Page 1

Siapa Imam Anda...? Lihat hal. C4 Dan C5

Masjid Raya Medan

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Kliwon, 28 September 2012/12 Zulqaidah 1433 H

Ancaman Banjir Masih Cukup Besar

Terbit 28 Halaman (A1-8, B1-12, C1-8)

No: 23996 Tahun Ke-66

6 Brimob Dan 3 Anggota Polres T. Balai Dipecat

Lokasi Perang Uhud Ramai...

MEDAN (Waspada): Masyarakat diingatkan meningkatkan kewaspadaan disebabkan hujan lebat dan merata sedang melanda Sumatera Utara. Tingginya intensitas curah hujan, beberapa daerah di Sumut berpeluang ancaman banjir dan longsor. Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I, berulang kali memperingatkan warga agar lebih hati-hati , sebab ancaman banjir masih cukup besar. Mega Sirait, SP, kepala bidang Data dan Informasi (Datin) pada BMKG Wilayah I membenarkan hal itu saat dikonfirmasi di Bandara Polonia Medan, Kamis (27/9), berkaitan meningkatnya intensitas curah hujan di Sumatera Utara. Lanjut ke hal A2 kol. 3

Ibu Rumah Tangga Dan Perampok Berkelahi Satu Masuk RS, Satu Masuk Bui SEIBAMBAN (Waspada): Perkelahian antara perampok dan korbannya mengakibatkan satu orang masuk rumah sakit dan satu orang masuk bui. Korban, Siti Eliani, 35, warga Dusun XI, Pintu Air, Desa Suka Damai, Kec. Sei Bamban, Kab. Serdang Bedagai kepada Waspada di RSU Melati Desa Pon mengatakan, Kamis (27/9) pagi, ia menjenguk tetangganya yang sakit dengan

Lanjut ke hal A2 kol. 7

Harga Eceran: Rp2.500,-

MEDAN (Waspada): Enam anggota Brimobda Sumut dan tiga anggota Polres Tanjungbalai dipecat dari kesatuan karena terlibat berbagai kasus narkoba, perampokan, disersi atau tidak masuk dinas lebih dari 30 hari tanpa pem-beritahuan. Prosesi pemecatan ke enam anggota Brimob tersebut dilaksanakan di Mako Brimobda Sumut Jl. KH Wahid Hasyim Medan, Kamis (27/9). Dari enam orang tersebut hanya dua yang hadir. Ke enam anggota yang dipecat, Bripka Hariadi, Briptu Indra Hidayat Siahaan, Bripda Erwansyah. Ketiganya dipecat karena meninggalkan wilayah tugas secara tidak sah dalam waktu lebih dari 30 hari secara berturut. Lanjut ke hal A2 kol. 5


MADINAH (Waspada): Sejumlah jamaah calon haji dari seluruh dunia termasuk dari Indonesia kemarin mengunjungi lokasi perang Uhud di Madinah, sekaligus berziarah. Lokasi perang Uhud (foto), merupakan salah satu lokasi kuno bersejarah bagi umat Islam. Lebih dari 10 bus membawa para jamaah dari berbagai negara untuk menziarahi lokasi wafatnya para syuhada yang mati di medan perang dalam menegakkan agama Allah. “Ini merupakan pertama kali saya mengunjungi lokasi bersejarah yang menjadi saksi pengorbanan umat Muslim dalam upaya penyebaran agama,” ujar Shahid Muhammad Akhtar asal Pakistan, salah satu pengunjung yang berada di Gunung Rumat, dengan membawa kameranya. Seorang jamaah yang juga asal dari Pakistan, Muhammad Waqar, menga-

takan ia banyak membaca dan mendengar tentang peperangan bersejarah itu, tapi ia kini berkesempatan langsung untuk melihat Gunung Rumat, yaitu gunung para pemanah. Di bawah pengawasan Ketua Komite Haji Pemerintah Madinah Pangeran Abdulaziz bin Majed bin Abdulaziz, semua pihak terkait di Madinah tengah melakukan tugasnya dalam melayani para jamaah haji yang datang setiap saat di Kota Nabi. Tercatat, sebanyak 145.484 jamaah calon haji telah tiba di Madinah melalui jalur darat dan Bandara Internasional Pangeran Muhammad Bin Abdul Aziz International. Kebanyakan jamaah yang ada di Madinah berasal dari Malaysia dengan jumlah 28.765 jamaah, Turki 28.155 jamaah dan India 25.681 jamaah, dilaporkan Sekertaris Komite Haji Madinah pada Selasa lalu.(an/rzl)

MoU Pilkada Sidimpuan Sepakat Damai P. SIDIMPUAN (Waspada): Kapolda Sumatera Utara, Iren Pol DrsWisjnu Amat Sastro SH, meminta enam pasangan calon wali kota dan calon wakil wali kota peserta Pilkada Kota Padangsidimpuan menjaga kondusivitas keamanan dan ketertiban daerah selama berprosesnya pesta demokrasi yang tahun ini satu-satunya digelar di wilayah Sumatera Utara. Kapoldasu menyampaikan hal itu pada temu ramah bersama Wali Kota, Muspida Plus di

Lanjut ke hal A2 kol. 4

Aceh Kutuk ‘Innocence of Muslims’ BANDA ACEH( Waspada): Peserta Seminar Internasional Banda Aceh Model Kota Madani mengutuk keras pelecehan dan penghinaan kepada Nabi Muhammad SAW dan Islam melalui pembuatan film “Innocence of Muslims” dan publikasi karikatur yang melecehkan nabi Muhammad SAW, di media Charli Hebdo, Perancis. Kutukan dengan mengacungkan bendera kecil bertulisan “Kami Cinta Nabi Muham-

mad SAW, itu dibacakan dalam pernyataan sikap oleh juru bicara, yang juga tokoh Aceh

Ribuan Santri Bakar Bendera Israel Dan AS Drs Tgk Ghazali Abbas Adan di sela-sela Seminar Internasional Banda Aceh Kota Madani, di Aula Balai Kota Banda Aceh, Kamis (27/9). Pernyataan sikap yang terdiri tujuh poin itu, mengatakan Nabi Muhammad SAW adalah Rasul kami. Nabi Muhammad

adalah teladan kami, kehormatan kami, harga diri kami. Siapapun yang menghina Nabi Muhammad maka dia telah menghina Tuhan kami, Allah SWT. Pelaku pelecehan terhadap nabi Muhammad sama saja dengan penghinaan terhadap agama kami Islam dan telah

menghina kami umat Islam seluruh dunia. Kami rakyat Aceh memandang penghinaan melalui “Innocence of Muslims” dan Kartun Nabi Muhammad sebagai sebuah pelanggaran serius terhadap keberagaman dalam beragama. “Tindakan

tersebut mencerminkan tidak adanya penhormatan mereka terhadap agama Islam, dan itu melanggar HAM,” tegas Ghazali Abbas, yang disambut peserta seminar dengan teriakan “Allahu Akbar.” Selain itu, Ghazali mengimbau umat Islam dunia tidak

terpancing melakukan tindakan anarkisme. Musuh kita adalah mereka yang benci kepada Islam. Dan kita harus melawan mereka di antaranya dengan penguasaan terhadap sains dan teknologi. Umat Islam harus memperkuat media massa yang memihak kepada Islam dan

kaum muslimin. “Untuk itu, umat Islam dunia harus konsisten menjalankan ajaran Islam dan semakin menambah keyakinannya terhadap kebenaran ajaran Islam,” papar mantan anggota DPRRI itu. Lanjut ke hal A2 kol. 4

Calhaj Kloter 7 Masuk Di Asrama Haji Seorang Jamaah Medan Wafat Sebelum Masuk Asrama

Waspada/Surya Efendi

PLT Gubsu Gatot Pujo Nugroho bersama anak-anak dalam Peringatan Hari Anak Nasional (HAN) di Balai Prajurit Koda, I/BB.

Gatot Dan Tujuh Kdh Teken MoU Hadirkan Kab/kota Layak Anak MEDAN (Waspada): Plt. Gubsu H Gatot Pujo Nugroho dan tujuh kepala daerah (Kdh) se-Sumatera Utara menadatangani nota kesepahaman (MoU) untuk bersama mewujudkan kabupaten/kota layak anak. Penandatanganan disaksian ribuan anak di tengah kemeriahan acara peringatan Hari Anak Nasional Provinsi Sumatera Utara, Kamis (27/9) di Balai Prajurit Kodam I/BB. Penandatanganan setelah Gatot menetapkan tujuh kabu-

paten/kota yaitu Asahan, Labuhanbatu, Tobasa, Nias Selatan, Binjai, Tanjungbalai dan Gunung Sitoli menuju kabupaten/ kota layak anak. “Pemerintah pusat telah menetapkan Provinsi Sumatera Utara sebagai salah satu dari sepuluh provinsi yang mengembangkan kabupaten/kota layak anak,’’kata Gatot. Menurut Gatot, didampingi Ny Sutias Handayani pada 2010, telah ditindaklanjuti dengan menetapkan delapan

kabupaten/kota menuju layak anak, pada 2012 ditetapkan lagi tujuh kabupaten/kota menuju layak anak. Nota kesepahaman Pemprovsu dengan tujuh pemerintah kabupaten/kota berisi kerjasama pencapaian kinerja bidang pembangunan kesejahteraan dan perlindungan anak dalam mewujudkan kabupaten/ kota layak anak di Provinsi Sumatera Utara.

Lanjut ke hal A2 kol. 6

MEDAN (Waspada) : Jamaah calon haji (Calhaj) Kloter 7 asal Binjai, Tanjungbalai dan perorangan tiba di Asrama Haji Kamis (27/9). Kepala Kantor Kementerian Agama Binjai H Al Ahyu MA menyebutkan jamaah asal daerahnya ada 291 orang dilepas Wakil Wali Kota Binjai Timbas Tarigan. “Pemkab Binjai memberikan bantuan untuk penyediaan obat-obatan sebesar 30 juta rupiah . Sementara untuk Calhaj daftar tunggu mencapai 2.750 orang. Wali Kota Binjai HM. Idaham, SH berharap agar Calhaj disiplin dan menjaga kesehatan serta menjaga nama baik daerah khususnya dan Indonesia umumnya. Namun, para Calhaj Binjai nampak kecewa karena koper mereka basah akibat curahan air hujan.Mereka terpaksa membuka koper dan menjemur perlengkapan tak jauh dari aula penerimaan jamaah. Lanjut ke hal A2 kol. 1

Sekeluarga Naik Haji BERHAJI bersama dalam satu keluarga menjadi kebahagian tersendiri bagi mahasiswa Fakultas Kedokteran USU, Rahmi Silviyani, 20, warga Binjai. Berkat rezeki kedua orangtuanya, Rahmi akan mengutarakan niatnya di Baitullah bersama kedua orangtua dan empat saudara kandungnya. “Silvi ingin ke Tanah Suci karena niat, Waspada/Mursal AI bukan karena ajakan Lanjut ke RAHMI Silviyani, 20, (kanan) dan hal A2 kol. 1 ibunya Hj Suryani, 47.

CALHAJ INDONESIA: Jamaah calon haji asal Indonesia dan dari negara lain saat berada di Masjid Nabawi, Madinah. Foto diabadikan wartawan Waspada Amir Syarifuddin, Rabu (26/9) malam waktu setempat.

Gus, Gatot Terdongkrak Ondim Terkoreksi MEDAN (Waspada): Belum terjadi kenaikan yang signifikan pada bursa kupon PAPS (Partai Apa Pilih Siapa) Kamis (27/9). Para pendukung masing-masing kandidat Balon Gubsu mengirimkan kupon hanya sekadar untuk

menjaga poin. Nama Gus Irawan terdongkrak sedikit pada kupon PAPS Partai Demokrat dan Partai Golkar, sedangkan Gatot Pujo Nugroho

Lanjut ke hal A2 kol. 1

Ada-ada Saja

Al Bayan

Nasib Penghina Nabi

Pemburu Bantai Harimau Di Kebun Binatang

Oleh Tgk. H. Ameer Hamzah

KEPOLISIAN Negara Bagian Arunachal Pradesh, India, tengah mengejar komplotan pemburu yang memasuki kebun binatang dan membunuh seekor harimau. Para pemburu berhasil melakukan aksinya meski kebun binatang itu dijaga ketat. Lanjut ke hal A2 kol. 5

Begitulah, bagi setiap nabi, telah Kami adakan musuh dari orang-orang yang berdosa. (QS. Al-Furqan: 31). SETIAP RASUL pasti ada musuh-musuhnya, baik ketika mereka masih hidup maupun sudah wafat. Jika tidak ada musuh bukan nabi namanya. Musuh para nabi dan rasul adalah iblis, setan, kafirin, musyrikin dan munafikin. Para musuh itu mendustakan para rasul Allah, menolak agama yang dibawanya, menuduh para nabi itu gila, dan melawan sampai mereka kalah. Nabi Muhammad SAW. Telah dimusuhi oleh kaum musyrikin Quraisy, termasuk pamannya Abu Lahab dan Ummu Jamil (istri Abu Lahab). Karena memusuhi Nabi Abu Lahab dan Ummu Jamil dicelakakan Allah Ta’ala sebagaimana diabadikan dalam Alquran: Binasalah kedua tangan Abu Lahab dan benar-benar binasa dia. Tidaklah berguna baginya hartanya dan apa yang dia usahakan.

Lanjut ke hal A2 kol. 6

Serampang Waspada/Surya Efendi

MENJEMUR PAKAIAN BASAH: Beberapa jamaah calon haji asal Kota Binjai sibuk menjemur tas dan koper berisi pakaian dan peralatan yang basah ketika jamaah calon haji Kloter 7 tiba di Asrama Haji Pangkalan Masyhur Medan, Kamis (27/9). Koper mereka basah karena diguyur hujan pada Rabu (26/9) malam di Kota Binjai.

- Salut tegasnya rakyat Aceh - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

JUMAT, Kliwon, 28 September 2012/12 Zulqaidah 1433 H z zNo: 23996 * Tahun Ke-66

Terbit 28 Halaman (A1-8, B1-12, C1-8) z zHarga Eceran: Rp 2.500,-

Ribuan Santri Aceh Bakar Bendera Israel, AS


TERDAKWA kasus suap cek pelawat Miranda S. Goeltom saat berdoa usai menjalani sidang vonis di Pengadilan Tipikor, Jakarta, Kamis (27/9).

Divonis Tiga Tahun, Miranda Banding JAKARTA (Antara): Majelis hakim menjatuhkan vonis hukuman tiga tahun penjara dan denda Rp100 juta kepada Miranda Swaray Goeltom, terdakwa kasus suap terhadap anggota Komisi IX DPR RI periode 1999-2004 dalam pemilihan Deputi Gubernur Senior Bank Indonesia (DGSBI). “Terdakwa Miranda Swaray Goeltom bersalah dan terbukti melakukan tindak pidana korupsi secara bersama-sama sebagaimana dalam dakwaan pertama pasal 5 ayat 1 huruf b juncto pasal 55 ayat (1) KUHP,” kata Ketua Majelis Hakim Gusrizal dalam sidang di Pengadilan Tindak Pidana Korupsi Jakarta, Kamis (27/9). Menurut hakim, terdapat fakta pengadilan bahwa sebelum pemilihan DGSBI Miranda bertemu dengan anggota Komisi IX DPR RI dari Fraksi Partai Demokrasi Lanjut ke hal A2 kol 6

2.264 Calhaj Aceh Tiba Di Tanah Suci BANDA ACEH(Waspada): Sampai dengan kelompok terbang (Kloter) 07, jamaah calon haji (Calhaj) Provinsi Aceh yang telah diberangkatkan ke tanah suci berjumlah 2.264 orang. Demikian dikatakan Koordinator Humas dan Protokol P3IH Embarkasi Banda Aceh Darwin, Kamis (27/9). Dari jumlah tersebut, lanjutnya, tercatat 916 orang Calhaj lakilaki dan 1.348 orang calhaj perempuan. Sementara Kloter 07 sebanyak 325 orang, terdiri dari Kabupaten Aceh Besar sebanyak 17 orang, Aceh Selatan 108 orang dan Aceh Barat 195 orang, telah lepas landas dari Bandara SIM menuju bandara King Andul Aziz Jeddah, Kamis (27/9) pukul 10.15. Seorang Gagal Berangkat Dilaporkan sebanyak 320 Calhaj Kloter 08, Kamis (27/9) sore, dilepas oleh Sekda Kota Lhokseumawe H. Dasri, MM. dalam Kloter 08 ini tercatat satu orang Calhaj tidak jadi berangkat karena menunggu suaminya yang sakit keras. “Satu orang Calhaj asal Kota Lhokseumawe bernama Zakiah Binti M. Hasan menunda keberangkatannya tahun ini, karena suaminya sedang sakit. Jadi jumlah JCH yang akan berangkat adalah 319 orang,” kata Darwin mengutip Taufiq Abdullah, ketua Kloter 08 yang juga Kepala Kantor Kementerian Agama Kota Lhokseumawe. Darwin juga menjelaskan, Kloter 08 dijadwalkan keberangkatannya pada hari Jumat (28/9), pukul 07.15 diundur menjadi pukul 11.00 dari jadwal sebelumnya.

IDI (Waspada): Pemerintah RI diminta memboikot berbagai produk makanan dan minuman Amerika Serikat (AS) sebagai sikap dan ketegasan Indonesia yang mayoritas penduduk Islam atas penghinaan terhadap Nabi Muhammad SAW yang dilakukan warga AS. “Kita sangat menyesalkan sikap Presiden AS Barack Obama yang membiarkan film “Innocence of Muslim” tersebar ke seluruh dunia melalui situs internet,” kata Pimpinan Ponpes/Dayah Al Maimanah Darul Ihsan Kab. Aceh Timur, Tgk H Abdul Wahab kepada Waspada di sela-sela aksi damai ribuan santri dan ulama se Aceh Timur di halaman Masjid Agung Darusshalihin Idi, Kamis (27/9). Oleh karenanya, lanjut ulama kharismatik Aceh itu, atas nama pimpinan dayah/ ponpes se Aceh Timur diminta agar pemerintah Indonesia agar segera mengambil sikap tegas terhadap AS, bila perlu mengusir Duta besar (Dubes) AS dari Indonesia. “Umat muslim sudah dihina oleh kaum non-muslim (warga AS—red). Lanjut ke hal A2 kol 6


DUA santri muda mendengar orasi tentang film Innocence Of Muslims, dari atas lantai dua Masjid Agung Darussalihin Idi Rayeuk, Aceh Timur, Kamis (27/9) siang.

Waspadai Banjir Dan Longsor MEDAN (Waspada): Masyarakat diingatkan meningkatkan kewaspadaan disebabkan hujan lebat dan merata sedang melanda Sumatera Utara.

Tingginya intensitas curah hujan, beberapa daerah di

Sumut berpeluang ancaman banjir dan longsor. Pihak Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I, berulang kali memperingatkan warga agar lebih hati-hati , sebab ancaman banjir masih cukup besar. Mega Sirait, SP, kepala bidang Data dan Informasi (Datin) pada BMKG Wilayah

I membenarkan hal itu saat dikonfirmasi di Bandara Polonia Medan, Kamis (27/9), berkaitan meningkatnya intensitas curah hujan di Sumatera Utara. Kata dia, beberapa hari ke depan masih berpotensi terjadi curah hujan tinggi dan angin kencang di daerah ini, menyebabkan sungai-sungai

P.SIDIMPUAN (Waspada): Kapolda Sumatera Utara, Iren Pol Drs Wisjnu Amat Sastro SH, meminta enam pasangan calon wali kota dan calon wakil wali kota peserta Pilkada Kota Padangsidimpuan menjaga kondusivitas keamanan dan ketertiban daerah selama berprosesnya pesta demokrasi yang tahun ini satu-satunya digelar di wilayah Sumatera Utara. Kapoldasu menyampaikan hal itu pada temu ramah

Lanjut ke hal A2 kol 3

Besok Malam Kloter 10 Terbang

Lanjut ke hal A2 kol 1

bersama Wali Kota, Muspida Plus di auditorium Sekolah Tinggi Agama Islam 9STAIN) Padangsidimpuan, Kamis (27/9). Hadir KPU, Panwaslu, pasangan Cawalkot dan Cawawalkot, pimpinan perguruan tinggi, para SKPD, Camat, Lurah, Kepala Desa, Kepala Lingkungan, OKP, Ormas, dan alim ulama. “Saya harap Pilkada ini cukup satu putaran, sehingga tidak banyak anggaran negara

yang digunakan. Semua pasangan calon, saya minta tetap menjaga kondusivitas Kamtibmas. Jangan sampai memunculkan konflik horizontal di tengah masyarakat, dan tolong kendalikan setiap pergerakan massa pendukung dan tim suksesnya,” pinta Kapoldasu dan berharap Pilkada berlangsung lancar dan damai. Terkait penandatanganan nota kesepakatan bersama Lanjut ke hal A2 kol 4

Tugas PNS Akan Ditambah Waspada/Parlindungan Hutasoit

MASYARAKAT menyampaikan aspirasinya di Polres Humbang Hasundutan (Humbahas), Kamis (27/9). Mereka diterima Kapolres Humbahas AKBP Heri Sulismono.

Pasca Bentrok Di TPL, Massa Demo Polres Humbahas

DOLOKSANGGUL ( Waspada): Pasca bentrok warga di Desa Sipitu Huta Kec. Pollung, Kab. Humbang Has u n d u t a n ( Hu m b a h a s ) , ratusan massa demo diPolres Humbahas, Kamis (27/09). Kehadiran masyarakat terkait proses hukum terhadap 8 orang warga yang dipanggil sebagai saksi kasus bentrok antara masyarakat dengan Satpam PT TPL (Toba Pulp Lestari)

Tbk dan Brimob, Rabu (19/9). Kehadiran massa diterima Kapolres Humbahas AKBP Heri Sulismono, yang mengatakan, dalam kasus bentrok itu polisi tidak memihak siapapun. “Permasalahannya adalah pelanggaran hukum, sehingga polisi diperintahkan untuk menuntaskan kejadian itu,” ujarnya. Massa dalam orasinya disampaikan Pdt Haposan Si-

nambela dan Tohap Lumbanbatu mengatakan, massa tidak mau bentrok dengan pihak manapun. Namun pada saat itu, jawaban yang diterima memojokkan mereka. Sementara itu, Ketua DPRD Humbang Hasundutan Bangun Silaban di hadapan massa Kec. Pollung meminta pihak kepolisian menyelesaikan kasus ini dengan bijaksana. (a21)

Pj Rektor Unsyiah Tak Ingin Berpolemik

Nasib Penghina Nabi

PANYABUNGAN (Waspada): Para kalangan orangtua siswa di kawasan Kotanopan Kabupaten Mandailing Natal semakin khawatir terhadap peristiwa kesurupan massal yang semakin meluas melanda berbagai sekolah di daerah

BANDA ACEH (Waspada): Penjabat Rektor Universitas Syiah Kuala (Unsyiah) Prof Dr Samsul Rizal mengaku tidak ingin terus berpolemik. Syamsul juga mengindikasikan tak ingin terlibat ‘aksi’ balas pantun dengan mantan rektor. Ketika menjawab Waspada, Kamis (27/9) usai penyerahan beasiswa dari PT Angkasa Pura II untuk 61 mahasiswa Unsyiah, Samsul menyebutkan, dirinya tak ingin terus memperkeruh suasana. “Biarlah kejaksaan yang akan menuntaskan penyidikannya,” ujar dia. Kata dia, pihak Kejaksaan Tinggi Aceh tentu punya bukti yang cukup dalam mempublikasikan indikasi korupsi dana

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 4

Oleh: H. Ameer Hamzah Begitulah, bagi setiap nabi, telah Kami adakan musuh dari orang-orang yang berdosa (QS. Al-Furqan: 31)

Lanjut ke hal A2 kol 2

di di kawasan Dairi, Tanah Karo, Langkat, Taput dan Tapanuli Tengah (Tapteng). Menyingung gangguan penerbangan, Mega Sirait menyebutkan, jika hujan lebat disertai angin kencang maupun petir, biasanya bakal terjadi gangguan pada pesawat baik saat mau terbang maupun mendarat. (m32)

Pejabat Eselon Akan Dikurangi

Al Bayan

SETIAP RASUL pasti ada musuh-musuhnya, baik ketika mereka masih hidup maupun sudah wafat. Jika tidak ada musuh bukan nabi namanya. Musuh para nabi dan rasul adalah iblis, setan, kafirin, musyrikin dan munafikin. Para musuh itu mendustakan para rasul Allah, menolak agama yang dibawanya, menuduh para nabi

jang bantaran aliran sungai berhati-hati,” kata Mega Sirait. Hujan dan angin kencang akan terjadi di kawasan pesisir timur Sumut, perlu diwaspadai antara lain kawasan Deliserdang, Medan, Langkat, Sergai, Asahan dan Simalungun bahkan di Tapteng. Sementara ancaman longsor berpeluang dan bakal terja-

Kapoldasu Minta Cawalkot P.Sidimpuan Jaga Kamtibmas

11 Calhaj Aceh Timur Dialihkan Ke Kloter 12 IDI (Waspada): Nanti malam, 224 Calon Haji (Calhaj) Kabupaten Aceh Timur yang tergabung dalam Kelompok Terbang (Kloter) 10 bersama Calhaj Aceh Tamiang dan Kota Sabang Jumat (27/9) sekira pukul 21:15. Kepala Kantor Kementrian Agama (Kakakemenag) Aceh Timur Drs H Faisal Hasan melalui Kasi Haji dan Umrah, Drs. H. Ahmad Fauzi, MA saat dikonfirmasi terkait CalWaspada/Surya Efendi haj Aceh Timur menjelasDUA jamaah calon haji asal kan, dari total Calhaj Aceh Kota Binjai berfoto mengguna- Timur yang diberangkat kan handphone BB miliknya dalam Kloter 10 yakni 221 ketika jamaah calon haji Kloter Calhaj ditambah 5 petu7 tiba di Asrama Haji Pangkalan gas haji. “Tapi ada 11 Calhaj Masyhur Medan, Kamis (27/9). Aceh Timur yang berangkat dengan Kloter 12, dikarenakan 11 Calhaj Aceh Timur tersebut selesai administrasinya kemarin, Rabu (26/9). Jadi tidak memungkinkan diberangkatkan dengan Kloter

yang selama ini kering akan meluap, seperti Sungai Deli dan Babura di kawasan Medan. Banjir kiriman pada malam hari juga berpeluang terjadi, intensitas hujan di kawasan lereng-lereng perbukitan dan pergunungan saat ini tergolong meningkat seperti kawasan Tanah Karo. “Warga yang bertempat tinggal di sepan-


SEORANG siswi kesurupan di SMK Negeri 1 Kotanopan. Setelah diobati dan sadarkan diri, siswi tersebut diantar ke rumahnya.

Kesurupan Massal Meluas Ke SMP Di Madina

Waspada / Arman Konadi

MENPAN dan Reformasi Birokrasi Azwar Abubakar berbincang dengan Penjabat Rektor Universitas Syiah Kuala (Unsyiah) Prof Syamsul saat hendak memberi kuliah umum bertema reformasi birokrasi di Universitas Unsyiah, Banda Aceh, Kamis (27/9).

BANDA ACEH (Waspada): Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (Menpan RB) Republik Indonesia, Azwar Abubakar, mengatakan, struktur birokrasi di seluruh Indonesia akan dirampingkan. Pejabat eselon akan dikurangi, namun tugas PNS akan ditambah. Hal itu diungkapkan Azwar Ab u b a k a r d a l a m k u l i a h umumnya di Gedung AAC Dayan Dawood, Darussalam, Kamis (27/9). “Ini persoalan yang sedang kita benahi. Kita ingin agar semua lini dapat berfungsi dengan baik,” ujarnya. Dia mengakui, ada beberapa persoalan birokrasi yang Lanjut ke hal A2 kol 6

Ada-ada Saja

Pemburu Bantai Harimau Di Kebun Binatang

KEPOLISIAN Negara Bagian Arunachal Pradesh, India, tengah mengejar komplotan pemburu yang memasuki kebun binatang dan membunuh seekor harimau. Para pemburu berhasil melakukan aksinya meski kebun binatang

Lanjut ke hal A2 kol 5

Serampang - Salut tegasnya rakyat Aceh - He.... he....he....

Berita Utama


Kapoldasu ....

(MoU) Pilkada damai antara KPU, Panwaslu, dan enam pasanan calon, di akhir acara temu ramah ini. Kapoldasu minta seluruh pasangan calon untuk tidak menganggapnya seremonial. ‘’ Jika terjadi pelang-garan MoU, pihak yang melanggar kesepakatan akan dituntut pertanggungjawabannya,’’ kata Kapoldasu. Adapun isi MoU itu antara lain, seluruh pasangan calon berjanji tahapan kampanye secara jujur, adil, dan tidak mengangkat isu SARA. Menjaga kondusivitas Kamtibmas, fasilitas umum dan ketertiban lalulintas. Ikuti tahapan kampanye tanpa kekerasan dan aksi anarkisme, siap dipilih dan tidak dipilih, bersinergi dengan Polri menciptakan Pilkada damai.

Pj Rektor ....

11 Calhaj ....

10, sehingga dialihkan ke Kloter 12,” jelas Ahmad Fauzi. Dia menambahkan, 221 Calhaj Aceh Timur masuk Asrama Haji di Banda Aceh Jumat (28/9) pukul 21:15. Sementara terbang ke Tanah Suci Sabtu (29/9) dijadwalkan pukul 22:15. “Alhamdulillah, seluruh Calhaj Aceh Timur masih dalam kondisi sehat dan tidak masalah dengan kesehatan hingga hari ini, kemarin,” tandas H Ahmad Fauzi. 265 Calhaj Pidie Berangkat 30 September 265 Dari 280 Calhaj asal Kabupaten Pidie, dijadwalkan akan bertolak ke Arab Saudi pada, Minggu 7 Oktober 2012 mendatang melalui Bandara Internasional Sultan Iskandar Muda (SIM) Blang Bintang, Aceh Besar. Kepala Bagian Kesejahteraan Sosial (Kabag Kessos) Setdakab Pidie, Fauzi Ahmad, SH menjawab Waspada, Kamis (27/9) mengatakan, dari total 280 calhaj asal Kabupaten Pidie tahun ini, yang akan berangkat dalam kloter XI hanya 265 orang bersama Calhaj dari Kabupaten Aceh Jaya 53 orang dan Kabupaten Bener Meriah 2 orang. Sehubungan dengan jadwal keberangkatan tersebut, Calhaj asal Pidie itu akan masuk Asrama Haji Embarkasi Banda Aceh, Sabtu (29/9). “Keberangkatan Calhaj Pidie tergabung dalam kelompok terbang XI terdiri dari tiga kabupaten akan dilepas Bupati Pidie Sarjani Abdullah, di Asrama Haji Embarkasi Banda Aceh pada, Minggu (29/9) siang. Berdasarkan data diperoleh Waspada di Kantor Kementerian Agama (Kakemenag) Pidie, Calhaj Pidie, selain bergabung dalam kloter XI sebanyak 265 orang, sisanya 15 orang bergabung dalam kloter XII (terakhir) bersama Calhaj daerah lain. Untuk kloter 12 dijadwalkan keberangkatannya, 1 Oktober 2012, masuk asrama haji 30 September 2012 mendatang. Kepala Kantor Kementerian Agama (Kakankemenag) Kabupaten Pidie melalui Kasie Haji dan Umrah, Fadhli,

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mxg6+, MxM. 2. BxM+, Bg7. 3. BxB+mat.

Jawaban TTS: TTS Topik

Mimbar Jumat

Jawaban Sudoku:

4 1 7 5 9 3 8 6 2

6 8 5 2 7 4 3 9 1

9 3 2 1 6 8 7 4 5

8 7 9 4 5 1 2 3 6

2 6 3 9 8 7 1 5 4

5 4 1 3 2 6 9 7 8

1 9 6 8 3 5 4 2 7

3 5 8 7 4 2 6 1 9

7 2 4 6 1 9 5 8 3

S Ag mengatakan, dibandingkan Calhaj tahun 2011 lalu yang jumlahnya 406 orang, Calhaj Pidie tahun 2012 ini jauh lebih sedikit karena jumlahnya hanya 280 orang. Menurut Fadhli, dari totalnya 280 orang calhaj Pidie, kecuali 15 orang akan bergabung dengan kloter 12 alias kloter terakhir. “Calhaj yang tergabung dalam kloter XI adalah 320 orang, ditambah 5 petugas haji dan tenaga medis (kesehatan), jadi totalnya 325 orang, “kata Fadhli. “Setelah diinapkan semalam di Asrama Haji Embarkasi Banda Aceh, kemudian pada, Minggu (30/9) siang Pemkab Pidie akan melakukan upacara pelepasan di Asrama Haji Embarkasi Banda Aceh, sebelum bertolak ke Arab Saudi pada malamnya sekira pukul 23:00. “ujar Fadhli. Rombongan calhaj Pidie, yang tergabung dalam kloter XI dipandu Ketua Kloter, Ikhsan, SAg. “Tahun ini, Ikhsan, S. Ag ditunjuk sebagai Tim Pembimbing Haji Indonesia ( TPHI). Sedangkan Te n a g a K e s e h a t a n H a j i Indonesia (TKHI) ditunjuk dr. Elvira Arani Hasa dan Syaboini Abubakar, “timpal Fadhli. Jamaah Gayo Lues Meningkat Pemkab Gayo Lues melepas sebanyak 113 orang jamaah calon haji yang tergabung dalam kelompok terbang (Kloter) 9. Pelepasan dilakukan Bupati Gayo Lues H. Ibnu Hasim, Kamis (27/9) di Majid Raya Baitushalihin.

Al Bayan ....

itu gila, dan melawan sampai mereka kalah. Nabi Muhammad SAW. Telah dimusuhi oleh kaum musyrikin Quraisy, termasuk pamannya Abu Lahab dan Ummu Jamil (istri Abu Lahab). Karena memusuhi Nabi Abu Lahab dan Ummu Jamil dicelakakan Allah Ta’ala sebagaimana diabadikan dalam Alq u ra n : Bi n a s a l a h k e d u a tangan Abu Lahab dan benarbenar binasa dia. Tidaklah berguna baginya hartanya dan apa yang dia usahakan. Kelak dia akan masuk dalam api yang bergejolak (neraka). Begitu pula istrinya, pembawa kayu bakar (penyebar fitnah). Dilehernya ada tali sabut yang dipintal. (QS. Al-Lahab: 1-5). Bukan hanya Abu Lahab, ada juga Abu Jahal, Uqbah bin Abu Mu’ith, Al-Walid bin Mughirah, Aknas bin Syuraiq As-Sakafi, Abdullah bin Umay-

Bupati Gayo Lues dalam kesempatan tersebut mengatakan, atas nama pribadi, pemerintah daerah, dan masyarakat Kabupaten Gayo Lues mengucapkan selamat kepada seluruh Jamaah Haji yang akan berangkat ke tanah suci Makkatul Mukaromah dan Madinatul Munawarah. Bupati juga mengatakan, jamaah haji asal Gayo Lues pada musim haji kali ini jumlahnya mencapai 113, “jamaah haji kita berangkat dengan dua kloter, kloter 9 akan berangkat 111 jamaah ke Saudi Arabia pada Tanggal 29 sekira Pukul 07:15, sedangkan kloter 12 yang berangkat hanya 4 orang, totalnya 113 jamaah,” sebutnya. H Hasbullah, SAg Kasi Haji pada Kantor Kementerian Agama Kabupaten Gayo Lues, mengatakan, seluruh jamaah asal Gayo Lues semua berkumpul di Asrama haji Banda Aceh, untuk bertolak ke Makkah Almukarromah. Dikatakannya, kuota haji Kab. Gayo Lues untuk musim haji tahun 2012 sebanyak 113 orang, bila dibanding dengan tahun sebelumnya hanya 59 jamaah saja. (b24/b09/cjs)

tersebut. “Sebaiknya, kita tunggu saja hasil penyidikan Kejati dan biarlah pengadilan yang akan menjawabnya nanti,” papar Samsul. Seperti diberitakan Waspada, kemarin, Kejaksaan Tinggi Aceh saat ini sedang menangani kasus dugaan tindak pidana korupsi penyalahgunaan pengelolaan dana program Jalur Pengembangan Daerah (JPD) Unsyiah tahun anggaran 2009-2010 bersumber APBA. Kajati Aceh TM. Syahrizal melalui Kasipenkum Amir Hamzah, menyebutkan, pihaknya telah menetapkan kasus JPD Unsyiah ke tahap penyidikan. “Karena terdapat penyalahgunaan dan penyimpangan pada dana beasiswa itu,” ujar dia. “Patut diduga dana sebesar Rp2 M itu tidak disalurkan untuk beasiswa JPD, namun digunakan untuk kepentingan pribadi/lainnya, sesuai peruntukan dana tersebut sampai saat ini belum disetorkan kembali ke rekening Unsyiah,” kata Kasipenkum. Tim penyidik Kejati Aceh telah mengumpulkan bahan

Kloter 8 itu terdiri dari Calhaj Kota Lhokseumawe 147 orang, Aceh Besar 90 orang dan 82 orang dari Kota Banda Aceh plus 5 orang petugas. “Kepastian pengunduran jadwal penerbangan Calhaj Kloter 8-BTJ kita peroleh dari surat Direktur Pelayanan Haji dan

2.264 Calhaj ....

pihak penerbangan Garuda Indonesia,” kata Darwin. Adapun, terjadi pengunduran jadwal oleh pihak Garuda karena alasan operasional, proses service dan pemeliharaan peralatan pesawat membutuhkan waktu sedikit lebih lama. (b02)

yah al-Makhzumi, An-Nazir bin al-Harits, Abu Zam’ah, Syaibah bin Rabi’ah, Uthbah bin Rabiah, Umayyah bin Khallaf, kaum Yahudi Madinah, Majusi Persia dan Nasrani Najran. Musuh-musuh itu semuanya dibinasakan oleh Allah SWT. Allah berfirman: Dan ingatlah pada hari ketika orang-orang zalim itu menggigit dua jarinya (menyesali perbuatannya) seraya berkata: Aduhai, sekiranya dulu aku mengambil jalan bersama rasul (QS. Al-Furqan:27). Musuh-musuh Rasulullah itu kebayakan tewas mengenaskan dalam perang, ada juga yang dimakan singa, tertimpa penyakit supak, lepra dan ada juga yang sampai gila. Mereka itu putus asa sebagaimana firman Allah: Dan orang-orag yang membencimu Muhammad, dialah yang terputus dari rahmat Allah (QS. Al-kautsar:3).

Zaman modrn ini banyak juga musuh-musuh Rasulullah SAW. Mereka menghina Islam, Nabi Muhammad, Alquran, dan hadis Nabi. Ternyata nasib mereka itu sangat buruk, tertimpa musibah sebelum mereka mati. Di dunia saja mereka telah merasakan azab Allah, apalagi di akhirat kelak. Naudzubillahi mindzalik! RasulullahSAW telah dimuiakan Allah SWT, derajatnya sangat tinggi, dia tak akan hina meski seluruh manusia menghinanya. Di dunia beliau penghulu alam, di akhirat juga penghulu surga. Para nabi dan rasul yang lain tunduk kepadanya. Sedangkan yang memusuhi beliau pasti dikeluarkan dari daftar umatnya. Jika manusia tidak termasuk daftar umat Muhammad SAW sejak abad ke 6 M. Jangan mencari mereka di surga, sebab tempat abadi mereka adalah neraka.

Pada kesempatan itu Kapoldasu mengatakan untuk pengamanan Pilkada ini, pihaknya mengerahkan 495 personil Polri membantu personil Polres Padangsidimpuan. Sementara Kapolres Kota Padangsidimpuan, AKBP Andi Syahriful Taufik SIK.MSI, berterimakasih kepada undangan yang telah meluangkan waktu untuk bertemu ramah dengan Kapoldasu. Sedangkan, pasangan calon yang hadir dan menandatangani MoU di hadapan Kapoldasu, pasangan No.1 Mohammad Habib Nasution (cawalkot)-Soripada Harahap (cawawalkot), No.2 Riswan Daulai (cawawalkot), No.3 Muhammad Isnandar Nasution (cawawalkot). (a27) No.4 Dedi Jaminsyah Putra Harahap (cawalkot)Affan Siregar (cawawalkot), keterangan dan data dari anggota tim pengelola JPD, Karo Isra Setda Aceh, Dekan FKIP Unsyiah serta Pj Rektor Unsyiah, termasuk Pembantu Rektor II dan Karo Umum Unsyiah. “Mudahan dalam waktu dekat ini kita bisa menetapkan tersangka dalam kasus beasiswa Unsyiah ini,” papar dia. Amir menjelaskan, pada tahun 2009 dan 2010 Pemerindah Aceh melalui Biro Isra telah menyalurkan dana beas i s w a m e l a l u i re k e n i n g Unsyiah sebesar Rp17 miliar lebih. Dana tersebut diberikan karena adanya MoU antara Pemda Aceh dengan Unsyiah. Dana tersebut khusus diperuntukan bagi program JPD tahun 2009 Rp2 miliar lebih untuk 81 orang mahasiswa, dan 2010 Rp4 miliar lebih. Dana itu digunakan untuk membiayai perkuliahan, hidup, asrama, buku, pendaftaran dan perlengkapan mahasiswa. Ternyata diperjalanan, terjadi dugaan penyalahgunaan/penyimpangan, Kejati menemukan adanya penarikan dana JPD dari rekening Unsyiah oleh mantan rektor, tahun 2009 dan 2010 sebesar Rp2 miliar lebih. (b07)

Ada-ada Saja ....

itu dijaga ketat. Direktur Kebun Binatang It a n a g a r Zo ra m D o p u m mengatakan, komplotan pemburu menggunakan obat bius sebelum menyelinap masuk ke dalam kandang dan kemudian memotong-motong tubuh harimau berusia enam tahun. Namun, para pemburu itu belum sempat membawa kucing besar itu. Mereka kabur ketika para penjaga kebun binatang yang tengah makan malam kembali ke tempat tugasnya. “Ini bukan upaya pertama. Para pemburu ini pernah mencoba melakukan hal serupa,” kata Dopum. Pada Februari 2006, tiga harimau dan seekor macan tutul diracun oleh orang tak dikenal. Satu ekor harimau mati dan yang lainnya selamat. Pada Juni 2006, sekitar 30 kilogram bagian tubuh harimau seperti tulang dan kuku diambil dari sebuah mobil milik seorang perwira polisi di Negara Bagian Assam. Bagian tubuh harimau sangat mahal di beberapa kawasan Asia Timur, khususnya China. Di “Negeri Tirai Bambu” bagian tubuh harimau biasa digunakan untuk obat. Akibat perburuan ini, jumlah harimau di Asia menurun sangat cepat dalam beberapa dekade terakhir. Berdasarkan hasil sensus 2011, di alam liar India kini hanya terdapat 1.700 ekor harimau. Satu abad lalu, jumlah harimau di India diperkirakan mencapai 100.000 ekor. (kcm/rzl)

No.5 Amir Mirza Hutagalung (cawalkot) – Nurwin Nasution (cawawalkot), No.6 Mara Gunung Harahap (cawawalkot). Sedangkan Andar Amin Harahap (cawalkot No.3) dan Chaidir Ritonga (cawalkot No.6) tidak hadir karena berhalangan. Sedangkan Wali Kota Padangsidimpuan, Zulkarnain Nasution mengimbau masyarakat agar pada hari pemungutan suara menggunakan hak suaranya di TPS. (a27)

WASPADA Jumat 28 September 2012

Merampok Dan Desersi, Enam Brimob Dipecat MEDAN (Waspada): Enam anggota Brimobda Sumut dipecat dari kesatuannya karena terlibat kasus perampokan, disersi atau tidak masuk dinas lebih dari 30 hari tanpa pemberitahuan. Prosesi pemecatan ke enam anggota Brimob tersebut dilaksanakan di Mako Brimobda Sumut Jl. KH Wahid Hasyim Medan, Kamis (27/9). Dari enam orang tersebut hanya dua yang hadir.

Ke enam anggota yang dipecat, Bripka Hariadi, Briptu Indra Hidayat Siahaan, Bripda Erwansyah. Ketiganya dipecat karena meninggalkan wilayah tugas secara tidak sah dalam waktu lebih dari 30 hari secara berturut. Bripka Kristian Pane, Briptu Haposan Purba, dan Briptu Zulfika Afwan, terlibat pencurian dengan kekerasan secara bersama-sama (perampokan). (m27)

Pejabat Eselon ....

donesia, termasuk Aceh masih komplit serta terlalu berbelitbelit. Azwar memberi contoh, persoalan birokrasi yang masih berbelit di daerah, termasuk Aceh, seperti pelayanan kesehatan dan mutasi guru yang belum merata. Terkait dengan masalah tersebut, Azwar meminta, bupati dan wakil bupati yang berada diseluruh kabupaten kota untuk menuntaskan persoalan ini. “Ini tugas bupati dan walikota. Masak ini juga tugas menteri, bisa mati berdiri saya,” kata dia. Sementara itu, Penjabat Rektor Unsyiah Profesor Samsul Rizal, dalam sambutannya pada pembukaan kuliah umum Menpan RB, mengatakan, tujuan kegiatan tersebut

adalah untuk memberikan informasi kepada pihaknya membenahi kampus. “K i t a i n g i n s i n e r g i s dengan Menpan RB, sehingga apa yang dilakukan oleh Menpan RB juga dapat diterapkan didalam kampus,” ujarnya. Saat ini, kata Samsul lagi, Unsyiah telah memiliki 81 jurusan, yang terdiri dari 51 jurusan strata satu, 15 jurusan profesi dan 24 jurusan strata dua dan strata tiga. “Kita juga berencana membangun tiga gedung untuk fakultas baru, yaitu FISIP, Kelautan dan FMIPA Unsyiah. Ketiga gedung ini akan dibiayai oleh IDB dan difasilitasi oleh Bappenas,” ujarnya. (b07)

Ribuan Santri ....

se Aceh Timur. “Tujuannya adalah untuk mengajak uma Islam sedunia menentang kaum kafir yang telah menghina Nabi Muhammad SAW. Dan ini merupakan wujud kafir melecehkan Islam,” katanya. Zubir menambahkan, aksi itu dilakukan sebagai ungkapan kekecewaan terhadap perlakukan kaum kafir terhadap rasulullah SAW dan Islam melalui film, media, karikatur dan propaganda lainnya. “Kita selaku umat Islam sudah sangat siap berjihad dan berperang melawan yahudi yang menghina umat Islam. Agama Islam akan kami pertahankan hingga nafas kami terakhir,” tegas Zubir yang diiyakan sejumlah santri. Sejumlah orator yang hadir dan menyampaikan berbagai pendapat menentang film Innocence of Muslim antara lain, Benny Kelda dari Komite Mahasiswa Pemuda Aceh (KMPA) Aceh Timur, M Yunus dari Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Timur, Tgk H Abdullah Rasyid (Pengurus MPU Aceh), Tgk HM Iqbal Hanafiah dari Rabi-

thah Silaturrahmi Santri se Aceh (RASSA) dan Tgk Muhib dan Tgk Zulkarnaini dari utusan santri dayah se Aceh Timur. Sebagaimana diketahui, 6 film, novel dan kartu yang dibuat non-muslim menimbulkan protes keras dari muslim di seluruh penjuru dunia yakni Novel berjudul “The Satanic Verses” dikarang oleh Salman Rushdie dari India. Lalu, umat Islam juga protes terhadap film “Submission” yang dirilis tahun 2004 berdurasi 11 menit yang disutradarai oleh Theo Van Gogh dari Belanda. Kemudian film kartun berjudul The Life of Muhammad yang dirilis tahun 2008 yang dibuat oleh politisi Belanda keturunan Iran. Lalu, protes keras muslim dunia juga terhadap kartun Nabi Muhammad di Jylliand Posten tahun 2005 yang menggambarkan wajah Nabi Muhammad SAW dan film “Fitna” yang dirilis 2008 yang dibuat oleh Geert Wilders asal Belanda dan terakhir ptotes muslim tehadap film Innocence of muslim yang diakui dibuat oleh Bacile, warga AS. (b24)

Divonis Tiga Tahun ....

Unsur kesertaan Miranda yang didakwakan dalam juncto pasal 55 ayat (1) KUHP juga dianggap terbukti karena sebelum fit and proper test DGSBI, atas perintah Nunun Nurbaeti saksi Arie Malangjudo memberikan kantong berisi TC kepada perwakilan fraksi PDIP, PPP, Golkar dan TNI/Polri di DPR RI.Meski Nunun membantah telah memerintahkan Arie melakukan hal itu, saksi Ngatiran mengatakan mengambil kantong kertas dari ruang Nunun untuk dibawa kepada Arie.Majelis tidak sependapat dengan kuasa hukum yang mengatakan bahwa Miranda tidak tahu

sama sekali soal pemberian TC, dan pemberian TC kepada perwakilan fraksi di Komisi IX DPR RI oleh Arie adalah atas perintah Nunun. Banding Atas vonis majelis hakim tersebut, Miranda mengatakan akan langsung mengajukan banding.”Saya kaget, saya tidak menyangka. Saya tahu saya tidak berbuat apa-apa dan Tuhan tahu saya tidak berbuat apa-apa karena itu saya akan banding,” kata Miranda dalam sidang. Sementara Jaksa Penuntut Umum yang dipimpin oleh Jaksa Supardi mengatakan akan pikir-pikir.

Kesurupan ....

pan terjadi di ketiga sekolah tersebut, sehingga membuat anak-anak dicekam ketakutan dan khawatir ikut kesurupan. Kejadian kesurupan ini terjadi saat para guru dan siswa mau konsentrasi melaksanakan proses belajar mengajar jam pertama. Tiba-tiba ada siswi yang terjatuh dan langsung menjerit keras dan meronta-ronta. Saat kemudian, sejumlah siswi lainnya pun ikut kesurupan menjerit histeris dan meronta. Rahmad Rizki Daulay, sebagai salah seorang anggota DPRD Madina asal daerah itu

mengaku heran kesurupan massal itu, yang berakibat kepada terganggunya proses belajar mengajar anak-anak bahkan terpaksa dipulangkan meski jam pelajaran belum berakhir. Sementara Kepala Dinas Pendidikan Madina Imron Lubis dihubungi di ruang sidang DPRD Madina Kamis (27/9) mengatakan bahwa pihaknya sudah menurunkan tim ke Kotanopan untuk melakukan koordinasi dengan pihak sekolah untuk menangani kejadian kesurupan tersebut. (a28)

sedang dibenahnya, seperti pendistribusian Pegawai Negeri Sipil yang tidak merata, struktur organisasi pemerintahan yang masih gemuk tapi minim pelayanan, serta mutasi PNS yang tidak sesuai ketentuan di tiap daerah. Menurutnya, ke depan jabatan struktur di dinas, badan, serta departeman kementerian juga akan diperkecil, sementara kinerja staf akan dimaksimalkan. “Jumlah eselon, termasuk di Aceh akan dikurangi dan tugas PNS akan ditambah. Ini untuk memaksimalkan potensi yang ada,” katanya. Berbelit Pada sisi lain dia mengakui persoalan birokrasi di InPadahal muslim tidak pernah menghina agama yang dianut oleh mereka (yahudi). Jadi kita selaku umat Nabi Muhammad SAW tidak akan tinggal diam dan siap berjihad,” kata H Abdul Wahab. Pangamatan Waspada, ribuan santri dari berbagai Ponpes/Dayah di Aceh Timur sejak pukul 09:00 sudah mulai berdatangan ke halaman Masjid Agung Darusshalihin Idi yang berada di tengahtengah Kota Idi ataupun di depan Pendopo Bupati Aceh Timur. Tak hanya santri, kaum dari berbagai majelis taklim juga ikut dalam aksi damai itu dengan menggunakan berbagai kendaraan, termasuk berbagai jenis truk bak terbuka. Usai wirit yasin dan zikir bersama di dalam masjid, massa selanjutnya berdiri di halaman masjid mengikuti orasi yang disampaikan oleh sejumlah orator. Koordinator Aksi Damai, Zubir usai aksi damai kepada Waspada menjelaskan, aksi itu dilakukan hasil musyawarah ulama, santri, pemuda, masyarakat dan ulama serta LSM Indonesia Perjuangan (PDIP) di Hotel Dharmawangsa dan anggota dari Fraksi TNI/ Polri di kantor Miranda di Jalan Sudirman, Jakarta. Saksi Dhudie Makmun Murod, Endin AJ Soefihara, Udju Djuhaeri, Darsup Yusuf, Suyitno serta Hamka Yandhu juga terbukti menerima cek perjalanan (Travellers Che-que/ TC) Bank Internasional Indonesia masing-masing senilai Rp50 juta.”Setelah ada pemberian TC tersebut maka pada malam harinya setelah dilakukan voting maka terdakwa terpilih sebagai DGSBI 2004-2009,” kata Hakim Ang-gota, Anwar. itu. Apalagi kesurupan hanya terjadi terhadap pelajar wanita. Sepekan terakhir siswi kesurupan melanda tiga SMA yakni SMA Negeri 1, SMK Negeri 1 dan 2 Kotanopan, kini dikabarkan meluas ke SMP Negeri 1 Kotanopan yang lokasinya tidak jauh dari ketiga sekolah tersebut. Pada Kamis ( 27/9), ratusan siswa/i SMA Negeri 1, SMK Negeri 1 dan SMP Negeri 1 Kotanopan, dipulangkan sebelum jam pelajaran berakhir. Ini dikarenakan kejadian kesuru-

Berita Utama


WASPADA Jumat 28 September 2012

Puting Beliung Landa Tongging MEREK (Waspada ):Bencana puting beliung Kamis (27/9) siang melanda desa wisata Tongging Kec. Merek Kab. Karo, mengakibatkan sejumlah rumah warga rusak. Masyarakat Desa Tongging mengatakan, peristiwa angin puting beliung ini tidak saja merusak atap rumah bahkan sempat memutuskan jaringan listrik di Tongging,Warga juga mengatakan, adanya kerusakan keramba apung milik penduduk. Sedangkan, lima rumah penduduk, satu atap hotel yang terbuat dari bahan metal terangkat. Kepala DesaTongging Sinar Munthe yang dihubungi wartawan membenarkan hal ini.Munurutnya, sejumlah pohon mangga di tepi Danau Toba sekitar Desa Tongging mengalami kerontokan daun dan buah. Begitu pula tanaman kopi, padi dan kemiri rusak. Di sebutkannya angin puting beliung yang terjadi dengan tiba-tiba berlangsung selama sekitar satu jam setengah mengakibatkan aliran listrik ke Desa Tongging padam total. Atap hotel yang rusak adalah Hotel Anugrah ,sedangkan rumah yang rusak masing-masing milik Sabar Kita, Edo, Borneo, Galingging dan Torang Manihuruk. (c10/a36) Waspada/Musyawir

DUA santri muda mendengar orasi tentang film Innocence Of Muslims, dari atas lantai dua Masjid Agung Darussalihin Idi Rayeuk, Aceh Timur, Kamis (27/9) siang.

Aceh Kutuk ...

Calhaj Kloter 7 ... Dengan basahnya beberapa koper Calhaj membuat mereka harus membuang waktu dan tenaga untuk menjemur yang

basah dan juga harus mengambil nomor kamar untuk menginap di Ahmed. Kejadian ini juga mengganggu jadwal penerimaan dan istirahat mereka. Sejumlah polisi tampak ikut mem-

Sekeluarga Naik Haji ... orangtua. Tetapi Alhamdullillah, Silvi bersyukur atas rezeki yang diberikan Allah kepada orangtua, hingga Silvi bisa naik haji bersama-sama keluarga,” kata Silvi kepada Waspada usai diperiksa kesehatannya oleh petugas kesehatan haji di Asrama Haji Medan, Kamis (27/9). Silvi menuturkan, tahun 2003, ibunya Hj Suryani sudah menunaikan ibadah haji. Saat itu, anak ketiga dari empat bersaudara itu banyak mengetahui kebesaran Allah di Tanah Suci dari cerita bundanya. Dari itulah, hatinya terus tergerak untuk menunaikan ibadah haji. “Sepulang dari haji tahun 2003, Mama pun ingin sekali suatu saat kami sekeluarga berangkat naik haji. Di tahun 2008, niat itu mulai terwujud saat Papa mendaftarkan kami naik haji,” imbuhnya. Banyak tanggapan teman teman Silvi terkait kepergiannya ke Tanah Suci. Namun, semua itu ditanggapinya positif. “Saya ingin sekali, agar tidak ada yang menilai kalau naik haji hanya menggelar titel, atau haji KTP. Maka, sepulang dari haji, Silvi akan berusaha menjadi lebih baik, tidak meninggalkan shalat, selalu menutup aurat dan lainnya,” ungkap Silvi. Silvi mengaku, sejak kecil sudah disuruh kedua orangtuanya mengenakan jilbab, namun hal itu baru dilakukannya sejak masuk SMA. “Papa dan Mama selalu bilang, remaja boleh saja berteman dengan siapa saja, namun tetap dalam batas-batas syariat yang dianjurkan oleh Islam,” katanya. Harapannya di Tanah Suci, gadis ini ingin memanjatkan doa agar segala urusan yang dikerjakan dimudahkan. Sementara itu, ibunya Hj Suryani, 47, mengatakan, mengajak keempat anaknya ke Tanah Suci di usia muda, lebih kepada memberikan bimbingan kepada anak-anaknya. “Saya dan suami membawa anak-anak menunaikan ibadah haji agar ibadah kami dan juga anak-anak semakin mantap dari yang selama ini. Kalau anak-anak shalatnya masih oleng-oleng, Insyaallah sepulang dari Tanah Suci tidak lagi,” terangnya. Hj. Suryani yang terdaftar di Kloter 7 pergi bersama suami dr Agusnadi Tala dan keempat anaknya yakni, dr. Bari Putri Julanda, 25, Aditya Bagus SKM, 23, Rahmi Silviyani, 20, dan M.Fauzi Gusyan, 18. (h02)

Gus, Gatot Terdongkrak ... terdongkrak di PKS. Akibat dua nama tsb terdongkrak, poin Syah Afandin alias Ondim sedikit terkoreksi. Hasil selengkapnya hitungan kupon PAPS kemarin sbb: Untuk Partai Demokrat Ondim meraih suara 50% turun dari hasil kemarin 57%, Gus Irawan 30% (sebelumnya 23%), Amri Tambunan 12% (sebelumnya 10%), Sutan Bhatoegana 8% (Sebelumnya 10%). Total jumlah kupon PAPS untuk Partai Demokrat 15%. Di Partai Golkar, Chairuman Harahap meraih poin 41% (sebelumnya 43%), Gus Irawan 35% (sebelumnya 32%), Ondim 21% (sebelumnya 22%) dan lain-lain 3%. Total jumlah kupon PAPS untuk Partai Golkar 36%. Di PDI-P, suara Ondim 40% (sebelumnya 40%), Chairuman 28% (sebelumnya 28%), Cornel Simbolon 15% (sebelumnya 15%), Gus Irawan 11% (sebelumnya 11%), dan RE Nainggolan 6% (sebelumnya 6%). Total jumlah kupon PAPS untuk PDI-P 19%. Untuk PKS, Ondim 53% (kemarin 59%), Gatot Pujo Nugroho 29% (sebelumnya 21%), Fadly Nurzal 8% (sebelumnya 9%), Gus Irawan 7% (sebelumnya 8%) dan lain-lain 3%. Total jumlah kupon PAPS untuk PKS 15%.Di PAN, suara untuk Ondim 52% (sebelumnya 52%), Chairuman Harahap 30% (sebelumnya 30%), sedangkan Gus Irawan 15% (sebelumnya 15%) dan lain-lain 3%. Total jumlah kupon PAPS untuk PAN 15%. Harian Waspada memberikan kesempatan kepada pembaca untuk memberikan kontribusi kepada partai maupun Balon Gubsu dalam memecahkan masalah ‘sampan’ yang cocok untuk mengantarkan kandidat menjadi orang nomor satu di Sumatera Utara. Segera isi kupon PAPS yang terdapat di Halaman Politik dan Hukum, dukung kandidat kesayangan Anda dan dapatkan hadiahnya. Panitia juga mengumumkan agar pemenang survey Balon Gubsu periode lalu sudah diumumkan di Harian Waspada pada edisi 17 Jawaban Problem Catur, Agustus 2012 harap segera mengambil hadiah BlackBerry dengan TTS Dan Sudoku membawa identitas yang sesuai Dari Halaman Sport. tertulis pada kupon ke Sekretariat Redaksi (Sekred). Batas waktu pengambilan hadiah BlackBerry Jawaban Problem Catur: sampai 31 Oktober 2012. (Tim)

1. Mxg6+, MxM. 2. BxM+, Bg7. 3. BxB+mat.

Jawaban TTS: TTS Topik

Mimbar Jumat

Jawaban Sudoku:

4 1 7 5 9 3 8 6 2

6 8 5 2 7 4 3 9 1

9 3 2 1 6 8 7 4 5

8 7 9 4 5 1 2 3 6

2 6 3 9 8 7 1 5 4

5 4 1 3 2 6 9 7 8

1 9 6 8 3 5 4 2 7

3 5 8 7 4 2 6 1 9

7 2 4 6 1 9 5 8 3

bantu para Calhaj menjemur pakaian yang basah. “Gak tau basahnya dimana, apa di pendopo Pemko Binjai apa di bus,” kata salahseorangCalhajTeddyPurnama yang kopernya ikut basah. Di tempat terpisah Sekretaris Panitia Penyelenggara Ibadah Haji (PPIH) Drs Abd Rahman Harahap mengatakan ada 13 koper Calhaj yang basah. “Basahnya di daerah Binjai bukan di asrama haji,” ujarnya didampingi Humas PPIH M.Sazli Nasution dan staf Imam Bukhari. Menurut Rahman, sebelum berangkat,PemkoBinjaidanKantor Kemenag Binjai Rabu (26/9) sore mengumpulkan jamaahnya dan koper jemaah di Pemko Binjai yang dimasukkan dalam truk.“Bisasajabasahkarenahujan dan sebagian besar pakaiannya lembab,” terang Rahman. Sementara,Calhaj asal Tanjungbalai sebanyak 152 orang tiba dan mengikuti proses masuk asrama dengan menyerahkan surat panggilan masuk dan mengisi daftar barang bawaan mereka. Wafat Sementara, Kepala Kantor Kementerian Agama Kota Medan Iwan Zulhami melalui Kasi Haji Ahmad Qosbi menyebutkan, seorang jamaah bergabung dalam Kloter 8 atas nama Slamet, 64, meninggal dunia sebelum masuk asrama . Penduduk Pasar 1 Gg Pribadi Tj Sari ini seharusnya berangkat ber-sama isterinyaTeti Arlinawati Binti Anwar Kadih,50, manifest 454.Namun dia sudah melapor menunda keberangkatannya tahun depan. “Hingga sekarang sudah tiga jamaah yang wafat sebelum masuk asrama,”kata Ahmad Kosbi kemarin. (m37/h02/m32/m50)

Ancaman Banjir ... Kata dia, beberapa hari ke depan masih berpotensi terjadi curah hujan tinggi dan angin kencang di daerah ini, menyebabkan sungai-sungaiyangselamainikering akan meluap, seperti Sungai Deli dan Babura di kawasan Medan. Banjir kiriman pada malam hari juga berpeluang terjadi, intensitas hujan di kawasan lerenglereng perbukitan dan pergunungansaatinitergolongmeningkat sepertikawasanTanahKaro.“Warga yang bertempat tinggal di sepanjang bantaran aliran sungai berhati-hati,” kata Mega Sirait. Hujan dan angin kencang akanterjadidikawasanpesisirtimur Sumut, perlu diwaspadai antara lainkawasanDeliserdang,Medan, Langkat, Sergai, Asahan dan Simalungun bahkan di Tapteng. Ancaman longsor berpeluang dan bakal terjadi di kawasan Dairi, Tanah Karo, Langkat, Taput dan Tapanuli Tengah . Menyingung gangguan penerbangan, Mega Sirait menyebutkan, jika hujan lebat disertai angin kencang maupun petir, biasanya bakal terjadi gangguan pada pesawat baik saat mau terbang maupun mendarat. (m32)

Kecuali itu, dia juga mengimbau umat Islam agar memenuhi masjid-masjid dengan shalat berjamaah dan semakin giat mendalami ajaran Islam dan mengamalkannya dalam kehidupan sehari-hari. Sedangkan kepada negara-negara kuat Islam agar bersatu melawan para pembenci agama Islam. “Kami rakyat Aceh akan mendukung setiap pemimpin dunia Islam yang berani tampil melawan para pembenci Islam dan pelaku pelecehan terhadap Nabi Muhammad SAW,” demikian Ghazali Abbas dalam pernyataan sikap dihadiri ratusan peserta dari berbagai elemen masyarakat ini. Bakar Bendera Israel, AS Ribuan santri se Aceh mengikuti apel akbar mengecam Amerika Serikat (AS) dan Israel atas penghinaan terhadap Nabi Muhammad SAW. “Kita sangat menyesalkan sikap Presiden AS Barack Obama yang membiarkan film “Innocence of Muslim” tersebar ke seluruh dunia melalui situs internet,” kata Pimpinan Ponpes/Dayah Al Maimanah Darul Ihsan Kab. Aceh Timur, Tgk H Abdul Wahab kepada Waspada

MoU Pilkada ... auditorium Sekolah Tinggi Agama Islam 9STAIN) Padangsidimpuan, Kamis(27/9). Terkait penandatanganan nota kesepakatan bersama (MoU)PilkadadamaiantaraKPU, Panwaslu, dan enam pasanan calon, di akhir acara temu ramah ini. Kapoldasu minta seluruh pasangan calon untuk tidak menganggapnya seremonial. ‘’ Jika terjadi pelanggaran MoU, pihak yang melanggar kesepakatan akan dituntut pertanggungjawabannya,’’ kata Kapoldasu. Adapun isi MoU itu antara lain, seluruh pasangan calon berjanjitahapankampanyesecara jujur, adil, dan tidak mengangkat isu SARA. Menjaga kondusivitas Kamtibmas, fasilitas umum dan ketertiban lalulintas. Ikuti tahapan kampanye tanpa kekerasan dan aksi anarkisme, siap dipilih dan tidak dipilih, bersinergi dengan Polri menciptakan Pilkada damai. Kapoldasu mengatakan untuk pengamanan Pilkada ini, pihaknya mengerahkan 495 personil Polri membantu personil Polres Padangsidimpuan. Pasangan calon yang hadir dan menandatangani MoU di hadapan Kapoldasu, pasangan No.1 Mohammad Habib Nasution (cawalkot)-Soripada Harahap (cawawalkot), No.2 Riswan Daulai (cawawalkot), No.3 Muhammad Isnandar Nasution (cawawalkot). No.4 Dedi Jaminsyah Putra Harahap (cawalkot)Affan Siregar (cawawalkot), No.5 Amir Mirza Hutagalung (cawalkot) – Nurwin Nasution (cawawalkot),No.6MaraGunung Harahap (cawawalkot). Sedangkan Andar Amin Harahap (cawalkot No.3) dan Chaidir Ritonga (cawalkot No.6) tidak hadir karena berhalangan. (a27)

di sela-sela aksi damai ribuan santri dan ulama se Aceh Timur di halaman Masjid Agung Darusshalihin Idi, Kamis (27/9). Oleh karenanya, lanjut ulama kharismatik Aceh itu, atas nama pimpinan dayah/ Ponpes

se Aceh Timur diminta agar pemerintah Indonesia segera mengambil sikap tegas terhadap AS,bilaperlumengusirDutabesar (Dubes) AS dari Indonesia. Selain demo, mereka membakar bendera AS dan Israel . (b02/b24)

Empat Rumah, Bengkel Dan Mobil Terbakar MEDAN (Waspada): Empat rumah kopel di Jl. Pembangunan, Lingk. XI, Desa Purwodadi, Kec. Sunggal, Kab. Deliserdang, terbakar, Kamis (27/9) siang. Selain empat pintu rumah yang terbakar dihuni Syahrial Efendi Sitorus, 42, Putra, 37,Yusnan, 45, Budi, 35, dan satu bengkel, mobil pick up, mesin bubut dan mesin las ludes. Saksi mata mengatakan, peristiwa itu terjadi pukul 14:00, dan asap tebal maupun api terlihat dari salah satu rumah. Api cepat menjalar ke rumah lainnya karena saat itu udara panas terik. Belum tahu dari mana asal api, kerugian ratusan juta rupiah. Warga segera memberikan pertolongan dengan cara menyiramkan air ke arah api. Namun,

usaha itu tidak membuahkan hasil karena api dengan cepat merambat. Mobil pemadam kebakaran di Kec. Sunggal dan dibantu Pemkab Deliserdang langsung melakukan penyiraman hingga api berhasil dipadamkan. Kapolsek Sunggal AKP Bahtiar Marpaung, SH, S.Sos, MH yang turun bersama personelnya ke Tempat Kejadian Perkara (TKP) langsung melakukan pengamanan untuk mengantisipasi hal yang tidak diinginkan. Bahtiar didampingi Kanit Reskrim Polsek Sunggal AKPVictor Ziluwu, SH, SIK mengatakan, peristiwa itu tidak ada mengambil korban jiwa.Asal api maupun kerugian material masih dalam penyelidikanpihakberwajib.(m36)

6 Brimob ...

hentian tidak dengan hormat dari dinas Polri. Masing-masing Aiptu Zuhri Harahap terbukti melakukan tindak pidana penyalahgunaan narkoba golongan I, Bripka Periosa Tindaon meninggalkan tugas secara tidak sah dalam waktu lebih dari 30 hari kerja secara berturut-turut sejak 29 Desember 2009 sampai 22 Maret 2011 atau selama 500 hari kerja,Briptu Willy Sumitro Silalahi meninggalkan wilayah tugasa selama 30 hari kerja, sejak 31Januari2011hingga15November 2011 selama 290 hari kerja. Kapolres Tanjungbalai AKBP EP Sirait dalam amanatnya mengatakan, meski upacara PTDH dilakukan tanpa kehadiran bersangkutan, namun tidak mengurangi esensi dari apel tersebut. (m27/a32)

Bripka Kristian Pane, Briptu Haposan Purba, dan Briptu Zulfika Afwan, terlibat pencurian dengan kekerasan secara bersama-sama (perampokan). Tiga Polisi Dari Tanjungbalai diberitakan, tiga anggota Polres Tanjungbalai diberhentikan dengan tidak hormat (PTDH) pada apel pagi di halaman Mapolres, Kamis (27/9). Ketiga anggota Polres Tanjungbalai tersebut diberhentikan berdasarkan Surat Keputusan Kapoldasu Nomor : KEP/ 534/IX/2012 tertanggal 21 September 2012 tentang pember-

Ada-ada Saja ... Seperti dilansir BBC, Rabu (26/9), Direktur Kebun Binatang Itanagar Zoram Dopum mengatakan, komplotan pemburu menggunakan obat bius sebelum menyelinap masuk ke dalam kandang dan kemudian memotong-motong tubuh harimau berusia enam tahun. Namun, para pemburu itu belum sempat membawa kucing besar itu. Mereka kabur ketika para penjaga kebun binatang yang tengah makan malam kembali ke tempat tugasnya. “Ini bukan upaya pertama. Para pemburu ini pernah mencoba melakukan hal serupa,” kata Dopum. Pada Februari 2006, tiga harimau dan seekor macan tutul diracun oleh orang tak dikenal. Satu ekor harimau mati dan yang lainnya selamat. Pada Juni 2006, sekitar 30 kilogram bagian tubuh harimau seperti tulang dan kuku diambil dari sebuah mobil milik seorang perwira polisi di Negara Bagian Assam. Bagian tubuh harimau sangat mahal di beberapa kawasan Asia Timur, khususnya China. Di “Negeri Tirai Bambu” bagian tubuh harimau biasa digunakan untuk obat. Akibat perburuan ini, jumlah harimau di Asia menurun sangat cepat dalam beberapa dekade terakhir. Berdasarkan hasil sensus 2011, di alam liar India kini hanya terdapat 1.700 ekor harimau. Satu abadlalu,jumlahharimaudiIndia diperkirakan mencapai 100.000 ekor. (kcm/rzl)

Gatot Dan Tujuh Kdh ... Selain Plt. Gubsu, MoU ditandatangani Bupati Asahan Taufan Gama Simatupang, Bupati Labuhanbatu Tigor Panusunan Siregar, Bupati Tobasa Pandapotan Kasmin Simanjuntak , Bupati Nias Selatan Idealisman Dachi, Wali Kota Binjai M. Idaham,Wali Kota Tanjungbalai Thamrin Munthe, Wali Kota Gunung Sitoli Martinus Lase. Gatot mengimbau bupati/ wali kota di Sumut, terutama yang sudah ditetapkan sebagai daerah menuju layak anak agar dapat menghadirkan program-

Tolak Vonis 3 Tahun, Miranda Banding JAKARTA (Antara): Majelis hakim menjatuhkan hukuman (vonis) tiga tahun penjara dan dendaRp100jutakepadaMiranda Swaray Goeltom, terdakwa kasus suap terhadap anggota Komisi IX DPR RI periode 1999-2004 dalam pemilihan Deputi Gubernur Senior Bank Indonesia (DGSBI). “Terdakwa Miranda Swaray Goeltom bersalah dan terbukti melakukantindakpidanakorupsi secarabersama-sama,”kataKetua Majelis Hakim Gusrizal dalam sidangdiPengadilanTindakPidana Korupsi Jakarta, Kamis (27/9). Menurut hakim, terdapat fakta pengadilan bahwa sebelum pemilihan DGSBI Miranda bertemu dengan anggota Komisi IX DPR RI dari Fraksi Partai Demokrasi Indonesia Perjuangan (PDIP) di Hotel Dharmawangsa dan anggota dari Fraksi TNI/Polri di kantor Miranda di Jalan Sudirman, Jakarta. Saksi Dhudie Makmun Murod, Endin AJ Soefihara, Udju Djuhaeri, DarsupYusuf, Suyitno sertaHamkaYandhujugaterbukti

menerima cek perjalanan (Travellers Cheque/TC) Bank Internasional Indonesia masing-masing senilai Rp50 juta. Miranda Swaray Goeltom mengatakan dirinya masih mencari keadilan. “Mengapa saya langsung banding, bukan masalah lamanya tapi bahwa tidak dinyatakan apa buktinya, bagi saya yang terpenting adalah ingin mencari keadilan,” kata Miranda seusai sidang. “Apa yang terjadi ini? Yang terpikir oleh saya ada dua, satu mungkinopinipublikyangsudah demikian kuat membuat majelis hakim menjadi gamang apabila membebaskan saya,” ungkap Miranda.Kedua adalah Miranda menganggap bahwa kondisi kembalikezamanMpuGandring. “Mungkin kita kembali ke zaman Mpu Gandring, kalau kerisnya keluar sudah pasti ada yang mati, sama seperti saya, karena saya sudah jadi tersangka saya salah,”ungkapMiranda.Iamengungkapkan bila tidak ada bukti, seharusnya ia tidak disalahkan.

Ibu Rumah Tangga ... meninggalkan rumahnya tanpa penghuni. Sekembalinya dari rumah tetangga, Siti melihat ada sepedamotor terparkir tak jauh dari rumahnya. Kecurigaannya timbul, ia mencoba membuka pintu depan tetapi terkunci. Siti mengintai dari kaca jendela dan terkejut melihat kotak perhiasan berada di ruang tamu. Saat ia akan berteriak, pelaku And,46, warga Dusun V, Desa Punggulan, Kec.Airjoman, Rantauprapat, secepatnya membuka pintu membekap mulut Siti dan menariknya ke dalam rumah. Merasa terancam, Siti menggigit tangan And dan menendang selangkangan lelaki tersebut, sehingga ia melepaskan sekapannya. Selanjutnya, keduanya pasang ancang-ancang. Dalam posisi terdesak, pelaku mengambil parang milik Siti, Siti mengambil broti palang pintu dan perkelahian dilanjutkan. Siti menangkis ayunan parang yang datang bertubi-tubi ke tubuhnya, sambil berteriak,’’ Rampok’’. ‘’Aunan parang beberapa kali mengenai tubuhku,’’ kata Siti, didampingi suaminya Supriyadi,31. Melihat situasi tidak menguntungkan, pelaku kabur dengan membawa uang tunai Rp10 juta dan sejumlah perhiasan.Warga yang mendengar teriakan Siti segera mengejar pelaku dan berhasil menangkapnya. Sementara, Siti yang mengalami luka robek di sela jari kedua tangannya, memar mata kiri serta luka robek di kepala dan punggung dilarikan ke RSU Melati Desa Pon. Untuk menghindari amuk massa, pelaku sempat menaburkan uang hasil curian, namun massa tidak peduli hingga pelaku tertangkap di Dusun V, Kampung Jawa, Desa Bakaranbatu.Kabag OPS Polres Sergai Kompol B Aritonang didampingi Kasat Reskrim, AKP Deny Boy Panggabean, Plt. Kapolsek Firdaus, AKP ZN Siregar serta puluhan personel Polres Sergai dan Polsek Firdaus kewalahan meredam emosi ratusan warga yang ingin menghakimi pelaku yang diamankan di kantor Desa Bakaranbatu. (c03) program yang secara langsung dirasakan manfaatnya oleh anak untuk menyukseskan program pemerintah mewujudkan 100 kabupaten/kota layak anak 2014. Disebutkannya, sedikitnya ada lima hal menjadi agenda khusus pemerintah dan didukung masyarakat serta dunia usaha, yakni agar anak memperoleh haknya sebagaimana amanat UU 23/2002. Di antaranya, pelayanan pendidikan dan pengajaran bermutu, pelayanan kesehatan bermutu dan jaminan sosial, kebebasan berpartisipasi, beristirahat dan memanfaatkan waktu luang dan

Al Bayan ... Kelak dia akan masuk dalam api yang bergejolak (neraka). Begitu pula istrinya, pembawa kayu bakar (penyebar fitnah). Di lehernya ada tali sabut yang dipintal. (QS. Al-Lahab: 1-5). Bukan hanya Abu Lahab, ada juga Abu Jahal, Uqbah bin Abu Mu’ith, Al-Walid bin Mughirah, Aknas bin Syuraiq As-Sakafi, Abdullah bin Umayyah al-Makhzumi, An-Nazir bin alHarits, Abu Zam’ah, Syaibah bin Rabi’ah, Uthbah bin Rabiah, Umayyah bin Khallaf, kaum Yahudi Madinah, Majusi Persia dan Nasrani Najran. Musuh-musuh itu semuanya dibinasakan oleh Allah SWT. Allah berfirman: Dan ingatlah pada hari ketika orang-orang zalim itu menggigit dua jarinya (menyesali perbuatannya) seraya berkata: Aduhai, sekiranya dulu aku mengambil jalan bersama rasul (QS. Al-Furqan:27). Musuh-musuh Rasulullah itu kebayakan tewas mengenaskan dalam perang, ada juga yang dimakan singa, tertimpa penyakit supak, lepra

perlindungan dari diskriminasi dan eksploitasi. Sedangkan Deputi Tumbuh Kembang Anak Kementerian Pemberdayaan PermpuanWahyu Hartopo, berharap melalui penetapan kabupaten/kota layak anak di Sumut mendorong lahirnya generasi yang baik untuk mampu bersaing di tingkat global. Puncak peringatan Hari Anak Nasional dihadiri 1500 anak dari berbagai PAUD, SD, TK, SD dan SMU serta anak berkebutuhan khusus dari kabupaten/kota se Sumut. (m34)

dan ada juga yang sampai gila. Mereka itu putus asa sebagaimana firman Allah: Dan orangorang yang membencimu Muhammad, dialah yang terputus dari rahmat Allah (QS. Alkautsar:3). Zaman modern ini banyak juga musuhmusuh Rasulullah SAW. Mereka menghina Islam, Nabi Muhammad, Alquran, dan hadis Nabi. Ternyata nasib mereka itu sangat buruk, tertimpa musibah sebelum mereka mati. Di dunia saja mereka telah merasakan azab Allah, apalagi di akhirat kelak. Naudzubillahi mindzalik! RasulullahSAW telah dimuiakan Allah SWT, derajatnya sangat tinggi, dia tak akan hina meski seluruh manusia menghinanya. Di dunia beliau penghulu alam, di akhirat juga penghulu surga. Para nabi dan rasul yang lain tunduk kepadanya. Sedangkan yang memusuhi beliau pasti dikeluarkan dari daftar umatnya. Jika manusia tidak termasuk daftar umat Muhammad SAW sejak abad ke 6 M. Jangan mencari mereka di surga, sebab tempat abadi mereka adalah neraka.

WASPADA Jumat 28 September 2012

Umat Islam Kolkata Yang Marah Protes Film Anti-Islam KOLKATA (AP): Ribuan umat Islam berbaris di Kolkata, timur India, untuk memprotes film anti-Islam yang diproduksi di Amerika Serikat. Petugas kepolisian Rajashri Roy mengatakan para pemrotes meneriakkan‘Jatuhlah Amerika’ ketika mereka berpawai ke gedung perpustakaanAmericanCenterKamis(27/9). Diamengatakanmereka melemparipolisi—yangmenghambatgerakanmajumerekamenuju Konsulat AS — dengan batu. Mereka kemudian bubar dengan tertib. Para pemrotes tersebut berasal dari All Bengal Minority Council dan All Bengal MinorityYouth Federation. Film Innocence of Muslims, yang merendahkan Nabi Muhammad SAW itu telah memicu protes di seluruh dunia Muslim. Di Bangkok, para pemrotes Muslim mendorong perintang dan berhadapan dengan polisi di depan Kedubes AS di Bangkok dalam satu rapat umum menentang satu video yang diproduksi di AS yang merendahkan Nabi Muhammad. Kira-kira 300 petugas kepolisian berusaha menertibkan mereka Kamisketika200orangmelakukanrapatumum.Parapemrotestersebut digerakkan oleh satu kelompok yang menamakan dirinya Kelompok Muslim untuk Perdamaian. Aksi itu merupakan kedua kalinya dalam waktukurangdariduaminggubahwaumatIslamberkumpuldidekat kompleks kedubes untuk memprotes film tersebut. Para pemrotes mengatakan mereka ingin pemerintah AS menghukum pembuat film tersebut.(m10)

Jenderal AS Dituduh Lakukan Zina Dan Sodomi Di Afghanistan FORT BRAGG (AP): Seorang brigadir jenderal AD Amerika Serikat yang telah bertugas dalam lima peralihan tugas perang di Irak dan Afghanistan telah dikenakan tuduhan sodomi, perzinahan dan memiliki hubungan yang tidak benar dengan sejumlah wanita bawahannya, demikian menurut dua pejabat pertahanan AS. Para pejabat pertahanan itu berbicara dengan The Associated Press Rabu (26/9) dengan syarat tidak disebutkan namanya karena mereka tidak punya wewenang membicarakan kasus ityu secara terinci. Brigjend. Jeffrey A. Sinclair menghadapi kemungkinan mahkamah militer atas tuduhan serangkaian kejahatan seks, termasuk pemaksaan seks, melakukan penyimpangan seks, memiliki foto porno dan alkohol dan menyalahgunakan kartu dana perjalanan pemerintah.(m10)

Perluasan Masjid Nabawi Dari Waktu Ke Waktu NABI Muhammad SAW membangun Masjid Nabawi pada tahun-tahun awal Hijriah (sekitar tahun 622) dan masjid itu mengalami perluasan pertama pada tahun ke-7 Hijriah (sekitar tahun 629) setelah dia kembali dari berdakwah di Khaybar.Khalifah Umar bin Khattab dan khalifah ketiga, Utsman bin Affan juga meluaskan masjid tersebut, yang disusul oleh Raja Waleed bin Abdul Malik pada tahun 706 M. Raja Abdul Aziz memerintahkan pula perluasan Masjid Nabawi dengan tambahan seluas 6.024 meter2 pada tahun 1950, kemudian perluasan 40.440 meter2 diperintahkan oleh Raja Faisal pada tahun 1974. Raja Khaled pada tahun 1997 mengalokasikan tanah di baratdaya masjid tersebut untuk memungkinkan para jamaah dapat menunaikan ibadahnya dengan leluasa dan selama masa kekuasaan Raja Fahd , ruang ibadah bagi masjid tersebut mencapai 384.000 meter2. Kini, Pengasuh Dua Masjid Suci Raja Abdullah telah memerintahkan pengerjaan proyek perluasan Masjid Nabawi itu agar segera dimulai agar selesai dalam tempo kurang dari dua tahun. Raja Abdullah menegaskan pentingnya penyelesaian sesegera mungkin proyek itu pada tahap awal mengingat kebesaran Nabi Muhammad (saw), kata Menteri Keuangan Ibrahim Al-Assaf. Bangunan masjid akan berada di atas lahan seluas 614.800 meter persegi atau 1060 X 580 meter, sementara ruang gabungan dari masjid dan plaza berukuran 1.020, 500 meter persegi atau 1300 X 785 meter, yang dapat menampung satu juta jamaah di dalam masjid dan 800.000 jamaah di plaza, kata Al-Assaf. Proyek perluasan Masjid Nabawi itu sudah dilakukan oleh Raja Abdullah dengan peletakan batu pertama fondasinya Senin lalu. Bila selesai seluruh pembangunannya, masjid itu akan memiliki dua menara besar ditambah dengan sejumlah menara kecil di keempat sisinya. Sementara pada penyelesaian tahap pertamanya masjid tersebut akan dapat menampung lebih dari 800.000 jamaah, tahap kedua dan ketiga akan memberikan ruang bagi lebih dari satu juta jamaah. Secara keseluruhan perluasan baru itu akan memberikan tambahan ruang bagi 1,2 juta jamaah pada tahun 2040. Ruang plaza di timur dan sisi sebelah barat masjid akan dikembangkan. Gedung itu dikelilingi oleh plaza yang akan dibangun Bangunan sekitarnya plaza akan dibangun sesuai dengan pembangunan perkotaan dan sejalan dengan sejarah budaya Islami yang kaya di Madinah. Proyek itu, yang ditujukan untuk menampung 1,2 juta jamaah pada tahun 2040, juga akan dikembangkan bangunan sekitarnya yang dikenal sebagai Al-Ruwaq, yang akan berfungsi sebagai gerbang antara kota dan masjid. Rencana komprehensif bagi pengembangan masjid juga menuntut akuisisi seluruh properti pribadi yang dibutuhkan di bawah sektor kepemilikan publik. Rencana komprehensif untuk proyek tersebut juga merekomendasikan bahwa hotel yang ada di wilayah rekonstruksi harus diizinkan untuk beroperasi sampai pekerjaan yang sebenarnya dimulai di lokasi mereka. Hal ini untuk menghindari ketidaknyamanan kepada para peziarah. Ekspansi ke sisi utara membutuhkan 12,5 Ha lahan, sementara kompensasinya membutuhkan dana 2,16 miliar Riyal Saudi yang harus dibayarkan kepada pemilik properti. Kompensasi properti total untuk proyek tersebut diperkirakan sebesar 25 miliar Riyal Saudi. PembangunanZonaSentralharusmempertimbangkankeinginan pengunjungkemasjidagarmerekatetapdekatdenganmasjidsehingga mereka dapat berjalan kaki untuk beribadah setiap waktu. Desain proyek juga akan mempertahankan status masjid sebagai simbol Islam dan budayanya. Lahan-lahan yang akan diperlukan berada di utara plaza yang dekat Salae Jabal. Jalan lingkar baru yang diusulkan, Shari Arid Al-Janobi, yang membutuhkan lahan senilai 2,8 miliar Riyal Saudi, akan dibangun dengan biaya diperkirakan 972 juta Riyal Saudi. Juga akan ada sejumlah jembatan penyeberangan dan jalan lintas bawah tanah untuk membantu pejalan kaki dalam jumlah besar untuk menyeberang jalan baru. (an/mujo)

Luar Negeri Presiden Mesir Mohammed Moursi:

Muslim Didiskriminasi Di Seluruh Dunia NEW YORK (AP): Presiden Mesir Mohammed Moursi membahas segenap masalah yang menimpa imigran-imigran Muslim di seluruh negara dalam pidatonya di Sidang Majelis Umum Perserikatan Bangsa-Bangsa (PBB). Moursi mengecam kebijakan standar ganda Barat terhadap warga Muslim. “Apa yang saat ini dialami warga dan para imigran Muslim adalah diskriminasi dan pelanggaran terhadap hak mereka. Banyak pula kampanye-kampanye yang menghina Muslim dan hal ini tidak dapat diterima,” ujar Mursi. “Mesirmenghormatikebebasan berekspresi, namun bukan yang digunakan untuk menyebarkan kebencian dan tidak ditujukan untuk menyerang agama atau kultur tertentu,” tambahnya, seperti dikutip The Associated Press, Kamis. Moursi kembali mengencam film Innocence of Muslims yang menghinaNabiMuhammaddan menyinggung kembali masalah kebebasan bereskpresi yang sudah disalahgunakan. Politisi Ikhwanul Muslimin itu juga memba-

has serangan di kantor misi diplomatikASyangmenewaskansekira 51 orang, termasuk Dutabesar AS untuk Libya Christopher Stevens. Di Kairo, Mesir, warga menyaksikan siaran pidato Moursi lewat televisinya. Selain disambut oleh warga Mesir, Moursi juga mendapat kritik pedas. Salah seorang warga mengeritik pidato Moursi mengenai kebebasan berekspresi.Warga menyinggung isupenahanan-penahananaktivis Mesirdanmengaitkannyadengan pidato Moursi di PBB. Moursi juga membahas isuisu Timur Tengah lainnya dalam pidato pertamanya di Majelis Umum PBB. Isu tersebut antara lain adalah isu keanggotaan Palestina di PBB dan isu krisis Suriah yang makin memanas. Moursi telah memainkan pe-

rannya sebagai tokoh kelas berat di Timur Tengah Rabu, dengan menyatakandalampidatoperdananya di depan sidang MU PBB bahwa perang saudara di Syria adalah ‘tragedi zaman ini’ dan harus segera diakhiri. Prioritas dunia Dalam pidatonya di Sidang MU PBB Moursi membahas isu status Palestina di PBB. Mursi menganggap isu tersebut sebagai isuyangpalingpentingbagikomunitas internasional. “Sudah beberapa dekade berlalu sejak warga Palestina mengutarakan harapannya untuk membangun negara yang merdeka dengan Jerusalem sebagai ibukotanya. Meski merekamelanjutkanperjuangannya dengan cara yang legal, komunitas internasional masih belum bisa merealisasikan harapan dan aspirasi warga Palestina,” ujar Mursi, di Sidang Majelis Umum PBB seperti dikutip dari Bikyamasr, Kamis. “Saya mendesak kalian semua, mendukung warga Palestina untuk mendapatkan haknya membangun negara, seperti saat kalianmendukungrevolusiwarga

Arab. Sangat memalukan bila komunitas internasional terus menghalangi hak sebuah bangsa yangmendambakankemerdekaan,” tegasnya. Sementara itu, Menteri Luar Negeri AS Hillary Clinton menurut rencana bertemu dengan Presiden Otoritas Palestina Mahmoud Abbas Jumat (28/9) di markasbesar PBB. Salah seorang pejabat Palestina mengatakan, Clinton akan menjegal Abbas yang saat ini ingin memperbaharui status Palestina di PBB. Saat berada di New York, Abbas bertemu dengan sejumlah pemimpin dan pejabat tinggi negara. Mereka adalah Presiden Prancis Francois Hollande, Menteri Luar Negeri Rusia Sergei Lavrov, Menteri Luar Negeri Jerman GuidoWesterwelle dan lainnya. Kehadirannya di New York akan dimanfaatkan kembali untuk mengubah status Palestina menjadi “negara non-anggota PBB.” Abbas akan mengajukan permohonan itu pada hari ini, namunAbbastampaknyatidakakan mengusulkanresolusiuntukvoting. (ok/m10)

Hubungan Jepang Dan China Kembali Panas BEIJING (AP): Hubungan China dan Jepang kembali memanas ketika kedua belah pihak berusahamengesampingkanklaim satusamalainnyaatassatugugusan pulau yang disengketakannya. China Kamis (27/9) menyerang PM Jepang dan menyebutnya sebagai‘keras kepala’ dan salah untuk mengatakan negaranyatidakakanberkompromidalam sengketa mereka atas pulaupulaukecildiLautChinaTimuryang disengketakan keduanya. PM Jepang Yoshihiko Noda mengatakan di New York sehari sebelumnya bahwa kepulauan itu jelas‘satu bagian tak terpisahkandariwilayahnegerikamisesuai dengan sejarah dan hukum internasional.’Diamengatakanbahwa berbagaimasalahmengenaipulau itu harus diselesaikan dengan damai dan sesuai dengan aturan hukum. “China amat kecewa dan menentang dengan keras ketegaran pemimpin Jepang mengenai posisinya yang salah” tentang masalah ini, kata jurubicara Kementerian Luar Negeri Qin Gang dalam sebuah pernyataan yang mengulangi sikap China bahwa Jepang mengabaikan fakta-fakta sejarahdanhukuminternasional. Para diplomat senior dari kedua negara telah bertemu pekan ini di NewYork dan Beijing dalam usaha untuk memperbaiki hubu-

Presiden Rusia Ingatkan Standar Ganda Dalam Perangi Terorisme, Ekstrimisme MOSKOW, Rusia (Antara/ Xinhua-0ANA):Moskowbersikap menentang standar ganda dalam menghadapi ekstremisme dan terorisme, kata Presiden Rusia Vladimir Putin. Teroris layak perlakuan keras, kata Putin, tetapi menambahkan bahwa, dalam memerangi teroris, nilai-nilai budaya dan perasaan keagamaan masyarakat harus dihormati. “Halinidiperlukanuntukmeningkarkanupayabersamauntuk melawanancamanterorismedan ekstremisme di manapun terjadi -diLibya,Irak,Yaman,Syria,Mesir, Afghanistan,” kata Putin dalam pertemuandenganparadutabesar asing Rabu (26/9).Dia juga menegaskanbahwastandargandatidak harus diterapkan.

ngan kedua negara yang tegang akibat pertikaian atas gugus kepulauandiLautChinaTimuryang dikenalsebagaiSenkakudiJepang dan Diaoyu di China. Pemerintah China menegaskan Jepang harus menghormati sejarah dan hukum internasional yang berlaku terkait sengketa di Kepulauan Diaoyu atau dikenal di Jepang dengan Senkaku. Penegasan itu disampaikan Kementerian Luar Negeri China di Beijing, Kamis, menanggapi pernyataan PM Noda yang menyatakanpihaknyatidakakanber-

kompromi atas keputusannya terhadap Diaoyu. Jurubicara Kementerian Luar negeri China Qin Gang mengatakan penyelesaian sengketa teritorial harus didasarkan pada sejarah dan hukum internasional yang berlaku. “Dan Jepang harus menghormati sejarah dan mematuhiaturanhukuminternasional tersebut,” katanya menegaskan. Qin menambahkan Jepang harus segera menghentikan berbagai aksi yang mengancam kedaulatan negara lain.

PM Noda bersikeras bahwa tidak ada kompromi dengan China menyangkut kepemilikan kepulauan yang disengketakan dan dia mengecam terjadinya serangan terhadap kepentingankepentingan Jepang. Ketika berbicara kepada para wartawan di New York, Rabu, Noda mengatakan China telah salah paham tentang sengketa tersebut dan menuntut diakhirinyaancaman-ancamanterhadap warganegara dan kepentingan Jepang di China oleh para pengunjuk rasa nasionalis. (m10)

A3 Seputar ASEAN Filipina Desak NPA Serahkan Pengebom Di Davao City MANILA (Antara/Xinhua-OANA): Pemerintah Filipina mengatakan bahwa keadilan tak akan diperoleh 50 warga cedera dalam pemboman granat baru-baru ini di kota Davao, Filipina selatan, kecuali jika Tentara Rakyat Baru menyerahkan pelaku kejahatan itu untuk diadili. Alexander Padilla, ketua tim perundingan pemerintah dengan Partai Komunis-Front Nasional Demokratik Filipina-Tentara Rakyat Baru (CPP-NPA-NDF), mencatat bahwa sudah hampir satu bulan sejak pemboman itu, para penjahat di belakang kejadian tersebut masih bersembunyi. Dia mengatakan kompensasi 5.000 peso (sekitar AS$120) untuk per korban yang ditawarkan oleh NPA adalah“uang darah yang tidak bisamembasuhkejahatan,seranganberdarahyangentahbagaimana menemukan target di warga sipil yang malang itu.”“Serangan granat merupakanpelanggaranterhadaphukumkemanusiaaninternasional danhukumFilipina,”kataPadilla,mengulangisikappemerintahFilipina bahwa para tersangka di balik pemboman itu harus menghadapi tuntutan pidana di pengadilan. Sebuah granat meledak di festival desa di kabupaten terpencil Davao, Paquibato, pada akhir 1 September, dan lebih dari 50 warga sipil,banyakdarimerekaanak-anak,yangterlukaparahdalamledakan tersebut.Setelahledakan,KomandanNPAMerardoArcedariMindanao Selatan mengeluarkan pernyataan, mengakui bahwa anggotanya telah keliru melempar granat pada pertemuan pesta.

Myanmar Puji Putusan AS Kendurkan Larangan Impor YANGON (AP): Pengumuman Washington bahwa pihaknya akan mengendurkan larangan impor dari Myanmar telah mengundang pujian di kalangan negara demokrasi Asia Tenggara. Pembantu Presiden Zaw Htay mengatakan Kamis (27/9) bahwa langkah AS itu merupakan hasil usaha yang dilakukan oleh dua tokoh reformis, Presiden Thein Sein dan pemimpin oposisi Aung San Suu Kyi. Menteri Luar Negeri AS Hillary Clinton mengatakan kepada Presiden Myanmar Thein Sein, Rabu, bahwa AS segera mengambil langkah-langkah untuk melonggarkan larangan menyangkut impor dari Myanmar, negara di Asia Tenggara yang sedang bangkit dari isolasi politik dan ekonomi bertahun-tahun. AungWin, deputi ketua Asosiasi Garmen Myanmar, mengatakan industrinya gembira dengan langkah dan harapan muncul dari langkah-langkah tersebut. “Sebagai pengakuan terhadap kemajuan yang terus berlangsung menuju reformasi serta sebagai tanggapan terhadap permintaan daripemerintahdanpihakoposisi,ASmengambillangkahberikutnya dalam menormalisasi hubungan perdagangan kita,” kata Clinton kepada Thein Sein dalam pertemuan di sela-sela Sidang Majelis Umum PBB di New York. “Kami akan memulai proses melonggarkan larangan impor produk-produk Myanmar ke AS. Kami berharap hal ini akan membuka kesempatan bagi rakyat Anda untuk menjual produkproduk mereka ke pasar kami.” Pengumuman Hillary itu menandai langkah AS berikutnya dalam pemulihan hubungan dengan Myanmar, yang memungkinkan keuntungan ekonomis dan strategis bagi kedua negara serta menjadi dorongan politik bagi mantan jenderal yang sekarang memimpin reformasi Myanmar itu. Departemen Keuangan AS pekan lalu menghapus sanksi-sanksi individual bagi Thein Sein.(m10)

Haji 1433 H

A4 40 Hari Menuju Tanah Suci (Tafsir Ayat-ayat Haji)

Masjid Al-Haram Dan Tanah Haram (I) Oleh Azhari Akmal Tarigan HAI orang-orang yang beriman, sesungguhnya orang-orang musyrik itu najis (jiwanya), maka janganlah mereka mendekati Masjid al-Haram setelah tahun ini. (QS. Al-Taubah:28). Larangan orang musyrik untuk mendekati apa lagi masuk ke dalam masjid Al-Haram tidaklah mesti dipahami sebagai ajaran yang aneh. Tidak juga pantas dinilai sebagai ajaran Islam yang diskriminatif. Allah melarang orang musyrik mendekati masjid Al-Haram karena rumah Allah tersebut dibangun tidak buat mereka yang jiwanya bernajis. Rumah Allah hanya diperuntukkan bagi orang-orang yang hatinya bersih. Orang musyrik disebut najis bukan dalam konteks fisik, melainkan jiwanya. Sedangkan fisiknya tidak disebut najis sebagaimana najis pada umumnya. Disebabkan najis itulah, orang musyrik dilarang memasuki tanah haram dan mendekati masjid Al-Haram. Pada sisi lain, dalam konteks kehidupan bernegara lebih-lebih dalam tatanan hubungan internasional, larangan tersebut sebenarnya hal yang wajar.Bukankah setiap negara juga memiliki aturan-aturan tertentu yang bersifat larangan. Misalnya, larangan memasuki satu wilayah atau mengunjungi tempat tertentu. Bisa jadi larangan itu diperlakukan bagi rakyatnya sendiri namun bisa juga bagi orang lain. Biasanya, jika satu tempat dilarang dimasuki, sebabnya adalah tempat itu memang berbahaya atau bisa juga karena nilai atau kehormatan yang dikandungnya. Dalam konteks Masjid Al-Haram, Allah memuliakannya karena keagungan tempat tersebut. Tentu ada banyak hadis yang menjelaskan keutamaan Masjid Al-Haram. Satu saja yang ingin penulis kemukakan adalah sabda Rasul yang mengatakan, “tidak diikat bekal kecuali untuk mengunjungi tiga masjid, Masjid Al-Haram, Masjidku (Masjid Nabawi) dan Masjid Al-Aqsha”. Makna hadis itu adalah Rasul menyuruh kita ummatnya untuk berusaha sekuat mungkin untuk dapat berangkat ke Tanah Suci. Harus ada perjuangan keras untuk bisa mengunjunginya, setidaknya dua masjid, Masjid Al-Haram dan Masjid AlNabawi. Tidaklah heran, jika ada di antara umat Islam yang terus menabung walau perhari Rp. 50.000, - Rp. 100.000,- hanya untuk pergi haji. Nyatanya, ia dapat pergi haji dengan cara menabung bertahun-tahun. Waspada, 25 Sept 2012). Kajian kali ini sesungguhnya hanya menyoroti kata haram yang dirangkaikan dengan kata masjid Al-Haram. Ketika disebut kata haram, yang terbayang di benak kita adalah larangan atau sesuatu yang harus dihindari. Para pakar bahasa juga mengatakan arti asal kata yang mengandung huruf h-r-m mengandung arti larangan dan penegasan. Al-Isfahani menuliskan bahwa larangan itu timbul karena bisa jadi Allah SWT yang langsung mencegahnya (QS. Al-Qashas:12), karena menjadi ketentuan Allah yang bersifat mutlak (QS. Al-Ma’idah:72), dan bisa juga larangan itu terjadi karena pertimbangan syari’at, akal dan orang-orang yang dijunjung perintahnya. Kata haram di dalam Al-Qur’an dengan segala

derivasinya, termasuk dalam bentuk kata kerja, semuanya berjumlah 83 kali. Dalam bentuk masdar haraman sebanyak 28 kali. Jika kata haram digunakan dalam bentuk kata kerja, maka arti kata tersebut mencakup hal-hal yang dilarang syari’at, baik yang berhubungan dengan makanan, wanita yang bukan mahramnya, perbuatan yang diharamkan dan lain-lain. Sedangkan dalam bentuk mashdar, arti haram mengacu pada Tanah Mekkah yang disebut “tanah haram”, “masjid Al-Haram,” “al-masy’ar al-Haram,” (tempat-tempat yang dihormati; Arafah, Muzdalifah dan Mina), “Bait al-Haram,” (Ka’bah) dan “syahr al-Haram” (bulan haram). Khusus kata masjid al-Haram ditemukan di dalam QS. Al-Baqarah :144, 149, 150, 191, 196, 217, QS. AlMa’idah:5:2, QS. Al-Isra’:1 dan lain-lain. Di antara makna yang dikandungnya adalah berkaitan dengan fisik masjid seperti ayat yang telah penulis ungkap di atas dan juga berhubungan dengan arah kiblat shalat umat Islam. Kembali kepada ayat di atas, jika non muslim dilarang mendekati masjid Al-Haram dan mereka oleh Al-Qur’an disebut najis (jiwa atau aqidahnya), maka pemahaman yang dapat kita ambil adalah, masjid AlHaram sejatinya harus digunakan untuk meningkatkan kualitas spiritual kita. Masjid Al-Haram harus dimanfaatkan tidak saja tempat beribadah mahdah saja, tapi kita gunakan untuk melakukan refleksi kritis tentang diri kita sebagai hamba Allah. Menggunakannya untuk bermuhasabah (mengevaluasi diri) sehingga ia akan menemukan otentisitas dirinya sebagai manusia. Bagi jama’ah haji, makna lain kehadirannya di tanah suci adalah “kembali ke masjid” atau “kembali ke rumah Allah”. Bisa jadi selama di tanah air, ia jarang ke masjid untuk shalat jama’ah. Namun pada saat berada di Madinah atau Makkah, ia harus memaksa dirinya untuk tetap shalat berjama’ah di masjid Al-Haram ataupun di Masjid Al-Nabawi tanpa absen sekalipun. Di dalam satu hadis Nabi bersabda, Satu shalat di masjidku ini (Masjid Nabawi) lebih utama daripada seribu shalat di masjid-masjid selainnya, kecuali Masjid Al-Haram. Satu shalat di Masjid Al-Haram lebih utama seratus kali dari shalat di Masjidku ini. (H.R. Ahmad). Di samping ibadah mahdah, seperti shalat, thawaf, zikir, dan membaca Al-Qur’an, tentu ada banyak amalan lain yang bisa kita lakukan, lebih-lebih yang bernuansa sosial. Menjadikan diri menjadi “pelayan” bagi orang lain yang ingin meminum air zamzam, ini adalah amal yang luar biasa. Memberi ruang atau jalan bagi orang lain untuk lalu, atau member tempat bagi jama’ah lain yang ingin mencari tempat shalat, walau ia sendiri terjepit adalah amalan yang nilainya tidak kalah dengan ibadah mahdah. Berada di Masjid Al-Haram adalah sebuah kenikmatan yang tak terkira bagi jama’ah haji untuk melakukan beragam kebaikan; baik kebaikan individu lebihlebih social. Mudah-mudahan jama’ah haji tak menyianyiakan kesempatan emas tersebut. Insya Allah.

WASPADA Jumat 28 September 2012

Katering Asrama Haji Siapkan Makanan 950 Porsi Perhari MEDAN(Waspada):Katering Aziziah yang dikelola Hj Asmiati Agus sebagai penyedia makanan jamaah calon haji (calhaj) EmbarkasiMedan,mengakusetiapharinya menyiapkan makanan 950 porsi untuk calhaj dan petugas serta staf di kantor tersebut. “Setiap hari menu pagi, siang danmalamberbeda,”kataAsmiati di dapur pengolahan aneka masakan tersebut, Kamis (27/9). Untuk menu pagi calhaj, ada nasi putih, sup daging, telur balado,terikacang,dantehmanisserta kopi. Semua makanan itu sudah disiapkan sebelum jamaah memasukiaulapemberangkatan.Sebelum pukul 04:00 panitia sudah menyediakannyadiruangmakan. Menurut dia, khusus untuk siang hari bagi jamaah yang baru masuk asrama ada menu nasi putih, ayam goreng, sayur asam, tahu asam manis, ikan asin dan buah-buahan. Sedangkan malam hari nasi putih, ikan goreng, keripik kentang, sayur gulai, tempe goreng, dan pisang. “Untuk semua makanan ini selalu men-

dapat pengawasan oleh pihak kesehatandandiambilsamplenya sebelum disajikan kepada para jamaah,” tuturnya. Sementara untuk keperluan beras, kata dia, untuk satu kali makan menghabiskan 300 kilogram beras, sedangkan untuk sayur mayur akan habis 100 kilogram. “Agar semua bahan tetap segar, biasanya pengolahannya saatakandimasak.Kebetulanada kepala masak yang mengawasi cara kerja dan bagian kebersihan yangmemantaulangsunghigienis tidaknya bahan yang akan digunakan,” sebutnya. Karenaitu,jelasAsmiati,setiap hari usai memasak makanan dan sebelumnya dapur dan alat memasak tidak boleh ada yang kotor. Terutama lantai yang harus dibersihkan secara khusus, agar kebersihan benar-benar terjaga. Asmiati mengakui, memasak makanan untuk jamaah sangat menyita waktu dan perlu tenaga dan pikiran ekstra . Belanja dan persiapan memasak yang sudah dimulai sejak malam hari hingga

Waspada/Surya Efendi

BOARDING HAJI: Petugas Angkasa Pura dan Garuda Indonesia memeriksa kelengkapan paspor jamaah calon haji Kloter 6 asal Kab. Langkat untuk boarding keluar dari Asrama Haji Pangkalan Masyhur untuk menaiki bus menuju Bandara Polonia Medan, Rabu (26/9).

makansiang.Namun,diamengakui ada kebahagiaan tersendiri bisamenyiapkanmakananuntuk tamu-tamu Allah. “Saya merasa ada sesuatu kepuasan yang tidak ternilai harganya, walaupun sehari-hari katering yang saya kelola selalu mendapatkan order untuk berbagai acara,namundimusimhajisepertiinisayamerasaberbeda,”ujarnya yang menyebutkan lebih 4 kali memenangkan tander katering bagi Calhaj di Asrama Haji Embarkasi Medan ini. (m37)

Waspada/Anum Saskia

PENGELOLA Katering Aziziah menelaah langsung aneka masakan yang akan disiapkan untuk calhaj dan petugas di Asrama Haji Medan.

Bantu Calhaj Dengan Hati Ikhlas MESKIPUN usianya bisa dibilangsudahmulaiuzur,namun semangatnya tetap membara untuk memberikan pelayanan yang terbaik kepada seluruh jamaah calon haji (calhaj) yang masuk ke Asrama Haji Medan. Setiap jamaah yang memasuki ruang istirahat atau memeriksa kesehatannya, ayah tiga anak ini langsungmengangkattasjamaahdan mengantarkannya ke ruang yang dituju. “Bagi saya membantu jamaah calon haji murni dengan hati ikhlas. Saya bangga dan senang bisa membantu jamaah yang sudah tua maupun muda. Sebagai petugas haji sudah saya lakukan sejak tahun 2000, namun sampai tahun ini saya belum dapat menunaikan ibadah haji,”kata Renvil Lubis, 60, warga Kel. Karang Sari, Kec. Medan Polonia, yang sudah 12 tahun menjadi petugas di Asrama Haji Medan ini kepada Waspada saat ditemui seusai membantu jamaah calon haji, Selasa (25/9). Walaupunharusbangunpagi dan pulang pagi juga, Renvil yang biasadipanggilAyahinitetapsegar

bugar. Baginya, tidak menjadi penghalang untuk tetap melaksanakan tugasnya membantu jamaahcalonhaji.“Alhamdulillah saya sehat-sehat terus diberikan allah SWT.Makanya petugas lain sering bertanya sama saya apa resep biar tetap sehat. Saya hanya menjawabobatyangpalingmujarabituadalahmengerjakanpekerjaan dengan hati yang ikhlas,” ujarnya. Bila semua pekerjaan itu dikerjakan dengan hati ikhlas, sebut Renvil, maka hasilnya juga akan baik. “Cobalah kalau kita bekerja dengan ikhlas, pasti hasilnyajugabaik.Pekerjaanitujangan dijadikan sebagai beban, namun kerjakandengansungguh-sungguh danikhlas.Seseorangyangbekerja dengan ikhlas, maka kesehatannyajugatetapterlindungisehingga kita tetap tampak awet dan Allah juga akan memurahkan rezeki kita,” tuturnya tersenyum. Ketika ditanya kapan akan menunaikan ibadah haji, kakek yang mempunya cucu enam ini hanya tersenyum dan memohon doa supaya dapat berangkat ke tanahsuci.Karenabiladilihatdari

penghasilannya, maka besar kemungkinan tidak akan dapat melaksanakan ibadah haji.Tapi, kalau Allah telah menghendaki, maka apapun bisa terjadi. “SejakdudukdibangkuSekolahMenengahPertama(SMP)saya sudahberkeinginanmenunaikan ibadah haji, tapi sampai sudah tua juga belum dapat terlaksanakan. Saya selalu mohon doa kepada jamaah agar nantinya juga keinginanberangkatketanahsuci dapat terkabul. Saya yakin kalau Allahmenghendakinya,makasaya akan menunaikan ibadah haji,” tuturnya. Saat ditanya kembali apakah jamaah calon haji yang dibantu pernah memberikan uang tip, Renvil mengatakan menolaknya. Karena dirinya sadar kalau menjadi petugas di Asrama Haji telah mendapat gaji.“Ada juga jamaah yanghendakmemberikannya,tapi sayamenolaknya.Sayakansudah menerima gaji disini, jadi kenapa harus mengharapkan lagi dari jamaah calon haji. Saya benarbenar ikhlas membantu jamaah berangkat menunaikan ibadah haji ,” tutur Renvil. ME Ginting

Nama Jamaah Calon Haji Kloter 9 Asal Medan Dan Perorangan, Dijadwalkan Masuk Asrama Haji , Sabtu (29/9) Berangkat Melalui Bandara Polonia Medan, Minggu (30/9) 01.Untung Ali Rahman Nasution Bin Ali Rahman ( TPHI) 02. Asmuni Tarmun Diyorejo Bin Tarmun (TPIHI) 03. Legiran Kartopawiro Satiran Bin Karto (TKHI) 04. Nani Andriani Alamsyah Binti Alamsyah (TKHI) 05. Wahyunihar Suharto Tukul Binti Suharto 06. Syahrul Jalal Bin Jalaluddin Bin Jalal 07. Musmar Jetty Musa Binti Musa St.Batua 08. Salma Baritek Tanjung Binti Baritek H 09. Sufri Lela Kartodjo Binti Kartojo 10. Nurmala Atmo Rejo Binti Admorejo 11. Chaeruman Hanif Hanifanuddin Bin Hanif 12. Junaidi Abdul Hamid Bin Abdul Hamid 13. Khaliza Rukiah Shaik Binti Syech Abdu 14. Rahimah Mulia Harahap Binti Mara Muli 15. Nurhamidah Jabujur Siregar Binti Jabujur 16. Fariani Binti Ramali Zaini Binti Ramali 17. Suryati Mansoerdin Rahman Binti Mansoerdin 18. Muhammad Hambali Azhar Bin Azhar 19. Risna Rahmi Arifa Binti Akhlan Husen 20. Aah Atma Abdullah Binti Atma 21. Reyma Sundika Naibaho Binti Rajamti R 22. Muhammad Dahli Bin Ibrahim Bin Ibrahi 23. Syarifuddin Muhammad Syafri Bin M. Sy 24. Mistiarsih Mukhtar Noto Binti Mukhtar 25. Nurama Ali Aksah Binti Aksah 26. Salbiah Monang Nasution Binti Baginda 27. Enni Siti Rodiah Manik Binti Betak 28. Irma Arsiyanti Saaduddin Binti Saadud 29. Elfarison Buchari Sulaiman Bin Buchar 30. Tetty Wahab Situmeang Binti Abdul Wah 31. Dewi Rini Andriastuti Binti Kasry Kas 32. Akhyar Salamuddin Nasution Bin Salamu 33. Syahbudinsyah Ahmad Syafii Bin A Syaf 34. Sri Sukarwaty Wagimin Binti Wagimin 35. Wismarni Abu Samah Binti Abusamah 36. Muhammad Natsir Zainal Bin Zainal Abi 37. Supriyono Suparman Suparti Bin Suparm 38. Farida Nurul Aini Binti Harno 39. Nirwana Fiddin Malau Binti Fiddin Mal 40. Sudirman Sutan Buyung Bin St. Buyung 41. Nurainun Misidi Sucipto Binti Misidi 42. Sasmita Misidi Sucipto Binti Misidi S 43. Asna Dewista Binti Asri Chan Binti As 44. Adrian Bur Burhanuddin Aziz Bin Burhanuddin 45. Nurhayati Bustami Tanjung Binti Bustami 46. Sofiah Lubis Alamuddin Binti Alamuddin 47. Nur Aisyah Karimullah Harahap Binti K 48. Agus Salim Siregar Bin Mhd.Saleh Siregar 49. Basri Dahmin Pasaribu Bin Dahmin Pasaribu 50. Suriani Kasan Taruno Binti Hasan Taru 51. Mukhsin Razi Adam Bin Razi Adam 52. Bony Yandra Nasrul Bin Nasrul 53. Dilla Mai Fitri Binti Taslim 54. Rosmainar Rustam Tanjung Binti Rustam 55. Andrison Nasrul Sutan Minan Bin Nasrul 56. Khaidir Labai Rajang Bin Labai Rajang 57. Asmi Boy Djohar Bin Muhammad Bin Muhammad 58. Riswan Johan Pili Bin Johan 59. Zetrileni Muchtar Salayan Binti Muchtar 60. Alizar Darwis Pili Binti Darwis 61. Asnida Binti Hasan Kasim Binti Hasan 62. Agus Rial Sahrin Bin Sahrin 63. Budiman Muhammad Nur Bin M.Nur Mastad 64. Betty Marlina Syafnal Binti H.Safnal 65. Sumiyati Matjen Jimang Binti Matjen 66. Yurmailis Sabudin Agus Binti Sabudin 67. Bustami Bustaman Abdullah Bin Bustama 68. Nasaruddin Amran Murad Bin Ali Amran 69. Emalita Ali Ruddin Syari Binti H. Ali 70. Nurhayati Burhan Wali Binti Burhan Wali 71. Sulasteri Saridin Ahmad Binti Saridin 72. Rosana Purnama Nasution Binti H.Ir. M 73. Riza Fahlevi Naim Bin Naim Rizal H.M 74. Muhammad Irsan Nasution Bin Husin Ism 75. Nenny Triana Amin Binti Amin Sasmita 76. Siti Amrah Amat Sirait Binti Amat Sirait 77. Siti Hamidah Amat Sirat Binti Amat Sirait 78. Tirin Martosumo Legi Bin Marto Sumole 79. Sutarno Paijan Paimen Bin Paimin 80. Sularno Sandimen Kromo Bin Sandimin 81. Kamiyem Towono Muhammad Binti Towono 82. Hamidah Musa Siagian Binti H Musa Bin 83. Suwarno Wagiman Ngadiman Bin Wagiman 84. Nyoto Sandi Karya Bin H Sandi Karya 85. Umar Dhani Ibnu Hayan Bin Ibnu Hayan 86. Syafar Bin Maraweh Bin Maraweh 87. Guslijawati Binti Rusli Piliang Binti 88. Tarma Saija Panahatan Binti Panyahata 89. Hamser Djontan Saragih Bin Djontan Saragih 90. Wasly Jabbar Hutabarat Bin Jabbar Hutabarat 91. Zahara Ilyas Rangkuti Binti Ilyas Rangkuti

92. Karmina Imbalo Siregar Binti Imbalo S 93. Monang Amir Harahap Bin Amir Hasan 94. Rahmat Rajiun Tanjung Bin Rajiun 95. Lola Yosefa Syarmi Binti Syarmi 96. Umar Khatib Bin Muhammad Bin Muhammad 97. Lela Hayati Zein Binti Muhammad Zein 98. Suarni Ibrahim Lubis Binti Ibrahim 99. Nurhelma Hasan Zaini Binti Hasan Zain 100. Nuraini Muhammad Yunus Binti Muhammad 101. Bakaruddin Hakimin Abdul Bin Hakimin 102. Wirdah Hakam Zainuddin Binti Hakam Z 103. Asni Djamidin Djambak Binti Djamiadin 104. Henny Morina Binti Azwari Binti Azhar 105. Emma Yanti Hamid Binti Hamid Bahary 106. Hanafi Kadir Bin Abdul Kadir Bin Abdul 107. Zulkarnain Iskandar Koto Bin Iskandar 108. Taswar Jafar Caniago Bin Ja’far 109. Nurhadi Muhammad Dinur Binti Muhammad 110. Suriyani Tumiran Marto Binti Tumiran 111. Ngatemin Slamet Kromo Bin Selamat 112. Aisyah Abdul Halim Tanjung Binti Abdul 113. Nilasari Buhanuddin Siregar Binti Burhanuddin 114. Syawal Hassan Kutianyir Bin Muhammad 115. Idris Selamat Simatupang Bin Selamet 116. Komsani Johan Pardede Binti Johan Pardede 117. Siti Aisyah Djalaluddin Binti Djalalu 118. Syafrida Ali Umar Binti St Ali Umar 119. Nasrul Bin Bagindo Husin Bin Husin 120. Ismanidar Nurfiddin Syamsuddin Binti 121. Yulinar Tam Buyung Binti Sutan Tambuyung 122. Herbina Anwar Berutu Binti Anwar Beru 123. Nabsir Gamal Lingga Bin Gamal 124. Hasanuddin Bin Muhammad Nur Bin H. Mh 125. Muliono Sakiman Senteko Bin Sakiman 126. Misniati Senen Wongso Binti Senen 127. Ngaimah Imah Sarian Binti Sarian 128. Latri Puspitasari Suardi Binti Suardi 129. Adrian Sukarman Abdullah Bin Sukarman 130. Khairul Sakti Nasution Bin Abdol Nasution 131. Muhammad Said Kastam Bin M Kastam 132. Tukiam Satarun Abdullah Binti Satarun 133. Sutiar Sutiman Joyo Bin Sutiman 134. Darsilawarni Thamrin Hasibuan Binti T 135. Yusuf Effendi Sutomo Bin Sutomo 136. Yusniarti Bakhtiar Chaniago Binti Bak 137. Hasnah Binti Hakim Abdullah Binti Hak 138. Nuriah Abdul Hamid Binti Abdul Hamid 139. Ismed Muhammad Sarong Bin Muhammad Bi 140. Masri Machrum Rahmad Bin Makrun 141. Fahmi Mahyarruddin Salim Bin Mahyarud 142. Agus Mulyadi Mahadi Bin Mahadi 143. Aina Krisnawaty Ismail Atun Binti Ism 144. Asman Aman Kasdi Bin Aman 145. Ramli Parimin Abdullah Bin Parimin 146. Bahrinsyah Ampunsyah Abdullah Binti 147. Kamsiyem Muhammad Kasih Binti Kasih 148. Sumarlan Kasan Rejo Bin Hasan Rejo 149. Rosmini Harun Sumejo Binti Harun 150. Ernawati Binti Unong Effendy Binti M 151. Salmah Muhammad Saidi Binti Muhammad 152. Jumini Sarmila Dolah Binti Dolah 153. Suarno Muji Mujiran Bin Muji 154. Basri Ramlan Hamzah Bin Ramlan 155. Rohana Ramlan Sonodikromo Binti Ramla 156. Parlomoan Muhammad Lubis Bin Muhammad 157. Yusnah Yusuf Daulay Binti Muhammad Yu 158. Rukita Mudiah Lubis Binti Abdullah Mudiah 159. Jusmadi Ahmad Sanaan Bin H.Ahmad Sana 160. Sudarmi Binti Sumar Jiman Binti Sumar 161. Hazairin Fajar Dalimunthe Bin Fajar D 162. Tengku Arief Mulianda Bin Akhiruddin 163. Sri Rindayani Binti Jumono Binti Djum 164. Suwanto Suwandi Ngadiso Bin Ngadiso 165. Syalmiah Syamsuddin Tasrip Binti Syam 166. Ngadiso Rebin Suntani Bin Rebin 167. Iriadi Kasan Rusdi Bin Kasan Rusdi 168. Ernilawati Muhammad Asman Binti Asman 169. Tri Suci Ariaty Binti Budi Harjo H 170. Ade Irma Nasution Binti Ismail Nasution 171. Zuraidah Zainuddin Baidun Binti Zainuddin 172. Jumarnis Ali Amran Binti Ali Amran 173. Suparman Agus Rancak Bin Agus. R 174. Badri Asmari Iswan Bin Asmari 175. Laila Mahyuni Daulay Binti Ismail Dau 176. Jamaluddin Aminuddin Pohan Bin Amirud 177. Siti Mirhalina Hasibuan Binti Kasmir 178. Khainir Akbar Yusuf Bin H M Yusuf Ibr 179. Zulkifli Muhammad Syam Bin H.Mon Syam 180. Nurdewani Muhammad Syam Binti H.Moh 181. Supriadi Karno Atmo Bin Karno 182. Nur Sakdiah Karmiyo Binti Karmijo

183. Siti Asniah Abdul Manaf Binti Abdul M 184. Darman Asmar Fahruddin Bin Fakhruddin 185. Yusmidar Abdullah Rantak Binti Abdull 186. Fadil Rahman Abdul Rahman Bin Abd Rah 187. Susi Paisa Airani Binti Sori Muda Hrp 188. Muhammad Nasir Djamil Bin Djalil 189. Anisah Abdullah Abbas Binti Abdullah 190. Astuti Sugiman Paidin Binti Sugiman 191. Izham Syahputera Basyiruddin Bin Basy 192. Syukri Kasim Thamin Bin Kasim 193. Yunitia Ranti Wajarlis Binti Wazarlis 194. Yusnidar Burhanudin Yunus Binti H.Bur 195. Kamiluddin Jalaluddin Abdulla Bin Jal 196. Seneng Rahayu Anwar Binti Anwar S 197. Mulyani Rubingun Rono Binti Rubingon 198. Paino Nugroho Sutanto Bin Selamat 199. Muhammad Sarjono Bin Achmad Bin Achmad 200. Rusmidasari Murniati Ruslan Binti Rus 201. Irma Dewi Binti Ibrahim Labok Binti H 202. Irmayani Ibrahim Labok Binti H.Ibrahi 203. Chairiah Said Nasution Binti Mhd.Said 204. Mudjilun Wagino Abdullah Bin Wagino 205. Rika Mahriza Lubis Binti Ridwan Lubis 206. Tati Binti Tabri Darso Binti Tabri 207. Ardiah Batu Bara Binti Ismail Binti I 208. Kamal Bin Takim Lubis Bin Takim Lubis 209. Muhammad Jaharsyah Busnan Bin H. Mhd 210. Nurul Huda Binti Usman Binti H. Usman 211. Nur Azizah Muhammad Busnan Binti H. M 212. Nurana Busnan Salmah Binti H. Mhd. Busnan 213. Juriah Binti Sangkot Nasution Binti S 214. Teladan Terus Bukit Binti Terus Bukit 215. Said Husin Mayan Bangun Bin Mayan Bangun 216. Zainal Abidin Bin Umar Bin Umar 217. Hamidah Binti Hanan Pulah Binti Hanan 218. Anizar Zainuddin Saidina Ali Binti Za 219. Yohana Numaida Kidan Nasution Binti K 220. Sartono Bin Yoso Raharjo Bin Yosoraha 221. Zulkifli Suwardi Marsidi Bin Suwardi 222. Jumiati Jumirin Wirokromo Binti Jemir 223. Emi Peristiwati Syafaruddin Binti Syafaruddin 224. Nuraidah Syaf Sjafaruddin Binti Syafaruddin 225. Siti Zuraidah Muhammad Uyub Binti M U 226. Sawiyah Binti Kimong Armasih Binti Kimong 227. Nova Satria Bin Masir Bin Masir. H 228. Nurlena Lekidin Ahmad Binti Lekidin 229. Ris Inani Lubis Binti H.M.Nur Lubis 230. Amir Hamzah Raya Rambe Bin Tongku Ray 231. Yanuarlin Djamal Lubis Bin Sofyan Dja 232. Suhartini Sukardi Abdullah Binti Sukardi 233. Yeni Cut Mutia Binti Masri 234. Siti Naisyah Jahas Nasution Binti Jab 235. Maryam Djatantuk Batubara Binti Djatantuk 236. Julida Fatma Utami Binti Tumbak Busta 237. Abdul Aziz Hutahuruk Bin H.Ratto Naip 238. Paiman Paino Bin Paino Bin Paino 239. Bengan Panusunan Pane Bin Achmad Lela 240. Samariah Binti Ali Imran Binti Ali Im 241. Bambang Sulinda Saiman Bin Saiman 242. Heru Iswanto Abdul Rahim Bin Abdul Ra 243. Susi Agus Valiana Lubis Binti H Bangu 244. Nurhayati Juyam Atmal Binti Juyam 245. Sudiarmah Binti Johannes Foeuks Binti 246. Sulastri Sentot Suyono Binti Sentot S 247. Sundari Sentot Suyono Binti Sentot Su 248. Susiaty Suyono Sentot Binti Sentot Su 249. Nimmi Bindu Hasibuan Binti Bindu Hasi 250. Nasrul Said Datuk Bin Said Datuk Rajo 251. Zirna Yetti Nazaruddin Binti Nazaruddin 252. Ali Muddin Hamid Lubis Bin Abdul Hamid 253. Ibnu Hazam Bin Muhammad Bin Muhammad 254. Sukri Bin Asmuni Toha Bin Asmuni 255. Aina Elida Binti Syafii Binti Syafei 256. Januardin Burhanuddin Saman Bin Burhanuddin 257. Sri Mulyana Binti Muhammad Binti Mhd 258. Zulaiha Siti Aminah Binti August Arit 259. Siti Ramadani Binti Mara Sutan Binti 260. Nurjannah Abdul Hamid Yakub Binti Abd 261. Sutan Kahar Bosai Bin St Bosai 262. Aisyah Nurapi Sarkawi Binti Nurapi 263. Alwanti Alex Sander Saragih Binti Ale 264. Mardiah Yura Charti Binti Markum 265. Supriyadi Sukino Ahmad Bin Sukino 266. Salbiyah Binti Dollah Kamari Binti Do 267. Nurbayu Martiani Binti Danu Binti Rad 268. Zaharman Bin Abu Bakar Bin Abu Bakar 269. Zuhesti Binti Bustami Amin Binti Bust 270, Teti Mariani Lubis Binti Alm Herman 271. Gahraini Nasution Binti Landarat Bint 272. Julia Chayanti Binti Muchni Binti Muc 273. Taufik Helmi Pane Bin Chotib Mulia Pa

274. Syafnietty Nasruddin Abdullah Binti N 275. Makmur Bin Muhammad Taib Bin Muhammad 276. Nurhalena Hutabarat Binti Taib Binti 277. Marzuki Abdul Hamid Mahmud Bin Abdul 278. Mardiani Ibrahim Yakup Binti Ibrahim 279. Sukarman Muhammad Syahbidin Bin Muham 280. Rojiah Binti Marsam Yunus Binti Marsa 281. Rosmaini Syariful Harahap Binti M Sar 282. Misniwaty Sarjo Kerto Diharjo Binti S 283. Sunarti Kaini Amatdiyo Binti Kaini 284. Nur Prastiyati Binti Dulkawit Binti D 285. Nurmalinda Syrifuddin Saidi Binti Syafaruddin 286. Yetti Yakub Lubis Binti M.Yakub Lubis 287. Ismed Idris Damanik Bin Idris Damanik 288. Iriani Muhammad Yakub Lubis Binti M Y 289. Bachriwan Sanip Lubis Bin Sanip Lubis 290. Ahmad Buchari Amir Hasan Bin Amir Has 291. Pariyam Hanum Sinaga Binti Jakilam Sinaga 292. Demi Sujono Abdullah Binti Sujono 293. Syamsir Noor Muhammad Nurdin Bin Mhd. 294. Anita Purwanti Binti Soemarno Binti S 295. Asril Koto Bin Munir Bin Munir 296. Emilia Rusli Pelly Binti Rusli Pelly 297. Adriansyaj Dairi Alimi Bin Mhd.Dairi 298. Mulkan Harahap Bin Hasyim Bin H. Hasyim 299. Tetti Husnawati Binti Thamrin Hasibuan 300. Irwan Nuh Abdul Muthalib Bin Abdul Mu 301. Supriyantoro Hadi Soetjipto Bin Hadi 302. Rindu Legawati Eddi Gunawan Binti Edi 303. Sademi Dimun Partodikromo Binti Dimun 304. Sobirin Ilyas Lubis Bin Ilyas Lubis 305. 306. 307. 308. 309. 310. 311. 312. Muhammad Maulana Sinaga Bin Luan Sinaga 313. Zainimar Luan Abdullah Binti Abdullah 314. Luna Sari Sinaga Binti Luan Sinaga 315. Siti Maryana Isa Binti H.Muhammad Isa 316. Siti Mardiah Kemis Binti H.Muhammad I 317. Ramlah Ahmad Abdullah Binti H.Ahmad 318. Mariam Idrus Abdullah Binti Idrus 319. Masriah Sulaiman Abdullah Binti Sulai 320. Daswir Suren Buchari Bin S Buchari 321. Yogi Prayoga Suharno Bin Suharno 322. Surya Effendy Bin Amin Bin Hm.Amin Lu 323. Mehraniwati Binti Ismail Matsyam Bint 324. Nurhana Saleh Sembiring Binti Muhamma 325. Tuminah Kasimah Abdullah Binti Siman 326. Rumini Binti Sabran Muhammad Binti Sa 327. Rostina Syahruddin Pane Binti Syahruddin 328. Tjoet Lisna Ali Binti Tm Ali 329. Cut Nizma Muhammad Ali Binti Tm Ali 330. Pocut Ismeini Laili Kairina Binti Teu 331. Muhammad Zaini Puteh Bin Puteh 332. Nuzuluddin Lis Sutan Pengulu Bin Lis 333. Sarina Barumun Hasibuan Binti Barumum 334. Elizar Niviana Abdul Jalil Binti Abd 335. Makmur Amran Lubis Bin Amran Musa Lub 336. Said Bafsal Bin Said Tarmizy Bin Said 337. Syarifah Akmal Said Ibrahim Binti Sai 338. Syarifahramlah Said Abdullah Binti Sa 339. Yarnis Thaib Muhammad Amin Binti Thai 340. Muhammad Rivai Bin Saidi Bin Daini 341. Yuyun Indrawati Hamidah Binti O.Widja 342. Mohamad Milwan Bin Cornel Bin Ok.Corn 343. Rinaldo Sulaiman Adnan Bin Sulaiman 344. Arwin Rustam Bin Rustam Bin Rustam 345. Imam Hambali Muhammad Yasin Bin M Yas 346. Tugiyem Binti Murwo Wiyono Binti Murm 347. Nuraini Abdul Hamid Binti Abdul Hamid 348. Idhar Yahya Muhammad Bin Muhammad Yah 349. Anizar Arsyad Saman Binti Arsyad Sama 350. Marjani Usman Adam Binti H Usman 351. Ainal Mardhiah Usman Binti Usman 352. Intan Faridasari Kusumawaty Binti M Y 353. Ivan Adrian Montolalu Bin M Yoseph Mo 354. Rusliman Bin Abdul Kadir Miyo Bin Abd 355. Marliana Binti Mulio Haminto Binti Mu 356. Rusnik Binti Amran Betung Binti Amran 357. Misnah Binti Abdul Rahim Binti Abdul 358. Darma Sucipto Bin Darijan Bin Darijan 359. Nurhidayati Binti Muhammad Ridwan 360. Cut Lindia Ismail Yusuf Binti Drs. Is 361. Halimatus Sakdiah Abdul Halim Binti H 362. Rahmatsyah Hasan Basri Bin Hasan Basr 363. Muhammad Fatoni Yuleptano Bin M. Idri 364. Astika Cahyarani Tedjo Yuwono Binti T

365. Surya Kencana Soehady Aris Bin Soehad 366. Vitis Jenever Listra Yelly Binti H. 367. Ria Asfariani Arihan Binti Amril 368. Zulkifli Abdul Tiloli Bin Abdul 369. Nasriah Abdul Gani Harahap Binti Abdul 370. Herlinawaty Binti Ali Adam Siregar Bi 371. Salim Fahri Harahap Bin Ismail Harahap 372. Feri Aulia Bachtiar Bin Bahtiar Burha 373. Rita Nizmah Damanik Binti Abdul Syari 374. Sukasno Utomo Senan Bin Senan 375. Sarwo Edi Bin Karyo Bin Karyo Sasmito 376. Muhammad Haris Kaliraja Bin Khatib Lu 377. Syahnuri Pinayungan Hasibuan Bin St.P 378. Siti Akhir Siregar Binti H.Abdul Hali 379. Rukiah Sidi Ahmad Sutan Binti Sidi Ma 380. Yumiati Misnan Ahmad Binti Misnan 381. Razali Pupon Safii Bin H.Safii (Alm) 382. Faridah Idris Batubara Binti M.Idris 383. Chairina Arsyad Nasution Binti Muhamm 384. Rusni Hayaddin Ingah Binti Hayaddin 385. Ichwani Muhammad Yusuf Hasibun Binti 386. Latifah Kosim Harahap Binti Kosim Harahap 387. Fahruddin Muhalib Rangkuti Bin Mukhal 388. Aswin Jufri Dalimunthe Bin Jufri Dali 389. Sri Bulan Siregar Binti Puli Siregar 390. Siti Aida Firman Lubis Binti Abdul Ga 391. Khairani Ruhum Lubis Binti H.Ruhum Lu 392. Deliani Hasanuddin Siahaan Binti Hasan 393. Anismar Muhammad Ramawi Binti Ramawi 394. Suhariani Mucharar Hady Binti Muchara 395. Jawarni Suwito Harjo Binti Suwito Har 396. Sri Dahniar Husban Binti Raja Husban 397. Basiruddin Muhammad Siddik Bin Abdul 398. Yusman Jafaruddin Ahmad Bin Jafaruddin 399. Nurmas Kuaso Lubis Binti Kuaso Lubis 400. Ahmad Karib Paiman Bin Paiman 401. Wagimun Muhammad Yunus Bin M.Yunus 402. Zulfan Muhammad Syamsuddin Bin Syamsu 403. Ponimin Amat Iskak Bin Ahmad Iskak 404. Manisem Sanurejo Abdullah Binti Sanur 405. Mardiaty Ali Umar Tanjung Binti H.Bgd 406. Syahril Ali Jamil Bin H.Ali Djamil 407. Rosmawaty Marah Alam Harahap Binti Ma 408. Risna Yansari Siregar Binti Gading Si 409. Rosdiana Ibrahim Nasution Binti Ibrah 410. Dahlan Syamsuddin Sirait Bin Syamsudd 411. Rohani Purba Jangasi Binti Jangasi Pu 412. Nuraini Abu Zaman Binti Abu Zaman 413. Roslina Mat Amin Nasution Binti Haji 414. Ernawati Yahya Lubis Binti H. M. Yahy 415. Syahlis Irwandi Poniin Bin Poni’in 416. 417. Nurminah Abdul Kadir Binti Abdul Kadi 418. Sity Hafsyah Lubis Binti Bahauddin Lu 419. Thamrin Sopi Lubis Bin Sopi Lubis 420. Zainul Abu Bakar Siregar Bin Abu Baka 421. Khairuddin Abdul Jannah Daulay Bin Abdul 422. Dermawan Bangun Harahap Binti Bangun 423. Faulia Safitri Binti Njadhin Binti Nj 424. Yuherli Bin Muhammad Yusuf Bin M.Yusu 425.. Ruslianto Ahmad Saleh Bin Ahmad Saleh 426. Ernawati Harunsyah Usman Binti Haruns 427. Asba Ridwan Harahap Binti H.Riduwan H 428. Rohana Tapa Situmeang Binti Tapa Situ 429. Parida Hanum Ritonga Binti Sahdan Rit 430. Bangun Ridwan Harahap Bin H.Ahmad Rid 431. Muhammad Aminullah Ngadi Bin Ngadi 432. Ihwan Abdul Ritonga Bin Abdul Gani Ritonga 433. Masanawati Lamsana Harahap Binti Lams 434. Wantemas Ibrahim Musmar Bin Ibrahim M 435. Ali Mukti Siregar Bin H. Adnan Yahya 436. Irmasari Sutan Tua Harahap Binti H. B 437. Latifah Hanum Nasution Binti Abdul Ka 438. Mutiara Abu Nawas Binti Abu Nawas 439. Nazli Abu Nawas Binti Abu Nawas 440. Deliana Darwis Dahlan Binti Sidi Darw 441..Darwita Darwis Dahlan Binti Darwis 442. Juriah Misbahul Munir Binti Misbahul 443. Rostita Suhaimi Arif Binti Suhaimi Ar 444. Azhar Dahlan Bimbang Bin Dahlan Bimba 445. Evi Yuliani Nong Cik Binti Nong Cik 446. Dahlia Uteh Udin Binti Mhd.Uteh 447. Eni Herleli Hutapea Binti Herman Hutapea 448. Khairatun Nisaiah Kuncu Binti Kuncu 449. Kimrani Ahmad Iskandar Binti H Ahmad 450. Khazali Hakim Iskandar Bin HA Iskandar 451. Trinamarni Usman Endah Binti H Usman 452. Nurul Ummi Syahbuddin Binti M Syahbudin 453. Asni Muhammad Binti M Khotib 454. Masdalima Abdullah Hutauruk Binti Abdullah 455. Hamdan Yazid Bin KH Yazid. (m32/m37/m50/m46/h02)


WASPADA Jumat 28 September 2012

Tawuran Pelajar Jadi Masalah Sosial JAKARTA (Waspada): Tewasnya seorang siswa SMA 6 Jakarta dan seorang siswa SMK Zeni Jakarta akibat tawuran mengundang kekhawatiran Menteri Sosial, Salim Segaf Aljufri. Berbicara dalam acara ulang tahun ke-52 Karang Taruna di Jakarta, Kamis (27/9), Mensos mengimbau agar masyarakat ikut berperan aktif dalam mencegah berkembangnya tawuran di kalangan pelajar dan generasi muda. “Kita tidak ingin kekerasan

menjadi warisan budaya bangsa ini. Indonesia terkenal dengan sopan santun, ramah tamah dan kesetiakawanannya, maka itu yang harus dikedepankan,” kata Mensos Salim Segaf. Dia menilai, persoalan tawuran pelajar bukan sekedar lemahnya sistem pendidikan, tapi juga kendurnya semangat pengawasan dalam keluarga dan lingkungan. “Di sekolah itu hanya beberapa jam. Anak-anak dan remaja lebih banyak di rumah dan di lingkungannya. Maka keluarga dan lingkungan harus

ikut malu kalau sampai para pelajar ini saling bunuh,” kata dia lagi. Untuk itu, Salim mengimbau kepada semua organisasi sosial, khususnya karang taruna, untuk lebih meningkatkan peran dan kiprahnya dalam membangun potensi generasi muda. Berbagai kegiatan positif, seperti berkesenian, berolah raga atau berorganisasi, dapat menjadi kesibukan tersendiri sehingga remaja tidak banyak sekedar duduk-duduk di pinggir jalan sepulang sekolah.

“Ayo, ajak para pelajar kita supaya aktif berorganisasi. Mencari kesibukan dan bukannya berkelahi atau melakukan perilaku negatif lainnya,” tanda mensos. Ketua Karang Taruna Pusat, Taufan Eko Nugroho Rotorasiko mengatakan, karang taruna siap bangkit melawan hiruk pikuk perilaku destruktif remaja, di antaranya tawuran dan mengonsumsi narkoba. Saat ini, pecandu narkoba di Indonesia lebih dari 4 juta orang. Dari jumlah itu, sebagian besar adalah usia muda antara

15 sampai 25 tahun. “Memang bukan pekerjaan mudah untuk mengajak kepada kebaikan. Tapi setidaknya karang taruna dapat ikut serta memberi rangsangan bagi pembangunan jati diri di kalangan anak-anak muda,” tandas Taufan. Karang taruna sebagai satu program andalan Kemensos sudah memiliki cabang sampai ke pelosok-pelosok desa. Berbagai program, khususnya kesenian dan sosial, menjadi prioritas organisasi yang usianya sudah cukup tua ini. (dianw)

Pembacok Siswa SMA 6 Ditangkap

Waspada/Andy Yanto Aritonang

UNSUR panitia seminar Gerakan Batak Bersatu (GBB) Menuju dan Memilih Sumut 1.

GBB Kawal Pilgubsu 2013 Dari Politik Transaksional JAKARTA (Waspada): Gerakan Batak Bersatu (GBB) sebagai bagian integral masyarakat Sumut akan mengawal pelaksanaan pemilihan Gubernur Sumatera Utara (Pilgubsu) 2013 melalui pelaksanaan seminar bertajuk “ Menuju dan Memilih Sumut 1”. Seminar yang dijadwalkan di Jakarta dan Medan menampilkan pembicara utama Menteri Koordinator Kesejahteraan Rakyat Agung Laksono dan Menteri Komunikasi dan Informatika Tifatul Sembiring. “Pilgubsu 2013 harus dikawal agar tidak terjebak pada nilainilai transaksional yang dapat membajak demokrasi,” ujar ketua panitia seminar GBB “Menuju dan Memilih Sumut 1”, J.S Simatupang, SH didam-

pingi unsur pengurus, Hermanto Manullangdan Antoni A Pardosi,di Jakarta, Kamis (27/9). JS Simatupang mengingatkan, masyarakat Sumut mesti disadarkan agar tidak terbuai pada bujuk rayu dan tidak terjebak pada politik uang. “ Kesadaran politik masyarakat Sumut mesti dibangun agar menggunakan hak pilihnya secara cerdas,” tandasnya. Dia merujuk pada hasil Pilkada DKI Jakarta yang membuktikan rakyat sudah muak dengan politik yang transaksional. “ Warga Jakarta sudah menentukan pilihannya kepada Jokowi dan itu adalah kemenangan dari warga Jakarta. Kita pun ingin Pilgubsu 7 Maret 2013 jadi kemenangan rakyat Sumut,” harapnya.

Bagi GBB, tambah Simatupang, Pilgubsu 2013 merupakan momentum bagi Sumut mendapatkan seorang pemimpin yang pro rakyat dan punya kerakter kuat untuk membangun Sumut dan mengejar ketertinggalan Sumut dari daerah lainnya. GBB berharap seminar yang digelar nanti dapat merokemendasikan pemimpin Sumut yang ideal, kreatif dan progresif, berintegritas dan peduli, mampu merangsang transformasi nilai dan mengikis nilai-nilai transaksional, serta memaknai amanat rakyat sebagai aktualitas. “ Terpenting terbangunnya kesadaran politik masyarakat Sumut agar memilih secara cerdas sesuai nurani,” tukas JS Simatupang.(aya)

JAKARTA (Waspada): FR alias Doyok,19, pelaku pembacok Alawy Yusianto Putra,15, siswa SMAN 6 hingga tewas, ditangkap petugas Polres Metro Jakarta Selatan, di Yogyakarta Rabu (26/9) malam. “Ya benar. FR telah ditangkap. Sesegera mungkin dibawa ke Jakarta. Kemungkinan pakai pesawat,” kata Kapolres Metro Jakarta Selatan, Komisaris Besar Wahyu Hadiningrat kepada wartawan di Jakarta, Kamis (27/9). Tawuran antara siswa SMAN 6 dan SMAN 70 Jakarta terjadi di kawasan Bulungan, tak jauh dari Blok M Plaza, pada Senin (24/9) lalu, mengakibat tewasnya Alawy, siswa SMA yang tidak ikut tawuran. Alawy tewas akibat kena bacok di bagian dada. “Tadi malam FR kita tangkap dan sekarang sudah diamankan,” kata Wahyu Hadiningrat. 3 Siswa SMK Zeni Jadi Tersangka Penyidik Polres Metropolitan (Polrestro) Jakarta Selatan menetapkan tiga siswa SMK Kartika Zeni sebagai tersangka dalam kasus pembacokan yang menewaskan seorang pelajar SMKYayasan Karya (Yake) 66, Deni Januar. Menurut Kepala Satuan Reserse Kriminal Polrestro Jakarta Selatan, Ajun Komisaris Besar Polisi Hermawan di Jakarta, Kamis (27/9), polisi menangkap 11 orang dari SMK Kartika Zeni dan SMK Yake 66. Penyidik kemudian menetapkan dua tersangka dari 11 orang yang ditangkap, yakni EK dan GL dari SMK Kartika Zeni. Sebelumnya polisi telah menetapkan AD sebagai yang diduga sebagai pelaku utama dalam pembacokan Deni Januar sebagai tersangka. Hermawan menuturkan, EK dan GL adalah pelaku yang menendang dan memukul korban Deni Januar. “Mereka sudah ditahan di Polrestro Jakarta Selatan,” ujar Hermawan seraya menambahkan sembilan orang lainnya dipulangkan karena tidak ada cukup bukti untuk menahan mereka. Siswa SMK Yake 66 dengan SMK Kartika Zeni Jakarta Timur terlibat perkelahian di Jalan Payahkumbuh, Jakarta Selatan, Rabu (26/9), sekitar pukul 12.30 WIB. Lima siswa SMK Yake 66 yang baru turun dari Metromini diserang oleh 15 siswa SMK Kartika Zeni. Akibat serangan tersebut, Deni Januar meninggal dunia karena mendapatkan luka bacokan pada bagian perut sebelah kiri dan pinggang sebelah kanan. (j02)


Plt Gubsu Akan Jamu Peserta BRIN Dan Asean MEDAN (Waspada): Pelaksana Tugas Gubernur Sumatera Utara Gatot Pujo Nugroho direncanakan mengadakan welcome party bagi artis peserta kompetisi Bintang Radio Indonesia Nasional dan Asean tahun 201273 serta Pemimpin Redaksi LPP RRI Daerah se Indonesia di ruang Martabe Kantor Gubernur Sumatera Utara. Menurut Kepala LPP RRI Medan Drs. Rahadian Gingging, MK selaku Ketua Umum Panitia Kompetisi Bintang Radio Indonesia Nasional (BRIN) dan Asean tahun 2012, Kamis (27/9), Plt Gubsu menyambut baik pelaksanaan event nasional dan Asean ini. Saat audiensi, sebut Rahadian, Plt Gubsu Gatot Pujo Nugroho menyampaikan akan menjamu delegasi tersebut pada 5 September 2012 malam. Menurut Rahadian Gingging, bersamaan dengan BRIN dan Asean 2012. Lembaga Penyiaran Publik Radio Republik Indonesia (LPP RRI) juga menyelenggarakan Rapat Kerja Nasional Kepala LPP RRI Daerah/ 73 Pemred se Indonesia dan Kongres Nasional Dharma Wanita

Persatuan LPP RRI tahun 2012. Sementara itu, delegasi Asean, seperti Malaysia dan Brunei Darussalam selain mengirimkan pesertanya untuk Kompetisi Bintang Radio, juga menyelenggarakan lomba balas pantun dan pentas drama di Kampus Universitas Medan Area pada 9 Oktober 2012. Delegasi dua negara tersebut masingmasing dipimpin Pimpinan Lembaga Radio Televisi Malaysia dan Radio Televisi Brunei Darussalam. Usai mengikuti Lomba Balas Pantun dan Pentas Drama, delegasi RTM, RTB dan LPP RRI, akan melakukan study banding ke Stasiun TVRI Medan, dan petang harinya pukul 16:00 berkunjung ke Harian Waspada Medan. Pada Study Banding tersebut, tiga lembaga media dari tiga negara itu mengharapkan informasi penting dari TVRI dan Harian Waspada terlebih di era persaingan media dewasa ini yang mengharuskan semua media melakukan convergensi. (m08/rel)

KPK Periksa Mantan Kakorlantas Hari Ini JAKARTA (Waspada): Komisi Pemberantasan Korupsi (KPK) hari ini Jumat (28/9), akan melakukan pemeriksaan perdana terhadap tersangka kasus simulator SIM Korlantas Polri, mantan Kakorlantas Polri yang juga mantan Gubernur Akpol Irjen Pol Djoko Susilo, “Jumat besok sekitar pukul 09:00 tersangka DS diperiksa,” kata Juru Bicara KPK Johan Budi

di KPK Jakarta, Kamis (27/9). Sebelum memeriksa Djoko Susilo yang telah ditetapkan sebagai tersangka, KPK sudah melakukan pemeriksaan pendahuluan kepada beberapa perwira Polri lain, di antaranya Kapolres Temanggung, AKBP Susilo Wardono, AKBP Indra Darmawan dan AKBP Heru Trisasono. Selain itu, KPK juga sudah

memeriksa panitia pengadaan proyek simulator SIM 2011, di antaranya AKBP Wisnhu Buddhaya, AKBP Wandi Rustiwan, Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini. KPK sudah menetapkan tiga tersangka lain terkait kasus ini, di antaranya Brigjen Pol Didik Purnomo, Budi Susanto dan Sukotjo S Bambang.(j02)

Pemerintah Berdayakan BLK JAKARTA (Waspada): Pemerintah memberdayakan keberadaaan Balai Latihan Kerja (BLK) di pusat dan daerah untuk meningkatkan keterampilan dan kompetensi kerja para pengganggur dan pencari kerja agar mereka siap bekerja dan cepat diserap oleh pasar kerja dan industri. Pada tahun 2012 ini, Kementerian Tenaga Kerja dan Transmigrasi menargetkan sebanyak 97.340 orang bisa mengikuti pelatihan kerja berbasis kompetensi yang diselenggarakan Balai-balai Latihan Kerja di 33 Provinsi seluruh Indonesia. Menteri Tenaga Kerja dan

Transmigrasi Muhaimin Iskandar mengatakan keberadaan BLK-BLK di pusat dan daerah memang terbukti efektif dalam meningkatkan keterampilan dan kompetensi para pencari kerja karena program pelatihan disesuaikan dengan kebutuhan pasar kerja dan industri. “Kemenakertrans terus melakukan proses pelatihan, sertifikasi dan penempatan di balai latihan kerja dengan sasaran para pengangguran, pencari kerja dan masyarakat umum sehingga nantinya lulusan BLK langsung dapat terserap pasar kerja di daerahdaerah, kata Menakertrans Muhaimin Iskandar di Jakarta

baru-baru ini. Hal tersebut, dikatakan Muhaimin, seusai acara penyerahan bantuan pelatihan bagi Yayasan Pendidikan Maarif dan peresmian Bursa Kerja Online Khusus SMK dan Website di Sidoarjo, Jawa Timur pagi harinya. Muhaimin mengatakan program pelatihan berbasis kompetensi di BLK-BLK ditujukan penyiapan sumber daya manusia yang kompeten, produktif melalui program pelatihan di Balai Latihan Kerja (BLK) untuk mengurangi pengangguran terutama di daerah-daerah yang tingkat penganggurannya masih tinggi. (j04)



WASPADA Jumat 28 September 2012

Klose Jujur Ngaku Handball Cavani Hatrik Menangkan Napoli


STRIKER Alvaro Pereira (tengah) membuka keunggulan Inter Milan atas Chievo di Stadion Marc Antonio Bentegodi, Verona, Italia, Kamis (27/9) dinihari WIB.

Rekor Mourinho Pecah Inter Menang Di Kandang Chievo ROMA (Waspada): Alenatorre Andrea Stramaccioni memecahkan rekor kemenangan tandang pendahulunya di Inter Milan, Jose Mourinho, saat sukses mempersembahkan treble winners pada musim 2009-10. Strama telah membawa La Beneamata meraih lima kemenangan tandang beruntun di Liga Seri A dan Liga Europa, Rabu (KamisWIB), setelah Inter mempecundangi ChievoVerona 2-0 di Stadion Marc Antonio Bengegodi. Menurut Football Italia, Kamis (27/9), rekor lima kemenangan tandang di Inter itu hanya pernah dilakukan oleh Roberto Mancini pada Desember 2007 hingga Januari 2008. Hasil lima tandang I Nerrazzurri malah sangat impresif, mereka mencetak 12 gol tanpa seka-

lipun kebobolan. Dua gol kemenangan Inter ke gawang Chievo disumbangkan Alvaro Pereira menit 43 dan Antonio Cassano menit 74. Menurut Strama, sukses itu tak terlepas dari perubahan strategi yang diterapkannya. Dia kini memainkan tiga bek Andrea Ranocchia, Walter Samuel dan Juan Jesus di lini belakang dalam formasi 1-3-5-2. “Saya pikir strategi ini bisa menjadi dasar kerja kami di masa depan. Strategi ini cara terbaik untuk memanfaatkan pemain yang ada di tim, percam-

puran antara kesolidan dan serangan, tanpa kehilangan keseimbangan,” klaimnya. “Saya melihat pemain sayap di sistem ini menjadi barometer mental yang kami butuhkan. Saya meminta tim lebih berani dalam serangan, dan saya pikir ini cara yang terbaik,” tambah Strama. Hasil di Verona membuat Inter memenangi semua pertandingan tandangnya, namun Javier Zanetti dan kawan-kawan belum pernah meraih kemenangan kandang di Giuseppe Meazza, Milan. “Sekarang saatnya kami berpikir untuk mencetak beberapa gol di laga kandang. Peluang itu selalu datang, tapi sayangnya kami tidak bisa mengubahnya menjadi gol,” ungkap Cassano. “Tapi itu tentu tidak bisa diraih dengan mudah. Sebab semua tim yang tandang ke Milan selalu memperagakan permainan bertahan. Kami

Hasil Rabu (Kamis WIB)

Klasemen Liga Seri A

Pescara vs Palermo AC Milan vs Cagliari Roma vs Sampdoria Catania vs Atalanta Chievo vs Inter Milan Genoa vs Parma Napoli vs SS Lazio Torino vs Udinese

Juventus 5 4 1 0 11-2 13 Napoli 5 4 1 0 11-2 13 Sampdoria* 5 3 2 0 8-5 10 Inter Milan 5 3 0 2 8-5 9 SS Lazio 5 3 0 2 7-5 9 Fiorentina 5 2 2 1 6-4 8 AS Roma 5 2 2 1 11-7 8 Catania 5 2 2 1 7-7 8 Genoa 5 2 1 2 7-7 7 AC Milan 5 2 0 3 6-5 6 Torino* 5 1 3 1 4-3 5 Udinese 5 1 2 2 6-9 5 Atalanta* 5 2 1 2 4-4 5 Parma 5 1 2 2 5-7 5 Bologna 4 1 1 2 5-8 4 Pescara 5 1 1 3 4-10 4 Chievo 5 1 0 4 3-9 3 Cagliari 5 0 2 3 2-9 2 Palermo 5 0 1 4 1-9 1 Siena* 4 1 2 1 5-4 -1 *Siena minus 6 poin, Atalanta 2, Torino dan Sampdoria 1 poin.

1-0 2-0 1-1 2-1 0-2 1-1 3-0 0-0

Hasil Selasa (Rabu WIB) Fiorentina vs Juventus


akan berusaha memenanginya pada Minggu nanti dalam duel melawan Fiorentina,” tekad bomber bengal Italia itu. Cassano sementara ini menjadi bomber tersubur Nerazzurri. Mantan penyerang AS Roma dan Real Madrid itu sudah membukukan tiga gol dari lima laga La Beneamata di semua kompetisi, sejak diboyong dari AC Milan. “Semua rekan memudahkan saya, ini skuad luar biasa dan saya merasa nyaman di sini. Saya memimpin tim dengan gol-gol saya. Tapi yang terpen-

Pembuktian Kaka MADRID (Waspada): Ricardo Kaka memberi peringatan tentang kemampuannya, Rabu (Kamis WIB), ketika dia membuat hatrik dalam kemenangan 8-0 Real Madrid atas klub Millonarios dari Kolombia. Pada laga perebutan Piala Santiago Bernabeu tersebut, Kaka seolah ingin membuktikan kepantasan harganya yang mencapai 65 juta euro. “Dia (Kaka) bermain amat bagus malam ini,” puji Mourinho, seperti dilansir Reuters, Kamis (27/9). Kaka dipercaya menjadi starter saat menghadapi Millonarios. Kesempatan yang diberikan Mourinho itu tidak disiasiakannya dengan menyarangkan tiga bola ke gawang tim tamu menit 14, 38 dan 60. Lima gol El Merengues lain-

nya dicetak oleh Jose Callejon menit 23 dan 68, Alvaro Morata menit 32 dan 36, serta Karim Benzema menit 78. “Kaka dan sejumlah pemain lainnya melakukan tugas yang cukup bagus untuk mendapat perhatian pelatih,” tambah Mourinho. Bintang Brazil berusia 30 tahun itu sebelumnya gagal menunjukkan kiprahnya, setelah sempat tampil amat bersinar. Kaka malah berulang kali dihantam cedera selama tiga tahun terakhir, sejak dia bergabung dengan Madrid dari AC Milan. Karenanya dia menjadi pilihan ketiga musim ini di belakang Mesut Ozil (Jerman) dan pembelian terbaru Luka Modric (Kroasia). El Real bahkan sempat berusaha menjualnya di awal musim ini, namun usaha


KAKA masih mampu mencetak gol kendati ditekan kiper Jose Luis Tancredi (kiri), di Stadion Santiago Bernabeu, Madrid, Kamis (27/9) dinihari WIB. itu gagal karena tidak ada klub yang bisa memenuhi permin-

Falcao Kembali Motori Atletico MADRID ( Waspada): Radamel Falcao kembali memotori kemenangan Atletico Madrid dengan dua gol yang disarangkannya ke gawang tuan rumah Real Betis. Ketajaman striker Kolombia itu memenangkan Atletico 4-2 pada partai tunda La Liga Primera, Rabu (Kamis WIB), sekaligus membawa timnya naik ke urutan dua klasemen sementara, hanya dua angka di bawah Barcelona. Striker Kolumbia yang dalam keadaan prima itu menuai golnya musim ini menjadi tujuh dan menempatkan diri di urutan teratas daftar pencetak gol La Liga, di atas pemain Bercelona Lionel Messi. Pemain pengganti Diego Costa dan Raul Garcia menyempurnakan kemenangan tim mereka, sedangkan Betis - yang akhirnya bermain dengan

Agenda Babak 16 Besar 30 dan 31 Oktober 2012 Montpellier vs Bordeaux Bastia vs AJ Auxerre Paris SG vs Marseille AS Monaco vs Troyes LOSC Lille vs Toulouse Rennes vs Arles-Avignon Nice vs Olympique Lyon Sochaux vs Saint-Etienne


sembilan orang - membuat penyandang gelar Eropa Atletico kini mengantongi 13 poin dari lima pertandingan, dua angka di bawah pimpinan klasemen Barcelona. Betis memimpin lebih dahulu menit 25 ketika Salvador

Agra behasil menguasai bola dan melewati bek Miranda, kemudian yang dengan sigap menaklukkan kiper Sergio Asenjo. Atletico hanya butuh dua menit untuk membalas. Falcao dengan gesit menyambut bola dari Raul Garcia dan tendangannya menyilang menembus gawang Betis. Kiper Casto Espinosa tetap membuat timnya menekan Atletico dengan beberapa penyelamatan gemilangnya. Betis memimpin lagi lewat gol bunuh diri Francisco Juanfran menit 45. Namun tiga menit babak kedua berjalan, Falcao melalui tendangan 12 pas kembali menyamakan skor dengan gol ketujuhnya di awal musim ini. Hadiah penalti itu mereka dapat menyusul kartu merah yang jatuh pada penyerang Betis, Damien Perquis. Tim tuan rumah makin merana ketika pemain pengganti Joel Campbell mendapat kartu kuning kedua

taan nilai transfer Los Blancos. (m15/ant/rtr)

Klasemen La Liga Barcelona Atl Madrid Mallorca Malaga Sevilla Real Betis Real Madrid Vallecano Levante Deportivo Celta Vigo Zaragoza Valladolid Sociedad Valencia Ath Bilbao Getafe Granada Espanyol Osasuna

5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5

5 4 3 3 3 3 2 2 2 1 2 2 2 2 1 1 1 0 0 0

0 1 2 2 2 0 1 1 1 3 0 0 0 0 2 2 1 2 1 1

0 14-3 0 15-7 0 7-3 0 6-2 0 6-2 2 10-9 2 7-4 2 6-7 2 7-9 1 7-7 3 6-6 3 5-6 3 4-5 3 6-9 2 6-8 2 8-12 3 6-10 3 2-8 4 7-11 4 3-10

15 13 11 11 11 9 7 7 7 6 6 6 6 6 5 5 4 2 1 1

menit 83, setelah Diego Costa membawa Atletico gentian memimpin. Raul Garcia kemudian mencetak gol keempat Atletico pada injury time babak kedua. (m15/ant/rtr/afp)

Monaco Teruskan Kiprah Bagus PARIS (Antara/Reuters): AS Monaco meneruskan kiprah bagusnya musim ini, ketika tim Ligue 2 itu mengalahkan Valenciennes 4-2 pada perpanjangan waktu, Rabu (Kamis WIB), sehingga maju ke putaran 16 besar Piala Liga Prancis. Valenciennes kelihatannya sudah hampir memenangi pertandingan itu, setelah Gael Danic dan Andreas Wolf mem-

buat gol bunuh diri sehingga kedudukan 2-0 setelah laga berlangsung 32 menit. Tetapi striker Senegal, Ibrahima Toure, yang sudah mencetak sembilan gol dalam delapan laga Ligue 2 musim ini, mempertipis kekalahan timnya menit 35 lewat tendangan dari jarak dekat. Yannick Ferraira Carrasco menyamakan angka lewat ten-

dangan penalti memasuki babak kedua. Lucas Ocampos menambah gol ketiga Monaco lewat umpan yang dikirim Toure 14 menit memasuki babak kedua, sebelum Toure menyempurnakan kemenangan pada menit akhir lagi. Tim Ligue 2 lainnya, Arles Avignon, juga melaju setelah menang 2-1 di kandang sendiri atas AC Ajaccio.

ting adalah seluruh pemain memberikan segalanya,” pungkas Cassano. (m15/vvn/fi/espn)

ROMA (Waspada): Edinson Cavani mencetak hatrik ketika Napoli menggasak SS Lazio 3-0 pada giornata 5 Liga Seri A, Rabu (Kamis WIB), setelah gol tim tamu dianulir karena Miroslav Klose mengaku bola mengenai tangannya. Penyerang veteran Jerman itu menyarangkan bola ke gawang Napoli menit ketiga.Wasit sempat menyatakan gol, tapi kemudian menganulirnya karena Klose dengan jujur mengaku handball. Napoli mengambil kesempatan dari gol yang dianulir itu. Mereka melakukan serangan balik dan Cavani mencetak gol dari jarak jauh menit 19 untuk membuka keunggulan tim tuan rumah. Striker Uruguay itu kemudian mengatasi perangkap offside ketika mengejar umpan dari kapten Paolo Cannavaro, lantas menyarangkan gol keduanya menit 31. “Klose pantas mendapat hadiah karena sikap jujurnya,” puji Cannavaro, seperti dilansir Reuters, Kamis (27/9). Walter Mazzarri, alenatorre Napoli, ikut memuji kejujuran mantan mesin gol Bayern Munich dan Werder Bremen tersebut. “Itu adalah sikap yang baik (dari Klose), namun saya juga bersyukur dengan aturan yang ada,” tuturnya. “Pasalnya, dia (Klose) sadar telah tertangkap kamera dan bisa saja mendapat hukuman berat karena itu,” katanya menambahkan. Cavani melengkapi hatrik-


STRIKER Lazio Miroslav Klose (11) dengan jujur mengaku handball kepada wasit di Stadion San Paolo, Naples, Kamis (27/9) dinihari WIB. nya menit 64, tetapi dia gagal dalam usaha membuat gol keempat melalui tendangan penalti 11 menit kemudian. Cavani menendang bola terlalu tinggi, sehingga melebar dari gawang yang dijaga Federico Marchetti. “Para pemain telah memberikan penampilan cukup baik dan saya senang dengan itu. Saya mengatakan kepada pemain bahwa kami bisa saja kalah dalam laga kali ini, karena Lazio tim bagus,” papar Mazzarri. Di Stadion San Siro, Stephan El Shaaraway mencetak gol kandang pertama untuk AC Milan pada semua pertandingan musim ini. Kecemerlangannya dengan memborong dua gol menit 15 dan 82, membawa I

Rossoneri menang 2-0 atas Cagliari sekaligus mengurangi tekanan kepada pelatih Massimiliano Allegri. Di Stadion Olimpico Roma, kapten Francesco Totti menjelang ulang tahunnya ke-36, mencetak gol ketika AS Roma ditahan 1-1 oleh tamunya Sampdoria. Totti mencetak gol setelah terjadi kemelut di dekat mulut gawang lawan. Dia membuat Il Lupo unggul lebih dahulu menit 34, tetapi Il Samp mampu menyamakan kedudukan meskipun tempur dengan 10 pemain karena Enzo Maresca dikeluarkan dari lapangan pada awal babak kedua. (m15/ant/rtr/fi)

Patung Zidane Tanduk Materazzi


PARIS (Antara/Reuters): Ulah Zinedine Zidane menanduk bek Italia Marco Materazzi pada final Piala Dunia 2006, dibuat permanen dalam bentuk patung, dan dipajang di Paris, ibukota Prancis. Patung itu akan diletakkan di depan Alun-alun Pompidou dan akan tetap di tempat itu hingga 7 Januari 2013. Patung setinggi lima meter yang terbuat dari perunggu itu diciptakan pematung Adel Abdessemed sebagai kenangan ketika kapten tim Prancis itu menanduk dada Materazzi pada perpanjangan waktu. Zidane dikeluarkan dari lapangan dan tidak pernah lagi bermain secara internasional. Les Bleus yang memenangi Piala Dunia 1998, akhirnya kalah lewat adu penalti dari Gli Azzurri. Belakangan Zidane mengaku, sengaja menanduk Materazzi karena pemain Inter Milan itu menghina keluarganya.


WASPADA Jumat 28 September 2012


Rooney Gembira Tampil Lagi LONDON (Waspada): Striker Manchester United (MU) Wayne Rooney mengaku gembira dapat tampil lagi di lapangan setelah empat minggu beristirahat. Rooney comeback, Rabu (Kamis WIB), saat timnya menang 2-1 atas Newcastle United pada babak ketiga Piala Liga Inggris di Stadion Old Trafford, Manchester. “Rasanya gembira dapat main lagi bersama temanteman saya. Saya berharap dapat tampil lagi pada pertandingan selanjutnya,” tutur Rooney melalui Sky Sports, Kamis (27/9). Rooney absen sejak mengalami cedera pada kakinya, ketika Setan Merah MU melawan Fulham pada 20 Agustus. Dia tidak mencetak gol ke gawang The Magpies sebelum digantikan Nick Powell menit 76, tetapi kondisinya kelihatan sangat bugar. “Saya merasa sehat kendati

rasanya agak susah menjalani pertandingan pertama setelah beberapa minggu tidak bergerak. Saya berharap kondisi saya membaik dan kebugaran fisik ini bermanfaat untuk saya,” tekad striker Inggris itu. United dengan mudah maju ke putaran empat, kendati manajer Sir Alex Ferguson melakukan 11 pergantian pemain dibanding tim yang mengalahkan Liverpool akhir pekan lalu di Liga Premier. Selain Rooney, gelandang Darren Fletcher pun tampil pertama kalinya dalam 10 bulan terakhir. Gelandang Anderson yang memecah kebuntuan gol MU lewat tendangan spektakular kaki kirinya dari jarak sekitar

Agenda Babak IV 29 & 30 Oktober BOMBER MU Wayne Rooney (kanan) menghindari tekel bek Newcastle Cheick Tiote di Stadion Old Trafford, Manchester, Inggris, Kamis (27/9) dinihari WIB. -AP25 meter satu menit sebelum turun minum. Tom Cleverley menggandakan skor lewat gebrakan menggunakan kaki kanan menit 58, sebelum Papiss Cisse mempertipis kekalahan Newcastle menit 62. Meskipun menyumbang-

kan gol, penampilan Cleverley sempat menuai kekecewaan dari Ferguson. Menurut Rooney, Sir Fergie merasa gusar lantaran Cleverley membuang peluang mencetak gol di babak pertama. “Manajer tidak terlalu se-

Sunderland vs Middlesbrough Swindon Town vs Aston Villa Wigan Athletic vs Bradford Leeds United vs Southampton Reading vs Arsenal Norwich vs Tottenham Hotspur Liverpool vs Swansea City Chelsea vs Manchester United nang dengan Tom karena kegagalan (mencetak gol) di babak pertama. Tapi gol yang dia ciptakan sangat bagus,” beber Rooney. Kegagalan Cleverley itu terjadi menit 35. Pemain berusia 23 tahun ini sudah berdiri di dekat gawang Newcastle saat mendapatkan umpan dari Javier ‘Chicharito’ Hernandez, tapi dia telat bereaksi hingga bola segera diamankan kiper Rob Elliot. (m15/ant/rtr/sky)

Sahin Simbol Kebangkitan The Reds Hasil Rabu (Kamis WIB) Arsenal vs Coventry Man United vs Newcastle Norwich vs Doncaster QPR vs Reading West Brom vs Liverpool

6-1 2-1 1-0 2-3 1-2

Hasil Selasa (Rabu WIB)


Bradford vs Burton Chelsea vs Wolves Crawley vs Swansea Leeds vs Everton Man City vs Aston Villa Milton KD vs Sunderland Preston vs Middlesbrough Southampton vs Sheffield-W Swindon vs Burnley West Ham vs Wigan

3-2 6-0 2-3 2-1 2-4 0-2 1-3 1-0 3-1 1-4

LONDON (Waspada): Penyandang gelar Liverpool sempat kecolongan di The Hawthorns, Rabu (Kamis WIB), ketika mengalahkan West Bromwich Albion 2-1 berkat dua gol Nuri Sahin (foto) pada babak ketiga Piala Liga Inggris. “Saya pikir ini kemenangan simbolis, karena pertandingan ini menunjukkan seberapa cepat kami bergerak sebagai sebuah tim,” klaim Brendan Rodgers, manajer The Reds, seperti dilansir Reuters, Kamis (27/9). The Reds kebobolan gol menit ketiga lewat tendangan jarak dekat Gabriel Tamas, yang tidak dapat diantisipasi kiper pengganti, Brad Jones. Sahin menjadi simbol kebangkitan The Pool, ketika me-

15 SLTA, SLTP Ikuti LPI Sumut MEDAN (Waspada): Setelah mengikuti babak kualifikasi di berbagai kabupaten/kota seSumatera Utara, 15 tim sepakbola tingkat SLTP dan SLTA akan mengikuti Liga Pendidikan Indonesia (LPI) untuk mencari wakil Sumut di kancah nasional yang digelar mulai 4 Oktober mendatang. Tingkat SLTA diikuti delapan tim yang terbagi atas Labuhanbatu Utara, Tanjungbalai, Serdang Bedagai, Labuhanbatu (Grup A) dan Batubara, Tebingtinggi, Medan, Deliserdang (Grup B). Grup A tingkat SLTP dihuni Tebingtinggi, Labuhanbatu Utara, Tanjungbalai, Deli-

serdang, sedangkan Serdang Bedagai, Medan, dan Batubara bergabung di Grup B. Demikian disampaikan Ketua LPI Sumut Drs Safei Pilly didampingi Koordinator Bidang Pertandingan Adi Khairul Sinaga dan Sekretaris Waluyo Santoso di Medan, Kamis (27/ 9). Ditambahkan, pertandingan tingkat SLTP dilaksanakan di Lapangan Pancing (Dispora Sumut) dan SLTA di lapangan Asrama PPLP Medan Sunggal. Safei menambahkan, sebelum putaran final LPI Sumut, masing-masing kabupaten/kota terlebih dulu menggelar babak kualifikasi. Juara masing-masing

kabupaten/kota merupakan wakil yang bertanding di LPI tingkat Sumut. Koordinator Pertandingan, Adi Khairul, melanjutkan pada putaran final ini diharapkan timtim yang berlaga merupakan tim-tim tangguh. “Dengan demikian diharapkan wakil Sumut baik tingkat SLTP maupun SLTA dapat memperoleh hasil maksimal di tingkat nasional,” ujarnya. “Semangat sepakbola Sumatera Utara diharapkan bangkit untuk menjuarai LPI tingkat nasional,” pungkas pria yang akrab disapa Bento. (m18)

nyamakan kedudukan lewat tendangan spekulatif dari jarak jauh menit 17. Gelandang pinjaman dari Real Madrid itu menggebrak lagi menit 82 dengan memanfaatkan umpan dari Oussama Assaidi. “Dia (Sahin) masih memperbaiki kecepatannya. Memang sulit baginya, karena dia datang ke sini dengan catatan sudah lama tidak bertanding. Tapi dia kini semakin baik, dia memiliki arogansi sepakbola yang besar,” jelas Rodgers. “Dia hebat saat menguasai bola. Anda bisa melihat saat mencetak gol pertama, dia menunjukkan teknik bagus dan tidak takut untuk melepaskan tendangan. Untuk gol kedua, dia menunjukkan bahwa dirinya

mampu menerobos kotak penalti lawan dan menciptakan gol,” pujinya lagi. Mantan manager Swansea City yang baru menangani Si Merah di awal musim ini, pun memuji penampilan beberapa pemain mudanya. Di antaranya Sebastian Coates (21 tahun), Jack Robinson (19 tahun), AndreWisdom (19 tahun), Daniel Pacheco (21 tahun), dan Samid Yesil (18 tahun), semuanya dia turunkan sebagai starter. “Saya selalu senang melihat penampilan pemain muda yang memiliki teknik hebat. Tapi yang paling penting, mereka juga memahami bagaimana caranya bertarung. Mereka telah tampil luar biasa,” tambah Rodgers. (m15/vvn/rtr/espn)

Panahan PPLP Sumut Ujicoba MEDAN (Waspada): Skuad panahan Pusat Pendidikan Latihan Pelajar (PPLP) Sumut menggelar try out (ujicoba) dalam persiapan menghadapi Kejuaraan Antar-PPLP se-Indonesia di Riau, 1520 Oktober mendatang. Menurut pelatih panahan PPLP Sumut, Drs Rahmat Purba, sebelum bertarung di kejuaraan tersebut, skuad pelajar menggelar try out ke Sei Karang PTPN III, Minggu (30/9). Setelah itu, atlet melanjutkan ujicoba ke Serdang Bedagai pada 7 Oktober mendatang. “Kita mempersiapkan delapan atlet putra dan putri. Diharapkan mereka nantinya dapat bertanding maksimal,” ujar Rahmat Kamis (27/9). Empat atlet putra masing-masing adalah Juni Ray Barus, Rian Aner Fernando Saragih, Fido Randika, dan Janhot Maruli Aman Purba. Untuk putri masing-masing ada Sry Mala Tarigan, Irna Alisha Nasution, Lisa Mutiara, dan Endamya Bevi Nesra Barus. “Nantinya, anak-anak mengikuti nomor lomba ronde nasional pada jarak 30, 40, dan 50 meter. Kita berharap atlet pelajar ini dapat memperoleh hasil maksimal,” tutup Rahmat lagi. (m18)

Agenda Surya SBW 2012 Semakin Menarik MEDAN (Waspada): Memasuki hari kedua event Surya Sumatera Bike Week (Surya SBW) 2012 di Lapangan Benteng, Medan, Kamis (27/9), sejumlah agenda yang digelar menyedot perhatian pengunjung. Sejumlah agenda menarik kembali bergulir guna menyemarakkan kegiatan kebanggaan Sumut ini, di antaranya Riders Welcome Bikes sebagai penyambutan pengendara motor bercc besar (Moge) yang datang dari berbagai daerah dan negara tetangga. Kedatangan mereka adalah bagian dari agenda berkumpulnya 1000 rider motor besar di event ini sekaligus menjadikan Surya SBW 2012 sebagai ajang otomotif terbesar yang pernah terselenggara di tanah air. “Yang pasti, setiap kedatangan tamu-tamu bikers tersebut selalu kita sambut dengan acara Riders Welcome Bike berupa pemakaian ulos,” ucap Ke-

tua Panpel Surya SBW, Faisal A Nasution. Selain itu, agenda lainnya adalah donor darah bersama PMI Medan, Babes Bike Wash, Pesta Budaya Sumut, Games Bikers Community, pengumuman 30 Besar modifikasi motor umum serta lainnnya. Humas Panpel Surya SBW 2012, Dedi Dermawan M, mengatakan kegiatan di arena Surya SBW 2012 semakin mendekati puncaknya. “Jumat (28/9) ini, mata acara semakin meningkat untuk memikat peserta dan pengunjung. Event ini memang sengaja kita rangkai dengan seabreg agenda menarik sebagai persembahan kepada peserta dan warga, agar mereka terkesan dengan keanekaragaman budaya serta cita rasa kuliner di daerah ini,” ungkap Dedi. Adapun agenda tersebut di antaranya bazar, donor darah, riders welcome bike, free style

Problem Catur Jawaban di halaman A2 8







1 A








Penyesalan Van Der Vaart 10 Pemain Gladbach Tahan Hamburg BERL IN (Waspada): 10 Pemain Borussia Moenchengladbach mampu bertahan, bahkan mencetak gol menit akhir untuk membuat laga jadi 2-2 lawan Hamburg SV pada spieltag 6 Bundesliga. Duel di markas Gladbach, Rabu (Kamis WIB) tersebut, ditandai sukses Rafael van der Vaart mencetak gol pertama sejak kembali ke klub itu dari Tottenham Hotspur. Tetapi Van derVaart gagal dalam tendangan penalti pada babak kedua. “Pekerjaan kami akan sempurna bila saya berhasil mencetak gol penalti. Setelah itu saya berpikir sepertinya saya melakukan kesalahan,” sesal bintang Belanda itu, seperti diberitakan AFP, Kamis (27/9) Alvaro Dominguez memaksakan hasil seri menit 90, menyambut bola dari tendangan bebas Juan Arango. Van der

Hasil Rabu (Kamis WIB) M’gladbach vs Hamburg Stuttgart vs Hoffenheim Hanover vs Nuremberg Freiburg vs W Bremen Augsburg vs Leverkusen

Vaart, favorit penonton di Hamburg pada musim 2005-2008, menjebol gawang lawan dari tepi kotak penalti menit 23 untuk membawa timnya unggul lebih dahulu. Artjom Rudnevs membuat Hamburg memimpin lagi pada akhir babak pertama, setelah Martin Stranzl menyamakan skor menit 39. Stranzl kemudian dikeluarkan wasit dengan kartu merah menit 53 karena melakukan gerakan kasar. Gol penyama kedudukan oleh Dominguez membuat Hamburg gagal meneruskan kiprah positifnya, seperti saat mengalahkan juara bertahan Borussia Dortmund minggu lalu. “Saya tetap puas, karena kami bermain bagus. Tapi saya khawatir dengan jalannya pertandingan. Kami menjaga jarak dalam 90 menit dan kami kemasukan gol pada tiap babak,” jelas Thorsten Fink, pelatih Hamburg. (m15/ant/afp/ap)

2-2 0-3 4-1 1-2 1-3

Hasil Selasa (Rabu WIB) B Munich vs Wolfsburg Schalke vs Mainz Furth vs Fortuna E Frankfurt vs Dortmund

3-0 3-0 0-2 3-3

Klasemen Bundesliga B Munich E Frankfurt Hanover Schalke Fortuna Dortmund W Bremen Leverkusen Nuremberg M’gladbach Hoffenheim Freiburg Wolfsburg Hamburg Mainz Furth Stuttgart Augsburg

5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5

5 4 3 3 2 2 2 2 2 1 2 1 1 1 1 1 0 0

0 1 1 1 3 2 1 1 1 3 0 2 2 1 1 1 2 1

0 0 1 1 0 1 2 2 2 1 3 2 2 3 3 3 3 4

17-2 15 14-7 13 14-8 10 10-5 10 4-0 9 11-8 8 9-8 7 7-7 7 7-9 7 7-7 6 10-12 6 7-8 5 2-8 5 7-10 4 4-8 4 2-8 4 3-12 2 2-10 1

PSSI Medan Umumkan Susunan Pengurus Segera Gelar Kompetisi SSB MEDAN (Waspada): Pengurus Cabang PSSI Kota Medan periode 2012-2016 resmi mengumumkan susunan pengurus di Gedung Mantan Pemain PSMS, Stadion Kebun Bunga Medan, Kamis (27/9). “Kami optimis sosok-sosok yang duduk di kepengurusan ini mampu dan mau bekerja untuk kemajuan sepakbola Kota Medan,” ujar Ketua Umum Pengcab PSSI Medan, Ir Azzam Rizal MEng. Azzam, terpilih secara aklamasi sebagai Ketua Pengcab PSSI Kota Medan dalam Muscablub pada 8 Juli 2012, mengatakan akan segera menjalankan program-program organisasi, salah satunya menggelar kom-

petisi antar-SSB se-Kota Medan pada pertengahan Oktober. Adapun susunan Pengcab PSSI Kota Medan periode 20122016 adalah H Amran YS, Ir H Isman Nuryadi, H Dollah Unai (Dewan Kehormatan), H Martius Latuperissa, Parlin Siagian, Kompol Sujono, dan H Juanda (Dewan Pembina). Ir Azzam Rizal MEng (Ketum), H Nobon Kayamuddin, Ir Alwi Ibrahim Lubis, Ruslan, Muslim Simbolon, M Syarif (Wakil Ketua), Drs Aripay Tambunan MM, Ucok Abdurahman (Sekretaris/Wakil) serta Hadi Burhan dan Drs Irwansyah Siregar (Bendahara/Wakil). Kepengurusan juga dilengkapi biro-biro. Bidang organi-

sasi diisi Sugito, Suyud Ngadimin, dan Amri Siregar. Selanjutnya Abdul Rahman (Hukum), Maspriono (Fair Play), Posan Makmur, M Ishak Siregar (Kompetisi), Irianto (Perwasitan), Syahdan (Status dan Alih Status), Sunardi A, Jamaluddin Hutauruk, Syamsir Alamsyah (Sepakbola Usia Muda) Anwar Fadil, Hj Ade Nurleli Chatab (Futsal dan Sepakbola Wanita), Edy Sofyan BSc, Darlan Hasibuan SE (Diklat dan SDM), Abraham, Muslim Zakaria (Promosi), Syafrizal Batubara (Marketing), M Umar (Komdis), Mardi Harjo, Saharuddin Hasibuan (Keamanan), dr Anas (Medis) dengan Irma Juni dan Waristo (Media). (m42)

18 Klub Ramaikan Kompetisi PSSI Labusel

hadir Ketua Harley Davidson Club Indonesia (HDCI) Pusat Nanan Soekarna bersama Plt Gubsu dan unsur FKPD. Begitupun event Surya SBW 2012 masih berlangsung hingga Minggu (30/9) sore,” tandas Dedi. (m47)

KOTAPINANG (Waspada): Asisten III Pemkab Labusel, Syafruddin Nasution, resmi membuka Kompetisi PSSI Kabupaten Labusel di Lapangan PTPN III Sisumut, Kamis (27/9). Event itu digelar mulai 27 September hingga 27 Oktober dengan diikuti 18 klub. Dalam sambutan tertulis dibacakan Syafruddin, Bupati Labusel,Wildan Aswan Tanjung, mengatakan harus ada upaya berkesinambungan dalam mengembangkan sepakbola di Labusel. Bupati juga beharap tim peserta kompetisi mengedepankan sportivitas dan wasit bertindak adil.



Waspada/Armansyah Th

ATRAKSI free style di arena Surya SBW 2012 di Lapangan Benteng Medan menjadi salah satu acara yang menyedot banyak pengunjung, Kamis (27/9). perfomance, games bikers community, festival seni, kontes motor klasik, lomba fotografi, pemilihan Miss Surya SBW 2012 serta hiburan band dan modern dance. Menurut Dedi, puncak aca-


Putih melangkah, mematikan lawannya tiga langkah.


RAFAEL van der Vaart, bintang Hamburg, bertarung seimbang dengan pemain Gladbach Havard Nordtveit (kanan) di Bundesliga, Kamis (27/9) dinihari WIB.

ra berlangsung Sabtu (29/9) besok di mana belasan agenda sudah disiapkan menjelang penutupan pada malam hari yang diisi penampilan band rock papan atas, RIF. “Di haripenutupanjugaakan

Kadisbudparpora Labusel, Mahmul, berharap dari event itu muncul pemain-pemain berbakat yang ke depan dapat mengangkat prestasi sepakbola Labusel di kancah regional dan nasional. Dia juga menyebut sepakbola dipertimbangkan untuk menjadi salah satu dari tiga olahraga unggulan daerah itu. Ketua Pengcab PSSI Labusel, dr Donny Irwansyah Dalimunthe, mengatakan kompetisi tersebut bagian dari proses pembinaan sekaligus memunculkan pemain-pemain terbaik di daerah itu. Pada PON XVIII/2012 Riau, dua pemain binaan PSSI Labusel terpilih sebagai pemain

inti tim sepakbola Sumut, hingga akhirnya sukses menyabet medali perak. “Kita harapkan melalui event ini kembali lahir pemainpemain hebat yang ke depan dapat membanggakan daerah. Kami yakin di Labusel ini banyak pemain berbakat, tetapi belum muncul dan melalui event ini diharapkan segera terlihat,” ucap Donny seraya mengatakan 14 klub terbaik dari event itu nantinya berhak menghuni Divisi Utama PSSI Labusel. Di laga pembuka Grup A, kesebelasan TWD FC Kotapinang berhasil menaklukkan Silpa FC Silangkitang 3-0. (c18)


MIMBAR JUMAT 1. Benar; Hadis yang terkuat statusnya karena sanadnya dan perawinya terpercaya. 4. Imam hadis kedua setelah Imam Bukhari. 7. Haji kecil. 9. Judul surat Al Quran ke-93 disebut HR Dailami sebagai karunia Allah kepada pembacanya dan disimpan Rasulullah untuk umatnya pada hari kiamat. 11. Ungkapan penyesalan pada seseorang. 12.Imam hadis ke empat yang nama lengkapnya Abu Isa Muhammad bin Isa bin Saurah bin Musa. 14.Salah satu dari empat takdir yang dituliskan untuk janin dalam kandungan. 15.Nama ayat 255 QS Al Baqarah. 17.Judul surat Al Quran ke-55 disebut HR Baihaqi sebagai pengantin Al Quran. 18.Rukunnya termasuk percaya pada Allah. 20.Dikumandangkan setelah azan. 21.Sangkakala; Terompet. 24.Suku berasal dari Timur Tengah. 25.Cemburu; Dengki. 26.Kota Nabi Muhammad SAW.

2. Singkatan hajjah. 3. Masa halangan beribadah bagi wanita. 4. Perasaan karena berbuat sesuatu yang tidak baik. 5. Ucapan akhir shalat. 6. Shalat yang disunahkan mandi lebih dahulu sebelum pergi ke masjid. 8. Satu dari dua surat Al Quran yang disebut Al Muawwidzatain. 9. Judul surat Al Quran ke-44 disebut HR Tirmidzi pembacanya dimohonkan ampun oleh 70.000 malaikat. 10.Juru dakwah. 13.Salah satu dari empat takdir yang dituliskan untuk janin dalam kandungan. 14.Dua surat Al Quran, selain Ali Imran, yang disebut HR Muslim sebagai pembela bagi pembacanya pada hari kiamat 16.Al-_____, surat Al Quran terdiri dari empat ayat memurnikan keesaan Allah. 19.Orang yang ahli dan memiliki wewenang dalam hukum Islam. 21.Singkatan Negara Islam Indonesia. 22.Ar-____, surat Al Quran tentang kerajaan Romawi (kini Italia). 23.Bapak.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat sulit (****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.



7 2 5 2 3 6


6 4 1 8 2 3 5


2 6

2 9 4 5 1 7 *****09



WASPADA Jumat 28 September 2012

Duo Unggulan Tersingkir TOKYO (Waspada): Dua petenis unggulan, Victoria Azarenka (Belarus) dan Maria Sharapova (Rusia), tersingkir di perempatfinal turnamen Pan Pacific Terbuka, Kamis (27/9). Azarenka harus tersingkir karena mengalami kelelahan kronis, sedangkan Sharapova harus mengakui keunggulan Samantha Stosur (Australia). Sharapova harus mengubur mimpinya meraih gelar ketiganya di Tokyo setelah dalam babak delapan besar yang penuh drama dan kualitas tinggi, unggulan kedua itu menyerah

6-4, 7-6 dari Stosur. Alhasil, Stosur yang ditempatkan sebagai unggulan delapan akan menghadapi petenis Rusia lainnya, Nadia Petrova. Untuk lolos ke semifinal, Petrova

menghentikan laju unggulan enam Sara Errani (Italia) 3-6, 7-5, 6-3. Stosur, menang sekali dari 11 pertemuan sebelumnya dengan Sharapova, berhasil mengambil inisiatif dan merebut set pertama. Di set kedua, laga lebih ketat dan harus diselesaikan melalui tiebreak 12-10 untuk Stosur. Azarenka, juara Australia Terbuka 2012, terpaksa mengundurkan diri sebelum laga melawan Angelique Kerber (Jerman) dimulai karena kelelahan. Finalis AS Terbuka ini juga

terlihat susah payah dalam laga babak ketiganya kemarin “Sebelum turnamen, saya memang merasa kurang sehat. Energi saya sangat lemah dan merasa bukan diri sendiri saat ini. Mungkin ini dampak kelelahan selama musim ini. Saya sendiri tidak tahu apa yang terjadi,” ungkap Azarenka. Lawan Kerber di semifinal nanti adalah Agnieszka Radwanska. Petenis Polandia ini memastikan diri meraih tiket empat besar setelah menyingkirkan CarolineWozniacki (Denmark) 6-4, 6-3. (m33/rtr)

Nasib Schumi Tergantung Hamilton BRACKLEY, Inggris (Waspada): Ketua Tim Mercedes GP, Ross Brawn, mengatakan masa depan Michael Schumacher di arena Formula 1 (F1) masih dalam pembicaraan. Pasalnya, Mercedes juga sedang menunggu kepastian mengenai keputusan akhir pebalap McLaren,

Lewis Hamilton, untuk musim 2013. Hamilton sedang menjadi pusat pembicaraan karena baik Mercedes maupun McLaren memberikan penawaran yang menggiurkan. Kini, kedua tim tersebut menantikan keputusan yang akan diambil juara dunia

2008 itu. Keputusan pebalap Inggris tersebut akan memberikan pengaruh terhadap masa depan Schumacher. Jika Hamilton memutuskan bergabung dengan Mercedes, maka tak ada tempat lagi bagi Schumacher yang notabene juara dunia tujuh kali


LEWIS Hamilton (kiri) diisukan menjadi tandem Nico Rosberg (tengah) di Mercedes GP musim depan, sedangkan Michael Schumacher (kanan) dipastikan putus kontrak.


Brawn mengakui situasi saat ini jauh dari stabil. Ditambahkannya bahwa tim masih menyadari keuntungan dari keberadaan pebalap veteran asal Jerman tersebut, meskipun gagal menyelesaikan lomba di GP Singapura akhir pekan lalu. Berbicara tentang masa depan Schumacher di BBC Radio 5 Live, Kamis (27/9), Brawn mengatakan masih dalam pembicaraan. Dirinya mengaku tidak bisa berkomentar terlalu banyak mengenai hal tersebut, tetapi Michael (Schumacher) sepenuhnya masih menjadi aset tim. “Saya pikir kontribusi Michael sangat banyak, sehingga saya kira keputusan mengenai masa depannya bertahan atau tidak merupakan hal yang sulit. Tentu saja dia sangat dilibatkan dalam keputusan itu dan diskusi sedang berlangsung hingga sekarang,” ungkap Brawn. Brawn pun mengakui bahwa mereka pasti mencari pebalap yang kompetitif jika harus mengganti Schumacher. Pilihan tersebut jatuh ke Hamilton yang layak menjadi tandem Nico Rosberg. “Saya pikir tim-tim ambisius mencari para pebalap top dan kami adalah tim yang ambisius. Tetapi saya pikir di luar sana ada begitu banyak spekulasi,” tutup Brawn. (m33/auto)


PETENIS Rusia, Maria Sharapova, gagal merebut trofi Pan Pacific Terbuka ketiga akibat takluk di tangan Samantha Stosur di Tokyo, Kamis (27/9).

Bautista Fokus Jaga Momentum MADRID (Waspada): Sukses merebut podium ketiga di MotoGP San Marino kian meningkatkan motivasi rider San Carlo Honda Gresini, Alvaro Bautista (foto). Karena itu, Bautista menaruh harapan bisa menjaga momentum terbaik di MotoGP Aragon. Pebalap Spanyol ini merasa dalam dua seri terakhir di MotoGP San Marino dan Republik Ceko, motornya terus menghasilkan tenaga maksimal. Mantan pebalap Suzuki itu pun mengakhiri balap di Brno sebagai peringkat enam. Satu seri setelah itu, Bautista merebut podium ketiga di Misano. Rapor bagus ini tidak lepas dari kerja keras seluruh awak tim membenahi setiap sektor RC213V. “Di Misano, kami telah melakukan pekerjaan besar. Kami

Hanya Vita/Nadya Tersisih PALEMBANG (Waspada): Satu-satunya andalan Merah Putih merebut gelar di Indonesia Terbuka Grand Prix Gold 2012 di Palembang yang gagal adalahVita Marissa/Nadya Melati (foto). Ganda putri unggulan kelima itu tersingkir usai dikalahkan Xiaohan Yu/Yaqiong Huang (China) 21-11, 18-21, 2115, Kamis (27/9). Beruntung, kegagalan Vita/ Nadya tersebut tidak diikuti ganda putri lainnya, yakni Anneke Feinya Agustin/Nitya Krishinda Maheswari, Pia Zebadiah Bernadeth/Rizki Amelia Pradipta, dan Suci Rizky Andini/Della Destiara Haris. Melawan Imawan Gebby/ Nuraidah, Anneke dan Nitya

menang 21-17, 21-12. Bila Pia/ Rizki mengalahkan Khairunnisa Imma/Geovani Mareta 21-12, 21-13, maka Suci/Della mengungguli Tresna Novelia/Dara Ayu 21-17, 21-18. Di tunggal putri, Adrianti Firdasari melaju ke babak delapan besar dengan mengalahkan Sayaka Takahashi (Jepang) 13-21, 21-13, 23-21. Firda, unggulan ketujuh, harus berjibaku menaklukkan perlawanan Takahashi karena kewalahan akibat angin kencang. “Saya sudah bermain tidak pakai teknik lagi, mungkin jika diterbangkan layang-layang di lapangan tempat main, maka akan tinggi. Angin dari pendingin ruangan demikian kencang, dan

baru kali ini saya alami,” kata Firda yang selanjutnya ditantang Rusydina Antardayu Riodigin, Jumat (28/9) ini. Selain Firda, tunggal putri diwakili Lindaweni Fanetri, Aprilla Yuswandari, Desi Hera, danYeni Asmarani.Tunggal putra menjaga peluang juara setelah Tommy Sugiarto cs lolos ke babak delapan besar. Tommy memastikan langkah berkat kemenangan atas Goh Soon Huat (Malaysia) 21-16, 20-22, 21-12. Tiga tunggal putra lainnya, Simon Santoso, Sony Dwi Kuncoro, dan Hayom Rumbaka juga menyusul Tommy. Sebelumnya, Simon menaklukkan Chen Yuekun (China) 21-23 21-


12, 21-14, Hayom menyisihkan Zainuddin Iskandar Zulkarnain (Malaysia) 21-12, 16-21, 21-17, dan Sony menundukkan Andrew Smith (Inggris) 14-21, 21-7, 21-13. Ganda campuran terbaik, Tantowi Ahmad/Liliyana Natsir, menjaga peluang kala menundukkan Rhoma Putra Eka/Aris Budiharti 21-8, 21-15. Hasil serupa diraih Muhammad Rijal/ Debby Susanto yang menang atas Lukhi Apri Nugroho/Annisa Saufika 21-18, 21-14. Kedua pasangan disusul Alfian Eko Prasetya/Gloria Ema-

nuelle Widjaja dan Riky Widianto/Puspita Richi Dili. Alfian/ Gloria mengandaskan Irfan Fadhilah/Weni Anggraini 22-20, 25-23 dan Riky/Puspita memaksa Zhao Jiang Terry/Dellis Yuliana (Singapura) kalah 21-10, 21-10. Sementara ganda putra yang masih bertahan adalah Wijaya Rendra/Rian Sukmawan, Angga Pratama/Ryan Agung Saputra, Gideon Markus Fernaldi/Agripinna Prima Rahmanto, dan Yonathan Suryatama Dasuki/Hendra AG. (m33/ant/tsw)

telah menemukan setingan tepat pada motor. Kami terus memperbaiki performanya dari seri sebelumnya di MotoGP Ceko,” ujar Bautista, Kamis (27/9). “Kami mendapat kesempatan cukup banyak melakukan sesi ujicoba di sini. Tim terus membuat terobosan. Itu meningkatkan harapan saya bisa mendapatkan hasil berbeda di Aragon,” lanjut Bautista menambahkan serangkaian ujicoba di Aragon membuatnya mengenal lebih dalam karakteristik trek tersebut. Kendati Aragon bukan salah satu trek favoritnya, Bautista akan berupaya keras menaklukkan sirkuit sepanjang 5.078 km itu. Dia menggambarkan Aragon trek sulit dan menantang. “Kami akan mencari setelan motor terbaik dalam latihan nanti, sekaligus beradaptasi dengan Aragon yang bukan favorit saya,” katanya lagi. “Aragon memiliki beberapa


tikungan cepat. Beberapa titik pengereman keras serta kombinasi arah tikungan. Lintasan juga dipadukan dengan trek lurus panjang. Jelas tidak mudah

mencari setingan terbaik agar bekerja sempurna di seluruh sektor sirkuit,” tuntas pebalap berusia 27 tahun tersebut. (m33/auto)

Medan Metropolitan

WASPADA Jumat 28 September 2012


DARI KIRI KE KANAN: Rekaman gambar saat anggota Polwan Aiptu Resmiati dibantu sejumlah rekannya setelah terjatuh ke dalam parit ketika mengamankan aksi unjukrasa di kantor Gubsu baru-baru ini.


Kapolresta Medan: Pendemo Jangan Bertindak Anarkis MEDAN (Waspada): Kapolresta Medan Kombes Pol. Monang Situmorang, SH, MSi meminta seluruh lapisan masyarakat yang ingin menyampaikan aspirasi melalui aksi unjukrasa, tidak melakukan tindakan anarkis. “Pendemo jangan bertindak anarkis. Silakan berunjukrasa, tapi dengan cara damai dan profesional. Setiap ada aksi unjukrasa, polisi selalu bertindak pro aktif dengan berupaya mempertemukan pendemo dengan pejabat terkait sehingga aspirasi mereka tersalurkan,” tegas Monang kepada Waspada, Kamis (27/9). Kapolresta menyesalkan tindakan anarkis yang dilakukan sekelompok orang saat berlangsung unjukrasa di kantor Gubsu, Jln. Diponegoro Medan, belum lama ini. Saat itu, seorang anggota Polwan yang sedang melakukan pengamanan unjukrasa, terjatuh ke dalam parit dan terbentur benda keras pada bagian kepala. Kamis (27/9) siang, Kapolresta Medan Kombes Pol. Monang Situmorang, SH, MSi didampingi Kasat Reserse Narkoba Kompol Dony Alexander dan Kapolsek Medan Kota Kompol Sandy Sinurat membesuk Aiptu Resmiati yang dirawat di RSU Permata Bunda. Anggota Polwan yang menjadi korban demo anarkis tersebut terpaksa menjalani perawatan intensif karena

Waspada/Rudi Arman

KAPOLRESTA Medan Kombes Monang Situmorang, SH, MSi (dua dari kiri) didampingi Kasat Reserse Narkoba Kompol Dony Alexander (kiri) ketika membesuk anggota Polwan Aiptu Resmiati yang dirawat di RSU Permata Bunda Medan, Kamis (27/9).

mengalami memar dan pusing akibat benturan keras pada kepala. Tidak hanya itu, Aiptu Resmiati yang bertugas di Min Reskrim Polsek Medan Kota ini. sempat terminum air limbah saat terjatuh ke dalam parit. Saat berlangsung aksi unjukrasa tersebut, menurut Monang, pihaknya sudah berusaha melakukan mediasi antara pendemo dengan Plt. Gubsu. Namun saat itu, Plt. Gubsu sedang berada di luar. Karena tidak sabar, pendemo memaksa masuk ke dalam halaman sehingga terjadi kericuhan. Petugas kepolisian yang melakukan pengamanan, berusaha mencegah agar para pendemo tidak masuk ke dalam halaman hingga terjadi aksi saling dorong. Aiptu Resmiati yang ikut melakukan pengamanan, akhirnya terdesak ke pinggir hingga terjatuh ke dalam parit. “Tidak saja Aiptu Resmiati, tapi ada juga enam anggota kita yang mengalami luka-luka akibat aksi tersebut,” kata Kapolresta Medan seraya menambahkan, seluruh biaya perawatan Aiptu Resmiati di RSU Permata Bunda ditanggung pihak kepolisian. Sebelumnya Resmiati menceritakan kepada wartawan, dirinya terjatuh saat terjadi aksi saling dorong antara pihak kepolisian dengan pengunjukrasa. “Saya berada di pinggir. Karena kalah tenaga, saya terdorong hingga terjatuh ke dalam parit. Setelah itu, saya tertimpa dua pengunjukrasa yang ikut terjatuh ke parit,” ujarnya. Karena mengalami benturan pada kepala, Resmiati dibawa ke RSU Materna untuk mendapatkan pertolongan pertama. Setelah itu, Resmiati dirujuk ke RSU Permata Bunda guna menjalani perawatan intensif. (m39)

Penggunaan Atribut Pemko Harus Ada Izin Dinas Perhubungan Kota Medan Segera Tertibkan Jukir Liar MEDAN (Waspada): Kriminolog Nursariani, SH, M.Hum berpendapat, seseorang yang menggunakan seragam atau atribut milik instansi tertentu, harus memiliki izin dari instansi tersebut. Jika mereka menggunakan atribut tanpa memenuhi syarat-syarat yang telah ditetapkan, maka hal itu dianggap liar. Fenomena saat ini, ada juru parkir (jukir) liar yang menggunakan atribut milik Pemko Medan dan Dinas Perhubungan untuk mengelabui masyarakat. “Yang jadi permasalahan, kenapa hal ini dibiarkan?” kata Nursariani kepada Waspada, Kamis (27/9) Saat ini, menurut Nursariani, sering terjadi pembiaran

terhadap sesuatu yang semestinya tidak dibenarkan. “Kalau menurut saya, jukir liar itu tidak akan berani, kalau dia bekerja sendirian apalagi memakai atribut Pemko. Kita khawatirkan, ada oknum yang sengaja mengumpulkan orang-orang ini. Menurut saya, mereka tidak bekerja sendirian,” katanya. Maraknya aksi jukir liar ini disebabkan faktor pembiaraan dari pemerintah. Sampai-sampai masyarakat tidak tahu mana yang jukir ilegal dan legal akibat penggunaan atribut Pemko tersebut. “Kalau pun masyarakat tahu, mereka terpaksa membayar retribusi parkir ketimbang terjadi keributan. Padahal tindakan jukir liar itu jelas-jelas ilegal. Hal ini terjadi karena sudah dilakukan terus menerus sehingga menjadi kebiasaan. Ditambah masyarakat tidak begitu

peduli dengan keberadaan jukir liar ini,” tambahnya. Selain adanya oknum berpengaruh yang mendukung keberadaan jukir liar ini, faktor lainnya adalah masalah perekonomian. “Anak-anak muda itu terpaksa menjadi jukir karena faktor ekonomi, tidak ada lapangan pekerjaan dan lainnya. Inilah yang melatarbelakangi munculnya jukir-jukir liar itu,” katanya.

Nursariani menegaskan, keberadaan jukir liar dapat mengurangi Pendapatan Asli Daerah (PAD). Sebab, uang retribusi yang dikutip dari pemilik kendaraan bermotor, masuk ke kantong pribadi atau ke kantong orang-orang tertentu. “Seharusnya pemilik kendaraan bermotor tidak membayar retribusi parkir kepada jukir liar. Memang dari segi tariff, mungkin tidak terlalu berat. Tapi kalau

jumlah pemilik kendaraan bermotor yang membayar retribusi cukup banyak, maka akan merugikan pemerintah,” jelasnya. Karena itu, Nursariani mengharapkan pemerintah segera melakukan penertiban tanpa tebang pilih. Penertiban ini jangan dilakukan hanya pada saat-saat tertentu, tetapi secara terus menerus.“Jadi, penertiban yang dilakukan jangan tebang pilih, harus maksimal dan kom-

Waspada/gito ap

DUA tersangka kasus pencurian sepeda motor dan parabola, menunduk saat di interogasi Kapolsek Medan Kota Kompol Sandy Sinurat, Kamis (27/9). Keduanya kini ditahan guna mempertanggungjawabkan perbuatannya.

katanya. Renward mengaku tidak mengetahui adanya keterlibatan oknum Dishub yang membeking jukir liar. Karena itu, pihaknya meminta bantuan warga bila mengetahui oknum Dishub yang membeking jukir liar, segera dilaporkan. “Kalau memang ada oknum Dishub yang “memelihara” jukir liar, pasti kita tindak tegas. Saya akan mencari siapa sebenarnya oknum Dishub yang membeking jukir liar. Kalau ditemukan, pasti ditindak tegas. Saya juga akan melaporkannya kepada pak wali kalau ada oknum Dishub yang membeking jukir liar,” tambahnya. Renward mengakui banyak jukir liar yang mengenakan sera-

gam beserta atribut milik Pemko dan Dishub Medan. Untuk menertibkannya, harus dilakukan razia secara terus menerus. Sebab, keberadaan jukir liar sangat mengganggu kenyamanan para pengendara kendaraan bermotor. Jukir liar ini kerap memberikanizinparkirberlapiskepadapengemudimobilsehinggamenimbulkan kemacatan lalulintas. “Kita akan koordinasi dengan aparat kepolisian untuk menertibkan jukir liar ini. Kalau ada jukir tidak memakai kartu identitas yang ditandatangani Kadishub Renward Parapat, berarti itu liar. Kita juga mengimbau seluruh jukir yang belum mendapat kartu identitas baru agar segera mengurusnya,” demikian Renward. (h02/m50)

Meski Kabur, Bandar Sabu Divonis 9 Tahun Penjara

Dua Pencuri Ditangkap MEDAN (Waspada): Dua tersangka kasus pencurian ditangkap petugas Polsek Medan Kota dari dua lokasi berbeda, Rabu (26/ 9). Dari kedua tersangka polisi mengamankan barang bukti satu sepedamotor dan parabola. Kedua tersangka berinisial SG, 29, asal Dusun Pekan, Desa Sungai Liput, Aceh Tamiang, dan S, 26, penduduk Jln. Air Bersih, Medan. Kapolsek Medan Kota Kompol Sandy Sinurat kepada wartawan, Kamis (27/9) mengatakan, dari tersangka SG pihaknya mengamankan sepedamotor Satria FU milik Lukman Situmeang, penduduk Jln. Mahkamah. Disebutkan Sandy, tersangka merupakan pekerja di bengkel las milik Lukman, bahkan sudah bekerja lebih 10 tahun. Saat diperiksa SG mengaku khilaf karena butuh biaya untuk menikah. “Tersangka mengaku hendak ‘kawin lari’ dengan pacarnya karena hubungan mereka tidak direstui. Dia terdesak, akhirnya melarikan sepedamotor milik Lukman dengan alasan meminjam. Selain itu dia membawa kabur uang Rp13,7 juta milik korban,” tuturnya. Korban Lukman kepada wartawan mengatakan, sudah mengikhlaskan uang miliknya yang habis dibawa SG. “Mungkin dia khilaf, saya sudah memaafkannya,” sebutnya. Saat bersamaan Polsek Medan Kota juga mengamankan tersangka S serta barang bukti hasil curian parabola, yang dicuri dari rumah M Sholeh Tanjung, 31, di Jln. Air Bersih Gang Rela. Tersangka ditangkap setelah korban membuat pengaduan kehilangan parabola. Dalam penyelidikan, polisi mencurigai S sebagai pelaku. “Dia ditangkap saat hendak menjual parabola itu,” kata Sandy.(m27)

prehensif serta berkesinambungan,” tegasnya. Ditertibkan Di tempat terpisah, Kepala Dinas Perhubungan Kota Medan Renward Parapat mengatakan, pihaknya segera menertibkan jukir liar yang telah mengurangi Pendapatan Asli Daerah (PAD). Selain itu, Renward akan melakukan investigasi tentang dugaan keterlibatan anggotanya yang membeking jukir liar. “Sebenarnya kita sudah melakukan razia terhadap seluruh jukir yang ada di Kota Medan. Bahkan, kita pernah menangkap jukir liar yang menggunakan atribut Pemko atau Dishub Medan. Tapi untuk memberantas jukir liar ini, kita akan melakukan razia lebih gencar lagi,”

Waspada/gito ap

DIAMANKAN: Kapolsek Medan Kota Kompol Sandy Sinurat (dua dari kiri) menginterogasi dua jukir (kanan dan dua dari kanan) yang diamankan akibat memberlakukan parkir berlapis untuk kendaraan roda empat di kawasan Jln. Thamrin, beberapa waktu lalu. Razia yang dilakukan petugas Polsek Medan Kota tersebut bukan untuk menertibkan jukir liar, tetapi untuk menertibkan parkir mobil berlapis yang diberlakukan jukir hingga memacatkan arus lalulintas.

Lima Produsen Pupuk Diperiksa MEDAN (Waspada): Polda Sumut memeriksa sejumlah produsen pupuk untuk mengetahui kemungkinan adanya kebocoran ketersediaan stok atas dugaan pengoplosan pupuk subsidi ke non subsidi yang terungkap beberapa waktu lalu di gudang Mabar, Medan Deli, awal September. “Hari ini kita memeriksa produsen dari Petrokimia Gresik. Pertanyaanya tentang kemungkinan terganggunya ketersediaan pupuk atas dugaan pengoplosan,” kata Kasubdit II/ Perindustrian dan Perdagangan (Indag) Dit Reskrimsus Poldasu AKBP Edi Fariadi kepada Waspada, Kamis (27/9) Sampai hari ini, sudah tiga produsen pupuk yang diperiksa terkait dugaan pengoplosan, yaitu Pupuk Iskandar Muda (PIM), Pupuk Sriwijaya (Pusri) dan terakhir Petrokimia Gresik. “Setelah ini ada dua lagi produsen yang akan dipanggil, yaitu Kujang dan Kaltim,” kata Fariadi menyebutkan tujuannya untuk mengetahui ada tidaknya pengopolosan itu. Menurut dia, selain memanggil para produsen pupuk sebagai saksi ahli kasus itu, mereka juga menyelidiki dugaan keterlibatan distributor pupuk lainnya dalam pengoplosan pu-

puk subsidi menjadi non subsidi. “Penyelidikan terhadap para distributor nakal masih kita lakukan, dan kami yakin selain PT Asia Multi Nusantara (AMN) yang kini disegel, masih ada distributor nakal lainnya yang melakukan pengoplosan,” sebutnya. Stok lama Sebelumnya Waka Poldasu Brigjen Pol. Cornelis Hutagaol dan Direktur Reskrimsus Kombes Sadono Budi Nugroho meninjau gudang pupuk bermasalah di gudang BIA No. 59-A dan gudang No. 40 Kawasan Industri Medan (KIM) I, Medan Labuhan. Gudang ini telah disegel Polda setelah digerebek Senin (3/9) lalu, atas dugaan pengoplosan 2500 ton pupuk dilakukan PT AMN. Sedangkan Direktur PT AMN berinisial RB sudah ditahan, karena terbukti mengganti karung pupuk tanpa persetujuan Disperindag. Saat memantau gudang, Waka Polda memerintahkan Direktur Krimsus menuntaskan kasus tersebut dan mencari siapa saja yang terlibat dalam pengoplosan, termasuk kemungkinan adanya unsur penipuan kepada konsumen. “Ini menjadi atensi kita, karena banyak keluhan konsumen terkait persoalan ini,” kataWaka Polda.

Kepada wartawan, Direktur Reskrimsus Sadono Budi Nugroho menjelaskan, pihaknya telah memeriksa distributor pupuk di Surabaya, yaitu PT Sumber Urip. “Perusahaan itu distributor resmi PT Pusri,” katanya. Pada pemeriksaan lalu, pupuk itu diketahui stok lama PT Sumber Urip (stok JanuariMaret). “Karung putih merupakan stok lama tidak lagi dijual, karena sejak Maret sampai April sudah ganti karung warna coklat. Ini sudah diketahui PT AMN, namun tetap mengganti karung putih ke karung coklat, lalu dijual dengan harga non subsidi,” kata Sadono menyebutkan, pupuk Nitromate (NitrogenHumateAcid)itudiproduksi PT Rianginto Mitra Sejahtera. Tersangka RB, kata Sadono, akan dijerat pasal penipuan terhadap konsumen karena memanipulasi harga. Namun karena belum sempat dijual tersangka hanya dikenakan UU No. 5/ 1984 tentang perindustrian, yaitu memindahkan atau melakukan pekerjaan dengan menggunakan alat (packing) yang dikaterogirikan industri dengan ancaman hukuman 5 tahun. Dari keterangan RB, pupuk tersebut akan dijual Rp4.600/ kilo.(m27)

MEDAN (Waspada): Meski terdakwa Sharen Patricia alias A Liang, 25, bandar sabu yang kabur setelah sidang tuntutan belum tertangkap, namun majelis hakim Pengadilan Negeri (PN) Medan, tetap menjatuhkan vonis 9 tahun penjara. Dalam sidang yang tidak dihadirinya, bandar sabu-sabu itu selain dijatuhi hukuman 9 tahun penjara, juga diberi tambahan hukuman denda Rp1 miliar. “Terdakwa atas nama Sharen Patricia sudah divonis pada Selasa (25/9). Majelisnya diketuai Marlianis dengan anggota ErwinTumpak Pasaribu dan Wahidin,” kata Humas PN Medan Ahmad Guntur, Kamis (27/9). Putusan majelis hakim ini lebih rendah empat tahun dari tuntutan Jaksa Penuntut Umum (JPU) Maria Fr Tarigan. Perempuan itu sebelumnya dituntut dengan hukuman 13 tahun penjara karena mengedarkan sabu-sabu. Guntur tidak bisa mengomentari putusan hakim.Vonis yang lebih ringan dari tuntutan jaksa ini memang dipertanyakan wartawan, karena Sharen melarikan diri. Dia hanya memastikan pembacaan vonis

tanpa kehadiran terdakwa tidak melanggar hukum acara. “Kalau sudah ada tuntutan bisa divonis. Jadi vonisnya tanpa dihadiri terdakwa. Namun, ini bukan sidang in absensia. Kalau sidang in absensi dari awal terdakwa tidak ada, dan itu hanya berlaku untuk perkara tertentu, termasuk kasus korupsi,” tuturnya. Dalam dua persidangan terakhir, Sharen tidak hadir di PN Medan. Dia melarikan diri saat akan dibawa dari depan Lapas Wanita ke PN Medan, Selasa (18/9) siang. Pelariannya itu dilakukan menjelang sidang pembacaan pledoi setelah sepekan sebelumnya, dia dituntut dengan hukuman 13 tahun penjara. Sharen didakwa sebagai pemasok sabu-sabu kepada pacarnya Jimmy Angkasa dan ayah sang pacar Gunawan alias A Cai. Ayah dan anak ini sudah divonis masing-masing 5 tahun penjara, Selasa (25/9). Guntur memaparkan, jika nanti tertangkap, Sharen harus memulai hukuman dari awal. Dia dapat menyikapi vonis hakim setelah mendapat pemberitahuan dari pengadilan. (m38)

Kritis Ditikam Teman Sendiri MEDAN (Waspada): Gara-gara banyak minuman keras, pria berinisial PN, 34, warga Jln. Pelita II, Kel. Sidorame Timur, Kec. Medan Perjuangan, nekad menikam temannya sendiri Edwar Simorangkir, 23, warga yang sama, Kamis (27/ 9) sekira pukul 02:00, di warung tuak Jalan Pelita II, Medan Perjuangan. Akibatnya, korban Edwar menderita luka tusuk di dada kiri dan menembus paru-parunya. Korban kini dirawat di IGD RS Dr Pirngadi Medan, sedangkan pelaku berinisial PN masih diburon petugas Polsek Medan Timur. Informasi yang diperoleh di kepolisian, dini hari itu korban Edwar Simorangkir dan tersangka PN serta beberapa teman mereka minum tuak di satu warung tuak di kawasan Jalan Pelita II. Setelah warung tuak tutup, teman-teman mereka pulang, sedangkan korban dan tersangka masih berada di depan warung tuak tersebut. Tiba-tiba korban dan tersangka yang sudah mabuk itu terlibat pertengkaran yang belum diketahui motifnya. Diduga sudah saling dipengaruhi miras, keduanya terus bertengkar. Selanjutnya tersangka PN mengambil belati dan menikam dada kiri korban mengenai paru-paru hingga korban terkapar. Sejumlah warga yang mengetahui peristiwa itu segera melarikan korban ke RSU Dr Pirngadi

Medan, sedangkan tersangka PN langsung melarikan diri. Kapolsek Medan Timur Kompol Patar Silalahi melalui Kanit Reskrim AKP Ridwan Danil menjelaskan, motif penikaman tersebut belum diketahui karena korban masih dirawat intensif sedangkan pelaku penikaman masih diburon. “Motifnya belum diketahui karena korban belum membuat laporan pengaduan sedangkan pelakunya masih dikejar,” sebutnya. Pada hari yang sama, petugas Polsek Medan Timur meringkus HS, 18, warga Jalan Tangkul, Kel. Sidorejo, Kec. Medan Tembung. Tersangka HS ditangkap warga usai mencuri dua unit handphone dari rumah korban Sanggul boru Simamora, warga Jalan Mesjid Taufik Gang Bintara, Kel. Tegalrejo, Kec. Medan Perjuangan. Kanit Reskrim Polsek Medan Timur AKP Ridwan Danil menjelaskan, sekira pukul 06:30, tersangka HS melihat jendela depan rumah korban terbuka. Dari balik jendela, tersangka melihat dua handphone tergeletak di atas meja. Dia lalu mengambil kayu dan mengkait dua HP tersebut. “Setelah dua HP berada di tangannya, tersangka HS bergegas pergi namun diketahui oleh pemilik rumah. Korban berteriak sehingga tersangka HS ditangkap dan dipukuli warga,” jelas Ridwan. (h04)

Medan Metropolitan Dua Pembobol Kartu ATM Masuk DPO B2

MEDAN (Waspada): Menyusul diamankannya tersangka SL, 44, yang diduga melakukan pembobolan terhadap kartu ATM milik sejumlah nasabah bank, kini Polsek Medan Helvetia memburu dua pelaku lainnya. Sebab, ada indikasi kawanan pembobol kartu ATM ini sudah beraksi di sejumlah kawasan di Kota Medan.

“Dua pelaku berinisial OS dan Ud sudah masuk dalam Daftar Pencarian Orang (DPO) terkait kasus pembobolan kartu ATM milik nasabah bank. Selain itu, kita juga membentuk dua tim khusus (timsus) yang dipimpin Kanit Reskrim Iptu Syarifurrahman, SH, SIK,” kata Kapolsek Medan Helvetia AKP Tris Lesmana Zeviansyah, SH, SIK, MH kepada Waspada, Kamis (27/9) malam.

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.20 08.45 10.30 11.55 14.10 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 12.25 17.55


CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

QG-831 QG-833 QG-835 QG-880 QG-882

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981

06.05 11.20 08.00 17.25 104.10 18.30 21.25 17.00 08.25 11.35 17.10

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

10.55 18.25

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

09.55 17.40

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Batam

Y6-594 Y6-596 7P-568

16.00 18.15 12.25

Jakarta Jakarta Batam

Y6-593 Y6-595 YP-567

13.00 15.15 10.30

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

MANDALA AIRLINE 1 Jakarta 2 Singapura 3. Jakarta 4 Jakarta (5.7)

RI-092 RI-861 RI-096 RI-096

06.40 11.00 18.50 16.40

Singapura Jakarta Jakarta Jakarta (5.7)

RI-862 RI-093 RI-097 RI-097

07.20 11.30 19.20 20.55

Jadwal Perjalanan Kereta Api No KA

Nama KA

U.2 Sri Bilah U.4 Sri Bilah U.6 Sri Bilah U.8 Sri Bilah U.1 Sri Bilah U.3 Sri Bilah U.5 Sri Bilah U.7 Sri Bilah U.10 Sri Bilah U.12 Sri Bilah U.9 Sri Bilah U.11 Sri Bilah U.14 Putri Deli U.16 Putri Deli U.18 Putri Deli U.13 Putri Deli U.15 Putri Deli U.17 Putri Deli U.22 Siantar Ekspres U.21 Siantar Ekspres PLB 7000 Sri Lelawangsa PLB 7002 Sri Lelawangsa PLB 7004 Sri Lelawangsa PLB 7008 Sri Lelawangsa PLB 7010 Sri Lelawangsa PLB 7012 Sri Lelawangsa PLB 7001 Sri Lelawangsa PLB 7003 Sri Lelawangsa PLB 700 Sri Lelawangsa PLB 7009 Sri Lelawangsa PLB 7011 Sri Lelawangsa PLB 7012 Sri Lelawangsa


Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi



Berangkat Datang

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan

08.00 10.30 15.00 22.50 08.05 14.35 16.55 23.25 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 05.00 09.50 12.15 14.40 05.20 08.55 06.30 11.00 13.30 15.50

13.16 15.31 20.18 03.34 13.12 19.49 21.50 04.21 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.22 05.52 10.42 13.07 15.32 07.22 09.47 07.22 11.52 14.22 16.42


Tris menjelaskan, sebelumnya Polsek Medan Helvetia sudah mengamankan tersangka SL, 44. Saa ini, tersangka SL masih menjalani perawatan di RS Bhayangkara Poldasu Jln. KH Wahid Hasyim Medan, akibat menderita luka-luka setelah hajar massa. Menurut Tris, para pelaku diperkirakan sudah lama beraksi di wilayah hukum Polresta Medan. Sebab, salah seorang korban mengaku menjadi korban pembobolan kartu ATM di wilayah hukum Polsek Medan Area. “Para korban diminta datang ke Mapolsek Medan Helvetia untuk mengenali para pelaku pembobol kartu ATM dan membuat laporan,” ujarnya. Sementara itu, Kanit Reskrim Polsek Medan Helvetia Iptu Syarifurrahman, SH, SIK mengatakan, komplotan ini sudah beraksi selama tiga tahun dan belum diketahui secara pasti jumlah korbannya. “Kita masih menunggu keterangan dari tersangka SL. Diharapkan dalam dua atau tiga hari ke depan, tersangka SL sudah bisa dijemput dari RS Bhayangkara Poldasu dan dibawa ke Mapolsek Medan Helvetia untuk menjalani pemeriksaan,” ungkapnya. “Timsus yang diturunkan ke lapangan sedang mengumpulkan berbagai informasi dari warga dan nasabah bank yang menjadi korban. Sedangkan dua pelaku yang sudah diketahui identitasnya, kini masih dalam pengejaran,” tegasnya. Syarifurrahman menambahkan, tersangka SL, 44, penduduk Jln. Persamaan, Kelurahan Sitirejo II, Kecamatan Medan Amplas ditangkap di Jln. Gaperta depan SPBU, Medan Helvetia, Minggu (23/9). Dari tersangka SL, 44, polisi menyita

barang bukti tiga lembar kartu ATM milik nasabah bank, uang Rp100 ribu dan lainnya. Tersangka SL ditangkap saat menarik uang dari ATM Bank Mandiri di Jln. Gaperta Ujung. Sedangkan kartu ATM yang digunakan tersangka SL diketahui milik Grees Indah Br Panjaitan, 26, penduduk Jln. Pembangunan II, Lingkungan VII, Kelurahan Tanjunggusta, Kecamatan Medan Helvetia. Massa yang mengetahui aksi SL, langsung mengejarnya. Sedangkan dua pelaku lainnya berinisial OS dan Ud yang menunggu di dalam taksi, langsung melarikan diri. Melihat massa mengejarnya, tersangka SL menaburkan sejumlah uang yang baru diambilnya dari mesin ATM. Namun massa tidak menghiraukan uang tersebut dan terus mengejar tersangka SL. Pada saat bersamaan, petugas Polsek Medan Helvetia yang melakukan patroli di kawasan itu, bergegas melakukan pengejaran terhadap tersangka SL. Akhirnya tersangka SL berhasil ditangkap. Dalam keadaan emosi, massa langsung menghajar tersangka SL hingga babak belur. Petugas Polsek Medan Helvetia yang berada di lokasi kejadian langsung mengamankan tersagka SL dan membawanya ke RS Bhayangkara. Dari hasil olah Tempat Kejadian Perkara (TKP) yang dilakukan petugas Polsek Medan Helvetia, diketahui semula Grees Indah Br Panjaitan bermaksud mengambil uang dari ATM Bank Mandiri di OK Supermarket. Namun kartu ATM miliknya tidak bisa dimasukkan ke dalam mesin. Tiba-tiba tersangka SL datang dan mengambil kartu ATM dari tangan korban. Lalu

dia memasukkan kartu itu ke mulut mesin ATM. Melihat kartu ATM tersangkut, tersangka SL langsung pergi meninggalkan korbannya. Setelah itu, korban memanggil sekuriti. Beberapa menit kemudian, satu pelaku lagi berinisial OS datang ke mesin ATM dan berpura-pura hendak mengambil uang. Kemudian OS yang berpura-pura simpatik kepada korban memberikan nomor telefon untuk dihubungi. Setelah itu, OS berlalu meninggalkan korbannya. Dalam keadaan bingung, korban langsung menghubungi nomor telefon yang diberikan OS. Ternyata nomor telefon tersebut milik Ud. Selanjutnya, Ud meminta korban memberitahukan nomor PIN kartu ATM milik korban. Tanpa merasa curiga, korban memberitahukan nomor PIN kartu ATM miliknya. Setelah itu, Ud menyatakan kartu ATM milik korban sudah diblokir. Sebelum meninggalkan ATM, korban meminta bantuan kepada petugas sekuriti minimarket agar memperhatikan kartu ATM yang tersangkut itu. Melihat korban pergi, tersangka LS kembali datang dan mengeluarkan kartu ATM milik korban dengan cara mencabut batang korek api yang diselipkan di samping mulut mesin ATM tersebut. Karena sudah mengetahui nomor PIN kartu ATM milik korban, lalu tersangka LS mengambil uang dari mesin ATM tersebut. Tanpa disadarinya, gerak-gerik LS sudah dipantau petugas sekuriti. Ketika LS keluar dari ruangan ATM, massa langsung mengejar dan menghajarnya hingga babak belur.(m36)

Unpri-PN Medan Tandatangani MoU Penelitian Dan Pengkajian Hukum MEDAN (Waspada): Universitas Prima Indonesia (Unpri) melalui Fakultas Hukum (FH) menjalin kerjasama dengan Pengadilan Negeri (PN) Medan dalam bidang penelitian dan pengkajian hukum. Kemudian, peningkatan kegiatan klinis hukum bagi mahasiswa FH Unpri dalam bentuk bimbingan dan penyediaan sarana dan prasarana praktik di lapangan. Penandatanganan MoU tersebut langsung dilakukan Dekan FH Unpri Tommy Leonard dengan Ketua PN Medan Erwin Mangatas Malau di Rumah Sakit Gigi dan Mulut Unpri Jln. Pabrik Tenun Medan, Selasa (25/9). Turut hadir Ketua Yayasan Perguruan Tinggi Prima Indonesia I Nyoman Enrich Lister, Rektor Unpri Prof. Djakobus Tarigan,Wakil Rektor I Prof. Monang Panjaitan, Wakil Rektor II Ermi Girsang,Wakil Ketua PN Medan Surya Perdamaian, Panitera Bastarial dan lainnya. Dekan FH Unpri Tommy Leonard mengatakan, penandatanganan MoU tersebut merupakan bentuk formalisasi kerjasama antara FH Unpri dengan PN Medan yang sudah terjalin baik dalam beberapa tahun belakangan ini. “PN Medan telah memberi dukungan yang sangat baik dalam kegiatan klinis hukum mahasiswa FH Unpri, dalam bentuk bimbingan dan penyediaan sarana dan prasarana. Dengan demikian, mahasiswa tidak hanya mempelajari teori acara persidangan di kelas, tetapi dapat mengetahui proses persidangan yang dilaksanakan di PN Medan,” ujarnya. Menurut Tommy, kegiatan klinis hukum merupakan mata kuliah wajib bagi mahasiswa FH Unpri. Ini merupakan suatu pengalaman luar biasa dan

WASPADA Jumat 28 September 2012


PLT Gubsu Gatot Pujo Nugroho bersalaman usai memimpin apel pagi di Perguruan Al Azhar Medan.

Kurikulum Berbasis Karakter Dicanangkan MEDAN (Waspada): Plt. Gubsu H. Gatot Pujo Nugroho mencanangkan revisi penguatan kurikulum berbasis karakter bangsa dengan menyerap budaya leluhur untuk memperkuat daya saing bangsa dalam kancah global. “Untuk mempercepat peningkatan sumber daya manusia (SDM) Sumut yang berkarakter diminta seluruh dewan guru dan tenaga kependidikan melakukan perbaikan penguatan kurikulum berkarakter,” tegas Gatot, Rabu (26/9). Dia mengemukakan itu dalam kunjungan di sekolah-sekolah di Sumut, antara lain Perguruan Al Azhar Medan diawali memimpin apel pagi di hadapan ratusan pelajar dan guru, siang dan sore ke SMK Internasional Jl. Karya Medan dan Perguran Yayasan SD, SMP, SMA AL Fitiyan Jl. Sunggal Medan. Dalam kunjungan itu, Gatot didampingi Kadis Pendidikan Sumut Drs. H. Syaiful Syafri, MM. Disebutkannya, perbaikan kurikulum perlu

dilakukan mulai dari tingkat Pendidikan Anak Usia Dini (PAUD), SD, SMP, SMA dan SMK. Gatot meminta Kadisdik Sumut agar hakhak guru dan siswa seperti tunjangan profesi, fungsional, kualifikasi demikian juga beasiswa dan penyaluran dana BOS disalurkan tepat waktu. Di Perguruan Al Azhar hadir fungsionaris Yayasan Hj Rahmah Nasution antara lain H Mahyuzar Nasution (Pembina), Ir. Riza Novida (Ketua), Rektor Universitas Al Azhar Sintho, SE, MM dan para kepala sekolah. Gatot mengharapkan dari kunjungan ini, Pemprov Sumut dapat informasi penting untuk meningkatkan mutu pendidikan dan sumber daya manusia.Dia menjelaskan, jika tidak ingin jadi penonton di negara sendiri maka mau tidak mau generasi muda harus belajar keras mempersiapkan ilmu pengetahuan. Apalagi, pada 2015 mendatang seiring berlakuknya Komunitas ASEAN maka kompetisi ketat harus dihadapi. (m34)

DJ Cheeraa Feat Hibur Pengunjung Soechi MEDAN (Waspada): Hotel Soechi International Medan, untuk menggaet para pengunjung, akan mengelar acara bertajuk Road King dengan mendatangkan DJ Cheeraa Feat Febs Rhythm Percussion, yang keduanya merupakan pemain asal Medan, Sabtu (29/9). Hal itu dilakukan guna menghibur para pencinta dunia hiburan malam di Medan. Assistant Food and Beverage Manager Hotel Soechi Mariono, Kamis (27/9) mengatakan, pihaknya sengaja membuat tema baru tersebut, karena ingin memberi suasana baru dalam dunia hiburan malam di Medan. “Dengan adanya konsep ini, kami ingin menyegarkan suasana agar tamu atau pengunjung tak bosan dengan konsepkonsep yang monoton,” katanya. Sama halnya seperti waktu-waktu sebelumnya, hampir setiap pekan pihaknya selalu mendatangkan DJ atau pemusik dari luar daerah seperti Jakarta, Surabaya, Bandung, dan kota-kota lainnya. Biasanya mereka didatangkan untuk mengisi hiburan setiap malam Minggu. “Pada hari-hari

biasa kami memberi kesempatan bagi DJ maupun pemusik lokal untuk unjuk kebolehan di sini,” sebutnya. Zodiac Pub and Bistro, salah satu tempat hiburan yang di hotel tersebut menjadi tempat bagi DJ dan pemusik menghibur para pecinta hiburan malam. Dengan kapasitas hampir 200 tempat duduk, pihaknya menjamin warga akan terhibur dengan musik-musik yang disuguhkan para DJ. Selain memberikan suasana baru di dunia malam, pihaknya juga memiliki beragam menu makanan yang bisa dinikmati bagi para pengunjung yang datang ke Hotel Soechi. Mariono berharap, dengan adanya penawaran paket ini, angka kunjungan di dua restoran yang ada di hotel itu, Restoran Kim Cu dan Restoran Asoka akan meningkat.“Pengunjung juga bisa merasakan menu lain yang tersedia seperti ayam rebus Thailand, kailan dua rasa, gulai opor daging, usus sapi dan lalapan segar sambal , daging ikan tauco dan ayam goreng wafer,” tuturnya. (cdu)

Mahasiswa Perlu Dibekali Ilmu Perbankan


DEKAN FH Unpri Tommy Leonard menyerahkan cenderamata kepada Ketua PN Medan Erwin Mangatas Malau, usai memberikan kuliah umum dan penandatanganan MoU di Rumah Sakit Gigi dan Mulut Unpri, Jln. Pabrik Tenun Medan, Selasa (25/9). kebanggaan bagi mahasiswa. “Hal ini tidak mungkin terjadi tanpa dukungan dan kerjasama yang sangat baik dari seluruh elemen di PN Medan. Kerjasama yang sudah terjalin baik selama ini kami harapkan dapat semakin ditingkatkan,” ujar Tommy. Tommy menambahkan, FH Unpri dan PN Medan juga sepakat membuat suatu MoU sebagai landasan dalam kerjasama untuk kegiatan seperti, upaya peningkatan kesadaran hukum melalui konsultasi dan penyuluhan hukum kepada masyarakat, penelitian dan pengkajian hukum, pengabdian masyarakat di bidang hukum dan kegiatan lainnya yang memberi manfaat bagi masyarakat umum sesuai peraturan perundangundangan. Sebelum melakukan penandatanganan MoU, Ketua PN Medan Erwin Mangatas Malau memberikan kuliah umum kepada mahasiswa FH Unpri. Di hadapan para mahasiswa, Ma-

lau memaparkan soal hukum kepailitan. Kondisi perekonomian Indonesia yang terpuruk sejak pertengahan tahun 1997 akibat gejolak moneter, membawa pengaruh serta menimbulkan kesulitan yang sangat besar terhadap perekonomian nasional. Bahkan, mempengaruhi dunia usaha dalam mengembangkan atau mempertahankan eksistensinya, termasuk kemampuan memenuhi kewajiban dalam membayar utang-utang kreditornya. Menurut Malau, salah satu sarana hukum yang dapat diharapkan secara cepat, adil, terbuka dan efektif, maka dibentuklah Pengadilan Niaga. Pengadilan ini mempunyai kewenangan bagi penyelesaian utang piutang melalui lembaga kepailitan maupun lembaga Penundaan Kewajiban Pembayaran Utang (PKPU) dengan diperbaharuinya UU No.4Tahun 1998, kemudian diubah dan diganti dengan UUNo.37Tahun2004yangdisahkan pada 18 Oktober 2004. (m41)

Peduli Umat Waspada Umumkan Penerima Beasiswa Prestasi Tahap XX Tahun 2012 MEDAN (Waspada): Sedikitnya 76 mahasiswa telah mengikuti seleksi tahap kedua berupa wawancara langsung di Masjid Dakwah USU pada 25 September 2012. Sementara tiga mahasiswa tidak hadir dan dianggap mengundurkan diri. Dari hasil seleksi tahap kedua tersebut, pihak panitia memutuskan penerima Beasiswa Prestasi Tahap XX dari Dompet Dhuafa Peduli Umat Waspada dan LAZ PT. Bank Sumut sebanyak 35 mahasiswa/i yaitu : USU: Ratih, Desi AfriYanti, Reza Ahmadi, Dedi Agustianto, Siti Maryam Nasution, Sri Wardani Rambe, Darmansyah Manalu, Nuraminah Nasution, Septian Andre Irawan, Bangun Sikettang, dan Syahroni Lubis. Unimed : Imam Deli Irawan, Abdul Kadir, Hidayatul Husna, Sartika Anggraini, Rizal dan

Anisa Putri Yani. IAIN SU : Nurul Huda, Ibnu Hajar, Aminah, Ramadhan Ariga, Nurhayani, Zhilla Athrya, Juliana Manurung, Robiyani, Nurcahaya Bulan, Chalidin dan Juliana Nasution. UMN Al-Washliyah : Heni Handayani, Univa : Ishak Pohan, Dara Melati STMIK Budi Dharma : Asro Pohan. STAI Tebingtinggi : Lydia Sartika. UMSU: Leli Dahriani Lubis. Universitas TJUT NYAK DHIEN : Mukhlis Siregar. Bagi penerima beasiswa diharapkan hadir pada acara silaturahmi penyerahan beasiswa perdana di Gedung Harian Waspada Jln. Brigjen Katamso No. 1 Medan pada Sabtu, 6 Oktober 2012 pukul 13:30 - selesai.(m25)

MEDAN (Waspada): Semakin pesatnya dunia perbankan yang berkembang dan persaingan semakin sengit, maka perlu dilakukan pembekalan ilmu perbankan kepada mahasiswa, khususnya bagi mahasiswa ekonomi agar mereka kelak mampu memasuki dan paham dalam menjalani pekerjaan di perbankan nanti. Demikian dikatakan Direktur Bank OCBC NISP, Rama P Kusumaputra kepada Waspada, Kamis (27/9). “Kepedulian Bank OCBC NISP terhadap kemajuan dunia pendidikan Indonesia telah menjadi perhatian Bank OCBC NISP sejak lama. Bank OCBC NISP mewujudkannya melalui berbagai kegiatan Corporate Sosial Responsibility (CSR)-nya yang memang difokuskan pada bidang pendidikan. Untuk itu, Bank OCBC NISP kembali menggelar workshop mengenai ilmu perbankan kepada mahasiswa, agar mereka mampu menjalankan tugasnya saat terjun di dunia perbankan,” ujarnya. Kata dia, acara tersebut merupakan salah bentuk Coorporate Social Responsibility (CSR) yang rutin selalu diadakan setiap setahun sekali, dalam rangka pemberian pengetahuan terhadap mahasiswa dari berbagai universitas. Menurut Rama, kegiatan tersebut sudah

dimulai sejak tahun 2007, dan telah diikuti 2.000 mahasiswa dari 50 perguruan tinggi yang ada di Indonesia. Dia mengaku, pengetahuan yang diberikan antara lain seputar pengetahuan tentang bank. Dari mulai pengertian bank, tabungan, kredit, dasar–dasar hukum yang mengatur tentang perbankan, sistem perbankan yang sehat, lembaga penjamin simpanan, hingga sistem kredit dan tabungan yang diterapkan khusus di OCBC NISP. Tak hanya itu, mahasiswa diberikan tes atas setiap pengetahuan yang telah terima. oleh karena itu, ilmu yang didapat secara teori tidak semata–mata hanya sebagai pemanis. Tapi mahasiswa juga dituntut untuk memahami setiap materi yang diberikan. Sementara itu, acara yang diadakan di Medan tersebut dihadiri 80 mahasiswa dari beberapa perguruan tinggi , antara lain Mikroskil, IT&B, IBBI, dan PMCI. “Dengan adanya kegiatan ini kami mengajak para mahasiswa untuk memper-siapkan diri dalam menghadapi masa depan setelah lulus nanti. Apapun yang menjadi profesinya kelak, Bank OCBC NISP senantiasa hadir untuk menjadi patner mereka,” katanya. (cdu)

Siswa Eria Ikut Penyuluhan Bahaya HIV/AIDS MEDAN (Waspada): Ratusan siswa SMP, SMA dan SMK Perguruan Eria Jln. Sisingamangaraja Medan mengikuti penyuluhan tentang bahaya Human Immonudeficiency Virus/Acquired Immuno Deficiency Syndrome (HIV/AIDS) dan narkoba bagi remaja. Kegiatan yang diselenggarakan Puskesmas Teladan bekerjasama dengan praktisi dari Gerakan Anti Narkoba Sumut dan Komisi Penanggulangan AIDS Kota Medan ini, berlangsung di aula sekolah tersebut, Kamis (27/9). Wakil Koordinator Perguruan Eria Drs. H. Rukzaidan mengatakan, kegiatan ini memberikan manfaat positif bagi siswa untuk mendapatkan informasi yang benar tentang bahaya penyalahgunaan narkoba dan penyebab HIV/AIDS. “Tentu saja, pihak yayasan memberikan apresiasi terhadap kegiatan ini. Diharapkan para siswa mewaspadai diri agar terhindar dari bahaya HIV/ AIDS dan narkoba. Sebagai generasi muda, mereka perlu membentengi dirinya. Semua bisa dicegah sejak dini dengan pengetahuan yang benar,” ujarnya. Pembicara dr. Nelli Murniati M.KT dari Puskesmas Teladan menjelaskan, kelompok yang

berisiko tinggi tertular HIV/AIDS yakni Pekerjsa Seks Komersial (PSK) dan pelanggannya, waria beserta pasangan dan pelanggannya, orang yang mendapatkan transfusi darah dari pengidap HIV/ AIDS, petugas kesehatan yang berhubungan dengan spesimen pasien HIV/AIDS serta pengguna narkotik suntik dan pasangannya. Sedangkan pembicara dari Komisi Penanggulangan AIDS Daerah Kota Medan, L Marsudi Budi Utomo mengatakan, penularan HIV/AIDS didominasi ibu rumah tangga. Sejak 2006 hingga 2012, jumlahnya mencapai 407 orang. Sedangkan kelompokmahasiswamencapai78orang.Totaljumlah pengidap HIV/AIDS sebanyak 3.237 orang. Karena itu, para remaja khususnya pelajar, perlu membentengi diri agar tidak terjerumus pada perilaku seks bebas dan penyalahgunaan narkoba sebagai antisipasi tidak tertular penyakit mematikan ini. “Bisa kena tapi bisa dicegah,” ujarnya. Sementara itu, Imaniar, siswa SMK Eria mengakui program ini sangat bermanfaat. “Siswa sekolah ini sering mendapatkan penyuluhan seperti ini. Kami senang karena mendapatkan pengetahuan tentang mencegah penularan HIV/ AIDS,” kata Imaniar.(m37)

Waspada/Anum Saskia

Ratusan siswa Eria sedang mendengarkan penjelasan dari narasumber tentang bahaya HIV/AIDS.

Medan Metropolitan

WASPADA Jumat 28 September 2012


Puluhan Pedagang Petisah Unjukrasa Ke DPRD Medan

KETUA Komisi C DPRD Medan A Hie menerima puluhan pedagang kaki lima Pasar Petisah, di kantor DPRD sementara Jln. Krakatau Medan.


Pemda Diajak Terapkan Akses Data Dengan BPK MEDAN (Waspada): Plt. Gubsu H Gatot Pujo Nugroho mengajak semua Pemerintah Daerah (Pemda) di Sumatera Utara, menerapkan sistem informasi untuk akses data (e-audit) dengan Badan Pemeriksa Keuangan (BPK). Hal itu disampaikan Plt Gubsu diwakili Sekdaprovsu H Nurdin Lubis di hadapan bupati dan wali kota se-Sumut, di kantor BPK RI Perwakilan Sumut Jln. Imam Bonjol, Medan, dalam

penandatanganan Keputusan Bersama tentang Petunjuk Teknis (Juknis) Akses Data, Kamis (27/9). “Ini sangat penting dan siginifikan dalam memperkuat komitmen kita mencegah korupsi,” ujarnya. Gatot berharap, dengan eaudit sistem pengelolaan keuangan daerah lebih baik dan akuntabel. BPK RI dan Pemprovsu sudah sepakat membangun sistem data dan akses informasi laporan keuangan (eauditee).

”Sistem e-audit akan memudahkan BPK melakukan pemeriksaan keuangan Pemprovsu dan 33 kabupaten/kota di Sumut,” sebutnya. Acara tersebut dihadiri Inspektur Wilayah Provsu H Dzaili Azwar, Kepala Biro Keuangan Pemprovsu H Baharuddin Siagian, Kepala Biro Hukum H Abdul Jalil dan Inspektur Kabupaten/Kota se Sumut. Keputusan Bersama Juknis Akses Data ini ditandatangani Kepala BPK Perwakilan Sumut Muktini beserta Plt. Gubsu dan

tiga kabupaten/kota yang siap menerapkan akses data, yakni Wali Kota Medan H Rahudman Harahap, Wali Kota Sibolga Syarfi Hutauruk, dan Bupati Humbahas Maddin Sihombing. “Kita berharap sistem ini segera link atau tersambung di semua kabupaten dan kota dan targetnya akhir 2012 semua Pemda se Sumut, sudah menerapkan akses data e-auditee,” kata Muktini. Komitmen ini merupakan bagian dari program Sinergi Nasional Sistem Informasi (SNSI)

guna memudahkan BPK melakukan audit secara elektronik. “Sistem e-auditee mengefisienkan kerja BPK. Ke depan, petugas BPK tidak lagi repot dengan berkas yang rumit, tetapi terbantu melakukan pengawasan dan pemeriksaan dengan hanya membuka sistem e-auditee,” tuturnya. Sementara itu, Wali Kota Medan Rahudman Harahap menyampaikan, penandatanganan Keputusan Bersama ini tindak lanjut Nota Kesepahaman antara BPK dan Pemerin-

tah Kota Medan, tentang Pengembangan dan Pengelolaan Sistem Informasi untuk Akses Data Pemerintah Daerah terkait pemeriksaan pengelolaan dan tanggung jawab keuangan negara. “Secara umum seluruh pemerintah daerah khususnya Kota Medan, siap memberikan dukungan terhadap e-audit, sehingga ke depan secara bertahap akan terus menjadi satu kesatuan dalam sistem informasi yang terintegrasi,” kata Rahudman.(m34)

Pemko Medan Belum Mampu Atasi Banjir


KEPUTUSAN Bersama Juknis e-audit ditandatangani Kepala Perwakilan BPK RI Sumut Muktini dan Plt Gubsu yang diwakili Sekdaprovsu H Nurdin Lubis.

Ka Kesdam I/BB Kunker Ke Rumkit Siantar MEDAN (Waspada): Kepala Kesdam I/BB Kol. CKM dr. Dubel Meriyenes Sp.B melaksanakan kunjungan kerja ke Rumkit P. Siantar, Jumat (21/9). Dalam kunjungan bersama Ka Rumkit Binjai Mayor CKM dr. M. Irsan, SpKK itu, Dubel mengaku bangga atas kemajuan RS tersebut. Ka Kesdam I/BB menilai Rumkit Siantar terus berkembang di bawah pimpinan Mayor CKM drg. Reinhart Nababan. “Diharapkan RS Siantar terus memberikan layanan yang maksimal kepada masyarakat umum dan prajurit TNI,” ujarnya. Kedatangan Ka Kesdam I/BB langsung disambut oleh Dandenkesyah 010401 P. Siantar Letkol CKM Ricardo S. Simanjuntak, S.Sos, MKes diiringi tarian budaya Simalungun yang dipersembahkan mahasiswi Akper Kesdam I/BB P. Siantar. Selanjutnya, Ka Kesdam I/BB memberikan pengarahan di ruang Denkesyah 01 04 01 P. Siantar. Selanjutnya Ka Kesdam I/BB melihat langsung kondisi fisik Rumkit Tkt IV 01 07 01 P. Siantar dan memberikan bingkisan kepada keluarga pasien dari prajurit TNI AD yang sedang dirawat. Kemudian Ka Kesdam I/BB beramah tamah dengan para mahasiswa Akper Kesdam I/BB P. Siantar. Turut hadir dalam kunker tersebut Ketua Persit KCK Ranting V Kes Cab 4 Log PD I/BB Ny. Anidawati, Danrumkit Tk IV 01 07 01 P. Siantar serta Danrumkit Tk IV 01 07 02 Binjai. (h02)


KEPALA Kesdam I/BB Kol. CKM Dr. Dubel Meriyenes Sp.B (depan) melaksanakan kunjungan kerja Ke Rumkit P. Siantar, Jumat (21/9).

MEDAN (Waspada): Meski anggaran perawatan dan pembangunan saluran drainase setiap tahun dikucurkan, namun sampai saat ini Pemerintah Kota (Pemko) Medan, tetap belum mampu mengatasi banjir. Setiap hujan turun, jalanjalan Kota Medan digenangan air sampai lutut. Kondisi inilah membuat warga menjadi apatis dengan Pemko Medan khususnya Dinas Bina Marga Kota Medan. Adapun genangan air setiap hujan turunseperti di kawasan simpang Limun Medan, kawasan Medan Denai, Medan Tembung, Medan Marelan, Medan Selayang, Medan Maimun, Medan Amplas, dan sejumlah kawasan lainnya. Iswandi, warga Medan Tembung, kepada Waspada, Rabu (26/9) mengatakan, kecewa dengan kinerja Pemko Medan. “Kita tahu tiap tahun anggaran perawatan dan pembangunan saluran drainase dikucurkan, tapi kenapa setiap turun hujan langsung banjir di mana-mana. Sepertinya mereka hanya cakap-cakap saja di kantor sana,” katanya. Menurut dia, seperti hujan yang terjadi kemarin malam. Sepedamotornya mogok di Jln.

Letda Sujono, bahkan saat itu ada puluhan pengemudi sepedamotor yang juga mengalami hal sama. “Kalau begini siapa yang mau bertanggungjawab dengan kerusakan sepedamotor kami. Mau rupanya Pemko bertanggung jawab, kan tidak. Jadi untuk apa ada anggaran untuk perbaikan drainase? Itu sama aja sia-sia. Pemerintah ini menipu rakyat saja, kalau kita terlambat bayar PBB, KTP kita pun ditahan,” ujarnya Demikian juga dikatakan John Fernando, warga Kecamatan Medan Amplas, yang mengeluhkan hal yang sama. “Simpang Limun ini katanya sudah diperbaiki drainasenya, tapi buktinya mana. Kalau hujan turun tetap saja banjir terus. Saya sering mengalami kalau di sini terpaksa mendorong sepedamotor, banjirnya bisa sampai di atas lutut,” sebutnya. John mengatakan, dirinya sangat kecewa dengan Pemko Medan, apalagi Wali Kota Medan Rahudman Harahap sudah menyatakan kalau Medan bebas banjir, tapi tidak ada buktinya. “Ini membuktikan Pemko Medanmasihlemahdalammenjalankan programnya,” katanya. Kadis Bina Marga Kota Medan Gunawan Lubis ketika di-

konfirmasi mengatakan, banjir yang terjadi selama ini di Kota Medan, disebabkan drainase yang tidak sanggup lagi untuk menampung debit air. Sebab, curah hujan yang tinggi mengakibatkan saluran drainase tidak mampu menampung debit air. Kondisi ini juga diperparah dengan terjadinya luapan air sungai di Kota Medan. “Banjir yang terjadi di Medan itu kan sekarang bukan karena drainase kita yang tidak berfungsi, tapi karena debit air hujan yang banyak sehingga tidak tertampung lagi oleh drainase. Selain itu, terjadinya luapan air sungai sehingga drainase kita tak sanggup lagi menampungnya dan menjadi banjir,” ujarnya. Gunawan mengatakan, dari pantauan yang dilakukan pihaknya di beberapa kawasan yang terjadinya banjir karena hujan kemarin malam itu disebabkan adanya luapan air sungai. Seperti di Medan Marelan dan lainnya. Selain itu, daerah resapan air juga banyak yang berubah fungsi menjadi tempat permukiman. Kondisi inilah yang mengakibatkan Kota Medan kerap dilanda banjir. “Kalau drainase kita hingga saat ini masih berfungsi. Kalau

tidak berfungsi jelas air akan bertahan berhari-hari, ini kan tidak pernah mendengar air bertahan hingga satu hari. Kalaupun terjadi banjir, paling hanya bertahan satu hingga dua jam dan setelah itu surut. Itu artinya drainase kita sebenarnya masih baik. Tapi, karena curah hujan yang tinggi ditambah dengan luapan air sungai mengakibatkan drainase meluap,” tuturnya. Dalam tahun ini, kata Gunawan, pihaknya menganggarkan Rp150 miliar untuk pembenahan drainase di Kota Medan. Ada beberapa kawasan dilakukan pembenahan drainase seperti di kawasan Medan Tembung, Medan Selayang, Medan Timur, Medan Marelan, dan lainnya. “Pembenahan drainase kita lakukan di seluruh kecamatan, memang ada beberapa kecamatan yang prioritas. Kita juga melakukan normalisasi sendimentasi alur drainase,” sebutnya. Terkait upaya untuk meminimalisir luapan air sungai, Gunawan mengatakan, hal itu kewenangan dari Balai Wilayah Sungai. “Kita kan punya tupoksi masing-masing, kalau hal itu terkait kewenangan dengan Balai Wilayah Sungai,” ujarnya. (m50)

Lomba Karya Tulis Pelestarian Kawasan TNGL MEDAN (Waspada): Balai Besar Taman Nasional Gunung Leuser Kementrian Kehutanan Direktorat Jenderal Perlindungan Hutan Dan Konservasi Alam mengadakan lomba karya tulis ilmiah. Pihak panitia dalam kunjungannya ke kantor Bumi Warta Harian Waspada Medan, Rabu (26/9) menjelaskan, Indonesia memiliki banyak taman nasional yang menawan, salah satu yang menarik Taman Nasional Gunung Leuser (TNGL). Kawasan TNGL seluas 1.094.692 ha terletak di dua provinsi yakni Provinsi Aceh dan Sumatera Utara, merupakan kawasan pelestarian alam yang

memiliki nilai sangat penting dalam sistem penyangga kehidupan, pengawetan keanekaragaman jenis tumbuhan dan satwa, serta pemanfaatan secara lestari sumber daya alam hayati dan ekosistemnya. Dalam rangka peringatan Hari Konservasi Nasional (HKN) pada 13 Agustus 2012 dan Hari Cinta Puspa dan Satwa tanggal 5 November 2012, Balai Besar Taman Nasional Gunung Leuser akan mengadakan kegiatan “Lomba Karya Tulis Konservasi TNGL”. Kegiatan ini merupakan ajang lomba kreativitas dan inovasi di kalangan pelajar, mahasiswa dan masyarakat umum

dalam menulis karya tulis berbentuk makalah, untuk memberikan masukan dan saran ilmiah dalam pengelolaan kawasan konservasi khususnya Taman Nasional Gunung Leuser. Lomba karya tulis ini bertemakan “Taman Nasional Gunung Leuser–Situs Warisan Dunia–Terancam Kelestariannya : Solusi dan Pemecahannya”. Me n g i n g a t a d a n y a ancaman yang serius di kawasan The Tropical Rainforest Heritage of Sumatera (TRHS) ini, diharap-kan peserta lomba memahami nilai penting kawasan TNGL sebagai fungsi perlindungan, pengawetan dan pemanfaatan secara lestari.

Lomba ini akan memperebutkan hadiah berupa trophy dan uang pembinaan totalnya Rp28 juta yakni, Pemenang I Rp8.000.000, II Rp6.000.000, III Rp4.000.000. Harapan I Rp2.500.000, II Rp2.000.000, III Rp1.500.000. Finalis 4 orang masing-masing memperoleh Rp1.000.000. Penerimaan naskah paling lambat 31 Oktober 2012 dan pengumuman pemenang tanggal 8 November 2012. Keterangan lebih lanjut dapat menghubungi panitia yaitu Ade telp 0852 7504 2455, Dewi 0813 8143 5564 dan Gita 0812 1990 1318. (m35)

MEDAN (Waspada): Puluhan pedagang kaki lima (PKL) Petisah unjukrasa ke kantor DPRD Medan, Kamis (27/9). Pedagang mayoritas perempuan itu meminta para wakil rakyat dapat memperjuangkan nasib mereka agar Wali Kota Medan tidak semena-mena melakukan pengusuran dengan mengunakan kekuasaan melalui Satuan Polisi Pamong Praja (Sat Pol PP). Pedagang juga menuntut agar tidak ada lagi pengusuran. Kedatangan para pengunjukrasa di kantor sementera DPRD Medan Jln. Krakatau Medan, diterima oleh Ketua Komisi C DPRD Medan A Hie. Sementara anggota DPRD lainnya masih menikmati pelesiran di luar kota. Kepada A Hie, puluhan pedagang Pasar Petisah yang tergabung dalam Forum Solidaritas Menolak Pengusuran Pedagang Kaki Lima mengharapkan agar tidak ada lagi penggusuran. “Pengusuran No, penataan Yes,” ujar para pedagang yang juga membawa poster. Menurut salah seorang pengunjukrasa,Wali Kota Medan selaku pemimpin harus peka dan peduli terhadap nasib para pedagang. Sebagaimana yang disebutkan Presiden RI SBY mengatakan kesedihannya jika para PKL digusur. Kata dia, mereka sudah tiga minggu tidak berjualan dan hingga saat ini belum mendapatkan apa pun sehingga tidak dapat memenuhi kehidupan keluarga. Pedagang sangat menderita dengan tindakan arogansi yang dilakukan oleh personel Sat Pol PP. “Sudah tiga minggu kami tidak berjualan, kami butuh makan, anak-anak kami juga sekolah.Tapi lihat kebijakan yang dilakukan oleh Dirut PD Pasar yang merupakan perpanjangan tangan pemimpin di kota ini justru menyuruh Sat Pol PP yang sangat arogan,” sebutnya. Ketua Komisi C DPRD Medan A Hie menyebutkan, pihaknya akan segera memperhatikan keluhan para pedagang. Sejalan dengan itu, Komisi C akan menyurati Wali Kota Medan maupun PD Pasar meminta dasar dan upaya yang akan dilakukan terhadap nasib pedagang. “Saya sangat mengerti dengan keluhan para pedagang, persoalan ini akan segera dicari solusi,” tuturnya. Selanjutnya, A Hie mengajak perwakilan pedagang ke ruangan Komisi C DPRD Medan untuk membicarakan dan langkah serius yang dapat ditempuh dalam waktu dekat. Menurut dia, Komisi C akan menyurati serta memanggil PD Pasar dan Pemko Medan terkait kebijakan menggusur pedagang. Surat Komisi C itu juga mempertanyakan terkait adanya Inpres No 6 tahun 2012 masalah penataan PKL. Kepada wartawan A Hie menyebutkan, terkait dengan keluhan pedagang, Wali Kota diharapkan dapat melakukan pendekatan dengan pedagang bukan langsung dibenturkan dengan Satpol PP. PKL yang dinilai penggerak ekonomi kecil harus dilindungi dan ditata dengan baik. “Kita setuju jika PKL ditertibkan dan ditata, namun bukan kekerasan. Kita sangat menyayangkan jika dilakukan tindakan kekerasan namun tidak mencari solusi,” ujar politisi Demokrat itu. Dia mengharapkan perhatian serius Wali Kota Medan untuk mencari solusi. “Kapasitas wali kota harus sanggup mendekatkan diri dengan pedagang, sehingga PKL merasa tidak terabaikan dan kelangsungan hidupnya lebih terjamin,” sebutnya. (m30)

HTI-Tokoh Umat Bangun Kebersamaan MEDAN (Waspada): Hizbut Tahrir Indonesia (HTI) Medan dan tokoh umat, menggelar silaturrahim akbar di Masjid Agung Jln. Diponegoro Medan, Minggu (23/9). Silaturrahim bertujuan membangun kebersamaan dengan berbagai kalangan tokoh umat di daerah Medan dan sekitarnya yang dihadiri 1.000 orang terdiri dari ulama, ustadz/ ustadazah, mubaligh/ muballighoh, akademisi, guru, pengurus BKM, majelis taklim,

pengusaha, dan tokoh lainnya. Dalam kesempatan itu juga hadir Ketua BKM Masjid Agung Medan Dr dr Fanani Lubis, Majelis Pakar Kahmi Sumut/Dosen USU Ir Awaluddin Thayab MSc, Rektor Universitas Amir Hamzah Medan Tarmizi SH, MHum, dan Dr Ishak Abbas. Liqa Syawwal Tokoh Umat ini dibuka Ustadz Azwir Ibnu Aziz (foto) dari HTI DPD I Sumut. Kata dia, maksud diselenggrakannya acara ini dalam rangka membangkitkan dan membawa umat menuju kehidupan yang lebih baik dan mensejahterakan dalam bingkai khilafah. “Saat ini HTI berada dalam tahapan dakwah tafaul maal ummah, menuju ke istilamu al hukmi. Setelah tayangan multimedia, capaian dakwah HTI,” ujarnya. Sementara dalam penyampaian Kalimatul Hikmah oleh Ustadz Farid Wadji dari DPP HTI mengatakan, bahwa khilafah adalah janji Allah SWT dan kabar gembira dari Rasulullah SAW. Keberadaan khilafah merupakan perkara yang diwajibkan Allah SWT atas seluruh kaum muslimin. Ketiadaannya merupakan sebab yang mengakibatkan terlantarnya hukum-hukum Islam. Selain itu, khilafah juga berguna sebagai penjaga dan pelindung umat Islam. Sedangkan testimoni diberikan tiga ulama yakni Ustadz Bunhiya Sinaga (Deliserdang), Ustadz Huzaifah Al Ayyubi (Medan), dan Ustadz Muhammad Al Fatih (Serdang Bedagai). Seruan Hizbut Tahrir Indonesia pasca Ramadhan disampaikan oleh Ustadz Musa Abdul Ghoni (HTI DPD I Sumut). (cwan)

Kondom Alat KB Paling Rendah Penggunanya MEDAN (Waspada): Salah satu alat kontrasepsi yang paling efektif untuk mencegah kehamilan adalah kondom. Tapi, kondom justeru merupakan alat kontrasepsi yang paling diabaikan. Di Medan, warga yang menggunakan kondom hanya mencapai 18,3 persen dari 28.410 jumlah pencapaian akseptor KB yang menggunakan kondom hingga Agustus 2012. “Target pencapaian akseptor KB yang menggunakan alat kontrasepsi kondom tahun ini sebanyak 65.370 orang, tapi hingga Agustus pencapaiannya baru mencapai 28.410. Dari jumlah itu, Medan memang nomor dua terendah yang warganya menggunakan kondom yakni hanya mencapai 18,3 persen. Menyusul, Kabupaten Pak-pak Bharat yang terendah yakni 16,2 persen,” kata Kepala Sub Bagian Advokasi Pergerakan dan Informasi BkkbN Sumatera Utara Anthony, Selasa (25/9). Menurut Anthony, berbeda dengan daerah yang terpencil seperti Nias Barat, warganya justru memilih kondom sebagai alat kontrasepsi dengan pencapaian 63,6 persen, Nias Selatan sebanyak 60 persen, Nias mencapai 56,7 persen. Daerah yang pencapaiannya tertinggi bahkan melebih target di antaranya, Padang Lawas Utara yakni 153,7 persen, Labuhan Batu Utara 133,2 persen, Kabupaten Karo 105,3 persen. “Kenapa Nias justru pencapaiannya tinggi, karena kadangkadang suami enggan membawa istrinya untuk memasang alat kontrasepsi. Prianya justeru yang lebih berpartisipasi menggunakan alat kontrasepsi. Karena kondom efektif, mereka lebih minat memakai kondom,” ujarnya. Kata dia, banyak juga warga yang menganggap kondom menganggu hubungan suami istri. Padahal, alat kontrasepsi yang sangat tipis tersebut banyak manfaatnya. Di antaranya sebagai penangkal penyakit menular, sebagai alat kontrasepsi, dan bisa menghambat ejakulasi dini bagi pria. Anthony mengakui, pihaknya tidak berhenti mensosialisasikan penggunakan kondom kepada warga. “BkkbN secara rutin melakukan kordinasi dengan kabupaten kota, khususnya didaerah penyangga utama seperti Medan, Binjai, dan sekitarnya untuk mengoptimalkan pemakaian alat kontrasepsi terutama kondom,” sebutnya. (h02)

Politik & Hukum


KPUD Paluta Sosialisasi Verifikasi Parpol Peserta Pemilu 2014 GUNUNGTUA (Waspada): Puluhan pengurus partai politik dan tokoh masyarakat di Kabupaten Padanglawas Utara (Paluta) mengikuti sosialisasi peraturan KPU tentang verifikasi Partai Politik Peserta Pemilu 2014 yang diselenggarakan oleh Komisi Pemilihan Umum Daerah Paluta di Aula Hotel Mitra Gunungtua, Jalan Lintas Gunungtua-Padangsidimpuan, baru-baru ini. Sosialisasi regulasi Pemilu 2014 ini mengambil tema tentang peningkatan fungsi dan peran partai politik dalam rangka penguatan pelaksanaan demokrasi dan sistem kepartaian yang efektif sesuai peraturan perundang-undangan yang dibuka Bupati Padanglawas Utara Drs H Bachrum Harahap diwakili Asisten III Setdakab Paluta Drs Hailullah Harahap, dihadiri Ketua DPRD Paluta Muchlis Harahap, Wakil Ketua DPRD Paluta Drs H Ahmad Sailan Siregar beserta undangan lainnya. Bertindak sebagai narasumber anggota komisioner dari KPUD Sumut, yakni Dr Surya Perdana, SH, M.Hum dan Rajin Sitepu, SH, M. Hum. KeduanyatampilsebagaipembicaradidampingiKetua KPUD Paluta Muhammad Ali Ansor, S. Ag bersama anggota komisioner lainnya Nasir Harahap, Aman Siregar, Ongkusyah dan Syafri Siregar. Sekretaris KPUD Paluta Harlin Munawar Harahap, S. Sos dalam laporannya menyebutkan, kegiatan sosialisasi peraturan KPU tentang verifikasi Partai Politik Peserta Pemilu 2014 yang diselenggarakan oleh KPUD Paluta bertujuan menyampaikan informasi tentang persiapan verifikasi, sehingga seluruh peserta yang terdiri dari pemda, parpol dan masyarakat dapat mempersiapkan segala sesuatu yang dibutuhkan pada pelaksanaan pemilu mendatang.

Ketua KPUD Paluta Muhammad Ali Ansor, SAg dalam sambutannya menyampaikan apresiasi dan penghargaan yang setinggi-tingginya kepada para pengurus parpol yang turut hadir dalam acara sosialisasi tersebut sekaligus mengucapkan terimakasih atas partisipasi aktif dari pengurus parpol guna kelancaran acara tersebut. Bupati Paluta Drs H Bachrum Harahap melalui Asisten III Setdakab Drs Hailullah Harahap mengapresiasikegiatanyangdilaksanakansekaligus berharap agar pihak KPUD Paluta senantiasa melakukan kegiatan sosialisasi guna meningkatkan penyelenggaraan Pemilu yang mandiri, jujur, adil, tertib, dan proporsionalitas, profesionalitas, akuntabilitas, efisiensi, dan efektivitas, sebagaimana yang diamanatkan dalam undang-undang. Kemudian kepada pengurus partai politik, ia berpesan agar menyamakan pandangan dalam memahami ketentuan yang ada, sebab adanya kesamaan pemahaman, pengurus partai dapat mempersiapkan diri memenuhi kelengkapan persyaratan verifikasi partai politik sebagai peserta pemilu Tahun 2014. Adapun yang disosialisaskan kepada pengurus parpol dan tokoh-tokoh masyarakat yakni, Peraturan KPU Nomor 11 Tahun 2012 tentang perubahan atas Peraturan KPU Nomor 7 Tahun 2012 tentang Tahapan, Program dan Jadwal Penyelenggaraan Pemilihan Umum anggota DPR, DPD dan DPRD tahun 2014, Peraturan KPU Nomor 12 Tahun 2012 tentang Perubahan Atas Peraturan KPU Nomor 8 Tahun 2012 tentang Pendaftaran, Verifikasi dan Penetapan Partai Politik Peserta Pemilu Anggota DPR,DPD dan DPRD Kabupaten/Kota. (a35)

Soal RUU Penataan Ruang, DPD Serap Masukan USU MEDAN (Waspada): Untuk mendapatkan masukan lebih komprehensif dalam penyusunan RUU, Komite I DPD RI berekerja sama dengan Universitas Sumatera Utara (USU) menggelar kegiatan Focus Group Discussion (FGD) di kampus USU, Rabu, (19/9). Rektor USU Prof Syahril Pasaribu menyampaikan penataan ruang merupakan satu sistem proses perencanaan tata ruang, pemanfaatan ruang, dan pengendalian pemanfaatan ruang sebagaimana tercantum dalam UU Nomor 26 Tahun 2007. “Masalah tata ruang adalah masalah kita bersama, oleh karena itu kita semua memiliki peran dan tanggung jawab bersama untuk membentuk tata ruang yang dapat meningkatkan kualitas kehidupan kita,” katanya. Dalam sesi pemaparan yang disampaikan Anggota Tim Kerja DPD RI yang juga dihadiri oleh Rahmat Sah (Anggota DPD RI asal Sumut), beberapa kondisi di tanah air yang terekam terkait dengan persoalan penataan ruang ini yang dipaparkan dalam acara ini seperti, Derivasi kebijakan dari Undang-Undang Nomor 26 tahun 2007 tentang Penataan Ruang yang terus bergulir di tengah banyaknya persoalan seperti sinkronisasi kebijakan. Baik antara pemerintah pusat dengan daerah maupun antar pemerintah daerah baik dilevel propinsi maupun di tingkat kabupaten/kota. Disamping itu, Otonomi Daerah telah memberikan legitimasi untuk menyerahkan kewenangan dalam proses penyelenggaraan penataan ruang kepada daerah. Konsekuensi dari kondisi ini antara lain, memberikan kemungkinan banyaknya kabupaten/kota yang lebih memikirkan

kepentingannya sendiri, tanpa memikirkan sinergi dalam perencanaan tata ruang dan pelaksanaan pembangunan dengan kabupaten/kota lainnya, atau hanya sekedar untuk mengejar targetnya dalam lingkup “kacamata” masing-masing. Isu lainnya yang juga diperbincangkan menyangkut kondisi saat ini, dimana baru terdapat 13 propinsi (39,39%) dan 150 kabupaten/kota dari 491 (30,55%) yang baru memiliki Paraturan Daerah (Perda) tentang RTRW. Perda RTRW inilah yang saat ini menjadi acuan bagi implementasi pembangunan dan investasi di daerah dengan menjaga koridor keberlangsungan lingkungan (per 4 Juni 2012 versi Ditjen Penataan Ruang Kementerian PU). Ini artinya ada fenomena keterlambatan yang perlu diketahui masalah penyebabnya sekaligus untuk dapat dicarikan solusianya. Masalah lainnya yang terkait dengan penataan ruang seperti, tidak adanya sinergi antara pusat dan daerah dalam kerangka kerjasama yang saling menguntungkan (simbiosis mutualisme). Perencanaan tata ruang yang tidak mempunyai proyeksi kepentingan atau kebutuhan masa yang akan datang. Aspek potensi dan budaya yang ada di masyarakat dan daerah belum menjadi pertimbangan dalam perencanaan tata ruang. Perencanaan tata ruang yang belum bersinergi dengan upaya pelestarian lingkungan dalam kerangka pembangunan yang berkelanjutan (sustainable development), dan masih lemahnya aspek penegakan hukum dalam penataan ruang kita. Peserta kagiatan ini terdiri dari jajaran pemerintah daerah (Dinas Tata Kota, Bappeda, SKPD terkait), DPR Provinsi dan kabupaten/kota, akademisi, dan unsur lainnya di Sumatera Utara. (m49)

WASPADA Jumat 28 September 2012

Karang Taruna Siap Menangkan Erry Nuradi PERBAUNGAN (Waspada): Karang Taruna Provinsi Sumatera Utara siap mendukung dan memenangkan Ir HT Erry Nuradi, MSi, menjadi Gubernur Sumatera Utara periode 2013 - 2018 pada Pemilukada 2013. Demikian dinyatakan Ketua Umum (Ketum) Karang Taruna Sumatera Utara H. Sholahuddin Nasution, SE, dalam sambutannya pada acara perayaan Hari Ulang Tahun (HUT) ke 52 Karang Taruna (KT) di halaman Kantor Kepala Desa Deli Muda Hilir Kecamatan Perbaungan, Kab. Serdang Bedagai, Rabu (26/ 9). Dikatakannya, dukungan yang diberikan kepada HT Erry Nuradi yang saat ini menjabat sebagai Bupati Sergai karena beberapa faktor yang cukup mendukung di antaranya bahwa Erry Nuradi cukup mendukung akan program Karang Taruna, terbukti hanya Kabupaten Sergai dari 33 kab/kota yang mempunyaiPerdaKarangTaruna di APBD Sergai sejak tahun 2007. Dengan kepedulian beliau itu, maka Bupati Sergai HT Erry

Nuradi diangkat menjadi Ketua Majelis Pertimbangan Karang Taruna (MPKT) Provsu. Selain itu Erry Nuradi mempunyai kemampuan dan skill dalam memanajemen pemerintahan sehingga Kabupaten Sergai yang relatif muda telah mampu mensejajarkan diri dengan kab/kota lainnya, papar Sholahuddin. Sebelumnya Ketua MPKT Serdang Bedagai Zulkarnain Herman menyampaikan dalam memperingatai HUT KT adalah memiliki makna untuk refleksi diri terhadap pekerjaan organisasi ini sejak dibentuk pada 26 September 1960, tepat 52 tahun lalu di Kampun Melayu di Jakarta. Untuk itu ke depan nanti bila organisasi ingin memiliki Perda tentang KT, tentunya pemimpin utama di Pemprovsu harus sosok yang mengerti tentang KT dan sosok tersebut tidak lain adalah HT Erry Nuradi, dan menjadikan Kabupaten Sergai sebagai buminya Karang Taruna, beber Zulkarnain Herman. Sedangkan Bupati Sergai yang juga menjabat sebagai Ketua MPKT Sumut HT Erry Nuradi, MSi memberikan apre-

siasi kepada seluruh kader-kader KT khususnya KT Sergai yang selama ini cukup memberikan dukungan terhadap pemerintah. Karena keberadaan KT menurut Erry Nuradi memiliki ciri yang tersendiri, karena KT berbasis di desa dan kelurahan dengan melaksanakan tiga

Waspada/Edi Saputra

Masyarakat Ditantang Uji Track Record Amri Tambunan TANJUNGMORAWA (Waspada): Masyarakat ditantang untuk menguji bagaimana rekam jejak (track record) Amri Tambunan yang saat ini menjabat sebagai Bupati Deliserdang. Rekam jejaknya yang mampu membawa Deliserdang lebih bermartabat, membuat sejumlah tokoh pemuda dari lintas organisasi yang bergabung dalam Komunitas Pemuda menyatakan kebulatan tekad mendukung Drs H Amri Tambunan menjadi calon Gubernur Sumatera Utara (Gubsu) periode 2013-2018. Hal tersebut terungkap dalam sebuah pertemuan di Kecamatan Tanjungmorawa yang diprakarsai Drs Tuangkus Harianja, kemarin. Hadir pada pertemuan itu antara lain Agusli, SH, Drs H Ibnu Hajar, Muhammad Syahrum, Muhammad Arsul, SH, RE Gultom, Kamal Idris, Sumingrat Ady Kesuma, Kamil Siregar, Ir Elzan Albar,

Wahyudi, Suratmin, Gito, Sujarwo, Dedy Irawan Ziliwu, SH, Erwin Peranginangin, Hariadi, Deni AG, Zubri Sitorus, Esy Syahputra Lubis, Marwan Efendi, Edi Kawilarang dan sejumlah tokoh muda lainnya. “Silakan masyarakat uji rekam jejak Pak Amri. Kami telah mengujinya ternyata kepemimpinannya positif dalam memimpin Deliserdang dua periode. Untuk itu, kami memberi dukungan terhadap Amri Tambunan menjadi calon Gubsu.Yang tentunya dukungan itu disampaikan setelah melihat dan menguji rekam jejak putra sulung (Alm)HDjamaluddinTambunan itu dalam memimpin roda pemerintahan, pembangunan dan kemasyarakatan ,” ujarnya. Tuangkus Harianja bersama Agusli SH, Muhammad Syahrum dan Ibnu Hajar menjelaskan, terlepas dari berbagai kekurangan dan kelemahan, namun selama dua periode memimpin

pemerintahan, pembangunan dan kemasyarakatan sebagai bupati, Amri Tambunan berhasil membawa kabupaten ini ke arah yang lebih baik bahkan berhasil memacu percepatan pembangunan melebihi kabupaten/ kota yang ada di Sumut. Sebagai bupati, Amri Tambunan berhasil melakukan percepatan pembangunan melalui berbagai program dan konsep pembangunan yang digagasnya antara lain bidang pendidikan melalui konsep “Cerdas”, kesehatan melalui “Ceria” infrastruktur melalui “GDSM” serta program kemanusiaan peduli masyarakat miskin melalui “Baru Yakin” (Bedah rumah masyarakat miskin/kurang mampu) dengan sasaran 10 ribu rumah tidak layak huni menjadi rumah sehat dan layak huni. Semua program dilakukan melalui pola kebersamaan dengan mengandalkan tiga pilar kekuatan yaitu pemerintah, par-

MEDAN (Waspada): Gabungan Polisi Militer dari TNI AD, TNI AL dan TNI AU menggelar razia penegakkan dan ketertiban (Gaktib) 2012 di Jln. Gatot Subroto Medan, Rabu (26/9). Razia yang dilakukan dalam rangka HUT TNI ke 67, antara lain untuk memeriksa kelengkapan administrasi kendaraan bermotor prajurit TNI, stiker berlogo TNI yang menempel di kendaraan dan jaket/celana TNI yang dipakai masyarakat sipil. Razia tersebut di pimpin oleh Dansatlak Hartib Denpom 1/ 5 Pomdam I/BB Lettu Cpm Hendra Syahputra. Kepala Penerangan Kodam (Kapendam) I/BB Kol. Kav. Halilintar Sembiring mengatakan, hukum, disiplin dan tata tertib merupakan ciri utama sakaligus sendi kehidupan paling mendasar bagi prajurit TNI. Selain itu, lanjutnya, Operasi Gaktib Polisi Militer juga memberikan dorongan agar dapat ditekan sekecil mungkin berbagai bentuk pelanggaran hukum, disiplin dan tata tertib dilingkungan TNI. “Kegiatan Gaktib ini rutin dilakukan, bukan hanya dalam rangka HUT TNI saja. Itu tujuannya untuk menertibkan kendaraankendaraan yang digunakan TNI yang tidak memakai kelengkapan surat-surat kendaraan dan lainnya, namun belum ada laporan dari hasil razia tersebut,” kata Kapendam. Menurut Halilintar, personel baik militer maupun PNS yang terjaring dalam Operasi Gaktib tersebut akan diberikan sanksi dan selanjutnya wajib melengkapi dan mengurus kelengkapan surat-surat sesuai dengan ketentuan yang berlaku. “Tapi saya belum dapat laporan berapa kendaraan TNI yang terjaring razia karena tidak melengkapi surat-surat,” sebutnya. (h02)

BELAWAN (Waspada): Mobil milik Sekretaris Angkatan Muda Pembaharuan Indonesia (AMPI) Kota Medan Asri Mulia Rambe alias Bayek dijarah maling saat parkir di Jln. Platina Komplek Bank, Kel. Titi Papan, Kec. Medan Deli, Rabu (26/9) siang pukul 12:30. Akibat kejadian itu, korban kehilangan uang Rp400 juta yang disimpan dalam mobil. Lurah Titi Papan Thamrin Lubis, teman korban, mengatakan, peristiwa itu berlangsung sangat cepat sehingga korban bersama warga tidak berhasil mengejar pelaku yang diperkirakan dua orang dan mengendarai sepedamotor jenis bebek. Ketika itu, korban berencana pulang ke rumahnya yang tidak jauh dari lokasi kejadian. Belum sampai ke rumahnya, korban melihat beberapa temannya sedang duduk-duduk di warung. Asli Mulia berhenti dan memarkirkan mobilnya sekitar 25 meter dari tempat korban menemui temannya. “Saat itu dia lewat, karena melihat kami dia berhenti untuk bincang-bincang tentang banjir pada jalan menuju rumahnya. Tidak lama kemudian dia mohon izin mau pulang,” kata Thamrin. Menurut dia, setelah sampai ke mobilnya yang diparkirkan, korban terkejut melihat kaca samping mobilnya pecah. Lalu dia memeriksa mobilnya, ternyata uang sejumlah Rp400 juta yang berada di dalam mobil telah hilang. “Kami tidak tahu kapan kaca mobil itu pecah dan kami berusaha mencari tahu pelakunya. Namun tidak dapat walau telah dikejar hingga ke ujung gang,” ujarnya. Kanit Tipiter Polres Pelabuhan Belawan Iptu Budiarto ketika dikonfirmasi membenarkan kejadian tersebut dan telah menerima laporan korban. “Kita masih melakukan penyelidikan,” katanya.(h03)

Provsu H. Sholahuddin, SE, tampak dihadiri Ketum Koni Sergai DarmaWijaya, SE, anggota DPRD Sergai Syafaruddin, SE, Kadis Parburpora Drs.Herland Panggabean, Ketua/anggota KT Kecamatan, Ketua/anggota Ormas se Sergai dan undangan lainnya. (co3)

BUPATI Sergai Ir HT Erry Nuradi yang juga Ketua MPKT Sumut memotong nasi tumpang pada acara HUT ke 52 Karang Taruna di Sergai, didampingi Ketum KT Provsu H. Sholahuddin, SE, Ketum Koni Sergai Darma Wijaya, SE, Ketua MPKT Sergai Zulkarnain Herman, SE, Rabu (26/9) di halaman kantor Desa Delimuda Hilir, Kec. Perbaungan.

Polisi Militer Gelar Razia Gaktib 2012

Kaca Mobil Dipecah Maling Rp400 Juta Raib

tugas pokok yakni Usaha Ekonomi Produktif (UEP), Usaha Kesejahteraan Sosial (UKS) dan Usaha Pengelolaan dan Pembinaan Organisasi. Acara diakhiri dengan pemotongan nasi tumpang itu diawali Bupati Sergai HT Erry Nuradi MSi, diikuti Ketum KT


GABUNGAN Polisi Militer dari TNI AD, TNI AL, dan TNI AU memeriksa surat-surat dan perlengkapan kendaraan prajurit TNI saat razia penegakkan dan ketertiban (Gaktib) 2012 di Jln. Gatot Subroto Medan.

Poldasu Periksa Mantan Kadisperindag Simalungun

Mahasiswi Kedokteran Tewas Digilas Dump Truk

MEDAN (Waspada): Mantan Kepala Dinas Perindustrian dan Perdagangan Simalungun Jhony Siahaan diperiksa penyidik Tindak Pidana Korupsi (Tipikor) Polda Sumut, Rabu (26/9). Dia diperiksa terkait dugaan korupsi penjualan minyak goreng curah di Pasar Murah senilai Rp1,3 miliar pada Tahun Anggaran 2008. Wakil Direktur Dit Reskrimsus Poldasu AKBP Rudi Setiawan membenarkan pihaknya memeriksa mantan Kadis yang kini staf ahli Kadisperindagsu. Namun Rudi belum bisa memastikan statusnya. “Masih tahap awal, jadi belum bisa dipastikan apakah hanya saksi, atau menjadi tersangka,” ujarnya. Kata Rudi, setiap orang yang dperiksa tidak harus menjadi tersangka. Bahkan seseorang yang sudah ditetapkan sebagai tersangka dalam kasus korupsi ataupun kasus lainnya bisa saja tidak ditahan. “Itu kewenangan penyidik. Kalau ditahan berarti ada penilaian subjektif atas sikap dan prilaku tersangka yang dianggap dapat melarikan diri dan menghilangkan barang bukti, tetapi jika tidak ditahan berarti penyidik mempunyai penilaian positif terhadap tersangka,” sebutnya. Sementara, Jonny Siahaan ditanya wartawan mengaku diperiksa penyidik Tipikor Poldasu sebagai saksi. “Pertanyaan penyidik masih hal mendasar, misalnya dimana aku sekolah SD sampai SMA, kuliah dimana serta apa aktifitasku saat ini,” katanya. Dia diperiksa karena adanya selisih hasil audit Badan Pengawasan Keuangan dan Pembangunan (BPKP) sebesar Rp700 juta dari alokasi anggaran untuk pengadaan minyak curah di pasar murah senilai Rp1,3 miliar. “Sebenarnya tidak sampai Rp700 juta, hanya Rp600 jutaan,” ujarnya menyebutkan, terlaksananya kegiatan pasar murah tidak terlepas dari tiga tim yang dibentuknya selaku penanggungjawab.(m27)

MEDAN (Waspada): Seorang mahasiswi Fakultas Kedokteran di Medan, tewas digilas dump truk di Jalan Makmur, Pasar VII simpang Jodoh Tembung, Kec. Percut Seituan, Kamis (27/9) sekira pukul 17:00. Dengan kondisi tubuh mengenaskan, mayat Nindi Afriani, 18, warga Jalan Makmur, Dusun VI, Desa Tembung, Kec. Percut Seituan, segera dievakuasi ke RSU Dr Pirngadi Medan, sedangkan sopir dump truk diamankan di Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, sore itu korban mengendarai sepedamotor bermaksud hendak pulang ke rumahnya. Sesampainya di Jalan Makmur Simpang Jodoh Tembung, korban mendahului dump truk BK 8551 LO, namun berusaha mengelakkan lubang hingga sepedamotornya menyenggol bagian depan truk dan korban terpental ke bawah kolong truk. Seketika itu juga, kepala korban tergilas ban truk hingga korban tewas seketika. Sopir truk bernama Anas, 40, warga Kec Labuhandeli, segera diamankan warga ke Polsek Percut Seituan berikut dump truknya. Sopir truk Anas menjelaskan, sore itu dirinya bermaksud hendak kembali ke Patumbak usai mengantar tanah timbun di kawasan Tembung. “Tibatiba sepedamotor korban menyenggol truk dan langsung tergilas,” sebutnya kepada petugas. (h04)

tisipasi masyarakat dan dukungan sektor swasta. Seperti sektor pendidikan, melalui konsep “Cerdas” pada tahun 2005 berhasil merehabilitasi 621 unit sekolah dari kondisi rusak menjadi layak pakai, sehingga pada tahun 2007 tidak ada lagi gedung sekolah dasar yang tidak layak pakai di Kab. Deliserdang. Begitu juga di sektor kesehatan lewat program “Ceria” (percepatan penurunan angka kematian ibu dan anak) sejumlah Puskesmas ditingkatkan statusnya menjadi Puskesmas rawat inap, membangun sejumlah Pustu di desa dan kecamatan serta Poskesdes di setiap desa dalam rangka mendekatkan pelayanan kesehatan kepada masyarakat. Untuk pembangunan infrastruktur, bupati menggulirkan program “GDSM” (Gerakan Deli Serdang Membangun) yaitu pembukaan jalan baru antar desa di setiap kecamatan, pelebaran jalan,

perkerasandanpengaspalanjalan serta pembangunan jembatan. Pada tahun 2004 saat Amri Tambunan mengawali debut kepemimpinannya di Deliserdang, panjang jalan di daerah ini hanya 1.317,6 Km. Dengan program GDSM pada 2011 panjang jalan di Deliserdang menjadi 3.372,90 Km dan jembatan yang dibangun sepanjang 13.677,95 meter (4.096 unit). Untuk meningkatkan rasa kesetiakawanan sosial antar sesama di tengah-tengah masyarakat sebagai bentuk peduli kepada warga miskin dan kurang mampu, pada Maret 2011 Amri Tambunan menggulirkan program kemanusiaan melalui program “Baru Yakin” Hingga saat ini, jumlah rumah yang sudah dibedah sudah mencapai 1.300 unit. Selain itu, angka kemiskinan di Kabupaten Deliserdang juga berhasil diturunkan mencapai 5,34 persen, terendah di Sumatera Utara.(a06/m13)

Ekonomi & Bisnis

WASPADA Jumat 28 September 2012


Pertamina Usul Naikkan Harga Gas Elpiji 12 Kg MEDAN (Waspada): PT Pertamina (Persero) mengusulkan kepada pemerintah untuk menaikkan harga gas elpiji 12 kg. Alasannya, mengingat selama ini Pertamina telah mengalami kerugian mencapai Rp5 triliun, karena menjual gas elpiji 12 kg di bawah harga yang seharusnya.

Vice President Corporate Communication PT Pertamina (Persero) Ali Mundakir, mengatakan itu di sela-sela acara Pertamina Days dengan tema ‘Pertamina Sobat Bumi’ berkaitan dengan hari ulang tahun ke55 Pertamina, di Atrium Sun Plaza Medan, Kamis (27/9). Disebutkan Ali Mundakir, selama ini Pertamina selalu rugi dalam penjualan elpiji 12 kg. karena menjual dengan harga di bawah harga yang seharusnya. Proyek kerugian tersebut mencapai Rp5 triliun selama tahun 2012 ini. ‘’Untuk itu, kita

(Pertamina) menyampaikan wacana kepada pemerintah untuk menaikkan harga dalam rangka mengurangi kerugian dalam bisnis elpiji 12 kg,’’ kata Ali Mundakir. Dia mengatakan, sebetulnya untuk menaikkan harga elpiji 12 kl ini tidak perlu izin dari pemerintah karena gas elpiji 12 kg bukan gas bersubsidi. Tetapi mengingat Pertamina merupakan perusahaan negara dan kenaikan harga akan memiliki dampak bagi masyarakat dan negara, maka kata Mundakir, pihaknya komunikasikan dulu

BANDA ACEH (Waspada) : Meski musibah tsunami sudah terlewati hampir delapan tahun, namun sebagian besar tambak ikan penduduk di Kec. Meuraxa, Syiahkuala, dan Kutaraja, Kota Banda Aceh masih terlantar. Puluhan bahkan ratusan hektare tambak ikan dan udang milik masyarakat, belum bisa dimanfaatkan kembali oleh warga setempat. Beberapa pemilik tambak mengaku meninggalkan usaha budidaya ikan dan udang itu karena sangat renta terhadap serangan virus yang mematikan ikan dan udang. Selain itu, warga juga mengeluhkan kondisi tambak yang tidak sempurna setelah direhab pasca tsunami yang terjadi 26 Desember 2004 lalu, sehingga tak bisa difungsikan. Sejumlah tambah di Gampong Lampaseh, Deah Glumpang, Blang Oi dan Gampong Alue, yang sempat direhap, kini juga tidak terpakai. Sulaiman, seorang petani

tambak di Deah Glumpang, kepada Waspada, Rabu (26/9) mengatakan dari total luas area tambak di empat desa itu seluas 70 hektare lebih, hanya 50 persen yang masih dimanfaatkan. “Setelah tsunami usaha tambak kami tidak memberi hasil lagi. Jangankan untuk memperoleh keuntungan setiap kali panen, untuk kembali modal saja sangat sulit. Yang sering terjadi malah gagal panen,’’ katanya. Menurut Sulaiman, pasca tsunami kondisi tambak memang rentan terkena virus. Bibit udang yang dimasukkan ke tambak, paling bertahan tiga hari, lalu mati. Tambak yang sempat direhab juga tidak sempurna. Bahkan kondisi pematang tambak yang dibangun beberapa NGO tidak padat, sehingga sering longsor. Sulaiman, menduga hal itu terjadi karena pematang tambak dibangun dengan tanah bercampur pasir serta lumpur yang dibawa tsunami dulu.

kepada pemerintah selaku pemilik Pertamina. Saat ini pihaknya sedang melakukan komunikasi, baik besaran dan waktunya. ‘’Saat ini belum ada. Jadi masyarakat jangan khawatir. Tenang dulu lah,’’ ujarnya. Dia menyebutkan, wacana ini disampaikan kepada pemerintah agar kajian kenaikan harga ini lebih konprehensif dan dikaji dari semua aspek, termasuk adanya kemungkinan banyak yang akan bermigrasi ke 3 kl. Sementara itu, dalam acara Pertamina Days yang akan berlangsung hingga 30 September 2012, nuansa bisnis migas yang ramah lingkungan mewarnai Atrium Sun Plaza Medan, serta menampilkan miniatur proses bisnis migas dari awal pencarian minyak mentah hingga pemasaran produk akhir. Juga ada permainan digital interaktif tiga dimensi atau Augmented Reality, sudut konsultasi berkarier di Pertamina (HR Corner), Program Corpo-

rate Social Responsibility Pertamina, pengenalan produk, talkshow dan temu pelanggan, menampilkan mobil GP2 milik Rio Haryanto, serta beragam kegiatan menarik lainnya. Pada kesempatan itu, Ali Mundakir, menyampaikan kegiatan tersebut mengedukasi dan berdialog langsung dengan masyarakat untuk menunjukkan semangat Pertamina yang terbarukan dan bersahabat dengan bumi. Sementara itu, Staf Ahli Ekonomi dan Keuangan Provsu Hj Sabrina, berharap Pertamina harus tetap eksis dan berjalan mengikuti perkembangan, sehingga mampu menghadapi persaingan demi kemajuan perusahaan dan bangsa. Sebagai salah satu BUMN yang sehat, Pertamina dituntut terus bekerja keras meningkatkan pelayanan di sektor energi, seperti penyediaan bahan bakar minyak, elpiji, pelumas dan lainnya yang hemat dan ramah lingkungan. (m41)

“Saat panen, pinggir pematang kerap longsor,” katanya. Berbeda dengan Iskandar Makti. Ia mengaku, walaupun usaha tambaknya berkali-kali gagal panen karena serangan virus, tapi masih tetap berusaha dan bertahan menjadi petani tambak. Tapi dia tidak lagi membudidayakan udang karena terlalu berisiko. Dia mengalihkannya pada mudidaya ikan rambeu.

Keuchik Gampong (Kepala Desa) Lampaseh Syahrul Nagor, kepada Waspada mengakui, saat ini banyak tambak warga desanya yang tidak dimanfaatkan lagi. Sebelumnya, 60 persen warganya berprofesi sebagai petani tambak. ‘’Tapi kini sudah banyak yang berhenti karena tidak sesuai lagi antara modal dikeluarkan dengan pendapatannya,’’ kata Syahrul Nagor.(b09)


Vice President Corporate Communication PT Pertamina (Persero) Ali Mundakir (kanan) bersama Staf Ahli Ekonomi dan Keuangan Provsu Hj Sabrina, melihat miniatur proses bisnis migas dari awal pencarian minyak mentah hingga pemasaran produk akhir dalam acara Pertamina Days, di Atrium Sun Plaza Medan, Kamis (27/9).

Delapan Tahun Pasca Tsunami DPRDSU Minta Register 40 Dikelola PT Perkebunan Tambak Masih Telantar

Daftar Harga Bahan Pokok Di Medan, Kamis (27/9) -Beras IR 64 -Beras Ramos -Beras Kuku Balam -Beras Kita -Beras Aceh -Minyak Goreng Kuning -Minyak Goreng Tropical -Minyak Goreng Bimoli -Daging Sapi -Daging Ayam -IKan Teri Belah -Ikan Teri Nasi Jumbo -Ikan Teri Medan -Ikan Asin Kakap -Ikan Asin Senangin -Ikan Asin Kepala Batu -Ikan Asin Gabus -Gula Merah Aren -Tepung Terigu Biasa -Tepung Terigu Bogasari -Kacang Tanah -Kacang Hijau -Telur Ayam Ras -Telur Ayam Kampung -Telur Bebek -Telur Puyuh -Cabai Merah -Cabai Rawit -Cabai Hijau -Bawang Merah -Bawang Putih -Gula Pasir -Daging Sapi -Ikan Tongkol -Ikan Dencis -Ikan Mujair -Ikan Kakap

: Rp8.500 per kg : Rp9.500 per kg : Rp9.500 per kg : Rp8.000 per kg : Rp8.000 per kg : Rp10.500 per kg : Rp24.000 per 2 Liter : Rp24.000 per 2 Liter : Rp75.000 per kg : Rp15.000 per kg : Rp80.000 per kg : Rp65.000 per kg : Rp60.000 per kg : Rp70.000 per kg : Rp85.000 per kg : Rp45.000 per kg : Rp60.000 per kg : Rp20.000 per kg : Rp6.700 per kg : Rp7.000 per kg : Rp18.000 per kg : Rp13.000 per kg : Rp900 : Rp2.000 : Rp1.700 : Rp350 : Rp16.000 per kg : Rp24.000 per kg : Rp13.000 per kg : Rp15.000 per kg : Rp18.000 per kg : Rp13.000 per kg : Rp75.000 per kg : Rp25.000 per kg : Rp20.000 per kg : Rp20.000 per kg : Rp30.000 per kg

541.000 523.000 385.000 275.000



Nilai Mata Uang Rupiah Terhadap Mata Uang Asing Mata Uang




Dolar AS Dolar Singapura Dolar Australia Euro Eropa Yen Jepang Dolar Hongkong Ringgit Malaysia Rial Saudi Arabia Poundsterling Inggris


9.600 7.808 9.974 12.349 123,54 1.238 3.110 2.559 15.532

9.615 7.821 9.999 12.373 123,78 1.240 3.127 2.564 15.559


MEDAN (Waspada) : Para pedagang emas di Medan memperkirakan harga logam mulia itu masih terus naik sampai beberapa hari ke depan. Meskipun begitu masih ada saja masyarakat membeli emas meski pergerakannya kecil. Kamis (27/9), Waspada mendatangi beberapa pedagang emas di Pasar Peringgan. Seorang pedagang Edi Suranta, mengatakan harga emas cenderung fluktuatif dalam beberapa pekan terakhir ini, dengan kecenderungan bertahan di harga Rp500.000 per gram. Kondisi ini diakuinya mempengaruhi perdagangan emas di Kota Medan. Dengan harga emas yang tinggi itu, kata Edi Suranta, merangsang masyarakat untuk menjual emasnya. Pada beberapa hari terakhir ini, banyak masyarakat datang ke toko emas untuk menjual logam mulia mereka. ‘’Itu sudah biasa. Kalau harga lagi tinggi, masyarakat menjual kembali emasnya,’’ kata Edi. Namun begitu, walau harga tinggi, tapi ada juga masyarakat yang membeli emas, walaupun jumlahnya tidak banyak. Edi Suranta, memperkirakan hanya lima persen. Kata Edi, emas batangan sekarang dibuka dengan harga Rp 541.000 per gram. Harga ini naik Rp 1.000 per gram dibanding pada harga penutupan Senin (24/9). Yakni Rp 540.000 per gram. Menurutnya, naiknya harga emas disebabkan nilai tukar rupiah terhadap mata uang Amerika Serikat saat ini turun di posisi Rp 9.575. Edi, juga menyebutkan kenaikan harga emas yang telah menembus titik tertinggi sepanjang tahun ini telah mendorong peningkatan harga emas perhiasan. Emas 22 karat dijual Rp523.000 per gram. Emas 18 karat naik dari Rp397.875 menjadi Rp406.125 per gram. Sementara itu, emas 17 karat naik dari Rp379.050 jadi Rp385.000 per gram. Meskipun begitu, di tengah tingginya harga emas ini, penjualan emas perhiasan masih relatif tinggi, yakni sekitar 30 persen. ‘’Mungkin karena pola investasi masyarakat di Medan yang masih suka berinvestasi di perhiasan, maka penjualan emas masyarakat pun ikut naik,’’ ujarnya. (cdu)

Pemkab Bener Meriah Cetak Sawah Baru

Harga Emas London Murni (LM) Emas 22 Karat (97%) Emas 17 Karat (70%) Suasa

Harga Emas Masih Terus Naik

*) Kurs dapat berubah sewaktu-waktu Sumber: PT Bank Mandiri (Persero)

REDELONG (Waspada): Sekretaris Daerah (Sekda) Bener Meriah T. Islah, meninjau lokasi percetakan sawah baru di tiga lokasi pada daerah Kemukiman Samar Kilang, Kec. Syiah Utama, Rabu ( 26/9). Itu merupakan program percetakan sawah baru yang dikelola kelompok tani didampingi tim teknis dari Dinas Pertanian dan Tanaman Pangan Bener Meriah. Kegiatan ini merupakan progrm nasional yang pembiayaannya dari APBN melalui program Bansos RI. Sekda T.Islah, kepada Waspada mengatakan, pencetakan sawah baru itu merupakan upaya pemerintah untuk memperluas lahan persawahan guna mencukupi kebutuhan pangan masyarakat. Sekarang ini lahan sawah semakin menyempit akibat alih fungsi berbagai kebutuhan, seperti perluasan pemukiman penduduk, ruas jalan serta untuk lahan pertanian lainya. Pemkab Bener Meriah pada tahun 2011-2012 mengakomodir upaya perluasan areal persawahan oleh pemerintah pusat melalui program Bansos RI di Kec. Syiah Utama seluas 300 hektare. Percetakan lahan sawah itu dikerjakan secara bertahap. Tahun 2011 seluas 100 hektare di Kampung Rusip kawasan Bontok dan tahap kedua tahun 2012 seluas 200 hektare di tiga lokasi, Samar Kilang, Kec. Syiah Utama, Kab. Bener Meriah. Salah seorang tokoh masyarakat Kemukiman Samar Kilang, Ahmadi, mengaku sangat bersyukur atas perhatian pemerintah. Dengan program ini makan akan menjadikan kawasan kemukiman Samar Kilang sebagai lumbung padi di Bener Meriah di masa mendatang. Diungkapkannya, Kemukiman Samar Kilang selama ini menjadi daerah terisolir. Diharapkan dengan dijadikannya sebagai lumbung padi, ke depan daerah yang memiliki potensi luar biasa ini akan lebih maju lagi. Untuk saat ini, ujar Ketua KIP Bener Meriah itu, masyarakat mengharapkan pemerintah provinsi mempercepat pembangunan ruas jalan menuju kemukiman yang hingga kini belum sepenuhnya menikmati jalan aspal.(b33)

MEDAN (Waspada): DPRD Sumatera Utara minta pemerintah pusat memberikan hak pengelolaan perkebunan kelapa sawit kawasan hutan Register 40, di Kab. Padang Lawas (Palas) kepada PT Perkebunan. Ketua Komisi A DPRD Sumut Isma Padli Pulungan, berbicara kepada wartawan di gedung dewan, Rabu (26/9). Dia mengomentari tentang keberadaan kebun kelapa sawit bermasalah di hutan Resiter 40 tersebut. Menurut Isma Padili, PT Perkebunan sangat layak diberikan hak pengeloaan perkebunan itu. Alasannya, selain perusahaan itu merupakan Badan Usaha Milik Daerah (BUMD)

Pemprovsu, juga karena letak hutan Register 40 itu di Sumut. ‘’Dengan pengelolaannya dilakukan oleh PT Perkebunan, maka dapat memajukan perekonomian dan sosial budaya di daerah ini. Terkait bagaimana sistem pengelolaan yang akan dilakukan, kata Isma Padli, hal itu dapat dibahas secara teknis oleh instansi yang bersangkutan. ‘’Namun pada prinsipnya, karena lokasi kawasan hutan tersebut berada di Provinsi Sumatera Utara, kan alangkah lebih baik bila pe-ngelolaannya di serahkan saja kepada Pemprovsu sebagai perwakilan pemerintah pusat di daerah,’’ katanya.

Untuk mengetahui lebih lanjut tentang keberadaan perkebunan kelapa sawit di hutan Register 40 itu, dalam waktu dekat ini Komisi A berencana akan mengundang pihak terkait melakukan rapat dengar pendapat. Kata Isma Padli, seluruh komponen terkait, termasuk PT Inhutani dan PT Torganda, yang dinilai terlibat aktif dalam pengelolaan hutan register 40 tersebut akan diundang. Menurut Isma Padli, pihaknya mendengar kalau sekarang ini yang mengelola kebun sawit di hutan Register 40 itu adalah PT Inhutani. Yakni sesuai dengan SK No. 39/Menhut-IV/ RHS/2010. Dalam SK itu

pemerintah menunjuk PT Inhutani IV sebagai Badan Pengelola Sementera (BPS) perkebunana sawit hutan Register 40. Perkebunan kelapa sawit itu telah disita negara sesuai Putusan MA Nomor.2642K/ PID/pid/2006 tanggal 12 Februari 2007. Sejauh ini, kata politisi dari Fraksi Partai Golkar tersebut, pihaknya belum mengetahui secara detail apa alasan Menteri Kehutanan menyerahkan pengelolaan semua barang bukti berupa aset perkebunan kelapa sawit seluas 47.000 hektare di kawasan hutan register 40 Padang Lawas itu dikelola sementara oleh PT. Inhutani IV. (m12)

Badai Ancam Nelayan Melaut LHOKSEUMAWE ( Waspada): Badai yang terjadi dalam dua hari ini menyebabkan ratusan nelayan di Lhokseumawe dan sekitarnya tidak melaut. Akibatnya harga ikan di pasar melambung tinggi. Di Pantai Ujong Blang, seorang nelayan berusia 30 tahun, Piah, Kamis (27/9) mengatakan sore sebelumnya terlihat ombak yang besar menghantamhantam tanggul pemecah ombak. “Kita yang di darat saja merasa ketakutan. Angin telah menumbangkan beberapa pohon di dekat pantai,” katanya. Sejumlah penjual ikan yang biasanya mangkal di sepanjang

jalan Ujong Blang, mulai terlihat sepi. Hanya beberapa tempat saja terlihat dengan ikan yang sedikit. Beberapa pedagang ikan yang mendapatkan pasokan dari nelayan yang berhasil pulang dengan membawa tangkapan itu, terpaksa menaikkan harga, karena modal yang dikeluarkannya menjadi lebih besar. Pedagangkan kemudian menaikkan harga jualnya. Sebagian pedagang lainnya mendapatkan pasokan dari ikan tambak yang harganya juga naik akibat permintaan yang naik. Biasanya, kata Ilyas,45, seorang pedagang ikan, bila ikan laut tidak mencukupi, ikan-ikan

yang didangkap dengan menggunakan pukat darat bias membantu untuk menutupi kekurangan. Tapi sekarang, pukat darat pun tidak bisa bekerja. ‘’Airnya pasang dan ombaknya besar,” ujarnya. Memang pada petang itu tidak ada kegiatan anak-anak nelayan yang menarik pukat darat sebagaimana mereka lakukan bila hari menjelang siang. Ombak yang pasang tidak menyisakan ruang antara lidah ombak dan batu pemecah, tempat di mana pukat didaratkan. ‘’Karenanya mustahil menjerat ikan,’’ lanjut Ilyas.

Kendati demikian, di bawah langit yang mendung dan hari yang telah gelap dengan girimis yang mulai turun, dari pantai terlihat cahaya di kejauhan. Beberapa perahu ada juga yang bersikeras tetap melaut. Namun, tampaknya mereka saling menjaga jarak agar dapat menolong awak boat lain bila terjadi sesuatu. Para nelayan yang bersikukuh tetap berlayar juga sesungguhnya tidak berani meninggalkan pantai terlalu jauh. “Kalau badai datang secara tiba-tiba, semuanya dapat bergegas pulang. Dapat ataupun tidak dapat ikan,” sela Piah.(b14)

UKM Di Aceh Masih Hadapi Kendala Klasik BANDA ACEH (Waspada): Pengembangan Usaha Kecil dan Menengah (UKM) di Aceh masih menghadapi kendala klasik.Yakni lemahnya penguasaan teknologi, permodalan, akses informasi, pemasaran, dan regulasi atau perlindungan hukum. ‘’Di sisi lain masih terkendalanya pengembangan UKM adalah menyangkut belum tersedianya pasar yang jelas untuk pemasaran produk UKM,’’ ungkap Anwar, salah seorang pengamat ekonomi di Banda Aceh, Kamis (27/9). Padahal, kata Anwar, salah satu kunci keberhasilan UKM itu adalah tersedianya pasar yang jelas terhadap produk mereka. Kejelasan pasar itu seharusnya menjadi perhatian pemerintah, sehingga pelaku

UKM bisa mengembangkan usaha mereka. Ketua Kamar Dagang dan Industri (Kadin) Aceh, H. Firmandez, mengatakan setidaknya ada dua faktor internal dan eksternal yang membuat daya saing UKM lemah. Mereka tidak mampu bersaing dengan negara lain seperti Singapura, Malaysia, Thailand, Filipina, Hongkong, dan Taiwan. Yakni infrastruktur, kebijakan, pungutan, akses pasar, sistem pemasaran dan kelembagaan yang belum jelas. Kata Firmandez, pemerintah harus berperan aktif mendorong keberhasilan UKM. Lewat dinas terkait, pemerintah harus memperluas pasar dan melakukan koordinasi dengan kementerian atau lembaga terkait. “Gubernur harus

BNI Resmikan Kantor Kas Delitua DELITUA (Waspada): BNI KantorWilayah Medan kembali membuka kantor kas di wilayah Deliserdang di Jalan Besar Delitua, Kelurahan Delitua Induk, Senin (24/9). Tujuannya adalah untuk meningkatkan kinerja bisnis dan pelayanan terhadap nasabah. CEO BNI wilayah Medan Johnny R. Tampubolon, dalam sambutannya mengatakan bertumbuhnya kinerja bank dapat mempengaruhi pertumbuhan di daerah. Pihaknya merasa perlu membuka kantor di Kec. Delitua, karena daerah itu merupakan pusat perdagangan enam kecamatan, diantaranya Kec. Delitua, Patumbak, Namorambe, STM Hilir dan Biru-biru. “Saat ini bank terus berusaha mendekatkan diri dengan

para nasabah, dan kehadiran BNI di Delitua atas permintaan nasabah,” ungkapnya. Johnny, berharap keberadaan BNI di Delitua dapat mengembangkan potensi ekonomi dengan memberikan pelayanan terbaik bagi para nasabah. Sementara itu, Bupati Deliserdang Amri Tambunan, mengharapkan BNI dapat memberikan manfaat dan mendorong kemajuan usaha, terutama saha kecil dan menengah. “Kemajuan daerah ditentukan seberapa besar kebersamaan dalam membangun dan kehadiran BNI ini diharapkan dapat memberi kontribusi bagi pertahanan ekonomi daerah,” kata Bupati. (c02)

secapat-nya mengganti kepala dinas terkait, apabila mampu bekerja optimal dalam mengembangkan perekonomian rakyat,’’ katanya. Diakui Firmandez, selama ini banyak keluhan pelaku UKM menghadapi faktor eksternal yang mengoyahkan kemampuan melanjutkan usahanya. Pelaku UKM masih mengandalkan pemerintah untuk menciptakan kreativitas inovasi. Direktur UKM Center Unsyiah Banda Aceh Iskandar Madjid, mengatakan kelemahan mendasar dihadapi UKM dalam bidang pemasaran adalah orientasi pasar yang rendah.

Mereka juga lemah dalam persaingan dan tidak memadainya infrastruktur pemasaran, serta lemahnya dukungan pemerintah. Kata Iskandar, UKM kurang mendapat perhatian pemerintah maupun pemegang otoritas modal yakni perbankan. Keluhan yang terdengar dari pelaku UKM selama ini adalah sulitnya mereka meraih akses fasilitas perdagangan, prosedur yang ruwet serta kurangnya informasi dan mahalnya biaya harus dikeluarkan. ‘’Pemerintah lebih memberikan dukungan kepada pengusaha sudah mapan (besar), “ sebutnya. (b09)

Kawasaki Kebanjiran Order JAKARTA (Waspada): Produsen motor Kawasaki kebanjiran order (pesanan) untuk jenis motor sport ber cc besar. Berdasarkan Surat Permintaan Order (SPO), saat ini, pesanan untuk Kawasaki Ninja 250 injection standar dan Ninja 250 ABS mencapai sekitar 2.500 unit. Manager Marketing & Promosi PT Kawasaki Motor Indonesia (KMI) Freddyanto Basuki, berbicara kepada Waspada di sela peluncuran Kawasaki Ninja 250 ABS di Jakarta, pekan kemarin. Katanya, dari jumlah pemesanan ini, 65 persen berasal dari pemesanan Ninja 250 injection atau standar. Sisanya untuk jenis 250 ABS. Menurutnya, jangka waktu inden untuk jenis Ninja 250 Injection dan 250 ABS memakan waktu dua bulanan. ‘’Prosesl inden ini diusahakan agar dapat secepatnya terlayani,’’ tutur Freddy. Dari tingginya permintaan sepeda tersebut, pihak Kawasaki memperluas pabriknya di Cibitung, Jawa Barat. Perluasan

pabrik ini menelan total investasi sebesar Rp 600 miliar. Nantinya pabrik ini mampu memproduksi secara keseluruhan jenis produk sepeda motor Kawasaki sebanyak 140.000 unit per tahun dari sebelumnya hanya 100.000 unit. Disebutkan Presiden Direktur PT KMIYoshihiro Tanigawa, tidak tertutup kemungkinan Indonesia akan menjadi basis produksi Kawasaki untuk wilayah ASEAN. ‘’Atau juga tipe dan jenis sepeda motor yang dijual di Thailand tidak sama dengan tipe sepeda motor yang dipasarkan di Indonesia,’’ tuturnya. Untuk saat ini, lanjut Tanigawa, sepeda motor Kawasaki yang diproduksi di Indonesia tidak saja untuk memenuhi kebutuhan pasar lokal, tetapi juga untuk keperluan ekspor di beberapa negara. Dalam pemasaran diperkirakan Kawasaki Ninja 250 ABS bakal dipatok pada kisaran harga Rp 56,9 juta, dengan dua pilihan warna Line Green plus Ebony dan Passion Red plus Stardust White. (J03)


B6 BLANGPIDIE (Waspada) : Puluhan warga yang bermukhim di Perumnas Babahlhok Kecamatan Blangpidie Kabupaten Aceh Barat Dayamengeluh. Pasalnya penyaluran air bersih ke perumahan mereka diputuskan sepihak oleh pihak pengelola, akibatnya warga tidak bisa lagi mengkonsumsi air bersih sejak sepekan lalu. Muhajam, warga setempat kepada Waspada Rabu (26/9) mengungkapkan pemutusan air bersih ke kompleks Perumnas Babahlhok sudah terjadi beberapa hari yang lalu, pihak pengelola menurutnya beralasan pemutusan itu disebabkan karena pelanggan menunggak dalam pembayaran rekening air bersih. “Seharusnya pihak pengelola jangan main putus saja, ditegur dulu lah, padahal rata-rata pelanggan di kompleks ini tunggakannya belum seberapa, masih hitungan bulan, kalau saudara cek ke lokasi lain tunggakannya ada yang sudah lebih dari 2 tahun,”ungkapnya. Kepala Bidang Cipta Karya Dinas Pekerjaan Umum Abdya Firmansyah, ST dihubungi Waspada terpisah menolak memberi komentar dengan alasan kurang mengetahui permasalahan. Sementara itu, Afrida Surya ST, Kepala UPTD SPAM Abdya dihubungi Waspada melalui ponselnya mengatakan kebijakan pemutusan saluran air ke rumah warga diambil pihaknya karena keringanan dalam membayar tunggakan rekening air yang diberikan kepada warga tidak pernah diselesaikan, padahal keringanan yang diberikan sudah melebihi dari 2 bulan. (b08)

REDELONG (Waspada): Musibah kebakaran melanda Dusun I, Kampung Meriah Jaya, Degol, Kecamatan Gajah Putih, Kabupaten Bener Meriah, Rabu (26/9) sekira pukul 09:00. Sekitar sembilan rumah warga di daerah itu, hangus terpanggang sementara tujuh unit lainnya rusak terkena imbas kebakaran. Kerugian yang diderita mencapai angka ratusan juta rupiah lantaran banyak harta benda milik korban yang tidak berhasil diselamatkan. Menurut penuturan saksi mata warga setempat, api berasal dari salah satu rumah milik Ngademin warga di Dusun I Kampung Meriah Jaya. Ketika itu, rumah tersebut dalam keadaan kosong sehingga diketahuinya terjadi kebakaran ketika api sudah mulai membesar. Sementara itu, Camat Gajah Putih Rizwanuri yang dihubungi Waspada, Rabu (26/9) sore, mengatakan, akibat musibah kebakaran itu, tercatat sekitar sembilan unit rumah warga di Dusun I, Kampung Meriah Jaya, Degol, hangus terbakar dan tujuh unit lainnya rusak ringan. “Saat ini, sebagian korban ada yang mengungsi ke kantor gecik dan beberapa Kepala Keluarga (KK) lainya, ditampung dirumah sanak famili mereka,” jelas Rizwanuri. Dikatakan, paska kejadian pihak Pemerintah Kabupaten Bener Meriah, langsung menyerahkan sejumlah bantuan berupa, dana masa panik, sembako, dan beberapa perlengkapan lainnya. (b33)

Wabup Agara Lepas Mahasiswa Tiga PTS Kemah Kerja Bakti KUTACANE (waspada) : Wakil Bupati Aceh Tenggara, H Ali Basrah, SPd.MM, Kamis (27/9) melepas seratusan mahasiswa dari berbagai perguruan tinggi swasta mengikuti Kemah Kerja Bakti Mahasiswa (KKBM) Lingkungan Kopertis Wilayah I NADSumut tahun 2012 . Acara pelepasan KKBM 100 mahasiswa terdiri dari 70 putra dan 30 putri di Aula Universitas Gunung Leuser (UGL) Kutacane, dihadiri Drs Margono, MM, dari kopertis wilayah I NAD – Sumut, Rektor UGL Prof Hasnudi,MS, para Dekan lingkup UGL, Ketua STIKES, Direktur Akbid Nurul Hasanah serta kepala SKPK. Dan Kegiatan KKMB ini diikuti civitas akademik UGL, Yayasan Nurul Hasanah, serta STIKES Pemda. Dijadwalkan para mahasiswa mengikuti KKBM selama satu minggu di Desa Kuta Ujung, Kecamatan Darul Hasanah. Prof Dr Ir Hasnudi,MS, Rektor UGL dalam sambutanya mernyampaikan, kegiatan KKBM yang dilaksanakan PTS (perguruan tinggi swasta) Agara, merupakan bagian dari menempa kesadaran mahasiswa untuk peka terhadap kehidupan rakyat. Jamanuddin,MAP, ketua panitia KKBM dalam laporanya di hadapan pengurus kopertis wilayah I NAD – Sumut, selain soal rangkaian kegiatan para mahiswa KKBM yakni melakukan bedah rumah, memfasilitasi sarana pendidikan, penyuluhan pertanian , pembagian bibit bagi warga, penyuluhan kesehatan, juga melaksanakan kegiatan penghijauan. Juga disampaikan tentang dua PTS lainya di Agara, yakni Sekolah Tinggi Ilmu Keguruan Usman Safri dan Akbid Alas Medika, tidak mengirimkan mahasiswa mereka untuk ikut KKBM tanpa pemberitahuan meski telah disurati oleh panitia. Wabup Agara, Ali Basrah, dalam sambutanya mengapresiasi kegiatan KKBM yang digelar oleh PTS wilayah I NAD-Sumut se-Agara ini. Ali Basrah mengatakan, Pemkab Agara berjanji akan lebih serius memperhatikan serta membangun UGL menjadi lebih baik lagi didalam kepemimpinan lima tahun ke depan. Kepada mahasiswa yang mengikuti KKBM disampaikan agar membantu kerja Pemerintah daerah untuk mensosialisasikan bahaya mengunakan narkoba bagi masyarakat pasalnya narkoba bukan hanya berdampak menghancurkan bagi si pemakai, tetapi bisa menghancurkan desa, kecamatan, kabupaten bahkan seluruh negara. Wabup Ali Basrah, mengatakan, kepemimpinan Bupati Hasanuddin, B, dan Ali Basrah, lima tahun kedepan sesuai visi dan misi mereka saat kampanye lalu, yakni atas nama pemerintah daerah, mereka komit memprogramkan bantuan beasiswa bagi mahasiswa kategori miskin tetapi memiliki prestasi akademik, akan dibantu biaya kuliahnya. (b25)

Elemen Sipil Dukung Bupati Rocky IDI (Waspada): Lembaga Swadaya Masyarakat, Acheh Future, mendukung sikap tegas Bupati Aceh Timur, Hasballah M Thaib alias Rocky, yang belakangan gencar menegakkan kedisiplinan pegawai di lingkungan Pemkab Aceh Timur. “Itu langkah bagus. Semakin disiplin pegawai, otomatis pelayanan kepada masyarakat juga akan semakin bagus,” kata Ketua Pusat Acheh Future, RazaliYusuf, kepada Waspada, Kamis (27/9). Namun demikian, sambung Razali, ketegasan bupati seperti itu harus kontinu an berlaku menyeluruh untuk semua satuan kerja perangkat daerah (SKPD). “Kalau kata orang Aceh. Bek lage su um ek manok. Artinya, penegakan disiplin pegawai harus terus dipantau, supaya kinerja seluruh SKPD ke depan semakin bagus. Dan yang terpenting lagi, bupati jangan sampai pilih kasih. Semua SKPK harus diperlakukan sama,” tandas Razali. (b19/b24)


SEJUMLAH warga mengambil cairan mirip minyak dari saluran irigasi di Desa Ampeh, Kec. Tanah Luas, Aceh Utara, Kamis (27/9). Cairan ini diduga limbah Exxon Mobil.

Air Irigasi Desa Ampeh Bercampur Minyak Diduga Tercemar Limbah Exxon LHOKSUKON (Waspada): Air saluran irigasi di Desa Ampeh, Kec. Tanah Luas, Aceh Utara, sejak Kamis (27/ 9) pagi, sekitar pukul 07:00, dilaporkan berubah warna seperti bercampur minyak. Penyebabnya diduga karena tercemar limbah Exxon Mobil. Sebab, irigasi itu mengitari kawasan Cluster II hingga Point A. Namun pihak Exxon sendiri menyatakan belum tentu limbah itu dari Exxon. “Saya sudah mengambil minyak itu. Setelah menyortir sejak pagi, kurang lebih terkumpul sekitar 40 liter. Lumayan, bisa untuk memasak,” kata Kahtijah, 50, ibu rumah tangga warga Desa Ampeh, kemarin. Khatijah menambahkan, selain dirinya, puluhan warga lain juga mengambil minyak dari saluran irigasi tersebut.“Da-

lam waktu sekitar 3 jam, masing-masing warga berhasil mengumpulkan sedikitnya 40 liter minyak,”tambahnya. Kepala Desa Ampeh, Dahlan, secara terpisah menyebutkan, setelah mengetahui ada cairan yang diduga minyak dalam saluran irigasi, pihaknya langsung memberitahukan staf humas Exxon Mobil. “Tujuannya, supaya mereka bisa mengecek langsung ke lapangan sekaligus memastikan sumber cairan tersebut. Sebab, banyak warga mencurigai itu limbah buangan dari Exxon. Warga juga khawatir, cairan itu mengalir ke sawah, lalu membuat padi mereka mati,” pungkas Dahlan. Belum Tentu Limbah Exxon Humas Exxon Mobil, Armia Ramli, membenarkan pihaknya sudah menerima laporan soal adanya cairan mirip minyak

dalam saluran irigasi Desa Ampeh. Tim Exxon, kata Armia, juga sudah turun ke lapangan untuk mengecek cairan itu. Namun sumbernya masih diteliti. “Meski dekat Exxon, belum tentu air irigasi itu tercemar limbah Exxon. Apalagi, selama ini kita tidak pernah membuang apapun dalam saluran irigasi,” kata Armia Ramli. Sementara Kepala Kantor Lingkungan Hidup Aceh Utara, Nuraina, secara terpisah, menjelaskan, pihaknya juga sudah menurunkan tim untuk memeriksa cairan mirip minyak dalam saluran irigasi Desa Ampeh. “Itu memang jenis minyak dan kemungkinan besar termasuk bahan berbahaya dan beracun (B3). Potensi pencemaran lingkungan cukup tinggi. Namun untuk memastikan jenisnya perlu kita uji dulu di laboratorium. Sampelnya sudah kita ambil,” kata Nuraina. (b19)

6 Kecamatan Di Aceh Utara Tak Miliki e-KTP LHOKSEUMAWE (Waspada): Enam dari 27 kecamatan di Aceh Utara belum miliki KTP elektronik (E-KTP). Kendati, masa berlaku KTP non elektronik sampai Desember 2012. Sementara realisasi pendistribusian E-KTP di Aceh Utara baru 151.103 jiwa (37,04 persen). Kepala Bidang Pendataan Penduduk Disdukcapil Aceh Utara, Muslim kepada Waspada, Kamis (27/9) mengatakan,di Aceh Utara terdapat enam kecamatan lagi menerima E-KTP. Kecamatan ini meliputi Baktiya, Baktiya Barat, Cot Girek, Sa-

wang, Seunuddon dan Syamatalira Aron. Kendalanya belum diketahui, karena sampai saat ini seluruh data sudah masuk ke Perum Percetakan Negara RI yang dicetak oleh Konsorsium PNRI. Dan, pihaknya berencana akan ke Jakarta untuk memastikan pada Senin mendatang. “Kami akan ke Jakarta memastikannya, karena deadline KTP non elektronik sampai 31 Desember 2012 sesuai dengan Peraturan Presiden nomor 67 tahun 2011,” ucap Muslim. Pun demikian, masih ba-

nyak kecamatan lain yang belum sepenuhnya terdistribusi E-KTP. Dari 407.982 jumlah penduduk Aceh Utara yang wajib KTP, baru terealisasi 238.121 (58,37 persen), pendistribusian di kecamatan 151.103 (37,04 persen) dan sisa 169.861 (41,63 persen). Sedangkan enam kecamatan ini, belum memiliki satu E-KTP pun. Sementara, Muslim mengakui masih banyak e-KTP di Aceh Utara yang salah data. Pun demikian kesalahan ini akan diperbaiki sebelum 2013 ini. (cmk)

Dua Pendonor 100 Kali Diboyong Ke Istana LHOKSEUMAWE (Waspada): H. Rochandiono, mantan karyawan PT. Asean Aceh Fertilizer (AAF) dan Samsul Anwar, mantan karyawan pensiunan PT Arun akan segera diundang ke istana negara untuk mengambil penghargaan dari Presiden Soesilo Bambang Yudhoyono, karena telah mendonorkan darahnya sebanyak 100 kali. Hal itu terungkap pada saat perayaan hari jadi PMI yang ke-67. “Ya...dalam waktu dekat, mereka diundang ke Jakarta untuk mengambil penghargaan dari Presiden SBY di Istana. Pemberian penghargaan kepada pendonor 100 kali merupakan agenda rutin tahunan. Para

pendonor tersebut dinilai telah ikut peduli terhadap kegiatan sosial melalui donor darah,” kata Ismed AJ Hasan, Ketua PMI Aceh Utara didampingi Agustiar, Humas, Kamis (27/9) di halaman Kantor Bupati Aceh Utara usai apel HUT PMI ke-67. Sedangkan Heryadi, pendonor 50 kali, Safrizal 25 kali donor dan Deliana 10 kali donor masing-masing diberikan sertifikat penghargaan dari PMI Aceh Utara. Sertifikat diserahkan oleh Drs. Muhammad Jamil, M.Kes dan Danrem 011/LW usai apel. Untuk memperingati hari jadinya, PMI Aceh Utara bekerjasama dengan Pemkab Aceh Utara melaksanakan kegiatan

donor darah massal di halaman kantor bupati setempat. Pada kesempatan itu PMI berhasil mengumpulkan sebanyak 86 kantong darah. Ismed AJ Hasan menilai, sedikitnya jumlah darah yang berhasil dikumpulkan di kalangan PNS karena kesadaran untuk mendonor masih kurang. Padahal, jumlah pegawai di lingkungan Pemkab Aceh Utara mencapai 12 ribu orang. “Kalau saja ada pegawai yang rela mendonorkan darahnya 1000-an kantong saja sudah cukup membantu karena kebutuhan darah sangat banyak. Pasalnya, PMI Aceh Utara membantu darah hingga ke Takengen,” katanya. (b18)

Nasir Djamil Dirotasi Ke Komisi Agama JAKARTA (Waspada): Wakil Ketua Komisi III DPR M Nasir Djamil dipindahkan ke Komisi VIII yang salah satunya membidangi masalah agama. “Sertijabnya pada Senin depan. Efektifnya mulai rapat di KomisiVII pada masa sidang mendatang sekitar Desember 2012,” sebut Nasir kepada Waspada, Kamis (27/9). Nasir menyebutkan, posisinya ditempati oleh Al Muzamil Yusuf yang sekarang anggota Komisi I. Disebutkan, Muzamil pernah di Komisi III. Kader PKS asal Aceh ini menjelaskan, rotasi ini sesuatu yang wajar. “Saya juga ditempatkan sebagai anggota Badan Urusan Rumah Tangga,” sebut alumni IAIN Ar-Raniry Banda Aceh ini. Sebagaimana diketahui, Nasir baru beberapa bulan menjabat Wakil Ketua Komisi III yang berhubungan dengan keamanan dan politik. Sedangkan di Komisi VIII meliputi agama, sosial, dan pemberdayaan perempuan. Mitra kerjanya Departemen Agama, Departemen Sosial, Menteri Negara Pemberdayaan Perempuan, Komisi Perlindungan Anak Indonesia, Badan Nasional Penanggulangan Bencana dan Badan Amil Zakat Nasional. (cmh)

Jumat 28 September 2012

Pemko Banda Aceh Bertanggungjawab Letakkan Dasar Kehidupan Islami

SPAM Abdya Putuskan Saluran Air Warga

Sembilan Rumah Hangus Di Digul


Waspada/Maimun Asnawi

DRS Muhammad Jamil, M.Kes,Wakil Bupati Aceh Utara, Danrem 011/LW Kolonel A. Rachim Siregar dan Komandan Kodim 0103 Aceh Utara, Kamis (27/9) sedang mengisi formulir untuk mendonorkan darah mereka dalam acara peringatan hari jadi PMI ke-67.

BANDA ACEH(Waspada): Walikota Banda Aceh Mawardy Nurdin menegaskan, Pemko Banda Aceh bertanggungjawab untuk meletakkan dasar kehidupan masyarakat yang islami dan meletakkan dasar pemahaman aqidah dan akhlak kepada seluruh generasi muda di kota ini, yang akan melanjutkan estafet pembangunan di masa akan datang. “Kami menyadari hal ini lebih kompleks ketimbang sekadar melakukan pembangunan fisik,” ujar Mawardy, ketika membuka Seminar Internasional Banda Aceh Model Kota Madani, di Aula Balai Kota, Kamis (27/9). Dikatakan, banyak aspek yang terkait erat dengan pelaksanaan syariat islam secara kaffah. Dan seminar ini sebagai langkah mencari frame work untuk mewujudkan visi dan misi Pemko Banda Aceh lima tahun mendatang. “Sejarah mengajarkan kepada kita kebesaran kita sebagai bangsa akan bisa terwujud dengan menegakkan nilai-nilai syariat dalam masyarakat,” ungkap Mawardy. Menurut Mawardy, kita perlu mendakwahkan Islam kepada setiap manusia, kepada ahli maksiat agar bertaubat dan kepada orang mu’min agar mantap dan meningkatkan imannya. Kita adalah juru dakwah bagi agama ini dengan menyampaikan berita gembira sekaligus ancaman, ujarnya. Sementara itu, keynote Speaker yang dijadwalkan dalam seminar ini, Menteri Besar (Gubernur) Negeri Kelantan Tuan Guru Dato’ Bentara Setia Haji Nik Abdul Aziz bin Nik Mat batal datang, karena dilaporkan sedang sakit. Nik Abdul Aziz bin Nik Mat digantikan oleh Tuan Guru Dato’ Taqiyuddin bin Hasan Ahli Exco (Menteri Pariwisata) Negeri Kelantan, Malaysia. Dalam penyampaiannya, Taqiyuddin mengatakan, antara Kelantan dan Aceh ada kesa-

maan yakni sama-sama digelar dengan serambi Mekkah. Kelantan yang berpenduduk 1,5 juta, itu juga dinamakan dengan “Darul Naim”, sebagaimana Aceh juga disebut dengan Darussalam. Kata dia, sejak tahun 1990, Kelantan telah diperintah oleh Partai Islam Se Malaysia (PAS) dan sebagai sumber rujukannya adalah Alquran, Sunnah dan Qias. Adapun yang menjadi tokohnya adalah Nik Abdul Aziz yang kini telah berumur 83 tahun. Beliau telah dipilih oleh rakyat dan Sultan Kerajaan Kelantan, ujar Taqiyuddin. Menurutnya, kota madani sebagai model kerasulan yakni kota yang mempunyai tiga hubungan yaitu hubungan manusia dengan Allah SWT, hubungan antara manusia dengan manusia dan hubungan manusia dengan lingkungannya. Disamping itu, bandar islami, itu juga harus mempunyai tiga konsep yaitu Alquran, Al-Sunnah dan Al-Iman,” papar Taqiyuddin, seraya menjelaskan satu persatu maknanya. Seminar sehari, itu juga menampulkan nara sumber Ir Tarmizi A Karim. M.Sc Dirjen Pemberdayaan Masyarakat dan Desa Kementerian Dalam Negeri RI dengan tema”Konsep Madani Dalam Tatanan Pemerintahan Daerah.” Prof DR Al-Yasa’ Abubakar,MA Guru Besar Ilmu Fiqh IAIN Ar-Raniry dengan tema “Aktualisasi Syariat Islam Dalam Bentuk Kota Madani (Dulu Kini dan Nanti). Prof Dr Syahrizal Abbas,MA, Pembantu Rektor IV IAIN Ar-Raniry, dengan tema “Arah Kebijakan Pemerintah Daerah Dalam Perspektif Hukum Nasional.” Sedangkan pembanding Prof Drs Yusny Saby, MA, PhD, Guru Besar Ilmu Pemikiran Islam IAIN Ar-Raniry Banda Aceh. Seminar itu dilanjutkan dengan tanya jawab, dengan moderator Mawardi Ismail,SH.MH, pakar hukum dan Pemerintahan Aceh. (b02)

Seorang Pria Dan 41 Wanita Terjaring Razia WH INGIN JAYA (Waspada): Sebanyak 41 orang wanita dan 1 orang lelaki terjaring dalam razia Polisi Syariat Islam (Wilayatul Hisbah) yang digelar di Desa Meunasah Manyang, Kec. Ingin Jaya, Kamis (27/9). Razia yang digelar sekira 2 jam itu juga diwarnai insiden terjatuhnya seorang ibu yang mengendarai sepeda motor karena berusaha menghindar razia petugas. Usai didata seluruh pelanggar akhirnya dilepas. Pantauan Waspada, razia penegakkan qanun (peraturan daerah) No 11 tahun 2002 tentang ibadah, aqidah dan syiar Islam yang digelar mulai pukul 10:00, juga melibatkan Polisi Lalu Lintas dan Polisi Militer. Petugas menghentikan seluruh pengendara yang dinilai tidak berpakaian sesuai syiar islam. Selain tidak menutup kepala, mereka yang terjaring umumnya mengenakan pakaian ketat meski mengenakan penutup kepala, dan mengenakan celana pendek bagi kaum laki-laki.

Mereka yang terjaring langsung didata petugas dan diberi pengarahan kemudian diperkenankan melanjutkan perjalanannya. Kepala Seksi Penegakan Pelanggaran pada Satpol Pamong Praja danWilayatul Hisbah Aceh Samsuddin mengatakan, selama razia pakaian dilakukan, pelanggar syariat Islam di Aceh terus berkurang. Dikatakan, polisi syariat akan terus melakukan razia hingga pelanggar syariat di Aceh benar-benar hilang. “Sejak Januari hingga September kami terus rutin melakukan razia dan mudah-mudahan jumlah pelanggar semakin berkurang,” kata Samsuddin. Untuk menekan angka pelanggar syariat Islam lanjut Samsudin, pihaknya juga akan menggelar razia di kafé-kafé dan tempat-tempat wisata, selain razia di jalan. “Jika dilokasi kita temukan ada pelanggaran tetap kita proses sesuai ketentuan yang ada,” pungkasnya. (cb06)

Prajurit Yonif 115/ML Ikuti UST MANGGAMAT, Aceh Selatan (Waspada): Komandan Korem (Danrem) 012/ Teuku Umar, Kolonel Inf Deddy Estoe Widodo S.IP, selaku Komandan Latihan (Danlak) bersama rombongan, Rabu (26/9) turun langsung ke komplek Pusat Latihan Tempur (Puslatpur) TNI, di Gampong Lawe Meulang, Kemukiman Meunggamat, Kecamatan Kluet Tengah, Kabupaten Aceh Selatan. Kehadiran Danrem 012/TU didampingi Dandim 0107/Aceh Selatan, Letkol Inf Saripuddin, SIP menghadiri kegiatan Uji Siap Tempur (UST) tingkat Kompi Yonif 115/ Macan Leuser yang dijadwalkan berlangsung selama empat hari, yakni Selasa hingga Jumat (25 – 28 September 2012). Danrem dalam amanatnya pada upacara pembukaan Uji Siap Tempur Tingkat Kompi

Yonif 115/ Macan Leuser TA 2012 memaparkan, Uji Siap Tempur yang sedang berlangsung itu memiliki nilai strategis dalam pembinaan satuan untuk mewujudkan profesionalisme prajurit. Karena dengan kegiatan itu akan menguji kesiapan tempur satuan di jajaran Korem 012/ Teuku Umar. Dalam uji siap tempur tersebut, jelas Danrem, semua komponen harus mampu menunjukkan kesiapan semua aspek yang meliputi personel, materil, tehnik dan taktik tempur dalam melaksanakan satuan tugas tempur, sekaligus untuk menguji kepemimpinan lapangan unsur komandan mulai dari komandan regu, komandan peleton dan komandan kompi dalam mengambil keputusan menghadapi keputusan tugas-tugas tempur dalam suatu operasi. (cb05)

Bupati Jangan Tutup Mata Soal Penerimaan Mahasiswa PPGT SINGKIL (Waspada) : Bupati Aceh Singkil H Safriadi diminta untuk tidak menuntup mata sekaitan dengan dugaan KKN dalam Penerimaan Calon Mahasiswa Rintisan Program Pendidikan Profesi Terintegrasi (PPGT) kewenangan tambahan Tahun 2012 Kementerian Pendidikan Nasional melalui Dirjen Perguruan Tinggi untuk Kabupaten Aceh Singkil yang telah diumumkan pekan lalu. Pasalnya apabila dibiarkan ke depan pejabat Dinas pendidikan Aceh Singkil yang ditunjuk sebagai panitia penerimaan akan menjadikan formasi sebagai lahan proyek untuk mengambil keuntungan pribadi yang mengorbankan hak calon mahasiswa lainnya. Demikian Muftadin, mahasiswa Unsyiah Banda Aceh Kepada Waspada, Rabu (26/9) melalui ponselnya. Menurut Tadin, formasi penerimaan Calon Mahasiswa PPGT sudah ditetapkan kriteria yang lulus dari panitia pusat. Namun pada kenyataannya panitia Kabupaten dalam hal ini Dinas Pendidikan Aceh Singkil

masih curang dalam melakukan rekrutmen. Sehingga mereka yang lulus kebanyakan dari orang-orang dekat pejabat pada Dinas Pendidikan Aceh Singkil. Yang lebih parah lagi, menurut Tadin, disinyalir adanya permainan uang yang dilakukan oleh panitia , padahal diketahui formasi lebih kepada mahasiswa tidak mampu dan berprestasi . Sementara itu Kepala Dinas Pendidikan Aceh Singkil Sanusi melalui Kabid Pendidikan dan Menengah Kalilullah yang dikonfirmasi Waspada melaui ponselnya mengatan hari ini telah memberangkatkan dua calon mahasiswa PPGT yang lulus ke Makassar dan selebihnya akan diberangkatkan besok sesuai dengan universitas masing-masing . Dari 39 calon mahasiswa PPGT yang lulus satu di antaranya mengundurkan diri. Terkait dengan pembiayaan keberangkatan untuk sementara ditanggung peserta yang kemudian akan dikembalikan lagi sebut Kalilullah yang mengaku belum ada penambahan bagi peserta yang tidak daftar ulang itu. (cdin)

Lima Bulan Bolos, Mantan Cabup Belum Dijatuhi Sanksi SINGKIL (Waspada) : Lima bulan sejak berakhirnya tahapan pemilukada Aceh Singkil April lalu , tercatat tiga mantan calon bupati dan wakil bupati yang ikut bertarung dengan status PNS hingga saat ini belum masuk kantor. Kendati demikian Pejabat Pembina Kepegawaian di daerah itu belum menjatuhkan sanksi apapun. Padahal sesuai dengan PP No. 53 Tahun 2010 tentang disiplin PNS menyebutkan tiga bulan tidak masuk kantor tanpa alasan yang jelas PNS bersangkutan dapat dikenakan sanksi berat berupa pemecatan. Namun sanksi tidak dilakukan. Anehnya lagi ketiga mantan Calon Bupati dan Wakil Bupati yang bolos selama lima bulan itu masih mendapatkan gaji serta tunjangan lain kendati tidak pernah bertugas . Disisi lain penegakan disiplin PNS terus dilakukan di sana, buktinya ratusan PNS di Aceh Singkil yang tidak hadir pasca libur lebaran dikenakan sanksi berupa surat pernyataan sehingga terkesan Disiplin hanya diberlakukan

kepada PNS rendahan dan tebang pilih . Kepala BKPP Aceh Singkil Syamsul Bahri yang dikonfirmasi Waspada, Kamis (27/9) mengatakan untuk menjatuhkan Sanksi bagi PNS bukan wewenangnya melainkan Bupati Aceh Singkil. Di tempat terpisah Sekda Aceh Singkil M Yakub KS yang ditemui di ruang kerjanya mengaku sudah melayangkan surat teguran kepada tiga mantan calon bupati dan wakil bupati untuk kembali bertugas.’’ Namun apabila tidak diindahkan kita akan surati dengan teguran kedua , dan hingga teguran ketiga , setelah itu baru kita jatuhkan sanksi. sebut Yakub . Adapun ketiga mantan calon bupati dan wakil bupati Aceh Singkil yang bolos itu adalah H Sazali dan H Muhammadin serta Syaiful Umar. Begitupun H Sazali dikabarkan telah pindah tugas ke Pemko Subulussalam. Kendati demikian gaji yang bersangkutan masih berada di Pemkab Aceh Singkil. (cdin)


WASPADA Jumat 28 September 2012

Tim Gabungan Tertibkan PKL

Kecelakaan Maut Di Jalinsum Aceh Timur

2 Tewas, 1 Kritis, 3 Luka

BIREUEN (Waspada): Tim Gabungan yang terdiri dari Satpol-PP, Polsek Kota Juang, Dinas Perhubungan dan Camat Kota Juang, Dahlan, SE, Kamis (29/9) melakukan penertiban para Pedagang Kaki Lima (PKL) di seputaran Pasar Pagi Bireuen mengantisipasi kesemrautan dan kemacetan arus lalulintas di sana. Umumnya para PKL ini berjualan sayur dan berbagai perlengkapan dapur. Di sela-sela penertiban, petugas turut memberikan sosialisasi akan pentingnya ketertiban kota kepada pedagang yang selama ini menggelar dagangannya di atas badan jalan. Camat Kota Juang, Dahlan, SE menuturkan, untuk penertiban dan kelancaran lalulintas menuju Pasar Pagi Bireuen akan dilakukan penataan ulang jalan keluar-masuk di sana. “Jalur keluar- masuk kendaraan ke pasar juga akan kita tata lagi,” jelas Camat. Mahdi,37, PKL di sana mengharapkan agar penertiban juga dilakukan untuk pedagang di toko-toko yang menggelar barang dagangannya sudah melebihi batas toko. Begitupun, harapnya, dengan penertiban ini Pemkab Bireuen dapat menyediakan lokasi lain untuk mereka berjualan. (b17/cb02)

IDI (Waspada): Lakalantas kembali terjadi di wilayah Kabupaten Aceh Timur, Rabu (26/ 9) sekira pukul 20:15 malam di Jalinsum Banda Aceh – Medan persisnya di Desa Gampong Jalan, Kecamatan Idi Rayeuk. Akibatnya, dua pelajar tewas ditempat dengan kondisi berlemuran darah. Kendaraan yang terlibat dalam lakalantas kali ini antara Vega F tanpa Nopol dengan minibus L-300 BL 1907 AB. Korban tewas yakni Rizki, 19, dan Mahyuddin, 18, pelajar asal Desa Keutapang Mameh, Kecamatan Idi Rayeuk, Aceh Timur. Kini jenazah korban sudah difardhukifayahkan oleh pihak keluarga di Tempat Pemakaman Umum (TPU) setempat. Informasi yang diperoleh menyebutkan, awalnya sepedamotor Yamaha Vega F tanpa nopol melaju dengan kecepatan sedang bersama dua kendaraan lain yakni Supra Fit BL 3278 DO dan Supra X BK 3873 BA. Ketiganya saling bergandengan di Jalinsum menuju ke arah barat (Idi Cut). Sesampai di lokasi, tibatiba stang sepedamotorVega F terhimpit dengan

Pembangunan Drainase Idi Asal Jadi IDI (Waspada): Pembangunan drainase di dalam perkotaan pusat pasar Idi sebagai Pusat Pemkab Aceh Timur dinilai asal jadi, sehingga terkesan seperti tidak berfungsi. Pasalnya, kini keberadaan drainase lebih tinggi dari badan jalan kota. “Akibatnya, ketika musim penghujan air tergenang di atas badan jalan dan sejumlaah pertokoan juga ikut tergenang dari luapan air dari atas badan jalan,” kata Ketua Komite Nasional Pemuda Indonesia (KNPI) Ikram M.Aji kepada Waspada, Kamis (27/9). Dia menambahkan, drainase yang dibangun dalam perkotaan jauh lebih besar dan lebih dalam dari drainase pembuangan akhir ke Calok Geulima, Kecamatan Idi Rayeuk. Akibatnya, air hujan tidak mengalir lancar hingga terjadi luapan. Kondisi itu diperparah lagi dengan beradaan jalan yang rendah dari bangu-nan drainase yang dibangun beberapa waktu lalu, sehingga jalan di areal kota seperti sungai saat digenangi air hujan. Oleh karenanya, lanjut Ikram, diharapkan Pemkab Aceh Timur melalui Badan Perencanaan dan Pembangunan Daerah (Bappeda) setempat buntuk segera merencanakan kembali pembangunan drainase hingga tembus ke Calok Gelima sebagai titik pembuangan akhir. “Jalan harus dibangun seluruhnya dan pembangunan drainase harus dibangun sesuai dengan rencana dan kebutuhan,” sebut Ikram seraya menandaskan, jika pembangunan dilakukan setengah-setengah seperti pembangunan drainase di Kota Idi maka terkesan asal jadi, sebab masyarakat tidak bisa menikmatinya. (b24)

Rumah M. Yahya Ludes Terbakar BIREUEN (Waspada): Rumah M. Yahya,68, warga Desa juli Setuy, Kecamatan Juli, Kabupaten Bireuen, Kamis (27/9) ludes terbakar. Kejadian naas ini terjadi sekira pukul 08:00. Kendati demikian, tidak ada korban jiwa dalam musibah itu tapi kerugian ditaksir mencapai puluhan juta rupiah. Salahuddin,39, anak korban mengatakan, saat itu dia bersama istri, anak-anaknya, dan keponakan berada di dalam rumah kemudian terlihat api membara di atap rumahnya. “Saya berusaha memadamkan api dengan air dari sumur, tetapi istri saya dan beberapa anak-anak panik sehingga saya selamatkan mereka dengan mengeluarkan dari rumah,” katanya. Namun, usaha yang dilakukannya tidak membuahkan hasil. Dalam waktu sekira tiga puluh menit, rumah semi permanen 6 x 9 meter itu hangus terbakar. Kecuali itu, besarnya kobaran api juga sempat melahap dinding rumah milik Hamdani Hamid,60, yang letaknya hanya berpaut dua meter dari rumah M. Yahya. Beruntung, petugas pemadam kebakaran dan warga setempat dapat menyelamatkan rumah Hamdani dari amukan si jago merah. (b17)

Ketua PN Langsa Ambil Sumpah Dua PNS Baru LANGSA (Waspada): Ketua Pengadilan Negeri Kota Langsa Effendi, SH melantik sekaligus mengambil sumpah dua calon pegawai negeri sipil (PNS) Nilawati Kesuma Wardani, SH, staf administrasi dan Reza Andika, ST staf administrasi bidang IT sebagai PNS di lingkungan PN Langsa di ruang sidang PN Langsa, Kamis (27/9). Menurut Effendi, pengambilan sumpah hari ini merupakan bersejarah dan karir bagi kedua PNS di lingkungan PN Langsa, karena anda telah melewati ujian pertama yang dijalankan selama bekerja disini. Apalagi, negara sudah menetapkan anda berkat keuletan, ketekunan, dan prestasi, atas hal itu dan pimpinan mengusulkan anda untuk diangkat jadi PNS. Dijelaskan Effendi, pengangkatan kedua PNS di lingkungan PN Langsa sesuai surat Sekretaris Mahkamah Agung RI No. 382/SEK/PNS.00.2/IV/2012 dan No. 382/SEK/PNS.00.2/IV/ 2012 yang mulai berlaku sejak 1 Juli 2012 kemarin. “Jadikanlah dirimu ikan mas yang mencari makan di air gunung yang bersih, bukan di muara yang terkotori. Maka dari itu bekerjalah dengan baik dan sungguh-sungguh dan jangan pernah kotori dengan nuansa korupsi,” pesan Effendi. (m43)


KETUA Pengadilan Negeri Kota Langsa Effendi, SH (kiri) ketika melantik sekaligus mengambil sumpah dua calon pegawai negeri sipil (PNS) Nilawati KesumaWardani,SH dan Reza Andika, ST sebagai PNS di ruang sidang PN Langsa, Kamis (27/9).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.




TIM Gabungan yang terdiri dari kepolisian dan Satpol-PP, Dinas Perhubungan sedang melakukan penertiban PKL di kawasan Pasar Pagi Bireuen, Kamis (27/9).

Aceh Utara Mampu Produksi Gabah Per Tahun 374 Ribu Ton LHOKSEUMAWE (Waspada): Ir Mawardi, Kepala Dinas Sumber Daya Air (SDA) Kabupaten Aceh Utara kepada Waspada, Kamis (27/9) pagi mengatakan, dalam satu musim tanam Aceh Utara mampu memproduksi gabah sebanyak 187 ribu ton dengan produktifitas 5,2 ton per hektar. Itu artinya dalam setahun petani sawah mampu menghasilkan gabah sebanyak 374 ribu ton dari luas total areal persawahan yang mencapai 36 ribu hektare. Jika hasil produksi dikalikan dengan harga gabah Rp4.000 dalam satu kilogram atau Rp4 juta dalam satu ton, maka penghasilan petani padi di Aceh Utara dalam setahun mencapai Rp1,5 triliun lebih. Untuk menjaga dan meningkatkan produktifitas gabah, Aceh Utara didukung oleh lima jaringan irigasi skala besar yaitu Irigasi Jambo Aye melayani 13.800 ha, irigasi Alue Bai 2.286 ha, irigasi Pase Kiri dan Pase Kanan lebih dari 7000 ha. Bukan hanya itu, Aceh Utara juga memiliki jaringan irigasi yang dilayani dengan pompanisasi dan irigasi skala kecil dibawah layanan 1.000 ha. “Karena itu saya katakan, pembangunan kilang padi paling modern di Indonesia yang dibangun oleh PT Arsari Pratama Group di Gampong Mane Kawan, Seunuddon sudah sangat tepat dan saya katakan, kilang padi tidak akan mengalami kekurangan bahan baku. Apa lagi, letak kilang padi berada di perbatasan Aceh Timur dan Aceh Utara. Sebagian gabah Aceh Timur pastinya dapat di-

produksi menjadi beras di kilang padi itu,” kata Ir Mawardi, Kadis SDA Aceh Utara itu. Menurut Mawardi, dengan dibangunnya kilang padi modern di Aceh Utara telah memacu semangat petani untuk lebih produktif, dan diyakini harga gabah nantinya akan bersaing dengan para agen pengusaha beras dari Kota Medan, Sumatera Utara, karena gabah-gabah petani langsung diolah menjadi beras di daerahnya sendiri. Kondisi tersebut membuat petani padi Aceh khususnya Aceh Utara semakin makmur. Selama ini, harga gabah tidak begitu tinggi karena dikuasai oleh pihak-pihak tertentu. Menyahuti program pembangunan kilang padi tersebut, tentunya Pemda Aceh Utara dan Pemerintah Aceh harus intens dalam melakukan perbaikan seluruh sistem jaringan irigasi yang ada. Ini merupakan salah satu usaha untuk menjaga kontinuitas jaringan. Jika hal ini dilakukan, maka dipastikan kilang padi tersebut tidak akan mengalami kekurangan bahan baku. Apa lagi, Muzakir Manaf, Wakil Gubernur Aceh sudah komitmen untuk mengharamkan gabah Aceh keluar ke Sumut. Mawardi menambahkan, karena jaringan irigasi di Aceh Utara banyak yang rusak, maka pemerintah harus konsisten untuk membenahi hal itu. Perbaikan jaringan irigasi tidak semudah memperbaiki jalan. Pasalnya, pembangunan jalan dapat dilakukan di tempat-tempat tertentu dan dinikmati oleh masyarakat tertentu, sementara jaringan irigasi, bila rusak di tempat tertentu maka semua petani tidak akan dapat menikmati air irigasi. Karena itu, jaringan irigasi sama sekali tidak boleh rusak. Paling tidak, untuk mendukung program kilang padi, pemerintah raus segera merehab semua jaringan irigasi

hingga mampu mengaliri ke areal persawahan. Siap Memperbaiki Terkait persoalan di atas, Drs Muhammad jamil, M.Kes,Wakil Bupati Aceh Utara mengatakan pihaknya komitmen untuk segera memperbaiki semua jaringan irigasi yang rusak, tentunya hal itu dilakukan dengan mendapatkan bantuan dari semua pihak, termasuk Pemerintah Pusat, karena kondisi keuangan Aceh Utara saat ini sedng tidak baik. Perbaikan jaringan akan dilakukan secara bertahap. Orang nomor dua di Aceh Utara itu juga mengaku, dengan hadirnya kilang padi itu, perekonomian masyarakat petani padi di Aceh Utara akan sejahtera, karena harga gabah akan normal akibat terjadi persaingan harga. Selain itu, harga beras akan dapat dikendalikan di daerah sehingga masyarakat tidak membeli beras dengan harga yang mahal. Dibangunnya kilang padi akan berefek pada pengurangan jumlah pengangguran. Meskipun hingga saat ini pihaknya belum mengetahui berapa jumlah tenaga kerja yang dibutuhkan di kilang padi tersebut. “Tapi pastinya, tenaga kerja pasti dibutuhkan. Tentunya, pemilik kilang padi memperioritaskan tenaga kerja lokal,” katanya. Zulfan Nukman, Kepala BI Lhokseumawe membenarkan komentar Kadis SDA dan Wakil Bupati Aceh Utara. Kata dia, dengan adanya kilang padi harga beras dan harga gabah akan stabil, karena harg-harga tidak dapat dipermainkan lagi oleh para toke dari Sumatera Utara. pasalnya, Aceh telah mampu mengolah beras di daerah sendiri. “Ini kesempatan yang baik. Dan ini merupakan kesempatan untuk mensejahterakan petani dan masyarakat,” sebut Zulfan Nukman. (b18)

kendaraan temannya yang saling bergandengan. Spontan, ketiga kendaraan saling berhimpitan dan terjatuh ke badan dan parit jalan. Dua kendaraan yakni Supra Fit dan Supra X terjatuh ke kiri jalan. Sementara sepedamotor Vega F yang berada paling kanan (ditengah jalan) jatuh ke kanan jalan. Tiba-tiba dari arah yang berlawa-nan muncul mobil minibus jenis L-300 langsung menghantam kendaraan yang dikendarai oleh Rizki dengan memboncengi Mahyuddin. “Setelah menghantam sepmor yang terjatuh di badan jalan, lalu mobil penumpang itupun menghantam pohon yang ada di pinggir jalan, sehingga penumpang di dalam minibus mengalami mengalami luka, termasuk salah satu penumpang L-300 mengalami luka kritis dan tiga lainnya mengalami luka serius, sehingga langsung mendapat perawatan serius di RS,” kata Kapolres Aceh Timur AKBP Iwan Eka Putra, S.Ik melalui Kasat Lantas, Iptu Teysar R Prayitno kepada Waspada Kamis (27/9) via telepon. (b24)

Polsek Baktiya Amankan 7 Kg Ganja ALUE IE PUTEH (Waspada): Kepolisian Sektor Baktiya—Alue Ie Puteh, Aceh Utara, mengamankan 7 kilogram ganja kering siap edar, dari dua tersangka, Kamis (27/9) dinihari. Tersangka GNW, 28, petani asal Desa Peunteut, Kec. Sawang, Aceh Utara dan SKD, 26, warga Desa Lancok, kecamatan sama. Mereka ditahan di Mapolsek Baktiya. Kapolres Aceh Utara, AKBP Farid BE, melalui KaWaspada/Musyawir polsek Baktiya, Ipda Zulfitri, KAPOLSEK Baktiya, Ipda Zulfitri (kanan), memperlihatkan menjelaskan, GNW ditang- tersangka GNW dan SKD serta barangbukti 7 kg ganja, di Mapolsek kap di jalan nasional, Desa Baktiya, Kamis (27/9) siang. Matang Kumbang, Kec. ganja itu milik SKD dan sekitar 30 menit kemuBaktiya, sekitar pukul 00:10. “Saat itu, kita sedang patroli. GNW melaju dian, SKD juga berhasil ditangkap di Jalan dari arah Pantonlabu dengan sepedamotor GL Nasional, Desa Meunasah Dayah, Kec. LhokPro. Dia bawa ransel besar. Karena mencu- sukon, Aceh Utara. “Kasus ini masih kita kembangkan. Bisa rigakan, tersangka kita stop dan setelah kita periksa, ternyata ranselnya berisi 7 bal ganja jadi mereka punya ladang ganja di pedalaman Sawang atau terkait dengan jaringan narkoba seberat 7 kg,” kata Ipda Zulfitri. Dari GNW, sambung Kapolsek, diketahui antar provinsi,” pungkas Ipda Zulfitri.(b19)

Dinas Kebersihan Aceh Utara Kekurangan Armada LHOKSEUMAWE (Waspada): Dinas Kebersihan Kabupaten Aceh Utara masih kekurangan armada pengangutan sampah. Dari 27 kecamatan yang ada, pemerintah hanya memiliki 20 armada. “Armada yang dibutuhkan tidak kurang dari 27 unit supaya semua sampah yang ada di setiap kecamatan teratasi. Kita akan meminta penambahan 19 armada truk pengangkut sampah lagi di tahun ini,” kata Kepala Dinas Kebersihan Aceh utara, M Nuzli di Lhokseumawe, Kamis (27/9).

Dengan adanya penambahan ini diharapkan dapat membantu dan meningkatkan kinerja Dinas Kebersihan dalam menangani masalah sampah di Aceh Utara. “Kita sudah mengajukan hal tersebut di APBD tahun ini Masalah armada, lanjutnya, memang menjadi kendala bagi petugas untuk mengangkut sampah. Karena, 20 armada yang beroperasi saat ini belum mencapai hasil yang maksimal untuk menanggulangi sampah di beberapa kecamatan. (b14)

Kuala Jangka Dangkal Puluhan Boat Nelayan Beralih JANGKA (Waspada) : Kenangkalan beberapa buah kuala yang terkena bencana alam tsunami 2004 lalu di desa pantai Kabupaten Bireuenmenjadisuatukendalabesarbagiparanelayan. Kuala-kuala yang masih menjadi kendala besar bagi boat nelayan beroperasi menangkap ikan, antara kuala Jeumpa Kecamatan Jeumpa, Kuala Krueng Juli, Kuala Raja, Kecamatan Kuala dan Kuala Jangka Kecamatan Jangka. Pengamatan Waspada ke Kuala Jangka Senin (24/9) boat nelayan ukuran besar kelihatan sepi di Kuala Jangka, hanya beberapa boat ukuran kecil saja yang sandar di Kuala Jangka. Camat Jangka Amiruddin, BA yang dikonfirmasi Waspada di kantornya Senin (24/9) mengatakan, kedangkalan kuala di Kabupaten Bireuen setelah terkena bencana tsunami 2004 lalu tidak hanya dialami nelayan Kecamatan Jangka, akan tetapi dialami seluruh nelayan

beberapa kuala dalam Kabupaten Bireuen Dikatakan, selama dangkalnya kuala jangka tertimbun tsunami 2004 delapan tahun lalu menjadi kendala besar bagi boat nelayan berukuran besar untuk melaut. Lantaran kuala dangkal, boat-boat nelayan ukuran besar kandas tak bisa melaiut menangkap ikan maupun kembali sandar menurunkan hasil tangkapan, selama ini telah ber-alih melaut maupun menurunkan hasil tangkapan ke Kuala Ceurape Kecamatan Kuta Blang. Untuk mengeruk kembali kedangkalan kuala Jangka dan kuala-kuala lainnya yang sudah dangkal harus dibangun jetty (penangkal ombak) jika tidak pengerukan kuala akan menjadi sia-sia, sebab habis dikeruk akan tertimbun lagi dengan pasir yang diterjang ombak, ujar Camat. (b12)

Tempatkanlah Sesuai Dengan Bidangnya TOKE Seu’um – nama akrab Usman Abdullah - sudah sebulan memimpin Pemerintahan Kota Langsa. Namun sejak dilantik pada 27 Agustus 2012 lalu bersama Marzuki Hamid sebagai wakilnya, telah melakukan gebrakan nyata di lapangan. Gebrakan itu menyangkut pembenahan pejabat di berbagai posisi penting dalam jajaran birokrasi pemerintahan. Sebuah pemerintahan yang baik, akan maju dan berkembang apabila ditunjang dengan aparatur yang profesional. Untuk mencapai semua itu, Wali Kota terpilih dalam pilkada dua tahapan ini, nampaknya tidak perlu menunggu waktu lama, apalagi sampai menanti seratus hari seperti menjadi model sejumlah pejabat selama ini. Melalui sebuah Surat Keputusan (SK) tertanggal 19 September 2012, Usman Abdullah merombak kabinet lama sekaligus memberhentikan delapan pejabat eselon-II dan lima pejabat eselon-III. Sebuah terobosan berani dalam pergantian pejabat dan kebijakan yang belum pernah terjadi selama ini. Akan tetapi apapun permasalahan dan latar belakang yang menjadi pertimbangan hingga kemudian dilakukan mutasi dan pergantian pejabat, namun yang pasti Wakil Wali Kota Langsa Marzuki Hamid telah melantik 23 pejabat baru di lingkungan birokrasi Pemerintahan Kota (Pemko) Langsa, Senin lalu (24/9). Pejabat yang dilantik meliputi delapan pejabat eselon

II-B dan 15 pejabat eselon IIIA/B. Beberapa di antara mareka yang dilantik merupakan pejabat ‘parkir’ yang diberhentikan Wali Kota Zulkifli Zainon. Salah satu adalah Mursyidin Budiman yang dicopot dari Kadis Syariat Islam era kabinet lama dan kini diangkat kembali sebagai Kepala Dinas Sosial, Tenaga Kerja dan Mobilitas Penduduk. Pertanyaan yang timbul sekarang, sudah tepatkan penempatan mareka sebagai pimpinan di sebuah SKPD (dinas/ badan). Masalahnya, karena ada di antara mareka itu dinilai terlalu dipaksakan untuk menduduki jabatan tertentu di eselonII. Mursyidin pernah menjabat Kabag Sosial sebelum memangku jabatan Kadis Syariat Islam. Posisi yang ditempati sekarang, bagaimanapun masih ada relevansinya dengan tugas masa lalu. Dia melewati fase jenjang karier sesuai dengan aturan. Tetapi bagaimana dengan sejumlah pejabat lain yang memang masih sangat baru dan asing ‘lapangan’ kerjanya. Mestinya, kalaupun ‘harus’ diangkat di suatu jabatan tertentu, tempatkanlah mareka pada posisi yang patut sehingga tidak mengundang pembicaraan sinis di kalangan birokrasi. Karenanya, wajar kalau kemudian bisik-bisik tajam bernada miring mencuat ke permukaan pasca pelantikan. Tidak saja pembiraan itu muncul di lingkungan pejabat Pemko, melainkan juga di kalangan masyarakat yang ikut peduli

terhadap penempatan pejabat pemerintah. Seorang tokoh mengecam keras penempatan itu. Belum lagi disinggung soal profesional yang menjadi salah satu landasan pengangkatan seorang pejabat pada suatu jabatan. Tentang soal ini, biarlah nanti waktu yang akan menjawab kelak. Mutasi dan pergantian pejabat sekaligus pelantikan yang dilakukanWakilWali Kota Langsa Marzuki Hamid, Senin lalu, merupakan pelantikan pertama yang dilakukan dalam pemerintahan Toke Seu’um. Menurut Sekda Muhammad Syahril, akan ada lagi mutasi dan pelantikan berikutnya yang direncanakan dua tahap lagi. Tahap kedua, katanya, dijadwalkan bulan depan dan tahap berikutnya paling lambat sekitar Desember. “Dengan demikian, dalam tahun 2012, masalah mutasi ini sudah tuntas,” tandasnya. Pelantikan yang dilakukan pada tahap pertama 24 September lalu, baru sebatas menyentuh beberapa kepala dinas/kepala badan (eselon II-B) serta kepala bidang atau kepala bagian (eselon III). Menurut sumber Waspada, masih ada beberapa kepala dinas/badan yang akan diganti dan dimutasikan pada tahap-tahap berikutnya. Pergantian dan pelantikan juga akan dilakukan lagi bagi pejabat eselon-II dan III serta pejabat eselon IV sehingga diharapkan sebelum memasuki tahun 2013 masalah pelantikan pejabat ini sudah selesai seluruhnya.

Waspada/Syahrul Karim

WAKIL Wali Kota Langsa Marzuki Hamid saat melantik dan mengambil sumpah jabatan terhadap 23 pejabat eselon II dan III di aula Pemko baru-baru ini. Pelantikan tersebut merupakan yang pertama kali dilakukan dalam pemerintahan Toke Seu’um sejak dilantik 27 Agustus lalu. Pelantikan pejabat baru dalam jajaran birokrasi pemerintahan Kota Langsa yang akan dilaksanakan dalam tahap berikutnya ini, juga termasuk pejabat fungsional seperti kepala sekolah dan pengawas. Beberapa di antaranya dikatakan sudah masuk dalam lingkaran bidikan radar mutasi. Sampai tulisan ini dikirim belum terungkap siapa saja yang bakal dicopot dan dimutasi. Seiring dengan isu itu, seorang kepala sekolah kelihatan paling sibuk dan menunjukkan sikap “sok akrab” dengan pejabat baru kepala dinas. “Dia sepertinya mengincar lokasi sekolah tertentu,” kata sumber. Mutasi dan pergeseran serta

pelantikan pejabat baru dalam jajaran pemerintahan Toke Seu’um, memang sulit ditebak. Ada pejabat yang selama ini diketahui tidak bermasalah dalam tugas, tetapi ternyata dicopot dan selanjutnya diposisikan dalam deretan bangku panjang. Sebaliknya, ada pejabat yang banyak disorot, ternyata masih dipertahankan. Pejabat ini hanya ditarik dari sebuah instansi tetapi kemudian masih diberikan kesempatan pada posisi dinas lain, juga sebagai pimpinan. Inikah yang disebut perubahan. Terlepas dari semua permasalahan mutasi dan pergeseran pejabat, namun yang pasti Wali Kota Usman Abdullah dan

Wakilnya Marzuki Hamid, telah bertekad untuk memajukan Kota Langsa. Berbagai upaya akan dilakukan untuk mencapai kemajuan tersebut. Sebab itu, Toke dan wakilnya mencari stafnya yang bisa dihandalkan (profesional) di bidangnya, selain jujur dan ikhlas dalam bekerja. Dia tak ingin roda pemerintahannya macet lantaran pejabatnya tidak mampu bekerja dengan maksimal. Dengan demikian harapan agar masyarakat dapat meningkatkan kesejahteraan dan kemakmuran dapat terwujut. “Mari kita bangun Kota Langsa,” cetusnya dalam setiap kesempatan. Syahrul Karim



WASPADA Jumat 28 September 2012

When The Water Run From Ipad BARU- baru ini masyarakat dikejutkan dengan pembagian alat komunikasi jenis tablet berupa ipad merek Apple kepada para wakil rakyat yang duduk di kursi Dewan Perwakilan Rakyat Kabupaten (DPRK) Pidie. Mereka sangat berkeinginan memiliki alat komunikasi canggih itu dengan alasan untuk membantu tugas-tugas legislasi. Dana untuk pengadaan alat komunikasi itu bersumber dari Anggaran Pendapatan Belanja Kabupaten (APBK) 2012 yang menyedot dana sekira Rp 289 juta. Pada bagian lain, ada ribuan warga Kecamatan Batee yang berdomisili di tiga desa, meliputi Desa Kareung, Awe dan Kule sangat membutuhkan pembangunan saluran air, supaya desa-desa mereka tidak tergenang air bah bila tiba musim penghujan. Dana yang dibutuhkan tidak pula besar hanya Rp 200 juta. Namun ironisnya, para wakil mereka yang kini menjadi penyambung lidah rakyat di parlemen malah meminta alat komunikasi canggih, yang padahal belum tentu bisa mereka pergunakan dengan maksimal, meskipun ada yang bisa jumlahnya dapat dihitung dengan jari. “ Ipad bukan didesain untuk menjadi alat bekerja, tetapi ipad didesain untuk menjadi consumer device. Kalau memang untuk menunjang produktivitas anggota DPRK, jangan beli ipad tapi kasih saja komputer. Itu juga paling-paling digunakan untuk nonton film atau buka situs-situs tertentu,” kritik Koordinator Pidie Transparansi Anggaran (Pita) Pidie Ismail Von H Sabi, kepada Waspada, Kamis (27/9). Ismail mengutarakan, pembelian ipad seharusnya harus dibarengi dengan peningkatan kerja dan prestasi dewan dalam tugas legislasi dan bageting. Selama ini dia menilai kinerja dewan masih standar dan jauh dari harapan masyarakat dalam memperjuangkan kepentingan publik. Apalagi, diketahui belanja aparatur Pidie lebih besar dibandingkan belanja untuk publik (masyarakat-red). Masyarakat Pidie menurut Ismail belum pernah merasakan anggaran, tetapi legislatif sudah melakukan pengadaan ipad. Seharusnya dana tersebut bisa digunakan untuk masyarakat Batee yang jauh sangat membutuhkan pembangunan saluran air pembuang di desa mereka supaya terhindar dari ancaman banjir bila datang hujan.

Dugaan Korupsi Pembangunan Gedung PPMG Aceh Besar Ke JPU KOTA JANTHO (Waspada): Penyidik Satuan Reserse Kriminal Poles Aceh Besar menyerahkan tiga tersangka dan barang bukti tindak pidana korupsi dalam peroses tender pembangunan gedung Pusat Pengembangunan Mutu Guru (PPMG) Aceh Besar ke Jaksa Penuntut Umum. Penyerahan ketiga tersangka masing-masing, IA, rekanan yang memenangkan tender pekerjaan tersebut, MY (konsultan pengawas) dan HU (sekretaris panitia lelang) serta barang bukti di antaranya hasil audit yang dilakukan BPKP Perwakilan Aceh, berlangsung di Kantor Kejaksaan Negeri (Kejari) Kota Janto, Rabu (26/9) siang, diterima Kasi Pidsus Kejari Jantho Munandar, SH. Sebelum penyerahan proses Tahap II itu berlangsung, ketiga tersangka terlebih dulu menjalani pemeriksaan kesehatan di Rumah Sakit Umum Jantho. “Ketiganya dinyatakan sehat dan sudah kita serahkan ke JPU (Jaksa Penuntut Umum-red) untuk proses selanjutnya,” kata Kapolres Aceh Besar AKBP Sigit Kusmardjoko melalui Kasat Reskrim Iptu Aries Diego Kakori, Rabu malam. Seperti diberitakan Waspada beberapa waktu lalu, Kepolisian Resort Aceh Besar yang menangani kasus itu, sebelumnya telah menetapkan rekanan, konsultan pengawas dan dan sekretaris panitia lelang sebagai tersangka kasus dugaan korupsi pembangunan gedung PPMG di Kecamatan Sukamakmur, Aceh Besar. Proyek senilai Rp1.961.979.000 itu dibangun dengan dana APBA Tahun 2009. BPKP Perwakilan Provinsi Aceh yang melakukan Audit Investigasi terhadap pembangunan gedung yang dikelola Dinas Pendidikan Provinsi Aceh itu, menemukan indikasi telah terjadi tindak pidana korupsi dalam proses tender sehingga menimbulkan kerugian negara sebesar Rp234. 025.314,55. Menurut Kapolres, ketiga tersangka diduga kuat telah melanggar Undang-Undang RI Nomor 20 tahun 2001 perubahan atas Undang-Undang RI Nomor 31 tahun 1999 tentang Pemberantasan Korupsi dengan ancaman hukuman maksimal 20 tahun penjara dan denda paling banyak Rp1miliar. Sementara itu, Kasi Pidsus Kejari Jantho Munandar, SH yang Waspada hubungi terpisah, Kamis (27/9), membenarkan pihaknya telah menerima penyerahan tersangka dan barang bukti dugaan korupsi proses pembangunan gedung PPMG di Kabupaten Aceh Besar. Menurutnya, ketiga tersangka kini dititipkan tempat penahanannya di Lembaga Pemasyarakatan (LP) Lambaro dan Rumah Tahanan (Rutan) Lhoknga. “Karena salah satunya adalah perempuan, jadi kita titipkan di Rutan Lhoknga. Setelah berkas dakwaannya rampung, nanti baru kita ajukan ke pengadilan untuk disindangkan,” ujar Munandar. (b05)

Pengurus YDBU Tetap Solid Bersama Pembina LANGSA (Waspada): Ketua II Pengurus Yayasan Dayah Bustanul Ulum (YDBU) Langsa Tgk H Nurdin Ibrahim, BA membantah dirinya telah mengundurkan diri bersama temantemannya yang lain dari kepengurusan yayasan. Sampai saat ini, YDBU Langsa sebagai Badan Hukum Penyelenggara (BPH) pendidikan di MUQ tetap menjalankan tugas sebagaimana biasa sesuai dengan peraturan perundangundangan yang berlaku, demikian tulisnya melalui siaran pers yang dikirim kepada Waspada, Kamis (27/9). Menurunya, bantahan perlu disampaikan sekaligus untuk meluruskan apa yang dikatakan sejumlah wali santri, sekarang telah terjadi kekosongan pengurus di Yayasan YDBU. Seperti diberitakan Waspada kemarin, sejumlah santri meminta Wali Kota Langsa agar mengambil alih YDBU karena telah terjadi kekosongan pengurus pasca mundurnya Nurdin Ibrahim, Tajul Munir dan Zulkarnaen. Nurdin Ibrahim menjelaskan, sampai saat ini permasalahan di MUQ dengan telah dibentuknya Tim Koordinasi Pelaksanaan Kegiatan yang terdiri dari Alumni MUQ dari berbagai angkatan semakin mengerucut dan sedikitdemi sedikit telah menemui titik terang. Adapun beberapa oknum wali santri yang mempermasalahkannya, diminta untuk berkoordinasi dengan tim. Dan pengurus yayasan sampai saat ini tetap solid bersama pembina dan pengawas serta tidak ada yang mengundurkan diri sebagaimana disampaikan oleh oknum tersebut, sehingga informasi yang mengatakan bahwa telah terjadi kekosongan pengurus yayasan adalah fitnah kubra yang sangat jahat. Mengenai keputusan pembina YDBU membentuk Tim Koordinasi Pelaksanaan Kegiatan pada Madrasah Ulumul Qur’an dengan melibatkan beberapa person alumni yang telah menyelesaikan pendidikan di berbagai perguruan tinggi baik di dalam maupun luar negeri (bukan alumni secara kelembagaan), dipandang sebuah keputusan yang tepat. Karena selain tidak bertentangan dengan peraturan perundang-undangan (sebagaimana halnya pengangkatan Direktur pada Akbid Bustanul Ulum), hubungan bathin yang kuat antara kakak/abang alumni beserta adik-adik kelasnya sangat mem-bantu untuk membuat situasi bertambah kondusif sebagai-mana yang diharapkan. Segala bentuk abnormalitas yang masih terjadi dalam dua hari belakangan ini yang diakibatkan oleh fitnah yang ditimbulkan oleh pihak-pihak yang tidak bertanggungjawab secara bertahap sudah diselesaikan oleh tim koordinasi dengan menggunakan prosedur-prosedur standar, demikian Nurdin Ibrahim. Di bagian akhir relisnya, Nurdin Ibrahim juga meminta kepada pihak-pihak terkait, Pemerintah Kota Langsa dan jajarannya yang selama ini telah memberikan kontribusi positif kepada MUQ untuk terus memberikan masukan-masukan untuk kesinambungan pelaksanaan pendidikan di MUQ. (b20)

Selain itu, masyarakat Batee yang tinggal di pesisir pantai seperti Desa Geunteng Timur dan Geunteng Barat juga sangat membutuhkan perhatian para wakil rakyat dalam pembahasan anggaran untuk dibangun batu pemecah ombak supaya terhindar dari abrasi gelombang pasang laut purnama. “ Yang dibutuhkan masyarakat kita hari ini adalah air mengalir dari pet, bukan ipad. Kerana masyarakat tidak mungkin mengharap air bias mengalir dari ipad, tapi dari saluran selang pet,” cetus Ismail. Ismail melanjutkan, pembelian ipad bukan dilihat dari besar kecilnya anggaran yang diperuntukkan dalam pengadaan ipad. Tapi ini bicara sensitif opini yang seharusnya mereka jaga di saat kondisi masyarakat Pidie masih hidup di bawah kemiskinan, contohnya masyarakat Batee yang tinggal di pesisir pantai. Secara terpisah, A.Jalil, 45 salah seorang warga Kecamatan Batee, kepada Waspada, Kamis (27/9) mengeluhkan Pemkab Pidie kurangnya mengalokasikan dana untuk membangun saluran air pembuang di desa mereka supaya terhindar dari banjir bila tiba musim penghujan. Menurut dia ada tiga desa di Kecamatan Batee yang selalu menjadi langganan banjir bila tiba musim hujan, antara lain Desa Kareung, Kule dan Desa Awe. “ Yang perlu dibangun sekira satu kilometer saluran air pembuang di desa supaya tidak terjadi banjir” katanya. Suadi Sulaiman, Anggota DPRK Pidie dari Fraksi Partai Aceh DP –III mengungkapkan pembangunan saluran air seperti harapan masyarakat Kecamatan Batee sudah menjadi prioritas utama Bupati Pidie Sarjani Abdullah sampai tahun 2014. Pembangunan itu akan dilakukan secara bertahap dan berkelanjutan sampai tahun 2014 meliputi seluruh Kabupaten Pidie. “ Harapan dan keluhan masyarakat selalu kita dengar dan kita prioritaskan dalam melakukan pembangunan daerah” kata Suadi Sulaiman. Pembangunan saluran air seperti harapan masyarakat mestinya lebih diprioritaskan, dari pada mendahulukan pemenuhan fasilitas, yang belum tentu bisa lebih bermakna dan bermanfaat bagi rakyat, dan dewan itu sendiri. Pun begitu rakyat tetap berharap dewan bisa lebih peduli dan memperhatikan nasib mereka lebih baik lagi dimasa sekarang dan mendatang, semoga. Muhammad Riza

IUP PT Kalista Alam Dicabut BANDA ACEH (Waspada) : Izin Usaha Perkebunan (IUP) PT Kalista Alam seluas 1.605 hektare akhirnya dicabut oleh Gubernur Aceh dr Zaini Abdullah, Kamis (27/9) pukul 13:30. “Baru saja izinnya sudah dicabut oleh Bapak Gubernur.” kata Kepala Biro Hukum dan Humas Setdaprov Aceh, Makmur Ibrahim, SH yang dihubungi Waspada beberapa saat setelah Izin itu dicabut. Setahun terakhir izin Perkebunan di Rawa Tripa di Pantai Barat Aceh itu telah menjadi perdebatan di Aceh antara aktivis penyelamat lingkungan dengan pengusaha perkebunan dan juga pemerintah daerah termasuk kepolisian. Tak hanya di Aceh, soal izin itu juga pernah bergulir di pe-

ngadilan yakni antara Walhi, Organisasi Lingkungan Hidup dan Pemerintah Aceh berikut PT Kalista Alam yang mendapat konsesi lahan di Hutan Rawa Gambut Rawa Tripa yang berada di Kabupaten Nagan Raya dan Kabupaten Aceh Barat Daya. Pencabutan IUP PT Kalista Alam tidak menjawab harapan Kuntoro Mangunsubroto, Kepala Unit Kerja Presiden Bidang Pengawasan dan Pengendalian Pembangunan (UKP4) dan Ketua Satuan Tugas Persiapan Kelembagaan REDD+ yang meminta Izin IUP PT Kalista Alam dan PT Surya Panen Subur dicabut dengan alasan kedua perusahaan perkebunan di Rawa Tripa telah melanggar hukum. Pelanggaran-pelanggaran menurut mantan Kepala BRR Aceh - Nias itu bertentangan dengan UU No. 18/2001 tentang Perkebunan, dan UU No. 32/

Fraksi PA Pidie Minta Bupati Usulkan Dana Minyeuk Panyot

2009 tentang Perlindungan dan Pengelolaan Lingkungan Hidup. Lalu, UU NO. 26/2007 mengenai RTRW serta Kepres No. 32/ 1990 tentang Pengelolaan Kawasan Lindung. Sementara Walhi Aceh memberikan apresiasi atas pencabutan izin IUP PT Kalista Alam itu, “Alhamdulillah bagi kita semua,” ungkap TM Zulfikar Pimpinan Walhi Aceh yang dihubungi terpisah. Ia juga meminta Pemerintah Aceh memerintahkan PT Kalista Alam untuk merehabilitasi lahan yang sudah di garap menjadi kawasan lindung. “Dari 1.605 hektare itu ada juga yang sudah digarap, luasan lahan itu kita harapkan dikembalikan seperti semula,” ungkap TM Zulfikar. Di masa mendatang Pemerintah Aceh diharapkan terus melakukan upaya perlindungan kawasan lindung di Aceh. (b08)

Usut Tuntas Indikasi Korupsi Di Unsyiah BANDAACEH (Waspada): Menanggapi indikasi korupsi yang terjadi di Universitas Syiah Kuala Banda Aceh, LSM Masyarakat Transparansi Aceh (MaTA) mendesak KejaksaanTinggi (Kejati) Aceh mempercepat pengusutan dan pengungkapan kasus tersebut secara transparan. MaTA juga mendesak kepada Kejati Aceh untuk segera menetapkan tersangka dan menelusuri seluruh aliran dana dalam kasus yang telah merugikan mahasiswa selaku penerima manfaat dari beasiswa Jalur Pengembangan Daerah (JPD). Menurut Koordinator Bidang Advokasi Korupsi dan Monitoring Peradilan MaTA Baihaqi, percepatan pengungkapan kasus ini merupakan pertarungan bagi kepemimpinan Kepala Kejati Aceh saat ini untuk menunjukkan komitmennya dalam upaya pemberantasan korupsi di Aceh. MaTA juga berharap pengungkapan kasus bukan hanya untuk melakukan booming isu namun harus di ungkapkan secara tuntas sehingga memberi efek jera kepada oknum-oknum yang terlibat, sebut Baihaqi dalam pernyataannya di Banda Aceh, Kamis (27/9). Selama ini, sebutnya, desasdesus indikasi adanya masalah dalam pengelolaan keuangan di Biro Rektor Unsyiah sudah menjadi pembicaraan publik. “Dengan demikian, pengungkapan kasus beasiswa program Jalur Pengembangan Daerah

(JPD) harus menjadi pintu masuk untuk membongkar secara keseluruhan indikasi korupsi di Biro Rektor Unsyiah. Ini hanya gunung es, sehingga aparat penegak hukum, khusus Kejati Aceh harus bertindak cepat dan mengembangkan kasus ini secara lebih komprehensif,” kata Baiha. MaTA mendesak kepada Pemerintah Aceh untuk segera mengevaluasi pemberian dana kepada Unsyiah. Ini penting dilakukan agar dana yang diberikan yang bersumber dari APBA tidak disalahgunakan. Selain kepada Unsyiah, Pemerintah Aceh juga perlu mengevaluasi pemberian dana kepada kampus-kampus lain di Aceh karena tidak tertutup kemungkinan indikasi korupsi seperti ini juga terjadi di kampus-kampus yang lain. Seperti ramai diberitakan, sebesar Rp2miliar lebih dari total Rp17,6miliar dana beasiswa dari Pemerintah Aceh yang diberikan kepada mahasiswa Unsyiah melalui program Jalur Pengembangan Daerah (JPD) Tahun 2009/2010, diduga telah dikorupsi. Profesional Desakan juga datang dari Kepala Sekolah Anti Korupsi Aceh. Indikasi dugaan tindak pidana korupsi terhadap Dana Beasiswa itu harus dituntaskan oleh pihak Kejati Aceh secara profesional dan dalam koridor hukum. “Penyelesaian ini merupa-

Waspada/Muhammad Riza

DUA bocah di pedalaman Tangse sedang melangkah di jalan rusak sepulang sekolah. Mereka berharap Pemkab Pidie bisa segera membangun jalan desa mereka dengan baik, dan melupakan dulu fasilitas lain yang tidak perlu.

kan sebuah keharusan, sebagai konsekwensi logis untuk menyelamatkan dunia pendidikan Acehdaripraktekkorup,terutama menyelamatkan marwah kampus Jantong Hatee masyarakat Aceh,” ungkap Suhendry, SIP. Selain itu, Kepala Sekolah Anti Korupsi Aceh ini juga memberikan apresiasi positif atas kinerja Kejati Aceh yang telah membongkar skema siklus gelap pertanggungjawaban anggaran dana beasiswa di Unsyiah. Karena, selama ini lembaga pendidikan tinggi di Aceh masih sangat alergi dan jarang terlihat mempertanggungjawabkan sesuatu kegiatan secara transparan. Seharusnya, sebut Suhendry, kampus-kampus di Aceh semisal Unsyiah sebagai “Jantong Hate” rakyat Aceh, secara normatif harus memberikan contoh konkrit dalam memberantas korupsi di Aceh, bukan menambah masalah baru bagi dunia pendidikan di Aceh. “Dengan adanya temuan dugaan tindak pidana korupsi terhadap Dana Beasiswa ini, jelas terlihat bahwa elit-elit di lingkungan Unsyiah tidak merespon dengan baik niat pemerintah untuk membantu dunia pendidikan di Aceh dan dapat dipastikan bahwa membongkar siklus kasus korupsi dana beasiswa ini merupakan pintu masuk untuk membongkar danadana lain yang dikelola oleh kampus Unsyiah,” paparnya.(b05/b04)

bawah kepemimpinan SarjaniSIGLI (Waspada): Fraksi M.Iriawan perlu kem-bali Partai Aceh (F-PA) Dewan mengalokasikaan dana un-tuk Perwakilan Rakyat (DPRK) membantu para guru ngaji yang Pidie meminta bupati Pidie membuka balai pengajian di Sarjani Abdullah mengusulkampung-kampung, sebab kan dana minyeuk panyot dana bantuan itu sudah lama (minyak lampu-red) untuk sekali tidak lagi diberikan. membatu balai pengajian Karena itu Partai Aceh sadi daerah itu. ngat mengharapkan dengan “ Kami sangat mengadanya bantuan dana tersebut harapkan kepada bupati supara guru ngaji dapat terbanpaya untuk anggaran 2013 tukan dalam mengajar anakbisa diusulkan dana Minyeuk Panyot untuk memUsman M.Yusuf, Ketua anak membaca ayat-ayat suci batu balai-balai pengajian Fraksi Partai Aceh Alquran yang benar.” Dengan begitukamidariFraksiPartaiAceh, yang banyak terdapat di seluruh Pidie” kata Ketua F-PA Usman M.Yusuf, mengingatkan kepada bupati supaya dana itu jangan lupa diusulkan, supaya para guru ngaji kepada Waspada, Kamis (27/9). Menurut dia, pemerintah Pidie di bisa terbantukan” demikian Usman. (b10)

Pemkab Pidie Tak Transparan Berikan Data Ke Dewan SIGLI (Waspada): Pemkab Pidie dinilai tidak transparan dalam memberikan dukungan data kepada Dewan Perwakilan Rakyat Kabupaten(DPRK) setempat untuk kelancaran pembahasan anggaran. “ Kepada saudara Bupati Pidie melalui pimpinan DPRK, kami mengharapkan ke depan supaya data pendukung dari SKPK agar dilampirkan untuk memperlanjar pembahasan.” Demikian laporan panitia anggaran DPRK Pidie yang disampaikan Muhammad, S.ThI dalam rapat penyampaian laporan KUA/PPAS 2013 dan penyampaian laporan tentang LKPJ akhir 2011, Rabu (26/9). Berdsarkan laporan tim panitia anggaran DPRK Pidie dalam melakukan pembahasan perhitungan anggaran 2011 masih banyak didapati dokumen-dokumen yang tidak lengkap yang disajikan SKPK. Dalam pembahasan penghitungan 2011 dari pendapatan yang direncanakan senilai Rp 754, 9 miliar hingga 31 Desember 2011 hanya terealisasi senilai Rp 733,8 miliar atau 97,19 persen sehingga mengalami kekurangan dari rencana senilai Rp 21, 1 miliar atau 2,81 persen. Adapun dana tersebut terdiri dari Pendapatan Asli Daerah (PAD) setelah perubahan dari rencana semula Rp 37,4 miliar yang terealisasi hingga 31 Desember 2011 hanya sebesar Rp 22,8 miliar atau 61,12 persen, sehingga menderita kekurangan dari rencana senilai Rp 14,5 miliar atau 38,88 persen. Pendapatan yang berasal dari pemberian pemerintah atau instansi lebih tinggi setelah dilakukan perubahan senilai Rp 696,1 miliar,

namun yang terealisasi hanya Rp 695,7 miliar atau 99,94 persen. Sedangkan lain-lain pendapatan yang sah direncanakan Rp 21,4 miliar namun yang terealisasi hanya Rp 15,1 miliar. Sedangkan untuk belanja yang direncanakan Rp 794,8 miliar namun hanya berhasil terealisasi senilai Rp 731,4 miliar atau 92,02 persen. Hal ini mengalami kekurangan dari rencana belanja senilai Rp 63,3 miliar. Dalam laporanya Muhammad juga mengungkapkan, untuk laporan belanja tidak langsung direncanakan senilai Rp 566,4 miliar, sedangkan realisasinya hanya Rp 533,5miliar, hal ini mengalami kekurangan senilai Rp 32,9 miliar. Begitupun, imbuhnya terhadap belanja langsung yang direncanakan semula Rp 228,3 miliar, sedangkan realisasinya hanya Rp 197,9 miliar atau berkurang dari rencana semula senilai Rp 37,4 miliar. Selanjutnya dilaporkan, penerima pembiayaan yang direncanakan senilai Rp Rp 43 miliar, realisasi hanya Rp 11,4 miliar sedangkan pengeluaran biaya pembiayaan direncanakan Rp 3,1 miliar namun realisasinya hingga 31 Desember 2011 dinyatakan nihil. Menilai dari seluruh permasalahan keuangan yang dialami Pemkab Pidie 2011 merupakan indikator masih kurannya dukungan data pendukung dari SKPK serta permasalahannya.” Maka kami perlu meminta bupati untuk melengkapi data pendukung dari setiap SKPK untuk kelancaran pembahasan” demikian Muhammad, SthI. (b10)

Waspada/Muhammad Riza

ANGGOTA Panggar DPRK Pidie Muhammad, SThI menyerahkan laporannya kepada pimpinan DPRK di Gedung deawan setempat disaksikan Sekda Pidie H Said Mulyadi, SE.MSi, Rabu (26/9).

Tak Kunjung Diperbaiki, Jembatan Peutow Ambruk LANGSA (Waspada): Akibat tak kunjung juga diperbaiki jembatan di lintasan jalan utama yang terletak di Desa Peutaw Kecamatan Birem Bayeun Aceh Timur, Rabu (26/9) sekira pukul 18:00 ambruk roboh. Meskipun tidak semua jembatan itu ambruk, namun jembatan itu sempat memakan korban warga setempat yang melintas dan terjatuh ke dalam sungai. Pantauan wartawan di lokasi, kondisi jembatan sangat memprihatinkan, di mana lantainya yang dibuat dengan batang pohon kelapa mulai keropos dan berlubang. Selain itu letak batang pohon kelapa itu juga tidak beraturan sehingga menyulitkan masyarakat yang melintas di jembatan tersebut dan pada sisi samping kanan kiri jembatan tidak ada pengaman. Begitu juga penyangga jem-


AKIBAT tak kunjung juga diperbaiki jembatan di lintasan jalan utama yang terletak di Desa Peutaw Kecamatan Birem Bayeun Aceh Timur, Rabu (26/9) sekira pukul 18:00 ambruk roboh. Tampak beberapa orang warga sedang membantu pengendara becak yang sedang melintas dijembatan itu, Kamis (27/9). batan itu terbuat dri batang kelapa yang sudah rapuh. Sementara akibat rubuhnya jembatan Peutow itu alat berat yang seja-

tinya akan memperbaiki jembatan di Desa Kemuning tidak bisa melintas, alhasil alat beko itu terpaksa membuat jalan alterlantif

dahulu disisi kanan jembatan untuk mempermudah jalur pengangkutan barang. Geuchik Peutaw,Yusuf Jamil ketika ditemui di lokasi jembatan bersama Sekdes Kemuning Hulu Mansur mengatakan, jembatan itu dibangun pada tahun 1980 dengan panjang 14 m dan lebar 5 m, sejak saat itu tidak pernah dilakukan perbaikan hingga akhirnya kondisinya semakin parah seperti sekarang. Padahal, jembatan tersebut merupakan satu-satunya jembatan yang menghubungkan ke Desa Keumuning Hulu dalam kecamatan yang sama, bahkan melalui jembatan tersebut masyarakat juga bisa menuju ke beberapa desa lainnya seperti Jamur Labu Kecamatan Birem Bayeun serta Desa Trom Kecamatan Langsa Baroe Kota Langsa. Akibat, tak kunjung diper-

baiki meskipun kondisi kerusakannya sudah begitu parah, Selasa (25/9), masyarakat Gampong Baru Kota Langsa ketika melintas di jembatan itu ketika menuju ke tempat pesta perkawinan terperosok dan jatuh ke sungai. Lantas, katanya, saat ini agar jembatan itu tetap bisa dilalui masyarakat, maka secara swadaya memasang batang pohon kelapa di ujung jembatan yang roboh. Ironisnya, kondisi jembatan yang sangat memprihatinkan ini sudah berulang kali disampaikan ke Pemerintah Aceh Timur, tapi sampai saat ini belum juga diperbaiki hingga ujung jembatan ini roboh. Padahal, menurutnya, jika pemerintah mau membangun kembali jembatan ini maka kondisinya tidak sampai separah ini dan tidak ada masyarakat yang menjadi

korbannya. “Sudah bosan saya mengusulkan kepada pemerintah untuk segera melakukan perbaikan jembatan ini, tapi tak kunjung terealisasi,” ucapnya kesal. Diakuinya, kondisi ini sudah disampaikan ke muspika setempat, dan kemarin (Rabured) sudah datang dari pihak Dinas PU Aceh Timur untuk melihat jembatan ini. Mudah-mudahan kali ini pemerintah melalui dinas terkait tidak hanya sekedar melakukan survei, namun benar-benar membangun kembali jembatan ini. Karena, jembatan ini sebagai jalur transportasi masyarakat untuk membawa hasil pertaniannya dan juga dilalui anak sekolah tingkat SMP dan SMA. “Jika SD sebahagian mereka sekolah di desa ini, tapi untuk tingkat SMP dan SMA mereka harus bersekolahkedesalain,”tandasnya.(m43)

Sumatera Utara

WASPADA Jumat 28 September 2012


Massa Desak DPRD Madina Segera Hentikan Kisruh PANYABUNGAN (Waspada): Ratusan pengunjukrasa menamakan dirinya Forum Masyarakat Penyelamat Madina (FMPM), Kamis (27/9) sekira pukul 11:00 menggelar aksi unjukrasa ke Kantor DPRD Kab. Mandailing Natal (Madina) dengan pengawalan ketat pihak Polres dan Satpol PP Madina. FMPM mendesak DPRD Madina supaya menghentikan kisruh politik, menuntaskan pembahasan agenda kerja DPRD, supaya bekerja sesuai

aturan hukum dan peraturan, menuntaskan persoalan rakyat, dan melaksanakan fungsi legislasi, anggaran dan pengawasan. Unjukrasa dengan koordi-

nator aksi Abdul Muis Pulungan, Syahriwan Koccu Nasution, Saifuddin Lubis, dan Ahmad Yasin Nasution, dilatari akibat dinamika politik selama sembilan bulan terakhir di DPRD Madina yang dinilai tidak mencerminkan etika politik yang sehat dan wajar. Ditegaskan, akibat perseteruan di internal DPRD yang melahirkan dua kubu (21 vs 19), telah mengakibatkan sejumlah agenda kerja DPRD tertunda, mulai dari LKPj Bupati, pembahasan KUA – PPAS P.APBD Ta 2012. Kemudian pembahasan dan pengesahan RP.APBD Ta 2012, KUA-PPAS R.APBD TA 2013, dan RRAPBD TA 2013, yang menurut aturan seharusnya sudah mulai dibahas dan disahkan tiga bulan sebelum tahun anggaran berjalan habis.

Pengunjuk rasajuga menuding anggota DPRD Madina telah “menari-nari” dan tidak perduli tentang permasalahan yang di hadapi masyarakat Madina, baik itu persoalan dengan PT.Sorikmas Mining, PT.Palmaris, dan sejumlah persoalan rakyat yang tidak pernah tuntas dibahasa meski telah menghabiskan anggaran atau uang rakyat ratusan juta rupiah. FMPM mengancam, jika gugatan mereka tidak di laksanakan, maka untuk dan atas nama 500.000 jiwa rakyat Madina akan membawa semua persoalan yang timbul akibat kisruh di internal DPRD Madina ke jalur hukum termasuk dugaan habisnya sekira Rp4 milliar dana di DPRD Madina selama 9 bulan kisruh terjadi. Ketua DPRD Madina, As Imran Khaitamy Daulay, SH di

damping Wakil Ketua Syafaruddin Ansari alias Todonk bersama sejumla anggota dewan lainnya mengatakan, berjanji menyelesaikan persoalan di internal dewan dengan baik, sehingga kinerja dan persoalan rakyat bisa di selesaikan dengan baik. Usai orasi, ratusan massa FMPM memasuki Gedung DPRD Madin sekaligus menyegel ruangan wakil Ketua DPRD Fahrizal Efendi Nasution, ruangan Fraksi Madina Bersatu, Fraksi Hanaura, dan ruangan Fraksi Partai Keadilan Sejahtera. Massa melakukan penyegelan karena kecewa salah seorang wakil ketua dan anggota dewan tergabung dalam fraksi (kubu 19) tersebut tidak hadir dalam sidang paripurna penyampaian LKPj Bupati Madina TA 2011 yang sedang berlangsung saat itu. (c14)

Banyak Rusak, Distribusi e-KTP Di Simalungun Terkendala Waspada/Sarmin

Massa Forum Masyarakat Penyelamat Madina menyegel ruangan fraksi, karena wakil rakyat tidak menghadiri sidang paripurna.

Enam Rumah Terbakar Di Buluh Pancur KABANJAHE (Waspada): Enam unit rumah milik penduduk di Desa Buluh Pancur, Kec. Laubaleng, Kab. Karo, berjarak sekira 80 km dari Kabanjahe sebagai Ibukota Kabupaten Karo, musnah dilalap sijago merah, Rabu (26/9) sekira pukul 22:00. Selain enam unit rumah terbakar, dalam peristiwa tersebut lima unit rumah milik warga lainnya sempat dirusak untuk memblokir penyebaran kobaran api. Dalam peristiwa tersebut tidak ada korban jiwa, sedangkan penyebab kebakaran diduga akibat hubungan pendek arus listrik. Camat Laubaleng Drs. Adil Sembiring mengatakan, telah melaporkan kejadian tersebut kepada Bupati Karo melalui surat nomor : 900/398/LB/ 2012 pada 27 September 2012. Sedangkan penyebab kebakaran dan kerugian material masih dalam penyelidikan pihak berwajib. Pemilik atau penghuni rumah yang terbakar, Gading Karokaro, Nd Inganta Br Ginting, Sabar Ginting, Sedia Karo-Karo, Remon Sinulingga, Tengku. Sedangkan rumah yang dirusak milik Ujung Br Karo, Maju Sembiring, Kemin Sembiring, Abadi Perangin-angin dan Nd Permena Br Karo. (c09)

SIMALUNGUN (Waspada): Distribusi e-KTP (Kartu Tanda Penduduk elektronik) di Kab. Simalungun terganggu akibat adanya kerusakan pada lembar e-KTP dan sidik jari yang tidak bisa dideteksi. Kepala Dinas Kependudukan dan Catatan Sipil Kab. Simalungun, Albert Sinaga, melalui Kabid Pendaftaran Pendudukan, Ikuten Ginting, mengakui hal itu kepada Waspada, Kamis (26/9). Kerusakan dan sidik jari tidak dapat terbaca (terdeteksi) diketahui saat dilakukannya pendistribusian melalui kantor camat di masing-masing wilayah. Ginting juga mengatakan, pihaknya belum dapat memastikan berapa besar jumlah lembar e-KTP warga yang rusak dan sidik jarinya yang tidak dapat terdeteksi. Tetapi yang pasti, pihaknya sudah menerima laporan melalui selular dari petugas di lapa-

ngan bahwa kasus kerusakan dan sidik jari tidak dapat dideteksi hampir terjadi di setiap kecamatan. Ginting meminta warga yang e-KTP-nya rusak atau sidik jarinya tidak bisa dideteksi agar bersabar, karena lembar e-KTP yang rusak tersebut akan dikembalikan ke Kemendagri (Kementerian Dalam Negeri). Sementara, proses distribusi e-KTP dikatakan baru berjalan sekira 25 persen. Dari 277 ribu lembar e-KTP yang akan dibagikan kepada warga yang telah didata dan difoto pada 2011 lalu, baru sekira 56 ribu lembar atau sekira 25 yang sudah dibagikan. “Persoalannya, masih banyak warga yang belum memenuhi undangan untuk mengambil eKTP di kantor camat,” katanya. Dia berharap, pemerintah nagori (desa) dan kecamatan tetap proaktif mensosialisasikan pengambilan e-KTP di kantor kecamatan dan memenuhi

undangan yang sudah diserahkan,sehingga kartu yang sudah tercetak tidak menumpuk di kantor camat. Sedangkan menyangkut biaya, dengan tegas Ikuten Ginting mengatakan warga tidak dibebani biaya saat mengambil e-KTP. “Pengambilan e-KTP gratis. Jika ada pungutan saat pengambilannya, berarti itu pungli (pungutan liar),” tegas Ginting seraya mengharapkan jika ada warga yang terkena pungli terkait pengambilan eKTP, maka diminta untuk melaporkannya ke dinas terkait. Sebelumnya Bupati Simalungun Jopinus Ramli (JR) Saragih pada acara lounching pembagian e-KTP oleh Dinas Kependudukan dan Catatan Sipil beberapa waktu lalu di Pamatang Raya juga menekankan dan meminta warga melaporkan aparat pemerintahan di kecamatan yang melakukan pungli dalam pengambilan e-KTP. (a29)

Banyak Aset Pemda Raib

Warga Samosir Pertanyakan Dana Rintisan Dan Gangguan PLN Bupati Tapsel: Pertanggungjawabkan Secara Hukum SAMOSIR (Waspada): Sejumlah warga Kab. Samosir mempertanyakan dana gangguan dan rintisan PLN di kawasan itu. Pasalnya, di beberapa lokasi di Samosir seperti kabel listrik yang ditutupi pohon mangga di Kec. Palipi tidak pernah mengadakan rintisan sehingga dikwatirkan akan berdampak buruk bagi masyarakat sekitar yang dapat mengancam keselamatan jiwa. Salah seorang warga, Manawar Rumapea kepada Waspada, kemarin, mengatakan, selain itu ada juga kabel puntir yang telanjang ASCR persis di depan Kantor Camat Palipi hampir putus, sehingga warga was-was bila melintas di dekat kabel tersebut apalagi saat hujan turun. Ditambahkannya, selama hampir setahun, pelaksanaan rintisan dan gangguan PLN di tiga Kantor Jaga PLN di wilayah kerja PLN Ranting Pangururan Cabang Siantar seperti Kec Palipi, Nainggolan dan Onan Runggu disinyalir tidak dilaksanakan. Dampak dari tidak dilaksanakannya rintisan dan gangguan, konsumen PLN dirugikan, apalagi listrik sering hidup-mati. Kepala Ranting PLN Ranting Pangururan RM Sitompul kepada Waspada, Kamis (20/9) mengatakan akan mengecek ke lokasi. Namun, mengenai anggaran rintisan dan gangguan PLN, dia kurang jelas menerangkan. (c11)

Rp12,2 M Dana PNPM-MP Untuk Gunungsitoli GUNUNGSITOLI (Waspada): Wali Kota Gunungsitoli diwakili Wakil Wali Kota Gunungsitoli, Drs. Aroni Zendrato mengatakan, pada 2012 ini Kota Gunungsitoli memperoleh dana PNPM-MP Rp12.240.000.000. Ini sangat membantu pemerintah daerah meningkatkan taraf hidup masyarakat di Kota Gunungsitoli. Hal itu disampaikan Wakil Wali Kota Gunungsitoli Drs. Aroni Zendrato saat membuka Seminar dan Lokakarya DPRD PNPMMP tahun 2012 di aula Samaeri Lantai II Kantor Wali Kota Gunungsitoli, Selasa (25/9). Aroni mengungkapkan, dana Rp12,240 miliar diarahkan pada pembangunan di berbagai bidang melalui program PNPM-MP yang bertujuan untuk meningkatkan taraf hidup masyarakat Kota Gunungsitoli. Program PNPM-MP ini juga sebagai salah satu upaya untuk mengentaskan kemiskinan. Untuk itu pemerintah harus membutuhkan langkah langkah yang sistematis dengan mengangkat derajat rakyat dengan memenuhi hak hak rakyat untuk hidup layak. Maka untuk meningkatkan anggaran dan kontribusi semua pihak pada program PNPM-MP, Wakil Wali Kota menjelaskan, koordinasi antarsektordalam menampungusulan masyarakat sangat diperlukan, sehingga untuk mendapat dukungan tersebut, maka dilakukan semiloka DPRD dalam meningkatkan program PNPM-MP. Disebutkan, untuk 2012, dana PNPM-MP yang digulirkan di Kota Gunungsitoli Rp12.240.000.000, yang didampingi dana urusan bersama yang dikeluarkan Pemerintah Kota Gunungsitoli dari APBD Rp1.360.000.000. Sehingga, jumlah keseluruhan dana untuk PNPM-MP yang dilaksanakan di Kota Gunungsitoli Rp13.600.000.000. (a25)

SIPIROK (Waspada): Banyak aset atau barang milik pemerintah daerah yang hilang akibat tidak terdata atau terinventarisasi dengan baik. Ini menimbulkan kerugian bagi daerah dan menjadi temuan yang harus dipertanggungjawabkan secara administrasi pemerintahan dan hukum. Bupati Tapanuli Selatan Syahrul M Pasaribu mengatakan itu dalam amanat tertulis dibacakan Asisten I, Drs. Aswad Daulay SH, MM pada pembukaan Pendidikan dan Pelatihan (Diklat) Pengelolaan Barang digelar Pemkab Tapsel bekerjasama dengan Badan Pemeriksa Keuangan dan Pembangunan perwakilan Sumatera Utara di Tor Sibohi Nauli Hotel Sipirok, Selasa (25/9). Lebih lanjut dikatakannya, sesuai Peraturan Menteri Dalam Negeri No. 17 tahun 2007, secara eksplisit diamanatkan, meka-

nisme pengelolaan barang milik daerah itu perlu dimaksimalkan, terutama yang berkaitan dengan penatausahaan aset. Inventarisasi dan pelaporan itu bertujuan agar semua kekayaan daerah, baik benda bergerak atau tidak bergerak yang dibeli ataupun diperoleh atas beban APBD maupun perolehan lain yang sah, dapat dihitung, diukur, dan ditimbang dengan baik. Bupati Tapsel mengakui, pengelolaan barang milik daerah cenderung kurang tertib. Hal ini dikarenakan kurangnya keseriusan dari para pegawai yang diamanahkan untuk mengurus, menekuni pekerjaan, dan kurang menghayati pekerjaan tersebut. Kepada para SKPD dan para pengurus serta penyimpan barang, Bupati Tapsel mengimbau agar membuat nomor kode aset di tiap satuan kerja masing-ma-

sing. Jangan lagi ada aset atau barang milik daerah yang tidak diberi kode registrasi, dan jangan sampai ada lagi aset yang hilang. Sementara itu dari BPKP perwakilan Sumut, Arthur Pasaribu, mengharap para peserta dapat mengikuti seluruh materi yang disampaikan narasumber dengan baik dan tekun. Kepada para pimpinan SKPD di Pemkab Tapsel, Arthur Pasaribu berharap agar jangan terlalu mudah memutasi stafnya yang telah mengikuti Diklat pengelolaan barang. Tujuannya agar ilmu yang didapat Diklat seperti ini tidak sia-sia. Ketua Panitia Diklat juga Kepala Badan Kepegawaian dan Diklat Pemkab Tapsel, Drs. Syahtoat, menyebut, Diklat ini diselengarakan tiga hari, SelasaKamis (25-27/9), dengan peserta 80 orang pengurus dan penyimpan barang dari seluruh SKPD se Pemkab Tapsel. (a27)

Wali Kota P. Sidimpuan Motivasi Dedi-Affan P.SIDIMPUAN (Waspada): Wali Kota Padangsidmpuan, Drs. H. Zulkarnain Nasution MM, secara mengejutkan memberi isarat penyerahan estafet tampuk kepemimpinan kota ini kepada pasangan calon wali kota dan calon wali kota nomor urut empat (4), Dedi Jaminsyah Putra Harahap SSTP.MSP-H. Affan Siregar SE. “Kuserahkan nusa dan bangsa ini kepadamu,” kata Zulkarnain Nasution sambil menepuk bahu Dedi JP Harahap ketika mengunjungi posko Dedi-Affan Center bersama Kapoldasu, Irjen Pol Drs. Wisjnu Amat Sastro, Kapolres Padangsidimpuan, AKBP Andi Syahriful Taufik SIK.MSI, dan Ketua Panwaslu, dan Dra. Helty Ritonga, Kamis (27/9). Selain kalimat isyarat itu, Zulkarnain Nasution juga memberi motivasi berupa strategi pemenangan atas sebuah pertarungan kepada Dedi-Affan. Strategi ini didapat Zulkarnain ketika mengikuti diklat teritorial Pertahanan Keamanan Rakyat Semesta (Hankamrata) selama enam bulan di Rindam Pematangsiantar. “Kenali wilayah sekitar, lakukan pembinaan, pemantapan, dan konsolidasi. Saya yakin semuanya pasti akan mantap. Tapi sebenarnya dukungan suhu berupa ‘orang pintar’ itu juga sangat perlu untuk pertarungan seperti Pilkada ini,” ujar Zulkarnain sambil mengungkapkan sejumlah strategi perang lainnya, seperti strategi perang rakyat Vietnam melawan Amerika. Pada kesempatan itu, Zulkarnain Nasution yang sudah dua periode memimpin Kota Padangsidimpuan tampak sangat akrab dengan Dedi dan Affan. Bahkan pada kesempatan itu Dedi membetulkan papan nama Zulkarnain yang sedikit miring. Sementara Zulkarnain tampak membiarkan apa yang dilakukan adik juniornya di pendidikan pemerintahan dalam negeri itu. Mengenai Affan Siregar, kepada Kapoldasu dan Kapolres Padangsidimpuan, Zulkarnain

mengatakan bahwa dialah yang membawa Affan ke kota ini. Dari sebelumnya menjabat Kadis Kebersihan di Pemko Binjai menjadi Kepala Bappeda di Padangsidimpuan. Setelah dua tahun kemudian, Affan menjabat Sekda di Tapanuli Selatan. “Dari Binjai ke Padangsidimpuan. Dua tahun menjabat Kepala Bappeda, beliau menjadi Sekda Tapsel sekira 4,5 tahun. Sekarang bertugas di Kota Medan dan kini mencalon diri sebagai calon wakil wali kota bersama Dedi,” ujarnya. Menanggapi motivasi yang diberikan Wali Kota Padangsidimpuan, Dedi didampingi Affan mengungkapkan rasa syukur dan terimakasih. Karena telah diberi wejangan berupa strategi dan motivasi oleh seorang senior, wali kota, dan tokoh Tabagsel yang penuh pengalaman. “Terimakasih atas motivasi Bapak, semoga apa yang disampaikan tadi dapat kami jalankan dengan baik. Kami mohon doa dan dukungan dalam perjuangan ini,” ucap Dedi Jaga Kamtibmas Sementara Kapoldasu Irjen Pol Drs. Wisjnu Amat Sastro didampingi Kapolres Padangsidimpuan AKBP Andi S Taufik SIK.MSI meminta pasangan Dedi-Affan beserta seluruh tim sukses dan pendukung untuk menjaga kamtibmas di Pilkada ini. “Tolong dijaga dan dikendalikan dengan baik semua pergerakan massa, jangan sampai memunculkan aksi anarkis dan konflik horizontal. Mohon teruslah berkoordinasi dan bekerjasama dengan Polri dalam menjaga situasi yang kondusif ini,” ujar Kapoldasu. Menjawab itu Dedi dan Affan menyatakan kesiapan untuk menjalankan dan melaksanakan semua yang diamanatkan Kapoldasu. Karena, selaku pasangan calon peserta Pilkada, Dedi-Affan akan terus berusaha bersikap santun dan sabar. (a27)

Bantah Konflik DPRD Dairi Berakhir Di Ruang Kerja Bupati SDIKALANG (Waspada): Salah seorang anggota DPRD Dairi yang tergabung dengan kelompok “18’, Togar Simorangkir, membantah terlibat dengan pertemuan sejumlah rekannya dengan Bupati Dairi, yang berlangsung di ruang kerja Bupati Dairi. “Terus terang, sedikitpun saya tidak mengetahui tentang pertemuan sejumlah rekan DPRD dengan Bupati Dairi. Saya baru mengetahuinya setelah membaca di salah satu koran. Saya selaku anggota dewan keberatan dengan pemberitaan ini, konflik yang mana diselesaikan di ruang Bupati itu?,” tanya Togar seraya menunjukkan pemberitaan di koran. Bantahan itu disampaikannya, di salah satu ruang Fraksi DPRD Dairi, usai mengikuti rapat paripurna Pemandangan Umum DPRD tentang Ranperda P-APBD Dairi TA 2012, Senin (24/9). Togar menegaskan kepada sejumlah wartawan, anggota dewan yang memenuhi undangan bupati untuk hadir di ruangannya, merupakan hak masing-masing dewan, namun jangan dibawa-bawa nama institusi DPRD. “Terus terang, saya selaku wakil rakyat tidak bertanggungjawab kepada bupati, atau kepada siapapun, saya hanya bertanggungjawab kepada rakyat Dairi,” tegas Togar.

Mulus Sedangkan Rapat Paripurna DPRD Dairi Senin(24/9), dengan agenda Pemandangan Umum Anggota DPRD, Atas Nota Pengantar Bupati Dairi tentang Ranperda Perubahan Anggaran Pendapatan Belanja Daerah (P – APBD) TA. 2012, berjalan mulus, tidak seperti pada siding-sidang sebelumnya. Sebab, pada rapat paripurna dipimpin langsung Ketua DPRD Dairi Delphi Masdiana Ujung didampingi dua Wakil Ketua Suparto Gultom, dan Benpha Hisar Nababan itu, berjalan normal, padahal diperkirakan akan terjadi hujan interupsi. Rapat Pemandangan Umum anggota DPRD Dairi dihadiri Sekda Dairi Julius Gurning serta sejumlah pimpinan SKPD Pemkab Dairi. Koordinator Advokasi dan Partisipasi Politik Perempuan, Ronald Silalahi yang dihubungi wartawan di lobi Gedung DPRD Dairi mengatakan, ini menunjukkan sikap kritis anggota DPRD atas kebijakan yang dibuat eksekutif makin melemah. ”Padahal, ada banyak hal dalam P-APBD yang perlu mendapat sorotan, seperti biaya perawatan mobil mewah, biaya perawatan kesehatan Bupati/ Wakil Bupati, dll,” kata Ronald. (ckm)

Hj. Rita Hidayat Bunda PUD Madina PHS Gelar Seminar Tambang Dan Aksi Tanam Pohon Di Sipirok

PANYABUNGAN (Waspada): Hj.Rita Hidayat Batubara Boru Harahap dikukuhkan menjadi Bunda Pendidikan Anak Usia Dini (PAUD) Kab. Mandailing Natal (Madina). Pengukuhan Bunda PAUD ini dilaksanakan dalam rangkaian Hari Anak Nasional (HAN) di Gedung Serbaguna, Rabu (26/9). Bupati Madina, Hidayat Batubara, SE mengimbau semua pihak supaya membantu dan memeberikan dukungan sehingga setiap anak-anak harus memperoleh hak-haknya. Acara dihadiri Kadisdik Madina Imron Lubis, Kakan Pemberdayaan Wanita Dan KB Dra.

RinaWati, serta sejumlah kepala SKPD. Bupati menegaskan, hak anak yang di maksud yakni hak pelayanan pendidikan dalam rangka pengembangan koknisi, afkesi dan psikomotor anak. “Kemudian hak pertumbuhan anak dengan derajat kesehatan untuk mendukung proses pembelajaran. Juga perlindungan dari diskriminasi, eksploitasi baik secara ekonomi maupun seksual, penelantaran, kekejaman, kekerasan, penganiayaan dan ketidakadilan,” ujar bupati. Disampaikan, di Kabupaten Mandailing Natal (Madina) pelayanan pendidikan, kesehatan dan sosial telah dilaksanakan,

khususnya di bidang PAUD yang telah berkembang pesat. Kadis Pendidikan Madina, Imron Lubis yang di konfirmasi usai acara menjelaskan, perkembangan PAUD di Madina memang saat ini meningkat atas keperdulian orangtua. Berdasarkan data pada 2012 ini, di jalur pendidikan formal yakni TK maupun Roudhatul Athfal, telah melayani 45.667 anak. Sementara di jalur non formal yaitu kelompok bermain 180 kelompok yang melayani 4.824 anak. “Itu berarti pelayanan pendidikan melalui PAUD sudah tertampung sebanyak 9.437 anak atau 20,88 persen,” ujarnya. (c14)

Musancab PD Gunungsitoli GUNUNGSITOLI (Waspada): Pelaksanaan Musyawarah Anak Cabang I Partai Demokrat Kota Gunungsitoli dilaksanakan di Auditorium STT Sunderman Gunungsitoli, Rabu (26/9). Pada Musancab I tersebut Kepengurusan Dewan Pimpinan Anak Cabang berhasil terbentuk di enam kecamatan yang ada di Kota Gunungsitoli. Ketua DPC Partai Demokrat, Drs. Marthinus Lase, MSP mengatakan, tantangan Partai Demokrat Kota Gunungsitoli ke depan semakin berat termasuk dalam menghadapi Pemilihan Gubernur Sumatera Utara pada 2013 dan Pemilu Legislatif pada 2014. Acara Musancab I Partai Demokrat Kota Gunungsitoli turut dihadiri Wakil Wali Kota Gunungsitoli, Aroni Zendrato, Kajari Gunungsitoli, Edi Sumarno, SH mewakili Ketua DPD Partai Demokrat Sumatera Utara, Ramli, Ketua DPRD Kota Gunungsitoli, Sowa,a Laoli, SE dan beberapa anggota DPRD Kota Gunungsitoli dari Partai Demokrat. Musyawarah Anak Cabang I Kota Gunungsitoli berhasil membentuk kepengurusan Dewan Pimpinan Anak Cabang masa bakti 2012-2017 di semua kecamatan masing-masing Ketua DPAC Kecamatan Gunungsitoli Herman Jaya Harefa, Ketua DPAC Kecamatan Gunungsitoli Selatan Sitariman Lase, DPAC Kecamatan Gunungsitoli Idanoi Yunius Larosa, DPAC Gunungsitoli Barat Lestarman Gulo, DPAC Kecamatan Gunungsitoli Utara Fotodo Zega dan DPAC Kecamatan Gunungsitoli Alo’oa Arifeli Zendrato. (a25)

Waspada/Sukri Falah Harahap

CAWALKOT No.4, Dedi JP Harahap memperbaiki papan nama Wali Kota Padangsidimpuan, Zulkarnain Nasution, yang sedikit miring, di hadapan Kapoldasu dan Kapolres ketika berkunjung ke posko Dedi-Affan Center.

Waspada/Sarmin Harahap

BUPATI Madina, Hidayat Batubara setelah memasangkan selempang kepada Ibunda PAUD, Hj.Rita Harahap, dalam acara peringatan HAN di Gedung Serba Guna.

SIPIROK (Waspada): Perkumpulan Hijau Sumatera (PHS) bekerjasama dengan Kementerian Lingkungan Hidup dan Lembaga Kajian dan Advokasi Rakyat (eLKAR) Tapanuli Selatan menggelar aksi tanam 3.000 bibit pohon dan seminar tambang di Sipirok, Tapanuli Selatan, belum lama ini. “Kegiatan ini bertujuan menyadarkan pemerintah dan masyarakat untuk melakukan rehabilitasi lahan dan kampanye lingkungan hidup guna mempertahankan hutan alam yang masih tersisa sekaligus sosialisasi dampak industri pertambangan terhadap ekosistem yang saat ini sangat marak dan mendapat perlawanan dari masyarakat di wilayah ini,” kata Ketua Dewan Pengurus PHS Safaruddin Siregar kepada wartawan didampingi pembicara yakni Direktur Eksekutif Nasional Walhi Abet Nego Tarigan dan Kepala Kantor Pusat Pengelolaan Ecoregion (PPE) Sumatra Muhammad Ilham Malik, di Tor Sibohi Nauli Hotel, Sabtu (22/9). “Kami berharap masyarakat mau membantudanbekerjasamamelestarikanekosistemTapsel dengancaramenanambantuanbibitpohongratis ini di pekarangan rumah dan di kawasan lahan kritis di sekitar kita,” ujar Safaruddin Siregar. Lebih dari 200-an undangan yang datang dari berbagai kecamatan di Tapsel mendapat dua bibit setiap orang secara gratis. Bibit pohon yang diberikan berupa 1.750 batang bibit mangga, 556 bibit durian, 325 batang bibit rambutan, 200 batang bibit aren dan 125 batang bibit mahoni. Aksi tanam 12.000 pohon ini juga dilakukan di Mandailing Natal, Padanglawas Utara, Serdang Bedagai, dan Medan. Dari seminar bertajuk ‘Industri Pertambangan dan Dampak Ekologisnya di Kabupaten Tapanuli Selatan’, mencuat permintaan agar menata ulang hutan di kawasan Kab. Tapsel menyusul pergesekan yang rutin terjadi antara masyarakat dengan perusahaan tambang di Kec.Batang Toru: PT. Agincourt Resources. Mengutip data Kementerian Kehutanan, ujar Direktur Eksekutif NasionalWalhi Abet Nego Tarigan, saat ini 33.000 desa di Indonesia berada di kawasan hutan dan rentan menjadi korban


KETUA Dewan Pengurus Perkumpulan Hijau Sumatera (PHS) Safaruddin Siregar menanam pohon di kawasan Hotel Tor Sibohi, Kec. Sipirok, Tapsel. Di sini, 3.000 pohon ditanam dan dibagikan kepada masyarakat sekitar sebagai bagian dari pelestarian ekosistem Tapsel. akibatnya tidak adanya kejelasan soal status hutan. Yang terjadi, lanjutnya, hak rakyat belum dipastikan, tapi izin pertambangan sudah diberikan. “Ini menjadi rumit,” tandasnya. Karenanya, menurut dia, pemerintah perlu melakukan pendataan dengan melibatkan partisipasi masyarakat. “Yang terjadi saat ini banyak Pemda main akal-akalan. Gaya naga bonar, ini boleh, ini tidak boleh. Inilah yang kemudian hari memicu pergesekan,” kata Abet. Kepala Kantor PPE Region Sumatra, Muhammad Ilham Malik, sebagai mewakili Kementerian Lingkungan Hidup RI, mengatakan bahwa konflik yang kerap terjadi antara perusahaan tambang dengan masyarakat sekitar adalah akibat tidak adanya kejelasan data. “Biasanya, ketika konflik, perusahaan menyodorkan data-data, tapi masyarakat juga menyodorkan data yang berbeda. Ini kan jadi membingungkan,” tandasnya. (ihn)


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Calhaj Labusel Berangkat Oktober KOTAPINANG (Waspada): Sebanyak 232 calon jamaah haji asal Kab. Labuhanbatu Selatan (Labusel) siap untuk diberangkatkan ke Tanah Suci Mekkah pada Oktober. Hasil pemeriksaan yang dilakukan Dinas Kesehatan Pemkab Labusel, tidak ada calon jamaah yang mengidap penyakit berbahaya. Hal itu diungkap Kadis Kesehatan, Rusman Lubis kepada Waspada, Rabu (26/9). Menurutnya, secara keseluruhan kondisi kesehatan calon jamaah cukup baik. Berdasarkan hasil pemeriksaan kesehatan tahap dua juga tidak ditemukan adanya calon jamaah yang menderita penyakit menular dan berbahaya. “Kita juga memberikan mereka vaksin meningitis dan khusus perempuan diperiksa kehamilan. Secara keseluruhan calon jamaah kita siap untuk berangkat. Namun kita imbau kalau ada calon jamaah yang ada riwayat penyakit seperti TBC, ginjal akut dan sebagainya untuk tetap berobat di dokter tempatnya biasa berobat,” kata Rusman. Sementara itu, Kepala Kantor Kementerian Agama Labuhanbatu, Azaman Harahap mengatakan, pada 2012 ini jumlah calon jamaah haji asal Labusel yang akan berangkat ke Mekah 232 orang yakni 62 jamaah tergabung dalam Kloter 18 Kab. Labuhanbatu dan 170 jamaah lainnya tergabung dalam Kloter 15 Kab. Labusel. “Kita sudah koordinasi dan dapat dikatakan seluruh jamaah sudah siap, kita sudah lakukan manasik, periksa kesehatan, dan sebagainya,” kata Azaman. Sementara itu Kabag Humas Pemkab Labusel, Bakhrul Karim mengatakan, Pemkab Labusel akan melakukan pemberangkatan calon jamaah haji asal Labusel pada 5 dan 8 Oktober mendatang. Pelepasan tersebut kata dia, dijadwalkan akan dilakukan Bupati Labusel, Wildan Aswan Tanjung. (c05)

Sumatera Utara

WASPADA Jumat 28 September 2012

Galian Kabel Optik Resahkan Warga KOTAPINANG (Waspada): Belum selesai keresahan warga terkait polusi debu galian pondasi pelebaran Jalinsum Aek Nabara Kotapinang, Kab. Labusel yang dikerjakan oleh PT. Seneca Indonesia. Kini warga Kotapinang dan sekitarnya diresahkan oleh proyek penggalian pemasangan kabel optik di sepanjang jalan protokol Jalinsum Kotapinang. Pengamatan Waspada, Kamis (27/9), penggalian dan pemasangan kabel dibahu jalan yang dilakukan PT. Putra Negara itu telah mengganggu aktivitas masyarakat. Seperti yang terlihat di depan Kantor Dinas Kesehatan, perempatan Jl. Kampung Jawa, dan di depan ruko di Jalan Sudirman, rekanan tidak menimbun bekas galian dengan semestinya, sehingga di sepanjang jalan itu terlihat gundukan tanah bekas galian. “Ini sangat mengganggu pengguna jalan dan saya sebagai pedagang. Pembeli jadi malas singgah ke toko saya karena ada gundukan di depan itu.

Biasanya omzet per hari mencapai Rp300 ribu, namun kini hanya Rp100 ribu. Kayaknya nggak siap-siap galian kabel optik ini,” kata Irfan pemilik toko Raisa Ponsel. Rudi pemilik warung di Jl. Sudirman juga mengeluhkan hal serupa. Menurutnya, pihak PT. Putra Negara melakukan galian tepat di depan warungnya, akibatnya areal parkir untuk pembeli tidak ada. “Pembeli jauh berkurang gara-gara galian ini. Udah digali bukannya ditimbun lagi,” katanya. Ketua ICMI Kab. Labusel, Abdullah Situmorang mengatakan, seharusnya penggalian

dan pemasangan kabel atau apapun dilakukan secara serentak dan dengan kajian yang cukup matang. Sehingga tidak mengganggu aktivitas warga. Karenanya, Abdullah mendesak DPRD Labusel dan Pemkab Labusel menghentikan proyek galian kabel optik tersebut. “Jika diamati, pekerjaan penggalian dan pemasangan kabel selalu mengganggu aktivitas masyarakat. Belum lagi debu bekas galian. Ini juga saya rasa nggak ada izinnya. Pemkab dan DPRD harus tegas,” katanya. Dikonfirmasi secara terpisah Purwono selaku pengawas pengerjaan proyek mengatakan, pihaknya akan meratakan kembali seperti semula bekas galian. Namun kata dia, pemasangan kabel optik tersebut belum selesai sehingga belum dapat dilakukan penimbunan. “Nanti kita ratakan kembali. Pekerjaan ini sudah ada izinnya dari PU,” katanya. (c18)

Fenomena Awan Berlafaz Allah Saat Pemberangkatan Haji TANJUNGBALAI (Waspada): Fenomena alam terjadi di Kota Tanjungbalai. Sebuah awan mirip kaligrafi bertuliskan Allah terlihat di langit bersamaan dengan acara pemberangkatan 154 calon jemaah haji asal Tanjungbalai, Kamis (27/ 9) sekira pukul 10:00. Peristiwa yang tergolong jarang terjadi ini membuat warga takjub dan langsung memuji kebesaran Allah. Seketika mereka menadahkan tangan ke langit seraya memanjatkan doa kepada Allah agar diberi hidayah dan keselamatan. Tak ingin melewatkan keajaiban yang berlangsung sekitar dua menit itu, warga beramai-ramai mengabadikannya menggunakan telepon genggam dan kamera digital baik dalam bentuk foto maupun video. Atas adanya lukisan arab yang dipercaya sengaja ditunjukkan Allah itu, mereka percaya akan membawa keberkahan dan keselamatan. “Saya sangat yakin ini pertanda baik baik bagi masyarakat Kota Tanjungbalai, apalagi waktunya bertepatan dengan pemberangkatan calon jamaah haji. Mudah-mudahan mereka menjadi haji mabrur dan kembali ke tanah air dengan selamat,” ungkap Ilham Sinambela,

FENOMENA awan mirip kaligrafi arab bertuliskan Allah terlihat di langit Kota Tanjungbalai bersamaan dengan pemberangkatan haji asal ‘Kota Kerang’ itu. seorang perawat di Rumah Sakit Umum Daerah (RSUD) Kota Tanjungbalai. Ilham mengaku sangat kagumdengankebesaranAllahyang ditunjukkan hari itu. Dia juga sempat meminta kepada Allah agar dipertemukan dengan jodohnya, sebab di usianya yang mencapai ke 32 tahun, Ilham masih menyandang status lajang. Sementara, warga lainnya Tin Fauziah, 40, berdoa agar di-

jauhkan dari segala macam marabahaya dan penyakit. Ibu rumah tangga warga jalan Singosari itu juga meminta agar diberikan kelimpahan rejeki agar dapat segera membangun rumah, karena hingga saat ini memiliki dua anak, keluarganya masih hidup mengontrak. “Semoga Allah memberikan kelimpahan rejeki kepada keluarga saya,” ujar ibu yang mengenakan jilbab warna putih itu. (a32)

Terumbu Karang P. Pandang Terkikis BATUBARA ( Waspada): Keadaan terumbu karang di laut sekitar Pulau Pandang mulai terkikis, sehingga pendapatan nelayan tradisional berkurang. Hal itu terungkap saat kunjungan Korem 022/PT dan Kodim 0208/Asahan di Pulau Pandang, dan terlihat di pisisir pantai bertabur terumbu karang yang hancur, Selasa (25/9). Sehingga, sangat dibutuhkan perhatian sehingga laut tetap terjaga ekosistemnya. “Sampai sekarang kita belum mengetahui penyebabnya, padahal penjarahan terumbu karang hampir tidak ada di wilayah ini,” ujar Petugas Navigasi

Mercusuar, Jefri Alexander Simamora, dan rekannya Bernad Dongoran,saatditemui Waspada. Namun besar dugaan, itu karena jaring nelayan yang sampai ke dasar laut sehingga merusak terumbu karang, sehingga serpihannya terbawa ke pinggir pantai bersama ombak. “Kita akui memang terumbu karang mulai kurang, sehingga banyak keluhan nelayan hasil tangkap berkurang,” jelas Jefri. Hal itu dibenarkan oleh salah satu nelayan tradisional Rahmad, asal Kualatanjung, Kab. Batubara, saat singgah di Pulau Pandang. Dia berharap agar masalah ditindak dengan

cepat, sehingga hasil tangkap nelayan tradisional bisa meningkat. “Hasil tangkap nelayan berkurang, karena ikan berkurang akibat terumbu karang terkikis,” jelasnya. Informasi dihimpun Waspada, Pulau Pandang merupakan yang berada di wilayah laut Kab. Batubara, dengan luas sekitar empat hektar, dan dengan ketinggian 70 meter dari permukaan, dengan kekayaan pemandangan sumber daya laut, terutama terumbu karang, sehingga banyak habitat laut tumbuh dan berkembang. Namun sayang, kekayaan itu mulai terkikis dan harus cepat diantisipasi. (a15)

Waspada/Rasudin Sihotang

PENGENDARA sepedamotor harus berhati-hati saat melintas di Jl. Jenderal Sudirman karena kondisi permukaan jalan bekas ditambal sulam tidak rata.

Tambal Sulam Jalan Jadi ‘Ranjau Darat’ Pengendara TANJUNGBALAI (Waspada): Perbaikan sejumlah jalan protokol di Kota Tanjungbalai dengan cara tambal sulam yang terkesan asal jadi lebih layak disebut ‘ranjau darat’ bagi pengendara terutama sepedamotor. “Tambal sulam asal-asalan itu bukan membuat pengendara semakin nyaman, malah lebih cocok dibilang ranjau darat yang siap menelan korban jiwa,” kata Mukti Ali, 51, pengendara sepedamotor saat melintas di jalan Arteri, Selasa (25/9). Menurutnya, ada sejumlah titik yang ditambal sulam seperti di jalan KL Yos Sudarso (jalan Besar Teluknibung) dan yang terparah berada berada kawasan titi Kapias hingga Polsek Teluknibung. Kemudian di jalan Arteri mulai dari kantor KPU hingga simpang Pos Polantas Simpang Pancakarsa. Berikutnya di Jl. Jenderal Sudirman mulai dari pos pengutipan retribusi jalan di Km.2 hingga gapura selamat datang di Kota Tanjungbalai di Km.7. Alasan dia mengibaratkan ‘ranjau darat’ berdasarkan hasil perbaikan jalan tambal sulam umumnya sangat memprihatinkan. Disebutkan, kondisi permukaan jalan yang dulu berlubang, saat ini berubah menjadi gundukan gunung-gunung kecil. Sehingga sangat rentan mengundang kecelakaan lalu lintas karena pengguna jalan terutama kereta kerap menghindari gundukan. “Tak terbilangkanlah lagi bang, berlubang

tak enak, ditambal pun makin tak enak. Sekarang lebih parah lagi, sering kali pengendara melaju dengan kencang dan tiba-tiba menghindari gundukan sehingga terjadi laka lantas,” ujar warga lainnya, Ibrahim Simangunsong, 32. Dia mencontohkan kecelakaan lalu lintas beberapa minggu lalu yang menyebabkan seorang ibu hamil muda tewas dan anaknya patah tulang kaki di jalan Sudirman Km. 5 Sijambi. Menurutnya, peristiwa melibatkan dua kereta dan satu truk pasir itu berawal dari permukaan jalan yang tidak rata. Sementara warga Tanjungbalai lainnya, Buyung, 29, menilai pengerjaan perbaikan jalan tidak dilakukan secara profesional. Pasalnya, pada saat penambalan, kontraktor tidak menggunakan alat yang seharusnya meratakan permukaan jalan. “Begitu ditambal langsung ditinggalkan, padahal seharusnya digilas dulu menggunakan stoom walls agar permukaan jalan rata,” pungkas Buyung. Dia menambahkan, kontraktor yang mengerjakan itu terkesan tidak perduli dengan hasilnya, demi mendapatkan keuntungan pribadinya. Untuk itu, warga meminta kepada pihak berwenang agar memeriksa kontraktor bersangkutan karena kualitas perbaikan jalan yang dinilai buruk. Mereka juga meminta agar dinas terkait tidak memenangkan kembali pemborong yang rekam jejaknya buruk. (a32)

KPU Batubara Seleksi Calon PPK LIMAPULUH (Waspada): Komisi Pemilihan Umum Daerah (KPUD) Kab. Batubara melaksanakan seleksi calon anggota Panitia Pemilihan Kecamatan (PPK) se wilayah Batubara. Seleksi akhir berupa wawancara dilaksanakan selama dua hari Selasa dan Rabu (25 dan 26/9) di kantor KPUD setempat Jl. Perintis Kemerdekaan, Limapuluh. Sumber Waspada mengatakan, seleksi diikuti 54 orang calon anggota PPK dari tujuh kecamatan yang ada. Di antaranya, Limapuluh 10 orang. Talawi 9, Seibalai 9, Medangderas 5, Seisuka 7, Airputih 8 dan Tanjungtiram 6 orang. Semuanya telah lolos seleksi tahap pertama berupa seleksi administrasi. “Dari seleksi wawancara akan dipilih

ditetapkan lima orang menjadi anggota PPK untuk masing-masing kecamatan. Pengumuman anggota PPK akan dilakukan dalam waktu dekat. Rencana pelantikannya pada 1 Oktober di kantor KPUD Batubara,” ujar sumber Waspada. Menurut sumber itu, seleksi untuk calon anggota Panitia Pemungutan Suara (PPS) tingkat desa juga sedang dilakukan. Seleksi administrasinya sudah, tinggal seleksi wawancara yang dilakukan setelah usai seleksi wawancara untuk calon PPK. Pengumuman hasilnya juga dalam waktu dekat dan rencana pelantikannya pada 2 Oktober di Limapuluh. Baik PPK maupun PPS yang dibentuk, adalah dalam rangka penyelenggaraan Pilgubsu 2013. (c04)

Operasi Kasih Sayang Satpol PP Labura Jaring 58 Siswa AEKKANOPAN (Waspada): Sebanyak 58 siswa dari berbagai perguruan di Labura terjaring petugas Satpol PP saat menggelar operasi kasih sayang dari berbagai tempat di Kec. Kualuhhulu dan Kec. Kualuh Selatan Rabu (26/9). Kakan Satpol PP Labura Drs. BambangWahyuandi menjelaskan, operasi kasih sayang digelar dua kali dalam sebulan. Operasi itu melibatkan petugas dari Kepolisian dan Dinas Pendidikan. Tujuannya, agar para pelajar tertib belajar dan tidak berkeliaran pada jam belajar. “Kita sengaja melibatkan petugas dari Kepolisian dan Dinas Pendidikan, agar para siswa tidak tidak lagi berkeliaran pada jam belajar. Dengan demikian para siswa akan tertib

belajar dan akhirnya mereka dapat meningkatkan mutu pendidikannya,” ujar Bambang. Dia juga menjelaskan, pada hari pertama operasi kasih sayang digelar, 35 pelajar terjaring dari beberapa tempat, sementara pada hari kedua hanya 23 pelajar yang terjaring. Seluru pelajar di boyong ke Kantor Satpol PP untuk diberi pengarahan dan membuat surat pernyataan. “Semua pelajar yang terjaring, kita boyong ke kantor untuk diberi pengarahan dan membuat surat pernyataan di depan orangtua dan wali kelas. Setelah itu, kita kembalikan lagi kepada orangtuanya,” kata Bambang, seraya berharap kepada para orangtua harus ikut mengontrol dan memberi nasihat kepada anaknya. (c08)

OK Arya: ‘Nasib Nelayan Masih Terus Jadi Pikiran’ SEKITAR 30 persen dari hampir 400 ribu jiwa warga Kab. Batubara masih dalam kondisi miskin. Mayoritas mereka berada di kawasan pesisir pantai kabupaten hasil pemekaran Asahan ini. Itu artinya, masyarakat miskin di sini adalah kaum nelayan. Kenyataannya memang demikian. Karena mayoritas dari 30-an persen warga miskin Batubara adalah nelayan. Persoalannya, apakah

nelayan tradisional ini adalah warga pinggiran atau warga yang terpinggirkan. Apakah hasil laut yang menjadi tangkapan nelayan memang sudah habis atau dihabiskan. Fakta-fakta di lapanganlah yang menjawabnya. Beberapa fakta yang ada sulit untuk dibantah, di antaranya, para nelayan pemodal kuat terlihat tumbuh kembang dengan pesatnya. Mereka selalu menjadi konglomerat di daerahnya. Banyak orang-orang

kaya dari golongan nelayan. Tetapi mereka dari golongan nelayan pemilik modal besar. Mereka memiliki boat dan kapal-kapal ikan besar dengan alat tangkap canggih dan didukung pula teknologi canggih. Demikian pula toke-toke (pedagang besar) ikan. Selalu terlihat hidup mewah. Begitu juga di wilayahwilayah kantong nelayan di Batubara. Misalnya di Tanjungtiram, Talawi, Perupuk Kec. Limapuluh, Kualatanjung, Desa


PUSKESMAS untuk melayani nelayan yang dibangun di Pulau Salah Namo oleh Pemkab Batubara kini sedang dalam proses perampungan.

Lalang dan Pagurawan di Kec. Medangderas. Fakta tersebut, setidaknya dapat menyimpulkan bahwa kekayaan laut sebenarnya masih menjanjikan kehidupan yang lebih layak bagi nelayan. Ketimpangan hidup di kawasan nelayan dengan kasat mata gampang dilihat Jurang pemisah antara nelayan kaya dengan miskin cukup lebar. Nelayan kaya adalah mereka pemilik modal besar. Sedang nelayan miskin itu tetap nelayan tradisional. Ini juga terjadi di Batubara. Banyak orang yang mengkambing hitamkan sikap mental nelayan yang menyebabkan itu semua, yang menyebabkan kemiskinan tetap setia menyelimuti kehidupan mereka. Sikap mental itu diantaranya pemboros, pemalas, tak berpikir jauh ke depan, tak mampu mengelola uang dengan benar dan sebagainya. Sudah hampir menjadi cerita usang, bahwa semakin jauh menurunnya hasil tangkapan nelayan tradisional disebabkan semakin meraja lelanya boat-boat dan kapal ikan besar yang beroperasi di perairan wilayah tangkapan nelayan tradisional. Kapal dan boat ini menggunakan alat tangkap yang jauh lebih hebat dari pukat

harimau. Pukat mereka memang tidak menggunakan nama pukat harimau, tetapi keganasan alat tangkap ini melebihi pukat harimau. Menghabiskan biota laut untuk mendapatkan hasil dalam jumlah besar. Ada yang namanya pukat tar ik, grandong dan lain sebagainya. Sementara dalam batasbatas perairan tertentu, penggunaan alat tangkap ini sudah dilarang Pemerintah.Yaitu batas perairan yang menjadi kawasan tangkapan nelayan kecil tadi. Larangan itu sudah cukup lama dikeluarkan. Tetapi semakin hari, operasi mereka di wilayah perairan nelayan tradisional semakin menjadijadi. Larangan Pemerintah itu seperti tak ada gunanya. Mereka tidak takut sama sekali, walau sanksi hukum sudah cukup jelas atas pelanggaran larangan tadi. Aparat negara di laut, seperti tak berdaya mengatasi itu. Bupati Batubara H OK Arya Zulkarnain SH MM mengakui jika mayoritas penduduk miskin di daerahnya berada di pesisir pantai. Mereka adalah nelayan. Pengakuan itu terekam saat OK Arya berbincang-bincang dengan salah satu elemen warga Batubara bersama Waspada yang melakukan silaturahim kepadanya baru-baru ini.

“Kalangan nelayan inilah yang masih saja jadi pikiran saya. Bagaimana agar taraf hidup mereka dapat terus diperbaiki. Sehingga kemiskinan dapat dientaskan dari kehidupan mereka,” aku OK Arya. Menurut OK Arya, pihaknya sudah merencanakan akan memasang ramburambu sebagai tanda pembatas perairan kawasan tangkapan nelayan tradisional yang terlarang untuk digarap kapal ikan pukat sejenis pukat harimau. Rambu akan dibuat dari lampu pelampung yang akan dipasang pada beberapa titik di sepanjang perairan Batubara yang memiliki garis pantai sekitar 60 kilometer itu. Selain itu akan ditingkatkan program keramba apung serta pembuatan rumpon yang sejak beberapa tahun lalu sudah mulai dilaksanakan. Juga akan dipasang sejenis tiang pancang terapung. OK Arya yakin dengan pengamanan wilayah tangkapnya kemudian diberikan beberapa pelayanan kebutuhan mendasarnya, kehidupan nelayan tradisional Batubara akan membaik. * Sahril

Sumatera Utara

WASPADA , Selasa 28 September 2012


Thamrin Lepas Jamaah Haji Tanjungbalai TANJUNGBALAI ( Waspada): Wali Kota Thamrin Munthe melepas 154 jamaah haji asal Kota Tanjungbalai di lapa-ngan Sultan Abdul Jalil Rah-madsyah Kamis (27/9). Jamaah haji kota kerang merupakan kloter ke VII embarkasi Medan yang akan berangkat ke tanah suci pada Jumat (28/ 9). SelainWali Kota, tampak hadir Kakan Kemenag Hayat-syah, Asisten Ekbangsos Husi-nuddin, Kakan Kesbang Linmas Amir Panjaitan, dan Kasat Pol PP Yusmada Siahaan,SH.

1 CM 2 CM

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000



Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


Pantauan Waspada, dari lapangan Sultan Abdul Jalil Rahmadsyah,parajamaahkonvoi menuju Jl. Pahlawan-SutomoTeuku Umar- Asahan- Jenderal Sudirman, baru selanjutnya bergerak ke Medan. Sebelumnya, Wali Kota Thamrin Munthe mengimbau, jamaah haji harus menjaga kekompakan, tolong-menolong dan senantiasa menjaga kesehatanan. “Haji merupakan ibadah fisik serta meneguhkan niat semata-mata karena ibadah supaya mendapat ridho Allah,”

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Xenia 1.300cc. Th. 2005. BK Mdn warna coklat metalik. Cat dan mesin mulus, mobil simpanan Hrg. Nego. HP. 0852 7650 6242 - DAIHATSU Xenia Deluxe Thn. 2011 W. Hitam metalic, sangatg mulus, siap pakai. Lengkap - Pick Up 2300 Th. 87/88. Hub. 0853 6172 0189 DAIHATSU PROMO

Ready Stock Potongan Khusus Terios DP 30 Jt-an. Xenia DP 20 Jt-an Pick Up DP 11 Jt-an. Jamin OK. Data dijemput. Hub. PAIREN 0812 6305 0708

DAIHATSU BARU CASH-CREDIT-TUKAR TAMBAH. DP MULAI 15% KREDIT 5 thn. Ready Stock, Proses cepat, ful diskon. HUB ANDIKA 0852 7074 7744


Xenia DP 18 Jt-an Angs. 3 Jt-an Terios DP 30 Jt-an Angs. 4 Jt-an PU DP 9 Jt-an Angs. 2 Jt-an Dapatkan Daihatsu NPC 90 Jt-an !!! Hub. ASTRA MULIA 0812 6359 5744


Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067 # DAIHATSU PROMO # Dapatkan Potongan Khusus Di bulan ini!!! Ready Stock: Xenia, Terios, Granmax MB & Pick Up Luxio. DP Murah, Angsuran Ringan, Proses Cepat. Hub. FERRY 0821 6736 3637


XENIA DP 30 Jt-an Angs. 3 Jt-an TERIOS DP 35 Jt-an Angs. 3 Jt-an PICK UP DP 12 Jt-an Angs 2 Jt-an LUXIO DP 24 Jt-an Angs. 3 Jt-an Hub: PT. CAPELLA MEDAN/JOSUA 081263110820

HONDA Genio Thn. 93. Mobil mulus luar dalam, mesin sehat, siap pakai. Complit. BK Medan asli. HP. 0813 6162 4975 MITSUBISHI Mikrobus 6 Roda, Th. 2007. Canter 110 PS. Karoseri Tugas Anda. Full AC, Ex Pariwisata. Peminat Serius Hub. 0821 6322 8000


5 CM 6 CM

Rp. 65.000 Rp. 78.000

Bagi yang ditolak Bank, Jaminan di Medan SHM. Hub. 0821 6443 2376

VELL FIRE ZG FACE LIFT 2012 (Baru/KM.0). Black On Black. Grs. 2 Thn. Full Option, Rp. 905Jt Nett (Khusus Hari ini Gratis Ass All Risk) Harrier 2.4L-Premium ‘05 Hitam, Sdh Pwr Black Door, MDL ‘08. Rp. 395Jt Nett/Khusus Hari Ini. Pemakai Serius. Hub. 081 9200 6088


TOYOTA Innova G M/T Bensin Thn. 2005. Biru, BK Mdn Rp. 147Jt. Hub. 0853 7089 9893 TOYOTA Kijang LX 1,8 Bensin Thn. 2004, New AC, VR, PS, CL, Jok kulit, Silver, Plat BM Rp. 99Jt. Hub. 0852 7538 3218 TOYOTA Corolla ‘96 M/T, STNK pjg 2013, BK 2 Angka, Mulus Hub. 0813 7010 5676, Hrg nego di tpt #TOYOTA BARU 100%#

Innova, Avanza, Rush, Fortuner, Yaris, Altis, Hilux, Dyna, Bisa Tukar Tambah Dgn Mobil Bekas Anda Cash & Credit, data dijemput. Hub. 0812 6064 9479 (Benny Nadeak)


Avanza, Innova, Fortuner PURBA: 0813 9736 0333

TOYOTA TWIN CAM 1991 Warna: Hijau metalik. Mulus, Power steering, Velg Racing, Siap pakai, mesin terawat. Harga 45 Juta/Nego. Telp. 0813 62400 114 TOYOTA Innova “07 Euro G Bensin Luxury, Pajak panjang, Velg 18, Ban Baru, Terawat. Km. 5xxx, Harga 180Jt/damai. Hub. 0812 6983 3389 BS Bantu Kredit. TOYOTA Kijang Kapsul LGX Th. ‘99. BK Mdn W. Coklat Muda Met Cat dan Mesin Mulus, siap pakai. Hrg. Nego. Hp. 0811 652 506 Perlu Uang Cepat

TOYOTA KIJANG LSX 2001 W. Biru Mika Metalic, VR, BR, VR. Sangat mulus, seperti baru. Hub. 0852 7786 8029

TOYOTA Rush Thn. 2008. Wrn Silver (Pemakai Langsung). BK Medan HP. 0821 6245 0937 Siap Pakai.

SUZUKI Escudo Thn. 2005, 2000 cc. Kondisi mulus, BK Panjang. Hub. 0812 650 2020 / 0823 6837 6228 SUZUKI Escudo 1600cc Thn. 2004. W. Hitam met, BK Mdn. Kondisi mulus, siap pakai. Hrg. 112Jt. TP. HP. 0821 6021 0957

SUZUKI Katana Thn. 90 Dijual. MTM. Msn sehat. Kaleng, Rawat Dikit. 31Jt. Neg. Hub. 0813 7551 1977 TP.





- BUNGA TABUNGAN= 8%/Pa - BUNGA DEPOSITO = 8%/Pa - BUNGA DEPOSITO KHUSUS *) 1 Bln = 9% 6 Bln = 11% 3 Bln = 10% 12 BLn = 12%

Telp. (061) 844 6489, 882 6936, 847 5544, 795 4444, 736 8754, (0622) 430 780, (0623) 348 322, (0624) 573 7456 * Syarat dan ketentuan berlaku TABUNGAN DAN DEPOSITO ANDA AMAN SERTA DIJAMIN OLEH PEMERINTAH/ LEMBAGA PENJAMIN SIMPANAN (LPS) WWW.LPS.GO.ID


TV, M.Cuci, Kulkas, Playstation, LCD Projektor, Laptop, Handycam, Camera Dslr dll Hub. GADING 0823 6967 7779 - (061) 663 2268

TOYOTA Kijang Kapsul Model LGX New Bensin 1,8 Th. 2003. Mulus, terawat, Siap pakai, VR, BR, PS, PW, CL, RMT, E. Miror. AC DB, Full Sound pake TV, Ada 3, Hrg. 126Jt. Nego. Hub. 0823 6261 5557

Pajero, L300 PU, Colt Diesel, Mirage Hub: PM. SIMARMATA. 08126 558 178


Rp. 91.000 Rp. 104.000

BUTUH DANA/KREDIT MOBIL Jaminan BPKB Mobil, Truk, Pick Up Min. Th 95. Mutlifinance. Hub. 0852 3395 8005

MAZDA Lantis Model Vios Biru met Th. 97, Over Kredit, Sgt orisinil, Balik DP 30Jt. Perbulan 1,446 x 16 Bulan. Hub. 0823 6635 9858


7 CM 8 CM

TOYOTA Kijang Thn. 94 Dijual. Tipe Kencana, Abu metalik. Kondisi sehat, dan terawat, AC DB (Dingin). Power Steering, Central Lock, Pajak Hidup, Medan asli. DVD, Velg Racing, Ban Radial. Hrg. 47Jt/Nego. Hub. Haris Sinaga 0813 6132 2601


BURSA BUTUH DANA BUTUH DANA CEPAT Syarat BPKB dan Surat Tanah. Hub. 0813 7059 0264





Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

GEBY AR D AN A CEP AT GEBYAR DAN ANA CEPA 3 Jam Cair, Tanpa usaha, Black list bank, Jaminan: SHMN, SK Camat, HGB, Pabrik, Projet, BPKB mobil, Spd motor, Mobil kredit, Pencairan 3 Jt - 500 Milyar Hub: Bpk. Roy 0813 7044 6633 - 0813 7044 6668

9 CM Rp. 126.000 10 CM Rp. 140.000

calhaj paling tua asal Kota Tanjungbalai, Abdul Manan Marpaung, 87, sedangkan termuda yaitu Surgayanti, 23. Lebih lanjut disebutkan, calon haji berangkat tahun ini merupakan jemaah yang mendaftar pada tahun 2009. Jumlah pendaftar dari Kota Tanjungbalaisebanyak176orang, lunas 155 orang. Semen-tara, calon jemaah yang baru mendaftar tahun ini, baru bisa berangkat sembilan tahun kemudian, yakni 2021. (a14)

Waspada/Rahmad F Siregar

WALI KOTA Thamrin Munthe dan masyarakat melepas keberangkatan jamaah haji Kota Tanjungbalai dari lapangan Sultan Abdul Jalil Rahmadsyah menuju Kota Medan.

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000








Menerima Siswa Baru, Instruktur Berpengalaman Garansi Sampai Mahir, Ruang belajar Wi-Fi, Bonus Alat Kerja Hub. MB 1 Celullar Jl. Besar Delitua No. 1 (depan Jl. Stasiun/sekolah Istiqlal) HP. 0813 6113 9888



Power QSC 1 PW. 850 Beta 3 2000W (2,5) 660 W (1.8) 1.600 (3.2) Sound Standard 2000W (3.0) 3600 (4.5) 2000 W (4.0) BMB Data 1, 2, 11, 21, 55 Hitam. Spk BMB 10, 12, Terima Visa 0%. Jl. Indragiri 25 Dkt. Asia 061-734 5487



HP: 0813 6262 9292



(Gadis/ Janda) Mjd: Prwt + Anak, Prwt sakit, Gaji Rp. 900 Rb - 1,5 Jt/bln (Bersih) Hub “CAHAYA” Jl. Ayahanda 44E 0823 6666 3456 - 0878 6933 0515




Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

Tukang las, Ahli pembuatan Jerjak, Pintu, Terali besi Hub. 0813 6148 9797




TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

Sebuah Perusahaan yang sedang berkembang membutuhkan tenaga Akuntansi


Persyaratan: 1. Pria/ wanita tamatan SMK jurusan Akuntansi 2. Usia 19 - 22 tahun dan belum menikah 3. Menguasai dasar-dasar Akuntansi 4. Dapat mengoperasikan computer/Microsoft Office

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu


1 Buah BPKB Bajaj Pulsar 200 DTS-i. No. Pol. BK 4690 OW a/n. AUGUST. Alamat Jl. Kapt. Muslim GG. Jawa No. 82 Medan.


Ada Garansi



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik



HP. 0813 7035 7291

TERCECER STUK BK 7529 DI No. Uji Mdn 26136 -A. A/n. PT . RAHAYU MEDAN Alamat Jl. Letjend Jamin Ginting No. 215 Mdn. Mobil Daihatsu.

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

JL. JEMADI NO. 67 664 3108 - 0852 1369 9288



STUK: BK 9943 BS. No. Uji: MDN. 1633 - B. A/n. RISMA MUNTHE. Alamat Jl. Ginting S. Kwala Medan. Mobil Mitsubishi L.300



Bergaransi/ Jl.Kpt. Muslim


STUK: BK 8140. BH. No. Uji: Mdn 50716-A. A/n. Manggiring Panjaitan. Alamat Jl. Permai. Gg. Amal No. 13 Mdn. Mobil Mitsubishi.





STUK: BK 8884 CH. No. Uji: AB. 01.00295. A/n. SURIYANTO. Alamat Jl. Karya Bakti Lk. 14. T. Mulia Mdn. Mobil Daihatsu.

Lamaran dapat dikirimkan ke: Harian ini dengan kode AKT’12 paling lambat tanggal 03 Oktober ‘12


845.8996 0812.631.6631







Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602



Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Pelanggan Yang Terhormat

MLM Baru (4 Bln) Bonus Harian Propolis Prosmart Brazil (Import) Cari Leader/Stockist Jl. Sumut - Aceh Kami ahli bangun Network & Cetak org sukses Hub. Founder Ir. Ivan-Bdg 0813 2353 1188


11 CM Rp. 165.000 12 CM Rp. 180.000


HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab

Menjernihkan air kuning, Bau, berminyak, dll (Garansi) - Buat sumur bor (061) 7724 2772 / 0812 6096 8888


Grop Investor Siap Bantu Kucurkan Dana dan Mudah Disetujui. Jaminan Properti Hub. 0823 6732 1000 - 061.8222 774

jamaah haji dapat beribadah dengan baik. “Doakan juga Tanjungbalai inisupaya terhindar dari malapetaka atau bencana serta pemerintahnya tetap komit melaksanakan tugas pemerintahan, terutama tentang kemasalatan umat,” pesan Surya. Sementara itu, Kabag Humas D a r u l Ya n a S i r e g a r menambahkan, semula calhaj Tanjungbalai berjumlah 155 orang, namun karena faktor kesehatan, satu orang mengundurkan diri, yaitu Mukhtar Kuncu,84. Dikatakannya, untuk


NISSAN Livina XR M/T Thn. 2008. Biru Met. Bk Rp. 125Jt. Hub. 0812 6594 2789

TOYOTA Kijang Grand Extra Thn. 94. Abu2 gelap. Velg Chorm BR. Hrg. 74 Jt. HP. 0853 7394 6872

Ertiga, APV Arena, Carry Pick Up LIWAN: 0852 6111 7724

pesan Thamrin. Oleh sebab itu, Thamrin berharap, semua jamaah bisa menjalankanibadahdenganbaik dan lancar, sehingga kembali ke Tanjungbalaisebagaihajimabrur. “Kebaikannya bisa ditularkan untuk membantu menciptakan ketentraman dan kenyamanan di Tanjungbalai,” kata Thamrin. Dan, dengan be-gitu, pembangunan di Tanjung-balai akan berjalan lancar. Hal sama dikatakan Wakil Ketua DPRD Kota Tanjungbalai Surya Darma AR. Dia berharap

Tercecer / hilang Surat Tanah Sertifikat. Hak Milik (SHM) No. 444, a/n. Tumtum Halomoan Simanihuruk. Alamat Jalan H. Agus Salim No. 6 Lk. 1 Kelurahan Jatinegara Kec. Binjai Utara.




LPGTK/PAUD Favorit Butuh cepat SMU/D3/S1 sbg guru, syarat kreatif Datang langsung hub: Jl. KH. Wahid Hasyim 92 Medan Tp, 4533875 - 4569269


SMU/D3/S1 syarat Kreatif, datang langsung: Jl. Karya Wisata No. 23A Johor Tp: 7861690 - 7862156 Medan


Kami Perusahaan yang bergerak di bidang Properti membutuhkan Karyawan untuk ditempatkan di bagian Marketing Dengan persyaratan: - Pria - Usia 19 s/d 30 thn - Pendidikan minimal SMU/ sederajat - Rajin, jujur, bertanggung jawab dan disiplin Lamaran ditujukan ke Harian Waspada dengan Kode “257”

1 Bh. Surat Keterangan Tanah, Alamat: Jl. Deli No. 24 Lingk. II Perbaungan. Kab. Serdang Bedagai An. Abdul Muin. Tercecer antara Perbaungan - Medan. DIJUAL Ruko 3 Tingkat, Baru Rehab, Keramik mar², Cocok buat usaha siap huni, alamat Jl. Sudirman dpn Kantor Pengadilan Lubuk Pakam Hub. 0811 652 306


Ukuran 7x15m, Lokasi Griya Martubung Jl. Tuar Indah 3 No. 251, Harga 90 Jt Hub. 0812 6323 7188 RUMAH PERMANEN BERTINGKAT

Di Pasar 3 Tembung, Uk. 18x11, KT 4, KM 2, RT 2, PAM, PLN, SHM, Sangat indah rumah Hub. 0813 6213 9613 - 0813 9642 3289


Perum. Pesona Nabila Blok D30, Uk. 7x14m, Uk. Bg 7x6m, SHM, Full keramik, 2 KT, 1 KM, Pintu/ jerjak besi Kp. Lalang Sei Mencirim Krio 0823 6863 7456



Luas ± 132 Ha Letak Desa Babo Aceh Tamiang Harga nego Hub: 0853 7058 2175


PERUMAHAN SETIA JADI JL. BENTENG HILIR UJUNG BANDAR SETIA Type 45 (Luas Tanah 6x16m) Kopel Harga Rp. 160.000.000 Peminat hub: DEBBY: 0812 640 5162 HENDRIK: 0812 6074 1978



KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106

TERCECER 1 Buah Surat Tanah A/n. M. Daud Munthe Alamat Aek Matio Gg. Al Hidayah Kel. Sirandorung Kab. Labuhan Batu.




Surat Tanah A/n: Frans Sigiro Silalahi. Luas: 15 x 37M Di Jl. Martubung. Bagi yang menemukan Hub. 845 9060




Surat Sebidang Tanah di Martubung 15x37mtr Atas Nama Urbanus Sigiro Bagi yang menemukannya Hub. 0852 6087 1266


BPKB, Sepeda Motor Honda/NF125TR,125 CC, Thn Perakitan 2008,BB 3039 HL, Warna Hitam, Pendaf: 891BR03122008,A/N:Winsan Harahap, Alamat Desa Aek Pining Kec Batangtoru, Kab Tapsel.


JL. KEDIRI NO. 36 MEDAN TELP. 451.6161


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222

Sumatera Utara

B12 Kota

Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:18 12:31 12:18 12:25 12:25 12:22 12:18 12:14 12:21 12:20

15:27 15:43 15:28 15:37 15:36 15:28 15:27 15:23 15:30 15:31

Magrib 18:21 18:34 18:22 18:29 18:28 18:26 18:22 18:17 18:24 18:24



Shubuh Syuruq


19:29 19:42 19:30 19:37 19:36 19:34 19:30 19:26 19:32 19:32

04:48 05:01 04:48 04:56 04:55 04:52 04:48 04:44 04:51 04:50

04:58 05:11 04:58 05:06 05:05 05:02 04:58 04:54 05:01 05:00

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:12 06:26 06:13 06:20 06:19 06:16 06:12 06:08 06:15 06:15

Zhuhur ‘Ashar 12:24 12:17 12:16 12:28 12:15 12:16 12:16 12:13 12:31 12:17

15:36 15:27 15:26 15:38 15:22 15:25 15:24 15:20 15:43 15:24



Imsak Shubuh Syuruq


18:27 18:20 18:19 18:31 18:19 18:20 18:20 18:16 18:34 18:21

19:35 19:28 19:28 19:39 19:27 19:28 19:28 19:25 19:42 19:29

04:54 04:47 04:46 04:58 04:45 04:46 04:46 04:43 05:01 04:47

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

05:04 04:57 04:56 05:08 04:55 04:56 04:56 04:53 05:11 04:57

06:18 06:11 06:10 06:22 06:09 06:10 06:10 06:07 06:25 06:11

Zhuhur ‘Ashar 12:17 12:19 12:28 12:21 12:18 12:25 12:13 12:23 12:16 12:16

15:24 15:27 15:40 15:29 15:28 15:36 15:22 15:33 15:24 15:25

WASPADA Jumat 28 September 2012




Shubuh Syuruq


18:21 18:22 18:32 18:25 18:22 18:28 18:17 18:27 18:20 18:19

19:29 19:30 19:40 19:33 19:30 19:36 19:25 19:35 19:28 19:27

04:47 04:49 04:59 04:51 04:48 04:55 04:43 04:54 04:46 04:46

04:57 04:59 05:09 05:01 04:58 05:05 04:53 05:04 04:56 04:56

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:11 06:13 06:23 06:15 06:12 06:19 06:07 06:18 06:10 06:10

Zhuhur 12:14 12:21 12:19 12:15 12:16 12:14 12:13 12:23 12:17 12:12 12:14

‘Ashar Magrib 15:19 15:26 15:27 15:24 15:25 15:20 15:19 16:35 15:25 15:19 15:22

18:18 18:25 18:22 18:18 18:20 18:17 18:17 18:26 18:21 18:16 18:17



Shubuh Syuruq

19:26 19:33 19:31 19:26 19:28 19:25 19:25 19:35 19:29 19:24 19:25

04:44 04:51 04:49 04:45 04:46 04:44 04:43 04:53 04:47 04:42 04:44

04:54 05:01 04:59 04:55 04:56 04:54 04:53 05:03 04:57 04:52 04:54

06:08 06:15 06:13 06:09 06:11 06:08 06:07 06:18 06:11 06:06 06:08

Angkut 50 Jerigen Crude Oil Ilegal, Suzuki Carry Terbakar P. BRANDAN (Waspada): Mobil Suzuki Carry pick up mengangkut 50 jerigen bahan bakar minyak jenis crude oil diduga hasil penambangan liar, Rabu (26/9) malam sekira pukul 19:40, musnah terbakar di Dusun Bukit I, Desa Securai Selatan, Kec. Babalan, Langkat. Akibat terbakarnya mobil juga menghanguskan rumah semi permanen milik Wakidi, termasuk bagian dapur rumah dinas penjaga sekolah dasar yang sudah lama tak ditempati. Tidak ada korban jiwa, namun kerugikan mencapai ratusan juta rupiah. Menurut keterangan, malam itu mobil Suzuki Carry BK 8994 BY dikemudikan, Patra Ginting membawa minyak mentah (crude oil) dari lapangan sumur liar. Di perjalanan,

minyak hasil eksploitasi ilegal tersebut terbakar tanpa diketahui penyebabnya. Sebagian minyak yang tumpah langsung mengalir dibawa arus hujan bersamaan dengan kobaran api ke bangunan rumah Wakidi. Warga berupaya memberi pertolongan, namun mereka tak mampu memadamkan api. Kobaran api baru dapat dipadamkan setelah satu unit mobil pemadam kebakaran milik Pemkab Langkat yang

Kacabjari P. Brandan Diganti STABAT (Waspada): Jabatan Kepala Cabang Kejaksaan Negeri (Kacabjari) Pangkalan Brandan Kab. Langkat diserahterimakan dari M. Amin, SH kepada Imang Job Marsudi yang sebelumnya Kasi Intel Kejari Lamongan, Jatim. M. Amin akan dipromosi menjadi Kasi Intel Kejari Bandar Lampung. Acara pisah sambut digelar di Aula Kejari Stabat, kemarin. Kajari Asep Nana Mulyana menyampaikan apresiasi atas kinerja pejabat lama dan akan mendoakan mudah-mudahan di wilayah tugas baru dapat meningkatkan prestasi. Sementara untuk pejabat baru diucapkan selamat bertugas. (a03)

Operasi 86 Penderita Katarak SEI RAMPAH (Waspada): Poldasu, Polres Serdang Bedagai bekerjasama dengan Yayasan Budha Tzuchi Indonesia melaksanakan operasi katarak gratis terhadap 86 penderita, di Mapolres Sergai Jalinsum Medan Tebingtinggi, Desa Firdaus, Kec. Sei Rampah, Kab. Serdang Bedagai, kemarin. Kapolres Sergai AKBP Arif Budiman, SH, S.Ik didampingi Ketua Bhayangkari dan segenap pengurus berterimakasih kepada Wardi dan relawan Bhuda Tzuchi Indonesia yang membantu operasi katarak masyarakat kurang mampu. Kata Kapolres, ini merupakan rasa persaudaraan dan kasih sayang sebagai sesama manusia, sehingga orang tidak bisa melihat jadi bisa melihat, terlebih bagi orang tidak mampu.(a08)

Warga P. Brandan Dambakan Perbaikan Infrastruktur P. Brandan (Waspada):Warga Pangkalan Brandan Kab. Langkat mendambakan pembangunan infrastruktur jalan, kata Ketua PK Golkar Kec. Sei Lepan, H. Ibrahim Azmi dan Wakil Sekretaris PK Golkar Kec. Babalan Budi Hermanto Nas, Rabu (26/9). Perbaikan infrastruktur jalan di hampir seluruh ruas badan jalan yang ada di Pangkalan Brandan, akan berdampak positif terhadap daerah sekitar. Warga sangat berharap gagasannya mengatasi masalah yang ada, harus mengacu lebih banyak di lapangan, sehingga menyerap langsung masalah yang ada. “Pemimpin setiap kecamatan harus melaksanakan tugas dan fungsinya (Tupoksi), menginisiatif gagasan, saran atau pun masukan dari warga dan mengontrolnya langsung secara rutin. “Kita mesti bongkar kebiasaan lama,” ujar Budi Hermanto Nas.(a04)

Belajar Mengemudi, Mobil Terbakar STABAT (Waspada): Mobil Daihatsu Xenia silver BK 1310 ZC milik Dr. Syadatina, warga Komplek Padang Hijau Kec. Sunggal, terbakar di Jalan T. Umar depan Asrama Polri Stabat. Informasi diperoleh dari salah seorang perwira Polres Langkat yang bermukim tidak jauh dari lokasi kejadian, sopir diduga masih belajar mengemudi. Saat membelok ban depan mobil masuk parit. Kemudian saat mundur, ke luar percikan api dari bagian belakang mobil hingga terjadi ledakan kecil dan perlahan seluruh bagian mobil hangus. Warga menyesalkan kinerja petugas pemadam kebakaran yang dihubungi berkali-kali tapi terlalu lama sampai di lokasi, sehingga mobil tidak dapat diselamatkan. Penyebab pasti pada kejadian Selasa (25/9) sore itu masih diselidiki aparat kepolisian.(a03)

Waspada/Abdul Hakim

MOBIL Daihatsu Xenia hangus terbakar di Jalan T. Umar Stabat.

MUI Binjai Kutuk Pembuatan Film Innocent Of Muslim BINJAI (Waspada): Ketua Majelis Ulama Indonesia (MUI) Kota Binjai DR. HM Jamil, MA di depan calon jamaah haji kota Binjai, Wali Kota Binjai, Ketua DPRD Binjai dan unsur Muspida Binjai di Pendopo Umar Baki, kemarin menyatakan, mengutuk dan menyesalkan pembuatan film “Innocent of Muslim” yang isinya menghina agama Islam. Ketua MUI DR. HM Jamil, MA didampingi Sekum Jafar Sidiq, S.Ag minta umat Islam di Binjai tidak menonton dengan membuka jaringan internet yang menyiarkan film tersebut. “Sudah terlalu banyak film yang menghina umat Islam, tapi tidak akan mudah dipercaya oleh umat Islam.” ujar Jamil. Sebab umat Islam sudah pintar dan keyakinannya teruji. Kepada calon jamaah haji asal Binjai, tidak usah ikut unjukrasa. lebih baik mendoakan, pembuat film yang menghina umat Islam itu diberikan petunjuk oleh Allah SWT, sehingga ia mengetahui kebesaran Islam dan Nabi Muhammad SAW.(a04)

selama ini standby di arel kantor camat Sei Lepan turun ke lokasi. Akibat peristiwa ini Wakidi menderita kerugian Rp70 juta. Korban tak hanya kehilangan rumah serta harta benda, tapi material bangunan berupa kusen yang baru ditempah untuk membangun rumahnya. Peristiwa serupa juga terjadi sembilan hari lalu, tepatnya 18 September di areal perkebunan kelapa sawit di Desa Bukit I. 10 Drum atau sekitar 2 ton lebih crude oil terbakar, namun peristiwa ini tidak menimbulkan korban jiwa.

Kapolsek P. Brandan, AKP Zainuddin Lubis dikonfirmasi Waspada, Kamis (27/9) mengatakan, saat ini pihaknya sedang melakukan proses penyelidikan. Secara terpisah, Kepala Layanan Operasi (KLO) PT Pertamina EP Field Pangkalansusu, Daniel Munthe mengatakan, capaian produksi minyak mentah dari penambang liar di Kab. Langkat 70 ton per hari atau setara 444 barel/day, sementara hasil produksi Pertamina ratarata 420 barel/day. Masalah penambangan ilegal ini, menurutnya, bukan

delik aduan, sebab dalam regulasi UU Migas sudah diatur secara jelas dan tegas tentang sanksisanksi hukum bagi pihak yang memproduksi, mengangkut, menyuling dan menjual minyak secara ilegal. “Penindakan itu bukan domainnya Pertamina, melainkan aparat penegak hukum,” ujarnya seraya menambahkan, Senin (1/10) depan, BP Migas, Badan Lingkungan Hidup (BLH), Pertamina Manajemen Resiko, Dinas Pertambangan Energi, dan unsur terkait lainnya menggelar sosialisasi.(a02)

Main Judi, Empat Oknum PNS Dishub Ditangkap TEBINGTINGGI (Waspada): Lagi asik main judi leng, 4 oknum PNS di Dinas Perhubungan (Dishub) KotaTebingtinggi dan seorang warga ditangkap aparat Polres Tebingtinggi di kantin belakang kantor Dishub di Jalan Gunung Agung, Kel. Tanjung Marulak, Kec. Rambutan, Tebingtinggi, Rabu (26/ 9) sore sekira pukul 17.00. Barang bukti 2 set kartu joker dan uang Rp54.000 diamankan petugas. Ke empat PNS tersebut M.RS, 46, Ar, 45, SH, 51, M.Y, 48, MT, tertangkap dalam keadaan berpakaian

dinas dan satu lagi seorang warga sipil, MT alias Munis, 52, warga Jalan Badak, Tebingtinggi. Berdasarkan informasi, ke empat PNS tersebut bukan pegawai biasa tapi sudah setingkat eselon tiga dan empat. Tapi beberapa saat setelah dimintai keterangan, ke empat oknum PNS beserta seorang warga itu dilepas kembali. Kapolres Tebingtinggi melalui Kasubag Humas AKP Ngemat Surbakti membenarkan penangkapan 4 oknum PNS yang sedang bermain judi di kantin belakang kantor mereka. “Memang benar

pelaku ditangkap tapi tidak ditahan, karena terkena pasal 303 bis KUHP yang ancaman hukuman di bawah empat tahun. Mereka bermain judi hanya iseng mengisi waktu bukan mencari keuntungan,” ucapnya. Sementara itu, Kadishub Djayardi, BA ketika dikonfirmasi melaluiteleponmengakuiadanya 4 oknum anggota dishub yang tertangkapmainjudi.“Sayasudah peringati mereka agar tidak main judi, tapi masih main. Mereka akan kita panggil karena sampai saat ini belum ada laporan ke saya,” janji Djayardi.(a11)

Rp23 M Anggaran Untuk RSU DR Djoelham Binjai BINJAI (Waspada): Tahun depan Pemerintah Kota (Pemko) Binjai mengajukan dana lebih dari Rp15 miliar untuk meningkatkan sarana Rumah Sakit Umum (RSU) DR Djoelham Binjai, dan Rp8,8 miliar untuk peningkatan sarana dan prasarana Puskemas dan Puskesmas Pembantu (Pustu) di Kota Binjai. Wali Kota Binjai, HM Idaham, SH, M.Si dalam rapat paripurna pembahasan P.APBD Kota Binjai, Selasa (25/9) di gedung DPRD Binjai, mengatakan, dana tersebut kucuran dari APBN dan tidak termasuk dalam APBD Kota Binjai. Rp15 miliar diperuntukkan bagi pembelian alat-alat kesehatan (alkes) di antaranya 15 set city scan dan perbaikan sarana dan prasarana kesehatan di Pusat Kesehatan Masyarakat (Puskesmas) rawat inap di Kel. Tanah Tinggi, Kec. Binjai Timur dan Kel. Limau Sundai, Kec. Binjai Barat, dimana pasiennya mencapai 70 orang per bulan.

“Kita akan rehab dan perbaiki fasilitas sarana dan prasarana Puskesmas rawat inap yang ada, mengingat tingginya kebutuhan masyarakat Kota Binjai terhadap layanan kesehatan yang baik terutama bagi pasien Jampersal, hingga kini tercatat lebih dari 70 orang/bulan pasien yang dirawat. Jadi ada dana Rp8,8 miliar dari APBN langsung nantinya akan kita perun-

tukkan ke sana,” ujar Idaham. Sementara anggota Fraksi PartaiKeadilanSejahtera,Su-harjo dalam pandangan umumnya menilaitidakhanyapentinguntuk meningkatkan fasilitas dari RSU DR.DJoelhamBinjai,namunpenting juga ditinjau dari pelayanan RS milik pemerintah itu, karena selama ini sebagai RS yang telah terakreditasi B itu masih jauh dari harapan masyarakat.(a05)

Murid SD Tewas Di Kolam Sekolah STABAT (Waspada): Irwansyah, bocah kelasVI SD Kel. Paya Mabar Stabat Kab. Langkat, tewas di kolam belakang gedung sekolahnya saat mandi-mandi, Kamis (27/9) siang. Informasi dihimpun, korban bersama teman-temannya usai pulang sekolah mandimandi di kolam tersebut yang airnya semakin dalam pasca hujan Rabu malam. Entah ba-

gaimana korban yang tidak pandai berenang begitu melompat ke kolam langsung hilang. Teman-temannya melihat Irwan tidak muncul ke permukaan langsung memberitahu warga dan dilakukan pencarian. Beberapa saat kemudian anak ke tiga pasangan Tukiran dan Atik itu ditemukan dalam keadaan tak bernyawa.(a03)

Kebahagiaan Dunia Dan Akhirat Harus Disejajarkan HAJI merupakan ibadah yang wajib dilaksanakan bagi umat Islam yang mampu untuk melaksanakannya. Ibadah haji juga merupakan salah satu wadah guna memperoleh kebahagiaan di akhirat kelak. Manusia sebagai makhluk ciptaan Allah SWT dalam menjalani kehidupan seharihari diharuskan untuk melaksanakan amal ibadah sesuai syariat agama, dan amal ibadah tersebut sangat dibutuhkan manusia untuk mendapat kebahagiaan hidup di dunia dan akhirat. Mendapatkan kebahagiaan hidup di dunia dan akhirat kelak selalu tertanam di benak salah satu calon jamaah haji asal Medan, Timur Tumanggor, tergabung dalam kloter 8, yang direncanakan bertolak ke tanah suci melalui Bandara Polonia pada Sabtu (29/9). Menurut Timur yang berprofesi sebagai PNS di lingkungan Pemkab Deliserdang dan kini menjabat Sekcam Patumbak, meski cobaan dari Allah SWT dalam menjalani kehidupan sehari-hari kerap menghampiri, namun kebahagiaan yang dirasakannya tidak dapat ternilai dengan apa pun. Nilai kebahagiaan itu juga makin bertambah se-

iring keberangkatannya menunaikan ibadah haji bersama istri BoyaYanti Gultom, dan ibunda tercinta Letap Mungkur. “Alhamdulillah Allah SWT memberi kesehatan bagi kami untuk melaksanakan ibadah haji bersama-sama,” ungkap mantan Sekcam Pagar Merbau ini. Pria kelahiran 1973 yang sudah dikaruniai dua putra dan

satu putri ini berharap Allah SWT memberi kesehatan dan keikhlasan bagi mereka selama menjadi tamu Allah, selama menjalankan seluruh rukun dan wajib haji. “Insya Allah menjadi haji mabrur sehingga cita-cita memperoleh kebahagiaan akhirat dapat terwujud,” kata pria yang murah senyum ini. * Andi Nasution

Waspada/Andi Nasution

TIMUR Tumanggor bersama istri Boya Yanti Gultom, calon jamaah haji asal Medan tergabung dalam kloter 8 yang akan bertolak ke tanah suci.

Waspada/HM Husni Siregar

BUPATI Deliserdang Drs.H.Amri Tambunan bersama Ketua TP PKK Ny.Hj.Anita Amri Tambunan dan Ketua Dekopinda Zulkifli Utama, SE meninjau stand UKM Fair 2012, pada HUT Koperasi tingkat Deliserdang, di Lapangan Garuda Tanjungmorawa.

HUT Koperasi Ke 65 Di DS Diwarnai Penyerahan Bantuan Dan UKM Fair TANJUNGMORAWA (Waspada): HUT Koperasi ke-65 tingkat Kabupaten Deliserdang 2012 diwarnai penyerahan bantuan dana bergulir, penghargaan koperasi berprestasi tingkat Pusat, Provinsi/Kabupaten, bantuan kepadapesertadiklat,beasiswadariPusatKoperasi Pegawai (PKP) RI, pinjaman modal KUR. Juga diserahkan bantuan bedah dua rumah bagi warga kurang mampu, bakti sosial donor darah serta pemeriksaan darah gratis dari PMI dan PT Askes serta pembukaan pameran stand Usaha Kecil dan Menengah (UKM Fair 2012), di LapanganGarudaTanjungmorawa,kemarinsore. Acara dihadiri Bupati Deliserdang Drs. H. Amri Tambunan, unsur Muspida, anggota DPRD, Ketua TP PKK Ny. Hj. Anita Amri Tambunan,Wakil Ketua TP PKK Ny. Hj. Asdiana Zainuddin, Kadis Koperasi dan UKM Ir. Syarifah Alwiyah, MMA, pimpinan SKPD, Camat seDeliserdang, pimpinan BUMN, BUMD/ Perbankan, pelaku ekonomi dan lainnya. Bupati Drs. H. Amri Tambunan mengatakan hariKoperasimerupakanhariyangpatutdijadikan sebagai momentum mengevaluasi diri dengan terus memperbaharui tekad dan semangat bergerak bersama menjadikan koperasi tampil sebagai sokoguru perekonomian bangsa. Bupati mengucapkan selamat kepada KPRI

kantor Kementerian Agama Deliserdang yang meraih predikat “Koperasi Berprestasi” tingkat Nasional. Demikian juga penghargaan Bakti Koperasi dari Kementerian Koperasi dan UKM diperoleh Ketua Dekranasda Deliserdang Ny. Hj. AnitaAmriTambunan,untukdapatdijadikanmotivasi pengembangan perkoperasian di daerah ini. Sementara Ketua Panitia Zulkifli Utama, SE menjelaskan peringatan HUT Koperasi Ke 65 selain UKM Fair juga memamerkan berbagai hasil UKM dirangkai pemberian bantuan dan penghargaan kepada 12 koperasi berprestasi, bantuan kepada 33 peserta Diklat teknisi HP, 10 peserta Diklat pembuatan Syrup, tiga kelompok peserta Diklat digital printing, 50 penerima beasiswa, hadiah bagi peserta lomba tangkas terampil, bantuan kepada enam Kopwan (KoperasiWanita) berupa mesin tik dan filing cabinet serta dua koperasi penerima badan hukum koperasi. Juga diserahkan bantuan pinjaman modal KUR/bantuan dari BUMN/Perbankan masingmasing kepada tiga UKM dari Bank Syariah Mandiri Cabang Lubukpakam, lima UKM dari PT Angkasa Pura, empat UKM dari PT Jamsostek, satu koperasi dari Bank Muamalat Cabang Lubukpakam dan dua unit rumah yang baru selesai dibedah oleh PT Jamsostek.(a06)

Di Sumut, 300 Ribu Bayi Lahir Setiap Tahun TEBINGTINGGI (Waspada): Diperkirakan setiap tahun 300 ribu bayi lahir di Sumut. Angka kelahiran itu sama dengan kelahiran dua kota baru sekelas kota Tebingtinggi yang total penduduknya sekira 150 ribu jiwa. Tingkat vertilitas sebesar itu, ke depan jelas akan mengancam keberadaan berbagai sumber daya yang ada, jika tidak dibatasi secara sistematis. Karenanya program keluarga berencana dengan dua anak memang harus didukung. Wali Kota Tebingtinggi Ir. H. Umar Z Hasibuan, MM menegaskan itu, pada acara pembukaan ‘Program KB Nasional Terpadu’ kerjasama TNI Dengan BKKBN, Rabu (26/9), di halaman Makoramil 013 Tebingtinggi Jalan KF Tandean. Dukungan kota Tebingtinggi terhadap program KB, tambah Wali Kota, sudah dilaksanakan sejak lama. Satu di antaranya program KB pria yang tingkat partisipasinya terus meningkat setiap tahun. “Untuk kota Tebing-

tinggi target akseptor KB dari 3306 akseptor, telah mencapai 70 persen lebih,” terang Umar Z Hasibuan. Dandim 0204 DS Letkol Inf. Wawik Dwinanto, S.Sos, M.Si dalam sambutannya mengatakan pertumbuhan penduduk yang tidak terkendali akan menjadi beban bagi negara. Karena itu penting untuk mengingatkan kembali betapa pengendalian penduduk melalui perwujudan program KB Kesehatan dalam bentuk keluarga kecil, bahagia dan sejahtera. Sedangkan Kabid Akpin BKKBN Sumut Drs. Datang Sembiring mengakui kota Tebingtinggi sebagai pelopor utama program KB pria di Sumut. Dari data di Kantor Pemberdayaan Perempuan dan KB, total peserta KB baru aktif hingga Agustus 2012 mencapai 16.424 orang. Peserta KB baru 4.295 akseptor. Namun, masih terdapat sekira 6.741 pasangan yang belum melaksanakan program KB. Sehingga menjadi target diikutsertakan.(a09)

PT Rapala Sangkal Keterangan Kuasa Hukum Ketua LMP Langkat LANGKAT (Waspada): PT Raya Padang Langkat (Rapala) menyangkal keterangan kuasa hukum Ketua Laskar Merah Putih (LMP) yang menyatakan, kliennya SS tidak terlibat pencurian dan penadahan tandan buah segar kelapa sawit milik perusahaan. Asisten Afdeling PT Rapala, Daulat Siregar mengatakan, yang memerintahkan penjarahan TBS adalah SS, yakni oknum yang disebut-sebut memiliki kapasitas sebagai Ketua Laskar Merah Putih (LMP) Kab. Langkat. “Ada beberapa saksi yang melihat dan mendengar,” ujarnya kepada Waspada, Senin (24/9) Awalnya SS bersama seorang warga, DIP serta puluhan orang berseragam OKP menda-tangi areal perusahaan. Mereka mendobrak palang seraya merusak gembok dan menguber penjaga palang.“SS lah yang memerintahkan anggotanya menjarahTBS dari peron afdeling 5A,” terangnya. Buah hasil jarahan itu, sambungnya, mereka jual ke pabrik kelapa sawit (PKS) PT KA melalui delivery order (DO) yang dikeluarkan Uncang. Setelah buah terjual, pelaku kembali menjarah TBS dari peron 5B. Buah hasil curian ini diangkut pick up dikemudikan De. Sebelum meninggalkan lokasi kebun, lanjutnya, SS mengeluarkan ultimatum agar rumah atau barak yang ditempati karyawan PT Rapala segera dikosongkan dengan memberi batas waktu se minggu. “Saya dan beberapa

karyawan kebun tidak dapat berbuat apa-apa,” ujar asisten kebun itu. Merasa dirugikan, manajemen PT Rapala melaporkan aksi pencurian dengan pemberatan ini ke Mapolres Langkat yang berujung penangkapan tersangka DIP dan De. Kemudian, 8 September, penyidik menahan SS. Daulat Siregar mengatakan, awalnya kedatangan SS bersama DIK dan anggotanya mempertanyakan permasalahan surat terkait konflik tanah. “Saya bilang kepada mereka, bahwa surat yang mereka titipkan sudah saya sampaikan ke pimpinan, sedangkan saya tidak berwenang menjawab persoalan itu,” ujarnya. Advokad dari Kantor Bintang Keadilan, Maruli M Purba, SH, selaku penasihat hukum SS, sebagaimana diberitakan, mendesak Polres Langkat melakukan gelar perkara. Dia menilai, penetapkan SS menjadi tersangka pencurian dan penadah sawit terkesan dipaksakan. Tapi menurut kuasa hukum tersangka SS, kliennya ketika itu melarang membawa TBS dari lokasi PT Rapala, namun sopir mobil pick up, De, mengaku ia diperintah DIP. Menurut Maruli, penetapan tersangka terhadap kliennya berawal dari 26 Juli lalu. Ketika itu SS, Ketua LMP Kab. Langkat atas perintah LMP Sumut mendampingi DIP yang sedang terlibat perkara dengan perusahaan perkebunan PT Rapala di Kec. Besitang.(a02)


WASPADA Jumat 28 September 2012

07:30 Dahsyat 09.00 Sinema Pagi 11:00 Intens 12:00 Seputar Indonesia Siang 12:30 Sinema Pagi 14:15 Silet 14.45 Kabar Kabari 15.30 Olivia 16.30 Seputar Indonesia 17.00 Layar Drama : Hanya Kamu 18.00 Layar Drama Indonesia : Puteri Bidadari 19.15 Layar Drama Indonesia : Yang Masih Di Bawah Umur 20.15 Layar Drama : Tukang Bubur Naik Haji 23.00 Mega Sinema RCTI 00.30 Seputar Indonesia


07:00 Inbox 09.05 Halo Selebriti 10:00 SCTV FTV Pagi 11.03 SCTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.00 Liputan 6 Terkini 14.30 Eat Bulaga Indonesia 16.00 Liputan 6 Terkini 16.30 SCTV FTV 17.00 Liputan 6 Petang 17.30 Putih Abu Abu 19.30 Ustadz Fotocopy 20.00 Liputan 6 Terkini 20.03 Si Biang Kerok 22.30 Liputan 6 Terkini 22.30 SCTV FTV Utama

08:00 Serial Pilihan 09:30 Kisah Unggulan 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Kribo 15:30 Lintas Petang 16:00 Animasi Spesial : Shaun The Sheep 16:30 Animasi Spesial : Chaplin And Co 17:00 Si Alif 18:00 Tendangan Si Madun Season 2 19:00 Aladdin 20:00 Dewi Bintari 21:00 Raden Kian Santang 22:00 Dia Ayu 23:00 Dangdut 01:00 Sidik

07:30 Curious George 08:00 Sinema Spesial 10:00 Pesbukers 11:30 Topik Siang 12:00 Klik ! 13:00 Tom & Jerry 13:30 Little Krishna 14:00 Tom & Jerry 14:30 Sinema Spesial 16:30 Coboy Junior 17:30 Topik Petang 18:00 Pesbukers 19:30 Catatan Si Olga 20:30 Boys Before Flowers 21:30 Sinema Spesial 23:30 Dokumenter

07:30 KISS Pagi 08:00 FTV Pagi 10:00 SinemaTV Spesial 12:00 Patroli 12:30 Drama Asia (Korea): Pasta 13:30 Drama Asia (Korea): Dream High 2 14:30 KISS Sore 15:30 Fokus 16:00 Sinema TV Unggulan 18:00 Miniseri Spesial 19:00 Serial Unggulan Spesial 20:00 Sinetron Unggulan: Tutur Tinular 22:00 Sinema Unggula

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.00 Headline News 10.05 Eleven Show 11.05 The Spring & Latern Festival 12.05 Metro Siang 13.05 Oasis 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 17.05 Metro Hari Ini 18.05 Suara Anda 19.05 Suara Anda 19.30 The Beauty Of Harmony 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 The Destroyed In Seconds 22.05 Provocative Proactive 23.05 Inside 23:30 Metro Sports

C1 07:30 Sinema Spesial 09:30 Cinta Cenat Cenut 10:30 Insert Siang 11:30 Jelang Siang 12:00 Reportase Siang 12:30 Sinema Spesial 14:15 Digital Clip 14:45 Sketsa 15:45 Show Imah 16:45 Reportase Sore 17:15 Insert 18:00 Dialogue 19:00 Tahan Tawa 20:00 Sketsa Prime 21:00 Bioskop Trans TV 23:00 Bioskop Trans TV

07.00 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Apa Kabar Indonesia Siang 15:30 Tabliqh Akbar 16:00 Live News Kabar Petang 19:00 Kabar Utama 20:00 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Telusur 22:30 KAbar Arena 23.00 Radio Show

08:00 Avatar 08:30 Dr. Dolittle 3 09:00 Doo Bee Doo 10:30 Obsesi 11.30 Buletin Indonesia Siang 12.00 Indonesia Bicara 13.00 Awas Ada Sule 14.00 Hot Spot 14:00 100% Ampuh 16:00 Fokus Selebriti 16:30 Oggy and The Cockroach 17.00 Kartun 19:00 Mantu Mantu Morotin Mertua 20.00 Big Movies 20:30 Big Movies 21:00 Big Movies 23.00 Big Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

End of Watch Puncaki Box Office


Michael Bay Sutradarai Transformer 5

Dua film, End of Watch dibintangi Jack Gyllenhaal dan film horor dibintangi aktris Jennifer Lawrence House at the End of the Street, secara bersamaan menduduki puncak box office Amerika Serikat. Dari perkiraan awal, kedua film ini masing-masing menghabiskan dana 13 juta dolar AS. Di bawah kedua film ini ada Trouble with the Curve dibintangi Clint Eastwood dan Amy Adams pada pringkat ketiga. BBC melaporkan, pekan ini adalah pekan lesu dengan pendapatan 88 juta dolar AS, turun sekitar 25 persen dari priode sama tahun lalu. “Ini adalah bentrokan dari kaum non-Titan,” kata analis pelacak box office, Paul Dergarabedian. Film Inggris Dredd tampil perdana dengan cukup mengecewakan karena hanya berhasil menduduki peringkat keenam dengan penghasilan 6,3 juta dolar AS. Perks, film pertama Emma Watson setelah Harry Potter, hanya mengantongi 244 ribu dolar AS, namun film ini hanya bisa dinikmati pada empat bioskop saja. Film Finding Nemo kembali dirilis dalam fitur 3D ada pada pringkat keempat dengan penghasilan 9,4 juta dolar AS, sedangkan film Milla Jovovich, Resident Evil: Retribution jatuh dari posisi puncak ke posisi lima dengan 6,7 juta dolar AS.(ant)

End of Watch/

Meskipun sudah dipastikan akan menyutradarai film Transformer 4, sutradara film hollywood Michael Bay berencana sekali lagi menyutradarai film Transformer 5 karena Steven Spielberg juga ikut terlibat di dalamnya menjadi produser. Kabar tersebut datang dari salah satu aktor Glenn Marshower juga bermain dalam tiga film transformer sebelumnya. Ia mengatakan Michael Bay dan Steven Spielberg akan kembali berduet bukan hanya di film Transformer 4 tapi juga Transformer 5. Sebelumnya, Bay mengatakan kalau karya Transformer 4 akan menjadi seri terakhir dari film yang bercerita tentang robot ini. “Setelah saya melihat acara pembukaan di Universal Studio, Spielberg mengatakan berencana untuk menyutradarai tidak Michael Bay/ hanya film Transformer 4 tapi juga Transformer 5,” kata Glenn. “Jadi saya rasa Desember nanti kami akan sekaligus syuting film Transformer 4 dan 5,” kata Spielberg kepada Glenn seperti dikutip Dalam berita sebelumnya, syuting film dua seri ini dilakukan bersamaan untuk menghemat dana. Pada saat itu, Bay mengumumkan kalau ia tidak akan terlibat dalam Transformer 5 walaupun seri sebelumnya Transformer: Dark of the Moon merengguk kesuksesan besar. Bay memastikan akan menyutradarai Transformer 4 awal tahun ini dengan merekrut beberapa aktor tambahan. “Saya kira sudah saatnya berhenti. Dan tawaran itupun datang dan membuatmu berpikir akan ada yang mengambil peran ini. Lalu saya berpikir oke mungkin ini panggilan jiwa untuk kembali menyutradarai, ‘Ada derita ada hasil’.. dan pihak studio berjanji akan memperbarui kontrak waralaba film ini,” kata Bay. Menurut rencana Transformer 4 akan mulai ditayangkan di Amerika Serikat pada 27 Juni 2014 mendatang.(ant)

Aerosmith Rilis Album Baru Penggemar Aerosmith dapat mengharapkan album yang benar-benar mewakili era berbeda ketika debut Music From Another Dimension dirilis. Rilisan ini merupakan album gress pertama Aerosmith yang terbit selama delapan tahun belakangan, begitu menurut basis Tom Hamilton. “Album berisi 14 track adalah refleksi semua era karir musik kami selama ini terutama tahun 1970-an”, kata Tom Hamilton. Hamilton menjelaskan se-

mua anggota band turut berpartisipasi menulis lirik lagu, meskipun tim Tyler-Perry tentunya mendominasi. Aerosmith juga mencomot track dari album yang pernah terbit termasuk singel pertama Legendary Child. “Kami membuat tembangtembang dengan sangat antusias, ketika memproduksi album ini tidak memiliki produser atau pendukung dari perusahaan rekaman”, jelasnya. Album ini sangat mirip persoalannya dengan yang terjadi pada tahun 1970-an. Jack Dou-

07:30 Selebrita Pagi 08:15 Rekreasi Azis Nunung 08:45 Ga Nyangka 09:15 Ups Salah 09:45 Spotlite 10:45 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Koki Pintar 14:30 Brownies 15:00 Tau Gak Sih? 15:30 Jejak Petualang 16:00 Orang Pinggiran 16:30 Redaksi Sore 17:00 Indonesiaku 18:00 Hitam Putih 19:15 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata

glas pernah menjadi produser yang terlibat langsung menyaksikan dan merasakan proses produksi album yang kemudian menjadi track populer setelah dirilis. Begitu juga proses yang terjadi pada rekaman baru ini, tambah sang basis. Tembang cover Shakey Ground merupakan tembang hit dari album Temptation meskipun Aerosmith mendasarinya dengan versi Etta James. Hamilton menjelaskan, kelompok musik ini membutuhkan tembang-tembang ekstra untuk tur

Heidi Klum Jadi Pembawa Acara MTV

musik ke Jepang dan Eropa. Album ini juga melibatkan beberapa bintang tamu. Hamilton juga mengatakan bahwa bagian terbaik dari album Music From Another Dimension adalah bernuansa musik baru dimainkan ketika group metal ini memulai tur dengan Cheap Trick pada Juni lalu di Minneapolis. Aerosmith berencana melantunkan tembang Legendary Child dan tembang lainnya dari album baru yang dapat di download ponsel kamera para penggemar. Nur/thr

Heidi Klum/rtr

Mantan model ternama Heidi Klum akan pulang ke kampung halamannya karena terpilih menjadi pembawa acara MTV Eropa Music Award 2012 diadakan di Frankfurt, Jerman November mendatang. “Saya sangat terhormat bisa menjadi pembawa acara MTV EMA di kampung halaman saya di Jerman. MTV EMA merupakan malam besar untuk dunia musik, fesyen dan budaya dan saya senang bisa terlibat di dalamnya,” ujar dia dalam sebuah pernyataan seperti dikutip Acara ini akan diadakan Minggu, 11 November 2012 pukul 09.00 waktu setempat dan ditayangkan seluruh chanel MTV secara langsung. Berbagai nominasi di umumkan berbagai artis seperti Rihanna dan Taylor Swift. Artis dan pengisi acara lainnya akan diumumkan nanti.(ant)

Kevin Enjoy Dulang Rupiah Bareng Sang Mama


SEIRING kemajuan pesat karir musiknya plus segudang kesibukan baru mengibarkan perusahaan “Aprilio Kingdom” bidang manajemen artis dan Label rekaman, pemusik Kevin Aprilio,22 kini mendulang pundi-pundi rupiah bersama Memes – sang mama. “Kebetulan Mama sangat senang berbisnis, jadi seiring beroperasinya Aprilio Kingdom, beliau saya libatkan. Toh, dengan mendulang rupiah baremg Mama, saya merasa jauh lebih enjoy,” papar Kevin Aprilio kepada Waspada di Studio Antv Epicentrum Kuningan – Jakarta Selatan, baru-baru ini. Ditemui selepas jumpa pers program baru Antv September “Senandung Raya” seperti Coffee Prince, Tamu Rempong, Perempuan Hebat, Mata Lensa, Oh My Bos serta “Aprilio Kingdom” – reality show yang menceritakan keseharian Kevin sebagai remaja berprestasi dan sukses, mulai dari bangun tidur hingga tidur kembali.

Ia menyebutkan, dengan keterlibatan Sang Mama, dirinya bisa jauh lebih fokus dalam memajukan kiprah para artis dan pemusik yang bernaung dalam manajemennya. “Sementara Mama bisa fokus mengurus kontrak dengan para klient dan bertanggungjawab penuh soal keuangan,” papar Keyboardis sekaligus pentolan Vierra dan Girl band Princess. Program Aprilio Kingdom menayang di Antv setiap Kamis petang mulai pukul 16.30, menyuguhkan seluk beluk kegiatan keseharian dilakukan Kevin Aprilio Sumaatmaja termasuk kendala dalam mengurus band dan girl band asuhannya secara blak-blakan. “Karena berkonsep reality show, yang ditampilkan program ini apa adanya tak dibikinbikin. Nah, agar menarik disuguhkan secara fun dan edukatif hingga bisa memberi insprirasi kepada pemirsa Antv,” terang Kevin yang tengah gigih mengu-

Jennifer Lopez/rtr

Kevin dan Memes harus lebih gigih menyiapkan materi lagu-lagu untuk album band kami tersebut,” tandas kekasih Elma Agustin , salah satu personel Princess, menutup pembicaraan. * (AgusT)

Atambua39DerajatCelcius Tayang Perdana di Tokyo

Jennifer Lopez Goyang Jakarta Kabar baik untuk penggemar Jennifer Lopez karena pesohor yang akrab disapa JLo ini sudah memastikan siap menggoyang Jakarta pada 30 November mendatang, demikian Direktur Operasional Dyandra Media Internasional Danny Budiharto, Rabu. Pada tanggal itu JLo akan berada untuk tur bertitel “JLo Dance AgainWorld Tour 2012” digelar di MEIS Ancol, Jakarta Utara, dengan promotor Dyandra Production dan Stellar Entertainment. “Dari pihak JLo sudah mengonfirmasi, nanti Jumat, 30 November JLo akan tampil pada konser di Jakarta. Ini adalah tur dunia pertama JLo sejak 2007,” kata Danny di Jakarta. Konser digelar selama 1,5 jam, JLo akan membawakan lagulagu terangkum dalam album anyarnya, Dance Again: The Hits dirilis April lalu. Mantan juri American Idol ini juga dikabarkan akan membawakan beberapa hits miliknya. Dalam rangkaian tur dunianya kali ini JLo berkolaborasi dengan desainer Zuhair Murad dan Jamie King, sang penata konser. Mengenai tiket konser, Danny mengungkapkan akan menjualnya pada harga terendah Rp800 ribu dan harga tertinggi Rpp 3,5 juta. Selama menjadi penyanyi, JLo telah menelurkan delapan album, tiga kompilasi, dengan total 34 single. JLo mulai dikenal dunia melalui single perdananya If You Had My Love, selain memiliki beberapa lagu terkenal seperti Waiting for Tonight, Feelin’ So Good, Let’s Get Loud, Love Don’t Cost A Thing, dan Jenny from the Block.(ant)

mpulan lagu-lagu baru sekaligus berniat memproduseri sendri album terbaru Vierra band yang dijadwalkan beredar akhir tahun atau awal 2013. “Seiring rencana Vierra keluar baik-baik dari Label Musica Studios, saya

Atambua 39 Derajat Celcius/

Film terbaru garapan Mira Lesmana (Miles) dan Riri Riza, “Atambua 39 Derajat Celsius”, bakal tayang perdana dalam skala dunia (world premiere) di Tokyo International Film Festival (TIFF) pada Oktober 2012. “Rencananya world premiere-nya di Tokyo International Film Festival bulan depan. Saya harap teman-teman yang ada di Tokyo dapat hadir karena saya juga rencananya akan hadir,” kata Mira Lesmana di Jakarta. Mira mengatakan, penggarapan film yang bercerita tentang pengungsi-pengungsi Timor Timur pascareferendum pada 1999 tersebut memakan waktu kurang lebih setahun. Tokyo International Film Festival sendiri rencananya akan digelar pada 20 hingga 28 Oktober 2012. Mira juga mengatakan, “Atambua 39 Derajat Celsius” juga akan diputar di Rotterdam International Film Festival, Holland, pada akhir Januari 2013. Di Indonesia, menurut istri sineas Mathias Muchus tersebut, film diperankan Gudino Soares, Petrus Beyleto, dan Putri Moruk tersebut mulai tayang pada 8 November 2012. “Di Indonesia hanya akan tayang di 20 bioskop saja,” ujar Mira. Pada Januari atau Februari 2012 Miles dan awaknya akan berkeliling Nusa Tenggara Timur (NTT) untuk memutar film tersebut menggunakan media layar tancap.(ant)



Jangan Lucuti KPK


Prihatin Tawuran Pelajar Tanggung Jawab Siapa?


enteri Pendidikan dan Kebudayaan Prof M Nuh memberi solusi penanggulangan tawuran di Jakarta dan kota lainnya, pascatewasnya dua pelajar dalam sepekan belakangan ini. Keduanya tewas akibat tawuran antarpelajar di dua tempat berbeda. Peristiwa berdarah di Bulungan, seorang pelajar bernama Alawy Yusianto Putra (15), siswa kelas X dari SMA 6 harus meregang nyawa dengan luka bacok di dada yang dilakukan tersangka FR siswa SMA 70. Serdangkan peristiwa di Manggarai, Denny Januar (17), siswa SMA Yayasan Karya 66 kelas III IPS, tewas disabet samurai oleh pelajar SMK Kartika Zeni berinisal AD. Menurut Mendikbud meninggalnya Denny merupakan persoalan sosial yang yang harus diatasi secepatnya. Korban anak baik, dia tidak terlibat tawuran. Pelakunya anak nakal bahkan mengaku puas membunuh. Hal ini jelas persoalan sosial. Kita tidak boleh saling menyalahkan. Dua peristiwa tawuran massal pelajar di Jakarta itu merupakan beban berat dalam dunia pendidikan. Khususnya bagi pihak sekolah yang menampung anakanak yang memiliki beban sosial luar biasa. Lantas, apa solusinya? Ada tiga solusi untuk mengatasi tawuran di Jakarta, kata Nuh. Pertama, mengajak polisi bersama-sama melakukan sweeping senjata tajam lebih sering. Para sopir Metromini harus bisa diajak kerja sama. Kalau ada yang membawa barang yang dicurigai harus dirazia. Kedua, pihak sekolah harus mencermati perilaku anak didik. Pelaku tawuran mengidap penyakit sosial dan harus diberikan pendekatan khusus. Yang ketiga, dinas pendidikan bersama dewan, komite sekolah, lebih sering ketemu melihat langsung apa yang terjadi di lapangan. Hemat kita, banyak faktor mengapa pelajar selalu terlibat tawuran (antarsekolah) seperti kurangnya perhatian dan pengawasan orang tua di rumah, kurangnya perhatian dan pembinaan guru di sekolah, kurang berperannya masyarakat, kurangnya contoh teladan dari pemimpin, dan lemahnya penegakan hukum. Intisari Sekarang ini sudah banyak orang tua yang kurang punya waktu berkomunikasi dengan putra-putrinya di rumah karena Beginilah kalau kuriku- kesibukan kerja. Terkadang pergi kerja subuh lum pendidikan nasional anak belum bangun, pulang malam anak sudah tidur. Masih untung jika komunikasi menargetkan kepintaran lewat handphone (HP) masih terjalin. semata, mengabaikan Akibatnya apa?, perkembangan anak di dan luar sekolah menjadi terpendidikan budi pekerti sekolah abaikan, tak terpantau lagi. Padahal, peranan lingkungan tempat tinggal, pergaulan, dan keagamaan tontonan, bacaan anak ikut menentukan dan membentuk karakter anak-anak (pelajar). Pada dasarnya generasi muda banyak meniru fenomena sosial yang terjadi di sekitarnya, apalagi sarana komunikasi lewat media massa sudah mudah diakses sehingga berbagai aksi kejahatan, perkelahian, amoral, dan hal-hal yang tidak baik dapat dengan mudah dilihat sehingga membentuk karakter peniruan di kalangan pelajar. Tentunya yang mudah tertular bila si anak kurang mendapat bimbingan dari orang tua dan guru di sekolah,termasuk bimbingan spiritual (agama). Gontokgondokan antar anggota dewan di parlemen, perkelahian massal yang sering terjadi di perguruan tinggi, banyaknya pemimpin tidak taat hukum, korupsi merajalela, tingginya angka pengangguran, sulitnya mendapatkan pekerjaan, ujian CPNS yang sarat KKN, dan meluasnya kemiskinan sampai melebarnya kesenjangan sosial, semuanya itu menjadi ajang peniruan yang negatif. Kalangan pelajar tidak melihat pentingnya pendidikan. Stigma negatif dengan menyebut dunia pendidikan gagal memang ada benarnya. Lihat saja para pelaku korupsi pada umumnya orang-orang yang memiliki pendidikan tinggi, gelarnya profesor, doktor, magister, sarjana S-1 dll. Hal itu menjadi contoh jelek di mata pelajar kita, membuat mereka frustrasi, apalagi dari kalangan keluarga miskin dan bermasalah di lingkungan sosialnya. Justru itu, permasalahan tawuran pelajar ini perlu diantisipasi dengan cepat dengan teraphy komperhensif. Tidak cukup dengan tiga solusi yang ditawarkan Mendikbud. Tidak semudah itu karena permasalahannya sudah kompleks dan pasti gagal jika hanya satu-dua pihak saja yang serius, sementara pihak-pihak lain melakukan pembiaran, masa bodoh, termasuk penegakan hukum dan disiplin sangat lemah. Tanggung jawab kenakalan pelajar kita di kota-kota besar tidak hanya terkait tawuran pelajar yang semakin massiv, tapi di banyak kasus lainnya, termasuk kriminalitas, narkoba dll. Oleh karena itu negara harus bertanggung jawab terhadap masa depan generasi muda penerus bangsa. Bagaimana nasib bangsa kita ke depan apabila generasi mudanya saling bermusuhan, saling bunuh, saling membenci, saling membentuk geng, melibatkan diri dalam kriminalitas. Pastilah kita prihatin melihat kondisi dunia pendidikan kita yang hanya mengedepankan, menargetkan kepintaran semata, sementara hal-hal yang mendasar terkait akhlakul kharimah, sopan santun, pendidikan budi pekerti dan nilai-nilai keagamaan semakin terbaikan.+


Faks 061 4510025

Facebook Smswaspada

+6285295972744 TERKUTUK LAH AMERIKA DAN PERANCIS , Memang Perang Salib belum usai . Kafir kafir selalu berupaya meruntuhkan Islam dan kita jangan terlena hai umat Muslim . +6281376684657 Pak. Tambunan jika berhasil jadi Gubsu . Tolonglah yg di jln kongsi sebelah kiri usahakan menjadi pemko medan. Biar mudah utk membangun wilayah tersebut Selamat berjuang pak.kami tetap +6285277208887 Alhamdulillah kalau Sumut nanti dipimpin oleh org yg tidak munafik,tak ada bermain politik uang dan mengatakan yg benar.hukum dunia tak sebanding diakhirat yg menanti janji kampanye.... +6285261172936 Kita Sholat dimasjid sama ngaji sama mengantar mayi t kekubur sama _tapi untuk mendapatkan memberikan / menempatkan jabatan (pns atau di swasta) tidak sama _ tentu pilih kawan asal sa tu kampung >Melayu tidak masuk agenda _ Melayu mau membantu Melayu _ tidak tau/bisa karena tak ada in dentitas (marga) takalamat cam ar 13) Fauji Halim Nerilam (nergilama _ camar 3) dng tanda tersebut kita tau me reka melayu _ jadi tak pay ah kita Melayu untuk mem bantunya _ dan dng bermar ga dapat diharap merubah sikap sedikit mengurangi pe nyakit kesombongan dan kec ongkakkan sesama melayu _ karena Melayu biasanya kal au punya jabatan/kaya bias anya memang begitu _ nasehat Dtk Kempas bin Dtk Hitam _Terusan kempas +6281264100513 Tragedi Tragis Khatib Jum’at dipaksa turun dari mimbar di masjid Baitu A’la Mujahidin Beureunuen Kecamatan Mutiara Kabupaten Pidie - Daerah Istimewa Aceh yg terjadi Jum’at 21 Sept 2012 adalah preseden terburuk sepanjang tahun 2012 di Indonesia dan sesungguhnya tidak dapat ditolerir walau dgn alasan apapun krn Pejabat Khatib Jum’at itu memiliki otorita khusus dan Luar Biasa dlm menyampaikan risalah islamiyah. Terlepas dari controversial tentang materi khotbahnya maka sebaiknya diselesaikan secara wasyawirhum bilmau’izatun Hasanah atau dialog intelectual seusai rangkaian sholat sunnah Jum’at. Sepatutnya jama’ah masjid setempat memberi apresiasi atas materi khotbah itu baru kemudian dipertanyakan alasan-alasan aktual dan faktualnya berdsrkan. Al- Qur’an n As Sunnah. Semoga al mukarran ustd Tgk Usman AR diberi kekuatan lahir dan bathin dlm menjunjung tinggi syari’at islam yg murni. Wallahu A’lm +6285763330204 Dingin pagi masih membaluti jalanan ini lelap mata penghuni bumi masih terkatup mengejar mimpi yg tersisa,kayuhan ini kian cepat derak jerit sepeda usang ku mncoba melawan karat yg membalut tiap inci tubuh nya,ya aku harus menyiapkn duit utk anak ku demi menebus selembar kertas berharga dari perjuangan belajar selama tiga tahun, aku tak mengerti kemana tujuan program belajar gratis dari pemerintah yg nyata nya kami tetap di pungut biaya mencekik leher, setelah ini nak bapak tk tahu lg kemana mencari duit buat kelanjutn sekolah mu di saat kita semakin sulit utk menelan butiran beras dn kian pahit nya hidup +6282369985753 Salut!..kepada KPUD tapsel. atas PERMAINAN KKN nya. Bersama pihak kecamatan. Dalam PEREKRUTAN anggota PPK untuk PILGUBSU 2013. TOLONG JANGAN DI TERUSKAN !!! . untuk waspada terimakasih.

WASPADA Jumat 28 September 2012

Oleh Dr Suhrawardi K Lubis, SH, SpN, MH Dengan dalih revisi UU Nomor 30 Tahun 2002, DPR diduga berusaha melucuti keistimewaan lembaga KPK sebagai lembaga superbody penanganan korupsi.


eberapa waktu silam, kejengkelan masyarakat terhadap keadaanbangsadannegara serasa tersalurkan. Saat itu, televisi sering menayangkan sajak/puisi yang berjudul“Negerinya Para Bedebah” yang ditulis dan dibacakan sendiri oleh Adi Masardi. Isi sajak itu intinya menyampaikan protes terhadap keadaan negara yang carut marut. Banyak rakyat, merasa terwakili dengan protes dalam bentuk puisi tersebut. Beberapa hari belakangan ini, puisi Adi Masardi itu ditayangkan kembali di salah satu stasiun televisi swasta nasional. Apakah negeri ini carut marut? Entahlah, yang pasti keberadaan Komisi Pemberantasan Korupsi (KPK), sebagai lembaga superbody pemberantasan korupsi di Indonesia, sekarang ini sedang dirisaukan masyarakat. Kerisauan itu terbelah pada duakelompok.Kelompokpertamaadalah parakoruptordenganantek-anteknyadan kedua kelompok masyarakat yang risau disebabkan KPK hendak dilucuti. Kelompok pertama berusaha sekuat tenagauntukmemeretelidanmembonsai KPK. Sedangkan kelompok kedua berkeinginan agar KPK tetap menjadi lembaga superbody, yaitu tetap menjadi lembaga yang memiliki keistimewaan dalam pemberantasan korupsi dibandingkan dengan kepolisian dan kejaksaan. Goyangan Silih Berganti Usaha menggoyang KPK sesungguhnyasilihberganti.PadamasaPatrialisAkbar (Politisi PAN) menjabat sebagai Menteri pada Kementerian Hukum dan HAM, ia pernah mengajukan Naskah Rancangan Undang-UndangTindak Pidana Korupsi (RUUTipikor).RUUtersebutjugamemuat pasal-pasal yang melucuti kewenangan KPK. Alhamdulillah, naskah RUU Tipikor itu mentok sampai di Sekretariat Negara dan buru-buru ditarik kembali sebelum disampaikan ke DPR-RI. Ketika itu, rakyat Indonesia berlega hati, karena KPK tidak jadi dilucuti. Selain kasus di atas, seperti dijelaskan dalam berbagai media, pada April 2009 KPK digoyang lagi dengan penetapan Ketua KPK Antasari Azhar

sebagai tersangka kasus tindak pidana pembunuhan berencana terhadap NasruddinZulkarnaen,direkturPutraRajawali Banjaran. Akhirnya, Antasari divonis 18 tahun penjara, hingga kini masih meringkuk di Lembaga Pemasyarakatan (LP). Sampai sekarang, masih banyak yang memandangkasusini sebagairekayasauntuk melemahkan KPK. Kemudian bulan September 2009, KPK dihantam kasus Cicak versus Buaya. Kasus ini bermula dengan penyadapan telephone yang dilakukan KPK terhadap Susno Duadji, Kepala Bareskrim Mabes Polri waktu itu. Tak lama setelah penyadapan, Chandra Hamzah dan Bibit Slamat Riyanto dinonaktifkan dengan tuduhan menyalahgunakanwewenangmengeluarkan pencekalan terhadap pengusaha Anggoro Widjoyo dan Joko Tjandra. Lebih lanjut pada Oktober 2011, goyanganberikutnyadatanglagi.Padawaktu itu, anggota DPR RI F-PKS, Fahri Hamzah yang jugaWakil Ketua Komisi III DPR (dalam rapat konsultasi dengan Jaksa Agung, Basrief Arief dan Kapolri, Jenderal Timur Pradopo) menyuarakan pembubaran KPK.FahriHamzahberalasan,bahwaKPK sudah kebablasan dan sudah menjadi lembaga superbody yang tidak mau diawasi oleh pihak luar KPK. Goyangan berikutnya terjadi bulan Desember 2011, ketika Nazarudin, Bendahara Umum Partai Demokrat (yang jadi tersangka proyekWisma Atlet) melontarkan nyanyian yang syairnya menyebut petinggi KPK sebagai perampok. Karena itu kekayaan pimpinan KPK perlu diaudit. Akhirnya, ketika itu Pusat Pelaporan Analisis danTransaksi Keuangan (PPATK) mengeluarkan laporan transaksi keuangan pimpinan KPK. Goyangan selanjutnya, keenggananMabesPolrimemperpanjang masa tugas penyidik Polri yang ditugaskan di KPK. Padahal, KPK sangat membutuhkan tenaga penyidik tersebut tetap berada di KPK. Jangan Lucuti Goyangan teranyar dan sangat mengkhawatirkan adalah usaha pencopotan kewenangan-kewenangan susbtansial yang dimiliki KPK. Dengan dalih revisi UU

Nomor 30 Tahun 2002, DPR diduga berusaha melucuti keistimewaan lembaga KPK sebagai lembaga superbody penanganan korupsi. Keistimewaan yang membuat KPK sebagai lembaga superbody adalah kewenangan untuk melakukan penyadapan, penuntutan dan tidak mengeluarkansuratperintahpemberhentian penyidikan. Kewenangan istimewa ini, dalam draf revisiUUNomor30Tahun2002telahdicabut. Pencabutan tersebut tentulah akan membuat KPK menjadi mandul tidak bertenaga dan ompong tidak berdaya untukmemburuparapencuridanperampok serta maling uang negara. Menanggapi rencana pencopotan kewenangan istimewa tersebut, ketua KPK Abraham Samad (seperti diberitakan media ibu kota pada Minggu, 23/9) mengancam akan mengundurkan diri. Beliau mengemukakan bahwa“saya sedang berpikir-pikir untuk tidak melanjutkan kepemimpinan saya”. Sikap tegas Ketua KPK Abraham Samad ini perlu mendapat dukungan dari masyarakatluas.Sebabapabilakewenagan KPK untuk melakukan penyadapan, penuntutan dan tidak mengeluarkan surat perintahpenghentianpenyidikandicabut, tentulah KPK akan mandul dan loyo tidak bertenaga. Sikap Ketua KPK, Abarham Samad ini diapresiasi oleh Teten Masduki (SekjenTII), Endriartono Sutarto (mantan PanglimaTNI)danJimlyAsshiddiqie(man-

tan Ketua MK).Teten Masduki mengemukakan“Ini pasti usulan koruptor. Sudahlah, memang negeri ini negeri maling. Kalau benar kewenangan KPK dipereteli, lebih baik Samad mundur saja, kalau perlu, semuapimpinanKPKmundursaja”.Sedangkan Endriartono Sutarto dan Jimly mengemukakan “Daripada dilemahkan, lebih baik KPK dibubarkan saja”. Kekhawatiran Ketua KPK Abraham Samad atas rencana pengerdilan kewenangan tersebut tentu pantas mendapat perhatian dari rakyat. Sebab, dengan kewenangan istimewayangdimilikiKPKsaat ini saja, perilakukorupsiterusberkembang dan menyebar kemana-mana. Konon lagi kewenangan istimewa tersebut dilucuti, tentudapatdipastikanprilakukorupsiakan semakin masif dan menggurita. Karena itu untuk kebaikan bangsa dan negara, sepantasnyalah rakyat mendukung agar KPK jangan dilucuti. Rakyat harus mengawal dan mengawasi serta melawansetiapgerak-gerikdanusahaDPR untuk memangkas wewenang istimewa KPK. Sebab, kalau pemangkasan kewenangan KPK berhasil disepakati DPR, tamatlah sudah kedigdayaan KPK dan tentu KPK akan lemah tak berdaya. Manakala itu yang terjadi, tentulah bendera para koruptorsemakinberkibar.Wallahua’lam. Penulis adalah Wakil Ketua PW Muhammadiyah SU, Dosen UMSU Dan Peneliti RUT-ISDEV USM Malaysia.

Amri, AY, CH, Gatot, Gus, RE: Tirulah Jokowi Oleh Sofyan Harahap Pilgubsu tahun depan dipastikan seru dan menarik.Politik pencitraan meniru trik dan strategi Jokowi nan sederhana, merakyat,dan memberi perspektif atau harapan baru bagi perbaikan kehidupan warga masyarakat yang sudah capek dibodohi.


engetikan nama/inisial/panggilan terhadapenamCagubpalingpopulardidalampollingPAPS(PartaiApa Pilih Siapa) sengaja dibuat berdasarkan abjad. Mereka itulah yang sesungguhnya paling berpeluang dipilih parpol pengusungdanbakallaku‘’dijual’’kepublik.Tidak ada pilih kasih, apalagi pesan sponsor. Tapi, rasanya tidak mungkin keenam Cagub favorit itu bakal mendapatkan perahu sehingga semuanya dapat maju dalam kompetisi Pilgubsu pada 7 Maret 2013, mengapa? Sebab, tidak mudah mendapatkan perahu parpol. Penyebabnya banyak, di antaranya kemampuan finansial dari para Cagub itu sendiri. Dari suara yang terdengar per satu kursi bernilai Rp2 miliar sehingga kalau satu parpol punya tujuh kursi nilainya Rp14 miliar. Itu baru nego dukungan perahu. Jika mau mendapat dukungan massa parpol ya harus keluar uang lagi untuk biaya sosialisasi ini-itu, seperti pembuatan spanduk, baleho, t-shirt dll. Justru itu, sedikitnya diperlukan Rp30 miliar untuk bisa memperoleh 15 kursi di DPRD Sumut sebagai syarat minimal mencalonkan diri. Bahkan untuk mendapatkan dukungan parpol besar dan menengah harus merogoh kocek lebih dalam lagi karena biasanya parpol besar banyak peminatnya dari luar, banyak pengurusnya,banyakcalonya,danbanyakpulajagojago internal sehingga perlu uang mundur. Saya mengangguk memberi sinyal setuju ketika bincang-bincang dengan Syah Afandin (Ondim), Ketua DPW PAN Sumut di satu tempat kuliner. Ya, paling banyak hanya empat pasangan calon saja yangmampumendapatkanperahuparpol ikut Pilgubsu tahun depan. Ondim sendiri memilih tidak bertarung di posisi orang nomor satu. Mungkin dia tahu tingkat persaingannya luar biasa ketat. Kalau mereka maunya Sumut-1, tak mau menjadi orang nomor dua. Bagi saya, demikian adik kandung H Syamsul Arifin itu menyatakan blak-blalan, menjadi Sumut-2 juga terhormat. Ondim menyatakan orang nomor2 bisa menjadi penyeimbang sekaligus pengawas. Yang pasti, peluang menjadi Cawagubsu di mata Ondim lebih realistis dan terbuka lebar dengan komunikasi intensif yang dilakukannya belakangan ini. Bagaimana kalau lewat jalur independen? Hematsaya,beda-bedatipis.Tetapsaja keluar banyak uang sementara peluang menangnya relatif kecil. Apalagi kalau mengikuti hati panas karena gagal mendapatkan perahu parpol. Ingat!, tidak mudahmendapatkansetengahjutadukungan masyarakat yang dibuktikan dari KTP.

Apalagi warga Sumut makin cerdas dan makin melek politik setelah hasil mengejutkan Pilgub DKI Jakarta lalu. Masyarakat tak ingin menjadi korban lagi dengan janjijanji politik, hanya manis di mulut, setelah terpilih rakyat dilupakan. Salah pilih pemimpin 5 tahun rakyat menderita. Peraturan menyatakan, calon independen harus mendapat dukungan 30 persen dari jumlah penduduk di wilayahnya (jumlah penduduk Sumut hampir 15 juta jiwa). Itu sebabnya, broker KTP bermunculan, ada yang mengaku punya 100 ribu KTP, entah dari mana diambil, tapi biasanya dari sejumlah kantor pemerintahan, bank-bank yang bila kita berurusan harus menggunakan fotokopi KTP. Hitung saja kalau satu KTP dihargai Rp5 ribu, berarti perlu modal Rp2,5 miliar. Itu pun masih berisiko gagal, jika KPUD Sumut nantinya benar-benar melakukan klarifikasi dan verifikasi sesuai aturan baku. Sebab,kopianKTPitudiambildengancara illegal sehingga saat dilakukan cross check atau konfirmasi ke pemilik KTP bakal ketahuan kalau mereka tidak pernah kenal dan tidak pernah memberi dukungan pada sang calon. Tiru Jokowi Pengalaman pahit dari Pilgub DKI Jakarta lalu, dukungan uang begitu besar oleh pasangan Foke – Nara dengan membeli perahu dan merangkul calon-calon yang kalah di putaran kedua sehingga terjadi ‘’penzaliman’’ demokrasi terhadap pasangan Jokowi – Ahok, ternyata tidak mampu ‘’membeli’’ suara masyarakat. Jokowi – Ahok meski hanya dengan modal kecil, hanya didukung dua parpol (PDIP dan Gerindra) mampu mempermalukan pasangan bertabur ‘’bintang’’. Lantas, apa modal Jokowi dan Ahok sesungguhnya sehingga mampu menjungkirbalikkan hasil survei? Sebenarnya sangat sederhana. Pilar atau parameter utamanya ya sosok Jokowi sebagai ikon perubahan, sementara Ahok memastikan dukungan dari etnis Cina yang lama merindukan munculnya kesempatan. Yang pertama itu tentu saja terkait kinerjaJokowisebagaiWalikotaSolo.Rakyat di sana senang dan dekat sehingga warga Solo memilihnya lebih 90 persen pada Pilkada periode keduanya. Kedua, modal visi dan misinya amat sederhana dengan muatan perubahan. Tidak muluk-muluk. Jokowi berupaya mengefektifkan dana APBD untuk kemajuan masyarakat Ibukota sehingga setiap tahunnyaakanterlihathasilnya,meskipun tidak mungkin selesai dalam 1-2 tahun melihatkompleksnyamasalahkemacetan, banjir, pengangguran, rakyat miskin, kriminalitas dll.Ternyata warga Jakarta mak-

lum ketimbang rivalnya mengaku ahli tapi tidak banyak membawa perubahan bagi warga. Ketiga, komitmen Jokowi untuk tidak korupsi anggaran pembangunan, tidak main proyek. Ini benar-benar berani dan mencengangkan banyak pihak, sehingga langsung meyakinkan di mata publik dan masyarakat pun berharap banyak padanya. Selama ini, APBD DKI Jakarta ratusan triliun setahun (tepatnya Rp138 triliun tahun 2012), namun entah digunakan untuk apa saja warga Jakarta tidak melihat perubahan dan manfaatnya bagi perbaikan hidup rakyat Jakarta. Keempat, tentu saja pembawaan Jokowi yang‘’ndeso’’ sangat familiar, mudah senyum,sederhana,danmerakyatdengan ucapannya begitu lepas tidak rekayasa. Tidak pernah marah dikritik, mudah dijumpai wartawan, selalu bersyukur dan mudah memaafkan orang-orang yang menzaliminya dengan melempar isu negatif. Imej baju kotak-kotak menambah kuatnilaijualnyasebagaipemimpinrakyat. Tak salah kalau PDIP dan Gerinda menjagokannya sekalipun cukup banyak tokoh yang berminat, seperti Nono Sampono, BoyBenardiSadikin(putraAliSadikinmantan Gubernur DKI), Prijanto dll. Saya melihat dari belasan bakal calon Gubsu danWagubsu yang sudah mendaftarkeberbagaiparpoltakseorangpunyang dapatmenirudanmerepresentasikanfigur Jokowi secara lengkap. Ada yang cocok parameter pertama, namun tidak untuk parameter kedua. Parameter kedua ada tidak dengan parameter ketiga dan keempat. Yang sulit ditemukan dari para Cagubsu adalah komitmen ketiga Jokowi akan bekerja keras menggunakan anggaran untuk kepentingan masyarakat. Sejumlah balonGubsubahkanbelumpunyavisidan misi jelas. Untuk membuat visi dan misi sajasepertinyaparacalonkesulitanapalagi mengaplikasikannya. Ada pula balon yang membuatnya terlalu‘’super’’ dan‘’idealis’’ mulai dari permasalahan pendidikan, kesehatan, pengangguran, infrastruktur jalan, melubernya barang impor, konflik tanah, perburuhan, nelayan tradisional, lingkungan, perdagangan, pariwisata, perpajakan, olahraga dll. Semuanya dijanjikan, apa mungkin bisa dibenahi? Tak pelak lagi, visi dan misi yang begitu melebarmembuatmasyarakatcenderung tidak yakin, namun visi dan misi yang simpel ala Syamsul Arifin pun —rakyat tak lapar, tak bodoh, tak sakit—sudah sulit dijual. Penutup Untuk Pilgubsu 7 Maret 2013 kemungkinan masuknya nama-nama baru relatif kecil.Artinya,untukDemokratmenyisakan tiga nama: Amri, AY, dan Gus. Ketiganya dalam polling bersaing ketat. Dari Golkar mencuat CH dan Gus, sementara Erry Nuradi sebagai kuda hitam. PDIP dengan dukungan PDS mayoritas menginginkan RE, sedang Gus (kuda hitam). PKS hampir pasti Gatot Cagubsu dengan Ondim Cawagubsu. PAN lebih cenderung ke Gus dan CH dengan wakil Ondim. Jika tidak ‘’deal’’ maka Fadly Nurzal (PPP) sudah menunggu.

WalaumasihadabelasanBalonGubsu lainnya,namunhasilsurveimembuktikan, nama-namasepertiBennyPasaribu,Anuar Shah, Hasbullah Hadi, Kamaluddin Harahap,Wisjnu S. Sastro, Sutan Bhatoegana, WildanTanjung, semuanya makin tertinggal ketimbang enam Cagubsu unggulkan (AmriTambunan,AYNasution,Chairuman Harahap, Gatot Pujo Nugroho, Gus Irawan Pasaribu, dan RE Nainggolan). Persaingan mendapatkan perahu parpol semakin sengit menjelang ‘’deadline’’ KPU Sumut. Bagi yang tidak sabar dan khawatir‘’dikadali’’ parpol yang terus mengulur waktu guna menaikkan posisi tawar, sebaiknya memilih jalur independen. Dan yang paling siap: Gus dan RE. Apalagi kalau keduanya bersatu, bisa satu putaran, karena sosok keduanya mendekati Jokowi-Ahok. Sebenarnya masih ada sosok yang lebih mendekati, anak muda bilang: 11-12 yaitu Soekirman,Wagub Sergai yang ‘’low profile’’, sayang parpol dan para kandidat Cagubsu tak berhasil merayunya sebagai wakil. Justru itu, Pilgubsu tahun depan dipastikan seru dan menarik. Politik pencitraan meniru trik dan strategi Jokowi nan sederhana, merakyat, dan memberi perspektif atau harapan baru bagi perbaikan kehidupan warga masyarakat yang sudah capek dibodohi.** Penulis adalah Wapenjab Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * ASITA: Visit Medan Year hanya slogan - Slogan dan billboard doang, he...he...he * PAD sektor parkir kota Medan terus merugi - Padahal parkir dimanamana * Calhaj Sumut di Madinah sehat - Alhamdulillah!


D Wak


WASPADA Jumat 28 September 2012


Otak Einstein Dalam Aplikasi iPad OTAK yang merevolusi Fisika sekarang ini dapat diunduh sebagai aplikasi dengan harga US$9.99. Tapi aplikasi tersebut tidak akan membantu memenangkan permainan Angry Birds. Meski tidak menyertakan kejeniusan Enstein, aplikasi eksklusif iPad ini diluncurkan Selasa (25/9), dengan janji untuk membuat gambar yang lebih detail dari otaknya lebih dapat diakses oleh para ilmuwan daripada sebelumnya. Para guru, murid dan siapa pun yang penasaran dapat melihatnya. Sebuah museum kedokteran yang sedang dibangun di Chicago mendapatkan pendanaan untuk memindai dan mendigitalkan hampir 350 gambar (slide) yang dibuat dari potongan otak Einstein setelah kematiannya pada 1955. Aplikasi tersebut akan memungkinkan para peneliti dan pemula untuk seolah-olah melihat otak pemenang Nobel yang eksentrik di bawah mikroskop. “Saya tidak sabar untuk mengetahui apa yang akan mereka temukan,” ujar Steve Landers, konsultan di Museum Kesehatan dan Kedokteran

Nasional Chicago yang merancang aplikasi tersebut. “Saya kira Einstein sendiri jika masih hidup akan senang.” Setelah Einstein wafat, seorang ahli patologi bernama Thomas Harvey melakukan otopsi dan mengeluarkan otak ilmuwan legendaris tersebut dengan harapan bahwa para peneliti dapat mengetahui rahasia di balik kejeniusannya. Harvey memberikan sampel pada para peneliti dan terlibat dalam sebuah studi pada 1999 yang diterbitkan jurnal The Lancet. Studi tersebut memperlihatkan bahwa satu bagian otak Einstein, lobus parietal, lebih lebar 15 persen dari ukuran normal. Lobus parietal berfungsi penting dalam memahami matematika, bahasa dan hubungan ruang. Aplikasi iPad baru ini memungkinkan para peneliti untuk menggali lebih dalam dengan melihat bagian-bagian otak di-

mana syarafnya terhubungkan lebih padat dibandingkan dengan ukuran normal, ujar Dr. Phillip Epstein, ilmuwan syarat di Chicago dan konsultan untuk museum tersebut. Namun karena jaringan otak tersebut diawetkan sebelum adanya teknologi pencitraan modern, mungkin akan sulit bagi para ilmuwan untuk mengetahui secara persis di bagian otak mana gambar (slide) itu berasal. Meski aplikasi baru tersebut mengorganisir gambar itu de dalam daerah otak umum, ia tidak memetakannya secara presisi dalam model anatomis. “Dulu belum ada alat MRI. Kita tidak punya model tiga dimensi dari otak Einstein, jadi kita tidak tahu dari mana sampel-sampel ini diambil,” ujar peneliti Jacopo Annese dari Observatorium Otak di Universitas California, San Diego. Selain itu, gambar berukuran satu inci kali tiga inci dalam aplikasi tersebut merepresentasikan hanya satu bagian kecil dari seluruh otak, ujar Annese. Annese telah mengawetkan dan mendigitalkan otak terkenal lainnya, yaitu milik Henry Molaison, yang meninggal pada 2008 setelah hidup selama berdekade-dekade lamanya dengan amnesia tingkat tinggi. Dikenal dengan “H.M.” dalam studi-stu-

Jangan Hina Orang CINDY Nerger (28), yang bergantung pada kupon makanan untuk memberi makan keluarganya, menceritakan dia menangis setelah dipermalukan seorang manajer di toko Kroger di Georgia, AS. “Kalau saya bekerja untuk memenuhi kebutuhan hidup dan bukan bergantung pada kupon makan seperti Anda,” begitu penghinaan manajer itu kepada saya. Penghinaan tersebut dilontarkan sang manajer setelah Cindy dan dua pekerja di toko itu bertengkar soal total belanja yang bisa didapat dari kupon makanan tersebut. Sang manajer mengatakan kepada karyawannya “kasihkan saja.” Namun, setelah itu dia menekankan katakata ‘bekerja untuk memenuhi kebutuhan hidup’, katanya. “Saya menoleh dan menyadari banyak orang mendengar kata-katanya dan melihat apa yang terjadi, saya merasa malu sampai saya menangis,” katanya. Dalam satu pernyataan kepada, seorang jubir Kroger mengatakan “Kami sangat menyesalkan apa yang dialami pelanggankami. Ucapan manajer tersebut bukan gambaran dari kebijakan perusahaan kami. Kami menghargai semua pelanggan ka mi. Harap diketahui bahwa kami telah melakukan langkah cepat untuk memastikan tindakan ini tidak terjadi lagi.” Sang jubir tidak menjawab ketika ditanya tentang informasi lain, tapi satu televisi lokal Georgia melaporkan bahwa Kroger sudah memindahkan manajer itu ke toko lain. Cindy mengatakan, alasan dia dan keluarganya – dia, suami dan putrinya – terpaksa bergantung pada kupon makanan karena keuntungan bisnis perkayuan suaminya jauh dari cukup untuk kebutuhan keluarganya. Sementara itu, Cindy harus menghabiskan waktunya selama 12 jam setiap malam di bagian dialysis untuk mengatasi penyakit ginjal yang

di ilmiah, Molaison berpartisipasi selama hidupnya dalam penelitian yang mengungkapkan pengetahuan baru mengenai pembelajaran dan memori. Laman berisi lebih dari 2.400 gambar dari otak Molaison akan tersedia untuk umum pada Desember, ujar Annese. “Akan ada Einstein yang lain dan kita akan melakukannya seperti H.M.,” ramal Annese. Untuk saat ini, menurutnya, sangat menyenangkan karena jaringan otak Einstein telah diawetkan secara digital sebelum semua gambar slide rusak atau hancur. Aplikasi ini akan menimbulkan ketertarikan dalam bidang penelitian otak, karena ini Einstein, ujarnya. “Ini adalah koleksi yang indah yang telah dibuka untuk publik,” ujar Annese. Beberapa orang mempertanyakan apakah Einstein akan senang melihat gambar-gambar otaknya dijual pada selain ilmuwan dengan harga $9.99. “Ada banyak debat mengenai apa niat Einstein sebenarnya,” ujar anggota dewan museum Jim Paglia. “Kami tahu ia tidak ingin ada sirkus seputar jenazahnya. Tapi ia paham nilai dari penelitian dan ilmu pengetahuan untuk meneliti otaknya, dan kami kira kami telah melakukannya dengan penuh hormat.” Paglia mengatakan aplikasi tersebut dapat “menginspirasi generasi baru ilmuwan syaraf.” Pendapatan dari penjualan akan masuk ke Museum Kesehatan dan Kedokteran Nasio-

Warga Super Kaya Asia Diperkirakan Meningkat Cindy Nerger dan putrinya, tidak terima dihina. dideritanya – dia menjalani pengobatan tersebut sejak usia 11 tahun. Namanya telah dimasukkan dalam daftar penerima donor ginjal selama lima tahun dan berharap suatu hari nanti, setelah pencangkokan ginjalnya berhasil, dia bisa menjadi seorang pekerja. Dia ingin melanjutkan pendidikan di bidang psikologi anak. “Banyak sekali pandangan jelek pada orangorang yang bergantung pada kupon makanan. Mereka hanyalah pecundang yang tidak mau bekerja. Padahal tidak semua kasusnya begitu,” katanya. Apa yang dialami Cindy di toko tersebut tersebar setelah dia mengungkapnya di Facebook, dan teman-temannya mendorongnya untuk menceritakan hal itu ke televisi. Stasiun televisi tersebut kemudian menghubunginya dan menyiarkan cerita tersebut. Sementara itu, Kroger, merespon keluhan Cindy dengan meminta maaf dan memberikan kupon hadian senilai 15 dolar. Cindy mengatakan dia menolak hadiah tersebut karena tidak berniat belanja di Kroger lagi. Yang dia inginkan hanya permintaan maaf dari sang manajer dan dilatih bagaimana cara melayani pelanggan dengan baik. Syafri/Yc

JUMLAH warga super kaya di Asia akan meningkat menjadi 2,67 juta orang pada tahun 2015 dengan peningkatan tertinggi di Indonesia sebesar 25%, menurut survei bank swasta Swiss. Survei bank swasta Julius Baer tentang kekayaan di Asia menyebutkan jumlah kekayaan pribadi warga Asia mencapai total sekitar US$16,7 triliun. Indonesia menempati kenaikan tertinggi karena “merebaknya bisnis dalam negeri,” menurut bank itu. Bank tersebut juga menyebutkan para taipan di Asia sebagian besar tidak terkena dampak melemahnya perekonomian global. Hal ini terjadi karena “permintaan dalam negeri yang didukung oleh peningkatan lapangan pekerjaan,” kata bank itu dalam satu pernyataan. Peningkatan orang super kaya sebesar 2,67 juta pada tahun 2015, merupakan peningkatan 30% dari perkiraan pada 2010. Di China warga super kaya akan mencapai 1,46 juta dalam tiga tahun mendatang dengan

Peran Media Sosial SATU foto yang memperlihatkan seorang pria tengah merangkul anjingnya berusia 19 tahun yang menderita arthritis (rematik) menyentuh hati jutaan orang ketika disiarkan secara online bulan lalu – curahan perhatian itu menginspirasi pemilik anjing untuk mendirikan yayasan guna membantu keluarga berpenghasilan rendah untuk merawat anjing tua peliharaan mereka. John Unger mengatakan, Schoep’s Legacy Foundation telah berhasil mengumpulkan lebih 25.000 dolar sejak John dan anjingnya, Schoep, difoto seorang temannya yang kemudian mempostingnya di Facebook. Sebelum foto itu disiarkan, John dan dokter hewan tempatnya berkonsultasi sudah berniat menyuntik mati Schoep. “Tanpa pengobatan, John dan saya sudah membahas tentang euthanasia (suntik mati) akhir Juli lalu,” kata Erik Haukass, sang dokter hewan, kepada Daily Mail. Tapi, dengan sumbangan dari orang-orang yang melihat foto itu, John akhirnya mampu mengobati Schoep dan hidup sehat hingga hari ini.

nal milik Kementerian Pertahanan AS di Silver Spring, Maryland, dan ke museum satelit Chicago, yang dijadwalkan dibuka pada 2015 dengan pameran interaktif dan koleksi digital museum. (voa/rzl)

jumlah aset sebesar US$9,3 miliar, kata laporan bank itu. Perekonomian China Melambat Namun dalam daftar tahunan orang super kaya yang dikeluarkan di China, disebutkan jumlah taipan justru menurun dalam satu tahun terakhir. China memiliki 251 orang taipan dengan kekayaan senilai US$1 miliar atau lebih, berkurang 20 dibandingkan tahun lalu, menurut laporan tahunan Hurun. Sebagian warga super kaya China itu mulai merasakan dampak melambatnya perekonomian di negara itu dengan berkurangnya jumlah kekayaan mereka dalam satu tahun terakhir. Namun jumlah warga super kaya di China itu masih jauh lebih tinggi dibandingkan tahun 2006 yang hanya mencapai 15 orang. Inilah untuk pertama kalinya dalam tujuh tahun jumlah miliuner di China menurun. Perekonomian China melambat dalam beberapa bulan terakhir. Dari 1.000 orang terkaya yang disurvei oleh Hurun, yang menempati posisi teratas adalah Zong Qinghou dari perusahaan minuman dengan kekayaan US$12,6 miliar. (bbc/rzl)

Patung Buddha Kuno Terbuat Dari Batu Meteor PATUNG Buddha berusia sekitar 1000 tahun yang ditemukan tim ekspedisi Nazi Jerman pada 1938, diyakini terbuat dari pecahan batu meteor, demikian analisa terbaru ilmuwan Universitas Suttgart, Jerman. Patung seberat 10 kilogram, yang lazim disebut “manusia besi”, menggambarkan sosok dewa kaum BuddhaVaisravana dan diyakini berasal dari abad ke-11 setelah masehi. Analisis geokimia oleh tim peneliti Jerman-Austria, yang dipublikasikan dalam jurnal Meteoritics dan Planetary Science mengungkapkan bahwa patung ini diukir di atas batu ataxite, salah-satu jenis batuan meteor yang langkah. “Patung ini dipahat dari batu meteor Chinga yang menabrak wilayah perbatasan antara Mongolia dan Siberia sekitar 15.000 tahun yang lalu,” kata ketua tim penelitian dari Institut Planetology, Universitas Stuttgart, Dr Elmar Buchner, seperti dilaporkan Science Daily. Nazi dan swastika Tim peneliti yang dipimpin Buchner melakukan analisa patung itu pada 2007, setelah pemiliknya mengijinkan mereka untuk mengambil potongan kecil dari patung itu. Dua tahun kemudian, tim peneliti itu diberi kesempatan untuk mengambil contoh yang lebih besar dari bagian dalam patung tersebut. Belum diketahui bagaimana patung itu ditemukan, namun

PATUNG Buddha berusia sekitar 1000 tahun diyakini para ahli diukir di atas batu meteor. diyakini bahwa simbol swastika yang diukir di bagian perut patung itu mendorong tim ekspedisi Nazi Jerman untuk membawanya pada 1938 lalu. Setelah dibawa ke Jeman,

patung yang diyakini merepesentasikan raja kaum Buddha di wilayah utara, atau sekarang dikenal sebagai wilayah Jambhala di Tibet ini, dikoleksi oleh seseorang. (bbc/rzl)

Gaun Termahal Di Dunia

John dan Schoep, menyentuh hati banyak orang. “Kondisi Schoep sangat menggembirakan sampai sekarang,” kata John. “Terapi yang dilakukan dengan bantuan sumbangan banyak pihak ibarat seperti mengembalikan waktu satu setengah tahun lalu.” Yayasan itu didirikan, tambah Erik, ketika mereka berdua ‘menyadari kami mendapat uang lebih banyak dari yang diperlukan untuk menyembuhkan sakit Schoep’. “Bantuan tersebut malah bisa membantu 30 atau 40 Schoep lainnya,” kata Erik. “Schoep digendong John di Lake Superior,” jelas Hannah Stonehouse Hudson, sang juru foto,

yang menyebarkan foto itu di Facebook. “Schoep bisa tidur setiap malam bila dibawa ke danau itu. Kondisi air danau tersebut meredakan nyeri rematik. Saat ini, Danau Superior, airnya sangat hangat, itulah suhu yang tepat untuk mengurangi rasa nyeri rematik. Saya sangat senang bisa mengabadikan momen tersebut. John menyelamatkan Schoep ketika dia masih berusia 8 bulan, dan anjing tersebut selalu di sisinya setiap waktu.” Hannah, seorang juru foto professional, mengatakan kepada Pioneer Press bisnisnya di bidang fotomemoto meningkat pesat

sejak foto John dan Schoep disiarkan di Facebook sehingga dia terpaksa menyewa seorang pegawai baru-baru ini. “Permintaan naik 30 persen,” jelas Hannah. “Mungkin ini balasan dari membantu seorang teman.” Karena kedermawanan publik, Schoep disembuhkan lewat penyinaran persendian guna mengurangi rasa sakit dan bengkak yang disebabkan rematik. “Dia sekarang berjalan lebih cepat,” ujar John. “Semua ini tidak dinyana,” cetusnya. Syafri/Yc

PERNAH dengar gaun berharga Rp 287 miliar? Segitulah dibandrol perancang busana asal Malaysia Faisol Abdullah untuk gaun Nightingale of Kuala Lumpur hasil kreasinya bekerjasama dengan perusahaan permata Mouawad. Gaunnya yang terbuat dari sutra satin sepanjang 14 meter itu dihiasi dengan 750 berlian yang kadar seluruhnya 1.100 karat. Gaun tersebut ditampilkan pada Fashion Festival STYLO tahun 2009 lalu. Di tahun 2010, ahli permata Chris Aire menciptakan gaun santai berhiaskan berlian. Gaun tersebut dihargai Rp 191 miliar. Awal tahun ini, dua perancang asal New York, Chloe dan Reese, menciptakan gaun hitam berhiaskan ratusan berlian 3 karat seharga Rp 143 miliar. Gaun tersebut ditampilkan pada Conclave Fashion Show yang diselenggarakan Komunitas Pecinta Permata Amerika. Tahun ini, seorang perancang otodidak asal Inggeris bernama Debbie Wingham memamerkan rancangan terbarunya di Kiev berupa gaun hitam termahal di dunia. Gaun yang dihargai Rp 54,5 miliar itu dihiasi berlian hitam yang langka. Debbie, yang hasil rancangannya telah dikenakan sejumlah selebritis seperti Kate Winslet, Hilary Swank, dan Dita Von Teese, menyebut gaun tersebut ‘kesyahduan bagi seorang wanita cantik yang mencintai hidup’. Dibutuhkan waktu lebih enam bulan untuk menjahit tangan gaun tersebut, yang juga dihiasi berlian putih dan emas putih “untuk memperkuat karakter pemakainya”, jelas Debbie. Debbie hanya menggunakan permata dari Dejoria ‘tambang berlian yang bebas konflik’, katanya kepada Telegraph. “Semua karya saya hasil dari kerjaan tangan,” tambahnya. Namun, tidak semua yang hadir pada Ukraine Fashion Week di Fairmont Grand Hotel di Kiev 14 September lalu senang dengan gaun rancangan Debbie tersebut.

GAUN seharga 30 juta dolar (Rp 287 miliar), hasil karya perancang Malaysia yang mendekorasinya dengan 750 butir berlian. “Saya bahkan tidak mau mencoba gaun itu, apalagi memakainya untuk pamer di depan juru foto,” kata seorang wanita yang memperhatikan seksama gaun tersebut. “Sayang sekali berlian-berlian tersebut dikorbankan untuk gaun sejelek itu,” ujarnya pada Telegraph. Syafri

Mimbar Jumat

WASPADA Jumat 28 September 2012


Gatot: Sekolah Di Pesantren Tetap Jadi Pilihan Pesantren Unggul Dalam Pembinaan Akhlak dan Intelektual Saat melakukan kunjungan kerja ke Labuhanbatu Selatan, Sabtu (22/9) lalu, rombongan Pelaksana tugas Gubernur Sumatera Utara (Plt. Gubsu) H.Gatot Pujo Nugroho, ST mengunjungi sejumlah pesantren di wilayah tersebut. Gatot menegaskan, dengan keseimbangan kurikulumnya maka pesantren tetap jadi pilihan para orangtua untuk mendidik anakanak mereka.

Karena waktu yang terbatas, Gatot Pujo Nugroho dan Sutias Handayani Pujo Nugroho pun berbagi tugas. Gatot Pujo Nugroho memilih mengunjungi Pesantren Raudlatul Uluum Aek Nabara sementara Sutias selaku Ketua TP PKK Sumut ke Pesantren Salafiyah Uswatun Hasanah, Desa Ulumahuan Aek Nabara. Di tengah gencarnya pendidikan modern, Gatot ingin menegaskan agar warga Sumatera Utara jangan melupakan pendidikan pesantren. Menurut Gatot, belajar di pesantren tidaklah seburuk

imej masyarakat selama ini. Menjawab kebutuhan zaman, sejumlah pesantren kini terus berbenah, tak hanya membekali santrinya dengan ilmu keagamaan tapi juga membekali mereka dengan pengetahuan modern. Seperti Informasi Teknologi, Otomotif, Bahasa Inggris, dan sejenisnya. Dalam kunjungan kedua tempat berbeda itu, Gatot maupun Sutias sama-sama mendapat sambutan hangat khas pesantren. Ribuan santri bersama ulama, serta guru-guru mere-

ka menyongsong kehadiran Gatot dan Sutias dengan membentuk barisan penyambutan yang panjang. Ketika ribuan santri di Pesantren Raudlatul Uluum, Plt. Gubsu menjelaskan pendidikan merupakan investasi terbesar bagi bangsa ini. Dengan pola pendidikan yang baik dan benar, maka ilmu yang diperoleh seorang santri akan bermanfaat tak hanya di dunia tapi juga di akhirat. ”Dengan materi pendidikan yang seimbang antara ilmu modern dan ilmu keagamaan, maka

Waspada/Surya Effendi

BENGKEL OTOMOTIF: Plt.Gubsu Gatot Pujo Nugroho, ST menyaksikan bengkel otomotif milik Pesantren Raudlatul Uluum, Aek Nabara. Tak hanya menghadirkan kurikulum keislaman, pesantren kini juga menghadirkan kurikulum berbasis teknologi modern. MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Hasan Ma’sum, MA Ar-Ridho Jl. Jati Psr.VIII Dusun X Gambir Desa B.Klippa Jamal Pasaribu, S.Ag Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Prof.Effendi Nad Deluxe Putra Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan H.M. Basri, S.Ag At-Tawwabin Jl. Pimpinan No. 1 Drs. H. Syamsul Rizal, P. Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Drs. H. Kamidin Selian Al-Bayan Jl. Kasuari I/Gurilla No. 10 Kel. Sidorejo Drs. H. Hamid Mashudi Al-Falah Jl. Pukat Banting IV No. 10 H. Mas’ud Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Juli Heriadi, M.Pd. Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hadizd Ahd. Yusuf, Nst. Al-Hilal Jl. Belat No. 76-B Drs. Satiman Al-Ikhlas Lingk. II Kel. Bandar Selamat Drs. H. Abd. Rahman Kasmi Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Drs. Borkat Harahap Al-Ishlah Jl. Pukat V Kel. Bantan Timur Drs. Syarifuddin Umar Lubis Al-Ikhlash Jl. Pasar V Gg. Al-Ikhlash Dusun XIII Durian Drs. Dahler Efendi Al-Istiqomah Komplek Veteran Medan Estate Drs. H. Syamsul Hilal Harahap Al-Ijtima’iyah Jl. Letda Sujono No. 152 Drs. H.M. Fahli El Fuad Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Jumiran Abdi, S.Ag Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Drs. H. Nadran Jamal Baiturrahman Kampus UNIMED Jl. Williem Iskandar Abdul Lathif Khan, S.Ag Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Burhanuddin Sitorus Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Drs. Mukhtaruddin Dlmy., MA Hidayatul Ubudiyah Jl. Kapten M.Jamil Lbs.Gg.Mangga Drs. H. Baharuddin Lubis Ikhlashiyah Jl. Suluh/Jl. Tempuling No. 20 Kel.Sidorejo H.M. Taufiq, MA Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Drs. M. Yamin Lubis Jamik Al-Jihad Jl. Besar Tembung Desa Tembung M. Zubir Nasution, S.Pd. Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Sopyan Lubis, BA Raya Muslimin Jl. Pukat I No. 1 d\h Jl. Mandailing No.1 H.M. Thahir Nasution, Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Drs. Armia Yusuf Taqwa Kampus I UMA Jl. Kolam No. 1 Medan Estate Dr. Ali Imran Sinaga, MA Taqwa Jl. Letda Sudjono No. 15 Drs. M.S. Dongoran Ubudiyah Jl. Taduan No. 109 Kel. Sidorejo Drs. H. Mahmud MEDAN TUNTUNGAN Ar-Rahman Griya Nusa 3 Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hikmah Kompleks R.S. Jiwa Propsu Jl. Tali Air Lk. IV Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Taqwa Jl. Sawit Raya, Perumnas Simalingkar

Zainal Arifin, MA Drs. Indra Budiman Drs. Ali Nurdin Nasution Jumendra Banurea, M.Ag M. Sya’ban Lubis, MA H. Solihin Adin, S.Ag Drs. M. Ridwan Drs. Agus Suhaedi, S.Pd.I Drs. M. Yusuf Arhad Drs. Arifinsyah Ir. Sobirin Choirul Harahap Tenerman, S.Sos

DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Drs. Amin Rasyid Nasution Ainul Yaqin Jl. Pembangunan IV No. 30 Desa Mulrorejo Achmad Jais, M.Ag At-Taubah Dusun XX Lr. Pertanian Blok Gading Khairil Anhar Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Supriadi Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC H. Umar M.Siregar, Lc Al-Hafiz Hamparan Perak Kec. Hamparan Perak H. Zainal Yusuf Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur Drs. H.M. Ilyas Purba Al-Ikhlas Komp. Kantor Bupati Deliserdang L.Pakam Abdul Latif Khan, S.Ag Al-Ikhlash Lingk. VI Gg. Sidorejo Kel. Deli Tua Drs. H. Abd. Jalil Tanjung Al-Ikhlash Jl. Pasar V Dusun Durian Gg. Masjid Drs. Dahler Efendi Al-Issyah Hakim Jl. Karya Jaya Kel. Deli Tua Drs. Khaidir Lubis Al-Jihad Jl. Pembangunan No. 26 Dr. H. Azhar Sitompul, MA Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Darwis Al-Mukhlisin Komplkek Namori Village Nayan Pelis, S.Ag Jami’ Al Muhajir Jl. Rel Pasar X No. 06 Bandar Khalifah Kumpul Pandapotan, S.Ag As-Salam Jl.Raya Medan Namorambe Komp.Pisu No.1 Ahmad Bahtiar, MA Baiturrahman Jl. Merica Raya Blok F Peru. Simalingkar Agusman Damanik, MA Baitussalam Dagang Kerawan Tanjung Morawa H. Ibnu Mubarrak, S.Sos.I H.M. Asjro Effendi Jl. Haji Misbah No. 22 Drs. H. Hasnan Ritonga, Lc, MA

Jami’ Jl. T. Imam Bonjol No. 17 Lubuk Pakam Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Jl. Besar Km. 11,5 Deli Tua Jami’ Jl. Irian No. 79 Kel. Pekan Tanjung Morawa Jami’ Al-Ihsan Jl. Imam Abdul Ds.Selemak Kec.H.Perak Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Khairul Fatihin Dusun II Kec. Tg. Morawa Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Nurul Burhanuddin Jl. Cempaka Dusun V Ds K.Durian Raya Jl. T. Raja Muda No. 26 Lubuk Pakam Syuhada Kec. Galang Taqwa Lubuk Pakam Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

belajar di pesantren Insya Allah akan menjadi invetasi berharga. Investasi yang tidak hanya bermanfaat untuk dunia tapi juga kehidupan di akhirat. Karenanya, bersekolah di pesantren tetap jadi pilihan,” kata Gatot seakan memotivasi para orangtua di Sumatera Utara agar tetap menjadi pesantren sebagai pilihan pendidikan anak-anak mereka. Untuk membuktikan kemajuan pendidikan di pesantren, Ketua Yayasan Pesantren Raudlatul Uluum Aek Nabara H.Bukhori Fasha, Spd, Mpd dengan bangga mengajak Gatot melihat fasilitas yang dimiliki pesantren yang berdisi tahun 1987 itu. Bahkan kader PKS itu didaulat untuk mencoba mengendarai mobil rakitan siswasiswa SMK Raudlatul Uluum. Sementara secara terpisah, Sutias Handayani didampingi Asisten II Bidang Perekonomian dan Pembangunan Pemerintah Provinsi Sumatera Utara Ir Hj.Sabrina mengunjungi Pesantren Salafiyah Uswatun Hasanah, Desa Ulumahuan. Sutias juga mendapat sambutan hangat. Para santri dan santriwati, guru dan warga sekitar Ponpes menyambut kehadirannya sejak dari pintu masuk hingga menuju pondok pesantren. Para santri juga menampilan pertunjukan kesenian khas pesantren untuk menyambut tamu-tamu kehormatan. Istri Plt.Gubsu menjelaskan, kehadiran mereka adalah untuk mengetahui perkembangan terkini dunia pendidikan di pesantren. Menurut Sutias, pesantren akan semakin memegang peranan penting bagi pembinaan akhlak masyarakat sejak usia dini. “Di tengah gencarnya dunia pendidikan modern yang ironisnya justru banyak membuat anak manusia agresif dan terdegradasi akhlaknya, maka pesantren akan kembali berkibar,” kata Sutias yang pada kesempatan itu menyerahkan sejumlah bantuan sarana kebersihan dan tali asih untuk warga pesantren. Pendiri pondok pesantren Ust. Darwin Lubis. S.Sos mengakui, dunia pendidikan modern

Drs. Dahlan, H.S. Bachtiar H. Sugianto, Lc Drs. H. Syarifuddin Abdullah Helmy, S.Pd.I Drs. Agen Harahap Drs. Ngadimin Drs. H. Syarifuddin Nasution A. Latif Khan, S.Ag H.M. Yusri Indra, Lc K.H.M. Husein Kasim T. Radian, S.Ag Drs. H. Efnedi Arief, MA Ahmad Syukri

BINJAI Agung Kota Binjai Amal Jl. H. Agus Salim No. 14 Kel. Jatinegara Amal Jl. T. Imam Bonjol Gg. Cempaka An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahmah Turiam Jl. Kakap No. 1 Kel. Tanah Tinggi Al-Hidayah Jl. Talam No. 28 Kel. Nangka Al-Hilal Jl. Ikan Irwana No. 17 Kel. Dataran Tinggi Al-Huda Kel. Pahlawan Kota Binjai Al-Mushlihin Kel. Satria Kota Binjai Al-Qadar Kel. Payaroba Griya Payaroba Indah Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Istiqomah Jl. T.A. Hamzah Kel. Jati Negara Jami’ Athohirin Kota Binjai Nurul Falah Jl. S.M. Raja No. 60 Nurul Yaqin Jl. S.M. Raja No. 94 Kel. Tanah Tinggi

Sobirin Syafii Ali Usman, S.Ag Yahya Drs. H. Jaharuddin, MA DR. H.M. Jamil, MA Drs. Amiruhansyah H.M. Effendi, MA Drs. M. Yahya H. Nurbain Tuah, Lc Seniman, Slp. Drs. Zainul Bahri Drs. H. Muslim Rawi Drs. H. Jannah Siregar Drs. H. Juniwan Aksara Drs. H. Farhan Rawi

ST A B AT Ar-Raudhah Dusun VII Desa Kebun Balok Al-Furqan Lingk. I Musyawarah Kel. Kwala Bingai

Aiyub, S.Pd.I H. Ibrahim, M.Ag

bawa perubahan khususnya di dunia pendidikan. Seorang siswa tak hanya cerdas tapi juga wajib berakhlak mulia,” beber Darwin. Di akhir silaturahmi, Sutias bersama Hj.Sabrina melakukan penanaman pohon di sekitar pondok pesantren yang berdiri tahun 2006 itu. (m46)

Waspada/Surya Effendi

SAMBUTAN SANTRI: Ketua TP PKK Sumut Hj.Sutias Handayani Gatot Pujo Nugroho mendapat sambutan hangat dari para santri dan warga Ponpes Pesantren Salafiyah Uswatun Hasanah, Desa Ulumahuan, Aeknabara.

Waspada/Surya Effendi

MOBIL RAKITAN: Plt.Gubsu Gatot Pujo Nugroho, ST mencoba mengendarai mobil rakitar santri-santri Pesantren Raudlatul Uluum, Aek Nabara, Sabtu (22/9) lalu. Gatot menegaskan, pesantren akan semakin menjadi pendidikan pilihan masyarakat.

INDRAPURA Jami’ Indrapura


KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Hidayah Jl. Cokroaminoto Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Jl. Merpati No. 44 Kel. Gambir Baru Jami’ Baiturrahim Kel. Kisaran Naga Nurul Yaqin Jl. Agus Salim Kel. Teladan Nurul Yaqin Kantor Direksi - PB. BSP Kisaran Nurul Huda Jl. Malik Ibrahim No. 37 Nuur-Assyiam Kel. Lestari Siti Zubaidah Jl. Budi Utomo No. 285

K.H. Alimuddin Siregar, S.Pd.I Drs. Jumiadi H. Mhd. Syafiq STP. MMP Abd. Hakim Dahmul Daulay, S.Ag Imron Ariadin, S.Pd.I Drs. Lahuddin Lubis Drs. H. Abdur Rasyid H. Salman Tanjung, MA Drs. H. Edy Sucipno M. Ihsan, SH H. Edi Sucipno, S.Ag, M.Pd Drs. Ibrahim Margolang, MA H. Samsul Qodri Marpaung Drs. H. Mhd. Sya’ban Nst. H. Amrin Sirait, S.Ag Drs. Bob Yuswardi

LABUHAN BATU Attaqwa Labuhan Batu Selatan Besar Tanjung Medan Labuhan Batu Selatan Besar Kota Pinang Labuhan Batu Selatan Jami’ Kota Pinang Labuhan Batu Selatan

Nahwan Rambe Salim Tambak, S.Ag Faisal Ahmad H. Mhd. Asli Pulungan

BATUBARA Ar-Rahman Dusun II Desa Pasar Lapan Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Iman Desa Perkotaan Kec. Air Putih Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

Sunaryo, K.S. Ahmad Hadian H. Zulkarnain Hasan Basri Muchtar, A.M.


TEBING TINGGI Amal Muslim Kp. Rao Amaliyah Jl. K.F. Tandean No.344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Al-Abidin Jl. Kom. Yos Sudarso Kel. Lalang Al-Hidayah Kel. Tanjung Maru Hilir Kampung Keling Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Al-Hasanah Jl. Kartini No. 16 Tebing Tinggi Al-Hasanah Jl. Merbau Perumnas Bagelen Teb. Tinggi Al-Haq Kel. Deblob Sundoro Padang Hilir Al-Qomar Jl. Kutilang Lingk. 05 Kel. Bulian Al-Khairani Jl. Baja Lingk. VI Kel. T. Tinggi Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak Al-Ihsan Simp. Dolok Kel. Sri Padang Kec. Rambutan Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Mukhlis Kel. Pasar Baru Al-Muthmainnah Lingk. I Kel. D.Sundoro Darul Jihad Jl. Ahmad Yani Komp. Detasemen B Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Istikmal K.F. Tandean Lingk. III Bandar Sakti Jami’ Jl. Batu Bara Kel. Satria Jami’ Jl. Soekarno-Hatta Kel. Tambangan Hulu Nurul Amal Kompl. Kodim Lingk. 04 Kel. Lalang Nurul Huda Jl. Bukit Bundar Lingk. 03 Kel. Lalang Nur Islam Jl. P. Irian Lingk. 94 Kel. Persiakan Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Jl. R. Suprapto No. 126 Syuhada Jl. Iskandar Muda No. 79-A Taqwa Jl. Bakti Kel. Satria Kota Tebing Tinggi Ubudiah Jl. Pulau Samosir Kel. Bandar Sono

saat ini memang sangat minim akhlak meski sangat kaya materimateri intelektual. Tapi kemajuan intelektual saja jelas tidak cukup untuk membentuk manusia yang seutuhnya. ”Akhlak pun wajb ditanamkan pada diri setiap manusia. Untuk itulah Pondok Pesantren Salafiyah Uswatun Hasanah hadir. Kami ingin mem-

Lahmanuddin H. Bustami Saragih Drs. Ahmanuddin Lubis Zulkarnain, S.Ag Irwansyah Nurdin Sofiyan, MS Nasiruddin Nasution, S.Pd.I Ibnu Kasim, S.Pd.I Drs. H. Komaruddin Ritonga Zuhril Lubis M. Amin Lubis, S.HI Ilyas Hibban, S.Ag Zulkifli M. Nuh Drs. Fahrisyam, S.Pd.I Drs. Ngatiran, MBA Drs. Daulat P. Sibarani Drs. H. Fakfarroni, SH Ansori, S.Ag Ibrahim Ahmad M. Rifai Damanik Edi Syahputra, S.Pd.I Abdul Yazib, S.Ag H. Amir Hasan, BA H. Ishaq Ibrahim, S.Pd.I Drs. Usman Amir Tagor Mulia, S.Sos.I H. Wijaya Damanik Drs. H. Ibrahim Harahap H. Zainul Arifin Drs. Abdul Khalik, M.AP Emil Sofyan Hermansyah, S.Pd.I

Arif-Al Azhim Polres Asahan

Drs. H. Nummat Adham, SH ,MH

TANJUNG BALAI Al-Istiqomah Jl. Anggur Kel. Pantai Johor

Amari Syahputra, S.Ag

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba

Albar Suheri, S.Ag

SIDIKALANG Agung Kota Sidikalang Al-Muhajirin Jl. Bambu Kuning Blok A No. 59 Telaga Zam-zam Jl. Ahmad Yani Batang Beruh

H. Sunaryo, S.Ag H. Sudiarman Manik, S.Ag Jono Pasis, S.Ag

BIREUEN Masjid Agung Bireuen Masjid Taqwa Gandapura Masjid Besar Makmur Masjid Besar Kutablang Masjid Besar Peusangan Masjid Besar Peusangan Selatan Masjid Besar Psg. Siblah Krueng Masjid Al Furqan Kota Juang Masjid Besar Kuala Masjid Baitul Huda Juli Masjid Besar An Nur Jangka Masjid Ridha Jeumpa Masjid Besar Peulimbang Masjid Baitunnur Peudada Masjid Baiturrahim Jeunieb Masjid Baitul Qiram Pandrah Masjid Besar Simpang Mamplam Masjid Besar Samalanga

Tgk M Yusuf Tgk H Shalihin Abdullah Tgk A Bakar Zakaria Tgk Fitriadi Tgk Urwatul Usqa Tgk Usman Puteh Drs Tgk Ahmad A Jadi M Pd Drs Tgk Djamaluddin Idris Tgk Umar Budiman Tgk M Nasir Tgk Rasyidin Tgk H Muhammad Ishaq Tgk Sayed Usman Tgk Cut Hasan Rasyid Tgk H Mardani Tgk Hasan Idris Tgk M Nur Tgk Abdul Hanan

Mimbar Jumat


Apakah Haji Anda Mabrur? Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Alwashliyah.


abi Muhammad Saw bersabda: Tiada hari-hari untuk beramal saleh yang paling dicintai Allah Swt selain daripada sepuluh hari (awal Zulhijjah) ini. Lalu para sahabat bertanya: Ya Rasulullah, mana lebih tinggi dari jihad fi sabililah? Beliau menjawab: Ya, lebih tinggi dari berjihad fi sabilillah, terkecuali orang yang keluar dari rumahnya (untuk berjihad) dengan jiwa, raga, dan hartanya lalu dia tidak kembali lagi dengan membawa apapun (mati syahid di medan perang) (HR. Bukhari). Hadis di atas dipahami bahwa ibadah haji lebih unggul dari ibadah-ibadah lainnya, bahkan melebihi dari sekian banyak ibadah yang diperintahkan Allah Swt kepada hamba-Nya. Keunggulan ibadah antara satu dengan lainnya dapat dipandang dari sisi materi ibadah, tempat ibadah dan waktu ibadah. Adapun materi ibadah mengungguli ibadah lainnya karena bobot perintah yang dibebankan kepada manusia, seperti ibadah wajib lebih ungul dari ibadah sunat, shalat wajib, puasa wajib, infaq wajib lebih utama dari shalat sunat, puasa sunat dan infaq sunat karena bobot perintahnya. Sedangkan waktu ibadah, Allah Swt telah mememilih waktu-waktu tertentu lebih utama dari waktu yang lain, seperti bulan Ramadhan, lailatul qadar, malam Jum’at, hari wukuf di Arafah, sepertiga akhir malam, kesemua waktu-waktu ini tidak sama nilainya dengan waktuwaktu lain. Demikian pula tempat-tempat ibadah, Allah Swt telah memberikan kelebihan tanah haram dari tanah halal, kelebihan Masjidil Haram dengan Mesjid Nabawi, kelebihan Mesjid Nabawi dengan Masjidil Aqsa, dan kelebihan semua mesjid tersebut dengan mesjid-mesjid yang ada di permukaan bumi ini. Akan halnya ibadah haji, terhimpun semua kebaikan di dalamnya, baik dari sisi materi ibadahnya, tempat pelaksanaannya, maupun waktu pelaksanaannya. Oleh sebab

itu, ibadah haji yang pantas mendapat predikat mabrur dibandingkan dengan ibadah-ibadah wajib lain seperti shalat, puasa dan zakat. Kemabruran haji sesungguhnya tidak dapat diperoleh dengan harapan, doa, dan penampilan-penampilan semata, akan tetapi haji mabrur diperoleh dengan adanya persiapan, tantangan, dan pemeliharaan kemabruran haji itu sendiri. Diawali dari persiapan, perbekalan, kemampuan (isti’tha’ah) untuk

lal dan niat yang tidak ikhlas belum lagi sampai ke Ka’bah atau ke Arafah, baru saja meneriakkan talbiah (labbaik allahumma labbaik), Allah Swt menjawab, tidak ada labbaik untuk anda, kembalilah anda ke tanah air. Karena ibadah haji merupakan ibadah maliah, ibadah jasadiah dan ibadah ruhiyah (ibadah yang berkaitan dengan rohaniah). Oleh sebab itu, seseorang yang mengumpulkan harta dengan jalan haram, misalnya korupsi, menipu,

Kemabruran haji sesungguhnya tidak dapat diperoleh dengan harapan, doa, dan penampilan-penampilan semata, akan tetapi haji mabrur diperoleh dengan adanya persiapan, tantangan, dan pemeliharaan kemabruran haji itu sendiri. melaksanakan ibadah haji dituntut untuk mempersiapkan bekal yang halal, ilmu yang mapan dan niat yang ikhlas. Persiapan bekal merupakan langkah awal untuk menggapai haji mabrur bahkan ia merupakan bahagian dari haji mabrur itu sendiri. sebab, jika seseorang datang ke tanah suci dengan membawa bekal yang kotor, dapat dipastikan kesucian dan kemuliaan ibadah haji yang dikerjakannya akan ternodai oleh kotoran harta yan dibawanya karena ibadah haji merupakan ibadah maliah (ibadah yang berkaitan dengan harta). Sama halnya seseorang yang datang dengan fisik yang tidak sehat, dapat dipastikan rukun-rukun haji dan wajib haji tidak optimal dilaksanakan, karena ibadah haji adalah ibadah jasadiah (ibadah yang berkaitan dengan fisik). Apalagi seseorang yang datang dengan niat yang tidak ikhlas dapat pula dipastikan ibadah hajinya tidak akan mencapai haji mabrur, malah mendapat haji mardud (ditolak). Ada riwayat menceritakan, di saat orang yang datang mengerjakan haji dengan bekal yang tidak ha-

menerima suap, dan lain-lain, tidak wajar berencana dan berfikir untuk mengerjakan haji, tetapi langkah awal yang dikerjakan bagaimana mengembalikan hak-hak orang lain yang ada di dalam hartanya, karena mengembalikan hak orang lain dari dalam hartanya lebih wajib dari mengerjakan ibadah haji itu sendiri. Sejalan dengan jalan pikiran di atas Prof. Dr. Yusuf Qaradhawi memfatwakan bahwa “Para koruptor tidak wajib haji karena ada yang lebih wajib bagi mereka yaitu mengembalikan uang negara kepada negara dan rakyat, setelah dikembalikan, jika ada tersisa yang menjadi hak miliknya yang sah dan halal barulah mereka wajib mengerjakan haji”. Adapun yang berkaitan dengan tantangan dalam pelaksanaan haji adalah hal yang populer disebut di dalam Alquran: Siapa-siapa yang menetapkan niatnya untuk mengerjakan ibadah haji, maka tidak boleh rafas, berbuat fasik dan berbantahbantahan di dalam masa mengerjakan ibadah haji dan apa yang kamu kerjakan berupa kebaikan, niscaya Allah mengetahuinya, berbekallah

dan sesungguhnya sebaik-baik bekal adalah taqwa dan bertaqwalah kepadaku wahai orang-orang yang berakal (QS. Al-Baqarah: 197). Ketiga larangan di atas yaitu, rafas (bercumbu dan berhubungan suami isteri) fusuk (larangan ihram) jidal (berbantah-bantahan) adalah larangan-larangan kecil yang mana di luar pelaksanaan haji sebagian larngan itu dibolehkan misalnya rafas, seperti firman Allah Swt: Dihalalkan kepadamu pada malammalam Ramadan untuk rafas kepada isterimu (QS. Al-Baqarah: 187). Demikian pula jidal dibolehkan pada saat tertentu di luar musim haji, seperti Allah Swt: Dan bantahlah mereka dengan jalan yang baik (QS. An-Nahl: 125). Apalagi larangan ihram seperti mematahkan dahan kayu dan berwangi-wangian. Meskipun larangan-larangan di atas adalah larangan-larangan kecil bagi jamaah calon haji, akan tetapi merupakan tantangan berat bagi mereka untuk memperoleh haji mabrur. Sebab kesucian, kemuliaan, dan kemabruran haji tidak saja dinodai oleh larangan-larangan berat seperti berzina, mencuri, karena hal itu tidak mungkin dilakukan oleh jamaah haji. Pesan yang terdalam dari larangan-larangan kecil itu, bahwa haji mab-rur suatu ibadah yang sulit untuk diperoleh dan mudah dinodai. Bukankah seorang yang terhormat dipandang masyarakat selalu tersandung dengan kerikil-kerikil kecil yang membuat harkat dan martabatnya ternodai? Uraian di atas seyogianya menjadi persiapan bagi seorang calon haji. Dengan kata lain, seseorang yang ingin mendapatkan haji mabrur tidak cukup dengan doa, mohon doa supaya dapat haji mabrur, akan tetapi pada pra haji, calon haji telah menempah dirinya dan pasca haji menjaga kemabruran hajinya dari hal-hal yang dapat menodai kesucian hajinya, sehingga pribadi masingmasing haji dapat mengetahui, “apakah haji anda mabrur?”. Wallahua’lam bil ash-shawab.

Hakikat Ibadah Haji Oleh Sugeng Wanto, MA Dosen Fakultas Ushuluddin IAIN-SU, Ketua Umum Pusat Ikatan Da’i Muda Cendikiawan (IDAMAN Centre) Sumatera Utara.


abbaik allhumma labbaik. Labbaika la syarika laka labbaik. Innal hamda wanni’mata laka wal mulk, la syarika laka labbaik. Kami hadir, hadir memenuhi panggilan-Mu ya Allah. Kami hadir, hadir untuk mengokohkan kesaksian, bahwa tidak ada sekutu yang pantas bagi-Mu. Sungguh segala pujian, nikmat dan kekuasaan itu hanyalah milik Mu, sungguh tak ada yang pantas menyekutukanMu. Ya Allah, untuk seluruh kesaksian itulah kami hadir di sini, di sisi Bait-Mu yang agung. Itulah talbiyah yang dipekikkan jutaan jamaah haji dari seluruh pelosok dunia, menjadi bukti konkret ketakwaan sejati pada Allah SWT tanpa membedakan warna kulit, status sosial, pangkat, jabatan. Kesungguhan setiap manusia untuk meraih takwa itulah yang membedakan kemuliaan satu dengan yang lainnya (Q.S. al Hujurat: 13). Talbiyah haji mengokohkan kembali makna dan kekuasaan syahadat dalam diri setiap Muslim, bahwa kita telah terikat perjanjian dengan Allah yang maha agung saat ditanya di

alam ruh, “Bukankah Aku ini Tuhanmu?” kita lalu menjawab, “Betul (Engkaulah Tuhan kami), kami bersaksi,” ( A’raaf: 172). Melakukan perjalanan haji menjadi idaman setiap Muslim yang beriman. Makanya, tidah heran jika orang yang telah mampu baik fisik, material, maupun mental spiritual berebutan menunggu giliran untuk bisa pergi ke Makkah al-Mukarramah dalam rangka memenuhi panggilan Allah SWT tersebut. Filosofis Haji Pada 10 Zulhijjah, dari atas untanya, Nabi Muhammad SAW menyampaikan khutbah. Usai khutbah, seorang bertanya: “Saya ber ziarah dulu (tawaf) ke baitullah setelah itu, saya melempar jumrah?” Beliau berkata, “If’al la haraj” (lakukan saja, tidak ada salahnya). Yang lainnya berkata, “saya bercukur dulu sebelum menyembelih. “Beliau berkata, “if’al la haraj-lakukan saja, tidak ada salahnya. Kata Abdullah bin Umar, “Setiap ditanya tentang sesuatu yang didahulukan atau diakhirkan, Nabi selalu berkata, “If’al la haraj-Lakukan saja, tidak ada

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Ustad, Apa hebatnya surat Al-Mulk itu, Saya selalu disuruh mengamalkan surat Al-Mulk dari para orang tua dan para alim. Dari Muhammmad Husni di Langkat. Jawab : Terimakasih atas pertanyaanya. Surat Al-Mulk dinamakan juga surat Tabarak, al-maniah, al-munjiyah dan al-waqiyah. Banyak memang keutamaan surat Al-Mulk ini, diantaranya: “ Dari Abu Hurairah Nabi bersabda: “Ada satu surat dalam Alquran yang berjumlah tiga puluh ayat dimana surat tersebut akan memintakan syafa’at bagi para pembacanya hingga dia diampuni, surat itu adalah surat Al-Mulk” (HR Abu Daud). Dari Anas bin Malik Nabi bersabda: “Ada satu surat dalam Alquran yang berjumlah tiga puluh ayat, yang memperjuangkan pembacanya hingga ia memasukkannya ke surga, surat itu adalah surat Al-Mulk” (HR Thabrani). Abdullah bin Mas’ud berkata: “ Barang siapa membaca surat Al-Mulk setiap malam, Allah akan menghindarkannnya dari siksa kubur dengan surat tersebut. Pada masa Nabi kami menamainya dengan al-mani’ah (penghalang). Ia adalah surat dalam alquran yang jika dibaca setiap malam, maka pembacanya akan mendapatkan banyak kebaikan”( HR An-Nasai). Abdullah Bin Mas’ud bersecerita: “ Surat Al-mulk adalah penghalang-dengan izin Allah-dari siksa kubur.Dalam Taurat juga ada surat Al-mulk. Barang siapa membacanya pada malam hari, maka ia akan mendapatkan banyak kebaikan” (HR Thabrani)’. Demikian diantara kehebatan surat Al-mulk, semoga dapat diamalkan.Walluhu A’lam. Al-Ustadz H. Ismail Hasyim, MA

Nabi Muhammad SAW menunjukkan bahwa yang paling penting dari ibadah haji bukanlah ritus-ritus formalnya, melainkan hakikatnya. salahnya.” (H.R. Bukhari). Hadis ini menunjukkan bahwa setiap perbuatan yang harus dilakukan oleh mukallaf dan Nabi SAW tidak menentukan dengan tegas. Artinya, cara dan urutan-urutan pelaksanaannya terbuka luas dan bersifat fleksibel. Setiap mukallaf dapat melakukannya sesuai keyakinannya, tulis Muhammad jilil Isa dalam kitabnya Ma la Yajuz Fih al–Khilaf yang dikutip kembali oleh Jalaluddin Rahmat “Meraih Cinta Ilahi” ketika mengomentari hadis ini. Ketika berkata if’al la haraj, Nabi Muhammad SAW bukan saja mengajarkan penghargaan pada pemahaman agama yang berbeda. Beliau juga menunjukkan bahwa yang paling penting dari ibadah haji bukanlah ritus-ritus formalnya, melainkan hakikatnya. Ritus-ritus itu, walaupun tidak boleh ditinggalkan, hanyalah wahana untuk tujuan haji yang sebenarnya. Kita tidak perlu mempertentangkannya. Namun, yang perlu dibicarakan adalah bagaimana membersihkan ibadah haji kita dari kata-kata kotor, kefasikan, pertengkaran dan lainnya. Inilah yang disebut dengan hakikat ibadah haji atau rahasia haji (asrar al hajj). Haji adalah safar ruhani menuju Allah SWT menurut al-Ghazali, orang tidak akan mencapai Tuhan tanpa meninggalkan kelezatan syahwat dan keterikatannya kepada hawa nafsu. Untuk itu, para dhuyufullah (tamu Allah) harus memperhatikan sisi ruhaniyah (spiritual) ibadah haji tersebut. Ibnu Qudamah dalam Minhajul Qashidin ada menyebutkan hal-hal yang mesti diperhatikan berkaitan dengan nilai-nilai ruhaniyah dalam rangka menjadi haji mabrur. Antara lain sebagai berikut : Pertama, hatinya betul-betul ikhlas untuk mendapatkan ridha Allah semata-mata. Kedua, menghindarkan diri dari barang-barang atau hal-hal yang berbau kesombongan duniawi. Ketiga, Jika ingin membawa bekal, maka hendaknya bekal yang paling utama adalah bekal amal untuk akhirat. Para dhu-yufullah harus mewaspadai agar amal-amalnya tidak rusak karena riya’ dan karena ingin membanggakan diri, karena hal ini sama sekali tidak ada manfaatnya. Keempat, saat mengucapkan talbiyah, diiringi dengan perasaan harap (raja’) dan takut (khouf). Kelima, saat melihat baitul-

haram, hendaklah dia merasakan keagungan-Nya, mengucapkan syukur kepada Allah karena dia dijadikan golongan orang-orang yang bisa berkunjung ke sana, merasakan keagungan thawaf di sekitar Ka’bah. Keenam, saat mencium atau melambai hajar aswad, hendaklah dia bersumpah setia untuk taat kepada Allah dan bertekad untuk memegang sumpah setianya. Ketujuh, saat memegang tabir Ka’bah atau saat di Multazam, hendaknya dia menempatkan dirinya sebagai orang yang bersalah di hadapan Tuhannya. Kedelapan, saat melakukan sya’i antara Shafa dan Marwah, dia harus menggambarkan dua tempat ini seperti dua tapak timbangan. Dia akan mendatangi dua tapak timbangan itu pada hari kiamat, atau seakan dia mendatangi pintu tempat malaikat untuk mengharap belas kasihnya. Kesembilan, saat wukuf di Arafah dan melihat sekian banyak manusia yang berkumpul di sana dan bermacam ragam bahasa dan suara mereka, maka bayangkanlah seakan itu adalah keadaan pada hari kiamat, saat manusia semua berkumpul dan memohon syafaat. Kesepuluh, saat melempar jumrah, niatkanlah untuk tunduk kepada perintah dan menunjukkan kepada ubudiyah dan ketundukan, semata karena mengikuti perintah itu tanpa memikirkannya dengan pikirannya yang macam-macam. Kesebelas, Jika engkau berkunjung ke Madinah, maka bayangkanlah bahwa itu adalah negeri yang telah dipilih untuk Nabi-Nya, bercerminlah dari kekhusyukan dan ketenangan Rasulullah ketika beliau berada di negeri tersebut. Tips haji dari Ibnu Qudamah itu sebetulnya menggambarkan perspektif sufistik. Ja’far Shadiq, tokoh besar dalam dunia tasawuf, memberikan nasihat kepada para dhuyufulah (jamaah haji): “Jika engkau berangkat haji, kosongkanlah hatimu dari segala urusan. Hadapkanlah dirimu sepenuhnya kepada Allah Swt., tinggalkan setiap penghalang dan serahkan urusanmu kepada penciptamu. Bertawakkallah kepada-Nya dalam setiap gerak dan diammu. Berserah dirilah kepada ketentuanketentuan-Nya, hukum-hukum-Nya, dan takdir-Nya…(Secara lengkap bisa dibaca dalam Jalaluddin Rahmat “Meraih Cinta Ilahi”). Semoga pada dhuyufullah menjadi haji yang mabrur. Amin. Wallahu a’lamu

WASPADA Jumat 28 September 2012

Idul Adha Dan Kewajiban Berkurban Meneladani Ketakwaan Nabi Ibrahim (2) Kalau Hari Raya Idul Fitri merupakan suatu manifestasi dari rasa gembira setelah sebulan penuh menjalani latihan pengendalian diri dan perang melawan hawa nafsu. Sedangkan Hari Raya Idul Adha adalah wujud dari keimanan dan ketakwaan serta kepatuhan terhadap Sang Khaliq, Allah SWT. Insya Allah, Hari Raya Idul Adha tahun ini (10 Dzulhijjah 1432 H) bersamaan dengan tanggal 26 Oktober 2012. Ada keistimewaan tersendiri dari Hari Raya Idul Adha, yakni waktunya bersamaan dengan pelaksanaan ibadah haji di Tanah Suci. Pada tanggal 10 Dzulhijjah jamaah haji yang telah selesai wukuf di Arafah akan melontar Jumratul Aqabah di Mina. Keistimewaan lain ialah kewajiban menyembelih kurban selesai menunaikan salat Idul Adha atau pada hari raya Tasyriq yakni tanggal 11, 12 dan 13 Dzulhijjah. Kaum muslimin juga dianjurkan melantunkan takbir, tahlil dan tahmid mulai dari tanggal 10 sampai dengan tanggal 13 Dzulhijjah (empat hari termasuk hari-hari tasyriq). Kalau Idul Fitri kita hanya disuruh bertakbir, bertahlil dan bertahmid hanya sampai usai salat Ied, maka pada Hari Raya Idul Adha kita melakukannya selama empat hari. Adapun makna hakiki dari ibadah kurban yang diwajibkan kepada seorang muslim yang memiliki kemampuan adalah ‘kerelaan berkurban’ sebagaimana dicontohkan oleh Nabi Ibrahim As, Nabi Ismail As dan Siti Hajar. Mereka rela berkurban demi kepatuhan dan ketaatannya kepada perintah Allah SWT. Syariat berkurban diturunkan Nabi Ibrahim As kepada Nabi Muhammad SAW dan umatnya memiliki makna dan hikmah yang besar bagi umat Islam. Hikmahnya adalah mengikuti jejak Nabi Ibrahim As. Secara rinci ada dua:.(Sumber: Hadis shahih/SP/mol).

Berlomba Menjadi Dhuyufurrahman Oleh Watni Marpaung, MA Dosen Fakultas Syariah IAIN SU


agi umat Islam Indonesia pada saat mendekati bulan-bulan Dzulhijjah atau bulan haji akan terlihat suatu tradisi dimana banyak masyarakat yang melakukan sedekah, upah-upah kepada para jama’ah haji yang akan berangkat ke tanah suci. Tradisi ini sudah menjadi kebiasaan yang berlangsung cukup lama di tanah air, sebagai sebuah bentuk tanda rasa syukur kepada Allah Swt atas rezeki yang diberikan selain mengharapkan do’a dari para saudara agar dalam melaksanakan hajinya dan semoga mendapatkan haji yang mabrur. Selain itu, tingkat keinginan umat Islam untuk melaksanakan rukun Islam yang kelima semakin tahun semakin meningkat. Padahal secara sudut pandang ekonomi, sebahagian besar masyarakat sangat terpukul dengan keadaan ekonomi yang tidak menentu. Tetapi semua itu terlihat seperti tidak menjadi penghalang untuk lebih dekat dengan pemilik alam ini sekaligus dapat bertamu di rumah-Nya. Bagaimana animo masyarakat yang begitu tinggi untuk berangkat ke tanah suci dapat kita lihat dari para pendaftar untuk jadi calon haji pada tahun yang akan datang. Bahkan terkadang sudah ada yang mendaftar diri atau keluarganya untuk dua, atau tiga tahun yang akan datang dan sampai pembatasan diri. Hal itu mengindikasikan adanya sikap saling berlomba untuk melakukan kebaikan sekalipun dengan biaya yang lumayan mahal. Agaknya inilah yang dimaksud oleh Allah dalam surat al-Baqarah ayat 148, yang artinya: “Berlomba-lombalah kamu dalam kebaikan”. Ayat di atas mengisyaratkan bahwa berkompetisi dalam kebaikan dan kebenaran merupakan sikap yang baik dan harus dikembangkan. Sama halnya saudara-saudara kita yang pergi haji sangatlah wajar kita berharap agar kiranya dapat pula menyusul mereka menjalankan ibadah ke tanah suci. Bukan malah sebaliknya, berlomba-lomba dalam melakukan aksi kejahatan dan maksiat, sebagaimana yang banyak kita lihat saat sekarang ini. Memotivasi diri untuk haji Dalam sebuah hadis disebutkan bahwa boleh iri kepada dua hal: Pertama, mereka yang mempunyai ilmu pengetahuan kemudian menggunakan ilmu tersebut untuk beribadah dan lebih mendekatkan diri kepada Allah. Kedua, orang mempunyai harta kemudian dia membelanjakan hartanya di jalan Allah. Dalam petikan makna hadis di atas kita dapat memetik satu di antara kebolehan iri hati kepada mereka yang memang Allah mengharuskan kita iri hati kepada mereka. Adalah orang-orang yang membelanjakan atau menghabiskan hartanya di jalan Allah dengan berbagai cara, mungkin dengan berinfak kepada pembangunan mesjid, sekolah, membantu anak yatim, dan lain sebagainya. Namun apabila kita kelompokkan para calon haji yang akan berangkat ke tanah suci pun dapat dikagorikan kepada mereka yang membelanjakan hartanya di jalan Allah, sebab telah menghabiskan ongkos yang mencapai jutaan rupiah disamping uang belanja yang ditinggalkan untuk keluarga dan bekal dalam perjalanan. Oleh karena itu, kita semua yang belum menunaikan ibadah haji ke Baitullah harus merasa iri hati kepada mereka karena lebih dahulu membelanjakan hartanya di jalan Allah. Adanya perasaan konstruktif itu akan memberikan motivasi yang kuat kepada kita untuk dapat pula dikemu-

dian hari menjadi dhuyuf alrahman berikutnya. Bahkan terkadang tidak sedikit pula dari saudara kita yang mempunyai harta kekayaan yang melimpah dan kewajiban untuk melaksanakan haji itu sampai pada dirinya. Namun karena cinta dengan dunia, serakah, lebih tepatnya lagi merasa rugi karena akan mengurangi harta kekayaan yang dimilikinya. Sehingga dia lupa bahwa harta yang dimilikinya hanyalah titipan Allah yang harus dialokasikan kepada jalan yang diridhoiNya. Harta yang telah dibelanjakan di jalan Allah maka itulah harta yang mendapatkan keberkahan dan akan ditambah lagi oleh-Nya. Keikhlasan Niat Dalam beribadah kepada Allah harus seluruhnya didasari dengan penuh keikhlasan yang sebenar-benarnya. Tidak terkecuali dalam melaksanakan ibadah haji ke Baitullah haruslah dimulai dengan keikhlasan semata-mata untuk mendapatkan ridho-Nya. Begitu pentingnya ikhlas dalam mengabdi kepada Allah secara tegas dinyatakan Allah daalm surat al-Bayyinah ayat 5, yang artinya: “Padahal mereka tidak disuruh kecuali supaya menyembah dengan memurnikan ketaatan kepada-Nya dalam menjalankan agama dengan lurus dan supaya mereka mendirikan shalat dan menunaika zakat, dan yang demikian itulah agama yang lurus”. Ayat di atas merupakan penegasan Allah yang tidak bisa ditawar-tawar lagi dalam menjalankann ibadah kepada-Nya. Keikhlasan yang mantap dalam hati ketika beribadah merupakan suatu tanda ibadah yang kita kerjakan bukan karena faktor yang lain selain dari diri-Nya. Sebab Allah menginginkan kemurnian secara totalitas beribadah dan mengabdi kepada-Nya tanpa karena iming-iming kehidupan dunia. Demikian juga halnya dengan pelaksanaan ibadah haji ke tanah suci adalah ibadah yang wajib untuk dikerjakan bagi mereka yang mempunyai kemampuan mengadakan perjala-nan, berupa bekal keberangkatan dan untuk yang ditinggalkan disamping keamanan. Namun demikian ibadah haji yang begitu banyak menyita waktu dan energi akan dapat menjadi sia-sia dan nihil sama sekali manakala dikotori oleh motivasi dan tujuan-tujuan yang bukan karena Allah, supaya disebut orang kaya, atau untuk mendapat gelar Pak Haji, atau agar menjadi beda dengan orang-orang yang belum haji misalnya. Motivasimotivasi seperti merupakan diantara faktor-faktor yang dapat merusak ibadah para jama’ah haji dalam beribadah kepada-Nya. Sekalipun agama memerintahkan kita untuk selalu berlomba-lomaba dalam kebaikan termasuklah diantaranya menunaikan ibadah haji ke Mekah, namun paling tidak harus pula dijaga diri kita dari hal-hal yang dapat merusak nilai-nilai ibadah yang kita lakukan sebagai sebuah introspeksi diri supaya tetap berada di jalan-Nya. Penutup Menjadi tamu Allah adalah sebuah sebutan yang sangat mulia dan terhormat dibanding dengan menjadi tamu pejabat negara atau pemerintah, sebab yang menerima kita adalah penguasa alam dan pengusa diri kita sendiri. Sudah sewajarnya kita semua berharap menjadi tamu yang mulia itu. Tetapi akan sangat cukup disayangkan jika motivasi atau niat menunaikan ibadah haji tersebut dikotori dengan hal-hal yang dapat merusak nilai ibadah itu sendiri.

Perasaan konstruktif itu akan memberikan motivasi yang kuat kepada kita untuk dapat pula dikemudian hari menjadi dhuyuf al-rahman.

Mimbar Jumat

WASPADA Jumat 28 September 2012

Segerakan Dan Raihlah Haji Mabrur (2) IJustru itu, berhajilah bagi umat Islam yang mampu. Punya uang Rp30an juta, jangan tunggu sampai Rp100 juta baru berangkat. Segera daftar, kapan waktu/giliran berangkat urusan pemerintah. Jangan sampai ajal tiba kita belum memenuhi panggilan rukun Islam kelima. Bahayanya besar, bisa mati sebagai Yahudi dan Majusi. Semoga Allah memudahkan seluruh jamaah haji dalam melaksanakan ibadah yang mulia ini. Kedudukan haji dalam agama Islam begitu utama masuk rukun Islam kelima, sebagaimana sabda Rasulullah SAW: “Islam dibangun atas lima dasar: bersaksi bahwa tiada tuhan yang berhak disembah kecuali Allah dan Muhammad adalah utusan Allah, mendirikan shalat, menunuaikan zakat, haji dan puasa Ramadhan”. (HR. Bukhari dan Muslim). Sungguh merugi umat Islam yang mengabaikan perintah berhaji. Dalam Alquran disebutkan siapa yang meninggalkan haji dengan sengaja karena tidak mengakui kewajibannya maka sungguh ia telah kafir kepada Allah Ta’ala: QS. Ali Imran: 97 yang artinya: “Mengerjakan haji adalah kewajiban manusia terhadap Allah, yaitu (bagi) orang yang sanggup mengadakan perjalanan ke Baitullah; Barang siapa mengingkari (kewajiban haji), maka sesungguhnya Allah Maha Kaya (tidak memerlukan sesuatu) dari semesta alam”. Begitu juga kerugian besar bagi siapa yang diluaskan rezekinya dan tidak kunjung melaksanakan haji Rasulullah bersabda: “Allah Ta’ala berfirman: “Sesungguhnya seorang hamba telah Aku sehatkan baginya badannya, aku luaskan rizekinya, berlalu atasnya lima tahun dan dia tidak mendatangiKu sungguh dia adalah orang yang sangat merugi”. (HR. Ibnu Hibban dan dishahihkan oleh Al Albani di dalam kitab Shahih At Targhib wa At Tarhib). (Sumber: Hadis shahih, Bukhari/Muslim,

Motivasi Beribadah Oleh Junaidi Dosen FU IAIN Dan UMSU


eribadah, itulah salah satu tujuan Allah SWT menciptakan manusia di bumi yang fana ini. Hal ini sebagaimana informasi yang diberikan Allah SWT dalam surat Adz-Dzariyat ayat 56, yang artinya “Dan tidaklah Kami ciptakan jin dan manusia kecuali untuk beribadah kepada-Ku” Dikarenakan ibadah merupakan tujuan diciptakannya manusia, maka alangkah bijaknya jika motivasi beribadah yang dilakukan adalah untuk memenuhi anjuran Allah SWT (untuk Allah). Namun dalam kenyataan sehari-hari, manusia beribadah karena motivasi-motivasi tertentu yang satu sama lain bisa saja berbeda. Secara umum, motivasi beribadah dapat dibagi menjadi dua yaitu: beribadah karena Allah dan beribadah karena selain Allah. Idealnya ibadah hendaklah dilakukan karena dilandasi motivasi karena Allah semata, inilah yang disebut dengan ikhlas. Sebagaimana yang telah difirmankan Allah dalam surat AlBayyinah ayat 5 ”Dan tidaklah manusia diperintahkan kecuali untuk beribadah kepada Allah dengan memurnikan ketaatan hanya kepada-Nya”. Ibadah yang dilakukan dengan motivasi ikhlas karena Allah, akan menghasilkan ibadah yang memiliki bobot nilai yang tinggi. Sehingga di samping berfungsi untuk mendekatkan diri kepada Allah, juga dapat digunakan sebagai alat untuk bernegosiasi dan bargaining (tawar menawar) dengan Allah di saat kita mengalami kesulitan dan membutuhkan se-suatu. Mungkin kita masih ingat dengan sebuah cerita tentang 3 orang penghuni gua yang pernah di-sampaikan oleh Rasulullah SAW dalam sebuah ha-disnya yang diriwayatkan oleh Bukhari dan Muslim. Dalam hadis tersebut, Rasulullah SAW menceritakan, “Dahulu kala ada 3 orang yang sedang keluar rumah untuk mengadakan perjalanan secara bersama. Dalam perjalanan mereka merasa lelah dan akhirnya memutuskan untuk beristirahat dalam sebuah gua. Ketika mereka sedang asyik istirahat, tiba-tiba datang angin topan yang sangat kuat dan besar, sehingga batu-batu besar menggelinding dan menutup pintu gua. Mereka berusaha dengan sekuat tenaga menyingkirkan batu, tetapi tidak membuahkan hasil dan batu tetap menutupi mulut gua. Dalam keadaan yang hampir putus asa, akhirnya mereka sepakat untuk mencari jalan keluar alternatif yaitu bernego kepada Allah SWT dengan menyebutkan amal terbaik yang pernah mereka lakukan ikhlas karena Allah. Orang pertama memulai negosiasi dengan mengatakan “Ya Allah, saya adalah orang yang selamanya berbakti pada kedua orang tua. Tidak pernah saya, istri dan anak-anak makan ataupun minum mendahului orang tuaku. Suatu hari, kami terlambat pulang dari pasar, sehingga ketika akan menghidangkan makanan dan minuman, ternyata mereka telah tertidur. Saya tidak berani membangunkan mereka, anak-anak Saya menangis karena lapar tapi saya tidak berani memberikan makanan kepada mereka sebelum kedua orang tua makan. Saya biarkan mereka sampai kedua orang tua saya bangun. Karena terlalu lama, akhirnya anak-anak pun tertidur. Ya Allah jika yang saya lakukan merupakan perbuatan baik dan ikhlas karena-Mu, dan Engkau terima, maka aku mohon kepada-Mu ya Allah, keluarkanlah aku dari kesulitan ini”. Setelah orang tersebut berdoa, ternyata batu tersebut bergeser, akan tetapi masih sangat sedikit sehingga mereka bertiga belum bisa keluar. Lalu giliran orang kedua menceritakan amal terbaik dan terikhlas karena Allah, yaitu tentang kemampuannya menahan nafsu. Setelah selesai menceritakan amalnya, orang tersebut berdoa “Ya Allah, jika saya mengendalikan tersebut sematamata karena takut kepada-Mu, maka tolonglah keluarkan kami dari gua ini”. Akhirnya batu tersebut bergeser, namun mereka juga belum bisa keluar. Kemudian giliran orang ketiga menceritakan

amal terbaiknya. Amal orang tersebut tentang upah/gaji yang seorang karyawan yang belum sempat dibayar karena karyawan tersebut pergi tanpa pamit, lalu upah tesebut dikembangkannya dalam bentuk ternak. Setelah sekian lama barulah karyawan itu muncul dan menagih upah tersebut. Kemudian semua ternak diserahkan pada karyawan tersebut. Setelah selesai menceritakan amalnya, ia pun berdoa “Ya Allah jika yang aku lakukan tersebut ikhlas karena-Mu dan Engkau terima, maka keluarkanlah kami dari gua ini”. Akhirnya batu tersebut menggelinding dan mulut gua pun terbuka, sehingga mereka bisa keluar dengan selamat. Cerita tersebut merupakan bentuk negosiasi dan tawar menawar dengan Allah yang dapat dilakukan melalui perantara (tawassul) amal shalih. Tapi tentunya amal atau ibadah tersebut dilandasi motivasi ikhlas karena Allah. Salah satu ibadah yang saat ini sedang ramai dan hangat serta menjadi sorotan berbagai kalangan adalah ibadah haji. Menurut Rasululullah SAW, ada empat motivasi seseorang melakukan ibadah haji, yaitu: Pertama: Wisata. Orang yang mela-kukan ibadah haji karena motivasi ini, maka haji bukan sebagai sarana un-tuk mendekatkan diri kepada Allah tetapi sebagai sarana untuk bersenang-senang untuk memuas-kan keinginan rekreatifnya. Sehingga ketika melaksanakan haji yang ada dalam pikirannya bukanlah hal-hal yang terkait dengan ibadahnya, tetapi lebih pada hal-hal yang berhubungan dengan kegiatan rek-reasinya seperti fasilitas penginapan, trans-portasi, konsumsi dan tempat-tempat belanja yang tidak ada di tanah air. Kedua: Bisnis. Orang yang mengerjakan ibadah haji karena motivasi ini, maka tujuan utamanya adalah mencari keuntungan, sedangkan haji hanyalah sebagai sambilan saja. Sehingga ketika di tanah suci, ia akan sibuk mencari partner bisnis, sibuk mencari modal atau usaha lain yang sifatnya untuk kepentingan bisnis. Ketiga; Popularitas. Orang yang mengerjakan ibadah haji karena motivasi ini, maka haji yang dilakukan hanya untuk mendukung popularitas-nya saja. Hal ini karena adanya sebuah pandangan dalam kehidupan masyarakat bahwa ibadah haji merupakan ibadah yang memiliki derajat yang tinggi, dan orang yang sudah berhaji dianggap sebagai orang yang sudah sempurna keimanannya. Di antara ciri yang dapat dilihat dari orang yang melaksanakan haji karena dilandasi motivasi popularitas adalah ia gemar mencantumkan gelar haji di depan namanya dan marah jika orang lupa menyebutkan gelar hajinya. Contoh yang paling tepat untuk menggambarkan realitas ini adalah sikap Haji Muhidin dalam sinetron seri yang berjudul “Tukang Bubur Naik Haji” yang ditayangkan salahsatu stasiun swasta nasional. Keempat: Allah. Orang yang mengerjakan ibadah haji karena motivasi ini, maka semua kemampuannya akan difokuskan untuk memenuhi panggilan (seruan) Allah SWT. Ia akan memperhatikan semua hal yang berkaitan dengan ibadah haji, seperti wajib haji, rukun haji dan lainlain. Sehingga ketika kembali ke tanah air, ia akan mendapatkan gelar haji mabrur yang ditandai dengan semakin baik kehidupannya, semakin dekat kepada Allah SWT (hablun minallah) dan semakin peduli serta ramah dengan sesama manusia (hablun minannas).

Menurut Rasululullah SAW, ada empat motivasi seseorang melakukan ibadah haji, yaitu: wisata, bisnis, popularitas, dan Allah.

Penutup Ibadah apapun yang kita lakukan hendaklah dilandasi motivasi karena Allah, hal ini karena akan menghasilkan ibadah yang memiliki bobot nilai yang tinggi. Sebaliknya, ibadah yang kita lakukan karena motivasi selain Allah, tidak punya nilai apa-apa di hadapan Allah.


Menakar Kriteria Ulama Dalam Alquran Oleh Achyar Zein Dosen Fak. Tarbiyah IAIN Sumut, Pengurus el-Misyka Circle


lquran memberikan batasan bahwa hamba-hamba Allah yang takut kepada-Nya hanyalah para ulama seperti disebutkan dalam QS. Fathir ayat 28. Batasan ini menunjukkan bahwa orang-orang yang memiliki ilmu pengetahuan sangat mungkin untuk bertaqwa kepadaNya bila dibanding dengan orangorang yang tidak memiliki pengetahuan sama sekali. Perbedaan pandangan tentang karakteristik ulama terdapat juga dalam literatur Islam yang satu sisi melihatnya melalui penguasaan dalam bidang ilmu pengetahuan dan pada sisi lain memandangnya melalui sikap seperti ketaqwaan kepada Allah. Prinsip yang mendasar dari kedua pandangan di atas tetap mengacu kepada teks-teks Alquran yang seharusnya dikompromikan agar saling melengkapi. Karakteristik ulama yang sesungguhnya sama dengan para nabi yang pada satu sisi bertugas sebagai penyampai risalah dan pada sisi lain sebagai ri’asah. Pernyataan Rasulullah bahwa ulama adalah pewaris para nabi menunjukkan bahwa pada diri seorang ulama menyatu dua sifat yaitu ilmu dan taqwa. Kedua sifat ini wajib ada pada diri seorang nabi dan karena itu pernyataan Rasulullah ini dapat dijadikan sebagai barometer untuk mengukur karakteristik seorang ulama. Sesungguhnya, karakteristik seorang ulama telah digambarkan di dalam Alquran secara utuh. Keutuhan karakteristik ini didapati berdasarkan konsep al-munasa-bah (korelasi) dengan ayat-ayat sebelum dan sesudahnya sebagaimana disebutkan di dalam Q.S. Fathir ayat 27-37. Surat Fathir ini menjelaskan tentang karakteristik para ulama yang mencakup dalam berbagai aspek. Sebagai contoh, ulama adalah sosok yang memberikan perhatian mendalam tentang alam, takut kepada Allah, membaca kitab-kitab-Nya, mendirikan shalat, berinfak dan mengharapkan perniagaan yang tidak rugi. Para ulama adalah sosok yang tidak pernah berhenti memikirkan alam karena setiap kali

berpikir tentang alam maka ketaqwaan mereka semakin bertambah. Dengan demikian, ulama itu adalah sosok yang kreatif dan dinamis khususnya dalam merenungi ciptaan-ciptaan Tuhan. Quraish Shihab dalam bukunya Dia di Mana-mana menjelaskan bahwa ulama adalah orang-orang yang terus-menerus mem-perhatikan dan memahami kitab Tuhan yang terhampar di alam raya. Mereka mengenalnya mela-lui hasil ciptaan-Nya, menjangkau-Nya melalui dampak kuasa-Nya, serta merasakan hakikat kebesaran-Nya dengan melihat aneka kebijakanNya. Dari sini, maka mereka takut dan kagum kepada-Nya serta bertaqwa dengan sebenar-benarnya. Menurut Wahbah al-Zuhayli dalam kitab tafsirnya al-Munir bahwa ulama ialah orang-orang yang mengetahui ilmu-ilmu alam dan rahasia-rahasianya dan juga orang-orang yang mengetahui tentang kehidupan. Pengertian yang dikemukakan oleh Wahbah ini menunjukkan bahwa ulama tidak hanya terbatas kepada orang-orang yang hanya menguasai bidang-bidang ilmu agama saja. Pernyataan yang menyebutkan bahwa ulama harus memikirkan alam mengindikasikan bahwa sebutan ulama tidak hanya terbatas kepada orang-orang yang hanya mengetahui persoalan agama saja akan tetapi memiliki kemampuan membuat teori-teori dalam memahami agama dan juga aspek-aspek yang lain (selain agama). Sebagaimana yang dikemukakan oleh Quraish Shihab dalam tafsirnya al-Mishbah bahwa sebutan ulama tidaklah bersifat khusus terhadap aspek kajian tertentu (bidang agama) akan tetapi sebutan ulama berlaku juga bagi orang-orang yang menguasai bidang-bidang disiplin ilmu yang lain. Ulasan yang dikemukakan oleh Hamka tentang karakteristik ulama terkesan cukup menarik. Di dalam tafsirnya al-Azhar, Hamka mengatakan bahwa ulama bukanlah orang-orang yang mengetahui hukum-hukum agama secara terbatas, dan bukan pula orang-orang yang hanya mengkaji kitab-kitab fiqh, dan bukan pula ditentukan oleh jubah dan serban besar.

Ulama bukanlah orang-orang yang mengetahui hukum-hukum agama secara terbatas, dan bukan pula orangorang yang hanya mengkaji kitabkitab fiqh, dan bukan pula ditentukan oleh jubah dan serban besar. Malahan dalam perjalanan sejarah telah kerapkali agama terancam bahaya karena serban yang besar. Karakteristik lain dari ulama adalah rasa ketakutan mereka yang mendalam terhadap Tuhan. Rasa takut ini muncul dikarenakan mereka memahami sifat-sifat Tuhan dan sekaligus memperhatikan bukti-bukti tentang Tuhan. Melalui bukti-bukti ini para ulama mengetahui hakikat yang sebenarnya. Rasa takut ini muncul karena diawali pengetahuan yang mendalam sehingga mereka memiliki kemampuan untuk menginternalisasi kesempurnaan Tuhan dan sifatsifat kemuliaan-Nya, demikian menurut Nizam al-Din al-Hasan di dalam tafsirnya Ghara’ib Alquran. Takutnya ulama kepada Tuhan sebagaimana yang ditegaskan oleh al-Razi dalam tafsirnya Mafatih alGhayb karena mereka sudah sampai kepada pendalaman ma‘rifat yang sebenarnya. Justru itu maka posisi ulama lebih tinggi derajatnya dari yang ahli ibadat. Pernyataan Allah bahwa yang paling mulia di sisi-Nya orang yang taqwa menjelaskan bahwa kemuliaan diukur melalui ketaqwaan sedangkan ketaqwaan diukur melalui ilmu pengetahuan. Oleh karena itu, ketaqwaan yang merupakan salah satu karakteristik ulama hanya dapat direalisasikan melalui ilmu pengetahuan. Dengan kata lain, tanpa ilmu pengetahuan tidak mungkin seseorang dapat menjadi taqwa. Menurut pandangan al-Syawkani dalam tafsirnya Fath al-Qadir bahwa prinsip rasa takut kepada Tuhan muncul setelah mengenal sifat-sifat-Nya yang mulia dan perbuatan-perbuatan-Nya yang serasi. Melalui sifat-sifat dan perbuatanperbuatan Tuhan ini timbullah rasa

kagum yang mendalam sehingga dapat melahirkan rasa takut. Menurut Wahbah al-Zuhayli, bahwa faktor-faktor yang menyebabkan takutnya ulama kepada Allah karena Dia sangat antusias membela para ulama dari orang-orang kafir, mengampuni dosa-dosa orang-orang mukmin yang bertaubat kepadaNya menyiksa dan memberi pahala orang-orang yang berhak mendapatkannya apabila ia takut. Selanjutnya Wahbah menjelaskan, faktor inilah yang mewajibkannya takut dan sekaligus berharap, adapun keadaan-Nya Mahaperkasa dan memiliki balasan mewajibkan ketakutan yang sempurna. KeadaanNya Yang Mahapengampun mewajibkan munculnya harapan yang kuat dan semua ini didapati melalui pemahaman yang mendalam. Adapun sosok yang mampu mendapatkannya adalah para ulama yang istimewa. Karakteristik ulama yang ideal menurut al-Tabataba’i dalam tafsirnya al-Mizan adalah orang-orang yang mengetahui tentang Allah yaitu mereka mengenal nama-nama, sifat-sifat dan perbuatan-perbuatan-Nya dengan pengenalan yang sempurna. Hati mereka tenteram, hilang keraguan dan kegelisahan dari jiwa mereka, dan muncul pengaruhnya terhadap aktifitas-aktifitas mereka lalu sesuai ucapan dan perbuatan mereka. Adapun yang dimaksud dengan takut ketika itu adalah benar-benar takut dan kemudian diiringi dengan kekhusyukan dalam bathin mereka dan kerendahan dalam penampilan. Karakteristik yang dikemukakan di atas dapat dijadikan sebagai barometer tentang keulamaan seseorang. Karakteristik ini juga meng-gambarkan bahwa ulama adalah sosok orang-orang yang berilmu bukan hanya sebatas penampilan lahiriyah.

Terorisme & Jihad Dalam Islam Oleh Yose Rizal, S.Ag.MM Kepala Sekolah MAPN 4 Martubung Medan, Alumni PPMDH TPI Medan


enilik dari judul diatas, ada satu hasrat yang menarik untuk dibahas sehingga penulis tertarik menjadikan judul ini sebagai tulisan. Akhir-akhir ini di media kita kerap sekali melihat dan menyaksikan kembali yang namanya terorisme, sebelum berbicara panjang tentang terorisme ini, saya ingin mengkaitkan dulu dengan jihad sehingga duduk masalahnya. Jihad merupakan istilah yang sangat mulia dalam islam. Tidak tanggung-tanggung, Allah akan menganugerahi surga yang dimasuki tanpa hisab bagi orang yang mati dalam rangka berjihad di jalan Allah (mati syahid). Namun sayang sekali istilah jihad ini disalah artikan oleh para kelompok Islam tertentu. Dan sebagai akibatnya muncullah citra buruk terhadap islam, dibatasinyanya gerakan dakwah, dan kerusakankerusakan yang lainnya. Mereka (para teroris) seringkali mengaitkan tindakan mereka tersebut atas dasar landasan agama islam, yaitu Jihad. Di Indonesia sendiri, gembong teroris ini dikatakan diketuai oleh Noordin M.Top Dkk dan juga dilansir memiliki hubungan dengan gerakan teroris Internasional yaitu Al-Qaedah. Ledakan demi ledakan terjadi di negeri kita ini dan peledakan terakhir yang terjadi yaitu di Hotel JW Marriott pada tanggal 17 Juli 2009, kemudian ledakan bom bali dan lain sebagainya. Bagi yang kurang paham agama mungkin menganggap mereka ini adalah para mujahidin yang kematian dengan “bom bunuh” dirinya akan membawa mereka ke surganya Allah dengan status mati syahid. Namun, sekali lagi apakah tindakan mereka ini benar-benar ada landasannya dalam agama Islam? Apakah tindakan pemboman mereka layak disebut berjihad di jalan Allah? Apakah mereka yang melakukan bom bunuh diri ini dapat dikatakan mati syahid? Oleh sebab itu, haruslah kita umat islam berpikir kritis mengenai hal ini. Janganlah kita menjelekkan agama kita sendiri atau menganggap ada ajaran yang salah dalam agama kita lantaran terkecoh melihat tindakan para pembom ini dengan tampilan-tampilan yang nampaknya agamis. Menurut Prof Syahrin Hrp, untuk memahami benar makna te-

rorisme ini kita harus mengambil dua kata yaitu teror dan isme, secara etimologi teror yaitu suatu tindakan yang membuat takut bagi diri orang lain (individual), sedangkan isme yaitu faham, jadi secara terminologi terorisme adalah suatu faham atas tindakan untuk mencapai tujuan kejahatan yang membuat rasa takut bagi diri orang lain yang ada di sekitar itu. Satu contoh: ketika kita melakukan tindakan yang membuat orang lain takut misalnya dengan membakar rumah orang lain yang menimbulkan keresahaan warga maka kita adalah teroris, kemudian jika kita melakukan tindakan kriminalitas misalnya mencuri, memperkosa anak gadis orang dan lain sebagainya yang menimbulkan rasa takut dalam masyarakat tempat tinggal kita maka kita itu dinamakan teroris. Sebenarnya dilingkungan tempat kita tinggal juga ada teroris, maka waspadailah!! Prof Syahrin juga mengatakan bahwa terorisme ini bukan jihad, al-jihadu syai’un wal irhabu syai’un akhor/ jihad adalah sesuatu dan terorisme adalah sesuatu yang lain, jadi jangan disatukan. jihad adalah Qital (Perang) dan mengerahkan kemampuan dari padanya untuk meninggikan kalimatullah. Dan ta’rif Jihad yang lebih mendasar dan lebih mencakup adalah yang dinyatakan dalam Mazhab Hanafi yaitu: Mencurahkan kemampuan dan kekuatan dengan berperang di jalan Allah SWT, dengan jiwa, harta dan lisan dan selain itu. Jadi jelas bahwa terorisme ini adalah haram baik perorangan, kelompok maupun Negara sesuai Fatwa Majelis Ulama Indonesia Nomor 3. Jadi cukup jelas juga bahwa perbedaan yang mencolok tentang makna teroris dengan jihad dalam islam agar kita selaku masyarakat dapat mewaspadainya bahwa sebenarnya terorisme ini hidup di tengahtengah kita, fastabikul khairat. Penutup Dapat ditarik satu kesimpulan dari tulisan ini bahwa Negara kita, Negara Indonesia ini sudah banyak sekali kelompok terorisme, ini sebenarnya bisa kita cegah aksi mereka melakukan tindak terorisme di Negara Indonesia ini khususnya Sumatera Utara jikalau kita mau bersatu dan tidak bercerai-berai. Karena

Perasaan konstruktif itu akan memberikan motivasi yang kuat kepada kita untuk dapat pula dikemudian hari menjadi dhuyuf al-rahman. terorisme ini kita juga tidak mengetahuinya, bisa jadi dia bisa jadi

kita bahkan bisa jadi keluarga kita. Wallahu A’lam bi Al-Shawab.

Rubrik Tanya Jawab Wakaf Kerjasama BWI Perwakilan Sumatera Utara dengan WASPADA

Benda Wakaf Yang Rusak Pertanyaan: Kepada Pengurus BWI yang terhormat Bagaimana kalau harta yang diwakafkan tidak bisa dimanfaatkan, atau rusak. Apa masih tetap mendapat pahala bagi yang berwakaf atau masih mengalir pahalanya kepada pewakif. BLY, S. Ag Tanjung Pura. As.Wr.Wb. Pak Bly yang baik. Jika kita cermati definisi wakaf baik dalam konteks fikih klasik ataupun undang-undang wakaf, maka ada beberapa kata kunci wakaf dan yang terpenting adalah harta tersebut bersifat kekal zatnya dan tidak habis apabila dipakai. Termasuk di dalamnya harta benda yang diwakafkan hendaklah tidak mudah rusak dan tidak pula sirna. Kata yang digunakan penulis fikih adalah baqa’ ‘ainih. Mengapa demikian ? Substansi wakaf sesungguhnya bukan pada zatnya tetapi pada manfa’atnya. Artinya, signifikansi wakaf sangat tergantung seberapa lama harta atau benda wakaf tersebut bisa ambil manfa’atnya buat kepentingan umum dan ummat. Apabila benda wakaf tidak dapat dimanfa’atkan lagi, maka substansi dari wakaf tersebut menjadi hilang. Sampai di sini ada dua hal penting. Pertama, bagi si wakif, pahala akan terus mengalir kepadanya, sepanjang harta yang diwakafkan itu bermanfa’at bagi kepentingan publik. Oleh sebab itu di dalam hadis kata yang digunakan adalah jariyah yang artinya mengalir. Kedua, bagi umat Islam, harta benda wakaf tentu akan berguna sepanjang bisa dimanfa’atkan untuk jangka waktu yang cukup panjang. Sejatinya wakaf yang kita berikan, bendanya haruslah kekal. Semisal tanah yang dipakai untuk pasar wakaf, rumah sakit wakaf dan sebagainya. Untuk saat ini, wakaf uang juga memiliki arti “zat kekal” dan berjangka waktu yang panjang, walaupun bentuknya tidak persis sama dengan wakaf tanah. Berbeda jika kita mewakafkan sesuatu yang hanya bisa dipakai sekali atau beberapa kali saja. Oleh sebab itu, Nazhir harus memiliki kecerdasan dalam menjaga asset-aset wakaf. Jika ada wakaf yang kurang bermanfa’at dan tersimpan digudang, maka nazir harus berupaya untuk memanfaatkannya dengan cara-cara yang tidak bertentangan dengan aspek fikih dan legal formalnya seperti UU. Bagi kita yang hendak berwakaf, maka kita harus memastikan harta atau benda wakaf itu kekal dan kemanfa’atannya bisa digunakan untuk jangka waktu yang panjang. Lihatlah masjid-masjid yang sampai hari ini berdiri megah di atas tanah-tanah wakaf. Pewakifnya bisa jadi telah meninggal dunia ratusan tahun yang lalu, namun sampai hari ini dan akan datang, pahalanya terus dinikmatinya. Inilah makna pahala yang mengalir seiring dengan mengalirnya manfa’at wakaf itu bagi public. Wallahu a’lam bi al-shawab. Pengurus BWI Perwakilan Sumatera Utara, Prof. Dr. H.M. Yasir Nasution, Drs. H. Kasim Siyo, Drs. H. Panusunan Pasaribu, MM, Drs. H. Abdur Rahman Harahap, MA, Dr. H. Azhar Sitompul, MA, Drs. H. Anif Ray, Drs. H. Asro, SH, MA, Prof. Dr. Hj. Rita F Dalimiunthe, H. Syarifuddin Siba, SH, M.Hum, Prof. Dr. H. Amiur Nuruddin, MA, Dr. H. Azhari Akmal Tarigan, MA. Pertanyaan dapat diajukan ke No Hp, 08126023328, 081533130505 dan 081362265116.


Mimbar Jumat

Timbuktu - Masjid terkenal Sankore, bagian dari perguruan tinggi abad pertengahan.

Pusat Akademik Di Afrika Selama berabad-abad, Timbuktu terwujud dalam imajinasi Barat sebagai tempat luas yang paling eksotis di dunia.

- Di luar Masjid Djingureber, satu dari tiga masjid yang mengisi perguruan tinggi Timbuktu.

TIMBUKTU pernah mengalami masa emas ketika kota itu menjadi pusat perdagangan emas dan garam. Selain sebagai pusat perdagangan, kota tersebut juga termasyur sebagai pusat akademik dan spiritual, yang memainkan peran penting dalam penyebaran Islam di Afrika. Para ulama Islam melakukan perjalanan jauh untuk menuntut ilmu di perguruan tinggi yang ada di kota itu, yang pada masa jayanya pernah memiliki 25.000 mahasiswa, serta

memiliki tiga masjid. Dibangun dari tanah lumpur dan kayu dengan gaya arsitektur Sudano-Sahelian, masjid Sankore, Sidi Yahia dan Djingarei-ber masih tetap tegak berdiri dan menjadi daya tarik utama di kota itu saat ini. Sementara Sankore, di masa jayanya, memiliki koleksi buku terbesar di Afrika setelah Perpustakaan Alexandria di Mesir. “Pada abad 14 dan 16, Timbuktu merupakan kota perguruan tinggi sangat penting di mana

WASPADA Jumat 28 September 2012 banyak naskah ilmiah tentang astronomi, matematika, fisika, medis, perekonomian dan agama dihasilkan,” kata Lazare Eloundou, Ketua unit Pusat Warisan Dunia UNESCO. Naskah-naskah ilmiah tersebut–jumlahnya ratusan ribu–masih tersimpan sebagai koleksi negara dan pribadi di kota itu. Selama beberapa generasi, keluarga-keluarga di kota itu melindungi naskah ilmiah tersebut dari tangan-tangan perusak. Karena khawatir melihat kerusuhan yang berlangsung saat ini akan menyebabkan naskah tersebut dijarah atau pun dirusak, para pustakawan dan curator berupaya menyembunyikan atau menyelundupkan naskah tersebut ke luar untuk dibawa ke tempat aman. Walau sudah ada laporan bahwa beberapa perpustakaan dijarah oleh sejumlah orang bersenjata, belum ada laporan tentang hilangnya dokumen secara signifikan, jelas Lazare. Terancam Selama berabad-abad lamanya, Timbuktu terwujud dalam imajinasi Barat sebagai tempat luas yang paling eksotis di dunia. Terletak di ujung selatan Gurun Sahara, kota tersebut hampir menjadi mitos di negara-negara yang jauh karena cerita-cerita dongengnya, dan sejumlah materi penting dan kekayaan intelektual yang ditemukan di sana. Para pengunjung terus berdatangan untuk mengeksplorasi kota tersebut yang masih tetap bertahan dari masa keemasan di abad pertengahan sebagai pusat akademik, keagamaan dan perdagangan yang penting—masjidmasjidnya yang terbuat dari tanah dan ratusan ribu naskah ilmiah tersimpan sebagai koleksi umum dan pribadi. Kota itu, sekarang menjadi bagian dari negara Mali dan dikenal sebagai ‘kota 333 orang suci’ untuk iman-iman sufi, syeikh dan ulama yang dimakamkan di sana, telah dijadikan sebagai Situs Warisan Dunia oleh UNESCO pada tahun 1988. Namun, ada kekhawatiran tempat yang dilestarikan dengan penuh perhatian ini tengah terancam keberadaannya oleh pemberontak bersenjata yang merebut kekuasaan atas kawasan kota tua itu, setelah vakumnya kekuasaan di sana akibat mundurnya pasukan pemerintah Mali. Irina Bokova, Direktur Jenderal UNESCO, mengimbau semua pihak untuk menghormati dan melindungi warisan penting kota itu. “Bangunan-bangunan yang terbuat dari tanah di Timbuktu merupakan keajaiban luar biasa,

karenanya masjid Djingareyber, Sankore dan Sidi Yahia, harus diselamatkan,” katanya. “Selain masjid, 16 makam dan musola juga penting untuk dilestarikan guna mempertahankan identitas rakyat Mali dan warisan universal.” Timbuktu, yang berpenduduk sekitar 50.000 jiwa, dikuasai oleh sedikitnya dua kelompok yang saling bertikai yang terlibat dalam pemberontakan melawan pemerintah Mali, yang bermarkas di selatan ibukota, Bamako. Satu kelompok adalah Ansar Dine, satu kelompok Salafis yang berjuang untuk menerapkan hukum Syariah. Satu kelompok lagi, Gerakan Nasional Pembeba-san Azawad (MNLA), yang selama ini memperjuangkan wilayah merdeka bagi penduduk nomaden Tuareg di utara negara itu, dan awal bulan ini secara unilateral memproklamirkan kemerdekaan bagi wilayah yang mereka sebut Azawad.Menyusul penggulingan Presiden Libya Moammar Kadhafi, banyak pasukan Tuareg yang berperang bersama pasukan Kadhafi dilaporkan kembali ke utara Mali, membawa senjata mereka. Martin van Vliet, seorang peneliti di Pusat Penelitian Afrika di Leiden, Belanda, mengatakan, walau Timbuktu tidak lagi jadi kota yang penting secara ekonomi atau pun kemiliteran, tapi kota itu menjadi hadiah penting bagi pemberontak terkait simbolisnya. “Kelompok yang menguasai Timbuktu mengendalikan ibukota simbolis tersebut seluruhnya, karena kota tersebut terkenal ke seluruh dunia. Jadi jika Anda menguasai kota itu, hal itu akan tersiar luas.” Legenda Legenda Timbuktu mulai menyebar ke seluruh dunia ketika Kaisar Mali pergi berhaji ke Makkah lewat Kairo tahun 1324, dan memukau orang-orang yang bertemu dengannya karena emas yang mereka bawa. Awal abad ke 16, laporan tentang kota di atas pasir itu–saat itu menjadi bagian dari Kaisar Songhay – menyebar sampai ke Eropa lewat diplomat Moor dan penulis Leo Africanus, sambil menambahkan status mitos kota itu sebagai African El Dorado. Menjadi seorang warga Eropa yang pertama sampai ke kota itu merupakan obsesi bagi para eksplorer Barat saat itu, banyak di antara mereka gugur di kawasan gurun pasir. Pada 1824, Geographical Society of Paris bahkan menawarkan hadiah bagi warga Eropa pertama untuk menyelesaikan perjalanan ke sana. Syafri/CNN

Mengoptimalkan Upaya Membentuk Anak Shaleh

Belajar Syiah, Merajut Ukhuwah

Oleh Imam Pratomo, S.HI

Oleh Candiki Repantu

Staff Pengajar PPMDH TPI Medan Mahasiswa Program Magister Hukum Islam IAIN SU


nak adalah anugrah yang terindah sekaligus menjadi anak yang spiritual artinya setiap orang amanah yang telah Allah Swt titipkan ke- tua harus menjadi teladan bagi anaknya untuk pada kita semua, oleh karena itu selaku or- bisa cinta terhadap agama yang dipeluknya, ang tua harus benar-benar menjaga anak agar kelak Yang Patut diingat Orang Tua menjadi anak yang shaleh yang selalu mengabdi Ada suatu hal yang perlu dipahami oleh setiap dan taat kepada Allah Swt, berbakti kepada ibu dan ortu ketika mendidik anak. Kita memang ingin ayah serta Negara dan Agamanya. sekali menjadikan anak dan keturunan kita sebaInilah dambaan setiap orang tua agar mem- gai anak sholeh. Kita memang sudah berusaha punyai anak yang Shaleh dan Shaleha. Allah Swt mendidik mereka dengan pendidikan yang baik mempertegas dalam Alquran mengenai anak dan berkualitas. Bahkan mereka juga kita wajibkan adalah amanah sebagai berikut: “almalu wal ba- masuk sekolah yang berbasiskan agama atau nun dzinatu hayatid dunya/harta dan anak-anak masuk pondok pesantren. Namun kadangkala, adalah perhiasan dukita hanya bersandar nia”. pada usaha kita semaDalam kehidupan tanpa mau melirik Orang tua dalam mendidik anak- ta, ini, orang tua dalam bahwa hidayah dan mendidik anak-anakanaknya harus benar-benar memper- petunjuk adalah di tanya harus benar-benar ngan Allah termasuk hatikan setiap tindakan yang dila- hidayah pada anak memperhatikan setiap tindakan yang dilakudan keturunan kita. kukan oleh anak, mulai dari bangun kan oleh anak mulai Walaupun kita telah tidur hingga tidur kembali. dari bangun tidur pontang panting dehingga tidur kembali, ngan melakukan berjangan orang tua acuh bagai sebab, namun tak acuh terhadap anaknya, agar dikemudian hari jika Allah menakdirkan berbeda, lantas apa yang anak tersebut tidak tersesat dalam kehidupannya. bisa kita perbuat. Untuk menjadikan anak yang shaleh tidak lepas Selayaknya kita banyak merenungkan ayatdari guru mereka dalam memberikan bimbingan. ayat semacam ini: “Barangsiapa yang diberi peProf. Dr. Nasaruddin Umar, menyatakan bahwa tunjuk oleh Allah, maka dialah yang mendapat ada lima (5) tipikal anak yang shaleh: Pertama, or- petunjuk; dan barangsiapa yang disesatkan Allah, ang tua harus mejadikan anak-anaknya itu anak maka merekalah orang-orang yang merugi.” (QS. yang mempunyai badan dan pikiran yang sehat. Al a’rof: 178)/ “Maka sesungguhnya Allah menyeJikalau anak sehat sudah barang tentu ia akan mela- satkan siapa yang dikehendaki-Nya dan mekukan setiap perbuatan dengan pikiran yang sehat, nunjuki siapa yang dikehendaki-Nya; maka jadalam Hadist Rasulullah Saw dikatakan: “Al-aqlu nganlah dirimu binasa karena sedih terhadap mesalim fi jismi salim/akal yang sehat terdapat juga reka.” (QS. Fathir: 8 )/ “Dan kalau Kami menghenjiwa yang sehat. (Al-Hadist),. Kedua, orang tua daki niscaya Kami akan berikan kepada tiap-tiap harus menjadikan anak-anaknya itu menjadi anak jiwa petunjuk baginya.” (QS. As Sajdah: 13)/ “Dan yang cerdas, setiap orang tua harus benar-benar jikalau Tuhanmu menghendaki, tentulah bermendidik dan mengajari serta menasehati anaknya iman semua orang yang di muka bumi seluruhbahkan bila perlu menghukumnya jikalau ia melen- nya.” (QS. Yunus : 99) ceng dan tersesat. Sebagaimana yang telah disabPenutup dakan Rasulullah bahwa anak yang berumur sepuluh tahun jikalau diperintahkan untuk shalat Inilah Impian setiap orang tua dan menjadi ia enggan maka kata Rasul: “pukullah”, Insya Allah ladang amal dikemudian hari, karenanya amal anak tersebut menjadi cerdas. Ketiga, orang tua ha- yang tidak dapat putus dan mengalir terus adalah rus menjadikan anaknya itu menjadi anak yang doa anak yang shaleh ketika orang tua tersebut cultural artinya bahwa orang tua harus menerap- sudah meninggal sesuai Sabda Nabi Muhammad kan kepada anak-anaknya itu cinta terhadap buda- Saw: “ idza matab nu adama inqatha’a amaluhu yanya sendiri, ia tidak malu untuk mengakui bahwa illa min tsalasa, shadaqatin jariayatin au ilmu ia adalah anak Indonesia, sehingga budaya tersebut yantafau bihi au waladin shalihin yad’u lahu/ dapat meresap dalam jiwa sanubarinya. apabila mati anak adam itu maka terputuslah Keempat, orang tua harus menjadikan anak- amalannya kecuali tiga perkara, sedekah jariyah, anaknya menjadi anak yang ideologis artinya ilmu yang bermanfaat serta anak yang shaleh yang bahwa orang tua harus menanamkan terhadap mau mendoakan orangtuanya ketika meninggal” pikiran setiap anaknya akan betapa besar pengor- (Al-Hadist). Hadist ini menjelaskan betapa penbanan pahlawan kita, betapa besar perjuangan tingnya anak, oleh karenanya perhatikannlah ia yang telah dilakukan pahlawan-pahlawan kita dan jagalah ia dengan baik, jangan biarkan ia tersehinggah Indonesia dapat merdeka seperti saat se- sesat, bimbinglah ia kejalan yang benar yang dirikarang ini, kalau ini diterapkan maka pengaruh dari dhai Allah dan Rasulnya, maka ganjaran kepada luar (barat) akan sulit masuk kedalam jiwanya. kita selaku orang tua adalah surga jannatun na’im. Kelima, orang tua harus menjadikan anak-anaknya Wallahu Muafiq Ila Aqwami Thariq.

Tanggapan Tulisan M. Nasir Dan Fakhrurrazi Pulungan Tentang Syiah Ketua Yayasan Islam Abu Thalib Medan.


embaca tulisan Ustadz Nasir dan ustadz Fachrurrazy Pulungan, terlihat adanya prasangka dan kesalahpahaman, tanpa bukti atau tanpa mengetahui dengan baik argumen seseorang. Misalnya, tuduhan syiah memiliki syahadat tiga, menyatakan Alquran tidak asli, mencaci-maki sahabat, mengkafirkan Aisyah ra. Ini namanya hasty generalization (generalisasi terburu-buru), sebuah kesalahan berpikir dalam menilai argumentasi seseorang. Terlihat pula kontradiksi dalam tulisannya. Misalnya, Ustadz Nasir menulis, “perbedaan dalam fikih dapat dimaafkan…akan tetapi persoalan akidah tidak dapat ditolerir… Tetapi kemudian, tulisannya memasukkan persoalan fikih. Lihatlah pada poin 12 (soal membaca ‘amiin’ dalam shalat), poin 13 (soal shalat jama’), dan poin 14 (soal shalat dhuha), semuanya adalah persoalan fikih. Sebagai exercise, apakah syiah sesat karena tidak membaca ‘amiin’ dalam shalat (padahal itu sunnah), menjama’ shalat (yang juga ada dalam sunni), dan tidak shalat dhuha (yang hukumnya sunnah). Saya mau tanya kepada ustadz Nasir apakah ketiga hal itu menyebabkan orang sesat dan tidak berakidah Islam? Agar terhindar dari semantic fallacies—kesalahan berpikir akibat salah memberi makna atau menggunakan kata—maka saya batasi makna syiah dimaksud adalah syiah imamiyah itsna asyariyah, yaitu syiah yang meyakini pasca Nabi SAW, pemimpin Islam adalah 12 imam dari keluarga Nabi yaitu Ali, Hasan, Husein, Ali bin Husein, Muhammad bin Ali, Ja’far bin Muhammad, Musa bin Ja’far, Ali bin Musa, Muhammad bin Ali, Ali bin Muhammad, Hasan bin Ali, dan Muhamad bin Hasan. Tentang Abdullah bin Saba’ Ustadz Nasir menyebut Abdullah bin Saba’ (ibnu Saba’) “kuat dugaan perpecahan di tubuh umat Islam terjadi karena provokasi Abdullah bin Saba’ (seorang Yahudi yang pura-pura masuk Islam)”. Pembahasan Ibnu Saba’ bisa dinilai dari dua hal. Pertama, keberadaan Ibnu Saba’. Ulama syiah dan sunni ada yang menerimanya, ada yang menolaknya. Studi sistematis tentang Ibnu Saba’ dilakukan Murtadha Askari dalam bukunya Abdullah bin Saba’ wa Asathirul Ukhra yang nyaris mencapai 1000 halaman. Setelah meneliti sumber cerita Ibnu Saba’ dari syiah dan sunni, ia menyimpulkan Ibnu Saba’

adalah tokoh fiktif. Ulama sunni yang menganggap Ibnu Saba’ itu fiktif di antaranya adalah Thaha Husain, Dr Hamid Hafna Daud, Hasan Farhan al-Maliki, dan Abdul Aziz al-Halabi. Kedua, pendapat syiah tentang Ibnu Saba’. Kalaupun Ibnu Saba’ itu ada, tetapi ulama syiah tidak menganggap Ibnu Saba’ sebagai tokoh syiah dan sahabat Imam Ali. Ulama syiah mengecam serta berlepas diri (tabarri) darinya. Jelaslah persoalan Ibnu Saba’ tidak ada kaitannya dengan mazhab syiah. Mungkinkah orang yang ditolak keberadaanya atau dikecam ulama syiah dijadikan tokoh panutan dalam syiah? Sungguh kesimpulan yang gegabah. Poin-poin Tanggapan Pertama, tentang syariat (ibadah). Ustadz Nasir (pada poin 1) dan Ustadz Fachrurrazi (pada bag. 2) menuliskan rukun Islam sunni dan syiah. Dari yang mereka tulis, maka terlihat persamaannya bukan perbedaan. Yakni sama-sama shalat 5 kali sehari semalam, membayar zakat, puasa Ramadhan, dan haji ke Baitullah. Ada dua perbedaan, yaitu persoalan syahadat dan wilayah (kepemimpinan). Syiah juga mengucapkan syahadat sebagaimana orang sunni mengucapkannya. lebih jelas, pelajari shalat syiah, perhatikan bacaan tasyahud mereka yang di dalamnya ada syahadat, “Asyhadu an la ilaha illallah, wahdahu la syarika lahu, wa asyhadu anna muhammadan ‘abduhu wa rasuluh”, tanpa ada tambahan apapun. Jadi anggapan ustadz Nasir (pada poin 3) bahwa syiah memiliki 3 kalimat syahadat sungguh keliru. Adapun persoalan wilayah (kepemimpinan ahlul bait), adalah komitmen syiah menerima ajaran Islam dari Nabi dan ahlulbaitnya baik masalah akidah, hukum, ibadah dan lainnya. Salahkah, jika mengikuti ahlulbait Nabi? Kedua, tentang keimanan (akidah). Dalam syiah keimanan itu terbagi dua yakni ushuluddin (dasar agama) dan ushulul mazhab (dasar mazhab). Ushuluddin itu ada 3 yaitu Tauhid (ketuhanan), Nubuwah (kenabian), dan Ma’ad (kebangkitan di akhirat). Adapun ushulul mazhab ada dua yaitu al-adl (keadilan) dan imamah (kepemimpinan). Ini yang disebut ushulul khamsah (dasar yang lima) dalam syiah. Lantas, apakah syiah tidak percaya pada malaikat, kitab-kitab, dan takdir (qada dan qadar). Jangan gegabah menyimpulkannya! Syiah percaya semua itu. Syiah memasukkan kepercayaan pada malaikat dan

kitab dalam bab kenabian, karena nabilah yang menerima wahyu melalui perantara malaikat. Silahkan baca seluruh kitab akidah syiah, maka Anda akan menemukan pembuktian atas kenabian, malaikat dan wahyu (kitab suci). Jadi syiah mempercayai kenabian, malaikat dan kitab suci. Adapun takdir dimasukkan syiah di bab keadilan, sebab keadilan adalah dasar keyakinan pada takdir. Ketiga, tentang Sahabat dan Aisyah ra. Di antara yang sering dituduhkan adalah tentang sahabat dan Aisyah ra. Ustadz Nasir pada poin 7 dan 8 menyebutkan bahwa syiah mencaci maki sahabat dan mengkafirkan Aisyah ra. Untuk menjawabnya, saya kutipkan fatwa resmi pemimpin syiah Ayatullah Ali Khamenei, “Diharamkan melakukan penghinaan terhadap (tokohtokoh yang diagungkan) Ahlussunnah apalagi melontarkan tuduhan terhadap istri Nabi dengan perkataan yang menodai kehormatannya, tindakan demikian haram dilakukan terhadap istri para Nabi terutama Rasul termulia.” Keempat, tentang hadis syiah. Ustadz Nasir (poin ke-9) dan juga ustadz Fachrurozy mempersoalkan ilmu dan kitab hadis syiah. Ulama syiah menyusun keilmuan Islam di seluruh cabangnya, termasuk hadis. Salahkah syiah jika memiliki kumpulan hadis dari keluarga Nabi? Bagi syiah, riwayat dari 12 imam adalah hadis seperti hadis Rasul, karena seluruh ilmu imam syiah bersumber dari Rasulullah. Imam Ja’far Shadiq berkata, “Hadis yang aku riwayatkan adalah dari ayahku, yang didapat dari kakekku. Dan hadis kakekku adalah dari datukku Husein. Dan hadis Husein adalah juga hadis dari Hasan. Dan hadis Hasan berasal dari Amirul Mukminin Ali bin Abi Thalib. Dan hadis Ali berasal dari Rasulullah SAW. Dan hadis Rasulullah SAW berasal dari wahyu Allah ajja wa jalla.” (al-Kafi, juz I). Ucapan Imam Ja’far ini membantah Ustadz Fachrurrazy yang mengatakan, “semua hadis yang dikeluarkan para imam tidak perlu disandarkan kepada Nabi.” Kelima, tentang Alquran. Ustadz Nasir (poin ke-10) dan juga Ustadz Fachrurrazi menganggap syiah meyakini Alquran tidak asli lagi. Ini tuduhan palsu. Ulama syiah menegaskan bahwa Alquran terjaga sampai kiamat. Syaikh Shaduq (w. 381 H) dalam kitabnya al-I’tiqadat hal. 8384 menyatakan: “Keyakinan kami tentang Alquran, adalah Kalam Allah, wahyu-Nya, firman dan kitab

suci-Nya. Ia tidak didatangi kebatilan dari depan maupun belakang... Keenam, tentang surga dan cinta kepada Ali. Pada poin ke-11 Ustadz Nasir menulis, “menurut syiah surga diperuntukkan bagi orang yang cinta kepada Imam Ali walaupun tidak taat kepada Rasulullah, dan neraka diperuntukkan bagi orang yang memusuhi imam Ali, walaupun taat kepada Rasulullah.” Sebagai tanggapan, Allah berfirman, “Taatilah Allah, taatilah Rasul, dan ulil amri kalian” (Q.S. an-Nisa: 59). Pada ayat itu ada tiga ketaatan, yaitu taat pada Allah, Rasul, dan ulil amri (yang dalam penafsiran syiah adalah 12 imam). Lantas bagaimana mungkin syiah mempertentangkan kecin-taan kepada Ali dan ketaatan pada Rasul? Syaikh Kulaini dalam al-Kafi meriwayatkan Imam Baqir berkata, “Apakah cukup seseorang menganggap dirinya syiah dengan hanya mengatakan kecintaan kepada kami, Ahlul Bait? Demi Allah, tidak! Seseorang tidak termasuk syiah kami kecuali dia takut pada Allah dan mentaati-Nya. Ketujuh, tentang Q.S. al-Maidah: 55. Ustadz Fachrurrazi mengulas 55 yang berbunyi, “Sesungguhnya wali kamu hanyalah Allah, Rasul-Nya dan orang-orang yang beriman yang mendirikan shalat dan menunaikan zakat, seraya mereka ruku’. Perhatikan, Ayat tersebut menyebut 3 jenjang kewalian (kepemimpinan), yakni : 1). Allah, 2). Rasulullah, dan 3). Orang-orang yang beriman yang membayar zakat ketika ruku’. Para ahli Tafsir syiah dan sunni menyebutkan bahwa “orang beriman yang mendirikan shalat dan membayar zakat ketika ruku’ adalah Ali bin Abi Thalib. Banyak hadis menyatakan, “Pada saat ruku’, Ali memberikan cincinnya kepada pengemis, maka turunlah ayat tersebut, Q.S. al-Maidah: 55.” Banyak sahabat meriwayatkannya, seperti Abu Dzar, Anas, Ibnu Abbas, Jabir, dan Ali, yang tercatat di kitab sunni seperti Tafsir Ibnu Katsir; Asbab anNuzul al-Wahidi; Tafsir al-Kabir alRazi; Tafsir Thabari, Syawahid atTanzil al-Hiskani, dan lainnya. Jadi, Ustadz Fakhrurrazi menyatakan, “Tidaklah mungkin ayat tersebut turun mengenai Ali bin Abi Thalib yang menjadi imam tertinggi, sementara Rasulullah SAW masih hidup dan menjadi Rasul” tertolak dengan hadis di atas. Kesimpulannya, bahwa Imam Ali telah dipilih sebagai wali (pemimpin) sejak masa Rasul masih hidup, dan secara total pasca wafatnya Rasul SAW. Wallahu a’lam.

Waspada, Jumat 28 September 2012  

waspada daily

Waspada, Jumat 28 September 2012  

waspada daily