelayan dan Tokoh masyarakat. (a13)

Bupati Serahkan e-KTP Kepada Masyarakat Panai Tengah PANAI TENGAH (Waspada): Bupati Labuhanbatu dr. H.Tigor Panusunan Siregar SpPDmenyerahkandokumen kependudukan berupa e-KTP, Kartu Keluarga dan Akta Kelahiran kepada masyarakatPanai Tengahyangdipusatkandikantor CamatPanaiTengahdiLabuhan Bilik, Rabu (27/6). Selain itu, Bupati juga menandatangani prasasti pembangunan yang dilaksanakan melalui PNPM Mandiri dan PNPM Pisew. Bupati Labuhanbatu dr. H. Tigor Panusunan Siregar SpPD pada kesempatan itu Waspada/Budi Surya Hasibuan menyampaikan terimakasihBUPATI Tigor Panusunan Siregar menyerahkan e-KTP secara nya kepada masyarakat Panai Huluataspartisipasinyadalam simbolis kepada 5 orang perwakilan masyarakat Panai Hulu. pembangunan. Sejak pemerintahan Tigor-Suhari, program pemberian manfaatkan sebaik-baiknya untuk meningkatkan dokumen catatan sipil telah dilaksanakan dengan kesejahteraan masyarakat”. cuma-cuma. Hal itu dapat berlangsung dengan Tigor juga mengapresiasi peran Tim Pengbaik berkat kawalan dari masyarakat. gerak PKK dalam menggerakkan Posyandu. Mengenai pendataan dokumen catatan sipil “Posyandu tidak akan bisa bergerak kalau Tim yang tidak dilaksanakan oleh sebahagian masya- Penggerak PKK tidak ikut berpartisipasi, karena rakat, Tigor mengimbau agar secepatnya PKK merupakan organisasi yang tumbuh di melakukan pencatatan. “Masih ada saja yang lalai tengah-tengah masyarakat. “Untuk itu saya minta menyebabkanwargayangtidakterdatapadatahun Kepala Desa, Kepala Kelurahan dan Camat untuk 2011 yang lalu harus dilakukan melalui pengadilan menggerakkanPKKagarberperandalam program negeri yang tentunya akan menimbulkan biaya peningkatann kesehatan di darah ini,” katanya. yang tidak sedikit,” sebutnya. Sebelumnya Camat Panai Tengah Mora A “Mengenai dana PNPM di Panai Hulu, saya Parapat, S.Sos dalam laporannyan mengatakan, nilai telah berjalan dengan baik. Tahun 2013 tugas-tugasbidangpemerintahan,kemasya-rakatan anggaran untuk pelaksanaan PNPM Pisew dan danpembangunandiPanaiTengahberjalandengan PNPM Mandiri di setiap kecamatan akan baik. Pelayanan e-KTP telah tercapai melampaui mencapai sebesar Rp1 miliar. Dana ini harus kita target yang ditetapkan yakni sebanyak 118 %. (c07)

Suasana Khitan Massal PT Jasa Raharja Perwakilan Kisaran di RSU Wira Husada, Kisaran, Asahan. Waspada/Bustami Chie Pit

Sengkarut Perbatasan Labusel Timbulkan Banyak Masalah TIGA tahun sudah Kab. Labuhanbatu Selatan (Labusel) resmi memisahkan diri dari Kab. Labuhanbatu. Namun sampai kini belum ada kepastian mengenai tapal batasbaikdenganKab.Labuhanbatu, Kab. Rokan Hilir, maupun Padanglawas Utara (Paluta). Kondisi ini rawan menimbulkan masalah yang membutuhkan perhatian serius. Salah satu dampaknya adalah kasus hukum yang menimpa dua warga Kab. Rohil.MerekaditahandiPolsek Kampungrakyat, Kab. Labusel terkait kasus pembakaran lahan di Desa Limau Kapas. Namun yang menjadi lokasi tindak kejahatan ini dilakukan justru masih bersengketa.

Menurut kedua pelaku, pembakaran itu berada di wilayah hukum polsek Panipahan. Jika mengacu pada SK Mendagri No. 185.5-580 tentang Garis Batas Wilayah antara Kab. Bengkalis diProvinsiRiaudenganLabuhanbatu di Provinsi Sumut yang dikeluarkan pada 23 September 1984, maka tempat kejadian itu masuk wilayah Kab. Rohil. Sedangkan menurut korban, itu wilayah Labusel jika mengacu pada gapura batas daerah. Maka kawasan itu masuk wilayah Kab. Labusel yang menjadi daerah hukum PN Rantauprapat. Tidak kalah sengkarutnya adalah lahanyangdipersengketakan antara pelapor dan terlapor yang masing-masing pihak memiliki surat kepemilikan lahan yang dikeluarkan Badan Pertana-

han masing-masing kabupaten. Padahal,objektanahyangdimaksud sama. Akibat tidak jelasnya masalah tersebut, keduanya sampaikinitakdapatdisidangkan. Pihak Kejaksaan Negeri Rantauprapat Cab. Kotapinang tidak berani melimpahkan kasus tersebut, karena tidak ada alasan kuat yang menyebutkan wilayah itu masuk Kab. Labusel. “Ini berkaitan dengan kompetensi ‘mengadili’ atau penuntutan yang akan dilakukan Kejari Rantauprapat terhadap setiap tindak pidana yang terjadi di daerahperbatasanLabuhanbatu, Labusel dengan Provinsi Riau,” kata Kasipidum Kejari Rantauprapat, Parada Situmorang. Dalam kasus ini, kata dia, penuntut umum selaku peneliti terhadap kasus ini harus jeli dan

cermat memahami batas kedua daerah yaitu dengan meminta pihak yang berwenang menentukan garis batas. Menurutnya, karena Riau dan Sumut masih berada di wilayah Kodam I / BB, sehinggadapatmemintabantuan lembaga tersebut. “Atau melalui GPS dengan dasarpetarupabumiatautopographi yang diterbitkan TNI. Ahli dari kehutananpundapatmenentukan titikkoordinatbatasinidengancara dasarpetayangditerbitkaninstansi yang berwenang, seperti Kemendagri,” katanya. Dijelaskan Parada, jika batas wilayah ini tidak jelas dan mereka tetap menyidangkan perkara tersebut, maka dampaknya Pengadilan dapat menolak kasus ini pada saat eksepsi. Karenanya, kata dia, agar kasus serupa tidak

terjadi, Pemda Labuhanbatu dan Labusel harus segera mengajak seluruh stake holder terkait upaya mensosialisasikan tata batas. “Dasarnya cukup dengan topografi TNI yang diterbitkan Mabes TNI dan itu ada di Kodam. Sebab ini menyangkut kompetensi mengadili sebagai mana diatur di KUHAP,” katanya. Dari sisi pembangunan pun turut mengalami kendala.Tahun 2012 ini Pemkab Labusel telah mengalokasikan anggaran mencapai Rp5 miliar melalui APBD 2012 untuk melakukan prekerasan jalan di kawasan itu. Namun pekerjaan ini sipastikan akan terganjal, sebab belum ada kepastian mengenai tapal batas wilayah. Tidak ada aturan yang membenarkan pemerintahan suatu daerah memperbaiki

infrastruktur daerah lain. “Pengalokasiandanatersebutakan menimbulkan masalah jika tapalbatasbelumtuntas,”kata Wakil Ketua DPRD Labusel, Zainal Harahap. Kerugian secara ekonomi tentunya dirasakan PT. Sumatera Rang Lestari (PT. SRL) danwargadiDesaSeiMaranti. Jika mengacu pada SK Mendagri, maka sebagian wilayah HTI mereka masuk ke wilayah Rohil yang artinya masyarakat penggarap akan semakin leluasa merebut lahan PT. SRL, sebab HTI perusahaan itu terletak di Kab. Labuhanbatu. “Kami jadi disulitkan dengan kondisi ini. Kami butuhkan kejelasan hukum,” kata Humas PT. SRL Anwar. * Deni Syafrizal Daulay

B4 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

P S : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window

- D. Hiline 4x4 PU. BK, Biru, 02, 04, 06 - D. Hiline 4x4 PU, BK Htm -92, 97, 01 Bantu Kredit Hub. Yos Sudarso 42-F. Lewat Pajak Glugur, 0812 6070 476 DAIHATSU Espass Master Pick Up Thn. 2007. W. Hitam met, Bak Kargo Tree way. Mobil mulus & siap pakai. Jl. Mustafa Gg. 7. No. 16D. HP. 0852 6040 8971


Xenia 1.300cc Angs. 2,4Jt-an/bln. Gran Max Pick Up Angs. 2,3Jt-an/bln. Hub. DIKA 0852 7074 7744 (Terima Tukar Tambah)

DAIHATSU Taft Hiline Pick Up Dijual (30 Unit). Minibus (20 Unit). Tahun 94-97, All 4x4. Contact. 0813 6100 5545 - 0878 6960 8311 DAIHATSU Gran Max 1,5 Minibus Thn. 2008. AC, CD, VR, PS, CL, Biru, BK Mdn Rp. 82Jt. Hub. 0819 33248044 DAIHATSU Espass Minibus Thn. 1996. W. Silver met. Full sound system Mobil cantik & terawat. Jl. G. Singgah Mata No. 29. HP. 0813 6179 0291


Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067

FORD Telstar Thn. 84 1600cc (BL). Mrh Dunhil. AC, TP, VR, BR, 14 Inc. Baru. Msn/bdi cantik (22Jt). 061.8456676 / 0815 3316 8155 ISUZU Panther Total Assy Thn. 92. BK Mdn asli. AC, Tape, VR, BR, mulus. W. biru gelap. komplit. Hub. 0813 6007 5306

D I J UA L S A L A H S AT U 1.Isuzu Panther Miyabi Thn. 95. PS, PW, CL, Remot, H. 47Jt. 2.Kijang Super Tugas Anda Short Thn. 90/91. Power Stering, 5 speed, lampu dpn gren 5 pintu, remot, alarm, jok kulit, H. 40Jt.Mobil orisinil, mulus, cantik. Hub. Ibu Hj. Mualimah. 061.77572509-082369075633 (maaf sms TP)


Isuzu Panther Grand Deluxe Long ‘95. Biru, PW, PS, DVD, jok, mobil mulus. Isuzu Panther LDX 92 Merah, P. Steering, P. Window, CD Pioneer, jok siap pakai. Hub. 77305875 / 0812 6568 818 NEW, PICANTO, RIO, SPORTAGE KIA ALL DP Rendah, Angs. murah, bunga rendah. All New Picanto Free Jok kulit MOBIL Khusus + Undian liburan ke Korea Info /pemesanan: 0852 769 100 79 BARU Terima Tukar Tambah. GEBYAR MITSUBISHI

L300 PU, T120SS, Colt Diesel. DP rendah, angsuran ringan + Proses Cepat. Hub. ZEKY SARAGIH: 0812 6990 1133

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Carry Real Van DRV Thn. 2003, W. Hijau met, Over Kredit Balik DP 16,5Jt. Angsuran 1,8Jt/bln. Hub. 0813 6169 3572



Sdh Kanvas, Ban Cangkul Rp. 45Jt. Tanah Jl.Setiasama. SK Camat Sri Gunting. 1. 7x19=Rp. 30Jt 2. 6x19=Rp. 28Jt Hub. Bpk Happan. HP. 0812 6332 7787

SUZUKI Thn. 2005 Tipe 20i

Silver metalic mobil mulus, mesin sehat, complit AC, Audio BK Medan. Hub. 0813 7022 4339 - 0812 6338 3979 DEALER RESMI SUZUKI MOBIL Carry PU 1.5 FD DP 10Jt-an Angs. Rp. 2.663.000. Ertiga Ready: Pesan sekarang juga Hub. 0852 6222 6789 / 77722121

SUZUKI Carry Futura MB 1.3 Dijual. Thn. 93 BK Medan, AC DB, Jok kulit, cantik. Harga 36Juta/Nego. Hub. 0812 6393 235 SUZUKI X Over Th. 2008. W. Hitam, lengkap, original, jok kulit, sensor mundur, spt baru. Hrg. 145Jt/damai. Hub. 0813 7618 8118

SUZUKI Swift ST 2008 manual, warna merah maron, BK Mdn. Harga nego. Hub. 0813 6223 4109 SUZUKI Jimny SJ 410 Thn. 84 Dijual. Warna Biru, 4x4 Aktif (free lock). Ban Maxxis 30 Kondisi 90%, AC, Tape, Lampu Atap, jok kulit, luar dalam mulus. Bisa Tukar Tambah dengan carry minibus. Hub. 0852 9675 0080


Avanza, Innova, Fortuner Purba: 08139 789 4633 TOYOTA Kijang LGX New Model 1.8 EFI Th. 2004. Biru met, mulus, orisinil, VR, BR, PS, PW, CL, E. Miror, AC DB, Full Sound Pake TV 3 Unit, Hrg. 146Jt. Nego. Hub. 0852 7688 3371

Grop Investor Siap Bantu Kucurkan Dana dan Mudah Disetujui. Jaminan Properti Hub. 0823 6732 1000 - 061.8222 774


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500


Jaminan: SHM, SK Camat, SK Lurah, BPKB Spd. Mtr, mobil, Pick Up. Bantu Pelunasan BPKB Pinjaman 1 Juta - 1 Milyar. Proses 3 Jam Cair. Tanpa Usaha. Pinjaman 5 M - 500 Milyar. Jaminan SPBU, Pabrik, Tambang Batu Bara. Rumah Sakit, Hotel. Hub. Family Finc: HP. 081362290001, 0813 70446633 B I R O J A S A “ATO K ”

Jl. B. Katamso No. 567 HP. 0853 5944 5215 Membantu Pengurusan * Paspor Baru/Perpanjang/Hilang * SIM, STNK, SPEKSI, BPKB * SIUP, HO, TDP * Akte Nikah, Akte Lahir, dll Proses Cepat, Aman, Tepat, antar jemput berkas. Biaya terjangkau.






SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

TOYOTA Kijang Krista Thn. 97. 1,8cc. W. biru silver. Plat BK. Lengkap AC DB, Tape, VR, BR, PW, PS, CL, Remot, Mulus, original luar dalam BU. Hub. HP. 0852 7618 0616 Mdn.

TOYOTA Starlet 1.3 Th. 89 . Warna hitam, AC, Ban Baru. BK Medan. Harga 35,5Jt Nego. Aquarium ukuran 2x80cm dijual Harga Nego. Hub. HP. 0852 6229 5240 TOYOTA Twin Cam Thn. 1990. W. Biru malam. Pajak hidup, AC Dingin lengkap. Hrg. 37.500.000 Net. HP. 0821 6080 2009

TOYOTA Avanza Type G Tahun 2010. W. Abu2 metalic, lengkap. Harga 135Jt/ damai. Hub. 0812 6331 2994 TOYOTA Corolla All New 96. BK Medan, warna hijau, kondisi mulus sekali (original). Hub. 0821 6399 3022 TOYOTA Innova G Bensin 2009 bln 12, hitam, 1 tangan dari baru, BK asli Medan, mobil terawat, sangat mulus, km 35.000. Mbl simpanan, H. 210Jt/Nego. Hub. 0812 6018 900

MITSUBISHI Eterna Th. 1991, BK Mdn Wrn merah, AC, Tape, CD, VR, Ban Baru, mesin sehat, siap pakai. H. Nego. Hub. 0813 6139 1011

TOYOTA Avanza E Thn. 2011. W. Silver metalic. Hub. 0812 6069 200

MITSUBISHI L300 Box Thn. 2005. Mobil cantik, sehat, siap pakai. Hub. 0821 6078 9900

Rp. 91.000 Rp. 104.000


MERCY E 220 Model Master Piece Th. 94. Hitam met, sgt orisinil dan mewah. Hrg. 65Jt. Nego. Hub. 0812 6063 7823 MERCY C180 Kompressor A/T. Thn. 2003, Silver, BK. Hub. Jln. Biduk No. 57. 77863981

MITSUBISHI Galant V6/MT/2,0 Thn. ‘97. Abu silver met. Plat BK - Mutasi - Mulus, siap pakai. Hrg. 64Jt (nego). Kredit. DP 27Jt. Angsuran: 1,695Jt x 35 bulan. Hub. 0852 9775 0771 - 77756757 Jl. SM Raja/Sebelum polda

7 CM 8 CM

OPEL Blazer LT Injection Biru met Th. 97. Mulus, orisinil, mesin sehat, AC Dingin, Full sound Pake TV, Hrg. 46Jt. Terima BBN Nama Pembeli. Hub. 061 77700712

TOYOTA Starlet 1,3 ‘87. AC, Tape, VR, Wr. Merah mulus. BK Mdn asli (full pajak 1 thn). Hub. 0823 6420 4849


9 CM Rp. 126.000 10 CM Rp. 140.000




Alat-Alat Giling Padi - 1 Unit ayaan padi 90 kamar - 1 unit Gomba Pembuangan Kulit Padi - 1 Unit ayaan Sampah - 2 Unit Pipisan Beras NL25 - 3 Unit Alipator Bagi yang berminat hubungi: 0853 7288 8832

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000


Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Pelanggan Yang Terhormat


Jl. Binjai Kuala Km. 13 Pasar 2 Padang Cermin – Selesai – Langkat Telp. (061) 457.6116 HP. 0813.6137.2321

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab

- Menerima Santri/Yah Baru Tsanawiyah, Aliyah - Diasuh Alumni² Tim. Tengah: Madinah, Mesir, Syria dan India – Plus USU – UNIMED, IAIN - Medium Arab – Inggris – Plus Tahfizul Qur’an - Kurikulum umum, Agama seimbang - Saatnya membentuk generasi solih/solihah Segera daftar ke alamat diatas atau Hub. Telp. Diatas Pimp. Dr. H. Syafi’I Siregar, MA


Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602






MODAL HANYA 6,5 JT, Penghasilan mencari lebih 100% Perbulan, selama .... Andapunlangsungmenjadi“BosPengusaha Gerai Ice Cream” Dijamin berhasil Tidak percaya ?? Silahkan buktikan !!! (NB. Hanya untuk 100 orang pertama) Info Hub. 0852.9777.7979 Kantor: CV. PMC Medan Jl. Panglima Denai No. 03 Medan

HARGA TERMURAH Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

11 CM Rp. 165.000 12 CM Rp. 180.000

Jumat, 29 Juni 2012


KRISNA WATER 1. Pemasangan Depot Air Minum Sistem

Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0852 6168 0200 - 0812 600 5410



UASBN SD, UN (SMP, SMA, SMK & STM) LENGKAP DENGAN - PEGANGAN GURU (Materi & Latihan², Perangkat Pembelajaran, RPP terbaru & Berkarakter (EEK). Materi & Kunci Pembahasan) - CD LISTENING & CD PERANGKAT MENGAJAR - CD MEDIA PEMBELAJARAN (POWER POINT) Hubungi: Telp/ Fax. (0271) 733.994/ 723.036/723.046 081.744.0365/081.2153.5440/081.2297.99994 Website:

Ingin Menjadi BIDAN Dan PERAWAT yang Profesional Berintegritas And, Pelayanan Prima Bergabung dengan kami AKADEMI KEBIDANAN DAN AKADEMI KEPERAWATAN DEWI MAYA MEDAN TERAKREDITASI “B” IZIN DIKNAS: No. 07/D/0/2005 IZIN DEPARTEMEN KESEHATAN RI No: HK.06.01/III/3/02231/2010


HAJI & UMROH SERVICE Jl. Sutomo Ujung No. 102 B-Medan Telp. (061) 664.3024 Fax. 061) 664.0250 Email:

Study Banding: - Akademi Kebidanan & Keperawatan di Jakarta - Luar Negeri (Malaysia dan Jepang)





HP. 0812.6570.8255




UMROH RAMADHAN: SPECIAL PAKET IQTIKAF (Apartement) 9 Hari (Rp. 16.200.000) 11 Hari (Rp. 17.000.000) 13 Hari (Rp. 18.000.000) Lailatul Qadar + Puasa Syawal 17 Hari (Rp. 19.500.000,-) Full Ramadhan 37 - 38 Hari (Rp. 23.500.000) Arbain HAJI PLUS 27-28 Hari Harga Mulai USD 7000 Info lebih lanjut hub: Hj. Nasla: 0813.7077.7555 - 0852.2177.7555 Dian: 0852.7556.6555


Umroh Reguler 9hr = 09, 14 July Umroh Ramadhan (Awal) 21 dan 25 Juli Tgl. 28 Juli dan 11 Agustus (AKhir Ramadhan) ONH Plus/Khusus

Jamaah Luar kota dapat menginapan/hotel, makan dan transportasi ke Bandara Gratis !!!! Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00 WIB hr Minggu Pkl. 09.00-11.00 Wib

Tempat Manasik Mesjid Agung Medan Jl. P. Diponegoro DAFTARKAN SEGERA KE: KANTOR PUSAT MULTAZAM MEDAN Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456





Bagi Jamaah luar kota menginap di Hotel Madani (GRATIS) Pesawat via Singapore Menjual Tiket Domestik DAFTAR SEGERA


JL. S.M.RAJA NO. 4/18 MEDAN TELP : 061-7326981, 081375031889, 085262133488 Website :

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda




KHUSUS REPARASI /SERVICE Kulkas, M. Cuci, Sanyo Air, Dispenser, Bongkar Pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789



Kulkas, mesin, AC, Dispenser, Cuci AC. Hub. 0852 6202 3406

061.7629 4790




HP. 0812 635 99957 7352833 0812 635 99947




Jl. P. Brayan Medan

0813 7035 7291 Ada Garansi


845.8996 0812.631.6631


Bergaransi/ Jl.Kpt. Muslim

TUMPAT/ SEDOT SETIA BUDI HP. 8442246 0812 631 6631 Ada Garansi


Sumatera Utara

WASPADA Jumat 29 Juni 2012

Komisi D DPRD Sumut Ke Madina Terkait Tambang

Tutup PT. SM Kalau Tak Bermanfaat Bagi Masyarakat PANYABUNGAN (Waspada): Komisi D DPRD Sumut meminta supaya PT Sorikmas Mining ditutup saja jika tidak ada manfaatnya bagi masyarakat Madina khususnya dan Sumatera Utara umumnya. Pernyataan ini terungkap saat Komisi D DPRD Sumut mengadakan kunjungan kerja ke Kabupaten Mandailing Natal (Madina), Kamis (28/6) bersama

Dinas Pertambangan Dan Energi Sumut,BadanLingkunganHidup Sumut, dan DPP IMA Madina. Karena, menurut Komisi D DPRD Sumut, saham negara

4 Pengeroyok Menyerah KABANJAHE (Waspada): Seorang tersangka pelaku penikaman IG,13 warga jalan jamin Ginting Kec Berastagi beserta tiga teman tersangka yang ikut melakukan pengeroyokan terhadap korban Moris Siburian,19 penduduk Gang Sibayak lorong II, Desa Rumah Berastagi, Kec Berastagi, Kab. Karo menyerahkan diri yang diserahkan orangtua masing-masing ke Mapolres Tanah Karo, Kamis (28/6). Ketiga teman tersangka pelaku pengeroyokan SG,18 warga Kandibata Kabanjahe, JS,16 warga Desa Rumah Kabanjahe dan AS,17 warga Desa Rumah Berastagi di hadapan polisi mengaku ikut melakukan pemukulan terhadap korban. Ketika itu ketiganya melihat korban MS bersama tersangka IG sedang baku hantam, selanjutnya ketiga teman tersangka langsung mencoba membantu tersangka IG dengan ikut melakukan pemukulan. keterangan para tersangka yang terlibat pengeroyokan yang mengakibatkan korban tewas, peristiwa ini berawal dari tersangka IG yang ketika itu hendak membeli tuak di salah satu warung tepatnya di depan Plaza Kabanjahe. Setibanya di lokasi, korban yang juga mengenal tersangka meminta uang. Karena mengaku tidak memiliki uang, kemudian rokok tersangka diminta. Tersangka IG kembali ke persawahan tempat tersangka bersama ketiga temannya kumpul, kemudian mengambil pisau milik tersangka yang dismpan di lokasi persawahan, kemudian tersangka menjumpai korban . Korban bersama tersangka kemudian terlibat bakuhantam. Setelah beberapa saat, ketiga teman tersangka yang mengikuti dari belakang segera membentu tersangka IG melakukakan pemukulan secara membabi buta terhadap korban. TersangkaIGmencabutpisauyang disiapkan,kemudiandiarahkan ke dada korban, dengan menghujani tusukan sebanyak dua kali hingga akhirnya korban terkapar dengan banyak mengeluarkan darah. KapolresTanahKaroAKBPMarcelinoSampouwSHSikMTkepada Waspada membenarkan pihaknya telah melakukan pemeriksaan terhadap keempat tersangka pelaku pengeroyokan terhadap korban MS. “Keempat tersangka masih di bawah umur,” ujarnya. (c10)

Australia lebih dominan (75%) di PT SM, sementara untuk Indonesia melalui Aneka Tambang hanya 25 persen saja. Bagi hasil tersebut dinilai tidak se imbang dengan ancaman kerusakan lingkungan yang ditimbulkan, serta terganggunya kearifan lokal. RombonganKomisiDdipimpin Ketua H.Yan Sahri diterima Bupati Madina Hidayat Batubara diwakili Sekda Daud Batubara di Aula Kantor Bupati Madina. Hadir di pertemuan itu Asisten III, Samad Lubis, para kadis, kabag, dan Nurul Fazrie dari PT.Sorikmas Mining (SM). DPRDSumutjugamenyoroti tentang maraknya tambang liar dan penanganannya yang mendesak, serta meminta ketegasan PT.SM menyangkut aktifitas mereka saat ini, dan juga poinpoin yang terkandung dalam kontrak karya (KK). DPRD Sumut selain menyoroti masalah Amdal dan penggunaan campuran kimia saat melakukanpemboransertasungai yang tercemar, juga mempertanyakankomitmenbagihasiluntuk SumateraUtara(Sumut)dariPT.SM jika sudah berproduksi. Pemkab Madina menjawab pertanyaan DPRD Sumut terkait dugaan pencemaran sungai di sekitar lokasi tambang mengatakan, saat ini masih tahap pemeriksaan laboratorium di Medan karena Pemkab Madina belum memiliki alat untuk itu. Tekait penertiban tambang rakyat, hingga saat masih terbentur karena belum ada aturan yang jelas tentang dasar hukum menerbitkan izin di dalam lahan yang masih konsesi kawasan

hutan lindung. Pemkab Madina berharap kepada DPRD Sumut supaya ikut membantu sehingga permasalahan tambang yang makin kompleks di Madina bisa terselesaikan dengan sebaik-baiknya. Sementara IMA Madina melalui juru bicaranya yang juga Ketua Umum IMA Madina Ahmad Irwandi mengatakan keberadaan PT.SM saat ini telah ilegal karena perpanjangan ke-7 tahap eksplorasi telah berakhir 7 Oktober 2011, dan sampai saat ini belummendapatperpanjanganizin. Mereka juga meminta Bupati Madina supayamerekomendasikan kepada Presiden untuk meninjauulangkontrakkaryaPT.SM, mencabutsuratrekomendasipinjampakaikawasanhutanlindung, melakukan upaya hukum terhadap PT.SM, dan menyurati PT.SM menghentikan seluruh kegiatannya. Mewakili PT.SM, Nurul Fazri selakuhumasPT.SMmenjelaskan, pihaknya saat ini sudah menuju tahapan penyusunan Amdal. Terkait kewajiban, PT.SM telah melakukan sesuai yang tertuang dalam kontrak karya. PT.SM juga telah melakukan kegiatan CSR untuk masyarakat dengan baik. Pertemuan tersebut akhirnya ditutup karena DPRD Sumut dan PemkabMadinamenganggapsiasia dilakukan, tidak akan ada kesepakatanbersama,karenayang diharapkandatangdariPT.SMdalah Presdir, PaulWills langsung. Terkait Presdir PT.SM yang tidakdatang,NurulFazriemengatakan Presdir PT.SM, Paul Wills sudah siap datang dan saat ini sedangdalamperjalananmenuju

Madina untuk acara tersebut. “ Namun jadwal kunjungan DPRD Sumut yang sampai ke kami itu untuk Jumat (29/6). Untuk menghormati undangan yang sampai ke kami secara lisan hari ini, makanya saya yang datang,” ucap Nurul kepada wartawan. Anggota Komisi DDPRD Sumut yang datang yakni, Yan Sahri, Ajib Shah, Amiruddin, Martua,Marahalim,YusufSiregar, Hamsal Nasution, Ana Risman, Rony Sianturi, Zulkifli Siregar, dan Parlautan Siregar. Hingga saat ini, penyelesaian tambang di Madina baik itu yang legal maupun ilegal tidak pernah berwujud alias selalu mengambang. DPRD Madina sudah pernah membentuk pansus PT.SM, DPRDSumutdengantimpencari faktanya, masyarakat Hutagodang Muda dengan ASMASY, Nagajuang dengan Formantam, bahkan dari adat Clean Marga Nasution . Namu semua semangat menyelesaikan konflik itu hanya berujung di media massa dan mulut ke mulut para aktivis, akademisi, politisi, dan jurnalis. Sehingga masyarakat terlihat apatismelihatlembagamanapun yang datang dalam konteks penyelesaian tambang. Realita di Madina saat ini, penambang sudah tidak menghiraukan hukum demi sejengkal perut, tambang rakyat terus menjamur,galundungmerajalela,dan siapa yang “ kuat dan lihai “ dialah yang bisa aman dan nyaman dalamaktifitastambangliar. Beberapa kali penambang liar di tangkap aparat polisi dan masuk penjara, kemudian lepas lagi. (c14)


TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188





Ingin bekerja di dunia penerbangan daftarkan segera, bagi lulusan min. SMU di Airlines staf bidang: - Ticketing - Ground Handling Hub Jl. Karya Wisata No. 23A Telp. (061) 786.1690 Medan Johor Jl. K.H. Wahid Hasyim No. 92 Telp. (061) 456.9269


Kami perusahaan Telekomunikasi & Security System, membutuhkan beberapa orang karyawan untuk di didik sebagai Teknisi - Pria (Muslim) usia 18 - 23 tahun - Min. SMU/ SMK/ sederajat - Memiliki kenderaan + SIM C - Pengalaman kerja tidak diutamakan Lamaran diantar langsung ke: Jl. Pukat II/ Sejati No. 77 Medan (1 minggu)


Perusahaan CV. PMC-Medan, membutuhkan Karyawan/ti, syarat: - Min. SMA/sederajat - Penampilan menarik (Ada uang transportasi & uang makan/hari, penghasilan sangat memuaskan) Antar lamaran segera ke: Jl. Panglima Denai Ujung No. 03 Medan Info Hub. 0853.7133.9956-0852.9777.7979

PT. Setiawan Sedjati

Persyaratan: Dibutuhkan yang berpengalaman dibidangnya masing-masing Antar segera surat lamaran Anda ke :



Setelah antar surat lamaran, SMS ke nomor HP: 0813.6210.5778



1 (Satu) Berkas Surat Keterangan Tanah No. 592.2/1471/LD/1995. Tertanggal 13 Nopember 1995. Yang diketahui Camat Labuhan Deli. Terletak di Dusun XVI Pasar VIII Desa Helvetia Kec. Labuhan Deli. Dengan Luas. L.208 M2 (Dua Ratus Delapan M2) A/n. WAGINEM

- Merk terkenal - Kwalitas terjamin - Bergaransi Hubungi 0852 1090 7422 0852 6076 2430 Pondok Kelapa No. 9B Medan Ringroad Tersedia Cicilan Kartu Kredit 12 3ulan Gratis Modem + Kartu Cuma tambah Rp.100Rb


Sebuah perusahaan yang sedang berkembang, bergerak di bidang Foto Studio Digital, Membutuhkan segera karywan/karyawati Dengan kriteria sebagai berikut: 1. Sehat Jasmani dan rohani 2. Pria/ wanita, usia max. 22 tahun 3. Pendidikan minimum SMU sederajat 4. Berpenampilan menarik, baik, jujur dan disiplin 5. Mampu mengoperasikan komputer dengan baik 6. Mampu berkomunikasi dengan baik dan bertanggung jawab 7. Dapat bekerja full time Kirimkan lamaran lengkap beserta foto seluruh badan 1 lembar, pasfoto terbaru ukuran 4x6: 1 lembar warna, Fotocopy KTP, Ijazah terakhir dan No. telepon/HP yang dapat dihubungi. Lamaran ditujukan kepada MARI PHOTO STUDIO Jl. HM. Joni No. 42 Medan, selambat-lambatnya 7 (tujuh) hari setelah iklan ini diterbitkan.

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


Uk. Tanah 17x31m, KT 5, KM 3, Tkt, Ada toko, Harga 1,6 M/ nego alamat Jl. Karya Kasih Mdn Johor Hub. 0821.6886.1331 0813.7686.8728


Di perumahan Villa Asri Permai No. 11, 1 KM dari Villa Gading Mas/ simpang Kongsi Marindal, Luas Tanah 145m ², Luas bangunan 80m², ada halaman belakang depan, Teralis besi, Carport, Harga 375 Jt/bisa KPR Hub Telp. 0813.7533.4051


Kami perusahaan yang bergerak dibidang Distributor Snack membutuhkan beberapa orang SUPIR untuk ditempatkan di dalam dan diluar kota dengan persyaratan: 1. 2. 3. 4.

Laki-laki Umur max. 40 tahun Memiliki SIM B Disiplin, jujur dan ulet







DARI PELABUHAN RATU SUKABUMI Merawat kejantanan secara alami (tidak ada efek samping) besar dan panjang, permanen dan cukup sekali datang Alamat: Jl. SM. Raja masuk Jl. Sempurna No. 18 (samping UISU SM. Raja)

HP. 081311196331


Kompleks Citra Menteng Jl. Menteng VII (Khusus Muslim), Fasilitas: Mushola Lpg. Batminton, Aman, Scurity 24 Jam. Dijamin Tak mengecewakan. Harga 330 Jt/Nego Dewi: 0821.6301.9020

RUMAH Dijual cepat Komp. Johor Indah Permai I Blok X/No.19 Jl. Karya Wisata, LT.165m, 11x15, 3 KT, 2 KM, AC, PAM, Telpon, L i s t r i k , S H M , H r g 4 3 5 J t / n e g o H P. 0812.6486.084 - 0852.6121.9695





1. Luas : ±2 Hektar Harga : 40 Jt/ hektar Kondisi Tanah Rata 2. Luas : ±8 Hektar Harga : 12 Jt/ hektar Komisi tanah gelombang, rata, lantai, lokasi tanah di Kab. Simalungun Cocok utk tanaman sawit, karet, dll Jarak kota Medan ke lokasi Tanah 80 Km dari Amplas Minat hub: 0821.6436.3601 - 0812.6359.4688




Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat






Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari




Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Lamaran diantar langsung ke:


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333

Ingin Promosikan Produk Anda Harian


Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll



No. Izin Kejaksaan, Nomor: B12/DSP.5/01/2012 Metode: Penanganan dari ujung kaki sampai pada pangkal alat vital untuk membetulkan urat yang tersumbat dan melancarkan peradaran darah membetulkan aliran sperma. kemudian dikusuk/ terapy untuk penambah ukuran besar dan panjang tidak ada efek samping, permanen, bebas pantangan dan untuk semua agama. WANITA: PRIA - Panjang: 10 - 12 - - Memperindah payudara - Menjadikan G-spot, seperti 14 - 16 - 18 - Besar: 3 - 4 - 5 - 6 - 7 perawan kembali - Sperma encer - keturunan - Ejakulasi dini KONSULTASI UMUM: DIJAMIN - Susuk semar asih BERGARANSI - Susuk Ratu Malam - Ajian pemutus & penyambung cinta


Kirimkan surat lamaran anda, lengkap dengan Pas photo 3x4: 2 lbr dan foto copy Kartu Rumah Tangga dan SIM beserta Nomor HP yang bisa dihubungi.

Jl. Letda Sujono Komplek Gudang Intan No .11 atau hubungi langsung no HP. 0813.7016.6466 atas nama: AZHAR/ BAPAK EDI SURYANTO No HP. 0813.6160.1707.Selambatnya 7 hari setelah iklan ini diterbitkan


HILANG/TERCECER HILANG / TERCECER 1 Bh BPKB Mobil Jeep BK 818JZ. Bagi siapa yang menemukan Hub. ARIE 061-7630 9024 dan akan diberikan hadiah sepantasnya tidak dituntut.


Informasi Pembaca Bursa Property









masih di tempatnya. Ketika korban pulang diantar Sastradi Ginting, Selasa (26/6) pukul 04:00, mobil barang itu masih di tempatnya. Namun, ketika korban bangun dan pergi ke halaman rumahnya sesudah dibangunkan pamannya serta menyebutkan mobil korban merk Suzuki APV kempes bannya, korban menjadi sangat terkejut, karena mobil barang miliknya tidak ada lagi di halaman. Korban segera kembali ke dalam rumah dan mencek kunci mobil barang itu. Ternyata, kunci mobil barang itu masih ada di dalam rumah korban. Sementara, sepedamotor milik korban Ponirin hilang ketika korban memarkirkan sepedamotornya di pinggir jalan, persisnya di depan balerong pasar ikan. Korban saat itu masuk ke dalam pasar ikan dan sesudah 20 menit di dalam pasar ikan, korban segera keluar. Namun, ketika hendak mengambil sepedamotornya, ternyata sepedamotor itu sudah tidak ada lagi. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, S.Ik, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin, SH, Rabu (27/6) menyebutkan mobil dan sepedamotor korban diduga dicuri maling dengan menggunakan kunci palsu dan saat ini masih dalam penyelidikan. (a30)




PEMATANGSIANTAR (Waspada): Satu unit mobil barang Mitsubishi Colt L300 PU FB (4x2) M/T tahun 2008 BK 9310 CE senilai Rp120 juta dan satu unit sepeda motor Suzuki Titan Tromol Drum BK 3854 TAE senilai Rp14 juta hilang diduga dicuri maling yang belum diketahui identitasnya di wilayah hukum Polres Pematangsiantar. Mobil barang milik korban Ferry David Mulianta Ginting, 28, wiraswasta, warga Jalan Rimba Raya, Kelurahan Siopatsuhu, Kecamatan Siantar Timur, Kota Pematangsiantar diketahui hilang dari halaman rumah korban pada Selasa (26/6) pukul 07:00. Sedang sepedamotor milik korban Ponirin, 32, wiraswasta, warga Jalan Tanjung Pinggir, Kelurahan Pondok Sayur, Kecamatan Siantar Martoba, Pematangsiantar diketahui hilang di Jalan Patuan Anggi, Kel. Sukadame, Kec. Siantar Utara, Pematangsiantar, Senin (25/ 6) pukul 23:15. Menurut Ferry, mobil barang miliknya diparkirkan supirnya Riki Pakpahan di halaman rumah korban, Senin (25/6) pukul 18:30. Sesudah menyimpan STNK mobil di dalam laci mobil dan kunci mobil di dalam rumah korban, Riki Pakpahan selanjutnya pulang ke rumahnya. Ketika korban dijemput temannya Sastradi Ginting pukul 23:00, mobil barang milik korban

- Toshiba 14” : 1,9Jt - IBM 11” : 1,5Jt - IBM 14” : 1,3Jt - HP 12” : 1,6Jt - HP. 14” : 1,7Jt - Dell 12” : 1,5Jt - Dell 14” : 1,7Jt - Compaq 14” : 1,3Jt.

Perusahaan agen tunggal mesin-mesin penggandaan/cetakmerekterkenal,kantor pusat di Jakarta, membutuhkan SEGERA tenaga Teknisi dengan persyaratan sbb:

Jl. H. Adam Malik No. 83A Medan Telp. (061) 661.8015 - 661.8312

Mobil Dan Sepedamotor Hilang



1. Pria, usia maksimum 23 tahun 2. Pendidikan minimal SMK jurusan Elektronika 3. Menguasai Teknik Komputer lebih diutamakan 4. Berbadansehat,ramahdanpekerjakeras 5. Setelah lulus training ditempatkan di kota Medan, Pematang Siantar dan Banda Aceh Kami menawarkan status Pegawai tetap, insentif, tunjangan kesehatan, asuransi, jamsostek dan peningkatan karir Lamaranlengkapdapatdikirimataudibawa langsungselamabulanJuli2012ke:

Yusuf. Ketua PWI yang menaungi lima wilayah kabupaten/kota di Tabagsel itu meminta agar insan pers di Tabagsel selain mempedomani kode etik jurnalistik juga mempedomani nilai luhur Batak, yaitu termasuk Dalihan Na Tolu dengan arti hormattumora(hormatkepadamertuadansejajarannya), hormat marboru (hormat kepada bagian anakmenantudananakperempuansejajarannya) dan hormat markahanggi (satu silisilah marga). ‘’Jika nilai-nilai dasar di Tanah Batak Angkola ini kita pedomani dan nilai agama kita junjung, niscayaperpecahandiantarakitapastiakanminim, sehingga harga diri kita sebagai anak Batak Angkola, Mandailing dan etnis lainnya dapat saling bersatu padu demi membangun kota pendidikannya Tapanuli ini,’’ ujar Yusuf. (c13)




P.SIDIMPUAN(Waspada): Insanpersdiingatkantidakterjebakberitatitipanuntukpembusukan karakter bakal calon (Balon) Wali Kota Padangsidimpuan. Peringatan ini disampaikan Ketua Persatuan Wartawan Indonesia (PWI) Perwakilan Tapanuli Bagian Selatan (Tabagsel), MYusuf Siregar kepada wartawan di sekretariat PWI Tabagsel, Jalan SM Raja, Kota Padangsidimpuan, kemarin, menyusul memanasnya suhu politik menjelang tahapan Pemilukada di Kota Padangsidimpuan, ‘’Harapan kita kepada rekan-rekan insan pers agar tidak terkontaminasi berita titipan dari seseoranguntukpembusukankepadabakalcalon (Balon) Wali Kota Padangsidimpuan. Pers yang sehat tidak akan tendensius. Mari kita persilakan para kandidat bersaing secara sehat,” tutur M

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188



Ketua PWI: Hindari Pembusukan Balon Wali Kota P. Sidimpuan

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun




Media yang Tepat untuk Iklan Anda



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222



Gudang Miras Digrebek

PENANGGALAN (Waspada) : Para kepala desa, mukim, register dan warga Kec. Penanggalan, Subulussalam mengikuti sosialisasi UU No. 23/2002 tentang Perlindungan Anak (PA) dan UU No.23/2004 tentang Penghapusan Kekerasan Dalam Rumah Tangga (PKDRT), Kamis (28/6) di Penanggalan. Kepada peserta, Wali Kota Subulussalam Merah Sakti saat membuka acara meminta peserta lebih serius mengikuti rangkaian acara. Soal KDRT, para orang tua diingatkan menjalankan tugas pokok dan fungsi, mempedomani ajaran agama dan norma-norma yang ada. “Hidup jangan dipikirkan, tetapi dijalani,” ujar Sakti. Seperti disebutkan Kepala Badan Pemberdayaan Perempuan Perlindungan Anak dan Keluarga Berencana (Kaban PPPAKB) Rahmatsah, penetapan para orang tua menjadi peserta karena sosok ini disinyalir rentan dalam KDRT. Tampil sebagai pemateri, Nurul Akmal dari unsur Komite Perempuan Aceh Bangkit (KPAB), Plt Kadis Syariat Islam Usni B dan Kasat Reskrim Polres Aceh Singkil AKP Ibrahim. (b28)

Pelantikan Bupati/Wabup Bupati Pidie 12 Juli SIGLI (Waspada) : Pelantikan Bupati dan Wakil Bupati Pidie terpilih hingga kini masih belum jelas. Ini terlihat dari kesiapan dan informasi serta SK pelantikan yang sampai hari ini belum juga masuk ke DPRK setempat. Namun Sekda Pidie Said Mulyadi mengatakan, pelantikan Sarjani Abdullah dan M Iriawan, sebagai Bupati danWakil Bupati Pidie akan dilaksanakan pada 12 Juli 2012. ”Kita wacanakan 12 Juli ini, Bupati dan Wakil Bupati Pidie terpilih dilantik,” ujar Said Mulyadi, Kamis (28/6). Menurut Said Mulyadi, pelantikan itu harus dilalui beberapa proses. Antara lain DPRK harus membentuk rapat Badan Musyawarah (Bamus) yang agendanya menentukan jadwal pelantikan. Ketua DPRK Pidie Muhammad AR menyatakan segera akan melakukan pelantikan. Namun jadwalnya belum ditetapkan karena perlu juga dilihat kesiapan gubernur. (b10)

PLN Rayon Bireuen Tingkatkan Keandalan Pasokan BIREUEN (Waspada) : Dalam upaya meningkatkan keandalan sistem pasokan aliran listrik pelanggan menyambut bulan suci Ramadhan dan Hari Raya Idul Fitri 1433 H, PLN Rayon Bireuen melakukan pemeliharaan gardu hubung dan jaringan distribusi. Manager PLN Rayon Bireuen Ridwan Adam menjelaskan hal itu di kantornya Kamis (28/6). Dikatakan, pemeliharaan gardu hubung dan jaringan distribusi Bireuen semata-mata untuk meningkatkan keandalan pasokan lustrik agar umat Islam di Bireuen dalam melaksanakan ibadah di bulan suci Ramadhan tidak terganggu. Ridwan Adam menyampaikan permintaan maaf kepada para pelanggan 14 kecamatan di Bireuen karena saat dilakukan pemeliharaan, Sabtu (30/6) pukul 08:00 –16:00 aliran listrik terpaksa dipadamkan sementara, setelah itu akan menyala kembali. Menurut Ridwan Adam, aliran listrik yang dipadamkan sementara di Kecamatan Gandapura, Makmur, Kuta Blang Blang, Peusangan, Peusangan Selatan, Peusangan Siblah Krueng, Jangka, Kuala, Kota Juang, Juli, Jeumpa, Peudada, Plimbang dan Kecamatan Jeunieb. Sedangkan Kecamatan Samalanga, Simpang Mamplam dan Kecamatan Pandrah tidak mengalamI pemadaman karena sudah dilakukan pemeliharaan gardu dan jaringan distribusi sebelumnya. (b12)

Sabu Diamankan Di Perumahan PT Arun LHOKSEUMAWE (Waspada) : Polisi menemukan satu ji sabu-sabu (paket kecil) di komplek perumahan PT Arun NGL, Batuphat, Kecamatan Muara Satu, Lhokseumawe, Rabu (27/ 6) dini hari. Tersangka Nazir, 25, asal Kecamatan Sawang itu digerebek berdasarkan informasi securiti perusahaan itu. “Setelah kami dapatkan informasi dari securiti PT Arun, langsung bergerak. Menurut securiti, mereka mencurigai di rumah tersebut ada yang aneh. Seperti banyak anak muda keluar masuk, dan ada seorang perempuan di rumah itu tengah malam,” ujar Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kapolsek Muara Satu Iptu Ichsan. Setelah dipastikan ternyata benar, Satpam melaporkan ke pihak Kepolisian Sektor Muara Satu. Atas informasi itu menggerebek Nazir warga Pante Jaloh, Sawang, Aceh Utara sebagai tersangka pemilik sabu-sabu serta empat temannya plus satu perempuan. (cmk)

Merah Sakti Tinjau Lokasi MTQ III PENANGGALAN (Waspada) : Menyongsong pelaksanaan Musabaqah Tilawatil Quran (MTQ) III Kota Subulussalam, Oktober 2012 di Kec. Penanggalan, Wali Kota Subulussalam Merah Sakti meninjau lokasi kegiatan itu di Desa Lae Mbrsih, Kec. Penanggalan, Subulussalam. Saat di lokasi, Kamis (28/6), dia didampingi Pj Camat Penanggalan Hotma Capah, Kapolsek AKP Eko Y dan Kades, M Rifai Berutu, Wali Kota Sakti memanggil Kadis Pekerjaan Umum (PU) Ansari.Kepada Anasri, Sakti minta ditindaklanjuti pembangunan tribun yang tampak belum rampung dan nyaris terlantar. Bahkan permintaan Pj Camat Hotma Capah tentang keberadaan mandi cuci kakus (MCK), mushalla, listrik dan jalan lingkar yang sama sekali belum ada, Sakti meminta Anasri mengambil inisiatif. (b28)

Waspada/Khairul Boangmanalu

WALI Kota Subulussalam Merah Sakti saat membuka Sosialisasi UU No.23/2002 dan UU No.23/2004 didampingi Kaban PPPAKB, Pj Camat, Kapolsek dan narasumber AKP Ibrahim, Kasat Reskrim Polres Aceh Singkil.

Penerbangan Di Bandara SIM Banda Aceh Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

Jumat 29 Juni 2012

HMI Demo DPRK Aceh Tengah

Kades Ikuti Sosialisasi UU PKDRT

Tiba (flight, asal, waktu) Garuda Indonesia



Waspada/Irwandi MN

TAMPAK aksi demo HMI sedang berlangsung, sesaat sebelum audiensi berlangsung di Gedung DPRK Aceh Tengah.

Mobil Mantan Pejabat Pemko Banda Aceh Dibakar KOTAJANTHO (Waspada) : Sebuah mobil Toyota Fortuner warna Silver nomor polisi BL 835 AB milik Zainal, mantan pejabat Pemko Banda Aceh yang sedang parkir di depan Lembaga Pemasyarakatan (LP) Lhoknga, Aceh Besar, Rabu (27/6) dini hari dibakar orang tak dikenal. Pada saat kejadian sekira

pukul 02:00, Zainal sedang mengunjungi istrinya, Rasilina alias Mami Salon, yang sedang menjalani masa tahanan di lembaga pemasyarakatan tersebut karena terlibat kasus human trafficking. Kejadian itu pertama sekali diketahui anggota jaga di LP KhususWanita yang mendengar suara alarm dari mobil korban. “Mereka langsung keluar dan melihat ada api di bagian belakang mobil. Pada saat itu, komandan jaga LP melihat ada dua orang tidak dikenal meng-

gunakan sepeda motor dan langsung kabur,” kata saksi mata. Saksi mata juga menyebutkan, api sempat menyala di mobil dan langsung dipadamkan petugas jaga sehingga tidak sampai merambat kemanamana. Kasus ini sekarang sudah ditangani Polsek Lhokgha. Kapolres Aceh Besar AKBP Sigit Kusmardjoko mengatakan, pihaknya hingga saat ini masih melakukan penyelidikan dan pengembangan terhadap kasus tersebut. (b05)

Irwandi Tolak Kedatangan Wagub Aceh BANDA ACEH (Waspada): Irwandi Yusuf menolak kehadiran Wakil Gubernur Aceh, Muzakir Manaf yang berencana datang membesuknya, Selasa (26/ 6) malam. Hal itu disampaikan Irwansyah Ketua Umum Partai Nasional Aceh Rabu (27/6) pagi. “Irwandi menolaknya karena belum bicara dengan rekanrekan lain,” ungkap Irwansyah kepada Waspada. Rencana kunjunganWagub Aceh itu menjadi perhatian para kombatan GAM lain yang berpihak pada Irwandi pada Pilkada 2012 lalu. Kediaman Irwandi seketika dipenuhi oleh mantan TNA terlebih maksud kunjungan Muzakir Manaf belum diketahui oleh mereka. Irwandi sendiri enggan berkomentar atas penolakan kehadiran Muzakir Manaf ke kediamannya di kawasan lampriet, Menurut Irwansyah, mantan representatif GAM hanya berharap kasus pemukulan terhadap cepat diungkap oleh kepolisian. Mantan Gubernur Aceh drh Irwandi Yusuf dipukul oleh sejumlah Satgas Partai Aceh di pintu gerbang gedung DPRA usai menghadiri acara pelantikan Gubernur-Wakil Gubernur

Aceh dr Zaini Abdullah-Muzakir Manaf, Senin (25/6) sekira pukul 15:45. Tanda-tanda kekisruhan itu sudah mulai terlihat manakala Menteri Dalam Negeri Gamawan Fauzi memberi apresiasi kepada dokter hewan lulusan Universitas Syiah Kuala, Banda Aceh. Teriakan huuu dari para undangan yang berada di tenda luar membuat suasana di luar gedung sedikit riuh. Dan keriuhan itu terus berlanjut manakala pria penggemar sepakbola itu melangkah keluar dari ruang sidang paripurna. Pengamanan yang tidak maksimal membuat mantan petinggi Gerakan Aceh Merdeka (GAM) mudah dijangkau tangan-tangan satgas PA yang berusaha mengeroyok Irwandi. Sebelumnya Irwandi juga disoraki sebagai pengkhianat bangsa Aceh. Saat pengeroyokan terjadi Irwandi sempat membalas pemukulan dan tendangan yang dilakukan satgas PA tersebut. Irwandi yang di kalangan GAM dijuluki TGK Agam itu kemudian dilarikan beberapa polisi berpakaian putih dan dimasukkan ke dalam mobil patroli milik polisi lalu dibawa pergi ke arah Jambo Tape.

Saat di dalam mobil pun beberapa kader PA berpakaian sipil berusaha mengejar serta berteriak kesal yang ditujukan kepada Irwandi. Suasana gaduh itu juga disaksikan para tamu dari Jakarta dan sejumlah tamu asing dan sejumlah pejabat negara yang hadir dalam pelantikan tersebut. Irwandi Yusuf saat ditemui di RSU Zainoel Abidin saat akan divisum menyatakan, peristiwa itu terjadi saat dia keluar dari ruang paripurna Gedung DPRA. ‘’Saat itu saya diteriaki, namun saya jalan terus menuju mobil. Tiba-tiba massa beringas dan langsung memukul wajah saya (sambil menunjuk bagian pipinya sebelah kanan) dan kepala saya bagian belakang. Kaca mata saya juga patah,’’ urainya. Disebutkan, dirinya tidak mengetahui secara pasti siapa pelakunya, namun sempat melihat ada pria berpakaian loreng merah dan memakai baret merah memukulnya. Jubir KPA, Muklis Abee membantah keterlibatan satgas PA dalam insiden pemukulan Irwandi Yusuf. “Itu masyarakat umum, itu acara umum bukan acara PA,” kata Muklis.(b08)

Bermula Saling Ejek KERUSUHAN bermula dari saling ejek antar pendukung pada saat pertandingan sepakbola Popda Aceh XII/2012 antara AcehTengahberhadapandengan Aceh Selatan di SHB Lhong Raya, Senin (25/6), yang berakhir dengan kedudukan 4-1 untuk keunggulan Aceh Selatan. Saat pertandingan sudah usai dan kedua tim sudah meninggalkan lapangan, entah siapa yang memulai, tiba-tiba terjadi lagi perkelahian antar pendukung kedua kubu di luar stadion, yang mengakibatkan seorang pendukung Aceh Selatan yang bernama Feri mengalami luka di pergelangan tangan. Akibat kerusuhan itu, pihak Dispora Aceh selaku penanggungjawab Popda telah memanggil pimpinan kedua kubu untuk menyelesaikan permasalahan ini. Dalam pertemuan di ruang rapat Dispora Aceh, Selasa (26/6), kedua kubu sepakat untuk berdamai. Dalam pertemuan itu, Kontingen Aceh Tengah juga menyatakan akan menanggung seluruh biaya yang dikeluarkan untuk mengobati korban yang luka serta membuat upacara peusijuk bagi si korban. Selain itu, pihak panitia dengan kedua kubu juga menandatangani kesepakatan, yang salah satu isinya menyebutkan, setiap kerusuhan yang terjadi di lapangan akan menjadi tanggungjawab panitia, sedangkan untuk kejadian yang di luar lapangan tidak menjadi tanggungjawab panitia. Pertemuan itu dipimpin

Kadispora Aceh, Hasan Basri, yang didampingi Kabis Olahraga/Ketua Panpel, Drs. Nuzuli, MS, dan beberapa pejabat Dispora Aceh, serta Kadispora Aceh Tengah beserta jajaran dan Kabidpora Disdikpora Aceh Selatan beserta jajaran. Kabar terlukanya pendukung Aceh Selatan itu menyebar begitu cepat hingga Rumah Sakit Bulan Sabit kawasan Lamlagang tempat korban di rawat dipenuhi oleh mahasiswa dan Masyarakat Aceh Selatan serta puluhan Mahasiswa Aceh Tengah yang juga ikut mendapat kabar melalui pesan SMS mulai pukul 20:03. “Saat itu polisi sempat menembak dua kali ke udara,” kata Fitrial Patra yang berada dilokasi itu sejak pukul 19:00. Lalu polisi kemudian membawa belasan mahasiswa Aceh Tengah ke Polsek Lamlagang. Kondisi kemudian redam hingga sejumlah orang kemungkinan mahasiswa bermotor melewati Rumah Adat AcehSelatandiArenaPKAdengan membawa senjata tajam. Di rumah adat itu sejumlah ofisial kontingen Aceh Selatan menginap. Menurut Fitrial Patra karena merasa risih dengan aksi mahasiswa bermotor itu. Ofisial lalu memberi kabar kepada yang lain warga Aceh selatan lain yang tinggal di Banda Aceh. Kejadian tersebut terjadi sekira pukul 23:30 Selasa (26/6) sampai pukul 01:00 Rabu (27/6) dini hari. “Mereka (mahasiswa Aceh Tengah) lewat sambil bawa parang ada juga linggis,” ungkap Patra.

Selain kondisi risih, mahasiswa Aceh Selatan yang di balut emosi dihadang sejumlah orang di antaranya polisi dan anggota TNI di pintu masuk Taman Shulthanah Shafiatuddin atau Arena PKA di Kawasan Lamprit Banda Aceh. “Mereka dihadang, sebagian lolos karena lompat pagar,” ungkap Patra. Setelah berkumpul dan merasa ofisial Aceh Selatan merasa sudah diamankan, provokasi baru pun terjadi, hingga bentrok dan saling lempar oleh kelompok kecil mahasiswa terjadi mulai pukul 01:30. Pada akhirnya massa yang sebelumnya sudah berkumpul di rumah adat Aceh selatan mengejar mahasiswa Aceh Tengah yang terkonsentrasi di belakang panggung Utama PKA. “Kondisi saat itu sudah tidak menentu lagi, di ujung sana sudah ada yang bakar kereta(sepedamotor),”kataPatra. Kondisi semakin tidak menentu karena jumlah mahasiswa dibantu warga semakin ramai datang ke Arena PKA, hingga pukul 05:00 Rabu (27/6) pagi. Patra memperkirakan jumlah massa saat itu berkisar 600 orang, namun keterangan lain menyebut jumlah masa lebih 1.000 orang. Paska kejadian, sejumlah tokoh berkumpul di Rumah adat atau anjungan Aceh Tengah, diantaranya Seniman Gayo, Joe Samalanga dan Taf Haikal, Jubir Kaukus Barat Selatan Asal Bakongan, Aceh Selatan serta pejabat Pemerintah Aceh asal Aceh Tengah, disaksikan Wakasat Intel Polresta AKP Saiful(b08/b04)

TAKENGEN (Waspada) : Mengkritisi maraknya peredaran minuman keras (Miras) dan sulitnya masyarakat mendapatkan suplai air bersih dari PDAM Tirta Tawar di Aceh Tengah, anggota Himpunan Mahasiswa Islam (HMI) melakukan aksi demo di DPRK kabupaten setempat, Kamis (28/6). Dalam aksi demo di lembaga terhormat ini puluhan massa HMI cabang Aceh terlibat saling dorong dengan petugas keamanan. Pasalnya mereka meminta ketua DPRK untuk keluar menemui massa. Tak kunjung keluar, massa mulai menerobos pengamanan petugas, hingga menyebabkan pintu masuk utama DPRK sebelah pecah. “Kami hanya menyampaikan aspirasi rakyat, peredaran minuman keras telah meresahkan di negeri yang bersyariat ini. Selain itu kondisi masyarakat saat ini kesulitan mendapat suplai air bersih. Apa fungsi PDAM di daerah ini? Serta kinerja pihak terkait perlu dipertanyakan,” jelas Surahman, koordinator aksi HMI di depan gedung DPRK Aceh Tengah. Menghindari aksi HMI yang mulai ‘memanas’, petugas kemudian mengamankan Sukran, penanggung jawab demo. Namun seketika seperti di komando massa ini kembali berupaya memasuki gedung DPRK sembari meminta pimpinan mereka dilepas. “Lepaskan ketua kami. Kami ini bukan penjahat. Kami hanya menjembatani kepentingan rakyat,” tutur Hasan, anggota HMI lainnya. Selang beberapa saat setelah itu, Sukran kembali menemui massa didampingiWakil Ketua DPRK Aceh Tengah, Nazar dan sejumlah petugas pengaman. Di ruang DPRK tersebut, massa selain dite-

mui Wakil DPRK, juga hadir Penjabat Bupati Aceh Tengah Mohd Tanwier serta beberapa pejabat struktural Pemda. “Persoalan air bersih telah menjadi perhatian kami. Bahkan kita sedang menunggu turunnya dana hibah sebesar Rp5 miliar dari Pemprov Aceh untuk meningkatkan pelayanan dari PDAM. Selain itu perlu diketahui saat ini nilai jual air per meter kubiknya dari PDAM masih rendah dibanding biaya operasional,” kata Baong panggilan akrab Bupati Aceh Tengah ini di hadapan massa HMI. Terkait keberadaan miras, lanjut Baong, hal ini karena masih terbatas pengawasan yang dilakukan sehingga pihaknya meminta peran serta semua pihak untuk memberantasnya. Massa HMI juga mendesak bupati untuk segera melakukan penggerebekan di beberapa titik yang diduga sebagai lokasi peredaran miras di daerah dingin ini. Pada kesempatan itu, sesuai kesepakatan, massa HMI kemudian mempercayakan sepuluh anggotanya untuk melakukan penggerebekan miras dengan dikawal petugas kepolisian dan Satpol PP Aceh Tengah. Dari gedung DPRK Aceh Tengah, sepuluh anggota HMI dengan dikawal petugas keamanan kemudian bergerak, untuk melakukan penggerebekan di sebuah ruko di Pasar Inpres Takengen. Dan ditemukan satu kotak miras plus 2 krat minuman kaleng beralkohol rendah. Aksi ini sempat menjadi perhatian warga. Setelah itu aksi penggerebekan anggota HMI berlanjut ke titik lainnya di sebuah kios kelontong di Kampung BaruTakengen. Dari sana ditemukan puluhan botol miras yang kemudian langsung dibawa ke DPRK setempat (cb09)

Film Dokumenter MMD Diluncurkan BANDAACEH (Waspada) : Sebuah film dokumenter menyangkut pelaksanaan manajemen berbasis sekolah dengan judul ‘Menatap Masa Depan’, yang diproduksi UPTD Balai Teknologi Komunikasi dan Informasi Pendidikan (Tekkomdik) Aceh diluncurkan, Kamis (28/6) di Banda Aceh. Asisten II Setda Aceh T Said Mustafa yang hadir pada peluncuran itu mengatakan, film dokumenter ini merupakan langkah awal mendorong dan untuk meyakinkan semua pihak bahwa manajemen berbasis sekolah mampu meningkat mutu pendidikan di Aceh. “Namun tidak semua sekolah mampu melaksanakan manajemen berbasis sekolah ini segera mungkin, karena tidak semua siap dan masing-masingsekolahitujugapunyakeunggulan dan kelemahan masing-masing,” papar Mustafa.

Menurutnya, film tersebut merupakan upaya merangsang penerapan manajemen berbasis sekolah di seluruh jenjang pendidikan di bumi Serambi Mekkah. “Kita mengharapkan ke depan semua pihak mendukung pelaksanaan manajemen berbasis sekolah ini,” tandasnya. Kepala UPTD Balai Tekkomdik Aceh, Bustamam Ali, menyebutkan, film dokumenter berdurasi 30 menit itu dengan mengambil lokasi di salah satu sekolah di Padang Tiji, Pidie, sekolah di Lamteuba dan Rukoh, Aceh Besar serta dua sekolah RSBI di Kota Banda Aceh. “Kita ingin menunjukkan bahwa ada kelas sekolah yang jauh dari pusat kota seperti di Lamteuba, Aceh Besar, ternyata manajemen sekolahnya bagus. Artinya sekolah yang bagus itu tidak hanya berada di pusat kota provinsi dan di kabupaten/kota,” tutur Bustamam. (b06)

11 Siswa SMAN 1 Bireuen Dapat Jalur Undangan BIREUEN (Waspada) : 11 Siswa SMAN 1 Bireuen lulusan UN 2011-2012 mendapat jalur undangan masuk ke PTN Aceh dan luar Aceh. Kasek SMAN 1 Bireuen Hanafiah melaluiWakasek bidang kesiswaan MuhammadWali menjelaskan hal itu, Kamis (28/6). Ke-11 siswa yang sudah mendapat jalur undangan masuk ke PTN Aceh dan luar Aceh masing-masing, Rifdatus Sunniyah ke jurusan Komunikasi Fisip USU, Uswatul Khairi jurusan budidaya Perikanan Fakultas Perikanan UGM Yogyakarta, Fathayatul Husna juusan komunikasi Fakultas Dishum UIN Sunan Kali Jaga Jogyakarta. Menyusul Syarifah Rizkia Puteri jurusan Kesehatan Masyarakat Fakultas Kesehatan Masyarakat USU, Noval Prahara Putra jurusan Ilmu Komputer Fakultas FPMIPA UPI Bandung, Rahmat Asri Sufa jurusan Pendidikan Agama Islam Fakultas Tarbiyah IAIN Sumut dan Agung Yunanda jurusan pendidikan Bahasa Arab

Fakultas Tarbiyah IAIN Sumut. Sedangkan empat siswa SMAN 1 yang mendapat jalur undangan ke Universitas Syiah Kuala Banda Aceh,masing-masing Subhan Hadikusuma jurusan Pendidikan Biologi FKIP, Haris Akbarsyah Teknik Elektro Fakultas Teknik Unsyiah, Dita Fitri jurusan Pendidikan Geografi FKIP dan Kiki Ramadhani jurusan Pendidikan Bahasa Inggris FKIP. SMAN 1 Samalanga, Nurkhamsiah ke PTN Unimal Lhokseumawe, SMAN 1 Jeunieb, Ihsanul Arif jurusan Psikologi Unsyiah, SMAN 1 Peusangan, Mutia Hafni jurusan Ekonomi Perbankan Politeknik Lhokseumawe. SMAN 2 Bireuen, Farah Mutia jurusan Ekonomi Fakultas Ekonomi Unimal Lhokseumawe, Mariam Chanrunnisak jurusan Pendidikan Seni Drama, Tari dan Musik FKIP Unsyiah, Rini Yusmarni jurusan Pendidikan Fisika Unimus, Nurul Fitri dan AndriYani jurusan Ekonomi Pembangunan Fakultas Ekonomi Unimus Peusangan. (b12)

Ratusan Rumah Kost Di Lhokseumawe Ternyata Liar LHOKSEUMAWE (Waspada) : Ratusan rumah penyedia tempat kost di Kota Lhokseumawe ternyata berstatus liar dan beroperasi tanpa mengantongi surat izin Hinder Ordonantie (HO) berarti izin gangguan. Terhitung dari sekian banyak jumlah rumah kost di Kota Lhokseumawe, tapi pihak KP2T hanya menetapkan satu unit rumah yang memiliki surat izin HO dan lainnya berstatus liar. Hal itu berdasarkan informasi yang diperoleh dari Kepala Kantor Pelayanan, Perizinan Terpadu Satu Pintu (KP2T) Kota Lhokseumawe, Baktiar, Kamis (28/6). Akibat tidak memiliki surat izin tersebut, menyebabkan terjadi dampak buruk kerugian materi maupun moril bagi daerah dari segi tidak adanya retribusi untuk daerah serta tidak terkendalinya aturan norma dan adat. “Di Lhokseumawe ini, rumah kost yang

mempunyai izin hanya satu saja. Selebihnya tidak mempunyai izin, akibat tidak mempunyai izin, retribusi untuk daerah tidak ada sama sekali,” ujar Baktiar. Satu unit rumah kost yang mempunyai izin itu, papar Baktiar, adalah rumah yang terletak di kawasan Cunda, Kecamatan Muara Dua. Sehingga dengan tidak adanya pengurusan surat izin HO, tentunya bisnis yang selama ini berjalan lancar di atas permukaan Kota Lhokseumawe sangat merugikan daerah bila tidak ada retribusi. Baktiar berharap, para pihak pengusaha rumah kost harus segera mengurus izin HO tersebut karena itu memang sudah ketentuannya sehingga dengan adanya izin tersebut, nantinya retribusi untuk daerah akan ada dan PAD Kota Lhokseumawe akan menjadi lebih meningkat. (b16)

‘Zikir’ Minta SKPA Tingkatkan Kinerja BANDAACEH (Waspada) : Gubernur Aceh dr Zaini Abdullah dan Wakil Gubernur Muzakir Manaf meminta Satuan Kerja Perangkat Aceh (SKPA) dalam jajaran Pemerintah Aceh untuk meningkatkan kinerjanya yang lebih baik. Penegasan itu disampaikan pasangan Zikir, pada pertemuan dengan para kepala SKPA di ruang rapat unit kerja Percepatan dan Pengendalian Kegiatan (P2K) APBA, Kamis (28/6) di kantor gubernur di Banda Aceh. Sebelumnya gubernur dan wakil gubernur telah meminta para kepala SKPA untuk menyampaikan gambaran umum program kerja SKPA, visi misi, hambatan-hambatan kerja serta tahapan kinerja selanjutnya. “Substansi pertemuan gubernur dan wakil gubernur dengan SKPA itu untuk mendapat gambaran umum tupoksi, pola kerja, realisasi kerja serta hambatan yang dihadapi,” ujar Usamah El Madny, Kabag Humas Pemerintah Aceh. Selain mempertanyakan alasan-alasan target kinerja SKPA yang telah disepakati, Zikir juga meminta SKPA yang belum mencapai target realisasi agar pada rakor selanjutnya dapat memenuhi target kinerja yang disepakati. “Laporan SKPA hari ini, disebutkan Wagub Muzakkir Manaf akan menjadi bahan evaluasi memperbaiki kinerja Pemerintah Aceh ke depan,” ungkap Usamah. Rapat tersebut gubernur turut didampingi Sekda T Setia Budi dan para

asisten. Karena itu, Zaini meminta seluruh jajaran SKPA meningkatkan keikhlasan dan kedisiplinan dalam bekerja. Menurut Zaini, dengan keikhlasan dan disiplin berbagai program PemerintahAcehakandapatdilaksanakandenganbaik. Pada sisi lain, tambah Usamah, gubernur secara khusus meminta agar jajaran SKPA segera mempersiapkan dokumen anggaran untuk persiapan pembahasan RAPBA 2013 sehingga pengesahan APBA 2013 tepat waktu sesuai harapan Mendagri saat pelantikan gubernur dan wagub, pada 25 Juli lalu. Selain itu Zaini juga meminta agar jajaran SKPA yang paket kegiatannya masih terkendala agar segera mencarikan jalan keluar sehingga proyek yang telah direncanakan dapat berjalan sukses sesuai harapan. Gubernur Aceh Zaini Abdullah mengadakan rapat koordinasi dengan forum pimpinan daerah menyangkut kondisi keamanan. Gubernur mengatakan, masalah keamanan Aceh diserahkan kepada kepolisian. “Dalam rakor tadi, masalah keamanan sepenuhnya diserahkan kepada kepolisian. Pihak Polda tentu akan berupaya menciptakan ketertiban umum,” kata Zaini Abdullah usai rapat yang selanjutnya menerima kunjungan Panja RUU tentang produk halal dari Komisi VIII DPR-RI. (b06)


WASPADA Jumat 29 Juni 2012

Lagi, Warga Langsa Terjangkit DBD

DPRK Aceh Timur Rombak Kabinet IDI (Waspada) : Setelah perjalanannya hampir tiga tahun sejak 31 Agustus 2009 dilantik, kini DPRK Aceh Timur merombak kabinet. Sejumlah posisi legislatif itupun kini berubah posisi, bahkan salah satunya tidak lagi diberikan kepercayaan sebagai Ketua Komisi. “Kabinet di dewan sudah berubah setelah beberapa bulan bermusyawarah, seperti Ketua Komisi dan juga Wakil Ketua Fraksi Partai Aceh. Perubahan itupun melalui Sidang Paripurna di DPRK Aceh Timur di Langsa, Rabu (27/6),” ungkap Wakil Ketua II DPRK Aceh Timur Tgk Hasanuddin, Kamis (28/6). Dia menyebutkan, Komisi A masih diketuai Tajol Ula, Ketua Komisi B Muzakir yang sebelumnya menjabat Ketua Komisi E, Ketua Komisi C Sulaiman Ismail, yang sebelumnya menjabat Ketua Komisi B, Ketua Komisi D Abdul Hamid yang sebelumnya menjabat Ketua Komisi C, dan Ketua Komisi E Zulkifli M Thayeb yang sebelumnya menjabat Ketua Badan Kehormatan Dewan (BKD) DPRK Aceh Timur. Lebih lanjut Tgk. Hasanuddin menyebutkan, Ketua BKD kini dijabat Tgk Mukhtar Luthfi yang sebelumnya menjabat Wakil Ketua Fraksi Partai Aceh (PA) dan Ketua Panitia Legislasi (Panleg) masih dijabat Emda serta Wakil Ketua Fraksi PA yang sebelumnya dijabat Tgk Mukhtar Luthfi kini dijabat Mansur Abubakar. “Perombakan ini semata-mata untuk penyegaran,” kata Tgk Hasanuddin. Ketua Komisi E DPRK Aceh Timur Zulkifli M Thayeb saat dimintai keterangan mengatakan, proses penyegaran tersebut dilakukan melalui Rapat Pansus Tatip DPRK Aceh Timur dengan melibatkan para anggota dewan. “Untuk posisi Ketua dan Wakil Ketua DPRK Aceh Timur masih tetap. Sementara pergantian Ketua Komisi dan lainnya adalah keputusan bersama dengan tujuan untuk meningkatkan kinerja dewan yang semakin berkualitas,” tuturnya. (b24)

Tanah Wakaf Harus Dikelola Produktif SABANG ( Waspada) : Dalam rangka meningkatkan pengelolaan tanah wakaf secara baik dan produktif perlu didukung seluruh elemen masyarakat sehingga bisa bermanfaat bagi kemaslahatan dan kesejahteraan umat. Mewakafkan harta adalah manifestasi dari amal shaleh dan merupakan suatu tindakan seseorang yang memberikan manfaat bagi yang bersangkutan dan juga kepada orang lain yang dipandang besar manfaatnya. Pada umumnya masyarakat masih sering mewakafkan hartanya secara sukarela, baik yang berwujud tanah maupun dalam bentuk harta benda lain untuk kepentingan agama. Demikian dikatakan Penjabat Wali Kota Sabang Zulkifli HS diwakili Asisten III Pemko Sabang Ir Ridwan saat membuka pembinaan nazir dalam pemeliharaan dan pemberdayaan tanah wakaf se-Kota Sabang dilaksanakan Kantor Kementerian Agama setempat, Selasa (26/6). Dikatakan, sebagai salah satu keseriusan dalam melindungi keberadaan Tanah Wakaf, pemerintah telah mengeluarkan beberapa peraturan pemerintah No.42 tahun 2006 tentang pelaksanaan undang-undang No.41 tahun 2004 tentang wakaf sebagai dasar hukum terhadap kelangsungan/kelestarian tanah wakaf sebagai asset umat Islam. Wakaf telah disyariatkan dan telah dipraktikan umat Islam seluruh dunia sejak zaman Nabi Muhammad SAW sampai sekarang. Karenanya perwakafan merupakan salah satu masalah yang penting dalam rangka hubungan antara hukum Islam dengan hukum nasional.(b31)

LANGSA (Waspada) : Dinas Kesehatan Kota Langsa kembali menemukan seorang warga, Ernawati, 33, warga Gampong Paya Bujok Tunong, Kec. Langsa Baro, positif terjangkit penyakit Demam Berdarah Dengue (DBD). Dengan demikian memasuki Januari-Juni 2012 ini, penderita DBD di daerah setempat meningkat menjadi 39 orang. Kabid Kesehatan Masyarakat Dinkes Kota Langsa, Syamsidar, Kamis (28/6), pihaknya kembali mendata seorang warga dari Gampong Paya Bujok Tunong, Ernawati, 33, positif terjangkit penyakit yang disebabkan gigitan nyamuk Aedes Aegepty (penyakit DBD). Korban diketahui mulai terjangkit DBD sejak, Rabu (27/6), kini sedang dalam penanganan pihak medis di Rumah Sakit Umum Daerah (RSUD) Langsa. Syamsidar menjelaskan, petugas pena-


POLISI memasang police line di lokasi truk tronton yang terbalik di pinggir jalan nasional di Desa Meunasah Nga Matang Ubi, Kec. Lhoksukon, Aceh Utara, Kamis (28/6).

35 Persen Anak Usia SD Di Aceh Merokok LHOKSEUMAWE (Waspada) : Tercatat 35 persen anak usia SD di Aceh sudah mulai kebiasaan buruk merokok. Keadaan ini sangat memprihatinkan sekali. “Saya sangat prihatin melihat kondisi remaja saat ini, budaya merokok dianggap hal biasa. Hampir di setiap sudut jalan, kios, kedai, warung-warung selalu saja ada perokok dan orang yang menjual rokok,” ungkap aktifis Perempuan dan Anak, Syarifah Rahmah di Lhokseumawe, Kamis (28/6). Menurutnya, persentase

perokok usia SMP lebih tinggi lagi, yaitu mencapai 50 persen, sedangkan usia SMA mencapai 60 persen. Hal ini, katanya, sudah termasuk anak yang putus sekolah dan jadi pengangguran ataupun gelandangan. Jika ditambah dengan mahasiswa, katanya, maka produktifitas merokok di kalangan generasi muda bertambah banyak sebagaimana diketahui, persentase perokok di Aceh lebih tinggi bila dibanding daerah nusantara lainnya. Namun, untuk mengetahui akurasi persentase remaja perokok harus dilakukan survei, pendataan dan penelitian secara khusus yang sejauh ini belum

Waspada/Mahadi Pinem

KEHADIRAN pasangan calon Bupati-Wakil Bupati Agara 2012 – 2017, Sanu-Ali Basrah, di Kecamatan Lawe Sumur, Rabu (27/6) disambut antusias pendukung yang mengelu-elukan Sanu – Ali Basrah, sejak menuju panggung orasi hingga meninggalkan lapangan hijau Buah Pala menuju posko SABAR.

Kampanye Terakhir, Satgas PA se-Aceh Merapat Ke Kubu Sanu –Ali Basrah

Tuhapeut : Pimpinan Partai Aceh Memimpin Serambi Mekkah, Sokong Coblos Nomor 2 Informasi dihimpun, Satgas PA yang turun ke Agara di bawah komando Tuhapeut ini, orang pilihan antara lain berasal dari kesatuan Satgas Aceh utara, Banda Aceh, Aceh Tamiang, juga Aceh Tengah, bertugas menjaga berlangsungnya pilkada damai di Agara, terutama menjamin keamanan di kubu pasangan calon Bupati-Wakil Bupati Agara Sanu-Ali Basrah. “Sebelum selesai pilkada, kami tak akan pulang, lanjutkan pak Sanu,” kata Tuhapeut. Salim Fakhri, Ketua Tim Pemenangan Sanu-Ali Basrah di hadapan ribuan pendukung nomor 2 ini menyampaikan, peluang Agara untuk mendapat perhatian lebih dari pimpinan tertinggi di Aceh yakni Gubernur – Wakil Gubernur Aceh saat ini telah disampaikan Tuhapeut. Caranya hanya dengan mencoblos nomor 2, Sanu-Ali Basrah, maka peluang membangun Bumi Sepakat Segenep yang lebih bermartabat akan terlaksana karena pasangan Sanu –Ali Basrah telah nyata sebagaimana ditegaskan Tuhapeut pasangan ini didukung dari pusat komando PA/KPA untuk memenangkan Pilkada Agara.

nganan khusus penyakit menular Dinkes Kota Langsa juga telah melakukan pengasapan (fogging) ke lokasi rumah Ernawati dan sekitarnya guna proses awal pencegahan perkembangbiakan nyamuk Aedes Aegepty di daerah itu. “Kita minta warga agar terus mewaspadai serangan DBD dan tak lupa melakukan langkahlangkah yang disarankan untuk pemberantasan sarang nyamuk di tempat tinggal masingmasing,” katanya. Sementara data di Dinkes Kota Langsa, sepanjang 2012 ini (Januari-Juni), jumlah kasus serangan DBD mencapai 39 orang. Terakhir dalam sepekan ini menimpa dua warga, yakni Hafzah, 63, warga Gampong Blang, Kec. Langsa Kota dan Ernawati, 33, warga Gampong Paya Bujok Tunong, Kec. Langsa Baro. (m43)

Dana Aspirasi DPRK Langsa Disalurkan

dilakukan. “Sedangkan yang saya ungkapkan itu adalah hasil pengamatan dan pendataan ringan,” ucapnya. Rahmah yang juga pendidik ini mengaku kerap menjadi korban asap rokok di tempat umum, seperti di kedai saat minum, di ruang tunggu rumah sakit dan di kantor-kantor yang tidak mengeluarkan larangan merokok di dalam ruangan. Di beberapa tempat mangkal remaja tanggung, dia sering memperhatikan sejumlah anak yang merokok, dengan gaya yang cukup mahir layaknya orang dewasa. “Anak-anak itu tidak risih maupun takut, tidak seperti anak-anak dulu. Mereka happy saja,” ujarnya. Kebanyakan dari anak yang merokok itu adalah karena orangtuanya perokok, di lingkungannya banyak orang merokok, ditambah pula dengan gampangnya mendapatkan rokok. Selain itu ada ungkapan yang mengatakan kalau tidak merokok maka tidak gaul, maka habis rusak semua generasi muda. (b14)

Satu Keluarga Diserempet Tronton

KUTACANE (Waspada) : Pada putaran terakhir kampanye terbuka Pilkada Aceh Tenggara, Rabu (27/6), Satgas Partai Aceh dari berbagai kabupaten di bawah komando Tuhapeut, merapat ke kubu Sanu-Ali Basrah. Tuhapeut dari panggung orasi Sanu – Ali Basrah di Kecamatan Lawe Sumur, lapangan bola Buah Pala di hadapan ribuan pendukung bupati incumbent ini. Dia menegaskan sesuai instruksi komando pusat, Partai Aceh mendukung kemenangan Sanu-Ali Basrah menjadi Bupati-Wakil Bupati Agara periode 2012-2017. Tuhapeut dengan logat melayu menyampaikan, pucuk pimpinan Aceh dipimpin PA dan harapan dari komando pusat untuk memenangkan calon nomor 2 karena PA tak sokong siapa – siapa kecuali nomor 2. Dikatakan, bila ada yang memakai seragam loreng di luar komando yang bukan berada di kubu Sanu – Ali Basrah, mereka bukan orang Partai Aceh. Ditegaskan juga khusus Pilkada Agara, Tuhapeut diperintahkan bersama 80 satgas pilihan akan tetap berada di Kutacane hingga pilkada usai.


Pasangan calon Bupatiwakil Bupati Agara priode 2012 – 2017, Sanu – Ali Basrah, melakukan orasi singkat, menyampaikan pada pendukung Sanu –Ali Basrah,agar istoqomah, memenangkan pemilukada Agara ini dengan santun dan bermartabat. Pantauan Waspada, Rabu siang, ketika pasangan Sanu –Ali Basrah, keluar dari posko utamanya bergerak menuju lokasi kampanye terbuka di Lawe Sumur, sempat terjadi kemacetan karena berpapasan dengan massa kandidat lainya. Dalam kondisi macet, itu tampak Kapolres Agara AKBP Trisno R dan Komandan Kodim Letkol Inf, R Andy R, turun kejalan, mengurai kemacetan seta mengingatkan agar tidak terjadi insiden. Dalam situasi macet itu, tampak Satgas PA berseragam lengkap yang turun dari Aceh ini , bergerak menuju konvoi massa kandidat lain yang terkena macet, bertindak tegas mengambil semua atribut partai Aceh yang ada dibarisan konvoi dari tangan mereka yang bukan dari kubu pendukung pasangan Sanu – Ali Basrah. Kampanye terbuka, Rabu

(27/6), ada 2 pasang calon tidak menggelar kampanye, yakni pasangan nomor 5, Marthin Desky – Kamasiah, tidak menggelar kampanye di Lawe Bulan/Deleng Pokhison, dan pasangan nomor 7, Ridwan – Erwin, tidak melakukan kampanye di Badar. Lima pasangan lain menggelar kampanye terbuka di putaran terakhir sebagaimana disampaikan Kapolres Trisno R, melalui Kabag Ops Kompol Syafrinizal, pasangan nomor 4, Armen Desky – Appan melaksanakan kampanye di lapangan Biak Muli, pasangan nomor 1 Raidin – Muslim, kampanye terbuka di Lawe Ger-ger. Pasangan nomor 3, Rajidin –Sarim melaksanakan kampanye terbuka di Stadion H Syahadat, pasangan nomor 6, Amriko – Riduan, kampanye terbuka di lapangan Kutatengah. “Situasi kampanye aman dan terkendali hingga berakhirnya massa kampanye,” ujar Kompol Syafrinizal. Sementara Ketua Panwaslu Agara Junianto Siahaan mengatakan, dengan berakhirnya masa kampanye, maka terhitung mulai, Jumat (29/6) semua atribut kandidat harus sudah dibersihkan, tidak lagi terpajang.(b25)

LHOKSUKON (Waspada): Seorang kakek bersama anak dan cucunya luka-luka terkena bak truk tronton yang terbalik persis di depan rumah mereka di pinggir jalan nasional Desa Meunasah Nga Matang Ubi, Kec. Lhoksukon, Aceh Utara, Kamis (28/6). Sang kakek, Isa Mahmud, 56, dan anaknya Saifullah, 15, menderita luka hampir di sekujur tubuh dan kini dirawat intensif di Rumah Sakit PMI Lhokseumawe. Sedangkan sang cucu, Intan Dara, yang baru berusia 3 tahun, hanya menderita luka ringan. Kapolres Aceh Utara AKBP Farid BE melalui Kasat Lantas Ipda Mega Tetuko menjelaskan, truk tronton Hino BL 8530 AC itu disopiri Mahyeddin Musa, 52, warga Desa Lhok Kuyun, Kec.Sawang, Aceh Utara. Dia mengaku melaju sedang sekitar 60 km per jam dari arah Medan, Sumut. “Setiba di lokasi kejadian, sopir hilang kendali. Laju truk melebar ke kiri jalan, lalu terbalik. Bak belakangnya mengenai korban yang ketika itu sedang duduk di pondok depan rumah rumah,” kata Kasat Lantas Polres Aceh Utara Ipda Mega Tetuko. (b19)

menjelaskan, pemberian banLANGSA (Waspada) : tuan dana aspirasi ini tidak daBeredarnya isu di kalangan lam bentuk uang, hanya bermasyarakat Kota Langsa bentuk kegiatan, yang masingyang menyatakan sejumlah masing anggota menyalurkan anggota DPRK Langsa tidak sendiri dana itu melalui dinasmenyalurkan dana aspirasi dinas terkait yang telah ditunjuk. dengan total Rp5 miliar unKemudian dana itu nantinya tuk 25 anggota dewan dikawal anggota dawan mau menuai pertanyaan di madisalurkan ke mana saja. syarakat ke mana dana itu DiakuiYuyu, dana itu jika sedisalurkan. kilas dilihat tidak nampak peWakil Ketua DPRK Langnyalurannya ke mana diperunsa Syahyuzar AKA, di kantortukkan, makanya kalau anggota nya, Kamis (28/6) menyatadewan tidak menyalurkan dana kan, dana aspirasi yang dipeSyahyuzar AKA, aspirasi itu dana tersebut bisa runtukan bagi 25 anggota Ketua DPRK Langsa bergeser untuk keperluan lain. DPRK Langsa sejauh ini su“Kita sudah memberi bantuan dah disalurkan sesuai pedana untuk daerah pemilihanruntukannya yang diajukan masyarakat, se-perti memperbaiki infrastruktur nya, jadi manfaatkan dana ini untuk keperluan jalan, irigasi, drainase, mushalla, tempat wudhu, masyarakat sesuai janji-janjinya sebelum bantuan ternak kambing, sapi, bebek, timba- terpilih menjadi anggota dewan,” terangnya,. Maka dari itu, anggota dewan harus mengangan dan lain-lain yang sifatnya menyentuh wal dana itu ke mana saja diperuntukkan, kalau kepada kebu-tuhan warga. Dana aspirasi dengan total Rp5 miliar itu, anggota dawan tidak mampu mengawal dana menurutnya, dibagikan kepada 25 anggota de- itu akan hilang. “Dana itu saat ini masih berada wan, di mana masing-masing anggota menda- di dinas-dinas, menunggu penyalurannya, jika pat dana aspirasi Rp200 juta. “Peruntukannya mau menyalurkan terlebih dahulu berkoorsesuai kebutuhan dan perkembangan di masya- dinasi dengan dinas terkait untuk apa penyalurakat, baik itu di daerah pemilihannya (Dapil) rannya. Kalau anggota dewan tidak punya sendiri maupun di lingkungan masyarakat lain- kemampuan menyakinkan dinas, maka dana itu tidak ada bisa disalurkan,” terangnya. (m43/ nya,” paparnya. Syahyuzar, yang biasa disapa Yuyu kembali b21)

Warga Aceh Utara Saksikan MTQ Ke-31 KUTAMAKMUR (Waspada) : Diperkirakan belasan ribu warga Aceh Utara dari 852 gampong di 27 kecamatan, tumpah ruah di lapangan bola kaki Kuta Makmur untuk menyaksikan Musabaqah Tilawatil Quran (MTQ) ke-31. MTQ penting dilaksanakan setiap tahun untuk membumikan syiar Islam. Acara pembukaan MTQ ke-31 berlangsung khidmat. M Alibasyah, Penjabat Bupati Aceh Utara pada kesempatan itu menyampaikan, MTQ penting dilaksanakan selain untuk membumikan syiar Islam, juga Maimun Asnawi untuk menumbuhkembangkan proses pendidikan, PENJABAT Bupati Aceh Utara HM Alibasyah, Rabu (27/6) saat k h u s u s n y a d i b i d a n g menyerahkan piala bergilir MTQ Aceh Utara kepada Camat Kuta keahlian membaca Alqu- Makmur. dalam menggalakkan pembangunan untuk ran, memahami kandungannya dan pada masa depan. akhirnya dapat diimplementasikan dalam Mursyid MB, Ketua Umum MTQ ke-31 segala aspek kehidupan. Aceh Utara didampingi Amir Mahmud, Kadis Karena itu pula, MTQ ke -31 ini mengambil Syariat Islam menyebutkan, MTQ tersebut thema “Melalui MTQ ke-31 kita wujudkan melombakan 9 cabang yaitu tilawah, hifzil, pembangunan Aceh Utara berkarakter dan tafsirul quran, fahmil, syarhil, khattil. Pada hari berbasis syariat”. Thema tersebut memiliki pertama, panitia l menampilkan lima orang makna yang sangat luas, karena Alquran peserta tilawah. (b18) dijadikan sebagai sumber energi dan inspirasi

Pungutan Murid Baru Harus Persetujuan Komite Sekolah LHOKSEUMAWE (Waspada) : Kendati pemerintah daerah tidak membenarkan pungutan biaya murid baru, namun kebijakan sekolah untuk biaya bantuan sekolah tetap dibenarkan. Namun biaya tersebut harus melalui musyawarah wali murid bersama komite sekolah sehingga penggunaannya jelas dan tidak tumpang tindih dengan dana bantuan pemerintah untuk sekolah gratis. Kadis Pendidikan Pemuda dan Olahraga Lhokseumawe melalui Kabid Dikdas, Darafli, Kamis (28/6) menjelaskan, saat ini penerimaan murid baru sudah sampai tahap daftar ulang. Penerimaan murid baru, menurutnya, tidak dibenarkan memungut biaya dari orang tua murid. Untuk biaya panitia bisa dimanfaatkan dana bantuan operasional sekolah (BOS) dari pemerintah pusat. Darafli didampingi Sekretaris Disdikpora Lhokseumawe Nurmalita menambahkan, sejumlah sekolah mengalami keterbatasan dana, karena tidak dibenarkan melakukan pengutipan. Dengan menggratiskan seluruh biaya, sekarang ini pihak sekolah kekurangan

dana untuk mencapai mutu pendidikan yang lebih baik. Sedangkan dana BOS nilai terbatas. Setiap murid SD hanya mendapat Rp500.000 per tahun, sedangkan siswa SMP Rp700.000 per tahun. “Sementara kebutuhan mereka lebih tinggi. Sedangkan pihak sekolah tidak dibenarkan melakukan pengutipan,” jelasnya. Agar pendidikan di Kota Lhokseumawe tidak terpuruk, pihak sekolah dapat mengambil kebijakan pungutan kepada wali murid baru. Namun, harus melalui musyawarah bersama antara pihak sekolah, wali murid dan komite sekolah. “Tujuannya supaya penggunaan dana bantuan tersebut tepat sasaran,” jelas Kabid Dikdas. Dia juga mengatakan, penerimaan murid SD di Kecamatan Banda Sakti mencapai 1.724 orang. Sedangkan Muara Dua 1.097 orang, Muara Satu 630 orang dan Kecamatan Blang Mangat 4.091 orang. Siswa baru tingkat SMP yang tersebar di 19 sekolah mencapai 2.852 orang. Sedangkan Madrasah Ibtidaiyah sebanyak 680 orang dan MTsN sebanyak 1.120 orang. (b15)

Warga Miskin Mengaku Diintimidasi IBU Nuraini, 36, yang baru dua minggu melahirkan anak ketiganya mengaku kecewa atas tindakan sejumlah oknum dari kelompok tertentu yang memaksa mengambil uang bantuan untuk dirinya yang membutuhkan biaya pengobatan dirinya dari sumbangan sukarela yang diterimanya saat kunjungan M Fakhrudin ke kediamannya, Rabu (27/6). Dia juga mengaku sempat diancam dan dipaksa sejumlah orang agar mengembalikan dana pengobatan itu karena dianggap sebagai bentuk moneypolitik, tetapi dirinya bersikukuh

dan berani bersumpah bahwa pemberian dana untuk dirinya itu tidak diiringi embel-embel politik apapun. “Kami sangat sedih, hidup saya sudah susah dan ini juga masih dalam kondisi sakit karena baru melahirkan, tetapi mereka memaksa meminta uang (sumbangan) itu dari saya, padahal saya menerima uang itu tidak ada kepentingan politik apa-apa, saya juga tidak paham hal-hal seperti itu, tetapi mereka memaksa saya dan meminta uang itu dikembalikan,” kata Ny Nuraini saat ditemui Waspada di gubuknya yang terlihat rapuh

dengan kondisi memprihatinkan. Kejadian yang menimpa Nuraini saat kunjungan silaturrahmi Ir M Fakhruddin ke Desa Gunung Samarinda tersebut juga disesalkan kepala desa setempat M Akhir. Kepada Waspada Keucik Gunung Samarinda itu mengaku mendengar kabar yang menimpa warganya yang dinilai memang layak menerima bantuan. Selain karena kondisi yang memang sangat miskin serta baru melahirkan, keadaan kesehatan ibu tiga anak itu juga dianggap memang membutuh-

kan bantuan sehingga dirinya selaku kepala desa ikut memberikan apresiasi atas kepedulian yang ditunjukkan M Fakhruddin yang turun langsung melihat kondisi warganya yang memang sedang mengalami kesusahan. “Kita juga siap mendukung rencana gotong-royong membangun rumah ibu Nuraini yang sudah tidak layak tinggal, kepedulian seperti itu patut kita berikan apresiasi, karena langsung turun dan melihat kondisi masyarakat yang sedang kesulitan,” ujar Kepala Desa Gunung Samarinda, M Akhir. (cb05)



WASPADA Jumat 29 Juni 2012

Sanu-Ali Basrah, Terbaik, Terbukti, Teruji Lanjutkan Periode 2012 – 2017 Ir H Hasanuddin, B,MM, lahir 13 September 1952, dengan sapaan akrab Pak Sanu, dikenal sebagai sosok birokrat sekaligus politikus yang handal, piawai, di Aceh Tenggara. Bagaimana tidak, suami dari Hj Rahmiaty Desky, anak alm H Satibun Desky, tokoh pejuang kabupaten Agara ini, pada tahun 1993-1998 sukses menjabat Ketua DPD Partai Golkar Agara, menorehkan tinta emas di DPP Golkar. Kisah perjalanan kariernya berlangsung pasang surut. Akibat kebijakan pemerintah, karena abangnya H Syahbuddin,BP, menjabat Bupati Agara kala itu. Maka Hasanuddin, B, yang menjabat Kepala Dinas PU, harus “hijrah” ke Kabupaten Aceh Tengah, menjabat Kepala Bappeda dan Kadis PU. Selanjutnya pada tahun 2007, Hasanuddin B, yang berpasangan dengan H Samsul Bahri, berhasil memenangkan hati rakyat menjabat sebagai Bupati-Wakil Bupati Agara. Dilantik Gubernur Aceh saat itu IrwandiYusuf, sejak 1 September 2007. Sejak 2010 hingga saat ini, Hasanuddin B, kembali menjabat Ketua DPD Partai Golkar Agara yang memiliki 4 kursi di DPRK itu. Kilas balik, keberhasilan Hasanuddin B, memenangkan hati rakyat Agar dengan pasanganWakil Bupati Samsul Bahri, priode lalu itu, dicederai dengan istilah pilkada berdarah, akibat kisruh hingga pelantikan pasangan ini. Dan semua kalangan di Agara paham, menjadi Bupati sebagaimana dialami Hasanuddin B itu, sangat tidak nyaman. Pasalnya, sebagian anggota DPRK Agara, berada di barisan “lawan politik” sehingga keharmonisan membangun untuk kepentingan masyarakat Agara, jelas tetap ada benturan. Lantas, apakah Pak Sanu menyerah ? Birokrat dan politisi

yang diakui kawan dan lawan, cukup matang pengalaman dan piawai ini, menyadari benar. Persoalan politik tidak mungkin selamanya buntu, karena rumus politik itu sangat jelas, yakni, tak ada teman dan lawan yang abadi, justru yang ada adalah kepentingan abadi. Maka diyakini ada solusi selama komunikasi tetap diupayakan, Hasanuddin B, yang mengusung visi dan misi, mengedepankan kepentingan pembangunan Agara yang bermartabat, atas nama kepentingan daerah. Akhirnya semua kebuntuan luluh, mencair, berbalik menjadi dukungan atas kepemimpinan Hasanuddin B. Terbukti di penghujung masa jabatan, Hasanuddin B, yang maju untuk priode ke 2 berpasangan dengan H Ali Basrah,SPd.MM yang lahir,19 Juni 1966, didukung oleh 12 partai politik, lokal dan nasional. Partai Golkar, Demokrat, Partai Aceh, Hanura, PPP, PKS, parta PKPI, PPPI, partai patriot, PDP serta Partai PKB. Dari sejumlah 25 anggota DPRK Agara, tercatat 19 anggota DPRK itu menjatuhkan pilihan mendukung pasangan Sanu – Ali Basrah. Nyaris dukungan pencalonan ini menjadi dukungan mutlak dari wakil rakyat Agara pada pasangan Sanu – Ali Basrah. Praktis hanya 6 anggota DPRK Agara mendukung kandidat lainya.

Sebagai incumbent, langkah ditempuh Hasanuddin B -Ali Basrah , memenangkan pemilukada Bupati-Wakil Bupati Agara, priode 2012 – 2017, tentu saja disadari betul. Busur anak panah berbagai isu miring akan dibidikkan pada mereka. Bak kata pepatah “semakin tinggi pohon itu maka goncangan angin juga semakin kuat terasakan”. Bagi yang pro Sanu-Ali Basrah, berpikir realistis setelah menilai kinerja Sanu didalam menjalankan roda pemerintahan telah dipenuhinya semua janji politik yang dituangkan pada visi dan misi terdahulunya. Pemberdayaan ekonomi rakyat, telah terbukti dirasakan petani Agara berupa hasil panen gabah dan coklat mereka juga jagung, pemberdayaaan usaha kecil telah pula diupayakan berupa bantuan modal usaha pedagang kecil secara bertahap, bantuan bibit, ternak, pupuk digulirkan kepada petani Aceh Tenggara tersebar pada 16 kecamatan. Di bidang pendidikan,terus ditingkatkan. Sarana dan prasarana pendukung menuju peningkatan mutu, dunia pendidikan di Agara, dan selain dipacu pembangunan gedung sekolah baru. Di bawah kepemimpinan Hasanuddin B, status perguruan tinggi di Agara, semula berlabel sekolah tinggi, kini telah ditabalkan namanya menjadi Universitas Gunung Leuser. Hal ini dibuktikan dengan peningkatan pembangunan gedung kampus UGL itu. Demikian juga dengan skala prioritas sarana kesehatan, telah berdiri kokoh di 16 kecamatan Puskesmas, pustu, serta telah ditingkatan pembangunan gedung Rumah Sakit Umum H Syahuddin, juga diiringi penambahan peralatan medis, semua ini untuk pelayanan kesehatan bagi seluruh rakyat Agara. Soal pelayanan kesehatan Rumah sakit ini , sejak awal ditegaskan

gratis bagi rakyat, karena ada yang selama ini bermain-main dengan kebijakan pro rakyat, mereka diberi sanksi mutasi. Fakta juga telah membuktikan, kondisi hari ini, lebih dari 10 ribu orang tua pelajar ,siswasiswi, tingkat SMP, SMA, seAgara, merasakan kebahagian. Demikian juga yang dirasakan pemerintah daerah, jerih upaya yang dilakukan selama ini memacu peningkatkan kualitas dunia pendidikan telah menunjukkan hasil. Hari ini sesuai hasil ujian nasional, tercatat, Aceh Tenggara merupakan kabupaten dengan nilai UN (Ujian Nasional) yang terbaik di seluruh kabupaten/kota se-Aceh. Demikian juga dengan bidang keagamaan, telah berdiri kokoh di Lawe Pakam Islamic Center, juga hampir rampung pembangunan masjid Agung At-Taqwa yang dibangun dengan rincian dana diperkirakan Rp 50 miliar. Ditargetkan, pada tahun 2013 masjid termegah yang disiapkan untuk menampung sekira 4.000 jamaah ini, telah dapat difungsikan untuk kegiatan beriibadah umat. Demikian juga dengan pembangunan sarana jalan dua jalur, ini juga telah menunjukan warna baru wajah Bumi Sepakat Segenep. Namun masih ada pihak yang tidak puas, baik karena alasan politis,maupun ketidakpuasan lainya. Lantas apa tanggapan Hasanuddin B?Pak Sanu yang berpasangan dengan Ali Basrah, mengusung moto terbaik, Terbukti, Teruji Lanjutkan ini menilai, semua itu, ibarat singa tergiur buah anggur di atas pohon. Melalui khayalanya mengatakan, buah anggur itu asam, pahit, kelat, juga tak enak rasanya. Namun sesungguhnya buah anggur itu tak pernah benar-benar dicicipi. Singa itu tak tahu persis apa rasa buah anggur yang sebenarnya, tetapi mungkin karena latah atau me-

rasa semua pihak mau begitu saja percaya maka semua hal yang terpikirkan dilontarkan begitu saja. “ Bila mau jernih berpikir, jernih menilai, maka tak sulit , selama itu benar kita sebutkan benar dan salah kita sampaikan salah, ini yang benar, “ ujar Hasanuddin B. HM Salim Fakhri,SE.MM, Ketua DPRK Agara mengatakan, bila mengharapkan pembangunan itu diwujudkan melalui dana daerah, DAU, APBK, maka walau seorang profesor handal sekalipun menjabat Bupati Agara, digaransi 40 tahun ke depan tidak akan mampu dicapai dengan apa yang telah dikerjakan pemerintahan Sanu selama lima tahun terakhir ini. Pasalnya, sebagian besar uang daerah, setiap tahunnya, habis terbagi untuk pembayaran gaji Pegawai Negeri Sipil Agara. Kegigihan Hasanuddin B, berjuang di tingkat provinsi hingga pusat, berbuah sejumlah penghargaan yang didedikasikan bagi rakyat Aceh Tenggara. Di antaranya penghargaan dari Menteri Keuangan atas dedikasi peningkatan produksi beras di atas persen produksi Nasional, dan terakhir diterima Satya Lencana Kehormatan dari Presiden SBY atas keberhasilan pembangunan. Mengapa tanda kehormatan yang didedikasikan bagi rakyat Agara ini menjadi sebuah kebanggaan ? , pasalnya, tanda kehormatan ini hanya diterima tak lebih dari 23 kabupaten –kota se-Indonesia, karena pemerintahanya berhasil membangun tentu saja atas dukungan rakyat. Dengan sebagian kecil ulasan tentang kerja dan kinerja yang dilakukan pasangan calon Bupati-Wakil Bupati Aceh Tenggara priode 2012 – 2017, Sanu – Ali Basrah, ini, maka sangat sulit untuk dibantah kepemimpinan mereka memang masih yang terbaik, karena nyata Terbukti dan sudah Teruji, Lanjutkan. Pariwara

PADA putaran perdana kampanye rapat umum ditetapkan KIP Agara, pasangan calon Bupati-Wakil Bupati Agara priode 2012 - 2017, Sanu - Ali Basrah, mendapat jadwal pertama mengisi kampanye terbuka di Stadion H Syahadat, yang menjadi barometer dukungan rakyat, Sabtu (16/6), Terbukti puluhan ribu pendukung, menghadiri kampanye terbuka Sanu – Ali Basrah, terik matahari siang terkalahkan oleh teriakan Lanjutkan Sanu – Ali Basrah.

SABAR Melanjutkan Pembangunan Agara Lima Tahun Ke Depan PASANGAN calon BupatiWakil Bupati Agara priode 20122017, Sanu-Ali Basrah (SABAR), memiliki visi dan misi yang mulia untuk pembangunan Aceh Tenggara priode lima tahun ke depan. Kesungguhan masingmasing pasangan ini berbuat untuk Agara, H Sanu sebagai Bupati, dan H Ali Basrah Pasaribu, suami Hj Asnawati, anak dari H Sec Ahmadin, ini, menjabat Kadis Dikpora Agara, terbukti telah kinerja yang dibangun, dan semua itu dirasakan rakyat Agara. Visi lima tahun ke depan pemerintahan dipimpin pasangan Sanu – Ali Basrah, usai pencoblosan 2 Juli 2012 ini, yakni : terwujudnya Aceh Tenggara yang maju dan bermartabat. Makna maju di sini adalah, mewujudkan perekonomian masyarakat Aceh Tenggara yang telah mengalami peningkatan sejak tahun 2006 itu, diupayakan menjadi stabil dan kuat untuk dapat berbasis pertumbuhan potensi ekonomi daerah. Sedangkan yang dimaksudkan dengan bermartabat itu, adalah mewujudkan masyarakat yang berpegang teguh pada

ajaran syariat Islam dan menjunjung tinggi adat budaya dalam tatanan kehidupan masyarakat yang berbasis pendidikan dan berwawasan ilmu pengetahuan, dapat merasakan hasil pembangunan dan menjalani kehidupan dengan tenang, aman dan damai. Sedangkan misi yang digulirkan lima tahun ke depan adalah 1. Meningkatkan sistem tata kelola pemerintahan yang baik (Good Governmen and Governance) 2.Mengembangkan perekonomian rakyat di semua sektor untuk kemajuan daerah. 3. Meningkatkan pembangunan infrastruktur. 4. Memajukan pendidikan dan meningkatkan kualitas sumber daya manusia. 5. Meningkatkan pelayanan kesehatan masyarakat . 6. Meningkatkan kerukunan hidup antar umat beragama, di Aceh Tenggara yang multi etnis ini. Pasangan Sanu – Ali Basrah, telah meletakan pondasi dari visi dan misi mereka melalui karya nyata sejak tahun 2007 hingga saat ini. Artinya yang akan dilakukan kedepan adalah tindakan penguatan terhadap program kerja yang telah berhasil ditu-

naikan. Realistis, tidak mulukmuluk namun sangat mengena bagi kemajuan Agara ke depan. Dipastikan tingkat persaingan ke depan akan semakin tinggi, sehingga peluang yang dibuka pasangan Sanu – Ali Basrah, memfasilitasi pendidikan gratis warga kurang mampu hingga meraih gelar sarjana adalah sangat membantu di dalam peningkatan SDM rakyat. Sebagaimana ditegaskan dalam kampanye pasangan calon nomor urut 2 ini, hingga akhir masa jabatan mereka ditargetkan setiap rumah tangga di Agara telah dihasilkan satu orang sarjana. Gelar kesarjanaan tidak seharusnya disalahartikan sebagai jaminan bekerja sebagai PNS. Namun lebih penting dari itu yakni untuk meningkatkan SDM, kemampuan, mengembangkan pola pikir hingga masyarakat Agara memiliki kualitas, daya saing, bergaul setara dengan daerah lain. Soal pasangan calon Bupati-Wakil Bupati yang lainya, menjanjikan sekolah gratis. Hal ini dinilai aneh, sebab sekolah gratis justru telah diterapkan Hasanuddin B di Agara.

Demikian juga tentang berobat gratis. Ke depan ini yang akan ditargetkan pasangan SABAR adalah melahirkan satu orang sarjana pada tiap rumah tangga masyarakat Agara. Melahirkan generasi Agara yang berakhlak Agama. Cara pandang membangun Agara dan membangun masyarakat Agara kedepan, yang akan dilakoni pasangan calon BupatiWakil Bupati priode 2012 – 2017, Sanu – Ali Basrah, selaras dan seirama dengan yang disampaikan oleh beberapa tokoh Agara terkait kriteria pemimpin Agara yang pantas dipilih. Sebagaimana disampaikan Tgk H Hasanuddin Mendabe, Ketua MPU agar rakyat memilih pemimpin yang faham agama serta cinta dengan rumah Allah (Masjid). Sedangkan Ustadz Samsul Pane yang akrab disapa ustadz Sampan, dari Kota Medan, kepada pemilih calon Bupati Agara mewanti-wanti agar rakyat Agara memilih pemimpin selain taat agamanya, tak kalah penting adalah memilih calon yang berkarya nyata , jangan dipilih calon yang hanya berkarya kata.

Salah seorang tokoh pendiri Kabupaten Aceh Tenggara, H Nawawi Mamas yang juga Ketua Majelis Adat Aceh, Agara ini, justru secara terbuka menyatakan, bila untuk masa depan kebaikan Agara, maka pasangan Sanu- Ali Basrah cakap memimpin rakyat Agara, priode 2012 – 2017. Pasalnya, pasangan calon nomor urut 2 jauh dari kriteria tercela, dan sangat nyata sikap kepemimpinan diperlihatkan Sanu-Ali Basrah. Pasangan ini dekat dengan pemuka agama, ulama. Jelas komitmen mereka didalam menyikapi keragaman etnis di Agara. Hal ini juga telah nyata dirasakan umat kristiani Agara. Demikian juga dengan pengayoman terhadap ormas-ormas di Bumi Sepakat Segenep ini, pasangan Sanu-Ali Basrah, membuktikan perhatian yang sama. Demikian juga pembinaan dilakukan terhadap semua parpol, LSM serta insan pers, nyata, pasangan Sanu-Ali Basrah, yang memiliki histori aktif di berbagai ormas sebelum nama mereka booming, sangat mahfum, melakukan yang terbaik, tersebut. Pariwara

Peluang Sanu –Ali Basrah Memimpin Agara 2012 – 2017 Didukung Data Ilmiah Suara- suara yang dikumandangkan, tanggal 2 pilih nomor 2 untuk priode ke 2, menggema terus di seluruh kecamatan di Aceh Tenggara yang disambangi pasangan calon Bupati – wakil Bupati Agara priode 2012 – 2017, Sanu – Ali Basrah. Suara dukungan ini beragam dari jumlah ribuan hingga puluhan ribu pendukung, telah mengikrarkan untuk berjuang mengantarkan pasangan Sanu – Ali Basrah menjadi Bupatiwakil Bupati Agara priode 2012 – 2017. Hasanuddin,B, sebagai Bupati Incumbent, mendengar hampir semua hujatan, celaan yang dilontarkan, seiring dengan pencalonan dirinya dipriode ke 2 ini. Namun, sebagai politisi yng telah matang, diabaikan semua tudingan, bak kata pepatah, “waktu jua yang akan menjawab. Maka , biarkan anjing menggonggong, kafilahpun berlalu”. Menjelang tahapan akhir memasuki masa kampanye terbuka pasangan calon Bupati, Agara sempat digegerkan selebaran menghujat Sanu, yang dinyatakan pada selebaran gelap itu, yang membuat isi keburukan tentang Sanu tersebut adalah H Sehsaman. Nama H Sehsaman ini dikaitkan

dengan nama mantan Wakil Ketua DPRK Agara yang memimpin sidang paripurna pelantikan Hasanuddin B, selaku Bupati Agara priode 2007 lalu. Masyarakat Agara geger, terbuai, dan tentu saja, suasana ini menjadi angin segar bagi kandidat lain untuk mendapat simpatik suara rakyat untuk mencoblos mereka pada 2 juli 2012 nanti. Namun H Hasanuddin B dan pasanganya H Ali Basrah Pasaribu, tidak menunjukkan ekspresi risau dan galau menghadapi gencarnya “kampanye hitam” yang diarahkan pada mereka. Kenapa ? , pasalnya, pesta demokrasi pemilukada, untuk memutuskan seseorang maju mencalonkan diri, bahkan berpeluang menang atau kalah itu, bukan ditentukan oleh hujatan. Semua itu ada mekanismenya, melalui survey yang benar, maka dihasilkan keputusan yang benar. Dan pasangan Sanu – Ali Basrah yang diusung 12 partai politik yakni partai, Partai Golkar, Demokrat, Partai Aceh,Hanura, PPP, PKS, PKPI, PPPI, Partai Patriot, PDP serta PKB, berdasarkan survey yang dilakukan lembaga survey yang memiliki kredibilitas yang baik di republik ini. Dari kesimpulan hasil survey yang dilakukan pada masyarakat Agara, ternyata popularitas, serta

elektabilitas pasangan calon Bupati – Wakil Bupati Agara, yang paling dominan dan paling berpeluang memimpin Agara priode 2012 – 2017, adalah pasangan H Hasanuddin B – H Ali Basrah. Ini suara rakyat sesuai kajian ilmiah. Dan fakta ini telah pula diungkap Jurkam pasangan Sanu–Ali Basrah di tengah-tengah massa pendukung pasangan Sanu–Ali Basrah yang disambut meriah sekira 35.000 massa pendukung Sanu–Ali Basrah. Banyak tokoh-tokoh yang berpengaruh di Agara selama ini disebut- sebut, enggan di barisan kubu Hasanuddin B. Hal ini terbantahkan seiring berjalanya waktu. Pasalnya, satu persatu, nama-nama tokoh yang disebut berpaling tak mendukung pasangan calon Bupati-Wakil Bupati priode 2012 – 2017, Sanu – Ali Basrah, dari berbagai suku, ketika pasanganan Sanu – Ali Basrah, yang konsisten menggelar kampanye rapat terbuka sesuai jadwal, tampak dipanggung kehormatan, tokoh agama, sintua, ulama, tokoh pemuda, para tokoh tua, ikut menghentak semangat pendukung pasangan Sanu – Ali Basrah, mereka mengacungkan 2 jari membentuk simbol V (victori), yang berarti Sanu – Ali Basrah, menang. Pariwara

PEMBANGUNAN Masjid Agung At-Taqwa yang dibangun dengan anggaran Rp50 miliar, mampu menampung 4.000 jamaah. Pembangunan Masjid Agung At-Tagwa yang akan menjadi salah satu masjid termegah di Aceh ini, telah rampung 70 persen lebih dikerjakan, dan pada tahun 2013 Masjid termegah ini, telah dapat difungsikan untuk kegiatan beribadah


WASPADA Jumat 29 Juni 2012

Rerun EURO 2012 08:45 Dahsyat 11:00 INTENS 12:00 SEPUTAR INDONESIA 12:30 Layar Sinema Siang 14:30 CEK AND RICEK 15:00 INDONESIAN IDOL 2012 - XTRA 15:30 SEPUTAR INDONESIA 16:00 KONSER CINTA JAKARTA 18:30 Layar Drama Indonesia: Yang Masih Di Bawah Umur 19:30 Mega Sinetron : TUKANG BUBUR NAIK HAJI THE SERIES 21:00 Layar Drama Indonesia: AIR MATA UMMI 22:00 Box Office Movie


07.00 SCTV Musik Inbox 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 11.03 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 15.00 Uya Emang Kuya 15.30 Film Layar Lebar 16.00 Liputan 6 Terkini 16.03 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 FTV Istimewa 19.30 SCTV Sinetron : Putih Abu Abu 20.00 Liputan 6 Terkini 20.30 Badil Dan Blangkon Ajaib 21.30 Si Biang Kerok 22.00 SCTV FTV 00.00 Liputan 6 Malam

07:30 – Kisah Pilihan 08:30 - Serial Pilihan 09:30 - Kisah Unggulan 10:30 - Kribo 11:00 - Sidik 11:30 - Lintas Siang 12:00 - Layar Kemilau 13:30 - I Drama 15:00 - Starlite 15:30 - Lintas Petang 16:00 - Animasi Spesial 16:30 - Indonesia Beraksi 17:30 - Animasi Spesial : Shaun The Sheep 18:30 - Aladdin 19:30 - Dewi Bintari 22:00 - Putri Nabila 23:00 - Dangdut Never Dies 00:00 - Sport Mania 00:30 - Obat Malam 01:00 - Lintas Malam 01:30 - Cerita Dinihari

06:30 - Hati Ke Hati Bersama Mamah Dedeh 07:30 - Fresh & Fun 08:00 - Friends 09:00 - Fenomania 09:30 - Gerakan Koperasi Berprestasi 10:00 - Bread, Love And Dreams 11:30 - Topik Siang 12:00 - Klik ! 13:00 - Tom & Jerry 14:00 - Count Duckula 14:30 - Woody Wood Pecker 15:00 - ISL : 17:30 - Topik Petang 18:00 - Pesbukers 19:30 – Keluarga Selebritis 20:30 - Glory Jane 21:30 - Pilih Pilih Mantu 22:30 - Sinema Spesial

07:00 - KISS Pagi 08:00 - Halo Polisi 08:30 - Sinema TV Pagi 10:00 - Sinema TV Spesial 12:00 - Patroli 12:30 - Drama Asia (Korea): Naughty Kiss 13:30 - Drama Asia (Korea): Protect The Boss 15:00 - KISS Sore 16:00 - Fokus 16:30 - Buaya Show 17:00 - SinemaTv Spesial: 18:00 - Drama Asia (Mandarin): Kung Fu Master Wong Fei Hung 19:00 - Sinetron Unggulan 20:00 - Tutur Tinular 22:00 - Konser Dangdut

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Special Program 11.00 Headline News 11.30 Metro Siang 12.05 Metro Siang 13.05 Wideshot 13.05 Wideshot 14.00 Headline News 15.30 Wideshot 16.00 Headline News 16.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Eadle Documentary 21.05 Top Nine News 21.30 Kick Andy 23.00 Headline News 23:20 Metro Sports

C1 07:30 Sinema Spesial Liburan 09:30 Cinta Cenat Cenut 10:00 Riwayat 10:30 Insert 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Anak Negeri 13:15 Jail 14:00 Magic Comedy 14:30 Digital Clip 15:00 Sketsa 16:00 Show Imah 17:00 Reportase Sore 17:30 Insert Investigasi 18:15 Comedy Project 19:15 Dia-Loe-Gue 20:15 Bioskop TRANSTV Spesial 22:15 Bioskop TransTV: 01:15 Reportase Malam

06:30 Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Live News Kabar Pasar 16:30 Live News Kabar Petang 19:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Kabar Arena 22:30 Radio Show

08:00 Spongebob Squarepants 08:30 Oggy and The Cockroaches 09:00 Doo Bee Doo 10:00 Obsesi 11:00 Dapoer Cobek 11:30 Hot Spot 12:00 Global Siang 12:30 Awas Ada Sule 13:30 Ewon Sang Pemburu 14:00 Masih... Main Kata 15:00 100% Ampuh 16:30 Fokus Selebriti 17:00 Spongebob Squarepants 18:30 K-Pop 19:30 Cagur On The Street 20:00 Naik Enak, Turun Ogah 21:00 Big Movies 23:00 Big Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 13:00 Laptop Si Unyil 13:30 Unyilpedia 14:00 Dunia Binatang 14:30 Home Stay 15:00 Asal Usul 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Si Gundul 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Dua Dunia 00:00 Wisata Malam 00:30 Sport7 Malam 01:00 Redaksi Malam **m31/G

Audy – Iko Tak Menunda Momongan KENDATI belum memiliki rumah sendiri dan tanpa bulan madu khusus pasca menikah resmi Senin (25/6) di Hotel Gran Mahakam Jakarta Selatan – lantaran sang suami harus segera terbang ke Amerika syuting Remake film The Raid, Audy Item dan Iko Uwais sepakat segera mengejar kehamilan.

The Biggest Stars Di Celestial Movies Celestial Movies - saluran televisi berbayar menayangkan film Asia 24 jam nonstop tanpa jeda iklan tiap Minggu selama bulan Juli–Agustus pukul 20:00. Celestial Superstar Club adalah suguhan eksklusif berupa film-film blockbuster dan box office China dibintangi para superstar favorit, termasuk film gress Jet Li memenangkan Hong Kong Film Awards 2012: Flying Swords of Dragon Fate. Mengantongi kontrak eksklusif dengan para distributor film China terbesar, ramuan spesial Celestial Superstar Club ini mengukuhkan posisi Celestial Movies sebagai satu-satunya saluran TV yang memiliki suguhan aksi para superstar film Asia dan ragam film blockbuster terbaru dan terkini di layar kaca. Tidak tanggung-tanggung, sejumlah film andalan yang baru pertama kali tayang di layar kaca bakal disajikan Celestial Superstar Club, yaitu Flying Swords of Dragon Gate (15/7), Love You You (22/7), The Great Magician (12/8) dan The Viral Factor (26/8). Flying Swords of Dragon Gate adalah film laga teranyar dari sutradara ternama Tsui Hark menggandeng Jet Li sebagai bintang utamanya. Film wuxia 3D pertama di dunia ini, mengantongi delapan nominasi dan lima penghargaan Hong Kong Film Awards 2012. Sementara aktris sensasional Hong Kong Angelababy dan aktor tampan berdarah TaiwanKanada Eddie Peng, akan berperan sebagai sepasang kekasih dalam Love You You. Celestial Movies juga akan menghadirkan aksi tiga aktor papan atas peraih penghargaan, Tony Leung, Sean Lau dan Zhou Xun dalam komedi satir The Great Magician. Film karya sutradara peraih penghargaan, Derek Yee ini akan membawa kita ke tahun 1920-an dimana Tony Leung beraksi sebagai magician handal. Untuk penggemar aktor tampan Nicholas Tse dan Jay Chou, nantikan aksi mereka dalam film The Viral Factor. Film besutan sutradara ternama Dante Lam bergenre action, penuh adegan aksi laga spektakuler, kebut-kebutan dan tembak-menembak. Selain keempat film diatas, nantikan pula film komedi satir berhasil memecahkan rekor film blockbuster di negeri China; Let The Bullets Fly (Chow Yun Fat, Jiang Wen). Ada pula film penuh dengan spesial efek Computer Generated Imaging (CGI) spektakuler berjudul Sorcerer and the White Snake, dibintangi Jet Li, Eva Huang, Raymond Lam dan Charlene Choi. Celestial Movies juga mempersembahkan film sejarah RRC dan Hong Kong; 1911 dibintangi deretan aktor China ternama seperti Jackie Chan, Jaycee Chan (putranya), Li Bing Bing, Winston Chao dan Joan Chen. Film Let’s Go diperankan Juno Mak dan Stephy Tang tentang pencarian jati diri seorang pria untuk menjadi pahlawan pasca kematian sang ayah. Sementara aktris cantik Fiona Sit dan Chapman To akan menemukan cinta mereka ditengah profesi penjudi yang mereka lakoni, dalam film komedi Mr & Mrs Gambler. Celestial Movies dapat diakses melalui Indovision (ch. 20); Okevision (ch. 19); Telkomvision (ch. 108); Aora (ch, 211), Skynindo (ch. 37), Groovia (ch. 608), Centrin TV (ch. 312) dan Topaz TV (ch. 27).(m19)

“Kendati masih tinggal bergantian di rumah mertua indah dan pasca menikah saya akan meninggalkan Audy tiga bulanan untuk syuting Remake film The Raid di Amerika Serikat, kami berdua sepakat langsung mengejar kehamilan. Alias tanpa program menunda punya momongan,” papar Iko Uwais kepada Waspada di Pantai Timur – Ancol, baru-baru ini. Ditemui saat mendampingi Audy tampil di panggung “Jakarta Musik Festival” (JMF) 2012 Sabtu malam (23/6), atlet Pencak Silat belakangan populer sebagai aktor laga ini menambahkan, usia Audy pada 23 April lalu sudah 29 tahun. “Secara kesehatan, idealnya wanita yang sudah menikah diupayakan hamil

sebelum usianya melewati kepala tiga. Selain itu, banyak pasangan suamiistri yang pada akhirnya sulit punya keturunan akibat menunda kehamilan. Jadi, sangat beralasan bila kami sepakat segera punya momongan,” tandas Iko berencana memiliki dua anak. “Soal punya momongan, kami berprinsip mengalir seperti air. Kalau langsung diberi Allah SWT kehamilan, kami siap segalanya merawat sebaik mungkin benih-benih cinta kami hingga menjadi bayi yang sehat saat dilahirkan,” tekad Audy. JMF Meriah Kendati kawasan wisata Ancol sehari sebelumnya digempur sederet penyanyi dan band papan atas ibukota, Sabtu petang hingga malam (23/

6) lalu panggung JMF tetap berlangsung meriah. Tak kurang dari 60 band dan penyanyi dari berbegai jenis genre musik secara bergantian tampil di tiga panggung berbeda. Di panggung Pantai Timur antara lain tampil menghibur band yang tengah naik daun – Queenzella, Electra, Audy, Super Girlies, Vagetos, Power Slaves, Last Child, hingga Five Minutes. Di panggung Beach Pool sederet pendatang baru seperti band Vegas, Terra, Cat Rock, biduanita Meggie hingga Miss Ronggeng, pun mampu tampil memukau. Sedangkan di Backstage tempat prosesi pembukaan JMF diresmikan Deputi Gubernur DKI Jakarta Bidang Pariwisata dan Budaya, Sukesti Martono, musik Etnis Betawi Gambang Kromong dan alunan lagu band XO-IX dan Numata membahana menemani penonton menikmati santap malam. * (AgusT)

Tipe X/

Tipe X Di P.Siantar Grup band Tipe X dengan konsep musik Ska Sabtu (29/6) malam ini bakal menguncang publik P.Siantar di Lapangan H Adam Malik dalam rangkaian event Art of Party. Band baru merilis single terbaru Boy Band ini punya banyak hits seperti Sakit Hati, Genit, Salam Rindu, dan Mawar Hitam tentu menjadi tontonan menarik karena musik mereka bawakan berirama gembira. Tentu kehadiran Tipe X di P.Siantar sudah sangat ditunggu fans setia mereka menamakan dirinya X-Friends. Acara

dimulai pukul 16.00 nantinya grup ini bakal membawakan tembang-tembang hitsnya yang sudah sangat dikenal fansnya. “Event Art Of Party Roadshow ini sebagai apresiasi kami untuk para pecinta seni dan kreatifitas, juga membawakan band pemenang Create Your Own Style di awal tahun kemarin” ujar Romanus Depari, Area Marketing Manager Medan, PT Gelora Djaja. Pada roadshow ini juga dimeriahkan aksi Female DJ Verny (Jkt) dan Live PA. Acara dibuka Prya, Tenessa, Jazzy Busy, Donat, Wacacaw.(m19)

Musisi Gunakan YouTube Populerkan Karya


Penyanyi Cantika menyatakan Youtube digunakan untuk memperkenalkan karya. “YouTube untuk memperluas lagu-lagu yang kita buat,” katanya mewakili dua rekannya Audrey dan Gamaliel yang melejit setelah video mereka ditonton banyak orang di YouTube. “Kaget, viewer-nya banyak banget,” katanya dalam konferensi pers peluncuran YouTube Indonesia di Jakarta. Sementara, grup band Nidji mengaku menggunakan situs berbagi video terbesar di dunia itu untuk mengobati kerinduan penggemarnya. “Kalau Nidjiholic (sebutan untuk penggemar Nidji) kangen, bisa nonton dari YouTube,” kata vokalis Giring Ganesha mewakili rekan-rekannya di Nidji. Mengenai kemungkinan video diunduh secara cuma-cuma, Cantika berkomentar, “Konsekuensi punya akun di YouTube. Tujuan kami supaya video bisa ditonton.”(ant)

Audy dan Iko

Clas Mild Jalin Kerjasama Dengan UGL Clas Mild tidak pernah berhenti memberikan dukungan kepada mahasiswa dan kegiatan positif lainnya untuk kemajuan bersama. Sulianto selaku Branch Manager Clas Mild Medan didampingi Edi agustin selaku Sales & promotion supervisor menyebutkan, kegiatan Clas Mild tidak saja di Medan tapi juga di Aceh seperti menggalang kerjasama dengan mahasiswa Universitas

Gunung Leuser (UGL). Menurutnya, bentuk dukungan diberikan pihaknya, tidak melulu bidang musik, tapi juga olahraga sesuai Talk Line ”talk less do more” (sedikit bicara banyak bekerja). Kerjasama dengan mahasiswa Universitas Gunung Leuser menggelar turnamen olahraga piala UGL berlangsung 18 s/d 25 Juni 2012 bertujuan memotivasi serta meningkatkan efektifitas

mahasiswa baik dalam berakademik, kreatifitas dan sportifitas khususnya dalam berolah raga. Zulyadin ketua panitia menambahkan, kegiatan tersebut dilakukan agar Kampus UGL Kutacane mampu menjadi daya tarik masyarakat Aceh Tenggara umumnya dan khususnya bagi masyarakat luas agar memiliki motivasi yang jelas menjadi mahasiswa. (m19)



Wajar Kalau Parpol Islam Ditinggal Pemilih Fanatik


erdasarkan survei LSN yang dilakukan 10-20 Juni 2012, dukungan masyarakat dari 1.230 responden terhadap empat parpol Islam terbesar yakni PKS, PAN, PPP dan PKB hanya 15,7 persen. Kecenderungan ini menurun dibandingkan ketika pemilu tahun 1999 atau 2004 di mana total suara terhadap partai berbasis massa Islam cenderung masih tinggi di atas 20 persen. Kalau mantan Ketua Umum DPP PAN (Partai Amanat Nasional) Amien Rais menilai hal itu wajar dengan alasan dalam praktiknya berpolitik parpol Islam sudah tidak sesuai ajaran Islam. Amien memberi saran supaya parpol Islam segera berbenah diri dengan membuat etalase politisi Islam itu jujur, berintegritas, tidak korup agar kepercayaan masyarakat, pemilih parpol Islam kembali pulih. Namun begitu, Partai Keadilan Sejahtera (PKS) tetap percaya diri menghadapi Pemilu 2014. PKS menjadikan hasil riset Lembaga Survei Nasional (LSN) sebagai masukan untuk konsolidasi internal. Di mata Ketua DPP PKS Bukhori Yusuf pihaknya kini tengah merapatkan barisan dan konsolidasi internal agar elektabilitas partai berbasis Islam, khususnya PKS, kembali meningkat ke depannya. Kalau PAN dan PKS cenderung dapat menerima hasil survei LSN, PPP tidak setuju dengan hasil survei yang menunjukkan elektabilitas partai Islam turun. Bagi PPP, tidak hanya partai berbasis Islam yang popularitasnya turun. Partai lain berbasis nasional juga ada yang menurun. Penurunan parpol Islam di mata Sekjen PPP M Romahurmuziy karena relatif lemah dalam kemampuan memunculkan pemimpin nasional yang berkarakter kuat. Partai-partai menengah, termasuk PPP, belum memiliki figur yang memiliki jam terbang politik yang memadai dibandingkan dengan partaipartai papan atas. Hanya PKB saja yang tidak begitu peduli dengan hasil survei LSN. Hal ini bisa disebabkan pemilih PKB dari kalangan Nahdlatul Ulama (NU) dikenal fanatik sehingga sulit berpindah ke parpol lainnya. Tapi, modal percaya diri seperti itu bisa menjadi bumerang buat PKB karena pemilih fanatik pun bisa mengalihkan dukungannya ke parpol non-Islam (Golkar, PDIP, Demokrat) jika melihat kinerja yang ditampilkan kader-kader parpol nasionalis itu ternyata lebih bermanfaat bagi masyarakat. Hemat kita, parpol Islam harus berkaca Intisari diri dengan hasil survei yang menunjukkan tingkat elektabilitas dan popularitas mereka Sebaiknya PKS maupun menurun tajam saat ini. Pasti ada yang salah dengan kinerja parpol Islam selama ini sePPP,PAN,dan PKB kem- hingga pemilih fanatiknya tidak lagi bersimpada mereka. Bisa jadi sudah tidak mambali ke jati dirinya sebagai pati pu menjadi jembatan penghubung dalam parpol Islam menegak- menyalurkan aspirasi umat Islam. Jadi ada apa yang dikatakan Amien Rais kan amar makruf nahi benarnya bahwa parpol Islam harusnya bisa menunjukkan kinerja yang jelas, tidak sama saja dengan mungkar parpol nasionalis. Tak pelak lagi kini pemilih parpol Islam pun sudah semakin rasional dan bisa melihat dan menilai parpol yang berkinerja baik dengan parpol yang hanya dekat dengan rakyat menjelang pemilu saja. Sudahlah kinerjanya biasa-biasa saja, kalah dari parpol nasionalis, pimpinan dan pengurus parpol Islam cenderung melupakan /mengabaikan aspirasi umat Islam. Upaya untuk memajukan umat Islam di berbagai bidang, seperti di bidang ekonomi tidak terlihat sama sekali. Kecenderungan yang terlihat sudah hampir tidak ada bedanya parpol berbasis Islam dengan parpol lainnya (nasionalis). Lagak gayanya sudah tidak ada beda dengan anggota dewan dari parpol-parpol lainnya, malah memperburuk citra umat Islam dengan kasus korupsi, amoral, narkoba, KKN. Apalagi dalam internal parpol Islam itu selalu terlihat konflik dan friksi-friksi sehingga tidak menggambarkan ajaran Islam yang seutuhnya, ukhuwatul islamiyah. Justru itu, pada pemilu 2014 bisa menjadi ajang ‘’pembantaian’’ bagi parpol Islam, termasuk PKS jika tidak segera berbenah diri. Kalau kini masih ada empat parpol Islam yang menonjol, bisa ‘’koar-koar’’ di DPR RI, bukan tidak mungkin pada pemilu dua tahun mendatang tinggal 1-2 parpol Islam saja yang masih bertahan di DPR RI. Yang lain harus minggir, seperti halnya PBB (Partai Bulan Bintang) akibat penurunan suaranya tajam tidak memenuhi ketentuan electoral threshold. Partai PKS ini sebenarnya paling banyak diharapkan umat Islam untuk memperjuangkan aspirasi dan mengubah jalannya pemerintahan. Tapi melihat perjalanannya yang baru satu dekade lebih dalam percaturan panggung politik sudah kehabisann ide dan idealis, bukan tidak mungkin suara PKS akan terjun bebas dalam pemilu mendatang. Harapan umat Islam PKS bisa mencontoh pergerakan Ikhwanul Muslimin (IM) di Mesir semakin jauh dari harapan. Para tokoh dan kadernya tidak mampu mencontoh kader IM. Dipenjara oleh penguasa karena berjuang menegakkan amar makruf nahi mungkar. Bukan dipenjara karena korupsi. Apalagi PKS juga sudah ‘’gila’’ kekuasaan dengan menjadi parpol pendukung pemerintah sehingga tingkat kritisnya semakin tumpul karena takut para menterinya di’’recall’’ dari jabatannya. Begitu juga dengan kadar PKS di DPR semakin lemah dalam mengontrol jalannya pemerintahan. Inilah yang membuat simpati masyarakat berkurang pada PKS, PPP, PAN, dan PKB. Sebaiknya PKS maupun PPP, PAN, dan PKB kembali ke jati dirinya sebagai parpol Islam. Menjalankan visi dan misi partai untuk kemajuan bangsa Indonesia, khususnya umat Islam. Tidak mengapa bertindak sebagai oposisi ketimbang menjadi partai kaya pendukung pemerintah tapi ditinggal oleh pemilihnya yang fanatik.+


Faks 061 4510025

Facebook Smswaspada

+6285261706175 Halo waspada . Minggu 24 juni 4 syaban . Senin 25 juni kenapa 6 syaban. Thn lalu jg begitu ttp sy lupa tgl nya. Tlg koreksi. Tksh +6287768429149 Halo waspada, kenapa tak pernah muat keluhan saya di konsultasi minggu pak thoga? Apa pilihan aja ya? Jadi bertanya-tanya +6287747795593 Ass wr wb Uroenyo uroe kebahagiaan bandum kamoe aneuk Bgs Aceh ateuh kasih sayang Allah merestui pemimpin kamoe bandum segom Aceh keu ateuh yg mulia Ayahandan dr H Zaini Abdullah-Muzakir Manaf dgn geupeutreun pempimpin kamoenyoe yg ade lagi bijak ateuh titahnya bisa membawa kesejahteraan, damee yg abadi, rakyat makmur nanggroe beu aman & pendidikan beumeurata keubandum aneuk para syuhada beutamat pendidikan S.1 keu inong balee ureung kulah bu dlm prang beuna bantuan utk modal usaha,rumoh yg kareuloh beuna pat geuduk bek keunong ujeun ngon angen seuba, keubandum rakyat beusare beurata peugot akhlak ngon budi perkerti pejabat yg maksiat, yg pengkhianat bangsa pinah beurijang sipak uluwa,boh keupeujabat ureung yg sayang kebangsa yg cinta kenanggro seutia keu perjuangan bangsa aneuk Mahasiswa ngon pemuda KPA cok me sajan pangkei beurijang keubenteng bangsa,bangun pertanian ngon irigasi peu ile ie bandum dlm blang.Tks +6282168040028 Seorang bapak dari Aceh, mencari anaknya[wanita]. Bapak[Badaruddin, usia 90 tahun]. Keberadaan sekarang, datang ke Polsek Medan Kota. +6285270178008 Ayo PSMS berjuang kerja keras maju terus. kalah menang buat rusuh... +6285371206345 Saran buat Pemkab.Asahan agar membuat rambu trafik light di depan rumah dinas dan kantor bupati demi pengamanan pejabat negara dan keluarga +6285296168607 lampu setiap hari sampai 10 x bhkan sudah 1 bulan lebih.m0h0n ketegasan nya Jgn kcwakan msyrkt yg sdh susah dibuat hdp yg tak mudah ini Ditambah lagi stress nya karna pemadaman listrik yg brulang2 kali tanpa adanya pemberitahuan yg jelas&akurat! #dimana toleransi anda? +6285275616464 Yth bpk bupati:gaji ke 13 , kesra, intensif dari gubernur dan intensif rp 250 rbu/bln dari pusat, uda cair lubuhan-batu, labusel.kapan lagi labuhanbatu-utara.kami pns sangat membutuhkan.mohon kepedulian bpk Bupati Labura.bpk Kharuddinsyah SE. +6287766217023 Kepada yth : Bapak Kapoldasu, mohon ditertibkan perjudian kartu dan penjualan togel diperdagangan, Kec. Bandar Kab. Simalungun yg hanya menimbulkan status gugatan pidana dimasyarakat yg beraneka ragam suku & agama yg percaya akan ‘ Tuhan Yang Maha Esa‘ yg tidak sesuai dengan perundang-undangan yg berlakberlaku untuk memperkaya pribadi & orang lain secara hukum adalah tindak pidana korupsi dimasyarakat diwilayah RI yang merugikan bangsa. Terima kasih.

WASPADA Jumat 29 Juni 2012

Indonesia Negara Gagal? Oleh Fajar As Setidaknya ada 12 indikator yang menunjukkan kegagalan tersebut.


atu lembaga internasional yang mengamati penampilan negaranegara di dunia (The Fund for Peace) menempatkan peringkat Indonesia sebagai negara di ambang kegagalan. Dari peringkat 64 menurun keperingkat 63. Sebagaimana biasanya pejabat tinggi RI membantah keras ini sebagai peringkat yang salah karena pertumbuhan ekonomi RI berada di angka tinggi 6% lebih dan cadangan devisa RI telah mencapai di atas USD 100 miliar (seratus miliar dolar Amerika Serikat). Padasaatyangsamaparatokohpenting Indonesia mendiskusikan peringkat ini di berbagai kesempatan dengan basis yang tidak jelas.Yang terjadi adalah debat kusir dan akan lenyap tanpa jalan keluar. Perlu ditegaskan bahwa dilihat dari sisi harga mati dan prinsip perjuangan besar bangsa Indonesia, terutama sejak ke Presidenan Soeharto adalah tidak semata negara di ambang kegagalan. Marilah kita mengkaji kasus negara gagal ini dengan kejujuran, kecerdasan, dan tanpa tujuan politik praktis, serta seobyektif-obyektifnya. Prestasi Gemilang RI yang dirintis kemerdekaannya sejak 1908, 1. Kebangkitan Nasional, dan 2. Perhimpunan Indonesia, tahun 1928, 3. (Sumpah Pemuda), tahun 1945, 4. (Badan Penyelidik Usaha-usaha Persiapan Kemerdekaan Indonesia, BPUPKI yang bersidang dari tanggal 29 Mei 1945 sampai 16 Juli 1945) 5. Pancasila yang diamanatkan Soekarno pada 1 Juni 1945 6, Piagam Jakarta yang ditetapkan 22 Juni 1945 oleh Panitia Kecil BPUPKI, sidang-sidang Panitia Persiapan Kemerdekaan Indonesia yang menetapkan berlakunyadenganresmi7UUDNKRIyang telah diciptakan BPUPKI, dan RI yang terbentuk dengan sah dengan 8 Proklamasi Kemerdekaan Bangsa Indonesia tanggal 17 Agustus 1945. Kedelapan proses ini tidak terlihat sedikitpun bentuk-bentuk politik, ekonomi, sosial, dan pekerjaan negara sebagaimana berlangsung di Indonesia yang merdeka. Justru apa yang diamanatkan dan diperintahkan oleh delapan prestasi gilang-gemilang para perintis kemerdekaan dan para pendiribangsasangatbertentangandengan apa yang berlangsung dalam perjalanan administrasi(tatausaha)RI. Kebijaksanaan-

kebijaksanaan penyelenggara negara baik Majelis Permusyawaratan Rakyat yaitu : DewanPerwakilanRakyatdanDewanUtusan(yangdipelintirmenjadiDewanPerwakilan Daerah), Dewan Pertimbangan Agung (yangdipelintirmenjadiBadanPertimbangan Presiden), Badan Pemeriksa Keuangan, Mahkamah Agung, Dewan Gubernur Bank Indonesia, dan terutama Presiden danWakil Presiden terlihat sedikitpun tidak menjabarkan amanat dan perintah delapan prestasi gemilang para pendiri bangsa. Bahwa dengan cara lebih simpel dan jelasolehSoekarnodiamanatkantigaprinsip (harga mati) perjalanan administrasi (tata usaha) yaitu : 1. Berdaulat di bidang politik, 2. Berdiri di atas kaki sendiri di bidang ekonomi, dan 3. Berkepribadian Indonesia di bidang kebudayaan. Negara yang bagaimana pun dan di mana pun bila tidak berdaulat di bidang politik, tidak berdiri di atas kaki sendiri di bidang ekonomi, dan tidak berkepribadian nasional di bidang kebudayaan—maka negara dimaksud adalah negara gagal serta berada di dalam kendali dari negara lain. Demikianlah RI sejak Presidenan Soeharto hingga kini telah mengingkari delapan prestasi para pendiri bangsa serta mengingkaritigaamanatPresidenSoekarno, maka para penyelenggara negara kehilangan fundamen, filosofi, pedoman (kompas), kedaulatan, kebebasan ekonomi, dan kehilangan kepribadian yang menjadikan RI menjadi negara gagal. Setidaknya ada 12 indikator yang menunjukkan kegagalan tersebut : 1. Kehidupan ekonomi – sosial warga beserta kehancuran infrastruktur vital berupa jalan, jembatan, dan pengairan di desa-desa, di mana desa ini dahulu adalah basis utama mempertahankan kemerdekaan Indonesia dari gempuran balatentara kolonialisme Belanda. Merosotnya kondisi ekonomi-sosialsertakehancuraninfrastruktur tersebut telah mendorong berlangsungnya urbanisasi dari desa ke kota yang menimbulkan masalah dan kerumitan di kota. 2. Kerusakan sungai-sungai, pinggir

sungai, danau, pinggir danau yang sangat serius di seluruh wilayah RI. Sungai-sungai dan danau-danau Indonesia yang di zaman penjajahan terkenal sangat-sangat indah dan sehat, telah berubah menjadi sangat jorok.Warga tidak dapat lagi mempergunakannya untuk tempat mandi dan menjadi sumberairminum.Pinggiransungaidikotakota telah benar-benar rusak dan menjadi pemukimanwargayangsangatpadat.Warga pun mempergunakan sungai-sungai tersebut menjadi pembuangan tinja (najis) sehingga sungai Ciliwung di Jakarta telah disebut warga asing sebagai WC yang terpanjang di dunia. 3. Kehidupan para nelayan kecil yang tetap melarat dan kemelaratan mereka yang meningkat terus karena kegagalan serius administrasi (tata usaha) negara untuk menjaga kestabilan harga bahan bakar serta kegagalan momodenisir kehidupan paranelayanKeciltersebut. 4. Para fakir miskin yang terlantar di mana-mana, antara lain di kolong jembatan, di pinggir sungai, di tempat-tempat kumuh. 5.Anak-anakterlantar yang semakin membludak di mana anak-anak yang terlantar ini selalu menjadi sasarn kejahatan seksual dan tidak sedikit dari anak-anak yang terlantar ini dibunuh dengan sangat kejam oleh pengidap homoseksual. 6.Pesta-pestadan pertunjukan jorok dari penari dan penyanyi dangdut yang mengekor kepada cara-cara jorok yang dipamerkan oleh penari dan penyanyi dari Amerika Serikat, Eropa Barat, Korea Selatan, dan negeri-negeri lainnya yang sungguh-sungguh berlawanan dengan kepribadian bangsa Indonesia. Pertunjukan jorok ini juga disebarkan oleh film-film Indonesia serta siaran-siaran dari televisi swasta. 7. Hilang totalnya kedaulatan dan kekuasaan RI atas pulau-pulau Sipadan dan Ligitan, dan sedemikian mudahnya MalaysiamempecundangiIndonesiadiMahkamah Internasional. 8.Merajalelanyagerakanmakar,gerakan sepratis,dankerusuhan-kerusuhandiPapua Indonesia yang tidak pernah diatasi. Gerakan-gerakan makar dan separatis ini kelihatannya didalangi dan digerakkan ke-

kuatan-kekuatanasingdandiplomasinegara RI terlihat lumpuh. 9.Gerakanbesar-besarandansistematis para konglomerat busuk Indonesia yang telah dengan sengaja dan dengan cara terorganisir merampok, menjarah, dan mencopet uang dan harga rakyat. Apa yang dilakukan para konglomerat busuk ini adalah kejahatan kemanusiaan yang merugikan rakyat mencapai setidaknya Rp700 triliun. AdministrasiSoehartotelahmembayaruang yang dijarah para konglomerat busuk tersebut dengan uang rakyat, termasuk uang fakirmiskindananak-anakterlantarmenjadi pembayar uang dan harta yang dirampok. AdministrasiB.J.Habibie,K.H.Abdurrahman Wahid, Megawati Sukarnaputri, dan SBY tidakpernahmengkoreksidandalamkenyataannya menjadi mendukung perampokan dan penjarahan uang seluruhr akyat tersebut. 10. Perbuatan administrasi Megawati Sukarnaputri, di mana membuat kontrak dalam proses penjualan Liquified Natural Gas (LNG) produksi Tangguh, Papua, Indonesia dengan China. Kesalahan besar adalah ditetapkannya harga LNG sebesar USD 2,4/mm Btu dan jangka kontrak dibuat selama 25 tahun dengan batas harga BBM hanya USD 38. Perhatikan: bahwa harga BBM beberapa tahun belakangan ini telah mencapai lebih dari USD 100 dan harga pasar LNG telah mencapai USD 20/mm Btu, tetapinegaratelahdiikattidakbolehmenaikkan harga LNG kendati harga BBM telah mencapai USD 100 atau lebih dalam masa 25 tahun. Proses ini telah merugikan negara sebesar USD 75 miliar atau sekitar Rp700 triliun. Kelihatannya administrasi SBY tidak mengkoreksi dosa besar atau dalam kenyataannya telah melakukan pembiaran. 11. Fenomena negara di dalam negara telah meluas di mana otonomi daerah telah diterapkan kebablasan dan kelihatannya administrasinegaratidakberdayamengatasi masalah ini yang berakibat negara cenderung terpecah belah. 12.Perbuatankorupsiatauperampokan dan penjarahan uangnegaraatauuangseluruh rakyat Indonesia yang merajalela mulai dari desa sampai di tingkat pusat. Administrasi negara terlihat menjadi penonton saja dan malah terlibat dalam kejahatan kemanusiaan yang sangat kejam ini. 13. Dan sangat banyak lagi kegagalankegagalannegaraIndonesiayangberpotensi menjadi kejahatan negara. QuoVadisIndonesia? Mudah-mudahan akan kita kemukakan perkiraannya dalam kesempatan berikut. Penulis adalah Pengamat Ekonomi – Politik Internasional

DPR Versus KPK Rakyat Jadi Wasit Oleh Sofyan Harahap KPK di atas angin.Penggalangan dana yang dilontarkan Wakil Ketua KPK Bambang Wijayanto pun mendapat sambutan luar biasa dari berbagai lapisan masyarakat sebagai tekanan dan perlawanan terhadap penolakan DPR.


barat pertandingan tinju, perseteruan DPR dengan KPK terbilang kelas berat. Yang satu lembaga tinggi negara dan satu lagi lembaga super body. Pasti seru dan menarik perseteruan keduanya, namun siapa pemenangnya masih harus menunggu lama. Tapi, melihat respon masyarakat kelihatan sekali wasit berpihak pada KPK.Yang menjadi wasit di sini tentunya rakyat. Rakyat melihat kinerja KPK patut diberi apresiasi. Dewan Perwakilan Rakyat (DPR) sahsah saja menolak anggaran pembangunan gedung baru KPK (Komisi Pemberantasan Korupsi).Wakil Ketua DPR Priyo Budi Santoso pun boleh saja berkilah, bila pengajuan pendiriangedungKPK disetujuiseharusnya pendirian gedung baru DPR juga harus mendapat persetujuan. Namun kita harap DPR jangan sakit hati jika rakyat mengecam sikap pimpinan dan anggota DPR terhormat. Apalagi kalau sampai rakyat ‘saweran’ mengumpulkan koin untuk pembangunan gedung baru KPK. Jelas pukulan telak ke wajah DPR. Mau dikemanakan muka lembaga wakil rakyat itujikaDPRmenolaktapirakyatmendukung KPK? Sama artinya, DPR tidak berhak lagi mengatasnamakan rakyat karena aspirasi rakyat sudah diselewengkan, tak lagi didengar oleh pengurus dan anggota DPR. Kalau dikaitkan dengan pembangunan gedungbaruDPR yang gagal, tentunya tidak relevan.Sebab,tidakadakaitandenganKPK, kecuali dalam proses pelaksanaannya nanti terdapat indikasi korupsi. Baru KPK masuk. Yang pasti, rakyatlah yang menolak gedung baru DPR sehingga argumen Priyo tidak kuat dengan menyebut, ‘’jika gedung KPK dibangun maka gedung DPR juga harus dibangun.’’ Boleh-boleh saja DPR berargumentasi merekajugabutuhgedungbaru.Sebab,KPK beralasanbutuhgedungbarukarenakondisi gedung lama yang dipakai selama ini sudah over capasity. Kondisinya serupa tapi tak sama dengan DPR yang membutuhkan gedung baru karena jumlah anggota dewan dan pegawainya semakin bertambah banyak berikut tim asistensinya.Tapi, harus diingat. Kalau KPK hanya membutuhkan Rp 200an miliar, sementara DPR membutuhkan dana sampai Rp1 triliun.Ini yang dianggap aneh bin ajaib oleh rakyat. Faktor Dendam Janganlah menyalahkan wasit jika masyarakat beramai-ramai menolak gedung baru DPR dan mendukung gedung baru KPK. Sebab, rakyat berpikir rasional. Lagi pula, rakyat melihat fakta di lapangan bahwa pengalaman empiris menunjukkan citra DPR buruk dengan maraknya kasus korupsi selama ini sehingga lembaga legislatif itu dituding tempat atau sarangnya koruptor. Dengan penolakan DPR atau pemberian tanda ‘’bintang’’ dalam proposal anggaran gedung KPK semakin jelas kalau DPR

tidak senang, dendam, terhadap mitra kerjanya, KPKyang banyak menangkapdan memenjarakan anggota dewan maupun sudah mantan. Hal itu semakin membuat citra DPR semakin buruk di mata masyarakat. Beda dengan KPK yang gagah berani memberantas korupsi, walaupun fakta di lapangan berdasarkan pengalaman empiris pula, masih banyak kasus-kasus korupsi berskala besar belum juga tersentuh hukum sehingga KPK sebagai lembaga super body dianggap lambat, penakut, pilih kasih. Kita sebut saja kasus Bank Century, kasus megakorupsi Wisma Atlet (Palembang)danSportCentreHambalang(Bogor), sepertinya baru menyentuh orang-orang kecil, sementara sang ketua besar, aktor intelektual yang menentukan pemenang tender, bagi-bagi ‘fee’, dan kebijakan sarat KKN sehingga para pelaku seenaknya ‘menilap’ uang rakyat dalam anggaran berpuluhtriliununtukCentury,Hambalang, Wisma Atlet dll. Sampai saat ini belum juga tuntas terkuak alias mengambang. Kemarin Anas sudah dipanggil dan diperiksa KPK sejak pagi hingga malam. Semoga tidak sekadar memeriksa seakanakan KPK sudah menyahuti aspirasi rakyat, tapi sebenarnya yang diinginkan rakyat adalah KPK bekerja lebih agresif sehingga tidaktakutmenetapkansiapapuntersangka utamanya meskipun melibatkan orangorang penting di republik tercinta ini. Banyaknya tokoh partai besar terlibat kasuskorupsidanmerasayakintidakterlibat memang masuk akal. Wajar Anas dll menolak semua sangkaan dalam pernyataan di KPK karena sejak awal sudah melakukan berbagai cara dan trik agar mata rantai keterlibatannya terputus. Sehingga yang diajukan ke pengadilan hanya ‘keroco-keroco’nya. Semoga KPK tidak mudah dikibuli oleh tokoh-tokoh politik berwajah tanpa dosa namun sebenarnya licik berhati serigala. Tidak proporsional Pada hakikatnya kebutuhan dua lembaga—KPK dan DPR— akan gedung baru sama pentingnya, mereka sama-sama membutuhkannya, sehingga seharusnya tidak ada diistimewakan. Yang satu boleh dibangun, sementara yang satu tidak boleh dibangun. Harusnya sama-sama dibolehkan karena memang diperlukan untuk meningkatkan performa kinerja dua lembaga itu untuk menegakkan supremasi hukum dan mensejahterakan rakyat. Kalau KPK boleh, sementara DPR tidak boleh, sepertinya ada diskriminatif. Oleh karena itu diperlukankajianlebihmendalamsehingga hasilnya benar-benar valid dan teruji. Kita menyayangkan alasan DPR menolak gedung baru KPK atau menunda gedungdikaitkandenganefisiensikeuangan negara. Di satu sisi betul, namun di sisi lain, seharusnya DPR bisa membuat skala prioritas. Mana yang lebih mendesak dan

paling banyak mendapat dukungan rakyat seharusnya didahulukan. Kalaupun harus ditunda harus diberi penjelasan alas an penundaannya.Tidak boleh asal tunda tapi harus jelas sehingga dapat diterima masyarakat alias masuk akal. Bukan dengan memberi kode bintang (ditunda/ditahan). Kalau kita melihat dari jumlah dana dan kepentingannya seharusnya gedung KPK bisa diprioritaskan karena cukup proporsional dan mendesak, menyusul nantinya gedung baru buat DPRsetelah dilakukan penghematan dan pemangkasan di sanasini karena menembus triliunan tentunya sangat tidak proporsional sehingga jumlahnyatidakjauhberbedadengangedungKPK. Kalau masalahnya seperti yang terpublikasi di media massa saat ini jelas sekali anggotaDPRtidakmampulagiberpikirlogis bahwabangsakitasaatinilebihmembutuhkan KPK yang kuat sehingga para koruptor harus dibuat tiarap. Sementara posisi DPR tak ubahnya seperti pecundang sehingga wasit tidak punya pilihan untuk berpihak dan memenangkan KPK dengan suara absolut. Memang seharusnya KPK disupport dan jangan ada pihak yang mencoba-coba mengerdilkan KPK, apalagi berupaya mengkriminalisasi KPK. Sebab, KPK-lah satu-satunya lembaga –meski dalam posisi adhoc—yang masih bisa diharapkan memberantas korupsi, masih dipercaya rakyat, sehingga lembaga ini butuh dukungan infrastruktur yang memadai untuk menjalankankan tugasnya melakukan pencegahan dan pemberantasan korupsi. Oleh karenanya salah besar jika DPR menghambat gedung baru KPK, apalagi kalau ingin melakukan intervensi dan melakukan amputasi atas wewenang KPK. DPR seharusnyasadar diri dan tanggap dengan aspirasi masyarakat. Apalagi dengan semakin deras desakan publik membuat saweran lewat donasi koin KPK. Kalau sampai hal itu terjadi, maka DPR akan semakin kehilangan muka. Sebab, donasi dari berbagai elemen bangsa akan mengalirderas.Tidakakanmemakanwaktu lama mengumpulkan dana yang dibutuhkan KPK. Di sinilah diperlukan , keputusan arif dan bijaksana dari pimpinan dan anggota DPR khususnya Komisi-III untuk segera menghapus tanda‘’bintang’’ dalam proposal anggaran yang diajukan KPK. Teknisnya dengan melakukan pertemuan lagi dengan KPK dan pemerintah (Depkeu) sesuai dengan prosedural resmi. Langkah menempuh prosedur resmi yang berlaku di DPR sangat diperlukan sehingga rakyat yang kehidupannya susah tidak dibuat marah dengan sikap arogansi DPR yang semakin anjlok citranya. Kita sangat yakin tidak begitu sulit mengumpulkan dana sampai Rp 200an miliarjikarakyatdansemuakomponenbangsa yang menginginkan KPK semakin kuat mengulurkan bantuannya lewat koin KPK. Tanda-tandanya sudah terlihat dari kesediaan pimpinan KPK dan sejumlah menteri dipotong gajinya untuk gedung baru KPK. Sejumlah aktivis, LSM, sampai seniman ikut menggalang dana buat gedung KPK. Penutup Memang ada efek negatif dan kekhawatiran jika gedung KPK dibangun lewat saweran rakyat dari berbagai golongan.

Dampaknya bisa-bisa akan menghambat kinerjadanindependensiKPK.Apalagikalau mereka yang menyumbang dana besar di kemudian hari setelah gedung terbangun terlibat kasus korupsi.Timbul rasa sungkan KPK untuk memeriksanya. Hal ini perlu dipikirkan matang agar kelak tidak menjadi bumerang dan merusak kinerja serta harapan rakyat. Pertarungan DPR versus KPK masih belum selesai tapi tampaknya start atau ronde-rondeawalsudahdimenangkanKPK. Perhatian media massa, dukungan masyarakat semakin meluas merupakan momentum yang tepat bagi KPK untuk terus mendesakDPRdanpemerintahuntukmenyetujui pengajuangedung baru KPK tanpa harus rebut-ribut. Sangat disesalkan DPR tidak sensitif dan tidak aspiratif. Kini, KPK di atas angin. Penggalangan dana yang dilontarkan Wakil Ketua KPK BambangWijayanto pun mendapat sambutanluarbiasadariberbagailapisanmasyarakat sebagai tekanan dan perlawanan terhadap penolakan DPR. Sampai akhirnya DPRkalahKO,menyerah,danmengakomodir pembangunan gedung KPK. Mindset DPR perlu direformasi: Rakyat kok dilawan, kalau rakyat setuju tidak ada hak individu maupun lembaga DPR mengganjalnya.*** Penulis adalah wartawan Waspada, penerima penghargaan Press Card Number One dari PWI Pusat/Dewan Pers 2012

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Mendagri: Sumut tidak dapat pemekaran - Agak ditahan sikit ambisi * Anas dikabarkan tenang jumpai KPK - Tenang tapi menghanyutkan! * Pemko Medan tidak punya wibawa - Padahal meraih Adipura lo,he...he...he


D Wak


WASPADA Jumat 29 Juni 2012


Flu Babi 15 Kali Lebih Mematikan Dari Yang Pertama VIRUS flu babi, H1N1, 15 kali lebih mematikan dari pertama kali muncul, demikian hasil penelitian terbaru Organisasi Kesehatan Dunia (WHO). Dan tidak seperti flu musiman, penyakit pandemic H1N1 lebih banyak menyerang kaum muda yang banyak tinggal di Afrika dan Asia Tenggara. Bermula di tahun 2009, virus tersebut melanda seluruh penjuru dunia, dan WHO mencatat 18.500 kematian akibat flu babi yang dipastikan dari pemeriksaan laboratorium. Namun, menurut perhitungan baru dari peneliti di Pusat Kendali dan Pencegahan Penyakit AS, virus tersebut mungkin telah menewaskan antara 105.700 dan 400.000 orang di seluruh

dunia untuk tahun pertama saja, dan tambahan 46.000 sampai 179.000 orang kemungkinan meninggal akibat komplikasi kardiovaskular akibat virus tersebut. Kenaikan tingkat kematian tersebut, bukan hal luar biasa. Jumlah korban tewas akibat flu tersebut jelas menggarisbawahi berapa banyak orang tewas akibat virus tersebut, yang se-

benarnya disebabkan karena kebanyakan dokter di seluruh dunia tidak punya waktu atau nara sumber untuk memeriksa virus yang diidap pasien mereka dan melaporkan kasus tersebut ke pihak kesehatan. “Ini masalah dari tahun ke tahun, dari London sampai Nairobi,” kata Dr. William Schaffner, Ketua Medis Pencegahan (CDC) di Pusat Medis Universitas Vanderbilt. “Sangat sulit untuk memeriksa setiap orang yang mengidap influenza.” Masalah tersebut lebih besar lagi di negara yang hanya memiliki nara sumber medis terbatas. “Di beberapa negara, data tentang influenza agak langka atau bahkan tidak ada,” kata Dr. Fatimah Dawood, pelapor penelitian itu. Dan dia mengatakan bahkan meski seorang pasien diperiksa, terkadang virus tersebut tidak terdeteksi.

Penelitian tersebut, yang diterbitkan di jurnal medis The Lancet Kamis (27/6), merupakan usaha pertama untuk memberikan gambaran global tentang berapa banyak kematian yang terjadi pada tahun pertama munculnya pandemic flu babi. Para peneliti lebih terkejut lagi ketika mengetahui sasaran serang virus tersebut. Menurut analisis CDC, 80 persen kematian yang ditimbulkan flu babi terjadi pada orang-orang yang berusia di bawah 65 tahun. Berdasarkan geografi, 59 persen kematian tersebut terjadi di Afrika dan Asia Tenggara. “Potensi kesempatan hidup yang hilang jauh lebih tinggi dibanding yang bisa kita antisipasi ketika terjadi flu musiman,” kata Fatimah. Meski pun virus tersebut mematikan, pandemic flu babi masih dianggap sebagai jenis flu ringan. CDC mengkalkula-

sikan 575.000 orang telah tewas akibat flu babi H1N1 di tahun 2009. WHO memperkirakan flu musiman menewaskan 500.000 orang setiap tahunnya. “Jumlah tersebut memperlihatkan kepada kita betapa besar ancaman penyakit tersebut – bahkan flu paling ringan pun bisa menewaskan lebih dari setengah juta manusia,” kata John Barry, pengarang buku The Great Influenza. Untuk menanggulangi masalah ini, vaksinasi tahunan perlu dilakukan secara serius, menurut CDC. Dan dianjurkan agar setiap orang yang berusia di atas 6 bulan disuntik flu setiap tahunnya. “Hal ini akan mengingatkan kita kapan saatnya kita harus mendapatkan vaksinasi,” kata William. “Itulah langkah pencegahan terbaik yang kita miliki saat ini.” Syafri/YC

9 de Julio Avenue

Jalan Raya Terlebar Di Dunia 9 de Julio Avenue (atau Avenida 9 de Julio, dalam bahasa setempat) merupakan sebuah nama jalan yang terletak di pusat kota Buenos Aires, Argentina. Yang membuatnya istimewa, jalan raya ini memiliki luas yang luar biasa. Ada 9 jalur lebar, dengan median taman antara arus lalu lintas yang berlawanan, ini adalah jalan terluas di dunia. Hanya mereka dengan kecepatan yang lebih dan kaki panjang akan beruntung sampai ke sisi lain sebelum lampu lalu lintas di persimpangan berubah merah. Seorang pejalan kaki yang ingin menyeberang jalan ini biasanya memerlukan waktu beberapa menit dan rotasi lalu lintas 2 hingga 3 kali pergantian lampu merah. Jalan 9 de Julio Avenue hanya terbentang sepanjang 1 km, tapi lebarnya mencapai hingga 110 meter!. Lebar jalan yang tidak biasa itu karena mencakup blok seluruh kota, jarak antara dua jalan dalam pola kotak-kotak yang digunakan di Buenos Aires. Jalan ini terletak di sebelah barat pantai Río de la Plata,

dari distrik Retiro di utara ke stasiun Constitucion di selatan. Jalan raya di tempat ini memiliki hingga tujuh jalur di setiap arah dan di kedua sisinya diapit oleh jalan-jalan paralel dari dua jalur masing-masing. Arus lalu lintas di jalan ini jauh di kedua arah dan menghubungkan bagian-bagian unik dari metropolis. Beberapa landmark utama Buenos Aires ‘dapat dilihat di sepanjang jalan; yang paling menonjol, Obelisk, yang berada di tengahtengah 9 de Julio, Kedutaan Besar Perancis , patung Don Quixote, Colon Teatro dan bangunan mantan Menteri Komunikasi - bangunan yang berada di jalan itu sendiri di persimpangan jalan dengan Moreno. Jalan pertama kali direncanakan pada 1888, dengan nama Ayohuma, tetapi proyek pembangunan jalan ini sudah lama ditentang oleh pemilik tanah yang terkena dampak penggusuran, sehingga pekerjaan proyek molor dikerjakan sampai tahun 1935. Bahkan pemerintah Perancis menolak untuk menyerahkan gedung kedutaannya untuk dibongkar,

JALAN 9 de Julio Avenue terbentang sepanjang 1 km, tapi lebarnya mencapai hingga 110 meter!.

PERKEMBANGAN aktivitas bisnis yang makin meningkat membutuhkan perangkat teknologi pelayanan finansial cerdas.

Perkembangan Teknologi Pelayanan Keuangan Cerdas PERKEMBANGAN teknologi baru tidak pernah berhenti termasuk penemuan baru di bidang pelayanan finansial yang mengalami perubahan radikal selama beberapa tahun belakangan ini. Baik yang namanya teknologi pembayaran, menabung , meminjam ataupun menginvestasi uang memiliki perubahan teknologi yang dramatis. Dimulai dengan fungsi dasar perbankan yaitu penyimpanan dan penarikan uang, mesin teller otomatis mengalami revolusi besar di bank-bank seluruh dunia dengan memperkenalkan kemampuan untuk menghasilkan transaksi perbankan yang mudah dan cepat, kapan dan dimana saja. Teknologi mobile banking sekarang menyuguhkan akses pelayanan perbankan dengan mudah di mana saja. Mendepositokan satu cek saat ini tidak lagi repot-repot harus pergi ke bank cukup saja dipoto melalui ponsel via aplikasi bank. Sistim pem-bayaran NFC merubah ponsel menjadi dompet yang dapat membayar transaksi anda dengan hanya satu sentuhan. Teknologi pembayaran baru dari perusahaan-perusahaan seperti Square mengurangi pengeluran dana tambahan bagi para pelaku bisnis dan memungkin-kan orang-orang di dunia bisnis untuk menerima dan menggunakan berbagai bentuk teknologi pembayaran baru yang memudahkan transaksi bisnis. Sekarang bisnis-bisnis lebih kecil juga memiliki perangkat untuk berkembang tanpa memperdulikan transaksi volume perdagangan mereka dan tanpa ada biaya tambahan apapun. Penetrasi kartu kredit dan debit dengan mudah menggunakan teknologi yang mampu membuka pemasanran baru untuk industri proses pembayaran selama 50 tahun.

Teknologi sedang membantu mendemokrasikan investasi di seluruh dunia, menambanh akses pemasaran tanpa kekayaan substansial atau koneksi dan meyuguhkan peningkatan likuditas aset-aset perdagangan. Perusahaan seperti Second Market dan Sharespost menciptakan pemasaran efisien untuk aset yang tidak mudah diuangkan seperti saham perushaan pribadi, klaim kebang-krutan dan keamanan yang dipahami dan diketahui orang-orang tertentu saja. Sementara itu BATS menyatakan bahwa teknologi superior memungkinkannya untuk berkompetisi secara efektif dengan lembaga bisnis bergengsi seperti NYSE dan NASDAQ yang mempertaruh-kan 11 persen kewajaran perdagangan diberlakukan di Amerika Serikat pada basis harian melalui Bats Exchanges. Lending club menggunakan teknologi untuk menganggu pinjaman konsumer yaitu satu fungsi inti bank yang berubah pada beberapa dekade belakangan ini. “ Platform kami menggunakan teknologi untuk menghubungkan kreditor dengan investor guna memulai pinjaman awal, mengurangi ongkos untuk para kreditor dan merangsang pengembalian investasi melalui bank. Penggunaan teknologi pintar dan pemakaian teknologi canggih pada banyak proses perbankan memungkinkan Lending Club untuk beroperasi dengan pembayaran lebih murah daripada bank. Platform kami telah memfasilitasi 20.000 konsumer peminjam tahun ini dengan pekerja yang kurang dari 100 orang. Perusahaan-perusahaan pelayanan finansial cerdas mengambil keuntungan dari revolusi pemasaran,” jelas eksekutif Lending Club. Nurhayati Baheramsyah/cnn

Pria Jujur Kembalikan Uang 13.000 Dolar Ditemukannya 80 Juta Orang Percaya Keberadaan UFO Di Tong Sampah SEBANYAK tiga puluh enam persen warga Amerika (AS) atau sekira 80 juta orang percaya mengaku percaya akan keberadaan UFO atau mahluk asing. Dan sepersepuluh diantaranya percaya bahwa mereka pernah melihat benda angkasa berupa Piring Terbang itu, dikatakan jajak pendapat National Geographic baru-baru ini. Sementara tujuh belas persen diantaranya mengatakan tidak percaya adanya UFO (Unidentified Flying Objects), dan hampir setengah dari mereka yang disurvei mengatakan kurang yakin. Mungkin disebabkan cerminan iklim politik saat ini, diduga ada keraguan terhadap pemerintah - hampir empat-perlima dari responden mengatakan mereka percaya pemerintah telah menyembunyikan informasi tentang UFO dari publik. Survei ini dibuat untuk menyongsong tayangan terbaru National Geographic Channel bertajuk “Mengejar UFO”, dan Brad Dancer, wakil presiden se-

dan preservationists lokal menentang langkah itu juga, karena bangunan secara luas dipuji sebagai suatu maha karya arsitektur. Tahap awal diresmi-

kan pada tanggal 9 Juli 1937 dan bentangan utama dari jalan selesai pada 1960-an. Koneksi selatan diselesaikan setelah tahun 1980, ketika bagian pusat kota

Ilustrasi UFO nior untuk penonton dan pengembangan usaha National Geographic mengatakan hal ini tidak tidak untuk diseriusi. Para responden ditanyai apakah Presiden Barack Obama atau Mitt Romney yang merupakan penantang dari partai Republik akan menangani invasi asing lebih baik (Obama memenangkan 65 persen dalam kon-

tes itu) dan superhero mana yang akan panggil untuk menghalau invasi asing (Hulk, Batman,Spider-Man). “Kami mencoba untuk bersenang-senang sedikit dan melihat apakah referensi budaya pop telah berdampak pada kepercayaan masyarakat,” kata Dancer. “Ini dimaksudkan sebagai survei menyenangkan da-

ri opini publik.” Ia menambahkan, industri film Hollywood mungkin memberi kontribusi meyakinkan keberadaanUFO-yangdimilikioleh 55 persen orang Amerika, menurut penelitian - bahwa petugas bergaya ‘Men in Black’ mengancam orang yang melaporkan penampakan UFO. Saat film yang menggambarkan

Tablet Google Nexus 7 Berkisar Rp2 Jutaan GOOGLE resmi meluncurkan “produk pembunuh” iPad Apple, yaitu tablet Nexus 7. Tablet dengan ukuran layar 7 inci ini dibuat oleh Asus dengan hargapasaranmencapaiUS$199atau sekira Rp2 jutaan. Tablet ini siap dijual pada pertengahan Juli. Google berharap tablet ini akan mengalahkan iPad. Tablet ini juga siap bersaing dengan tablet Microsoft Surface yang dibuka pekan lalu. Tablet Android unggulan Amazon, Kindle Fire, juga siap dihajar. Tablet Google ini akan tersedia dalam dua versi. Anda bisa memilih ukuran penyimpanan 8GB seharga US$199 dan 16GB senilai US$249. Sebagai perbandingan, iPad terbaru dengan layar 9,7 inci dibanderol US$399 untuk kapasitas 16GB.

“Sudahselalumenjaditujuan program Nexus untuk menyediakan pengalaman terbaik. Kami ingin merancang kenikmatan pengalaman penggunaan Google terbaik,” ujar Direktur Managemen Produk Google, Hugo Barra. “Nexus 7 dibuat untuk Google Play. Konten Anda menjadi terdepan dan terpusat,” imbuhnya seperti dilansir dari Daily Mail. Perangkat terbaru ini memiliki tampilan HD 1280x800. Bagian dalam ditunjang dengan chip quad core Tegra 3 dengan prosesor grafis 12 core. Beratnya hanya 340 gram. Menurut Google, tablet ini bisa memutar video selama 9 jam hanya dengan sekali pengisian daya baterai. Google berharap dengan ukuran yang lebih kompak, Ne-

xus 7 akan menangkal popularitas iPad. Menurut Gizmodo, Nexus 7 berukuran 198,7 x 120 x 10,45mm. “Tablet ini memiliki portabilitas seringan bungkus kertas. Ini juga didukung penyimpanan komputasi awan,” ujar pihak Google, Chris Yerga. Nexus langsung memberikan Android versi terbaru, Jelly Bean. Sebagai dukungan, Nexus sudah ditanamkan CPU quad core 1,3GHz dan RAM 1GB. Teknologi terkini NFC juga sudah siap di dalamnya. Anda pun bisa menggunakan kamera depan 1,2MP untuk konferensi video. Google mengatakan ada 600.000 aplikasi Android tersedia

di toko konten Google Play. Perusahaaninijugaakanmulaimenjual film, program TV, dan majalah. Menurut Google, versi terbaruAndroidJellyBeanjauhlebih cepat dibanding versi sebelumnya. “Jelly Bean menyimpan begitu banyak peningkatan. Kami menyentuh setiap sisi Android,” ujar Barra. (vvn/rzl)

dari sistem kondisi jalan tol selesai. Kliring hak untuk persimpangan ini mendapat kecaman besar di daerah Constitucion. (net/rzl)

alien menjadi semakin nyata,itu dapat mempengaruhi sikap masyarakat, katanya. Jumlah warga AS semakin banyak yang percaya bahwa Bumi bukan satu-satunya planet dalam kehidupan alam semesta, katanya. Hasil penelitian menunjukkan bahwa 77 persen warga AS percaya ada tanda-tanda bahwa alien telah mengunjungi Bumi. Saat penelitian dapat digunakan sebagai amunisi oleh minoritas vokal penggemar UFO, Dancer mengatakan bahwa ia menyerahkan kepada publik tentang anggapan pasti dari definisi UFO.“UFO tidak selalu berarti pesawat angkasa mahluk asing,” katanya. “Ada hal-hal yang tidak dapat dijelaskan. Mereka ini menarik karena tidak merupakan rahasia... Orangorang suka misteri.” Studi yang dilakukan oleh perusahaan jajak pendapat Kelton Research, menemukan bahwa lebih banyak lagi warga Amerika yang percaya film “The X-Files” mewakili apa yang akan terjadi jika alien menginvasi bumi daripada film lainnya. Studiini,dimanasampelacak dari 1.114 orang Amerika berusia 18 yang disurvei, juga bertanya apa yang akan mereka lakukan jikaaliendatangkeBumi.Hampir seperempat res-ponden mengatakan mereka akan mencoba berteman dengan makhluk luar angkasa, 13 persen mengatakan mereka akan mengunci diri dalam ruangan, dan hanya satu dari 20 orang mengatakan mereka akan “mencoba untuk melakukan kekerasan fisik.” Angka-angka tersebut tidak mengejutkan peneliti UFO kawakan David MacDonald, direktur nirlaba Reksa Jaringan UFO, yang mengatakan ide kontak dengan makhluk luar angkasa telah menjadihalbiasadalambeberapa dekade terakhir.“Kami telah berkembang dengan‘StarTrek’,‘Star Wars’ dan ‘Battlestar Galactica,’” kata MacDonald. (yahoo/rzl)

KETIKA Kenneth Allen mengambil tas kertas yang terdapat di atas tong sampah di luar satu toko di Tennessee, dia menemukan dua hal: satu botol colonye (pengharum tubuh) dan uang tunai yang jumlahnya hampir 13.000 dolar. “Ketika melihat uang itu, tidak sedikit pun terbersit di hati saya untuk mengambilnya, karena perbuatan tersebut tidak baik,” kata Allen (foto) kepada televisi Fox4 KC tentang uang sejumlah 12.764,73 dolar yang ditemukannya di tong sampah tersebut. Allen sedang di toko Peachers Mill Road pada Sabtu sore bersama istrinya, Kristy, ketika mereka melihat tas tersebut. Suratkabar Leaf Chronicle menambahkan, kedua pasangan itu, yang singgah di toko tersebut untuk membeli krim soda, langsung menyerahkan uang tersebut ke kantor polisi Clarksville, yang kemudian mengembalikan uang tersebut kepada pemiliknya. “Dalam hati, saya bertekad mengambalikan uang itu karena berpikir mungkin orang tersebut sangat membutuhkan uang itu untuk sesuatu yang amat penting.” Rekaman video pengawas dari toko tersebut memperlihatkan pria tersebut yang berhenti di luar toko tersebut untuk membuka roti lapis dan es krim sebelum

meninggalkan tas kertas berisi uang tersebut di atas satu tong sampah. Pemilik uang tersebut adalah seorang pria berusia 51 tahun yang tanpa sengaja meninggalkan uang tersebut setelah keluar dari rumahsakit akibat mengalami reaksi berlawanan dari obat yang diterimanya dari dokter. Meski polisi tidak menyebutkan nama pria itu, mereka mengatakan dia sudah menghubungi Allen untuk mengucapkan terimakasih. “Ketika dia menelpon, saya Tanya “Kenapa Anda punya uang sebanyak itu?” kata Allen kepada ABC News. “Dia tidak menjawab pertanyaan saya itu, namun dia mengatakan dia sangat berterimakasih uang itu

dikembalikkan, dan sangat senang karena kami yang menemukannya.” Allen, yang baru-baru ini pension dari militer dan berencana mulai mengajar matematika di satu sekolah menengah atas pada tahun ajaran baru, mengatakan dia senang uang tersebut akhirnya diterima pemiliknya. “Mungkin jika orang lain yang menerima uang itu, mereka sudah menghabiskannya untuk pesta,” katanya. “Syukurlah, kami yang ditakdirkan untuk menemukannya,” kata Allen. Itulah tipe manusia jujur yang sangat jarang bisa ditemui saat ini. Setuju? Syafri/YC


Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Ar-Ridho Jl. A.R. Hakim Gg. Sepakat No. 6 Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Makmur Jl. A.R. Hakim Gg. Langgar/Bahagia No. 25 Al-Manar Jl. Laksana No. 47 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Al-Utaminiyah Jl. Utama Gg. H. Syukur No. 1 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jami’ Darul Ikhlas Jl. Batu No. 13 Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. B-A T.S. III Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Dr. Sun Yat Sen No. 71 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl.Denai Gg. Pinang No. 12 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gang I No. 2 Silaturrahim Jl. Emas No. 10 Silaturrahim Jl. Bromo Gg. Silaturrahim No. 11 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Jl. Puri Komplek Masjid Taqwa No. 183 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Drs. Ibnu Hajar Harahap Drs. H. Nurman Almi Drs. H. Hamid Mashudi H. Darwin Zainuddin, Lc, MA Son Haji Harahap Drs. Mahmuddin, MA Usman Abdillah, S.Pd.I Ibrahim Taufik Al Hafiz, S.Pd.I Aljuheri Lubis, S.Ag Drs. H. Irwansyah Putra, MA Drs. H.M. Salim Drs. M. Yusuf As’ady H. Hamdan Indra H. Surianda Lubis, S.Ag K.H. Khaidir Abd.Wahab, Lc, MA Aslam Umar, S.Ag Mukhlis Mukhtar, S.HI, S.Pd.I Drs. H. Abdul Sani Sinaga Rusydi Ahmad Irwan Syahputra, S.Ag, MA Drs. Suid Alam, S.Pd.I M. Ikromal Walad, S.S. H. Arif Muhammad Erde, MA Drs. H. Legimin Syukri Suharsono, Lc H. Burhanuddin Nur, Lc Drs. H. Eri Adlin Rusdi, A.R. H. Hamdani Nur, Lc Drs. Masaluddin Berutu Mex Zainis Caniago Drs. Sutikno Pahmi Drs. H. Lukman Hakim, M.Pd Drs. Efnedi Arif, MA Drs. Tukiman

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Kel. Harjosari II Al-HidayahMapolda Sumut Jl.S.M. Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I Kel. Harjosari II Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Al-Muqorrobin Aspol P.Merah Jl. Raya Medan Tenggara Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Ikhlashiyah Jl. Garu-I No. 69 Kel. Harjosari-I Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ridho Shobirin Jl. Garu IV Harjosari I Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VI Kel. Harjosari I Shilaturrahim Jl. Garu III No. II-G Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II Raya Taqwa Jl. S.M. Raja Km. 5,5 No. 1 Kel. Harjosari-I Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1-B Tarbiyah Lingk. I Kel. Siti Rejo II

Mukhyanuddin, S.Pd.I Drs. H.E. Brata Madya, M.SI Jamaluddin Sitorus, BA Sofwan, S.Pd.I H. Hanafi, Lc, MA Drs. Zulkifli Nasution Drs. Suhardi Harahap Drs. Sarawi Muhamjiz Drs. H. Hamdan Yazid, MA Drs. H. Syahrul Effendi Siregar Rahmat Hidayat, MA Muhammad Rahim, S.Pd.I M. Ramadhan Lubis, S.HI Drs. H. Abdul Razak M. Yusuf Siregar Drs. H.Efendi Sadli, SE, MA M. Dhobith Azhary Lubis Parlaungan Nasution, S.HI Drs. H. Ramli, A.T. H.M. Yusri Indra, Lc Ruskan Nawawi Drs. H. Khudri Lubis Muhammad Rahim, MA

MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30-A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Iklab Jl. Letjend. Jamin Ginting Km. 1,27 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede 42 Nurul Huda Jl. K.H.Wahid Hasyim Asrama Brimob

Drs. H. Syakira Zandi, M.SI Prof. DR. H. Syahrin Hrp., MA H. Daud Sagita Putra, MA H. Sugianto, Lc Robie Farenza, S.Ag Drs. Dani, N.S. Khamidal Wirya, S.Ag Drs. H. Ahmad Suhaimi, MA Usmar Chan Parlaungan Nasution, S.HI

MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 15 At-Taqwa Jl. Putri Hijau No. 14 Asy-Syafiah Jl. Karya Dalam (Depan kantor Lurah) Al-Furqan Jl. Karya 2 Lingk. XI Kel. Berombak Al-Jihad Jl. K.M. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Massawa (Arab) Jl. Temenggung No. 2-4-6 Al-Wiraji Jl. Karya Gg. Sosro Lingk. XVI Kel. Karang B. Baitus Syifa Jl. Putri Hijau Rumah Sakit Tembakau Deli Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Muslimin Jl. Karya Lingk.XVII No.41 Karang Berombak Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Nurul Haq Jl. Listrik No. 12 Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Syuhada Komplek Trikora Jl. Danau Toba No. 2 Taqwa Jl. Karya Gg. Madrasah No. 24

Baharuddin Drs. Azrai Nasution Alwi Sungkar Rasoki Batubara Drs. Muhd. Yamin Lubis Drs. H. Muchlis Nasution DR. H. Ahmad Zuhri, MA Drs. Fakhrurrozi Pulungan Ahmad Syafi’i Harahap, MA Rawoqi Batubara Jumanah Nasution, S.Ag H.M. Nasir, Lc, MA H. Khairuddin, Lc Drs. H. Yahya Zakaria Syamsuddin, SH H. Iqbal A.Muin, Lc, MA Drs. Jannah Siregar Drs. H. Hasrat E.Samosir, MA

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan

H. Ishak Naharuddin

MEDAN DELI Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Abraar Jl. K.L. Yos Sudarso Titi Papan Al-Iklas Jl. Alumunium II Lingk. XII Tg. Mulia Al-Jihad Jl. Mangaan I/Jl. Bahagia Raya Lingk. VI Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Jam’iyyatush Shoolihin Kel. Tg. Mulia Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia

Suwardi, S.Ag Iqrar Anshori, S.Pd Arwinsyah Drs. H. Sarbaini Drs. H. Zakaria Rasidi Waizul Qorni, MA H. Sabaruddin Sit, S.Ag Supriadi R., S.Pd.I Muhammad W. Wahid Sarman Drs. Nurtuah Tanjung Nurhadi

MEDAN DENAI Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Drs. H. Abd. Jalil Syah, Lc Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala Drs. H. Manaon Batubara Al-Amanah Jl. A.R. Hakim Gg. Aman No. 90 Kel. TSM. Drs. Syahrial, AS Al-Ansor Jl. Raya Medan Tenggara Gg. Anshor No. 11 Hasan Basri, S.Ag Al-Hidayah Jl. Menteng Indah VI Kel. Medan Tenggara Mulkan Lubis Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Drs. H. Bahauddin Nst., Lc Al-Hasanah Perumnas Mandala Drs. Darfikri Al-Muslimin Jl. Kenari XII Lingk. VII-VIII Per. Mandala Drs. A. Yani Kisno Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Drs. Najamuddin Hutapea Al-Mukhlishin Jl.Enggang I Perumnas Mandala Drs. H. Syahminan Hasibuan Al-Quba Jl. Rawa Kel. Tegalsari Mandala II Sudirman, MA Al-Ridha Jl. Jermal VII Drs. Ahmad Suhaemi, MA Baiturrahman Jl. Medan Tenggara VII No. 42 Drs. Helmi Walid, MA Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Drs. Muhammad Azizi Hijraturridha Jl. Selamat Ujung Gg. Subrak Sp. Limun H. Nano Wahyudi, Lc Nurul Islam Jl. M. Nawi Harahap H. Baharuddin Ahmad, SH Nurul Iman Jl. Rawa I Lorong Sedar Drs. H. Sampurna Silalahi Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Zuchrawardi Nst., S.Ag, MA Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Arwansyah, SP. Taqwa Jl. Jermal III No. 10 Armansyah, SE, MM Taqwa Jl. Pancasila Gg. Masjid No. 1 Kel.T.S.Mandala III Drs. H. Ibnu Hajar Harahap MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia Drs. H.M. Saleh, Lc

An-Nur Jl. Budi Luhur No. 75-A Ja’far Hasibuan Ar-Raudhah Jl. Persatuan No. 22-AR Helvetia Timur Eriyanto, S.HI As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Drs. Faisal Lubis Al-Falah Jl. Palem Raya Perumnas Helvetia Talkisman Lubis, S.Pd.I Al-Huda Jl. Balai Desa/Beringin V No. 116 Kel. Helvetia Drs. H. Irwan Sulaiman Lubis Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Drs. Hasanul Arifin Al-Hasanah Jl. Setia No. 41 Tg. Gusta Drs. H. Mahyuddin Nst., MA Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Drs. Muksin Nasution Al-Ikhas Jl. Teratai II Blok 18 Perumnas Helvetia Drs. Fahmi Ilham Al-Ikhlas Jl. Jongkong Komplek Dolok Sumut Nasrul Al-Ikhlas Jl. Setia Luhur No. 180 Lingk. XI Dwikora Affan Suadi, MA Al-Mustaqim Jl. Kapten Muslim No. 226 Damri Tambunan, S.HI, S.Pd.I Al-Mukhlisin Jl. Bakti Utara No. 21 Lingk. VI Kel. T.Gusta Bustami, H.S. Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Qori Ananda, S.Pd Al-Masturah Jl. Binjai Km. 7,8/Jl.Sekolah No. 29 Drs. Mahyudin Darussalam Jl. Asrama No. 11 Drs. H. Raden Taufiq Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Mara Susun Harianja Istiqomah Jl. Amal Luhur No. 86 Kel. Dwikora H. Harianto Effendi Tjut Nyak Dhien Jl. Gatot Subroto/Jl. Rasmi No. 28 Ahmad Tamrin S., MA Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah Drs. Dalail Ahmad, MA Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadomo Drs. Abd. Sani Nasution Taqwa Jl. Kapten Sumarsono Gg. Safar Akmal Fikri Taqwa Jl. Kamboja Raya No. 319 Blok 4 Perum Helvetia M. Ridwan Hisda Taqwa Jl. Setia No. 30 Tg. Gusta Drs. Kholidin Musa Taqwa Jl. Asrama No. 14-P Sei Sikambing V-II Surianda Lubis, S.Ag MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Parsaulian Siregar, Lc Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Azman, S.HI, S.Pd.I Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Drs. H. Zulham Batubara, MBA Annazhirin Jl. Karyawisata Kel. Gedung Johor Drs. H. Darwansyah Simanjuntak Ar-Raudhah Komplek Risva I Blok V Kel. Gedung Johor Drs. H. Zahiruddin Nst., MA Assyafi’iyah Jl. STM - Suka Tari No. 9 Kel. Suka Maju Drs. H. Akhdar Bunayya Al-Amin Jl. Eka Surya Gg. Eka Kencana Gedung Johor Ahmad Fuad, S.HI Al-Badaar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Drs. Sariman Al Faroq, MA Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Sofwan Harahap, S.Pd.I Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur M. Ihsan, S.Pd.I Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Budiman Tanjung, S.Pd.I Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Budiman, S.Ag Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Drs. H. Syamsul Basri Tamar Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Drs. H. Yahya Tambunan Al-Ikhlas Jl. Karya Kasih Baru Lingk. X Kel. P. Masyhur Fahrurrazi, S.Pd.I Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor H.M. Yusri Indra, Lc Al-Muslimin Jl. Suka Luhur DR. H. Syarbaini Tanjung, MA Al-Muharram Jl. Eka Budi Kel. Gedung Johor H. Aminuddin Lubis, SH Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Drs. H. Idris Yusuf Al-Mukhlisin Jl. Karya Sehati No. 14 Kel. P. Masyhur Syahruddin Ritonga, S.Pd.I Al-Muhajirin Komplek Medan Permai Drs. Ahmad Yani Al-Mustafa Jl. Karya Jaya Gg. Karya XII-XIV H. Abdul Aziz Rangkuti, S.Ag Baitul Iman Jl. Karya Jaya Asrama Arhanudse II/BS Drs. Parlindungan Nasution Baiturrahmah Jl. Karya Jaya No. 101 Pangk. Masyhur Drs. Yusuf Marpaung Fajar Ramadhan Perumahan Johor Indah Permai II Drs. H. Zulham Effendi Batubara Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Drs. A. Gazali Rangkuti Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Rustam Hasibuan, S.Ag Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Drs. H. Salahuddin Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Drs. H. Ismail Dahban Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Ismail Hasyim, MA Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala H. Abdul Jamil Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Drs. H. Khairuddin Siregar Sholihin Jl. Karya Jaya No. 160-G Gedung Johor Ismail Nasution, S.HI MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Huda Jl. Kemiri III No. 28 Simpang Limun Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Al-Muttaqin Jl. Amaliun/Panduan Tenaga Gg. Tengah Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Ridho Bakti Jl. Air Bersih Lingk. IX, Kel. Sudirejo-I Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7 Yayasan Zending Islam Indonesia Jl. SM. Raja No. 11-A

Drs. H. Muhyiddin Masykur Drs. Mulkan Daulay Drs. H. Ramli A.T. M. Khairul Munady Siregar, S.HI Baharuddin H. Khairul Hamdi, Lc Abdul Aziz, S.Pd.I H.M. Arsyad Ibrahim Drs. Masaluddin Brutu Drs. Agus Rizal Koto Abdul Majid, S.HI DR. H. Syafi’i Siregar, MA H. Amrin Siregar Drs. Zailani, S.Pd.I Drs. H. Mar’i Batubara Drs. Syahril Samidi Yasma, S.Ag, M.Pd M. Nurdin H. Abd. Muthalib Usba Anwar Shaleh, S.Pd.I

MEDAN LABUHAN Al-Amal Jl. Banten Gg. Amal No. 170 Dusun IX-A M. Syukri Al-Bani, MA Al-Husain Jl. Jala Raya Griya Martubung Drs. H. Syamsul Bahri Al-Mukarramah Kampung Besar Darat Kel. Martubung Jama’uddin Miraza Baitul Ikhwan Jl. T. Lestari 12/9198 Blok V Gr. Martubung Drs. Baihaqi Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Zulfikar Husni, S.Pd.I Raya Al-Osmani Labuhan - Deli Gazali Umar, BA MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Aur Jl. Brigjen Katamso/Kp. Aur Lingk.IV Kel. Aur Jami’ Jl. Brigjen Katamso Gg. Mesjid No.53 Nurul Muslimin Jl. Juanda (bundaran) Kel. Jati

Abdul Aziz, S.Pd.I H. Burhanuddin Noor, Lc H. Sugianto, Lc Drs. Hasan Muin Ahmad Syafi’i Harahap, S.Ag Mashur Utama Hsb., S.Pd.I Ahmad Supriadi, M.Ag Usman Siregar, S.HI

MEDAN MARELAN Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Marelan

Suhaimi, S.HI Drs. H. Mhd. Yusril Fuad, MA Mhd. Hasbi, S.Pd.I Drs. H. Syamsuddin Amin Drs. Sairin

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Drs. Borkat Harahap Ar-Rahman Jl. Prof. H.M. Yamin SH No. 363 Drs. Syahman Hasibuan Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Abdul Mutholib, M.Ag Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Drs. H. Makmur Situmorang Ar-Ramlah Jl. Sejati No. 16 Drs. Ali Suti Al-Amin Jl. Prof. H.M. Yamin SH, 482 H. Raden Syafi’i, SH, M.Hum Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Drs. Sangkot Nasution Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 03 Drs. H. Sariman Al-Faruq Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir H. Mar’i Muhammad, S.HI Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Drs. H. Mustamir Mtd., Lc, MA Al-Hurriyah Jl. M. Yakub No. 17 Edy Sahputra Siregar, S.HI, MA Al-Huda Jl. Malaka No. 117 Drs. H. Abdul Rahman Kasbi Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Drs. Ngadimin, K.R. Al-Muslimin Jl. Gerilya No. 1 Irwansyah, S.HI Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Drs. Tenerman Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Drs. Ibrahim Nor Ikhwaniyah Jl. M. Yacub No. 3 Nirwan Mtd., S.Sos.I, S.Pd.I Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Lukmanul Hakim, S.Pd.I Ikhlashiyah Jl.Sei Kera No. 314 Kel. Sei Kera Hulu Drs. H.M. Sinambela Istiqomah Jl. Bambu Runcing/Pahlawan Drs. H. Muhiddin Gurning Jamik Al-Ikhwan Jl. H.O.S. Cokroaminoto Kel. S.K.Hulu Hartono, S.Sos.I Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Drs. H.M. Mansur Azis Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Drs. Effendi Rambe Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syafi’i, S.Ag Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Drs. Sofyan Lubis Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Agusman Damanik S.Ag Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat DR. Faisar Ananda A., MA Taqwa Jl. Karantina Ujung Asrama TNI-AD Glugur Hong Drs. Ahmad Harahap

WASPADA Jumat 29 Juni 2012

MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Annas Kompleks Diskes Jl. Ibus Raya/Jl. Rotan Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Setia Al-Mukarram Jl. Sikambin Gg. Patimura No. 9 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

Baringin Siregar, S.Ag Drs. A. Majid Drs. Muhammad Ansari, M.Ag Drs. Zulkifli Drs. Mahyuddin Nasution, M.Ag Warto Drs. H. Juanda Sirait Drs. Syukri Asda Nasution Drs. H. Irwansyah Putra Badu Amin Nasution, S.Ag M. Ansar Batubara, S.Pd.I DR. H. Abdullah Jamil, M.SI Khairun Nazri, S.Pd.I H. Syamsul Anwar A., Lubis

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Assakinah Jl. Polonia (Starban) Komp. Perum TNI-AU Al-Hidayah Jl. Komodor Udara Adi Sucipto Polonia Al-Hidayah Jl. Starban Kel. Sari Rejo Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Bakti Jl. Mongonsidi I Baru No 11 Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 Dirgantara Lanud Jl. Imam Bonjol No. 52 Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Hanudnas III Polonia Komp. Kantor Hanudnas TNI-AU Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

Suherwin, Sos.I H. Ahmad Faisal Nst., S.Ag Rustam Efendi Hasibuan, S.Ag Suriadi, S.Ag Drs. Juraid, BA Drs. H. Syahrinal Azhar Lubis Drs. K.H. Amrin Siregar Drs. H. Abidin Azhar Lubis Ramadhan, S.HI Ahmad Faisal Nasution, MA M. Syukur Dalimunthe Drs. H. Ismail Malik

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. H. Sanadi Sitorus Al-Amri Jl. Nusa Indah Asam Kumbang Drs. H. Nazaruddin Hasibuan Al-Furqon Jl. Setiabudi Pasar I Tanjung Sari Drs. H. Basyaruddin Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV H. Abdul Mun’in, S.Ag, M.Ag Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Drs. Edi Purnomo Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Sugito Kelana, S.Ag Al-Ikhlas Pasar 7, Padang Bulan H. Suparman Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Drs. Legimin Sukri Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan M. Aminuddin, S.Pd.I Al-Muhtadun Jl. Karya Sembada No.179 Komp.Koserna Drs. H. Zahirudin Nasution Al-Munawwarah Jl. L.Putra No. 19-A Komp. Kejaksaan Drs. Ahmad Fauzi, M.Ag Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Drs. H.M. Nur Hasibuan Jami’ Jl. Pasar I Lingk. VIII Kel. Tg. Sari Drs. H. Nazaruddin Hasibuan Muslimin Jl. Setia Budi Kel. Tg. Sari Drs. H.M. Syafruddin Nurul Iman Kompl. Perhub. Jl. Penerbangan No. 77 Sariman Al Faruq Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan M. Juraidin Pinem Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan Mujiman Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Drs. Sarifuddin Sinaga Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. Abd. Wahab Kalimantan Salamiyah Jl. Bunga Kesuma No. 50-D Kel. P.B.S. II Drs. Lisman Lubis Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 H.M. Yahya Taqwa Kampus II UMA Jl. Setia Budi No. 79-B Dr. Sulidar, MA Taqwa Jl. Abdul Hakim No. 2 Pasar I Kel. Tg. Sari DR. Ali Imron Sinaga, MA MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei.S. Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Basyir Jl. Garuda No. 78-B Sei Sikambing-B Al-Badar Jl. Binjai Km. 6,8 Medan Al-Falah Jl. Murni No. 27 Kel. Tanjung Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Jihad Jl. Sunggal No. 129 Al-Mukhlisin Jl. Darussalam/ Sei Rokan No. 2 Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Muhajirin Jl. Perwira No.18-A Kompl. Pondok Karya Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Dermawan Jl. Rajawali No. 19 Sei Sekambing-B Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Isti’adah Jl. Amal No. 4 Kel. Sunggal Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Raudotussuffah Jl. Pinang Baris Kel. Lalang Riyadhussholihin Jl. Sunggal No.198 K.S.Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km. 13,7 Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Taqwa Sugeng Rejo Cabang Sei Sikambing-B

Buliyan Malfa Purba, S.HI Buyung Syafruddin Syamsul Arifin, SH Drs. H.M. Nasib Selmi Mahyuddin Siregar, S.Pd.I Drs. H.M. Azhar Drs. A. Yani, M.S. Eden Herdani Amir Panatagama, S.Pd.I M. Ridwan, S.Pd.I Abd. Rahman Drs. H. Adlan Sirait Zulhaidir Drs. Puji Rahmadi, MA Drs. Khalidin Musa Azhar Arifin, Lc Dr. Syafi’i, Siregar Drs. Hasanul Arifin H. Sudirman, Lc Drs. Ardiansyah Prof. H. Asmuni, MA Khairul Harahap, S.Pd. M. Ridwan, S.Pd.I Prof. DR. Ir. H. Basyaruddin, M.S. Drs. H. Legimin Syukri M. Khumaini Hamyar Drs. Khatim Hasan Drs. Isman Rambe Drs. M. Halim Harahap Prof. Dr. H. Hasan Bakti, MA Sahrial, S.Pd.I Hakimuddin, S.Ag Agus Naini Amin, Lc Syafi’i Umar Lubis H. Zulkarnain Asri, Lc, MA Dr. H. Azhar Sitompul, MA Maulana, S.Ag Dr. H.M. Yakub Amin, MA Drs. Mashul Drs. Bambang Permadi

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Ar-Ridho Kel. Sidorame Timur As-Sholah Jl. Pendidikan No. 39 Glugur Darat I Al-A’la Jl. Pembangunan No. 46 Kel. Glugur Darat II Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ikhlas Jl. Madiosantoso No. 197 Lingk. 14 P.B. Darat Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Kel. Gaharu Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Rabithatul Muslim Lingk. 14 Glugur Kota Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Pulo Brayan Bengkel Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap

K.H. Nazaruddin Lubis Abi Arrijallu Syauqih, S.Ag Drs. H. Juliardi Drs. H.M. Samin Pane H. Ponimin Kardi, SE Drs. Bahari Ahmad Drs. H. Amhar Nasution, MA Drs. Sugeng Wanto, MA Drs. Ahmad Syamsuri Matondang H. Bambang Irawan Hts., S.Ag Ganda Maulana, S.Ag H. Abdul Aziz Paqih, S.Pd.I Ibnu Saud Drs. Zulkifli Nasution Prof. DR. H.M. Hatta, MA H. Mhd. Din Kasa, Lc Drs. H. Kamidin Selian H. Ruslan Effendi, Lc, S.Pd.I H.M. Nurdin Rustam, Lc H.M. Ali Azmi Nasution, Lc, MA Ridwan, S.Ag Drs. H. Sokon Saragih, M.Ag H. Masohur Siregar Choirul Harahap Drs. Abd. Mukhsin, M.Soc,SC Prof. Dr. Ilhamuddin Nst., MA Drs. H. Ramli H. Akhyar Nasution, Lc, M.Ag Drs. H. Umar Khatib, M.Pd Hasburrahman, S.Pd.I Drs. Sartoni, AB Gunawan, S.Pd.I Drs. Mustafa Kholayani Fakhruddin, A.R., MA

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Drs. H. Kamil Selian (Bersambung ke hal C5 )

Mimbar Jumat

WASPADA Jumat 29Juni 2012


Tumbuhlah Dan Terus Maju, Generasi Berilmu Masjid Raya Taqwa Kota Parapat, Minggu (24/6) kemarin, secara resmi telah memiliki gedung madrasah baru yang dinamai dengan Madrasah Al Muttaqin. Di saat yang bersamaan, masjid tersebut telah pula diperluas dengan tujuan mempermudah ibadah jamaah yang dapat memakmurkan masjid, sembari terus menumbuhkan generasi berilmu yang mampu mewarnai daerah ini. Plt Gubernur Sumut, H Gatot Pujo Nugroho ST saat meresmikan dua bangunan tersebut, memberikan apresiasinya yang luar biasa, karena pembangunan

Madrasah Al-Muttaqin sekaligus perluasan Masjid Raya Taqwa di Kota Parapat tersebut berhasil dibangun murni dari swadaya masyarakat. “Ini sangat efesien, efektif dan prokduktif. Menjadi investasi, tidak hanya di dunia tetapi juga akhirat melalui infak dari seluruh masyarakat. Karena didirikannya sekolah adalah untuk mencetak manusia yang andal berilmu serta berakhlak,” ujarnya. Gatot menekankan, Pemprov Sumut selalu siap membantu dan mendukung pembangunan pendidikan di daerah ini. Karena pembangunan pendidikan merupakan tanggung jawab pemerintah dan masyarakat. Oleh sebab itu, mesti ada kerjasama dalam setiap prosesnya. Dalam kesempatan tersebut, Gatot juga memaparkan tentang pentingnya peran ilmu, sesuai dengan ajaran Rasulullah dan tuntutan zaman. Hal tersebut

menurut Gatot, telah diaplikasikan masyarakat Kota Parapat dengan melengkapi bangunan masjid ditambah dengan madrasah, sebagai wujud dari kepedulian dan kesadaran terhadap tuntutan melahirkan generasi berilmu. “Sekolah ini diharapkan menjadi ulil albab yang membuat orang-orang mengerti maksud dan tujuannya di dalam hidup di dunia ini. Bahwa hidup di dunia ini untuk bersamasama memakmurkan semesta raya dengan investasi. Tak kalah pentingnya adalah investasi akhirat. Karena dengan infak yang bapak dan ibu berikan, Insya Allah akan menjadi bagian dari amal zariah yang akan terus menerus pahalanya,” tegas Gatot. Plt Gubsu juga menyitir pesan Rasulullah yang menyebutkan, bahwa barang siapa berjalan di muka bumi dengan menuntut ilmu maka Allah

akan mudahkan baginya masuk surga. Dengan demikian, masyarakat yang telah berperan dalam pembangunan masjid dan madrasah tersebut, telah melakukan ibadah yang cukup penting dalam mempersiapkan sarana bagi orang yang akan menuntut ilmu. Pe re s m i a n g e d u n g b a r u madrasah tersebut, terdiri dari berbagai jenjang. meliputi TK-

I’TIBAR H.M. Hafez, Lc

RA, MDA dan MTs. Turut pula hadir, wakil Bupati Simalungun Nuriaty Damanik, Anggota DPRD Simanlungun Mansur Purba, Katua MUI Simalungun dan Kementerian Agama Si m a l u n g u n b e s e r t a u n s u r Mu s p i d a Si m a l u n g u n s e r t a Kadis Pendidikan Provsu Drs Syaiful Syafri, MM, dan Kadis Kominfo Provsu Dr H. Asren Nasution, MA.(m28)

Amir Syarifuddin

TANDATANGANI PRASASTI: Plt.Gubsu, H.Gatot Pujo Nugroho,ST menandatangani prasasti, peresmian Masjid Raya Taqwa dan Madrasah Al Muttaqin di Kota Parapat, Minggu (24/6).

Amir Syarifuddin

KHITANAN MASSAL: Anak-anak peserta khitan massal berfoto bersama Plt,Gubsu, H.Gatot Pujo Nugroho, ST, beserta Ketua TP PKK, Hj Sutias Handayani Gatot Pujo Nugroho, saat khitan massal yang digelar di Pondok Bungur Kec.Rawang Kab.Asahan. Acara digelar berdamaan dengan Silaturahim Paguyuban Wes Wayae, Rabu ( 27/6) di Asahan. Ar-Ridho Jl. Jati Psr.VIII Dusun X Gambir Desa B.Klippa Hasan Basri, S.Pd.I Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Drs. Supriadi Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan Drs. H. Usman Harahap At-Tawwabin Jl. Pimpinan No. 1 Drs. H. Sukon Saragih Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Drs. H. Nafiah, MA Al-Bayan Jl. Kasuari I/Gurilla No. 10 Kel. Sidorejo Drs. Abdul Hakim Al-Falah Jl. Pukat Banting IV No. 10 Drs. H. Samaruddin, S. Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir H. Adlan Sahar Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Drs. Hasan Basri Siregar Al-Hilal Jl. Belat No. 76-B Zailani, MA Al-Ikhlas Lingk. II Kel. Bandar Selamat Drs. M. Fadhli Said, MA Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Drs. H. Sokon Saragih Al-Ishlah Jl. Pukat V Kel. Bantan Timur H. Ahmad Faisal Nst., S.Ag Al-Ikhlash Jl. Pasar V Gg. Al-Ikhlash Dusun XIII Durian H. Abd. Rahim, Lc Al-Istiqomah Komplek Veteran Medan Estate Drs. Ansyari Yamamah, MA Al-Ijtima’iyah Jl. Letda Sujono No. 152 H. Sutan Sahrir, S.Ag Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Drs. Naharman Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Drs. Rijaluddin Siregar Baiturrahman Kampus UNIMED Jl. Williem Iskandar Nazaruddin Lubis Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I H. Tongku Alamsyah, S. Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Drs. M. Fadli Said, MA Hidayatul Ubudiyah Jl. Kapten M.Jamil Lbs.Gg.Mangga Drs. H. Baharuddin Lubis Ikhlashiyah Jl. Suluh/Jl. Tempuling No. 20 Kel.Sidorejo Syafaruddin Syam, MA Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo H. Bahauddin Nasution, Lc Jamik Al-Jihad Jl. Besar Tembung Desa Tembung Su’aib Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Syaiful Siregar Raya Muslimin Jl. Pukat I No. 1 d\h Jl. Mandailing No.1 Drs. H. Ali Sati Nasution Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Husni Mubarak, S.Pd.I Taqwa Kampus I UMA Jl. Kolam No. 1 Medan Estate Dr. Sidurrahman, MA Taqwa Jl. Letda Sudjono No. 15 M.S. Dongoran Ubudiyah Jl. Taduan No. 109 Kel. Sidorejo Drs. Ali Imran MEDAN TUNTUNGAN Ar-Rahman Griya Nusa 3 Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hikmah Kompleks R.S. Jiwa Propsu Jl. Tali Air Lk. IV Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Taqwa Jl. Sawit Raya, Perumnas Simalingkar

Drs. H. Basyaruddin Ja’far Mar’an Siregar, M.Phil Arfan Tanjung Drs. Sariman Al Faruq H. Ahmad Fauzi, Lc, M.SI Ikmaldi Jambak, S.Ag M. Hasyim Watni Marpaung, MA Ibrahim Fansuri, S.Pd.I Drs. H. Abdul Razak Drs. Mashur Utama, S.Sos Choirul Harahap Drs. M. Ridwan Hisda

DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam M. Fadli Lubis, S.Ag Ainul Yaqin Jl. Pembangunan IV No. 30 Desa Mulrorejo Aidil Mawar Nasution At-Taubah Dusun XX Lr. Pertanian Blok Gading Sulaiman Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Drs. M. Suud Tambunan Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC H. Umar M. Siregar, Lc Al-Hafiz Hamparan Perak Kec. Hamparan Perak Abdul Latif, S.Pd.I Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur Prof. H. Jumino Suhadi Al-Ikhlas Komp. Kantor Bupati Deliserdang L.Pakam Rusli, S.Ag Al-Ikhlash Lingk. VI Gg. Sidorejo Kel. Deli Tua Sugandi, S.Pd.I Al-Ikhlash Jl. Pasar V Dusun Durian Gg. Masjid H. Abd. Rahim, Lc Al-Issyah Hakim Jl. Karya Jaya Kel. Deli Tua H. Akhyar Al-Jihad Jl. Pembangunan No. 26 Bahrumsyah, S.Ag Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Ahmad Riadi Daulay, MA Al-Mukhlisin Komplkek Namori Village Drs. Adam Sukiman Jami’ Al Muhajir Jl. Rel Pasar X No. 06 Bandar Khalifah Drs. Mustamir Matondang As-Salam Jl.Raya Medan Namorambe Komp.Pisu No.1 Abu Wildan Baiturrahman Jl. Merica Raya Blok F Peru. Simalingkar Mukhtar Yahya, BA Baitussalam Dagang Kerawan Tanjung Morawa DR. H. Harianto, Lc, MA H.M. Asjro Effendi Jl. Haji Misbah No. 22 H. Hamdi Jamaluddin, Lc Jami’ Jl. T. Imam Bonjol No. 17 Lubuk Pakam Sumarno, S.Pd

Amir Syarifuddin

DRUM BAND SISWA: Para siswa Madrasah Al Muttaqin, unjuk kebolehan di hadapap Plt Gubsu, H.Gatot Pujo Nugroho, ST dan rombongan saat peresmian gedung baru Madrasah tersebut besrta Masjid Raya Taqwa di Kota Parapat, Minggu (24/6).

Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Jl. Besar Km. 11,5 Deli Tua Jami’ Jl. Irian No. 79 Kel. Pekan Tanjung Morawa Jami’ Al-Ihsan Jl. Imam Abdul Ds.Selemak Kec.H.Perak Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Khairul Fatihin Dusun II Kec. Tg. Morawa Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Nurul Burhanuddin Jl. Cempaka Dusun V Ds K.Durian Raya Jl. T. Raja Muda No. 26 Lubuk Pakam Syuhada Kec. Galang Taqwa Lubuk Pakam Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

Drs. Parlindungan Hasibuan Nasyir Ansori Abd. Rahman Abdullah Helmy, S.Pd.I Drs. Mukhtaruddin, MA Drs. H. Zainuddin Sinaga Selamet Riadi, S.HI H. Sutan Syahrir Dlt., S.Ag Sudarno, S.Ag Juhdi Drs. Awwaluddin, M.S. Drs. Burhanuddin, MA Bilal Senen

BINJAI Agung Kota Binjai Amal Jl. H. Agus Salim No. 14 Kel. Jatinegara Amal Jl. T. Imam Bonjol Gg. Cempaka An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahmah Turiam Jl. Kakap No. 1 Kel. Tanah Tinggi Al-Hidayah Jl. Talam No. 28 Kel. Nangka Al-Hilal Jl. Ikan Irwana No. 17 Kel. Dataran Tinggi Al-Huda Kel. Pahlawan Kota Binjai Al-Mushlihin Kel. Satria Kota Binjai Al-Qadar Kel. Payaroba Griya Payaroba Indah Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Istiqomah Jl. T.A. Hamzah Kel. Jati Negara Jami’ Athohirin Kota Binjai Nurul Falah Jl. S.M. Raja No. 60 Nurul Yaqin Jl. S.M. Raja No. 94 Kel. Tanah Tinggi

H. Hamzah Fansyuri Syafri Eliansyah, S.Ag H. Amrilsyah Lubis Drs. H. Baharuddin D., MA Drs. H.M. Nasir Drs. H. Jannah Siregar M. Rasyid, BA Drs. H. Afrianda M. Syahrin Pasaribu Drs. Zainul Bahri H. Hamzah Fansuri Drs. Darmolen Siregar Drs. H. Wagirin, S.Pd.I Indra Saidi Ahmad Efendi, S.Ag

M. Sapri Nasution, S.HI, S.Pd.I H.M. Tahir Asmuni, Lc

TEBING TINGGI Amal Muslim Kp. Rao Amaliyah Jl. K.F. Tandean No.344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Al-Abidin Jl. Kom. Yos Sudarso Kel. Lalang Al-Hidayah Kel. Tanjung Maru Hilir Kampung Keling Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Al-Hasanah Jl. Kartini No. 16 Tebing Tinggi Al-Hasanah Jl. Merbau Perumnas Bagelen Teb. Tinggi Al-Haq Kel. Deblob Sundoro Padang Hilir Al-Qomar Jl. Kutilang Lingk. 05 Kel. Bulian Al-Khairani Jl. Baja Lingk. VI Kel. T. Tinggi Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak Al-Ihsan Simp. Dolok Kel. Sri Padang Kec. Rambutan Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Mukhlis Kel. Pasar Baru Al-Muthmainnah Lingk. I Kel. D.Sundoro Darul Jihad Jl. Ahmad Yani Komp. Detasemen B Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Istikmal K.F. Tandean Lingk. III Bandar Sakti Jami’ Jl. Batu Bara Kel. Satria Jami’ Jl. Soekarno-Hatta Kel. Tambangan Hulu Nurul Amal Kompl. Kodim Lingk. 04 Kel. Lalang Nurul Huda Jl. Bukit Bundar Lingk. 03 Kel. Lalang Nur Islam Jl. P. Irian Lingk. 94 Kel. Persiakan Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Jl. R. Suprapto No. 126 Syuhada Jl. Iskandar Muda No. 79-A Taqwa Jl. Bakti Kel. Satria Kota Tebing Tinggi

Ubudiah Jl. Pulau Samosir Kel. Bandar Sono

Syaiful Bahri Sinaga

INDRAPURA Jami’ Indrapura


KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Hidayah Jl. Cokroaminoto Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Jl. Merpati No. 44 Kel. Gambir Baru Jami’ Baiturrahim Kel. Kisaran Naga Nurul Yaqin Jl. Agus Salim Kel. Teladan Nurul Yaqin Kantor Direksi - PB. BSP Kisaran Nurul Huda Jl. Malik Ibrahim No. 37 Nuur-Assyiam Kel. Lestari Siti Zubaidah Jl. Budi Utomo No. 285

Drs. H. Nummad Adhan, SH, M.Hum Drs. Pargalutan Dalimunthe H. Ahmad Zulhanuddin BB, Lc H. Nurul Ichsan Sitorus, SH, MA Drs. Syafii, MA Ngatiman Drs. Muksin, M.Pd H. Nono Astono, S.Pd.I H. Salman Tanjung, MA H. Salman Tanjung, Lc, MA Imron Rosadi, S.Pd.I Sofian Samosir, S.Ag H. Aswiluddin Rambe, S.Pd.I H. Jamaluddin Damanik H. Mhd. Syafiq, STP., MMP H. Rahmat Hidayat, Lc H. Syawaluddin Damanik, S.Ag

LABUHAN BATU Attaqwa Labuhan Batu Selatan Besar Tanjung Medan Labuhan Batu Selatan Besar Kota Pinang Labuhan Batu Selatan Jami’ Kota Pinang Labuhan Batu Selatan

H. Ramali Panggabean H. Abdul Malik Siregar, BA Zainal Arbain Tanjung Ahmad Fadli Tanjung, S.Ag


ST A B AT Ar-Raudhah Dusun VII Desa Kebun Balok Al-Furqan Lingk. I Musyawarah Kel. Kwala Bingai

Refleksi Isra’ Miraj Khadijah istri Rasulullah SAW dan Abu Thalib pamannya adalah tulang punggung dakwah Rasulullah SAW dalam menyebarkan syiar Islam. Khadijah selalu menjadi penyejuk dan motivator bagi Rasulullah SAW di dalam rumah saat Rasul mengalami kegalauan dan dan kesedihan. Sementara Abu Thalib selalu membela dan menopang dakwah Rasulullah SAW dari rekayasa dan konspirasi jahat kaum musyrik Quraisy. Namun takdir Allah SWT berbicara lain di saat-saat Rasulullah SAW sangat membutuhkan bantuan dan dukungan mereka berdua pada saat itu pula Allah SWT memanggil keduanya pulang ke rahmatullah. Diawali dengan kematian Abu Thalib dan setelah satu bulan kemudian Allah SWT pun menjemput Khadijah pulang kepangkuanNya. Setelah wafatnya Abu Thalib dan Khadijah perlawanan kaum musyrik berupa intimidasi, hinaan, caci-maki, boikot ekonomi dan sosial kepada Rasulullah SAW semakin bertubi-tubi dan semakin tak terbendung. Sementara Rasulullah SAW masih merasakan suasana duka cita yang mendalam dengan kepergian paman dan istrinya tercinta. Maka pada saat itulah Allah SWT menghibur Rasulullah SAW dengan Isra’ dan Miraj. Momentum sejarah tersebut adalah peristiwa yang terjadi sekitar 14 abad Hijriyah yang lalu, dimana pada saat itu Nabi Muhammad SAW diperjalankan oleh Allah SWT dari Masjidil Haram di Makkah ke Masjidil Aqsha di Palestina, lalu dilanjutkan dengan menembus lapisan langit tertinggi sampai batas yang tidak dapat dijangkau oleh ilmu semua makhluk, malaikat, manusia, dan jin. Dalam Alquran, dari sekian ribu ayat, hanya ada 4 ayat yang menjelaskan tentang Isra’ Miraj. Maksudnya, kebesaran Islam itu bukan terletak pada peristiwa Isra’ Miraj ini semata, tapi pada konsepnya, sistemnya, dan muatannya. Meskipun hanya Nabi Muhammad yang telah diperjalankan pada malam harinya, tapi dia tetaplah manusia biasa, hamba Allah. Hal ini perlu ditegaskan, karena dua umat sebelum Islam (Yahudi dan Kristen), telah terjebak men-Tuhankan nabinya. Ada beberapa pertanyaan mengenai peristiwa Isra’ Miraj. Salah satunya, mengapa Rasul diperjalankan ke Masjidil Aqsha? Tidak langsung saja ke langit? Paling tidak ada beberapa hikmahnya, antara lain: 1. Bahwa Nabi Muhammad adalah satu-satunya Nabi dari golongan Ibrahim AS yang berasal dari Ismail AS, sedangkan Nabi lainnya adalah berasal dari Ishaq AS. Inilah yang menyebabkan Yahudi dan Kristen menolak Nabi Muhammad, karena mereka melihat asal usul keturunannya (nasab). Alasan mereka itu sangat tidak ilmiah, dan kalau memang benar, mereka berarti rasialis, karena melihat orang itu dari keturunannya. Hikmah lainnya, bahwa Nabi Muhammad berdakwah di Makkah, sedangkan Nabi yang lain berdakwah di sekitar Palestina. Sebagai Muslim, tidaklah melihat asal usulnya, tapi dari ajarannya. 2. Allah SWT dengan segala ilmu-Nya mengetahui bahwa Masjidil Aqsha akan menjadi sumber sengketa sepanjang zaman. Mungkin Allah SWT ingin menjadikan tempat ini sebagai pembangkit ruhul jihad kaum Muslimin. Kadangkala, kalau tiada lawan semangat jihad kaum Muslimin cendrung melemah karena terlena, dengan adanya sengketa, semangat jihad kaum Muslimin terus terjaga dan terbina. 3. Allah SWT ingin memperlihatkan sebagian tanda-tanda kebesaranNya kepada nabi Muhammad SAW. Dalam Alquran surat An Najm ayat 12, terdapat kata Yaro dalam bahasa Arab yang artinya menyaksikan langsung. Berbeda dengan kata Syahida, yang berarti menyaksikan tapi tidak mesti secara langsung. Allah SWT memperlihatkan sebagian tandatanda kebesaran-Nya itu secara langsung, karena pada saat itu dakwah nabi Muhammad SAW sedang pada masa sulit, penuh duka cita. Pada peristiwa tersebut Nabi Muhammad SAW juga dipertemukan dengan Nabi-nabi sebelumnya, agar Muhammad SAW juga bisa melihat bahwa Nabi yang sebelumnya pun mengalami masa-masa sulit. Hal ini juga merupakan pelajaran bagi kita yang mengaku sebagai da’i, bahwa dalam kesulitan dakwah itu Allah SWT pasti ikut andil membela, menolong dan memenangkan dakwah ini.

Zulham Ibnu Hasyim, S.Pd.I Zulkarnain, S.Ag Drs. Daulat P. Sibarani Abd. Wahab Amirullah Lubis Irwan Syahruddin H. Asdi Akmal Nasution Ismail, S.Ag Drs. Ngatiran, MBA Abdul Yajib, S.Ag Salamuddin H. Wijaya Damanik Ponirin Burhan, S.Pd.I Mahmud Lubis, S.Pd.I Andri Yamin, S.Pd.I H. Abdurrahman Lahmanuddin, S.Ag H.M. Muslih Lubis Drs. Abd. Kholik, MAP Drs. Fahri Syam, S.Pd.I Zulkifli Muhammad Nuh H. Bustami Saragih, BA H. Muhammad Syamsi Sutrisno Drs. Ngatiran, MBA Drs. Zulfan, SH Drs. H. Gazali Saragih Abu Hasyim Siregar, SH S. Abduh, S.HI Ilyas Hibban, S.Ag

Ar-Rahman Dusun II Desa Pasar Lapan Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

A. Yasir Siregar, S.Ag Sailan, S.Pd.I Selamat Muchtar, A.M.

A S AHA N Arif-Al Azhim Polres Asahan

Drs. H. Edi Sucitno, MA

TANJUNG BALAI Al-Istiqomah Jl. Anggur Kel. Pantai Johor

H. Marwan Fahmi, BA

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba

Ja’far Sidik Nasution, S.Pd.I

SIDIKALANG Agung Kota Sidikalang Al-Muhajirin Jl. Bambu Kuning Blok A No. 59 Telaga Zam-zam Jl. Ahmad Yani Batang Beruh

H. Sunaryo, S.Ag Drs. H. Ahman Musa Hsb., MH Jono Pasi, S.Ag

BIREUEN Masjid Agung Bireuen Masjid Taqwa Gandapura Besar Makmur Masjid Besar Kutablang Masjid Besar Peusangan Masjid Besar Psg. Siblah Krueng Masjid Besar Peusangan Selatan Masjid Al Furqan Kota Juang Masjid Ridha Jeumpa Masjid Baitunnur Peudada Masjid Besar Peulimbang Masjid Baiturrahim Jeunieb Masjid Baitul Qiram Pandrah Masjid Besar Simpang Mamplam Masjid Besar Samalanga

Tgk Saifuddin Muhammad Dr Tgk Saifullah S Ag M Pd Tgk M Isa HUsen Tgk Syaikh A Rauf Tgk Jamaluddin Abd Tgk Azmi S Pdi Tgk Bustaman Tgk Zulfitri M Amin Tgk Mustafaruddin Drs Tgk H Anwar Mahmud Tgk Jailani Tgk Busyairi Tgk Martunis Tgk Syeh Marhaban Masjid Tgk M Nur Ummul Ayman

Mimbar Jumat


Nisfu Sya’ban & Bacaan Menjelang Azan Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Alwashliyah.


iriwayatkan dari Aisyah ra, dia berkata suatu malam Rasulullah Saw bangun dan melaksanakan shalat dan melamakan sujudnya hingga saya kira dia telah wafat (dalam sujudnya), manakala saya melihat keadaan demikian sayapun bangun, lalu saya gerakkan telunjuknya lalu bergerak dan kembali semula, maka manakala dia bangun dari sujudnya dan telah menyelesaikan shalatnya dia bersabda: Wahai Aisyah – wahai humaira’ – apakah kamu mengira bahwa Nabi Saw telah meninggalkanmu dan mengabaikan hakmu? Saya menjawab: Tidak, demi Allah ya Rasulullah. Akan tetapi saya mengira engkau telah wafat di dalam shalat karena terlalu lama sujudmu. Nabi SAW bersabda: Tahukan kamu – wahai Aisyah – malam apakah ini? Saya menjawab: Hanya Allah dan Rasul-Nya yang mengetahui. Dia bersabda: Malam ini malan nisfu Sya’ban, sesungguhnya Allah SWT memperhatikan hambaNya pada malam nisfu Sya’ban, maka Dia memberi keampunan bagi orangorang yang meminta ampun, dan menyayangi orang-orang yang minta dikasihani, dan ditangguhkan (keampunan) bagi orang-orang yang pendengki sebagaimana yang direncanakan-Nya. (Hadis Riwayat Al-Baihaqi – di dalam kitab Jami’ Turmuzi – Darul Hadis, 2001, Juz 3, hal.161). Hadis di atas menurut Imam Baihaqi adalah Hadis Mursal Jayyid (sebuah hadis yang diriwayatkan oleh seorang perawi dari seorang syekh yang semasa dengannya atau bertemu dengannya tetapi ia tidak pernah menerima satu hadis pun dari padanya namun ia meriwayatkan ada kemungkinan ia mendengar dari syekh itu. Imam Al-Baihaqi menduga bahwa Al-Wala’ menerima hadis tersebut dari Makhul, oleh sebab itu hadis ini digolongkan kepada Hadis Mursal Jayyid. Memang para ulama hadis berbeda pendapat dalam mempedomani hadis mursal sebagai landasan (hujjah) untuk beramal. Imam Syafi’i di dalam kitab Ar-Risalah hal.258, menyatakan bahwa hadis mursal mempunyai tingkatan-tingkatan yang berbeda, jika mursal dilakukan oleh para tabi’in yang senior seperti Said bin Musayyib, maka hadisnya dapat dijadikan hujjah sedangkan para yunior tabi’in mursalnya ditolak. Akan tetapi kebanyakan para ulama menerima hadis-hadis mursal sahabat tanpa membedakan apakah

dilakukan oleh tabi’in senior ataupun yunior, karena para sahabat telah dijamin keadilannya, sebagaimana sabada Nabi SAW: Sahabat-sahabatku semuanya adil. (lihat Ulumul Hadis DR. Subki Ashalih hal.166). Senada dengan hadis-hadis di atas, yang menjelaskan tentang keutamaan malam nisfu sya’ban, ada beberapa hadis lain yang menguatkan tentang keutamaan malam nisfu sya’ban, antara lain diriwayatkan oleh Aisyah, bahwa suatu malam dia kehilangan Rasul

malam nisfu sya’ban mempunyai dasar yang kuat untuk beramal di malam harinya dan berpuasa di siang harinya. Sedangkan amalan-amalan apa yang dibiasakan atau diwiridkan tidak dijelaskan oleh Nabi Muhammad SAW secara spesifik.Oleh sebab itu, penulis mengaitkan bacaan-bacaan menjelang azan dengan nisfu sya’ban dari sisi amalan-amalan atau wirid-wirid yang dibaca, sekaligus menjawab persoalan yang sering dipertanyakan orang apa dasar atau dalil membaca ayat-ayat Alquran seper-

Beramal dengan mempedomani dalil umum dari keutamaan nisfu sya’ban dan wirid adalah perbuatan terpuji, selama dia tidak meyakini, membuat statemen yang dibuatnya itu persis seperti apa yang pernah dilakukan oleh Nabi Muhammad SAW. SAW lalu dia keluar dari rumahnya, tiba-tiba dia melihat Nabi sedang berada di Baqi’ (kuburan dekat masjid Nabawi sekarang). Lalu Nabi SAW bertanya: Apakah kamu khawatir aku meninggalkanmu? Saya menjawab:Ya Rasulullah! Saya kira engkau mendatangi isteri-isterimu yang lain, maka Nabi SAW bersabda: Sesungguhnya Allah “turun” ke langit dunia (menurunkan rahmat-Nya) maka Dia mengampuni dosa-dosa lebih banyak dari bulu-bulu kambing suku Bani Kilab. (Jami’ Turmuzi hadis No.739). Syekh El-Mubarak Fury pensyarah kitab Jami’ Turmuzi mencantumkan 7 buah hadis dengan jalur-jalur yang berbeda dengan kualitas hadis yang berbeda-beda pula. Pada intinya malam nisfu sya’ban adalah malam yang diprioritaskan oleh Nabi SAW untuk memperbanyak amal ibadah, shalat, berdo’a, mem-baca Alquran dan lain-lain, karena beramal ibadah pada malam itu tidak sama kualitasnya dengan malam-malam lain, bahkan sebagian ulama menyatakan bahwa malam yang berkah yang disebut di dalam Alquran surat Ad-Dukhan ayat 3: Sesungguhnya kami menurunkan Alquran pada malam yang “diberkahi” adalah malam nisfu sya’ban. Demikian dijelaskan oleh Syekh Al-Mubarak Fury dalam syarah Jami’ Turmuzi. Terlepas dari perdebatan para ulama tentang kesahihan hadishadis di atas, yang jelas keutamaan

ti innallâha wamalâ ikatahû... (QS. al-Ahzab: 56) menjelang azan dikumandangkan, dan sebagian masjid ada yang membaca akhir surat al-Isra’ ayat 111 sebelum azan di-kumandangkan, bahkan ada pula membaca shalawat, tarhim dan sebagainya. Menurut hemat penulis, bacaanbacaan ayat-ayat Alquran atau zikir, shalawat, pujian-pujian kepada Allah dapat dikategorikan kepada wirid, yang mana asal kata wirid adalah hizb (bukan warada) yang berarti mengelompokkan ayat-ayat Alqruan untuk dijadikan amalan, karena para sahabat Nabi Muhammad SAW telah melakukan itu, ada yang mengelompokkan ayat Alquran 1 juz untuk dibaca setiap hari, ada yang 5 juz, ada pula yang 1 khatam Alquran satu hari. Dan kebiasaan ini dilakukan oleh mereka setiap malam tanpa menanyakan kepada Nabi ayat mana yang harus dibaca pada malam ini, juz berapa dibaca pada malam itu, dan dimana pula tempat membacanya, dan dalam kondisi apa pula ayat tersebut harus dibaca (dengan tetap mempedomani adab-adab membaca Alquran), akan tetapi mereka punya wirid tertentu dari ayat-ayat Alquran sesuai kapasitas kemampuan mereka membaca dan mewiridkannya, sehingga diduga kuat mereka-mereka para sahabat tidak ada yang tidak mewiridkan Alquran setiap malam menjelang mereka berbaring di tempat tidur. Terkadang – sebagai-

mana biasa -ada yang terlupa sampai bangun tidur dan masuk waktu subuh, mereka merasa rugi karena meninggalkan wirid-wirid mereka. Untuk menjawab kegelisahan mereka, Nabi SAW bersabda: Siapa-siapa yang tertidur dari wiridnya atau terhadap sebagian dari wiridnya, lalu dia baca setelah shalat subuh hingga antara shalat zuhur, dituliskan pahalanya seperti dia membaca di waktu malam harinya. Hadis ini diriwayatkan oleh Abu Daud dalam Sunannya hal.274-275 Juz 4, An-Nasai hal. 349351, Juz 6 Bab Mengqadha amalan sunat, Imam Turmuzi hal.494 Juz 2, Sunan Ad-Darimi hal. 375 Juz 4 Bab “Apabila Tertidur Dari Zikir”.Dari Hadis-hadis di atas dapat dipahami bahwa wirid dalam arti mengelompokkan ayat-ayat Alquran, baik per ayat, per juz, atau per surat, mempunyai landasan yang kuat dalam pengalaman bahkan bagi orang yang sudah terbiasa mewiridkan pekerjaan sunat bila terlupa dapat dikerjakan di luar waktunya. Hadis ini juga membolehkan untuk mengqadha amalanamalan sunat yang tertinggal di waktu malam, misalnya seorang yang membiasakan shalat tahajjud di waktu malam lalu dia tertidur maka boleh dia mengqadhanya di waktu pagi antara shalat subuh dan shalat zuhur. Demikian pula, bacaan-bacaan menjelang azan yang mengutip sebagian ayat Alquran yang ada kaitannya dengan azan atau tidak ada sama sekali (semata-mata tabaruk bi quran) atau mengingatkan orang dengan Alquran dapat dikategorikan kepada wirid (mengelompokkan 1 ayat Alquran untuk dibaca menjelang azan). Akhirnya, dari kajian hadis yang sederhana ini dapat disimpulkan bahwa, amalan-amalan nisfu sya’ban dan bacaan menjelang azan, mempunyai dasar pengamalannya. Hanya saja, secara spesifik tidak dijelaskan dan tidak diperinci, tergantung kepada kemampuan beramal. Oleh sebab itu, menetapkan amalanamalan tertentu dan mengada-adakan dengan alasan “itu dibuat oleh Nabi SAW”, itu adalah bid’ah. Sedangkan beramal dengan mempedomani dalil umum dari keutamaan nisfu sya’ban dan wirid adalah perbuatan terpuji, selama dia tidak meyakini, membuat statemen yang dibuatnya itu persis seperti apa yang pernah dilakukan oleh Nabi Muhammad SAW, sekali lagi itulah yang dikatakan bid’ah.Wallahua’lam bil ash-shawab.

Keistimewaan Bulan Sya’ban Oleh Drs H.As’ad Marlan, MAg Guru MAL IAIN Dan Dosen Fak. Tarbiah IAIN. SU


llah SWT, yang Maha Kuasa, Maha Bijaksana, lagi Maha Pencipta, melebihkan kedudukan dan derajat sebagian makhluk-Nya atas sebagian yang lain. Dia menciptakan manusia dan alam semesta serta memilih diantara mereka sebagai Rasul dan melebihkan sebagian Rasul itu atas sebagian yang lain. Allah juga memilihkan dan melebihkan sebagian negeri atau tempat atas sebagian yang lain, dan Allah memilih Mekkah sebagai tanah suci, Masjidiil Haram lebih utama dari pada masjid-masjid yang lain, begitu pula Masjid Nabawi (Madinah) lalu Masjidil Aqsha (Palestina). Kini kita telah berada di bulan Sya’ban. Bulan Sya’ban adalah salah satu bulan yang dimuliakan Allah. Menurut pendapat Yahya bin

Muas ra, ia berkata: “Sesungguhnya didalam bulan “Sya’ban” dimana didalam setiap hurufnya orang mukmin akan diberi suatu pemberian, dengan Syin diberi syaraf (kemuliaan) dan syafaat, dengan ‘Ain akan diberi Birr (kebaikan) dengan ‘Alif akan diberi ulfah (kelemah lembutan) dan dengan Nun akan diberi Nur (cahaya) dan oleh karenanya dikatakan, bulan Rajab itu untuk menyucikan hati dan bulan Ramadhan untuk menyucikan roh, sesungguhnya untuk menyucikan badannya pada bulan Rajab maka dia akan menyucikan hatinya pada bulan Sya’ban, dan orang yang akan menyucikan hatinya pada bulan Sya’ban akan menyucikan roh nya pada bulan Ramadhan, maka jika ia tidak menyucikan badannya pada bulan Ra-

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustaz, Mengapa ada Makiah dan Madaniyah, berapa banyak surat Makiyah dan berapa banyak surat Madaniyah ? Mohon penjelasan. Dari Suriamin, Langkat. Jawab : Terimakasih atas pertanyaanya. Terjadinya Makiah dan Madaniyah karena Alqur’an memang turun tidak pada satu tempat, pada umumnya turun di daerah Mekkah dan Madinah. Salah satu diantara gunanya adalah agar tahu mana hukum yang sudah dihapus dan mana pula hukum yang masih tetap berlaku. Berbeda pendapat Ulama tentang jumlah surat Makiyah dan Madaniyah, ada yang berkata jumlah surat Makiyah ada 94, Madaniyah 20, ada lagi yang berkata makkiyah ada 84 dan Madaniyah 30. Ada pula yang berkata, Surat Alquran yang disepakati para ulama sebagai surat Makiah ada 82 dan yang disepakati sebagai surat Madniyah ada 20 sedang 12 surat lainnya masih diperselisihkan status Makiyah atau Madaniyahnya. Perbedaan ini disebabkan adanya sebagian surat yang seluruh ayatayatnya Makiyah atau Madaniyah, ada pula surat yang Makiyah tetapi berisi sedikit ayat madaniyah atau sebaliknya. Oleh karena itu dari segi Makiyah dan Madaniyah ini Al-qur’an terbagi Kepada 4 bagian: 1. Surat Madaniyah yang ada berisi ayat makiyah, ada 6. Yaitu: AlBaqarah, Al-Maidah. Al-Anfal, At-taubah, Al-Hajj, Muhammad. 2. Surat Makiyah yang ada berisi ayat Madaniyah, ada 32, yaitu: AlAn’am, Al-A’raf, Hud, Yusuf, Ibrahim, Hijr, An-Nahl, Isra’, Kahfi, Maryam, Thaha, Furqon, Syu’ara, Qashahsh, Ankabut, Ar-Ruum, Lukman, Sajdah, Saba’, Yaasin, Zumar, Syuura, Zukhruf, Ahqaf, Qoof, An-Najm, Al-qomar, Waqiah, Al-qalam, Muzammmil, Al-Mursalat, Al-Ma’un. 3. Madaniyah Murni, Surat yang kesemua ayatnya madaniyah. ada 18 Surat, Yaitu: Ali-Imran, An-Nisa, An-Nur, Al-Ahzab, Al-Fath, hujarat, Hadid, Mujadalah, Hasyr, Mumthahanah, Shaff, Jum’ah, Munafiqun, Thaqabun, Thalaq, Tahrim, Zalzalah, Nasr. 4. Makkiyah Murni. Surat yang kesemua ayatnya Makiyah. Ada 58 Surat, yaitu (karena tempat terbatas nama-nama suratnya adalah kelebihan dari nama yang sudah kami sebutkan). (lihat Ahmad DJalal. ‘Ulumul Qur’an. Ha; 99-100). Wallahu A’lam. Al-Ustadz H. Ismail Hasyim, MA

Sesungguhnya untuk menyucikan badannya pada bulan Rajab maka dia akan menyucikan hatinya pada bulan Sya’ban, dan orang yang akan menyucikan hatinya pada bulan Sya’ban akan menyucikan roh nya pada bulan Ramadhan. jab dan hatinya pada bulan Sya’ban, kapan lagi dia akan menyucikan roh nya pada bulan Ramadhan?”. Ahli Hikmah pernah berkata: “Sesungguhnya bulan Rajab itu untuk memohon ampun dari segala dosa, dan bulan Sya’ban untuk menyucikan hati dari segala cacat, dan bulan Ramadhan untuk memberi penerangan hati, sedang pada malam Lailatul Qadar adalah untuk mendekatkan diri kepada Allah”. Keutamaan bulan Sya’ban sebagai berikut, diantaranya: Pertama, Sesuai dengan hadits Rasulullah SAW yang bersumber dari Aisyah ra ia berkata, “Saya tidak melihat Rasulullah SAW menyempurnakan puasa satu bulan, kecuali puasa pada bulan Ramadhan, dan saya tidak melihat beliau lebih banyak berpuasa dalam suatu bulan dari padanya, selain bulan Sya’ban”. (HR. Bukhari). Kedua, dari Abdillah bin Abi Qais, bahwa ia pernah mendengar Aisyah ra, berkata: “Bulan yang paling disukai oleh Rasulullah SAW untuk melakukan puasa sunnah ialah bulan Sya’ban, bahkan beliau lebih banyak puasanya di bulan itu, kemudian Nabi berpuasa bulan Ramadhan”. (HR. An-Nasai). Dalam hal ini, mengapa Nabi SAW, mengistimewakan bulan Sya’ban dengan banyak melakukan puasa di bulan itu? Karena pada bulan Sya’ban, seluruh amal ibadah manusia diangkat (dilaporkan) kepada Allah SWT sebagaimana dijelaskan Rasulullah SAW, dari Usamah bin Zaid ra, ia berkata, “Saya pernah bertanya kepada Rasulullah SAW; “Saya belum pernah melihat engkau berpuasa dalam satu bulan diantara bulan-bulan lain, sebanyak puasa yang engkau lakukan di bulan Sya’ban, Rasulullah menjawab, bulan itu biasanya dilupakan orang, yaitu bulan antara Rajab dan Ramadhan. Bulan Sya’ban merupakan bulan diangkatnya amal-amal kepada Tuhan semesta alam, aku suka, ketika amal-amalku dilaporkan, sedang aku dalam keadaan berpuasa”. (HR. Ahmad dan Nasai) Ketiga, Rasulullah SAW banyak mengadakan ceramah atau ta’lim

pada akhir bulan Sya’ban untuk menyambut kehadiran bulan Ramadhan. Adalah Rasulullah SAW, pada hari yang terakhir atau di penghujung dari bulan Sya’ban mengadakan ta’lim atau berceramah dihadapan para sahabat untuk memberikan penerangan keutamaan dan keistimewaan bulan Ramadhan. Rasulullah SAW bersabda: “Wahai manusia sesungguhnya kamu akan dinaungi oleh bulan yang senantiasa besar lagi penuh keberkahan, yaitu bulan yang didalamnya ada satu malam yang lebih baik dari seribu bulan, bulan yang Allah telah menjadikan puasanya suatu fardhu dan qiyam dimalam harinya suatu tathawwu’. Barang siapa mendekatkan dirinya kepada Allah dengan suatu pekerjaan kebajikan didalamnya, samalah dia dengan orang yang mengerjakan tujuh puluh fardhu di bulan yang lain. Ramadhan itu adalah bulan sabar, sedangkan sabar itu pahalanya adalah surga”. (HR. Ibnu Khuzaimah dari Salman). Dari hadits tersebut, maka sudah sewajarnya setiap kita yang berada di bulan Sya’ban, dan akan memasuki bulan Ramadhan, mengadakan pertemuan, baik atas nama pengajian, perwiritan maupun atas nama lembaga-lembaga Islam lain, dengan memberikan petunjuk-petunjuk yang diperlukan masyarakat yang harus dilaksanakan di dalam bulan Ramadhan itu. Keempat, Menurut satu riwayat, Barang siapa berpuasa tiga hari pada awal bulan Sya’ban, dan tiga hari pada pertengahannya, tiga hari pada akhirnya, maka Allah akan menuliskan baginya pahala tujuh puluh orang Nabi, seperti orang yang beribadah kepada Allah selama tujuh puluh tahun, dan jika ia wafat pada tahun itu dia wafat sebagai syahid. Kelima, Barang siapa yang mengagungkan bulan Sya’ban dan bertakwa kepada Allah, melakukan ketaatan kepada-Nya dan menahan diri dari kemaksiatan, maka Allah SWT akan mengampuni dosanya dan memberi keamanan kepadanya dari musibah maupun penyakit yang terjadi pada tahun itu.AminYa Rabbal ‘Alamin. Wallahu A’lam.

WASPADA Jumat 29 Juni 2012

Mencintai Dan Mencontoh Nabi SAW Bangga Hidup Di Tengah Rakyat Miskin (3) Sejarah menunjukkan, betapa keras dan revolusionernya perjuangan Nabi Muhammad SAW. Baginda Rasul adalah penggembala kecil yang terus “konsisten” menjadi buruh hingga hari tuanya. Beliau bangga hidup di tengah orang miskin hingga detikdetik terakhir kehidupannya. Karena pilihannya sebagai nabi yang hamba-nabiyyan ‘abdan-bukan sebagai nabi yang raja, maka beliau mampu menjelma pembela sejati bagi kaum tertindas. Atau, sebutlah beberapa nama nabi dan rasul yang berasal dari strata paling bawah dalam piramida sosial. Nabi Nuh as tukang kayu yang nyambi menjadi guru atau Nabi Musa as yang penggembala. Nabi Ibrahim as hanya se-orang tukang pemecah batu dan Nabi Isa as, selain gembala, juga tukang kayu. Sepanjang hidup dan sepanjang misi kenabian serta kerasulan mereka, para nabi akan selalu berdiri di barisan paling depan dalam membela kaum tertindas dan lemah dalam menghadapi kelompok yang lebih kuat. Sebagai penjuru orang-orang bertakwa, maka para nabi dan rasul adalah pendekar-pendekar keadilan sepanjang masa. Tidak banyak nabi dan rasul yang bergelimang harta. Sudah barang pasti, nabi dan rasul bukanlah para masaakin dan fuqara yang meminta-mintaas-saa-il wal mahruum. Hanya, karena tingkat empati yang luar biasa, para nabi dan rasul dapat dengan mudah merasakan denyut nadi orang-orang miskin dan fakir. Semangat semacam ini pulalah yang mesti kita adopsi, umat Islam dan umat manusia, terlebih para ulama/ustadz/dai harus memberi contoh bagaimana hidup dan perjuangan serta contoh-contoh yang dilakukan Nabi Muhammad SAW. Bukan malah sebaliknya, hidup glamour, senang dekat para pejabat, apalagi sampai menjual ayat untuk mendapatkan materi di dunia yang fana ini. Intinya jangan kufur nikmat, jangan takut miskin. Yang penting berusaha dan tidak miskin iman, pun jangan menjauhi kaum marjinal. Begitu menakutkannya kemiskinan dan kefakiran sehingga Baginda Rasulullah mewanti-wanti umat Islam dengan sebuah doa yang beliau ajarkan, “Ya Allah, aku berlindung kepada-Mu dari kekafiran dan kefakiran.” (HR Abu Dawud). (Sumber hadis shahih/rep.)

Keutamaan Bulan Sya’ban Oleh Fachrurrozy Pulungan Sekretaris Majelis Dakwah Pimpinan Wilayah Al Washliyah Sumut.


idaklah Nabi SAW puasa dalam satu bulan seperti puasa di bulan Sy’ban, bahkan beliau pernah puasa hampir sebulan, hanya tinggal beberapa hari saja” H.R. Bukhari, Muslim dan Ahmad dari ‘Aisyah ra. Sya’ban adalah nama bulan dari dua belas bulan yang ada dalam kalender Islam. Dinamakan Sya’ban, karena orang-orang Arab pada bulan-bulan tersebut yatasya’abun/berpencar untuk mencari sumber mata air. Dikatakan juga karena mereka tasya’ub/berpisahpisah di gua-gua. Dan dikatakan juga sebagai bulan Sya’ban karena bulan ini muncul/sya’aba di antara dua bulan Rajab dan Ramadhan. Sebagaimana diriwayatkan dalam hadis Bukhori dari ‘Aisyah ra, bahwa Rasulullah Muhammad SAW berpuasa lebih banyak pada bulan ini. Sebagian ulama, di antaranya Ibnu Mubarak telah merajihkan bahwa Nabi SAW tidak pernah puasa sebulan penuh kecuali pada bulan Ramadahan, namun banyak melakukan puasa pada bulan Sya’ban. Berkata Ibnu Hajar, puasa Nabi SAW pada bulan Sya’ban sebagai puasa sunat lebih banyak dari pada puasanya di selain bulan Sya’ban. Dan beliau puasa untuk mengagungkan bulan Sya’ban. Dari Usamah bin Zaid ra, dia berkata , ‘ Ya Rasulullah, saya tidak pernah melihatmu berpuasa dalam satu bulan dari bulan-bulan yang ada seperti puasamu di bulan Sya’ban’. Nabi SAW bersabda, “ dzaka syahrun yagfulu al nasu ‘anhu baina Rajabi wa Ramadhana, wa hua syahrun tarfa’u fihi al a’malu ila rabbil ‘alamin wa ahabbu an yurfa’a ‘amali wa ana sho-im “/Itulah bulan yang manusia lalai darinya antara Rajab dan Ramadhan, dan bulan yang didalamnya diangkat amalanamalan kepada Allah, dan aku suka amalanku diangkat sedang aku dalam keadaan berpuasa. H.R. Na-sai dalam kitab al Targhib wa al Tarhib, al Mundziri Juz 2, hal. 33. Dalam sunan Abu Daud dinyatakan juga bahwa Rasulullah SAW sangat mencintai bulan Sya’ban, karenanya beliau berpuasa di dalamnya kemudian beliau sambung dengan Ramadhan. Dalam hadis yang diriwayatkan oleh imam Muslim dari Abu salamah, katanya, ‘ Aku pernah bertanya kepada ‘Aisyah ra tentang puasa Rasulullah SAW, lalu ia menjawab, ‘ Rasulullah SAW pernah berpuasa (sunat) sehingga kami mengatakan bahwa beliau berpuasa, dan beliau pernah tidak berpuasa sehingga kami katakan beliau tidak berpuasa, dan aku tidak mengetahui beliau puasa sunat di bulan-bulan lain yang lebih banyak dari bulan Sya’ban. Beliau pernah puasa penuh di bulan Sya’ban, juga pernah tidak penuh berpuasa di bulan Sya’ban’. Hadis ini juga dikeluarkan oleh imam Bukhari. Dari keterangan hadis di atas menunjukkan bahwa ketika bulan ini diapit oleh dua bulan Rajab dan Ramadhan, manusia sibuk dengan kedua bulan tersebut sehingga lupa dengan bulan Sya’ban, dan banyak kaum muslimin menganggap puasa pada bulan Rajab lebih utama dari bulan Sya’ban, karena Rajab termasuk bulan haram. Padahal tidak demikian, khusunya lagi pada separuh bulan dari Sya’ban/nisfu Sya’ban, terdapat keistimewaan yang banyak. Sebagaimana diriwayatkan dari ‘Ali ra, bahwa Rasulullah SAW bersabda, “ Apabila datang malam Nisfu Sya’ban, maka tegakkanlah malam nya (dengan sholat, dzikir), dan puasalah pada siangnya, sesungguhnya Allah Tabaraka wa Ta’ala turun dengan berfirman, ‘ barangsiapa hambaku datang memohon ampun, maka Aku ampuni dosanya, barang siapa datang meminta rezeki, maka Aku berikan . (kitab Tarhib wa al Targhib juz2). Hadis senada juga dikeluarkan oleh imam Muslim dalam shahihnya dari Imran bin Hushain ra, bahwa Rasulullah SAW pernah bertanya kepadanya atau kepada orang lain, “Apakah kamu berpuasa pada pertengahan Sya’ban?”. Ia menjawab,‘ Tidak’. Beliau bersabda,“ Apabila kamu terlanjur tidak berpuasa, maka berpuasalah selama dua hari”. Ibnu Rajab berkata, bahwa bulan Sya’ban lebih utama dari puasa bulan haram. Dan amalan sunat yang paling utama adalah yang dekat dengan Ramadhan sebelum dan sesudahnya. Kedudukan puasa Sya’ban diantara puasa yang lain sama dengan kedudukan shalat sunat rawatib terhadap shalat fardhu sebelum dan sesudahnya, yakni sebagai penyempurna kekurangan pada yang wajib. Maka oleh karena sunat-sunat rawatib lebih utama dari sunah muthlaq dalam shalat, demikian pula

puasa sebelum dan sesudah Ramadhan lebih utama dari puasa yang jauh darinya. Berkata Ibnu hajar, puasa Rasulullah SAW pada bulan Sya’ban lebih banyak dari bulan selainnya, dan puasa itu untuk mengagungkan bulan Sya’ban. Dalam hadis lain, terdapat dalil disunatkannya menghidupkan waktu-waktu manusia lalai darinya, yaitu waktu Asar dan antara Magrib dan ‘Isya. Pada waktuwaktu ini disunatkan memperbanyak shalat, dzikir dan membaca Alquran. Waktu Asar adalah waktu dimana manusia lalai darinya, disebabkan kesibukan-kesibukan dalam berdagang/bisnis dan pekerjaan-pekerjaan lain. Dan menghidupkan waktu-waktu yang kebanyakan manusia lalai darinya dengan ketaatan memiliki beberapa faedah diantaranya : 1. Menjadikan amalan yang dilakukan secara sembunyi. Dan menyembunyikan serta merahasiakan amalan sunat adalah lebih utama, terlebih-lebih puasa, karena merupakan rahasia antara hamba denga rabbnya. Oleh karena itu dikatakan bahwa padanya tidak ada riya. Sebagaian ulama salaf berpuasa bertahun-tahun, tetapi tidak ada yang mengetahuinya. Mereka keluar dari rumahnya menuju pasar dengan membekali dua potong roti, kemudian kedua potong roti itu disedekahkan dan ia sendiri berpuasa. Maka keluarganya mengira bahwa ia telah memakannya dan orang-orang di pasar menyangka bahwa ia telah memakannya dirumahnya. 2. Amalan shalih pada waktu orang banyak lalai, lebih berat bagi jiwa. Dan diantara sebab keutamaan suatu amalan adalah kesulitannya atau beratnya amalan itu. Karena apabila suatu amalan banyak dikerjakan orang, maka akan menjadi mudah. Tetapi apabila sedikit orang yang melakukannya, maka akan menjadi berat. Sebagai contoh, ketika semua orang melaksanakan puasa Ramadhan, maka kita tidak begitu berat melakukannya, sebab semua orang juga tidak makan dan minum. Akan tetapi manakala semua orang dalam satu hari melakukan kegiatan makan dan minum, sedang kita dalam keadaan berpuasa, akan terasa sangat berat dan menekan. 3. Faedah lain berpuasa di bulan Sya’ban sebagai awal atau pembuka latihan untuk bulan Ramadhan agar tidak mengalami kesulitan dan berat ketika memasuki Ramadhan, bahkan akan semakin bersemangat. Sebagian ulama, diantaranya Ibnul Mubarak telah merajihkan bahwa Nabi Muhammad SAW tidak pernah menyempurnakan puasa bulan Sya’ban akan tetapi beliau banyak berpuasa di dalamnya. Pendapat ini didukung oleh hadis yang diriwayatkan imam Muslim dari ‘Aisyah ra, katanya, ‘ Saya tidak mengetahui beliau SAW puasa satu bulan penuh kecuali Ramadhan’. Dan dalam Shahihain dari Ibnu Abbas ra, ia berkata, ‘ Tidaklah Rasulullah SAW berpuasa sebulan penuh selain Ramadhan’.Dari keterangan kedua hadis ini, maka para ulama sepakat bahwa puasa Sya’ban tidak boleh dilakukan selama sebulan penuh. Hal ini sejalan dengan hadis yang diriwayatkan oleh imam Bukhari dan imam Muslim dari Abu Hurairah ra, dari Nabi SAW sabdanya, “ Janganlah kalian mendahului Ramadhan dengan puasa sehari atau dua hari sebelumnya kecuali orang yang terbiasa berpuasa, maka puasalah”. Berkaitan dengan puasa diakhir bulan Sya’ban dapat dilakukan karena : 1. Berpuasa dengan niat puasa Ramadhan sebagai bentuk kehati-hatian, barangkali sudah masuk bulan Ramadhan adalah haram hukumnya. 2. Berpuasa dengan niat nadzar atau mengqadha Ramadhan yang lalu atau membayar kafarah, jumhur ulama membolehkannya. 3. Berpuasa dengan niat puasa sunat sebagai pemisah antara Sya’ban dan Ramadhan, bagi yang tidak terbiasa melakukannya makruh hukumnya. Hal ini untuk menjaga agar tidak ada penambahan pada waktu yang bukan termasuk Ramadhan, sebagaimana dilarangnya puasa pada satu hari raya. Peringatan serupa pernah terjadi kepada ahlul kitab yang menambah puasa mereka berdasarkan pendapat dan hawa nafsu. Selain itu, membedakan antara yang wajib dan yang sunat adalah disyari’atkan. Oleh karenanya diharamkan berpuasa pada satu Syawal. Dan sebagaimana Rasulullah SAW melarang untuk menyambung shalat wajib dengan shalat sunat sampai dipisahkan oleh salam atau pembicaraan. Wallahu a’lam.

Banyak kaum muslimin menganggap puasa pada Bulan Rajab lebih utama dari Bulan Sya’ban, karena Rajab termasuk bulan haram. Padahal tidak demikian.

Mimbar Jumat

WASPADA Jumat 29 Juni 2012


Wakaf Produktif Melalui RS & Masjid Sujud Syukur Menerima Nikmat Rasa syukur saat menerima nikmat dari Allah SWT seharusnya diwujudkan dengan melakukan sujud syukur. Itulah yang selalu kita lihat saat seorang atlet menjuarai turnamen, saat seseorang diumumkan meraih keberhasilan. Ucapan Alhamdulillah, Allahuakbar segera keluar dari mulutnya, sembari kaki dan tangannya menyentuh lantai. Dalam Islam sujud syukur merupakan aktualisasi atau bagian dari amalan positif (ibadah), di mana sujud yang dilakukan oleh seseorang ketika mendapatkan nikmat atau terhindar dari suatu bencana dikembalikan dengan mengingat kebesaran Sang Pencipta.Berdasarkan hadits disebutkan, “ketika datang berita gembira kepadanya, yaitu taubatnya diterima oleh Allah, maka ia pun bersujud” (HR. Bukhari).“Bahwasannya Nabi SAW apabila datang kepadanya suatu perkara yang menyenangkan, beliau langsung bersujud” (HR. Abu Dawud, Tirmidzi, Ibnu Majah). Terkait dengan sujud syukur ini para ulama bersepakat sujud syukur hukumnya tidak wajib, melainkan sunnah. Artinya, dikerjakan berpahala, tidak dikerjakan tidak mengapa. Tapi, alangkah baiknya jika yang sunnah ini dikerjakan sebagai pertanda kita terus mengingat pada kebesaran-Nya. Adapun tata cara sujud syukur seperti sujud dalam shalat saja. Namun, sujud syukur ini tidak disyariatkan untuk bersuci (thaharah/wudhu) dan menghadap kiblat, karena ini bukan shalat, hanya saja dianjurkan menghadap kiblat lebih baik jika kita mengetahuinya. Saat sujud, bacaannya adalah seperti bacaan ketika sujud dalam shalat. Kemudian setelah itu bertakbir kembali dan mengangkat kepala. Setelah sujud tidak ada salam dan tidak ada tasyahud. Siapapun melakukan sujud syukur selayaknya memperbanyak syukur kepada Allah SWT karena maksud sujud ini adalah syukur kepada Allah yang telah memberinya nikmat. (Sumber buku dan risalah hadits shahih).

Mempertahankan “Piala Kearifan” Oleh Agusman Damanik, MA Dosen Fakultas Agama Islam Universitas Al Wasliyah (UNIVA) Medan


ersama ketiga daerah di Sumatera Utara yaitu langkat, Deliserdang dan Tanjung Balai, Kota Medan Meraih Piala Adipura kategori Kota Metropolitan. Bahkan Kabupaten Langkat menerima dua Piala yaitu Adipura dan Adiwiyata Mandiri. Piala Adiwiyata Mandiri merupakan program dari Adiwiyata untuk sekolah yang mewujudkan sekolah berwawasan dan peduli lingkungan dan diberikan sebagai bentuk apresiasi kepada sekolah yang mampu melaksanakan upaya peningkatan pendidikan lingkungan hidup secara baik dan benar sesuai dengan kriteria yang telah ditetapkan, diantara sekolah dimaksud yaitu SD Gebang, SD Tanjung Pura, SD Sawit Seberang, SMP 1 Stabat dan SMP 1 binjai. Berbagai bentuk Piala yang telah diraih tersebut tidak hanya untuk kebanggaan semata, lebih dari itu berupaya mempertahankannya agar tetap termasuk dalam prioritas bagi yang menilainya. Upaya ke arah itu telah dilakukan Walikota Medan dengan rencana ditetapkan Peraturan Daerah (PERDA) bagi yang membuang sampah s e m b a ra n g a n a k a n d i p e n j a ra s e l a m a e n a m bulan. Hal tersebut mulai ditindaklanjuti dengan memberikan denda 5 Juta. Kesemuanya itu merupakan bentuk upaya mempertahankan piala, sebagaimana yang saat ini tengah dilaku-kan El Matador Spanyol dalam pertandingan sepak bola Euro 2012 di dua negara: Polandia dan Ukraina. Guru penulis pernah berkata”dalam hidup ini kita wajib mempertahankan ‘piala kearifan’ agar tidak hilang dari genggaman. Piala kearifan itu adalah Taqwa. Dalam kaitannya dengan taqwa Abdullah Yusuf Ali salah seorang penafsir kontemporer menuliskan dalam tafsirnya Pertama, takut kepada Allah yang merupakan awal dari kebijaksanaan.Kedua, menahan diri atau menjaga lidah seseorang, tangan dan hati dari perbuatan maksiat. Ketiga, kesalehan atau prilaku yang baik. Dan ketiga inilah menurut penulis piala kearifan itu. Mereka yang memiliki karakter tersebutlah yang akan mampu mempertahan piala kearifan. 1. Manusia yang bijaksana Manusia yang bijaksana adalah yang mampu memberdayakan potensinya ke arah yang lebih baik. Kata bijaksana sering disebut Hikmah atau Hikam, orang yang bijak dinamakan Al Hakim. Itulah sebabnya dibelakang nama Luqman ditambah dengan kata Al Hakim, karena nasehat beliau yang penuh hikmah kepada anaknya dan juga ditujukan kepada kita yang membaca dan mendengarnya. Berkaitan dengan pemikiran Abdullah Yusuf Ali dalam tafsirnya tersebut, bahwa orang yang bijaksana ternyata merasa takut kepada Allah Maha Pencipta. Namun Takut yang dimaksud bukanlah takut untuk berbuat, tetapi takut dimaksud adalah yang merasa khawatir dan gelisah bila “sang kekasih” yakni Allah SWT memutuskan hubungan cinta dengannya. Dengan kata lain orang yang bijak juga yang membumikan sifat-sifat Tuhan dalam kepribadian dan prilakunya. Di kalangan intelektual Iran, orang yang bi-jak dikenal dengan “Arif ”, yakni orang yang memiliki pengetahuan, baik tentang dirinya terlebih lagi tentang Tuhannya. Orang yang seperti inilah yang akan terus memberdaya-kan kualitas ketaqwaannya. Ketaqwaan yang sebenarnya, bukan ketaqwaan yang formalitas. Sebagaimana firman Allah surat Ali Imran ayat 102"Hai orang-orang yang beriman, bertaqwalah kepada Allah dengan sebenar-benarnya dan janganlah kamu mati kecuali dalam keadaan berserah diri kepada Allah (muslim)”.

Potret manusia yang bijaksana telah terdapat pada diri Rasulullah Saw. Betapa bijaknya beliau ketika Abu Bakar sedih dan khawatir kalau orang quraisy mengetahui tempat persembunyian mereka. Rasulullah berkata “ janganlah kamu takut dan jangan kamu bersedih hati, yakinlah Allah bersama kita”. Hal tersebut telah diabadikan Allah dalam firmannya surat Attaubah ayat 40" Jikalau kamu tidak menolongnya (Muhammad) maka sesungguhnya Allah telah menolongnya (yaitu) ketika orang-orang kafir (musyrikin Makkah) mengeluarkannya (dari Makkah) sedang dia salah seorang dari dua orang ketika keduanya berada dalam gua, di waktu dia berkata kepada temannya: “Janganlah kamu berduka cita, sesungguhnya Allah beserta kita.” Maka Allah menurunkan kete-nangan-Nya kepada (Muhammad) dan memban-tunya dengan tentara yang kamu tidak melihat-nya, dan Allah menjadikan seruan orang-orang kafir itulah yang rendah. Dan kalimat Allah itulah yang tinggi. Allah Maha Perkasa lagi Maha Bijaksana”. 2. Manusia yang istiqamah. Menurut Ibnu Rajab Al Hambali, Manusia yang istiqamah adalah yang menempuh jalan (agama) yang lurus (benar) dengan tidak berpaling ke kiri maupun ke kanan. Istiqamah ini mencakup pelaksanaan semua bentuk ketaatan (kepada Allah) lahir dan batin, dan meninggalkan semua bentuk larangan-Nya. Sering kita mendengar kata ini dan kita bercita-cita menjadi orang yang istiqamah. Untuk menjadi manusia yang istiqamah ada beberapa kiat agar kita menjadi manusia yang istiqamah yaitu; Pertama, memahami dan mengamalkan dua kalimat syahadat dengan baik. Kedua, mengkaji Alquran dengan menghayati dan merenungkannya. Ketiga, Iltizam atau konsekuen dalam menjalankan perintah Allah. Keempat,membaca kisah orang-orang yang soleh yang dapat dijadikan teladan dalam kehidupan.Kelima , memperbanyak doa kepada Allah agar tetap diberi keistiqamahan. Keenam, bergaul dengan orang-orang yang soleh. Bila keenam kiat tersebut dapat kita laksanakan, maka tidak perlu khawatir dengan berbagai problematika kehidupan, sebab Allah selalu bersama orang-orang yang istiqamah dan mencurahkan rahmat dan ketenangan, bahkan yang terpenting surga sangat”merindukan kehadirannya”. Sebagaimana firman Allah dalam Alquran surat Fussilat ayat 30" Sesungguhnya orang-orang yang mengatakan: “Tuhan kami ialah Allah” kemudian mereka meneguhkan pendirian mereka, maka malaikat akan turun kepada mereka dengan mengatakan: “Janganlah kamu takut dan janganlah merasa sedih; dan gembirakanlah mereka dengan jannah yang telah dijanjikan Allah kepadamu”. 3. Manusia yang soleh. Manusia yang soleh adalah yang memadukan dua kesolehan, baik kesolehan individual maupun kesalehan sosial. Terutama Kesolehan sosial, Husein Muhammad dalam bukunya Spiritualitas Kemanusiaan berpendapat bahwa kesolehan sosial memiliki dimensi sosial yang lebih luas dibandingkan dengan dimensi ibadah individual. Itulah sebabnya nabi mengajarkan kepada umatnya untuk sholat berjamaah, karena pahalanya 27 derajat dibanding dengan sholat sendirian. Ajakan tersebut menunjukkan pentingnya kesalehan sosial disamping kesalehan individual. Dengan demikian hanyalah manusia yang bijaksana, manusia yang istiqamah dan manusia yang soleh yang mampu mempertahankan “Piala Kearifan” dalam kehidupannya.

Oleh Azhari Akmal Tarigan Pengurus BWI Perwakilan Sumut Bidang Litbang


alah satu institusi ekonomi Islam yang saat ini sedang mendapat perhatian serius adalah wakaf. Wakaf sesungguhnya merupakan ibadah sosialekonomi yang cukup penting dalam Islam di samping ZIS. Kendatipun di dalam Alquran kita tidak menemukan kata wakaf dengan segala derivasinya, namun substansi wakaf sebagai amal sosial dan amal kebajikan banyak disebut Alquran. Penyebutan wakaf produktif mengandung arti suatu upaya transformasi dari pengelolaan wakaf yang alami menjadi pengelolaan wakaf yang profesional untuk meningkatkan atau menambah manfaat wakaf. Dengan kata lain wakaf produktif adalah proses pengelolaan benda wakaf untuk menghasilkan barang atau jasa yang maksimum dengan modal yang minimum. Dalam bukunya Wakaf Produktif, Jaih Mubarak menuliskan, jika yang dimaksudkan dari istilah wakaf produktif adalah meningkatkan nilai tambah, maka istilah yang paling tepat adalah “wakaf operatif ”. Kata operatif dalam ilmu manajemen mengandung arti aktifitas yang mentransformasikan input menjadi output yang bermanfaat berupa barang dan jasa. Sedangkan kata produktif hanya mentransformasikan input menjadi output yang bermanfaat berupa barang saja.Terlepas apapun namanya, wakaf produktif ataupun wakaf operatif, intinya adalah bagaimana para nazir dapat mengelola harta (tanah) wakaf sehingga mampu memberi nilai tambah terhadap manfaat yang dihasilkannya. Sampai di sini, kita perlu memiliki nazir-nazir wakaf yang memiliki mental entrepreneurship. Jadi tidak sebatas mental da’i -nazhir saja. Dalam pengelolaan wakaf produktif, bentuknya dapat digambarkan berikut ini. Pertama, Pengelolaan ditangani langsung oleh nazir wakaf produktif; baik oleh nazir berbentuk perseorangan, ataupun badan hukum. Model ini dapat dilakukan bila nazir memiliki waktu, keahlian dan pengalaman yang memadai. Kedua, Pengelolaan ditangani oleh Badan Eksekutif yang diangkat oleh nazir, yang memiliki komitmen, kompetensi, dan di-

hargai secara profesional. Adalah penting untuk dicatat, Nazir wajib memproduktifkan harta benda wakaf yang existing dimiliki, terutama wakaf harta tidak bergerak dalam bentuk tanah yang telah ada. Dalam upaya ini, maka Nazir dapat menghimpun wakaf uang dalam upaya pengadaan modal kerja untuk memproduktifkan harta wakaf berbentuk tanah. Tidak itu saja, Nazir dapat menghimpun wakaf produktif non uang, seperti wakaf apartemen, wakaf ruko, wakaf SBPU, wakaf mall, wakaf kebun. Dalam rangka pengembangan Wakaf Produktif, maka ada dua pemikiran yang penulis tawarkan dalam artikel yang singkat ini. 1. Rumah Sakit Wakaf. Di berbagai belahan bumi Indonesia, peraktik wakaf produktif sudah banyak dilaksanakan. Belakangan ini bentuk yang semakin banyak dikembangkan adalah Rumah Sakit Wakaf. Di Indonesia terdapat beberapa rumah sakit yang didirikan dengan harta wakaf. Organisasi keagamaan seperti Muhammadiyah mengelola Rumah Sakit PKU maupun dengan nama lain tersebar di berbagai tempat di Indonesia. Demikian juga NU. Lembaga-lembaga wakaf yang juga cukup banyak mengembangkan rumah sakit; seperti Badan Wakaf Sultan Agung Semarang yang mengelola rumah sakit Islam Sultan Agung, Yayasan Kesehatan Islam (YAKIS) Kudus yang mengelola Rumah Sakit Islam Sunan Kudus. Yayasan Universitas Islam Malang juga telah membangun Rumah Sakit Islam Malang. Menurut Yusuf Qardhawi, rumah-rumah sakit wakaf yang didirikan pada masa kejayaan Islam di atas dapat diakses secara gratis oleh semua orang, baik kaya maupun miskin. Pasien tidak perlu membayar biaya kamar, pemeriksaan dokter, obatobatan, selimut makanan dan seluruh pelayanan maupun fasilitas. Bahkan setelah sembuh pasien diberi bekal secukupnya untuk dibawa pulang agar tidak segera bekerja sebelum kesehatannya benar-benar pulih. Biaya seluruh operasional diperoleh dari hasil wakaf produktif yang

Terlepas apapun namanya, wakaf produktif ataupun wakaf operatif, intinya adalah bagaimana para nazir dapat mengelola harta (tanah) wakaf sehingga mampu memberi nilai tambah terhadap manfaat yang dihasilkannya. sengaja diwakafkan untuk memenuhi kebutuhan wakaf yang konsumtif. b.Pemberdayaan Lahan Masjid. Salah satu kekhasan tanah wakaf di Indonesia adalah banyaknya tanah wakaf yang dipakai untuk bangunan masjid. Sayangnya, tanah-tanah wakaf tersebut hanya dipakai untuk keperluan ibadah semata. Palingpaling pemanfaatannya ditambahkan untuk pembangunan madrasah. Banyak tanah wakaf yang di atasnya telah dibangun masjid tidak diberdayakan secara ekonomis. Achmad Djunaidi dan Thobieb Al-Asyhar di dalam bukunya Menuju Era Wakaf Produktif, membuat simulasi bagaimana tanah wakaf masjid dapat diberdayakan sedemikian rupa. Dikawasan elit Jakarta, misalnya Pondok Indah yang terdapat masjid sebenarnya dapat diberdayakan dan tidak sekedar hanya masjid yang berlantai II. Biasanya lantai satu digunakan untuk resepsi perkawinan dan lantai II digunakan untuk ibadah. Tanah masjid tersebut dapat saja dibangun gedung bisnis Islam (Wakaf Center) berlantai 15 yang megah. Sehingga bangunan masjid tersebut setara dengan gedung-gedung bertingkat yang berada di sekitarnya. Tentu saja pengelolaannya tetap berada di bawah naungan nazhir wakaf professional. Bangunan 15 lantai tersebut akhirnya tidak sekedar sebagai tempat resepsi pernikahan, tetapi bisa dijadikan toko, kan-torkantor dan hal-hal yang menghasilkan dari sisi ekonomis. Contoh sederhana adalah Masjid Muhammadiyah Bengkulu yang merupakan wakaf Datuk Hasandin, kakeknya Megawati Soekarnoputri dari jalur Fatmawati. Kompleks masjid itu tadi-

nya hanya seluas 400-an meter persegi. Lalu dikelola dengan membangun gedung tiga tingkat. Lantai bawah dijadikan lima unit rumah toko (ruko). Lantai kedua untuk masjid, dan lantai paling atas untuk kantor pengurus Muhammadiyah setempat dan lembaga onderbouw-nya. Masing-masing ruko disewakan dengan tarif Rp. 7 juta sampai Rp. 10 juta pertahun. Aneka kebutuhan tersedia di lima ruko tersebut. Mulai dari alat-alat listrik, pakaian, sepatu, sampai jam tangan. Animo pembeli juga tinggi. Akhirnya penyewapun tak merasa rugi. Hasil sewa ruko itu cukup untuk membiayai kebutuhan oprasional masjid. Menurut Asrori, Wartawan Gatra, Masjid Al-Azhar Jakarta dan Masjid Istiqamah Bandung juga telah melakukan pemberdayaan wakaf produktif dengan pemanfaatan tanah masjid dengan maksimal. Hemat penulis, tanah masjid yang sering disebut sebagai wakaf dalam makna yang sebenarnya sehingga masjid juga disebut “baitullah,” adalah wahana pengelolaan wakaf produktif yang potensial. Lebih-lebih pada saat kita belum menemukan tanah yang strategis. Di samping itu, pengelolaan tanah masjid dapat dijadikan media pembelajaran bagaimana seharusnya wakaf produktif itu dikelola. Sejatinya, wakaf produktif tidak lagi sekedar menjadi wacana dikalangan masyarakat muslim. Wakaf produktif harus menjadi bagian dari program ummat ini dalam rangka memberdayakan sesamanya. Para nazhir harus menyadari tugasnya bukan sekedar menjaga harta wakaf tetapi lebih dari itu adalah membuatnya menjadi produktif, sehingga memiliki nilai tambah yang tak terhingga. Semoga…

Syafi’i Mendahului Benjamin Bloom Oleh Abdul Hakim Siregar, MSI Penulis adalah Guru MSN2, MSYPKS, & SMASNI Padangsidimpuan


mam Syâfi‘i (150-204 H/767820 M), ilmuwan Fiqih Islam (Hukum Islam) dan mazhab (pengikut) Syâfi‘i telah lama mempopulerkan tiga bagian rukun shalat: Rukun Qalbiyah (niat shalat dalam hati), Rukun Qauliyah (bacaan shalat yang diucapkan, seperti bacaan takbir dan al-Fatihah), dan Rukun Fi’liyah (gerakan–gerakan shalat, seperti berdiri (jika mampu), rukuk, i‘tidal, sujud, dan duduk). Jadi, Syâfi‘i dan mazhabnya lebih duluan menemukan tiga rukun shalat daripada tiga domain pendidikan Benjamin S Bloom (1913 – 1999 M/1333-1420 H), tak-sonomi Bloom: kognitif (knowledge), afektif (attitude), dan psiko-motorik (skills). Syâfi‘i mendahului teori Bloom, sebelas abad lebih atau seribu seratus empat puluh enam (1146) tahun sebelum Bloom mengampanyekan tiga domain pendidikan. Tiga bagian rukun shalat jika dibandingkan dengan tiga domain pendidikan, hasilnya; Rukun Qalbiyah (afektif dalam pendidikan), Rukun Qauliyah (kognitif dalam pendidikan, menyangkut pengetahuan, hafalan hingga evaluasi), dan Rukun Fi’liyah (psikomotorik dalam pendidikan). Lagi-lagi, ulama Mutakalimîn (ahli teologi Islam) mendahului Benjamin Bloom, Aliran Asy’ariyah, yang dipelopori Abû Hasan AlAsy’ari (260-324 H/873-935 M) merumuskan definisi îmân: taqrîru bil-qalbi (dibenarkan dalam hati, afektif), wa iqrâru bil-lisâni (diucapkan secara lisan, kognitif–knowledge), dan wa ‘amalu bil arkâni (diamalkan dengan tindakan, psikomotorik). Jadi, Ulama Fiqih (ahli Hukum Islam) dan Ulama Kalam (usuluddîn) telah mengatur ranah hukum dan akidah. Rukun shalat misalnya mencakup: rukun qalbiyah, qauliyah, dan fi’liyah. Sehingga ibadah shalat yang dikerjakan sah sekaligus menjadi pendidikan dan kecerdasan terpadu, meliputi: qalbiyah (afektif), qauliyah (lisan; kognitif), dan fi’liyah (psikomotorik). Rukun Qalbiyah Wilayah qalbiyah atau afektif dalam pola keilmuan (pendidikan) kini berkisar dengan ilmu humaniora dan kemanusiaan, yakni IPS (Ilmu Pengetahuan Sosial). Tujuan pembelajaran ini, kecerdasan emosional (EQ). Daniel Goleman memaparkan

kecerdasan emosi (EQ), mencakup: pengendalian diri, semangat dan ketekunan, serta kemampuan memotivasi diri sendiri. Orang yang dikuasai dorongan hati–menderita kekurangmampuan pengendalian moral: Kemampuan mengendalikan dorongan hati merupakan basis kemauan (will) dan watak (character). Kerangka kerja kecakapan emosi meliputi: kecakapan pribadi dan sosial. Kecakapan pribadi ialah kesadaran diri, pengaturan diri, dan motivasi. Ada pun kecakapan sosial, yakni empati dan keterampilan sosial. [Kajian mendalam mengenai qalb (hati) dapat ditemukan dalam tasawuf Islam].

jiwa–ruhiyyah). Kecerdasan tersebut, kata Covey, menuntut empat dimensi pribadi utuh: fisik/ekonomis (PQ), mental/ intelektual (IQ), sosial/emosional (EQ), dan spiritual/kontribusi (SQ). Sekaligus mencerminkan empat kebutuhan motivasi dasar setiap orang: untuk hidup (bertahan hidup/ badan/PQ/fi‘liyah), menyayangi (hubungan pertalian/hati/EQ/qalbiyah), belajar (tumbuh berkembang/pikiran/IQ/qauliyah), dan meninggalkan nama baik (makna dan sumbangan/jiwa/SQ/ruhiyyah). Keutamaan kecerdasan spiritual (SQ), papar Danah Zohar dan Ian Marshall ialah daya ubahnya. Jika,

Ibadah shalat yang dikerjakan sah sekaligus menjadi pendidikan dan kecerdasan terpadu, meliputi: qalbiyah (afektif), qauliyah (lisan; kognitif), dan fi’liyah (psikomotorik). Rukun Qauliyah; Ranah qauliyah; lisan atau kognitif berkaitan dengan pola keilmuwan sekarang, seperti Matematika, Fisika, Kimia, dan Bahasa. Ini yang disebut IPA (Ilmu Pengetahuan Alam) kecuali yang terakhir tadi, bahasa. Tujuan mempelajari ilmu ini demi kecerdasan intelektual–logika–rasional (IQ). Hasilnya, teknologi, mekanis, dan teknis. Riset ilmiah mengacu pada keilmuan eksakta dan logika rasional, induktif dan objektif. Rukun Fi‘liyah; Daerah fi’liyah atau psikomotorik dalam pola keilmuan saat ini adalah pelajaran olahraga (Penjas) dan seni. Tujuannya, kecerdasan fisik (PQ). Kecerdasan Lain Howar Gardner menyebut kecerdasan kini, kecerdasan majemuk (multiple intelligences); kecerdasan musik, kecerdasan gerakan badan, kecerdasan logika-matematika, kecerdasan linguistik, kecerdasan ruang, kecerdasan antar pribadi, dan kecerdasan inter pribadi. Apa pun istilahnya, menurut Stephen R. Covey, manusia memiliki empat anugrah kecerdasan: kecer-dasan fisik (PQ/tubuh/ fi’liyah–penulis), kecerdasan mental (IQ/pikiran–qauliyah), kecerdasan emosi (EQ/hati–qalbiyah), dan kecerdasan spiritual (SQ/

kecerdasan emosi (EQ) terletak pada kemampuan mendeteksi situasi di tempatnya berada dan bersikap dengan tepat di dalamnya, tetapi EQ masih bekerja pada batasan situasi dan membiarkan keadaan itu mengarahkannya. Lain halnya dengan SQ, yang memungkinkan orang menjadi lebih kreatif, mengubah aturan dan situasi. SQ memungkinkan bermain pada batasan, atau ‘permainan tak terbatas.’ SQ memberikan kemampuan membedakan. SQ memberikan rasa moral, kemampuan menyesuaikan aturan yang kaku dibarengi dengan pemahaman dan cinta serta kemampuan setara untuk melihat kapan cinta dan pemahaman sampai pada batasannya. SQ digunakan untuk bergulat ihwal baik dan jahat, serta membayangkan kemungkinan yang belum terwujud untuk bermimpi, bercita-cita, dan mengangkat diri dari kerendahan. SQ memungkinkan seseorang bertanya; apakah memang ingin berada pada situasi itu? Ataukah lebih suka mengubah situasi tersebut, memperbaikinya? Dengan demikian, pola pendidikan dalam shalat, sebetulnya terkait dengan kecerdasan: qalbiyah (EQ), qauliyah (IQ), dan fi‘liyah (PQ), bahkan tentunya ruhiyyah (SQ). Ayat di bawah ini contohnya,

…Sesungguhnya shalat itu adalah kewajiban yang ditentukan waktunya atas orang-orang yang beriman. (Qs. An-Nisâ/4: 103). Jadi, shalat mengajarkan kedisiplinan waktu. Tentunya juga, keteraturan bacaan dan ketertiban urutan dan gerakannya. Bila tidak, shalat batal–tidak sah. Bacalah apa yang telah diwahyukan kepadamu, yaitu Al Kitab (Alquran) dan dirikanlah shalat. Sesungguhnya shalat itu mencegah dari (perbuatan-perbuatan) keji dan mungkar. Dan sesungguhnya mengingat Allah (shalat) adalah lebih besar (keutamaannya dari ibadah lain). Dan Allah mengetahui apa yang kamu kerjakan. (Qs. Al-Ankabût/29: 45). Ayat tersebut menegaskan keterkaitan membaca (tilawah Alquran) dan mendirikan shalat, sehingga shalat dapat mencegah perbuatan keji dan munkar. Lalu, bagaimana dengan pertanyaan sebagian orang bahwa ada orang yang gemar shalat, tetapi belum dapat mengakhiri kelakuan maksiatnya? Jawabannya, sebagaimana dipopulerkan Syâfi‘i, shalat melibatkan tiga aspek: Pertama, rukun qalbiyah/afektif. Berarti, ia mesti mempunyai keinginan kuat (niat) melakukan kebaikan atau menghentikan maksiatnya; Kedua, rukun qauliyah/kognitif/ knowledge. Niat saja belum cukup, ia juga harus memiliki pengetahuan–keterampilan teknis untuk melakukan perbuatan baik atau menghentikan maksiatnya; dan, Ketiga, rukun fi‘liyah/psikomotorik. Pada akhirnya, ia wajib bertindak– memiliki kekuatan dan kemampuan fisik untuk mengerjakan amal baik atau meninggalkan kelakuan maksiatnya. Prinsip itulah, yang oleh Stephen R Covey disebut dengan pola kebiasaan efektif (effective habits) sebagai titik temu dari: knowledge–pengetahuan (apa yang harus dilakukan, mengapa), skills–keterampilan (bagaimana melakukan), dan desire– keinginan (mau melakukannya). Dan itulah prinsip perubahan kebiasaan versi Stephen R Covey. Oleh Bloom diistilahkan dengan tiga domein: kognitif, afektif, dan psikomotorik. Sebagai muslim, kita melaksanakan kewajiban shalat. Syâfi‘i misalnya memasyhurkan tiga rukun dalam shalat, mencakup: niat, bacaan, dan gerakan. Jika ini dimaknai, shalat sangat berarti dalam pendidikan dan kecerdasan.

Mimbar Jumat


WASPADA Jumat 29Juni 2012

Jejak Islam Di Inggris Islam sekarang menjadi agama terbesar kedua di Inggris. Ketika kerusuhan melanda kota-kota besar di Inggris beberapa waktu lalu tidak sedikit warga muslim yang menjadi korban. Kehadiran muslim di Inggris sudah berlangsung selama tiga abad. Keberadaan muslim di negeri kerajaan itu berhubungan dengan East India Company yang merekrut pelaut yang dikenal sebagai laskar dari India. Peningkatan jumlah kaum muslim di Inggris setelah dibukanya terusan Suez tahun 1869 ketika sejumlah besar orang-orang Yaman dan Somalia direkrut di Aden. Orang-orang Yaman khususnya tinggal di Cardiff dan South Shields dan warga Somalia menetap di Liverpool. Kendati demikian, populasi muslim di Inggris tidak lebih dari 15.000 jiwa. Tetapi mereka adalah penduduk permanen pertama muslim di Inggris. Komunitas Yaman secara signifikan dipengaruhi ajaran Sufi Alawi yang tiba di Inggris pada awal abad ke20. Pusat-pusat kelompok muslim khususnya dari Yaman awalnya menetap di pelabuhan-pelabuhan dan kemudian menyebar ke Sheffield dan Birmingham. Komunitas Yaman mengembangkan Islam pada awal abad ke-20 di Liverpool, London dan Woking. Sementara muslim dari India terdiri dari para pedagang, anggota aristokrasi India dan para mahasiswa yang ingin menuntut ilmu di Inggris. Jorgen Nielsen menulis dalam bukunya Moslem In Western Europe, dokter pribadi Ratu Victoria adalah seorang muslim. Keberadaan muslim di Inggris inilah yang bertanggungjawab mendirikan masjid pertama di Inggris pada akhir abad ke-19. Pada tahun 1887 seorang muallaf dari bangsawan Inggris Hendry William Quilliam mengadakan perjalanan ke Maroko. Dengan mengganti nama Syekh

Abdullah, ia mendirikan masjid, merayakan upacara perkawinan islami kaum muslimin yang menikah, berusaha mendapatkan lokasi kuburan khusus orang-orang muslim di Inggris dan mengajar orang-orang yang baru masuk Islam di Liverpool. Selama hidupnya, Syekh Abdullah sudah mengIslamkan 150 warga Inggris. Sultan Ottoman menunjuk Syekh Abdullah sebagai Syaikh Al-Islam atau anggota senior ulama dan ahli agama Islam di Inggris dan menjadikannya Amir atau pemimpin militer dan gubernur Afghanistan. Jabatan itu digunakan Syekh Abdullah untuk mencari dana membangun gedung yang sekarang digunakan sebagai Institut Islam di Liverpool. Masjid tertua di Inggris adalah Masjid Shahjehan dibangun di Woking pada tahun 1889. Seorang orientalis Hongaria yang masuk Islam bermana Dr. Leitner membujuk penguasa negara bagian Bopal di India untuk membiayai satu komplek perpustakaan, asrama, masjid dan bahkan sebuah universitas Islam. Namun, Leitner hanya mendapat dana untuk pembangunan asrama dan masjid dari penguasa Bopal. Pada akhir perang dunia pertama, Lord Headley dan pemimpin muslim lain di Inggris mendiskusikan ide pendirian masjid terbesar di London. Pada tahun 1928, lembaga London Nizamiah Trust didirikan untuk mencari dana pembangunan masjid itu. Namun kemajuannya terlalu lambat sampai akhir perang dunia kedua masjid itu belum didirikan. Tanah tempat masjid itu dibangun disumbangkan raja Inggris George VI di kawasan Regent Parks sebagai balas budi sang raja kepada penguasa Mesir yang

juga menyumbangkan tanah untuk pendirian katedral Anglikan terbesar di Kairo. Pada November 1944, Islamic Cultural Centre dibuka oleh Raja George VI sendiri. Tahun 1947, sekitar 13 duta besar dari negaranegara muslim mendirikan lembaga Central London Mosque Trust untuk mencari dana mendirikan masjid itu. Peletakan batu pertama masjid dimulai tahun 1954 dan karena berbagai kendala keuangan dan teknis masjid itu baru selesai pada tahun 1977. Masjid itu menjadi bangunan tempat ibadah kaum muslimin terbesar di Inggris. Sejalan dengan bertambahnya populasi kaum muslimin di Inggris yang datang dari berbagai negara seperti dunia Arab, Iran, Malaysia, Turki, Maroko, Siprus, Afrika timur dan barat sebagai dampak pergolakan politik negara-negara jajahan dan sebagai mahasiswa atau pedagang. Pada tahun 1950, Inggris menerima 10.000 imigran muslim dari India, Pakistan dan Bangladesh. Imigran muslim dari anak benua yaitu sebutan untuk negara India yang merupakan jajahan Inggris terkait dengan kebutuhan negara kerajaan itu dengan tenaga kerja murah atau untuk bergabung dengan keluarga mereka yang sebelumnya sudah tinggal di Inggris. . Philip Lewis dalam bukunya Islamic Britain mencatat bahwa pada perang dunia ke II, sebagai negara kolonialis yang memiliki banyak negara jajahan kerajaan Inggris merekrut serdadu angkatan lautnya dari kalangan muslim India mencapai 20 persen dari kesluruhan jumlah tentaranya. Menurut sensus tahun 1991, jumlah kaum muslimin di Inggris 1,5 juta jiwa dengan komposisi

Shahjahan, masjid pertama dan tertua di Woking, Inggris dari Pakistan, Bangladesh, India, Afrika timur, Turki, Iran dan Malaysia. Kini jumlah kaum muslimin di Inggris lebih tiga juta jiwa, peringkat kedua terbesar di Eropa setelah Prancis. Muslim di Inggris hidup dalam kelompok-kelompok atau organisasi sesuai dengan aspirasi dan dari mana mereka berasal. Ada kelompok Deobandi, Barelwi, Ahl-i Hadith, Ahl-i Qur’an, Jamaat al-Tabligh dan Jamaat-i Islami. Dua organisasi terbesar adalah Deobandis dan Barelwis. Dua kelompok ini juga sangat tekenal di India. Kelompok dan ajaran sufi juga berkembang di masyarakat Islam Inggris. Ajaran sufi Naqsbandiyya, Qadiriyya dan Chishtiyya sangat berpengaruh di kalangan muslim Inggris. Aliran dan kelompok sufi ini tidak hanya diikuti muslim dari India, tapi juga dari

Turki, Malaysia, Afrika barat dan beberapa komunitas Arab. Sekolah Alquran dan pendidikan yang terpusat di masjid dimaksudkan orangtrua muslim untuk membentengi pengaruh westernisasi, budaya sekuler dan mempertahankan budaya islami. Beberapa malam dalam seminggu anakanak muslim khususnya yang lahir di Inggris belajar Alquran, bahasa Arab, hukum-hukum Islam dan ba-hasa leluhur kedua orangtua mereka. Organisasi dan gerakan Islam berpengaruh mendirikan dar al ulum atau institusi pendidikan agama lebih tinggi yang kebanyakan materi pendidikannya pelajaran agama Islam dan dikombinasikan dengan beberapa subjek dari kurikulum pendidikan negeri Ratu Elizabeth itu. Lembaga pendidikan itu berdasarkan kurikulum pelaja-

ran agama dari negeri asal imigran muslim yaitu india yang bertujuan untuk mencetak para ulama Islam di Inggris. Tidak sedikit organisasi atau lembaga Islam di Inggris dikaitkan dengan kelompok militan atau jaringan teroris. Apalagi setelah iman Khomeini mengeluarkan fatwa halal membunuh Salman Rushdie, seorang warga Inggris keturunan India yang merendahkan dan menghina agama Islam melalui bukunya Satanic Verses. Sebenarnya fundamentalis Islam harus dilihat sebagai gerakan protes atau dampak dari gesekan dan ketegangan sosial dan politik yang terjadi di dunia Islam kontemporer karena Inggris yang memiliki banyak negara jajahan di dunia muslim. Selain itu, gerakan terorisme terus berkembang sebagai dampak dari standar ganda dan ketidakadilan barat tehadap dunia Islam. Fundamentalis Islam dan terorisme menimbulkan streotipe

yang jelek bagi Islam di Inggris khususnya dan dunia umumnya. Pada tahun 1990, Kalim Siddiqui seorang anggota Muslim Institute di London membentuk Muslim Manifesto yaitu perwakilan kaum muslimin di parlemen sebagaimana wadah Board of Deputies yang mewakili orang-orang Yahudi di parlemen Inggris. Islam sekarang menjadi agama terbesar kedua di Inggris. Ketika kerusuhan melanda kota-kota besar di Inggris beberapa waktu lalu tidak sedikit warga muslim yang menjadi korban. Kaum muslimin juga membantu tetangga mereka yang non muslim yang menjadi korban kerusuhan itu. Tiga remaja muslim tewas dalam huru-hara itu karena membantu tetangga mereka yang non muslim diserang para penjarah. Nurhayati Baheramsyah/ Islam Outside the Arab World

Pertanggungjawaban Hidup Yang Hakiki Menghayati Makna Kematian Dra Hj.Rayani Hanum Srg, MH.

Ketua Komisi Pemberdayaan Perempuan DP.MUI Kota Medan, Dosen Kopertis Wil SUMUT-NAD Dpk STIH Swadaya.


angat menarik apa yang dituliskan Syaikhul Hadi pertanggungjawabannya nanti di hadapan Allah semua dalam buku Cermin Hati, sebuah kisah Khalifah akan terungkap perbuatan buruknya itu.Hal ini sesuai apa Umar bin Khattab. Pada suatu hari Umar meyang dinyatakan Allah dalam Alquran Surat An Naba’ ayat 40 “Sesungguhnya kami peringatkan kepadamu (hai ornyewa seekor unta untuk pergi menjenguk sahabatnya ang kafir) akan siksa yang dekat, pada hari manusia yang sedang sakit. Karena Umar bertubuh tinggi, maka melihat apa yang diperbuat oleh kedua tangannya, dan dalam perjalananUmar tanpa sadar sorban yang orang kafir itu berkata: “alangkah baiknya sekiranya aku dipakainya tersangkut di sebuah pohon karena ia begitu dahulu adalah tanah”. Ayat ini memperingkatkan kita asyik berdzikir kepada Allah. bahwa sebuah pertanggung jawaban itu sangat penting Lalu, ada seorang laki-laki yang memperingatdifikirkan manusia. Difikirkan sebagai sebuah pertangkannya dalam perjalanan itu. Umar pun turun dari atas gungjawaban yang harus direalisasikan di akhirat kelak. unta dan menitipkan unta tersebut pada lelaki itu. Umar Banyak pertimbangan yang harus diambil sebagai bergegas mengambil kembali sorbannya yang hikmah dari sebuah kehidupan, manusia, dengan tersangkut. Lelaki itu heran melihat kelakuan sahabat perputaran roda kehidupannya sering menjadi tidak Umar, lalu lelaki itupun bertanya, “Hai Amirul seimbang. Pergantian baik dan buruk, bahagia dan sedih Mukminin, kenapa tidak tuan naiki saja unta ini untuk bahkan senang dan susah. Sering sekali membuat hidup pergi ke pohon itu, lalu kembali lagi, atau biarlah saya manusia juga ikut berubah, bahkan tingkat keimanan yang mengambil sorban tuan,” katanya. pun berubah. Yang Lalu, Umar pun paling berbahaya menjawab. “Jika kaadalah, jika tingkat mu yang pergi mengambilkannya, itu Memperbanyak mengembalikan semua perubahan kekuatan keimanan tidak perlu, karena ingatan pada sebuah pertanggungja- itu menurun dan itu bukan sorbantidak disadari oleh mu dan kamu buwaban kelak di hadapan Allah akan manusia. kan budakku. SeKarenanya, dangkan kenapa menjadi salah satu alat meminimalisir memperbanyak aku tidak menungkeegoan diri untuk berbuat semaunya. diri mengembaligangi unta itu untuk kan semua ingamengambil sorbantan pada sebuah ku kembali, itu karpertanggungena unta itu hanya jawaban yang kelak akan disampaikan di hadapan Alaku sewa untuk pergi dari rumahku menuju ke tempat lah akan menjadi salah satu alat meminimalisir keegoan tujuanku, dan tidak ada perjanjian untuk aku pakai diri untuk berbuat semaunya. Keadilan Allah akan kembali lagi, meskipun selangkah saja.” sampai pada memberi imbalan dari semua perlakuan Lalu, si lelaki mengatakan, “Apakah itu bukan hal yang kita selama di dunia ini. Sebab dunia adalah tempat sangat se-pele ya Amirul Mukminin?” Umar pun marah dimana manusia harus membuktikan eksistensi dengan me-nyatakan Fir-man Allah dalam Q.S.An Nur kehambaannya di hadapan Allah. ayat 15 yang artinya “Dan kamu me-nganggapnya suatu Motivasi Bagi Pengemban Amanah yang ri-ngan, padahal di sisi Allah adalah berat .” Terkhusus kepada orang-orang yang sedang Sebuah pertanggungjawaban yang hakiki sesungmenjalankan amanah, baik di pemerintahan maupun guhnya ada di hadapan Allah. Namun, acapkali kita dimana saja. Dan khusus juga bagi orang yang memsering lupa bahwa Allah Yang Mahatahu tidak pernah persiapkan diri untuk menerima amanah. Harus ada luput dari apapun yang kita kerjakan di dunia ini. Sering evaluasi diri untuk mempersiapkan diri sepenuhnya, kita menyembunyikan perbuatan, padahal dilihat Alapakah diri ini benar-benar siap mengemban amanah lah secara nyata. Ketakutan kita, masih sebatas pada yang kelak harus dipertanggungjawabkan di hadapan nilai keduniaan, sehingga kita sering dibutakan oleh Allah sekecil apapun itu; problematika dusta, meperbuatan yang seharusnya kita takut mengerjakannya. nyelagunakan wewenang, berbuat tidak adil, memenSeharusnya kita malu dan merasa berdosa melakutingkan salah satu pihak, dan semacamnya adalah satu kannya. Namun, karena nilai keimanan yang ada dalam hal besar di bawah naungan pertanggungjawaban— hati kita masih setipis kulit bawang. Jadilah ketakukan seolah dianggap kecil dan biasa. Inilah salah satu itu menjadi sebuah kebiasaan hidup. problematika kehidupan kita sebagai manusia. Kisah Umar bin Khattab memberi cerminan kepada Jangan sampai niat baik menerima jabatan sebagai kita bahwa sesungguhnya nilai dari sebuah pertangamanah dibarengi luapan nafsu dan egoisme diri. gungjawaban itu harus dimulai dari kehidupan di dunia Sehingga lupa akan pertanggungjawaban amanah ini. Merasa bahwa Allah melihat di setiap apapun yang tersebut nantinya di hadapan Allah. Bagi semua calon kita kerjakan dan perbuat. Dan harus juga diyakini anggota legislatif, dan eksekutif hendaklah menyerahkan bahwa setiap bagian tubuh kita akan memberi persegalanya kepada Allah dengan itikad penegasan— tanggungjawabannya masing-masing di hadapan Alsemua amanah yang akan diemban kelak adalah sebuah lah. Tidak akan ada nilai kebohongan yang tertutup lagi. pertanggungjawaban yang akan disampaikan di hadapan Karenanya, kita harus memulai melatih hati dan jiwa Allah. Karenanya, selain dari usaha yang maksimal, ini untuk terbiasa jujur atas sebuah pertanggungbermohonlah atas bimbingan Allah, agar setiap jawaban selama hidup di dunia ini. perlakuan dan pekerjaan, dihindari dari semua yang Akhirnya, akan ada filterisasi dalam setiap per-buatan melenceng dari amanah yang telah diberikan. yang dilakukan seorang Muslim. Dengan sendirinya, ia Akhirnya, semoga kita menjadi orang-orang yang akan merasa bahwa sebuah perbuatan ini pantas atau benar-benar amanah dan bisa mempertanggungjatidak. Semuanya adalah pertimbangan keimanan dan wabkan semua apa yang kita lakukan di hadapan pertanggungjawaban di hadapan Allah. Bisa dibayangAllah SWT. Amin. kan, betapa malunya seorang Muslim ketika dalam

(Kajian Q.S. Fushshilat ayat 30-31) Oleh Achyar Zein Dosen Fakultas Tarbiyah IAIN Sumatera Utara


ahir, hidup dan mati adalah perjalanan yang harus ditempuh oleh setiap manusia namun lahir dan hidup hanya berlangsung dengan waktu yang sangat singkat dan masih dapat dihitung dengan jari. Berlainan halnya dengan mati dimana waktunya hampir tidak pernah berkesudahan sehingga diperlukan bekal yang cukup untuk menghadapinya. Bila dilakukan perenungan secara mendalam maka hidup yang sebenarnya adalah mati sedangkan hidup yang kita rasakan sekarang itulah mati yang sebenarnya. Kehidupan harus diisi dengan kerja keras hanya untuk mereguk secuil kebahagiaan dan beberapa saat ke depan kebahagiaan yang sudah kita rasakan sudah tidak bahagia lagi dan kita terus sibuk untuk mencari kebahagiaan yang lain. Kebahagiaan yang berpindahpindah ini menunjukkan bahwa kita sudah mati karena tidak ada lagi jiwa dan perasaan kita untuk menikmatinya. Seseorang yang baru memiliki rumah dan kendaraan akan merasa bahagia namun ketika semua ini sudah dirasakannya maka yang bersangkutan tidak bahagia lagi dengan itu. Petani yang hidup di kampung menduga bahwa kehidupan di kota besar penuh dengan kebahagiaan sedangkan orang-orang yang hidup di kota selalu membayangkan bahwa kehidupan petani di kampung adalah kehidupan yang bahagia. Perasaan yang seperti ini pada prinsipnya memberikan gambaran bahwa kebahagiaan hidup di dunia sebenarnya tidak ada atau tidak lebih kecuali hanya sekadar fatamorgana. Keadaan yang seperti ini seharusnya memberikan pelajaran kepada kita untuk beralih mencari kebahagiaan di alam lain dan inilah yang disebut dengan mati. Kebahagiaan yang ada di alam kematian sudah disebutkan oleh Allah dalam Alquran agar manusia mempersiapkan bekal untuk itu. Oleh karena itu, kematian adalah istirahat dari pekerjaan yang selalu mengukur dunia yang tidak berbatas. Jika dengan demikian maka pemikiran kita perlu di balikkan supaya sibuk memikirkan kematian karena di

sinilah letak kebahagiaan yang hakiki. Berdasarkan hal ini maka sudah sewajarnya jika kita memandang bahwa kehidupan dunia adalah kehidupan yang sangat singkat dan karenanya jangan dikotori dengan perbuatanperbuatan yang tercela. Semua manusia baik mukmin maupun kafir mengakui bahwa kematian pasti akan datang. Walaupun kematian merupakan sesuatu yang sudah pasti namun sebagaian besar di antara manusia banyak yang takut menghadapinya. Ketakutan dalam menghadapi kematian disebabkan adanya keraguan bahwa kehidupannya selama di dunia

sebaliknya bila dunia dipahami sebagai tujuan maka hukumhukum Allah selalu diabaikan. Konsekwensi yang diterima ketika menjadikan dunia sebagai tujuan adalah kehidupan yang melarat ketika berada di alam akhirat. Untuk memberikan kesadaran kepada manusia bahwa dunia hanya sebatas sarana maka Allah memerintahkan kita untuk banyak mengingat mati. Ada juga yang memahami jika terlalu banyak mengingat mati maka dapat menumbuhkan sikap statis bahkan mundur. Pemikiran yang seperti ini tidak hanya salah akan tetapi menunjukkan ketololan yang luar biasa karena mengingat

Allah tidak pernah melarang kita untuk merebut dunia asalkan dipahami bahwa dunia adalah sarana bukan merupakan tujuan. hanya diisi dengan sesuatu yang tidak bermanfaat. Berlainan halnya dengan orang-orang yang taqwa dimana kematian merupakan sesuatu yang sudah lama mereka rindukan. Menarik sekali pernyataan Jalaluddin al-Rumi bahwa jika seorang janin diberitahu bahwa hidup di dunia lebih baik dari kehidupan di dalam rahim maka dapat dipastikan bahwa sang janin akan berontak untuk tidak mempercayainya. Ketika sang janin lahir ke dunia barulah dia menyadari akan hal itu dan inilah kita sekarang. Selanjutnya ketika kita hidup di dunia ini dengan segala keglamourannya tiba-tiba Allah menyebutkan bahwa ada kehidupan yang lebih baik dari dunia yaitu akhirat. Pernyataan Allah ini kebanyakan dijawab seperti jawaban dalam janin bila dilihat dengan keserakahan manusia yang mengejar kehidupan dunia yang seolaholah tidak peduli dengan kehidupan akhirat. Allah tidak pernah melarang kita untuk merebut dunia asalkan dipahami bahwa dunia adalah sarana bukan merupakan tujuan. Bila dunia dipahami sebagai sarana maka hukum-hukum Allah selalu dijadikan panduan,

kematian akan membuat seseorang lebih kreatif karena bekerja itu sendiri adalah ibadah. Dunia adalah kehidupan sementara dan sesaat namun sangat menentukan kehidupan yang sesungguhnya di hari akhirat. Meskipun demikian maka dunia adalah merupakan tiket untuk menentukan posisi seseorang apakah sebagai penghuni surga atau penghuni neraka. Baik tidaknya pekerjaan yang dilakukan oleh seseorang semasa hidup adalah merupakan taruhan untuk menghadapi kehidupan yang sebenarnya yaitu kehidupan hari akhirat. Tidak dapat dipungkiri bahwa sebagian besar di antara kita banyak yang kurang memahami arti kehidupan dunia yang sesungguhnya. Kemudian banyak juga yang terlena dengan kemegahan dan keglamouran dunia yang sesungguhnya hampa. Mereka seolah-olah memahami bahwa kehidupan dunia adalah segalagalanya dan yang dicari adalah kesenangan semata tanpa memperdulikan hukum-hukum Tuhan. Mereka ini telah digambarkan dalam Alquran QS. al-Baqarah ayat 86 sebagai agen untuk men-jual akhirat demi kepentingan dunia. Dalam Alquran banyak sekali terdapat kecaman tentang kehi-

dupan dunia di antaranya disebutkan bahwa dunia adalah kesenangan yang menipu daya (Ali Imran: 185) dan permainan dan senda gurau (al-An’am: 32). Bila dunia adalah sebagai permainan dan senda gurau maka kehidupan di dalamnya tidak pernah abadi dan kenikmatan di dalamnya hanya bersifat semu dan sementara. Bukankah Allah telah menegaskan dalam Q.S. al-Dhuha bahwa kehidupan akhirat jauh lebih baik dari kehidupan dunia? Berdasarkan pernyataan di atas maka kematian hanyalah perpindahan dari alam mimpi ke alam nyata. Menurut al-Raghib al-Ashfahani sebagaimana yang dikutip oleh Prof. Dr. Quraish Shihab bahwa kematian merupakan tangga menuju kebahagiaan abadi. Mati merupakan perpindahan dari suatu tempat ke tempat lain sehingga dengan demikian maka kematian adalah merupakan kelahiran baru bagi manusia. Kehidupan manusia di dunia adalah ibarat telur dengan anak ayam dan kesempurnaan wujud anak ayam karena menetasnya telur. Oleh karena itu kematian adalah pintu menuju kesempurnaan, kebahagiaan dan surga yang abadi. Apabila persiapan menghadapi maut sudah lengkap dan sempurna maka kehadirannya selalu dirindukan karena mati itu sendiri adalah nikmat. Kenikmatan hidup adalah kenikmatan yang semu lagi membosankan dan tidak jarang sese-orang berpindah dari satu nikmat untuk menuju nikmat lainnya. Schopenhouer sebagaimana yang dikutip oleh Quraish Shihab mengatakan bahwa mengantuk itu adalah nikmat dan tidur jauh lebih nikmat dari mengantuk dan adapun nikmat yang lebih sempurna dari pada tidur adalah kematian. Kematian dapat menjadi nikmat apabila dilengkapi dengan bekal yang sempurna dan bagi yang tidak memiliki bekal maka kematian baginya adalah malapetaka. Meskipun demikian namun kematian tetap saja akan datang dan tidak peduli apakah yang bersangkutan sudah memiliki bekal atau tidak. Alquran menyebutkan bahwa mati pasti akan datang walaupun yang akan dijemput berlindung di balik tembok besi sekalipun, demikian disebutkan dalam QS. al-Nisa’ ayat 8.

Waspada, Jumat 29 Juni 2012  

waspada daily