Issuu on Google+

Mau Di Mana Anda Shalat Jumat...? Lihat hal. C10-C11 Masjid Raya Medan

JUMAT, Pon, 20 Januari 2012/25 Safar 1433 H

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) No: 23749 Tahun Ke-66

Terbit 28 Halaman (A1-8, B1-8, C1-12)

Harga Eceran: Rp2.500,-

Dahlan Dan Anas Bantah Terima Fee

Melihat Dari Dekat Masjid Terapung Di Melaka

JAKARTA (Antara): Menteri BUMN Dahlan Iskan membantah menerima uang atau‘fee’ ketika menjabat Dirut PLN, seperti yang dinyatakan oleh terdakwa kasus korupsi, M. Nazaruddin. “Masa saya gitu-gitu lah,” kata Dahlan ketika ditemui sebelum rapat kerja pemerintah 2012 di JI-Expo Kemayoran, Jakarta, Kamis(19/1). Media massa ramai memberitakan pernyataan Nazaruddin bahwa Dahlan diduga menerima ‘fee’ terkait sebuah proyek di PLN pada 2010. Nazaruddin mengatakan, jatah uang untuk Dahlan dia

PERNAHKAH Anda mengunjungi dan shalat di masjid terapung? Tak ada salahnya berdestinasi ke Melaka bersama keluarga. Perjalanan udara dari Medan, Sumatera Utara, ke satu negeri bagian jiran itu hanya sekejap. Kita langsung dapat menikmati eksotis Masjid Selat itu. Disebut Masjid Selat karena bangunannya berdiri di atas permukaan laut Melaka. Lokasinya terletak di Bandar Hilir yang tidak jauh dari pusat keramaian kota dan shopping centre. Diapit kawasan sejarah dan Menara Taming Sari, simbol keris Hang Tuah setinggi

Lanjut ke hal A2 kol. 6

Waspada/Muhammad Thariq

MASJID terapung di Melaka yang banyak dikunjungi turis lokal dan mancanegara. Foto diambil Minggu (15/1).

Lanjut ke hal A2 kol. 1

Jangan Dengarkan Anggaran Pilgubsu Orang Pesimistis Rp100 M Hibah JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono mengatakan, pernyataan dari orang pesimistis yang menyatakan Indonesia tidak bisa bangkit dan keluar dari berbagai masalah jangan didengarkan. “Saya minta jangan dengarkan orang yang pesimistis,” kata Presiden dalam rapat kerja pe-

merintah 2012 di Jl. Expo, Jakarta, Kamis (19/1). Menurut Presiden, Indone-

sia bisa bertahan dari berbagai tantangan di berbagai bidang karena upaya rakyat dan pemerintah. Kegigihan itu juga, menurut Presiden, yang membawa Indonesia dalam kondisi relatif baik, ditandai dengan penyelesaian konflik di beberapa daerah. ‘’ Seperti pelaksanaan Pemi-

lu langsung, pertumbuhan dan fundamental ekonomi yang baik, kehidupan demokrasi semakin berkembang, pemberantasan korupsi , terorisme dan narkoba, peningkatan pelayanan publik, kenaikan IHSG, peningkatan

Lanjut ke hal A2 kol. 6

MEDAN (Waspada): Sekdaprovsu H Nurdin Lubis menjamin anggaran Pilgubsu 2013 sebesar Rp100 miliar lebih sudah masuk dalam bentuk hibah di Anggaran Pendapatan Belanja Daerah (APBD) 2012 sehingga Komisi Pemilihan Umum (KPU) dipastikan dapat menjalankan tahapan sesuai jadwal.

“Oh ya sudah hibah (anggarannya). Hibah dari Pemprov Sumut ke KPU provinsi. Masuk ke rekening tersendiri,” kata Nurdin kepada wartawan saat dikonfirmasi mengenai kepastian anggaran Pilgubsu 2013 di Kantor Gubernur Sumut, Kamis (19/1). Nurdin mengakui, sebelum-

nya sempat diwacanakan anggaran Pilgubsu 2013 dimasukkan dalam dana cadangan dan tidak berbentuk hibah. Hal itu merujuk pada rencana anggaran pada Pilkada di Jawa Tengah (Jateng) yang jumlahnya cukup besar.

Lanjut ke hal A2 kol. 3

JK: Kepatuhan Sosial Masyarakat Makin Rendah


PRESIDEN Susilo Bambang Yudhoyono memaparkan kebijakan dan arahannya kepada para peserta Rapat Kerja Pemerintah 2012 di PRJ, Kemayoran, Jakarta, Kamis (19/1). Raker yang dihadiri oleh sejumlah pimpinan Lembaga Negara, para Menteri KIB II, Gubernur, Bupati/ Wali Kota, Kapolda, Kajati dan Pangdam se-Indonesia tersebut membahas sejumlah materi pembangunan yang berkaitan dengan APBN dan APBD termasuk penyerapan anggaran di tahun 2012 sebagai salah satu instrumen pertumbuhan ekonomi.

Kasus Tanah Di Medan Tak Bergejolak MEDAN (Waspada): Permasalahan tanah di Kota Medan akan dibahas secara perlahanlahan. Persoalan tanah ini tidak menjadi sesuatu yang mengkhawatirkan, karena tidak berhadapan dengan penggarap seperti daerah lain di Sumut. “Kasus tanah di Medan tidak bergejolak seperti di daerahdaerah lain. Tapi mereka tidak ada memiliki sertifikat. Saat ini kita terus melakukan pembahasan terhadap kasus-kasus tanah yang sifatnya tumpang tindih. Pembahasan tanah ini

kan tidak bisa terburu-buru,” kata Sekda Kota Medan Syaiful Bahri kepada Waspada di ruang kerjanya, Kamis (19/1). Sekda mengaku ada sejumlah persoalan, tetapi belum terlalu serius, seperti kasus tanah di Jl. Timor, Jl. Jati maupun persoalan tanah di Kel. Sari Rejo, Kec. Medan Polonia. “Saat ini masih dalam tahap menunggu keputusan hukum. Kasus tanah lainnya berkaitan dengan TNI AU. Ini juga sudah dilakukan pendekatan antara Pemko dengan KSAU,” sebutnya.

Al Bayan

Safiyah Binti Huyai Oleh Tgk. H. Ameer Hamzah UMMUL Mukminin yang ke sembilan adalah Safiyah binti Huyai. Ia adalah putri kepala suku Bani Nadhir, keturunan Yahudi Madinah. Wajahnya cantik, baru berusia 17 tahun. Sebelum kawin dengan Rasulullah, ia telah kawin dua kali dengan lelaki lain, namun belum punya anak. Safiyah adalah harta rampasan perang yang digiring Bilal bin Rabbah untuk menemui Nabi. Ayahnya mati terbunuh sehingga Safiyah sangat sedih. Rasulullah SAWmemahami kesedihan yang diterita oleh seorang putri dari sebuah istana yang dikalahkan. Bukan hanya putri itu yang menderita, tetapi juga suku bangsa yang bersangkutan.

Lanjut ke hal A2 kol. 3

Artinya, kata Sekda, persoalan kasus tanah khusus di Kota Medan masih dalam tahap pembahasan dengan tidak menimbulkan gejolak. Wali Kota Medan akan terus berupaya menyelesaikan persoalan tanah di Medan. Ketika ditanya berapa jumlah kasus tanah di Kota Medan, mantan Kepala Bappeda Kota Medan ini mengaku tidak tahu. “Kalau jumlahnya saya tidak tahu, karena pada waktu rapat koordinasidiMapoldasu,PakWali yang kesana,” ucapnya. (m50)

JAKARTA(Antara): Mantan wakil presiden Jusuf Kalla mengkhawatirkan semakin memudarnya kepatuhan sosial dalam masyarakat. “Permasalahan paling menonjol dewasa ini, yang paling berbahaya menurut saya hilangnya kepatuhan sosial. Kepatuhan sosial sudah rendah sekali sehingga sudah susah terkontrol, “ katanya dalam acara silaturahmi tokoh nasional di Jakarta, Kamis(19/1). Ketidakpatuhan sosial ini terlihat jelas dengan semakin seringnya berita-berita yang mengabarkan berbagai aksi kekerasan sosial, pembakaran, pendudukan dan sebagainya yang terjadi di masyarakat dilakukan secara beramai-ramai. Menurut dia, hilangnya kepatuhan sosial ini mengkhawatirkan karena masyarakat bertindak tanpa mengindahkan hukum dan menjalankan layaknya hukum rimba. Lanjut ke hal A2 kol. 1

Era Kejayaan Kodak Berakhir NEW YORK (Waspada): Eastman Kodak Co. yang merupakan satu produsen pengadaan alat-alat fotografi ternama, kini tengah menghadapi kebangkrutan. Kodak yang sempat mengalami era kejayaan dengan produk kamera dan film foto ini jatuh bangkrut setelah gagal beradaptasi dengan kemajuan teknologi di tengah populernya kamera digital dan ponsel pintar berfitur kamera. Menurut kantor berita Reuters, Kodak mengajukan perlindungan pailit ke Pengadilan di Kota New York pada Rabu (18/1) waktu setempat. Di Amerika Serikat (AS),

Lanjut ke hal A2 kol. 1

Nenas Buah Bergengsi Menjelang Imlek, Harga Rp150.000 MEDAN (Waspada) : Menjelang Tahun Baru Imlek, buah nenas menjadi sangat berharga. Tapi nenas yang satu ini beda dengan yang lainnya. Bentuknya yang kecil, bulat dan lonjong serta model beranak-anak banyak, menjadi nenas pilihan bagi warga Tionghoa yang akan merayakan Imlek. Pasar Beruang Medan, menjadi salah satu kawasan yang menyediakan aneka nenas dengan berbagai ukuran dan tipe nenas ini, yang digunakan untuk sembahyang bagi warga Tionghoa kala Imlek. Andi, seorang pedagang nenas di Pasar Beruang Medan sangat sibuk melayani pembeli nenas-nenas ini. Sejak pagi pukul 05:00, Andi mengaku sudah berada di pasar tersebut guna menjajakan nenas-nenas pilihan ini. Ditemui, Kamis (19/1) di lapak jualannya, Andi mengaku sudah puluhan tahun berdagang aneka nenas jelang Imlek. Harga nenas yang dijual sangat bervariasi antara Rp 15.000 s/d 150.000. Harga itu, kata Andi tergantung dari jenis nenas yang diinginkan. Lanjut ke hal A2 kol. 6

Waspada/Sukri Falah Harahap

WAKAPOLRES Tapsel, Kompol Zainuddin P, memberikan nasehat dan arahan kepada puluhan warga Desa Aek Kanan dan Padangmatinggi, Kec. Dolok Sigompulon, Kab. Paluta, yang sedang menunggu giliran untuk diperiksa, Kamis (19/1).

Warga Vs PT SA, 41 Tersangka P. SIDIMPUAN (Waspada): Polres Tapanuli Selatan menetapkan status tersangka terhadap 41 orang warga Desa Aek Kanan dan Desa Padang Matinggi, Kec. Dolok Sigompulon, Kab. Padanglawas Utara, atas kasus perusakan dan pembakaran di perkebunan PT Tanjung Siram (PT SA), Kamis (19/1). Dari jumlah itu, delapan orang ditahan dan 33 lagi dilakukan pemeriksaan lebih mendalam. Tidak tertutup kemungkinan jumlah tersangka bertambah lagi, karena Polres Tapsel masih memeriksa secara

intensif 18 warga lainnya (di luar 41 tersangka) diduga turut melakukan perusakan dan pembakaran. “Tersangka yang ditahan delapan orang. Mereka SH, MR, H, ET, R, AMR, M, dan HH. Sedangkan 33 tersangka lainnya masih dilakukan pendalaman,” kata Kapolres Tapsel, AKBP Subandriya SH,MH, melalui Kasat Reskrim AKP Lukmin Siregar, didampingi para perwira lainnya. Dijelaskan, pasca kejadian pembakaran dan perusakan 17 bangunan dan 3 kendaraan di

Muslim Tionghoa Rayakan Imlek Saling Berkunjung

Waspada/Anum Saskia

SALAH satu nenas yang diburu warga Tionghoa untuk merayakan Imlek, harganya Rp15.000 s/d 150.000 bahkan menjelang Imlek harganya diprediksi semakin mahal dijual pedagangnya di Pasar Beruang Medan.

MEDAN (Waspada) : Bagi masyarakat muslim Tionghoa, Imlek (tahun baru) menjadi satu hari untuk temu silaturahim dengan sesama saudara. Pertemuan dalam keluarga besar, biasanya diiringi dengan kegiatan makan-makan dan berbincang bersama tentang rencana satu tahun ke depan. Demikian disampaikan Rudy Wijaya dan Syamsudin yang bergabung di Persatuan Muslim Tionghoa Muslim Indonesia (PMTMI) Medan yang ditemui Waspada/Anum Purba Kamis (19/1). Keduanya mengaku, kegiaSyamsudin. tan dalam Imlek sekadar ajang silaturahmi dan tidak berkaitan dengan acara atau kegiatan ritual sesaji atau sembahyang yang dilaksanakan warga Tionghoa non muslim. Menurut Rudy Wijaya, Imlek itu adalah sebuah pergantian tahun yang dikenal dengan tradisi nenek moyang mereka sebagai sarana untuk berkumpul keluarga dan kerabat menjelang masa tanam setiap tahunnya.

Lanjut ke hal A2 kol. 3 Rudy Wijaya

PT Tanjung Siram, Selasa (17/1), Polres Tapsel telah memeriksa 129 warga Desa Aek Kanan dan Padangmatinggi. Awalnya Polres hanya memeriksa 10 warga, namun 119 warga lainnya datang ke Mapolres Tapsel di Padangsidimpuan dan meminta agar mereka juga turut diperiksa. Dari hasil pemeriksaan, ternyata 41 orang mengakui telah melakukan dan turut melakukan pembakaran serta perusakan di base camp PT Tanjung Siram. Yang dibakar itu adalah

Lanjut ke hal A2 kol. 1

Ada-ada Saja Ayah Balas Cakaran Dengan Gigitan HANYA karena kesal anaknya menangis dan mencakar wajahnya, seorang ayah asal China tega menggigit jari putrinya hingga putus. Balita malang yang baru berusia 2 tahun itu harus kehilangan dua jarinya setelah digigit sang ayah. Menurut satu situs lokal di

Lanjut ke hal A2 kol. 2

Serampang - Kalau Rp1 T baru sodap - He...he...he...

Siapa Khatib Jumat Anda ? Lihat Hal. C10-C11

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Pon, 20 Januari 2012/25 Safar 1433 H z zNo: 23749 * Tahun Ke-66

Terbit 28 Halaman (A1-8, B1-8, C1-12) z zHarga Eceran: Rp 2.500,-


PA Daftarkan Calon KDh

SEJUMLAH massa pendukung Partai Aceh (PA) berkonvoi menuju kantor Komisi Independent Pemilihan (KIP) Aceh Utara di Kota Lhokseumawe, Aceh. Kamis (19/1). Partai Aceh mendaftarkan pasangan calon Bupati/ Wakil Bupati Aceh Utara, Muhammad Thayeb dan M.Jamil.

LHOKSEUMAWE (Waspada): Partai Aceh (PA) Wilayah Pase mendaftarkan H. Muhammad ThaibDrs Muhammad Jamil, M.Kes sebagai calon bupati dan wakil bupati Aceh Utara serta Suaidi Yahya-Muhammad Nazar Saldun, SH, sebagai calon wali kota dan wakil wali kota Lhokseumawe, Kamis (19/1). Pendaftaran untuk menyelamatkan MoU Helsinki. Hal itu disampaikan Tgk. Zulkarnaini, Ketua PA Wilayah Pase yang ikut hadir ke KIP Aceh Utara dan KIP Kota Lhokseumawe. Dua pasangan calon kepala daerah diantar oleh ratusan pendukung.

Pimpinan Partai Aceh mengharapkan seluruh masyarakat Aceh bersatu padu untuk menyelamatkan MoU Helsinki. “Hari ini, Kamis Lanjut ke hal A2 kol 2

KIP Cabut SK Tentang Pendaftaran Tiga Hari Waspada/Sori Parlah Harahap

PULUHAN rumah karyawan dan tiga unit truk milik PT. Tanjung Siram di Kec. Dolok Sigompulon, Kab. Padanglawas Utara yang dibakar warga masih terlihat mengepulkan asap, Kamis, ((19/1).

Warga Vs PT SA, 41 Tersangka P.SIDIMPUAN (Waspada): Polres Tapanuli Selatan menetapkan status tersangka terhadap 41 orang warga Desa Aek Kanan dan Desa Padang Matinggi, Kec. Dolok Sigompulon, Kab. Padanglawas Utara, atas kasus perusakan dan pembakaran di perkebunan PT Tanjung Siram (PT SA), Kamis (19/1). Dari jumlah itu, delapan orang ditahan dan 33 lagi dilakukan pemeriksaan lebih

mendalam. Tidak tertutup kemungkinan jumlah tersangka bertambah lagi, karena Polres Tapsel masih memeriksa secara intensif 18 warga lainnya (di luar 41 tersangka) diduga turut melakukan perusakan dan pembakaran. “Tersangka yang ditahan delapan orang. Mereka SH, MR, H, ET, R, AMR, M, dan HH. Sedangkan 33 tersangka lainnya masih dilakukan pendalaman,” kata Kapolres Tapsel,

AKBP Subandriya SH,MH, melalui Kasat Reskrim AKP Lukmin Siregar, didampingi para perwira lainnya. Dijelaskan, pasca kejadian pembakaran dan perusakan 17 bangunan dan 3 kendaraan di PT Tanjung Siram, Selasa (17/1), Polres Tapsel telah memeriksa 129 warga Desa Aek Kanan dan Padangmatinggi. Aw a l n y a Po l re s h a n y a Lanjut ke hal A2 kol 6

Pemungutan Suara 9 April BANDA ACEH (Waspada): Komisi Independen Pemilihan Aceh (KIP) mencabut Surat Keputusan No 29/2012 yang mengatur soal tahapan pendaftaran, verifikasi, hingga penetapan bakal kandidat baru calon kepala daerah. Pada SK itu disebutkan pendaftaran kandidat hanya berlangsung hingga 20 Januari. Dengan pencabutan SK ini, KIP menegaskan membuka pendaftaran selama tujuh hari. Pencabutan SK No 29/ 2012 dilakukan KIP Aceh setelah menggelar rapat tertutup dengan komisioner KIP se-

Lanjut ke hal A2 kol 6

Dahlan Iskan Bantah Nazaruddin JAKARTA (Antara): Menteri BUMN Dahlan Iskan membantah menerima uang atau ‘fee’ ketika menjabat Dirut PLN, seperti yang dinyatakan oleh terdakwa kasus korupsi, M. Nazaruddin. “Masa saya gitu-gitu lah,” kata Dahlan ketika ditemui sebelum rapat kerja pemerintah 2012 di JI-Expo Kemayoran, Jakarta, Kamis(19/1). Media massa ramai memberitakan pernyataan Nazaruddin bahwa Dahlan diduga menerima ‘fee’ terkait sebuah proyek di PLN pada 2010.

Nazaruddin mengatakan, jatah uang untuk Dahlan dia ketahui melalui pesan singkat yang dikirim oleh seorang bernama Wila. Wila juga menyampaikan hal tersebut ketika bertemu Nazaruddin, Sutan Bhatoegana, dan Mindo Rosalina Manulang di restoran sebuah hotel di Jakarta. Wila dikenal Nazaruddin sebagai pengusaha yang lama bekerja sama dengan PLN. Dahlan mengaku tidak tahu Lanjut ke hal A2 kol 1

Satiyah Binti Huyai Oleh: H. Ameer Hamzah UMMUL Mukminin yang ke sembilan adalah Safiyah binti Huyai. Ia adalah putri kepala suku Bani Nadhir, keturunan Yahudi Madinah. Wajahnya cantik, baru berusia 17 tahun. Sebelum kawin dengan Rasulullah, ia telah kawin dua kali dengan lelaki lain, namun belum punya anak. Safiyah adalah harta rampasan perang yang digiring Bilal bin Rabbah untuk menemui Nabi. Ayahnya mati terbunuh sehingga Safiyah sangat sedih. Rasulullah SAWmemahami kesedihan yang diterita oleh seorang putri dari sebuah istana yang dikalahkan. Bukan hanya putri itu yang menderita, tetapi juga suku bangsa yang bersangkutan. Atas pertimbangan itulah Rasulullah mengajaknya

Lanjut ke hal A2 kol 2

KAPOLRES Langkat AKBP H Mardiyono ketika memperhatikan goni berisi ganja yang baru dipanen bersama tiga tersangkanya di Mapolres Langkat di Stabat, Kamis (19/1).

Anggaran Pilgubsu Rp100 M Hibah APBD Pemprovsu MEDAN (Waspada): Sekdaprovsu H Nurdin Lubis menjamin anggaran Pilgubsu 2013 sebesar Rp100 miliar lebih sudah masuk dalam bentuk hibah di Anggaran Pendapatan Belanja Daerah (APBD) 2012. Sehingga Komisi Pemilihan Umum (KPU) dipastikan dapat menjalankan tahapan sesuai jadwal.

Melihat Dari Dekat Masjid Terapung Di Melaka

Waspada/Muhammad Thariq

MASJID terapung di Melaka yang banyak dikunjungi turis lokal dan mancanegara. Foto diambil Minggu (15/1).

Ada-ada Saja

Al Bayan

Waspada/ Ibnu Kasir

Aceh di Banda Aceh, Kamis (19/1). Ketua Divisi Perencanaan dan Data KIP Aceh Yarwin Adi Dharma mengatakan, para komisioner KIP se-Aceh mengaku tidak nyaman dengan jadwal tahapan yang diatur dalam SK 29. “Ka w a n - k a w a n t i d a k nyaman dengan tahapan itu, kalau pendaftaran hanya tiga hari. Keinginan kawan-kawan di kabupaten/kota, kita maksimalkan saja pendaftaran selama tujuh hari,” kata Yarwin

Ayah Balas Cakaran Dengan Gigitan

HANYA karena kesal anaknya menangis dan mencakar wajahnya, seorang ayah asal China tega menggigit jari putrinya hingga putus. Balita malang yang baru berusia 2 tahun itu harus kehilangan dua jarinya setelah digigit sang ayah. Menurut satu situs lokal di Guizhou, pria bernama Wang Ai itu menggigit putrinya saat ia sedang mabuk. Leilei mendapat perawatan di sebuah rumah sakit di Guiyang, China, karena dua jarinya putus serta wajahnya luka karena digigit sang ayah. Saat ditangkap polisi, Wang Ai mengatakan ia tega melakukan hal itu hanya karena putrinya menangis dan mencakar wajahnya. (st/rzl)

PERNAHKAH Anda mengunjungi dan shalat di masjid terapung? Tak ada salahnya berdestinasi ke Melaka bersama keluarga. Perjalanan udara dari Medan, Sumatera Utara, ke satu negeri bagian jiran itu hanya sekejap. Kita langsung dapat menikmati eksotis Masjid Selat itu. Disebut Masjid Selat karena bangunannya berdiri di atas permukaan laut Malaka. Lokasinya terletak di Bandar Hilir yang tidak jauh dari pusat keramaian kota dan shopping centre. Diapit kawasan sejarah dan Menara Taming Sari, simbol keris Hang Tuah setinggi 110 meter, masjid itu begitu kesohor di antara empat masjid terapung di dunia: masjid di Jeddah (rumah nenek moyang Siti Hawa), di Dubai dan Masjid Tengku Tengah Zaharah, Trengganu. Keberadaan masjid seluas 1,8 hektare itu terdiri dari bangunan utamanya adalah Lanjut ke hal A2 kol 2

“Oh ya sudah hibah (anggarannya). Hibah dari Pemprov Sumut ke KPU provinsi. Masuk ke rekening tersendiri,” kata Nurdin kepada wartawan saat dikonfirmasi mengenai kepastian anggaran Pilgubsu 2013 di Kantor Gubernur Sumut, Kamis (19/1).

STABAT (Waspada): Tiga dari empat orang diduga membawa dua goni ganja basah diringkus aparat Polres Langkat di kawasan Jalinsum Stabat, Kamis (19/1) pagi. Ketiganya, Am, 38 , Fah, 21 dan Ham, 33, warga Desa Kelambir Titi Payung, Kec. Hamparanperak,

Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 1

Pudarnya Kebahagiaan Meri Setelah Tes DNA PERISTIWA gempa dan tsunami yang melanda Aceh 7 tahun silam masih menorehkan kenangan kelam bagi hampir segenap masyarakat Aceh, tak terkecuali bagi keluarga Ibrahim Nur, 60.Tapi setelah kepulangan Meri Yulanda, 15, sang cucu, yang sempat dinyatakan hilang akibat bencana tersebut membuat lelaki itu sedikit lega. Kedatangan Meri membuat rumah Ibrahim di Jl. Sangkis, Kec. Ujung Baroh, ramai dikunjungi warga. Berbagai emosi tumpah kala itu. Tak hanya dari keluarga Ibrahim, juga dari warga yang datang. Mereka takjub. Hal yang sama dirasakan Yusnidar, 35, dan Tarmiyus, 43, pasangan yang pernah merasakan kehilangan anak bernama Meri Yulanda, saat tsunami menerjang Aceh. Kepulangan Meri pun tak luput dari pemberitaan media internasional, nasional dan lokal. Lanjut ke hal A2 kol 3

Nenas, Buah Bergengsi Jelang Imlek MEDAN ( Waspada): Jelang Tahun Baru Imlek, buah nenas menjadi sangat berharga. Tapi nenas yang satu ini beda dengan yang lainnya. Bentuknya yang kecil, bulat dan lonjong serta model beranak-anak banyak, menjadi nenas pilihan bagi warga Tionghoa yang akan merayakan Imlek. Pasar Beruang Medan, menjadi salah satu kawasan yang menyediakan aneka nenas dengan berbagai ukuran dan tipe nenas ini, yang digunakan untuk sembahyang bagi warga Tionghoa kala Imlek mendatang. Adalah Andi, seorang pedagang nenas di Pasar B e r u a n g Me d a n y a n g sangat sibuk melayani pembeli nenas-nenas ini. Sejak pagi pukul 05, Andi mengaku sudah berada di pasar tersebut guna Lanjut ke hal A2 kol 6

Bawa Ganja Dari Aceh, Tertangkap Di Langkat

Presiden Minta Politisi Aceh Tahan Diri

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono meminta para politisi Aceh untuk menahan diri dan tidak saling berhadapan sehingga kehidupan demokrasi di wilayah itu bisa berjalan dengan baik.

Lanjut ke hal A2 kol 1

Baca Pentas Demokrasi Aceh Di Halaman A4

Serampang Waspada/Anum Saskia

NENAS dengan bentuk banyak anak, harganya antara Rp 15.000 s/d 150.000 bahkan menjelang Hari Imlek harganya diprediksi semakin mahal, yang dijual oleh pedagangnya di Jalan Beruang Medan.


PENUKARAN UANG MENINGKAT. Seorang nasabah keturunan Tionghoa memperlihatkan uang pecahan Rp 10 ribu dan Rp 100 ribu yang baru ditukarnya di Bank Indonesia Medan, Sumut, Kamis (19/1).

- Genderang perang sudah ditabuh - He.... he....he....

Berita Utama

A2 Bawa Ganja ....

Perdamaian. Saat itulah mereka di-amankan.Tapi satu orang melarikan diri.Sedangkan dari dalam mobil, petugas menemukan dua goni berisi ganja basah yang baru dipanen seberat 7 kg. Kapolres Langkat AKBP H. Maardiyono didampingi Kasat Reskrim AKP Aldi Subartono dan Kasat Narkoba AKP SR Tambunan mengatakan, hasil pemeriksaan sementara, ketiganya mengaku daun ganja itu baru dipanen di kawasan Aceh Utara milik Sf yang melarikan diri. (a01/a03)

Anggaran Pilgubsu ....

dan kelurahan dan tidak perlu masuk dalam dana cadangan. “Kita lihat urgensinya dan jumlahnya juga tidak terlalu signifikan sebenarnya jadi dapat ditampung dan sudah dimasukkan,” terang Nurdin. Mengenai besaran anggaran yang ditetapkan, Nurdin mengaku tidak ingat persis.Yang pasti anggarannya di atas Rp100 miliar. Nantinya jika masih diperlukan dapat dialokasikan kembali dalam P-APBD 2012. Selain itu anggaran akan ditampung dalam APBD 2013. “Untuk tahun ini anggarannya tidak terlalu besar sekitar seratusan (Rp100 miliar) lebih. Yang diusulkan sebelumnya Rp 400 miliar lebih yang dianggarkan bertahap di dua mata anggaran (APBD 2012 dan 2013),” ujar mantan Kepala Inspektorat Sumut itu. (m28)

Deliserdang, seorang lainnya Sf, 40, warga Lhoukseumawe Aceh Utara, kabur. Informasi dihimpun Waspada, ketiga orang tersebut diringkus aparat Satlantas Polres Langkat saat melakukan razia di kawasan Jalinsum Stabat. Ketika itu mobil Xenia warna hitam Nopol BK 1597 KY melintas dari arah Aceh menuju Medan, saat dilakukan penyetopan, mobil terus melaju. Selanjutnya dilakukan pengejaran hingga mene-mukan mobil tersebut mengisi bahan bakar di SPBU

Nurdin mengakui, sebelumnya sempat diwacanakan anggaran Pilgubsu 2013 dimasukkan dalam dana cadangan dan tidak berbentuk hibah. Hal itu merujuk pada rencana anggaran pada Pilkada di Jawa Tengah (Jateng) yang jumlahnya cukup besar. Namun, setelah dievaluasi ternyata anggaran Pilgubsu 2013 yang akan dimasukkan dalam APBD 2012 tidak terlalu signifikan sebab hanya untuk kepentingan sosialisasi dan pembentukan panitia penyelenggara di tingkat kecamatan

Bendera GAM Berkibar Lagi

PEUREULAK (Waspada): Setelah berkibar 4 Desember 2011, bendera Gerakan Aceh Merdeka (GAM) kembali berki-bar di Aceh Timur. Kali ini, se-lembar bendera bintang bulan itu dinaikkan orang tak dikenal (OTK) di Desa Matang Peulawi, Kec. Peureulak Kota, Kamis (19/1) sekira pukul 14:00. Bendera berukuran 120X80 centimeter itu di kibarkan per-sisnya di sebuah pondok di tengah sawah berjarak sekitar 8 kilometer ke arah utara jalan nasional Banda Aceh – Medan. Setelah diinformasikan ke petu-gas, dengan bantuan masyara-kat setempat bendera tersebut diduga dinaikkan malam hari itu diturunkan dan diamankan di Polsek Peureulak Kota. (b24)

Presiden Minta .... “Saya serukan agar para politisi yang saling berhadapan agar menahan diri,” kata Yudhoyono dalam rapat kerja pemerintah 2012 di JI-Expo, Jakarta, Kamis (19/1) sore. Presiden meminta para politisi untuk tidak mengorbankan demokrasi hanya demi kepentingan politik golongan tertentu. Dia juga meminta semua pihak di Aceh untuk mengedepankan pendekatan perdamaian dalam menghadapi setiap masalah.

PA Daftarkan Calon....

(19/1) pukul 17:00, PA telah mendaftarkan satu pasangan calon untuk Bupati Aceh Utara dan satu pasangan calon wali kota Lhokseumawe,” kata Tgk. Zulkarnaini. H Muhammad Thaib, didampingi Drs. M. Jamil, M.Kes kepada Waspada mengaku optimis unggul di pesta demokrasi pada 16 Februari nanti. PA mendapatkan dukungan terbanyak dari masyarakat Aceh. Apalagi, PA merupakan partai yang menerima berbagai komponen masyarakat. “Insya Allah, kita akan meraih suara 85 persen. Jika gagal pada Pilkada nanti, kita akan berusaha pada kesempatan berikutnya. Dan kita akan mendukung siapun yang terpilih pada pesta demokrasi nantinya,” ucap H Muhammad Thaib, diamini M. Jamil, M.Kes dan Tgk. Zulkarnaini. Muhammad, Ketua KIP Aceh Utara pada kesempatan itu ketika ditemui Waspada mengatakan, sesuai perintah Mahkamah Konstistusi (MK) untuk membuka kembali jadwal pendaftaran, maka dilaksanakan sesuai aturan yang ada. KIP tetap menerima PA sebagaimana calon sebelumnya.

Melihat Dari Dekat ....

masjid dengan menara setinggi 35 meter, tempat wudhu atau mengenal Wila. Dia juga laki-laki dan perempuan serta tidak mengetahui adanya tempat jajanan. aliran dana kepadanya atauBangunannya didominasi pun PLN. warna krem muda. Namun Menurut dia, Nazaruddin interior kubahnya biru dan didakwa melakukan korupsi putih. Ukurannya sekitar 25 dalam kaitannya sebagai kader x 30 meter dan berdaya tampartai politik dan anggota pung 3.500 jamaah. Lantai DPR. Padahal, proyek PLN satu untuk jamaah laki-laki yang dimaksud itu tidak ada dan di atas jamaah peremkaitannya dengan DPR. puan. Boleh dikatakan Masjid “Proyek itu sama sekali Selat Malaka merupakan tidak ada hubungan sama masjid termewah di Melaka APBN dan DPR,” katanya. saat ini. Mihrabnya terbuat dari kayu hitam. Ukurannya lebih besar dibanding masjidJawaban Problem Catur, masjid kebanyakan. Satu kursi TTS Dan Sudoku di tengahnya. Seluruh lantainya tertutupi ambal empuk. Dari Halaman Sport. Lampu impor menggelantung di tengah kubah. Jika malam, masjid ini terlihat cukup Jawaban Problem Catur: megah karena dibalut lampu warna-warni. 1. a7+, Ra8. Kemudian, meskipun 2. Kc7+mat. angin berembus kencang di dalam masjid, jamaah masih dimanjakan kipas angin. Ada Jawaban TTS: 25 kipas berdiri, 20 bertengger di dinding bawah, 16 di empat TTS Topik Mimbar Jumat pilarnya. Selebihya di teras dan S U R G A J A M R A H lantai dua. Menara masjid A O I A I yang dibangun setinggi 35 meter dilengkapi lampu meK A' B A H R A H M A T J E A A R Al Bayan .... M A R A H G U N U N G I beriman dan mengawini putri A A E A keturunan Yahudi ini. Dengan perkawinan itu Safiyah meraH U T A MA H MA RWA H sa dimuliakan dan kaumnya E U A A banyak yang masuk Islam. K I A MA T R K A D I Hari-hari bersama Nabi adalah hari-hari yang cukup indah J B I S T I N J A S dan bersejarah. Safiyah yang A O A A A S L jelita itu sangat banyak menB A K A R M A A dapat perhatian dari Nabi, Z A B U L A H A B M pernah membawanya untuk musafir yang menyebabkan A I U D I Aisyah dan Hafsah cemburu. Gosip-gosip tentang SofiB A Y A N F I R D A U S yah semakin marak, para istri Jawaban Sudoku: Nabi yang lain sering mengganggu Sofiyah dengan me3 4 2 9 6 5 8 1 7 nyoalkan keturunannya, putri Yahudi yang dikutuk Allah 1 5 8 7 4 2 3 6 9 dalam Alquran. Aisyah sering 6 7 9 8 3 1 2 5 4 membanggakan ayahnya 5 8 7 3 2 6 9 4 1 Abubakar Siddiq, Hafsah membanggakan Umar bin 4 9 6 1 8 7 5 3 2 Khattab dan Zainab binti 2 3 1 4 5 9 6 7 8 Jahasy membanggakan proses 9 6 4 2 7 3 1 8 5 perkawinannya yang langsung disuruh Allah kepada Muham7 1 5 6 9 8 4 2 3 mad lewat wahyu. 8 2 3 5 1 4 7 9 6

Dahlan Iskan ....

Pudarnya ....

“Kami sangat bahagia meski juga sedih melihat kondisi Meri,” kata Yusnidar menantu Ibrahim saat dijumpai wartawan, Kamis 22 Desember lalu. “Saya mengenali Meri di tanda lahir di tubuhnya,” kata Yusnidar sambil menyingkap baju Meri yang saat itu terbaring di ranjang. Tetapi pada Rabu (18/1), kediaman Ibrahim tak lagi ramai dikunjungi warga. Di rumah berjarak sekitar 300 meter dari Pasar Bina Usaha Kota Meulaboh itu hanya tampak sosok Meri Yulanda berlari menuju dapur dan teras rumah berkonstruksi permanen. “Pak Nek !,” panggil Meri saat ditanya seisi rumah yang tampak sepi. Sejak tes DNA oleh lembaga Biologi Melekul Eijkman diserahkan pada keluarga Ibrahim, kebahagiaan di tengah keluarga itu seakan memudar. Tes yang dipimpin Prof Herawati Sudoyo itu menyatakan Meri Yulanda memiliki kesamaan DNA dengan Tarmius, namun bukan beribu Yusnidar. “Habis keluar tes itu (DNA-red) , mereka sudah kembali ke Alu Peunyareng. Tidak pernah datang lagi, tapi Hera tetap bersama kami,” kata istri Ibrahim. Hasil tes DNA itu juga menjawab keraguan Ibrahim

terhadap remaja yang kembali tepat di saat momen peringatan tujuh tahun tsunami itu. Remaja tersebut diyakini bukan sosok Meri Yulanda, tapi Herawati, buah hubungan Tar mius dengan wanita lain. Meski demikian, Ibrahim mengaku tidak mengenal sosok wanita yang melahirkan Herawati. Tarmius ayah Hera dikenal sebagai sosok yang pendiam. Sejak hasil tes DNA diserahkan, Ibrahim mengaku menanyakan keberadaan ibu Hera, namun anak tertuanya itu memilih diam. Mengetahui sosok ibu kandung Hera dinilai penting untuk mengungkap, apakah remaja tersebut hilang saat tsunami melanda Aceh atau pergi bersama ibu kandungnya sebelum tsunami menerjang Aceh. Hal itu untuk menjawab keraguan warga di kabupaten itu tentang sosok Meri yang disebut hilang saat tsunami. “Salah satu cara memang mencari tahu keberadaan Fatimah. Saya akan berusaha menemukan dia, tapi Hera tidak tahu alamat di Banda Aceh. Yang jelas saya yakin dia bukan Meri Yulanda, jadi sekarang saya memanggilnya Hera, karena tak baik terus menyebut orang yang tiada,” kata Ibrahim. “Tapi memang dia anak kandung Tarmius. Itu hasil tes

yang mengatakan. Walau hasil tes membuat hubungan ayah dan ibunya sekarang renggang, dia tetap saya pelihara. Saya tidak keberatan jika ada yang mengambil asal men u n j u k k a n b u k t i ,” k a t a Ibrahim. Seperti diwartakan sejumlah media, Herawati yang kemudian disebut Meri Yulanda kembali setelah sempat menghilang 7 tahun. Belum diketahui apakah kehilangan Herawati memiliki kaitan dengan tsunami yang menerjang Aceh. Kepada wartawan saat itu pihak keluarga meyakini remaja tersebut adalah sosok Meri yang hilang bersama saudara kandungnya saat berusia 8 tahun. Namun sejumlah informasi yang berkembang di masyarakat Aceh Barat, dua nama tersebut merupakan sosok yang berbeda. “Memang ibu Yus memiliki anak bernama Meri Yulanda dan hilang saat tsunami. Tapi yang sekarang bukan Meri, melainkan Herawati anak dari lain ibu,” kata sumber yang enggan namanya diwartakan. “Kami tidak ada merekayasa ini. Tapi saya melihat memang sejak dia kembali ada yang menciptakan kondisi agar terkesan Meri yang tujuannya agar dapat diterima di tengah keluarga Tarmius dengan istri sahnya sekarang,” ungkap Ibrahim. (cb06)

Berkas yang dibawa oleh pasangan calon masih ada beberapa hal yang belum dilengkapi seperti foto kopi rekening dana kampanye, susunan kampanye. Muhammad mengaku dengan kehadiran PA dalam pesta demokrasi yang akan digelar beberapa waktu ke depan, membuat KIP nyaman dalam melaksanakan tugas. PA Aceh Barat Sementara, PA Aceh Barat, Kamis (19/1) mendaftarkan kandidat pasangan calon bupati/wakil bupati. “Jadi sampai pembukaan pendaftaran yang ketiga kali ini, sudah ada tiga belas pasang yang mendaftar. Sembilan dari jalur perseorangan, sedang 4 lainnya melalui jalur partai,”kata ketua Pokja Pencalonan KIP Aceh Barat kepada wartawan. Bahagia mengatakan, dengan 9 pasangan dari yang maju dari partai perseorangan tersebut dipastikan tidak ada lagi pasangan yang akan mendaftar hingga batas waktu yang ditetapkan. “Menurut hemat kami rasanya PA adalah yang terakhir. Jadi untuk nomor urut 13 sementara waktu langsung kita tetapkan pada pasangan ini (Adami/ Tgk. Bustanuddin-

red). Tapi kita tetap menunggu hingga 24 Januari nanti ,”kata Bahagia. Menurut Bahagia meski jadwal yang singkat kedua pasangan dimaksud tetap harus mengikuti sejumlah tahapan seperti seperti tes baca Alquran dan uji kesehatan di Banda Aceh. Selain menjalani tahapan itu, pasangan Adami dan Tgk Bustanuddin kata Bahagia masih harus melampirkan beberapa persyaratan lain yang belum dilengkapi. Bahagia mengatakan, pihaknya telah menerima informasi dari KIP Aceh, untuk menggeser jadwal pencoblosan yang awalnya ditetapkan pada 16 februari. “Kita berharap ini dikabulkan karena jika tidak sangat menyulitkan. Setidaknya dibutukan waktu 50 hari untuk melakukan seluruh verifikasi sehingga hari H diprediksi bergeser ke 9 April,”kata Bahagia. Pantauan Waspada, selain dihadiri puluhan simpatisan partai Aceh, pendaftaran pasangan Adami-Tgk Busthanuddin ke KIP, didampingi Ketua PA Aceh Barat Tgk Yusnaini. Namun pria yang kerap disapa Abu Yus itu

enggan memberi komentar ketika ditanya wartawan terkait dibukanya keputusan MK yang meminta KIP membuka jadwal pendaftaran PA Bireuen Sedangakan, DPW-PA Bireuen hingga kini belum menentukan bakal calon (Balon) pasangan bupati dan wakil bupati untuk mengikuti Pimilu Kada yang direncanakan pada tertengahan Tahun 2012. Kendati demikian, Sekretaris DPW PA Bireuen, Muzakkir Zulkifli Kamis (19/1) mengakui sudah ada beberapa nama balon. Dia menjelaskan, dalam menentukan bakal calon bupati, PA akan melakukan melalui musyawarah yang diikuti seluruh pengurus mulai tingkat kabupaten hingga tingkat desa. Dia membantah semua isu yang menggelinding sekarang kalau partainya sudah menetapkan balon untuk bupati periode 20122017 di Kabupaten Bireuen. Menurutnya, PA akan mengusung balon yang dinilai mampu membawa Bireuen ke a rah yang lebih baik dan keputusan itu akan dilakukan melalui musyawarah partai. (b18/11/cb06/b17)

rah. Kenapa dipasang lampu merah? Menara itu berfungsi sebagai tempat peringatan bagi pesawat yang melintas di kota sekaligus alat pengingat shalat bagi nelayan-nelayan yang sedang menangkap ikan. Menurut Suhaimi, pemandu ducktour, Masjid Selat tidak pernah sepi dari pelancong lokal dan asing. “Setiap hari seribu pelancong datang untuk shalat dan berwisata,” katanya kepada Waspada, Minggu (15/1). Pengunjung tertarik dengan keindahan desain eksterior dan interiornya yang lebih modern dan fasilitasnya juga lengkap. Begitu juga hembusan angin laut begitu terasa mengibas-ngibas siapa saja yang shalat dan berwisata ke masjid tersebut. Deburan ombak dan panorama laut memperteguh kekusyukan ibadah karena kita berdiri di tengah indah dan luasnya laut kekusaan Ilahi, yang tak berujung dipandang mata. Selepas shalat kita pun dapat bergegas menjorok ke palataran luar masjid untuk menikmati taman, pemandangan laut lepas yang biru dan pulau-pulau kecil yang bertengger di sana. Dua pintu mengah terbuka menghadap

arah laut lepas, baik arah Utara dan Selatan. Gedung-gedung menjulang dan jalan layang dibangun di atas permukaan laut pasti tidak luput dari rekaman mata. Spontan syaraf kepala pun mengendur. Warisan dunia Masjid ini membuktikan kepada dunia bahwa Melaka tidak pernah kehabisan objek wisata. Bagaimana tidak, Melaka satu dari tiga negeri bagian yang tidak memiliki sult a n m a m p u ‘m e n y u l a p’ sungai, laut sampai bangunan-bangunan tua peninggalan penjajahnya menjadi objek wisata termasuk yang populer Masjid Selat ini. Sampai-sampai wisatanya pun meraih pengakuan UNESCO sebagai warisan dunia, adalah prakarsa Ketua Menteri Malaka YAB Datuk Seri Hj Mohd Ali Bin Mohd Rustam. Peletakan batu pertama masjid ini pada 2003. Hanya dalam tempo tiga tahun pembangunannya tuntas kemudian diresmikan Pertuan Agong XII Tuanku Syed Putra Jamalullail pada November 2006. Di negeri yang sebagian lautnya disulap menjadi daratan tidak sedikit menyumbang pendapatan daerah,

Safiyah mengadu kepada suaminya, ia tidak dapat menerima penghinaan seperti itu. Rasulullah membela Safiyah agar menjawabnya sebagai berikut: “Suamiku Muhammad, Ayahku Harun dan Pamanku Musa”. Setelah Safiyah mengembalikan katakata pamungkas ini, para istri Nabi yang lain tidak berani menjelek-jelekkan Safiyah. Abu Aiyub al-Anshari pernah menceritakan, “Pada malam pertama perkawinan antara Nabi dengan Safiyah, saya berjaga-jaga semalam suntuk di pintu rumah Rasulullah. Saya takut Safiyah akan membalas dendam kepada Rasulullah, karena gara-gara Islam, ayahnya tewas. Rupanya Safiyah benar-benar mencintai Rasulullah, dan tidak terjadi apa-apa terhadap suaminya”. Saat Rasulullah menjelang wafat, Safiyah duduk di sisi beliau. Tiba-tiba Safiyah berkata;

Ya Rasulullah, sekiranya apa yang kau rasakan saat ini berpindah kepada diriku, aku rela karena Allah!”. Istri-istri rasulullah yang lain saling memandang. Rasulullah bersabda.”Demi Allah ia jujur berkata begitu”. Setelah terjadi fitnah antara kaum Muslimin, Safiyah terjun ke jalan sambil memegang gamis Nabi. Ia berseru kepada kaum muslimin, “Wahai kaum muslimin, mengapa kau bersengketa? Lihatlah gamis Rasulullah masih baru! Bersatulah!” Ia juga telah berusaha membantu Usman yang terkepung, bersama Ali bin Abi Thalib, Hasan dan Husein. Kaum pemberontak tidak berani menghalangnya. Safiyyah wafat pada tahun 50 H. Beliau dimakamkan di perkuburan Baqi’ bersama sejumlah istri-istri Nabi yang lain. Kiranya Allah telah meridhainya. Dan syurgalah tempatnya di Yaumil Qiamah nanti.

masjid-masjid yang telah berusia ratusan tahun dibangun bergaya Melayu-Jawa. Masjid Kampung Hulu sebagai masjid tertua misalnya, desainnya menunjukkan ciri khas masjid-masjid di Pulau Jawa. Kubahnya tidak bulat melainkan berbentuk piramida bersusun tiga dan di puncaknya bercungkup kecil. Sementara masjid-masjid yang dibangun belakangan sudah memadukan gaya Arab-Melayu. Selain untuk ibadah, rancangan masjid baru itu semua untuk menggaet wisatawan. Termasuk penulis yang sangat penasaran merasakan suasana Masjid Selat Malaka. Dari kejauhan Selat Malaka apabila kita berwisata laut dengan menggunakan ductour, mobil dua fungsi darat dan laut peninggalan Portugis, mengantarkan kita melihat anggunnya bangunan masjid bergaya Arab-Melayu yang sengaja dibangun berasimetris di garis pantai. Karena berhalaman luas yang juga timbunan laut menjadi daratan, bangunannya sangat menonjol mengarah ke laut lepas. Aturan ketat Meski terbuka untuk umum, petugas masjid memberlakukan aturan ketat, terutama bagi pelancong perempuan. Bila auratnya terbuka, mereka dilarang masuk masjid. Batas kunjungannya hanya sampai di halaman luar masjid. Jangankan warga asing, muslimah yang berpakaian tidak sopan juga dilarang masuk masjid. “Pengunjung muslimah kalau tidak pakai tudung dilarang masuk,” kata Zainul, petugas masjid. Meski demikian pelancong perempuan yang pakai kasual dan Tshirt diarahkan ke ruang ganti pakaian. Pihak masjid memberikan tudung yang sudah dipersiapkan untuk pelancong lokal dan turis. Itulah Melaka, meski masjid menjadi objek wisata, adab masuk masjid tidak bisa ditawartawar. Kini, Melaka menjadikan imbauan agama agar muslim shalat berjamaah dan memakmur kan masjid menjadi ajakan ampuh menggaet turis. * Muhammad Thariq

WASPADA Jumat 20 Januari 2012

Warga Vs PT SA ....

Lukmin Siregar, hingga Kamis (19/1) masih terdapat sekitar 15 orang perempuan dan anak-anak yang menduduki areal PT Tanjung Siram. Mereka dikawal oleh delapan personil Polres Tapsel dan Polsek Gunung Tua. Mengenai 88 warga yang sudah diperiksa dan tidak ditetapkan sebagai tersangka, tapi masih bertahan menginap di aula Pratidina Mapolres Tapsel, katanya akan dikembalikan ke rumah masingmasing. Jika sampai Jumat (20/1) warga masih bertahan, Kapolres Tapsel akan mengundang Bupati Padanglawas Utara, Bachrum Harahap, bertemu dan berdialog dengan warganya yang masih bertahan di Mapolres Tapsel. Pantauan Waspada di Mapolres Tapsel, 129 warga diperiksa bergantian. Mulai pagi hingga malam mereka bertahan di aula Mapolres dan pada sore harinya terlihat

Wakapolres Kompol Zainuddin P mendatangi dan mengajak mereka untuk ber-shalawat badar. Kuasa hukum warga Faisal Ritonga SH sejak siang sudah tidak berada di Mapolres Tapsel. Dia pergi bersama Ketua Partai Persatuan Pembangunan (PPP) Kab. Paluta yang merupakan warga Desa Aek Kanan. Hingga malam mereka belum kembali. Sedangkan sore harinya terlihat 129 warga tersebut mengaku belum makan siang. H Sati Rambe (tokoh masyarakat Desa Aek Kanan) terlihat mengajak teman-temannya untuk mengumpulkan uang guna membeli nasi. Pantauan Waspada di lokasi, Kamis (19/1), tiga hari pasca pembakaran puluhan rumah karyawan dan tiga unit truk milik PT. Tanjung Siram di Kec. Dolok Sigompulon, Kab. Padanglawas Utara, masih terlihat mengepulkan asap. (a27/a35)

KIP Cabut SK ....

kabupaten/kota melaksanakan lebih teknis, sampai melipat surat suara. Sedangkan kita di provinsi lebih pada kebijakan,” kata Abdul Salam Poroh. KIP Ajukan Permohonan ke MK Sementara itu, KIP Aceh, Kamis (19/1) pagi hingga menjelang magrib melakukan rapat koordinasi dengan komisioner KIP kab/kota membahas jadwal tahapan secara teknis yang akan dimohonkan kepada MK, agar MK menambah waktu untuk melaksanakan tahapan sela. Robby Syahputra mengatakan, dalam waktu tujuh hari KIP tidak mungkin bisa menetapkan calon kepala daerah, karena ada tahapan teknis yang perlu dilalui pasangan bakal calon, seperti verifikasi berkas pendaftaran, tes kesehatan, tes baca alquran, dan penetapan sebagai calon. Tahapan tersebut tidak bisa dilakukan selama tujuh hari masa keputusan sela. “Hasil rapat koordinasi kami tadi menetapkan bahwa KIP tidak mampu melaksanakan pemungutan suara pada 16 Februari. Karena berbagai alasan teknis, pemungutan suara akan dilakukan KIP pada 9 April sesuai jadwal yang kami

ajukan ke MK,” ujar Komisioner KIP bidang logistik Robby Syahputra dalam konferensi persnya, Kamis (19/1). Robby yang didampingi komisoner KIP bidang perencanaan dan data Yarwin Adi Dhar ma menambahkan, putusan sela MK soal pembukaan kembali jadwal pendaftaran Pilkada memaksa pihaknya menyesuaikan juga tahapan Pilkada lainnya. Pihaknya mengkhawatirkan pelaksanaan Pilkada pada 16 Februari tak akan optimal bila dipaksakan. PA Daftarkan Calon Sedangkan, Dewan Pimpinan Partai Aceh (DPA PA) akan mendaftarkan pasangan bakal calon gubernur Aceh dan wakil gubernur Aceh, dr Zaini Abdullah dan Muzakir Manaf, usai shalat Jumat (20/1). Juru bicara Partai Aceh Fakhrul Razi melalui pesan singkatnya, kepada wartawan menyebutkan, pendaftaran bakal calon gubernur dan wakil gubernur periode 20122017 dari Partai Aceh pada hari Jumat (setelah shalat jumat), dan massa akan berkumpul di Masjid Raya, lalu melakukan konvoi damai menuju kantor KIP Provinsi. (cb01)

Nanas, Buah ....

padanya. Di Pasar Ramai Thamrin Medan, nenas untuk sembahyang Tahun Baru Imlek juga banyak dijual, tetapi kebanyakan yang kecil dan sifat buahnya tunggal. Harganyapun bervariasi, ada yang Rp 5.000, ada juga seharga Rp 25.000. Nenas-nenas itu dikemas dalam satu wadah atau mangkuk cantik. Banyak juga nenas kecil dengan tekstur buah liris merah dan daunnya liris putih sedikit merah. Lily, warga Tionghoa yang sedang membeli nenas mengaku jika nenas-nenas ini memang sangat diperlukan untuk sembahyang. Kata Lily, nenas lain yang digunakansaat Imlek termasuk nenas kertas, harganya antara Rp 80.000 sampai 250.000 perbuah. Tergantung Kepercayaan Ketua Paguyuban Sosial Marga Tiongha Indonesia, Halim Loe,SE menyebutkan, nenas dalam bahasa Tionghoa disebut Onglay, artinya rajaraja yang datang. Kehadiran nenas sebagai salah satu buah yang dipilih untuk sembahyang, karena dianggap ada raja yang datang.

“Ini tradisi dan kepercayaan, karena itu beragam jenis dan tekstur nenas yang dipilih untuk sembahyang, tergantung pada kepercayaan. Kalau model nenas yang banyak pengikutnya, atau banyak anak-anak di sekelilingnya paling banyak dipilih,’’ kata Loe. Kata Loe, nenas itu hanya ada saat menjelang masa Tahun Baru Imlek, entah apa yang membuat hal itu bisa terjadi. ‘’ Tapi tetap saja hal ini sebagai suatu kepercayaan dan perlambang bahwa pergantian tahun itu selalu menjadi sebuah harapan yang baru bagi manusia. Imlek atau pergantian tahun tentu menjadi sebuah harapan baru untuk jadi yang lebih baik dan lebih beruntung,”kata Loe. Paling tidak, menurut Loe, sang petani nenas. “Tetapi, ada juga nenas kertas untuk dibakar. Saat saya masih kecil, tradisi bakar nenas kertas ini berlangsung dalam keluarga kami, sekarang tidak lagi. Bukan berarti kami tidak percaya, tapi begitulah tradisi,”kata Loe di Sekretarian PSMTI Kota Medan Jl. Muchtar Basri Medan, kemarin. (m37)

memeriksa 10 warga, namun 119 warga lainnya datang ke Mapolres Tapsel di Padangsidmpuan dan meminta agar mereka juga turut diperiksa. Dari hasil pemeriksaan, ternyata 41 orang mengakui telah melakukan dan turut melakukan pembakaran serta perusakan di base camp PT Tanjung Siram. Yang dibakar itu adalah sembilan rumah, dua kantor, dua dump truk, dan satu pick up. Sedangkan yang dirusak empat rumah dan dua kantor. “Terhadap para tersangka dikenakan Pasal 412 subsidair Pasal 410 dan 187 atau 170 KUH Pidana. Ancaman hukuman kurang lebih 12 tahun penjara,” kata Kasat Reskrim Polres Tapsel sembari menyebut hingga kini pihaknya masih mencari siapa otak pelaku di balik kejadian ini. Disinggung mengenai kondisi di lapangan pasca kejadian. Menur ut AKP di Media Center, Kamis (19/1). Yarwin menyebutkan, untuk memfinalisasikan tahapan baru pemilihan para komisioner KIP Aceh dan KIP kabupaten/kota masih akan mengadakan rapat. Dalam rapat pleno pagi tadi, kata Yarwin, salah satu usul yang mengemuka adalah menjadwal ulang tahapan Pilkada. Roby Syahputra menyebutkan, SK KIP Aceh No 29 tahun 2012 akan dicabut dan diganti dengan surat keputusan yang baru. “Kita akan mencabut pengumuman SK No 29 dan akan kita buat pendaftaran selama tujuh hari, agar jangan menimbulkan kegalauan di seluruh kabupaten/ kota,” ujar Roby. Mengenai langkah selanjutnya, Ketua KIP Abdul Salam Poroh mengatakan, pihaknya masih akan terus melakukan diskusi dan rapat dengan komisioner dari kabupaten/ kota. “ Prinsipnya, tidak semua dari kita melanggar amar putusan MK,” ujarnya. Rapat hari itu dengan komisioner KIP se-Aceh membahas teknis pelaksanaan amar putusan sela Mahkamah Konstitusi. “Kita membahas teknis pelaksanaan putusan MK di lapangan. Karena KIP menjajakan nenas-nenas pilihan ini. Ditemui, Kamis (19/1) di lapak jualannya, Andi mengaku sudah puluhan tahun berdagang aneka nenas jelang Imlek. Harga nenas yang dijual sangat bervariasi antara Rp 15 s/d 150.000. Harga itu, kata Andi tergantung dari jenis nenas yang diinginkan. “Ini nenas khusus untuk sembahyang, adanya saat menjelang Tahun Baru Imlek. Hari biasa, nenas ini tidak ada dan pohonnya tidak berbuah. Makanya, kalau petaninya beruntung, harga nenasnya sangat mahal. Kalau yang cukup bagus dan anaknya banyak, harganya bisa Rp 150.000. Dibelinya saat pagi hari, memang seperi itu kepercayaannya,”kata Andi yang mengaku nenas ini datang dari daerah Klumpang, Hamparanperak, Deliserdang. Dan, ada juga dari kawasan Pancurbatu. Ia meneruskan usaha yang dirintis ayahnya. Sehingga warga Tionghoa yang akan membeli nenas untuk berbagai keperluan sembahyang langsung saja memesan

Berita Utama


Presiden Minta Politisi Aceh Tahan Diri JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono meminta para politisi Aceh untuk menahan diri dan tidak saling berhadapan sehingga kehidupan demokrasi di wilayah itu bisa berjalan dengan baik. “Saya serukan agar para politisi yang saling berhadapan agar menahan diri,” kata Yudhoyono dalam rapat kerja pemerintah 2012 di JI-Expo, Jakarta, Kamis (19/1) sore. Presiden meminta para po-

JK: Kepatuhan Sosial ... “Ramai-ramai membunuh orang, tidak ada yang ditangkap dan tidak ada yang bersalah, polisi membakar. Dimana-mana sekarang asal ramai-ramai bertindak sepertinya tidak ada apaapa,” katanya. Untuk itu, menurut dia dibutuhkan suatu wibawa dan ketegasan hukum, guna menghindari terjadinya masyarakat yang semakin tidak terkontrol, tidak mengindahkan hukum dan memakai hukum sendiri dalam menyelesaikan masalah. Menurut JK, hilangnya kepatuhan sosial masyarakat karena masih banyaknya ketidakadilan dalam hukum yang dirasakan oleh masyarakat. Bila keadilan dapat ditegakkan dan para pemimpin juga memberikan teladan, menurut JK, maka hukum dapat berwi-

Warga Vs PT SA, ... sembilan rumah, dua kantor, dua dump truk, dan satu pick up. Sedangkan yang dirusak empat rumah dan dua kantor. “Terhadap para tersangka dikenakan Pasal 412 subsidair Pasal 410 dan 187 atau 170 KUH Pidana. Ancaman hukuman kurang lebih 12 tahun penjara,” kata Kasat Reskrim Polres Tapsel sembari menyebut hingga kini pihaknya masih mencari siapa otak pelaku di balik kejadian ini. Disinggung mengenai kondisi di lapangan pasca kejadian, menurut AKP Lukmin Siregar, hingga Kamis (19/1) masih terdapat sekitar 15 orang perem-

Dahlan Dan Anas ... ketahui melalui pesan singkat yang dikirim oleh seorang bernama Wila. Wila juga menyampaikan hal tersebut ketika bertemu Nazaruddin, Sutan Bhatoegana, dan Mindo Rosalina Manulang di restoran sebuah hotel di Jakarta. Wila dikenal Nazaruddin sebagai pengusaha yang lama bekerja sama dengan PLN. Dahlan mengaku tidak tahu atau mengenal Wila. Dia juga tidak mengetahui adanya aliran dana kepadanya ataupun PLN. Menurut dia, Nazaruddin didakwa melakukan korupsi dalam kaitannya sebagai kader partai politik dan anggota DPR.

Era Kejayaan Kodak ... perusahaan yang jatuh bangkrut berhak mengajukan perlindungan pailit ke pengadilan sesuai peraturan yang dikenal sebagai Chapter 11, agar tidak sampai dilikuidasi. Selanjutnya pengadilan akan menentukan apakah perusahaan yang bangkrut ini, sesuai kesepakatan dengan pihak-pihak kreditur, bisa diselamatkan melalui penjualan aset atau restrukturisasi korporat.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. a7+, Ra8. 2. Kc7+mat.

Jawaban TTS: TTS Topik

Mimbar Jumat




Jawaban Sudoku:

3 1 6 5 4 2 9 7 8

4 5 7 8 9 3 6 1 2

2 8 9 7 6 1 4 5 3

9 7 8 3 1 4 2 6 5

6 4 3 2 8 5 7 9 1

5 2 1 6 7 9 3 8 4

8 3 2 9 5 6 1 4 7

1 6 5 4 3 7 8 2 9

7 9 4 1 2 8 5 3 6

litisi untuk tidak mengorbankan demokrasi hanya demi kepentingan politik golongan tertentu. Dia juga meminta semua pihak di Aceh untuk mengedepankan pendekatan perdamaian dalam menghadapi setiap masalah. “Jaga Pilkada di Aceh supaya berlangsung aman, ‘fair’ (adil) dan demokratis,” kata Yudhoyono. ArahanYudhoyono tentang situasi di Aceh itu adalah bagian dari arahannya terkait upaya pemerintah dalam menangani tindakan kekerasan yang terjadi di tanah air.

Dia juga menyinggung tentang situasi di Papua. Menurut Yudhoyono, pemerintah tetap mengedepankan pendekatan peningkatan kesejahteraan rakyat. Pada saat yang sama, pemerintah tetap menegakkan hukum dan kedaulatan negara, tanpa harus melakukan pelanggaran HAM. Pemerintah berkomitmen untuk memanfaatkan sisa anggaran lebih untuk membangun prasarana transportasi di Papua dan daerah sekitarnya.

bawa dan masyarakat akan menjadikan hukum sebagai alat untuk mengatur. Ia menambahkan, perilaku adil tersebut perlu dicontohkan oleh para pemimpin bangsa. Ia mencontohkan, saat banjir di Jakarta pada 2008, dimana hampir seluruh Jakarta tenggelam, namun Istana tidak terkena banjir karena pintu Manggarai ditutup. Hal ini membuat kecemburuan. Namun kemudian, pemerintah membuka pintu air Manggarai sehingga Istana terkena banjir, maka masyarakat menjadi mahfum. “Jadi, selama adil, meskipun itu tidak enak, maka rakyat dapat menerima, tidak ada ramairamau,” katanya. Menurut JK, ketidakpatuhan sosial dimulai dari tragedi Tanjung Priok di mana terjadi pembunuhan beramai-ramai dan

pembakaran namun tidak ada yang dihukum dan dinyatakan bersalah.“Semenjak tragediTanjungpriok saya sudah mengatakan ini sudah mulai hukum rimba, itu mulainya pergeseran pola masyarakat,” katanya. Jadi Teladan Sejumlah tokoh nasional seperti Jusuf Kalla, Akbar Tanjung, Wiranto, Jimly Ashhiddiqie, Din Syamsudiin, dan beberapa tokoh lainnya menyerukan keteladanan sejati dari presiden dalam mengatasi berbagai permasalahan bangsa. “Pemimpin hendaknya memiliki keteladanan sejati, bukan hanyabersolek,”kataKetuaUmum PP Muhammadiyah, Din Syamsuddin, yang menyimpulkan hasildiskusiSilaturahmiTokohBangsa ke-3 bertema “Problematika Bangsa dan Solusinya” di Jakarta, Kamis(19/1). Turut hadir sejumlah tokoh seperti Ketua Konferensi Wali Gereja Indonesia Martinus Situmorang, tokoh agama Frans Magnis Suseno, serta Ketua Umum Asosiasi Pengusaha Indonesia SofyanWanandi, Ketua Dewan Perwakilan Daerah, politisi Nasdem Harry Tanoe, aktivis senior Harry Tjan, serta mantan menteri Fahmi Idris. Mantan wakil presiden Jusuf Kalla mengatakan semua permasalahan bangsa tentunya dapat diatasi dengan keteladanan. “Tidak ada masalah yang tidak bisa kita selesaikan, dasar permasalahannya hanya soal keadilan, kalau pemimpin sudah bertindak adil, maka tidak akan ada kemarahan rakyat,” kata Kalla. “Rakyat marah karena harapannya tidak tercapai, intinya bagaimana keadilan itu tercapai. Tidak harus sama-sama senang, bisa saja sama-sama susah,” katanya.

puan dan anak-anak yang menduduki areal PT Tanjung Siram. Mereka dikawal oleh delapan personil PolresTapsel dan Polsek Gunung Tua. Mengenai 88 warga yang sudah diperiksa dan tidak ditetapkan sebagai tersangka, tapi masih bertahan menginap di aula Pratidina Mapolres Tapsel, katanya akan dikembalikan ke rumah masing-masing. Jika sampai Jumat (20/1) warga masih bertahan, Kapolres Tapsel akan mengundang Bupati Padanglawas Utara, Bachrum Harahap, bertemu dan berdialog dengan warganya yang masih bertahan di Mapolres Tapsel. (a27/a35) Padahal, proyek PLN yang dimaksud itu tidak ada kaitannya dengan DPR. “Proyek itu sama sekali tidak ada hubungan sama APBN dan DPR,” katanya. Anas Bantah Terima Rp80 M Ketua Umum DPP Partai Demokrat Anas Urbaningrum juga membantah dirinya menerima “fee” sebesar Rp80 miliar dari proyek Pembangkit Listrik Tenaga Surya (PLTS) seperti yang dituduhkan terdakwa kasus suap Wisma Atlet SEA Games Muhammad Nazaruddin. “Mungkin itu (uang Rp80 miliar, red) daun jambu kali ya,” katanya menjawab wartawan sebelum berlangsungnya Natal Bersama Partai Demokrat di Kupang, Kamis (19/1)malam. “Dewan direktur dan seluruh tim senior manajemen yakin bahwa ini adalah langkah yang diperlukan dan tindakan yang benar demi masa depan Kodak,” kata Ketua Dewan Direksi dan Ketua Eksekutif Korporat Kodak, Antonio Perez. Untuk dapat bertahan, Kodak mengungkapkan telah mendapat pinjaman berjangka 18 bulan dari Citigroup sebesar US$950 juta atau sekira Rp 8,5 triliun. Perusahaan Amerika yang didirikan 130 tahun lalu itu pernah merajai industri peralatan fotografi - seperti penjualan kamera dan film. Bahkan Kodak pula yang memperkenalkan teknologi kamera digital. Namun, teknologi itulah yang lambat laun menghantam bisnis Kodak, yang selama dekade 1980an hingga 1990an sudah merasa nyaman sebagai pemain nomor satu industri fotografi. Konsumen, kini meninggalkan pemakaian film - yang menjadi bisnis inti Kodak - dan sejumlah pesaing mengembangkan produk kamera digital. Apalagi kini muncul teknologi ponsel pintar, dilengkapi dengan kamera beresolusi tinggi. Dalam beberapa tahun terakhir, pendapatan Kodak pun terus menurun tajam. Dulu mempekerjakan lebih dari 60.000 orang di mancanegara, Kodak kini hanya memiliki sekitar 7.000 pekerja. Kalangan media massa beberapa hari lalu sudah memperkirakan bahwa Kodak terancam jatuh bangkrut. Manajemen Kodak sempat menyatakan akan fokus ke industri percetakan dan produk konsumen lain. Namun, strategi itu gagal. Kini, demi bertahan hidup, Kodak berupaya mengandalkan penjualan sekira 1.100 hak paten teknologi produk fotografi. (net/rzl)

Ada-ada Saja ... Guizhou, pria bernama Wang Ai itu menggigit putrinya saat ia sedang mabuk. Balita bernama Leilei tersebut mendapat perawatan di sebuah rumah sakit di Guiyang, China, karena dua jarinya putus serta wajahnya luka karena digigit sang ayah. Saat ditangkap polisi, Wang Ai mengatakan ia tega melakukan hal itu hanya karena putrinya menangis dan mencakar wajahnya. (st/rzl)

Anggaran Pilgubsu ... Namun, setelah dievaluasi ternyata anggaran Pilgubsu 2013 yang akan dimasukkan dalam APBD 2012 tidak terlalu signifikan sebab hanya untuk kepentingan sosialisasi dan pembentukan panitia penyelenggara di tingkat kecamatan dan kelurahan dan tidak perlu masuk dalam dana cadangan. “Kita lihat urgensinya dan jumlahnya juga tidak terlalu signifikan sebenarnya jadi dapat ditampung dan sudah dimasukkan,” terang Nurdin. Mengenai besaran anggaran yang ditetapkan, Nurdin mengaku tidak ingat persis. Yang pasti anggarannya di atas Rp100 miliar. Nantinya jika masih diperlukan dapat dialokasikan kembali dalam P-APBD 2012. Selain itu anggaran akan ditampung dalam APBD 2013. “Untuk tahun ini anggarannya tidak terlalu besar sekitar Rp100 miliar lebih.Yang diusulkan sebelumnya Rp 400 miliar lebih yang dianggarkan berta-

Muslim Tionghoa ... Rudy menceritakan, dulu, masa tanam bagi masyarakat petani perlu dirayakan dan berdoa bersama sebagai rasa syukur kepada pencipta alam sambil berharap hasil panen tahun depannya akan lebih baik. Saat itu, semua keluarga yang merantau pulang kampung sambil membawa oleh-oleh untuk orang tua. Uang dalam amplop atau angpao, menjadi salah satu oleh-oleh yang dinantikan orang tua, setelah diberi, mereka akan membagikan juga untuk cucu-cucunya. ‘’ Sampai sekarang tradisi ini masih diwariskan pada masyarakat Tionghoa. Bedanya, masyarakat Tionghoa yang su-

Melihat Dari Dekat ...

Waspada/ Ibnu Kasir

KAPOLRES Langkat AKBP H Mardiyono ketika memperhatikan goni berisi ganja yang baru dipanen bersama tiga tersangkanya di Mapolres Langkat di Stabat, Kamis (19/1).

Bawa 2 Goni Ganja Dari Aceh, Tertangkap Polres Di Langkat STABAT (Waspada): Tiga dari empat orang diduga membawa dua goni ganja basah diringkus aparat Polres Langkat di kawasan Jalinsum Stabat, Kamis (19/1) pagi. Ketiganya, Am, 38 , Fah, 21 dan Ham, 33, warga Desa Kelambir Titi Payung, Kec. Hamparanperak, Deliserdang, seorang lainnya Sf, 40, warga Lhokseumawe Aceh Utara melarikan diri. Informasi dihimpun Waspada, ketiga orang tersebut diringkus aparat Satlantas Polres Langkat saat melakukan razia di kawasan Jalinsum Stabat. Ketika itu mobil Xenia warna hitam Nopol BK 1597 KY melintas dari arah Aceh menuju Medan, saat dilakukan penyetopan, mobil terus melaju. Selanjutnya dilakukan pengejaran hingga menemukan mobil tersebut mengisi bahan bakar di SPBU Perdamaian. Saat itulah mereka diamankan.Tapi satu orang melarikan diri.Sedangkan dari dalam mobil, petugas menemukan dua goni berisi ganja basah yang baru dipanen seberat 7 kg. Kapolres Langkat AKBP H. Mardiyono didampingi Kasat Reskrim AKP Aldi Subartono dan Kasat Narkoba AKP SR Tambunan mengatakan, hasil pemeriksaan sementara, ketiganya mengaku daun ganja itu baru dipanen di kawasan Aceh Utara milik Sf yang melarikan diri. (a01/a03)

Perampok Bersenpi Gasak Staf Kejatisu Di Depan Kantornya MEDAN (Waspada): Perampok bersenjata api melarikan tas salah seorang PNS staf Kejaksaan Tinggi Sumatera Utara (Kejatisu) berisi barang-barang berharga di depan kantor Kejatisu Jl. AH Nasution, Medan, Kamis (19/1). Informasi Waspada peroleh di Mapolsek Delitua, peristiwa itu terjadi sekira pukul 08:30, ketika korban E br Sembiring,54, warga Jl. Tembakau Raya,Simalingkar, baru turun dari angkot dengan membawa tas berisikan cincin berlian, sejumlah uang dan surat-surat berharga. Saat itulah korban dihampiri sang perampok memakai kemeja biru lengan panjang dan berhelm menodongkan senjata api, merampas tas korban dan malarikan diri ke arah Padangbulan. Dalam peristiwa itu, korban mengalami kerugian materi berkisar Rp 5 juta.Kasus tersebut sudah dilaporkan korban ke Mapolsek Delitua. Kapolsek Delitua, Kompol SP Sinulingga melalui Kanit Reskrim, AKP Semion Sembiring saat dikonfirmasi wartawan membenarkan adanya pengaduan korban. (m40) hap di dua mata anggaran (APBD 2012 dan 2013),” ujar mantan Kepala Inspektorat Sumut itu. Selain itu, Nurdin menjelaskan pada Februari mendatang akan ada rapat koordinasi Sekda dan Dinas Catatan Sipil kabupaten/kota untuk membahas persiapan Pilgubsu 2013 terkait dengan Daftar Penduduk Potensial Pemilih Pilkada (DP4) yang harus diserahkan pada Maret. Ketika dikonfirmasi DP4 yang diberikan akan sama pada Pilgubsu 2008, yang merupakan data kosong, Nurdin berjanji akan lebih baik dari yang sebelumnya. Ketua KPU Sumut Irham Buana Nasution ketika dikonfirmasi mengatakan pihaknya segera berkoordinasi ke Pemprov Sumut untuk menyatukan visi dalam menjalankan tahapan Pilgubsu 2013. Sebab KPU Sumut dalam rapat pleno terakhir sudah menetapkan jadwal dan tahapan yang akan dimulai September mendatang dengan pembentukan Panitia Pemilihan Kecamatan dan Petugas Pe-

mungutan Suara (PPK/PPS). Selain itu, berkoordinasi mengenai validasi data DP4 yang harus diserahkan setahun sebelum pelaksanaan pemungutan suara yang sudah ditetapkan pada 7 Maret 2013. Menurutnya, KPU Sumut tetap menyelenggarakan tahapan Pilgubsu 2013 sesuai peraturan perundang-undangan yang lama. Sebab belum ada undang-undang baru yang dibahas, apalagi disahkan di DPR. Untuk itu, katanya, tidak ada jaminan perubahan undang-undang Pilkada bisa selesai sebelum masa waktu kepala daerah di Sumut berakhir. Seperti diberitakan, tahapan Pilgubsu yang sudah ditetapkan antara lain pembentukan PPK/PPS pada 7 September 2012, pendaftaran calon perseorangan 7-12 Oktober, pendaftaran calon dari Parpol 1016 November, pemungutan suara 7 Maret 2013, dan pemungutan suara putaran kedua jika dibutuhkan 1 Mei 2013. (m28)

dah menganut agama lain seperti saya yang muslim, tidak lagi ikut aturan untuk doa-doa pada pencipta alam. Kami datang berkunjung, berbincang dengan keluarga lainnya dan bicara soal masa depan,”kata Rudy. Dia menambahkan, kepercayaan terhadap tahun yang datang, misalkan tahun ini dengan angka 2563 atau dikenal dengan Naga Air yang dipercaya membawa berkah dan keberuntungan masing-masing, sudah tidak lagi jadi kepercayaan. “Bagi umat Islam semua hari dan tahun itu baik, tidak ada klasifikasinya. Makanya, kita tidak lagi menganut pahampaham itu. Bagi kita pergantian tahun itu hanya hitungan waktu, baik buruk didalamnya tetap

berada pada ketentuan Allah SWT,”kata Rudy. Imlek dijadikan ajang saling berkunjung dan memberikan perhatian terhadap sesama yang kurang mampu, sehingga mereka dalam paguyuban memberikan bantuan sosial bagi yang kurang mampu. Hal yang sama disampaikan Syamsudin. Dia mengaku tetap menghormati keluarganya yang masih merayakan Imlek dengan sempurna. Artinya, melaksanakan serangkaian ritual kepercayaan yang masih dianut. Sedangkan dia dan keluarganya yang muslim, hanya untuk mengingat saja bahwa Imlek adalah tahun yang berganti dan saatnya keluarga berkumpul. (m37)

Al Bayan ... Atas pertimbangan itulah Rasulullah mengajaknya beriman dan mengawini putri keturunan Yahudi ini. Dengan perkawinan itu Safiyah merasa dimuliakan dan kaumnya banyak yang masuk Islam. Hari-hari bersama Nabi adalah hari-hari yang cukup indah dan bersejarah. Safiyah yang jelita itu sangat banyak mendapat perhatian dari Nabi, pernah membawanya untuk musafir yang menyebabkan Aisyah dan Hafsah cemburu. Gosip-gosip tentang Sofiyah semakin marak, para istri Nabi yang lain sering mengganggu Sofiyah dengan menyoalkan keturunannya, putri Yahudi yang dikutuk Allah dalam Alquran. Aisyah sering membanggakan ayahnya Abubakar Siddiq, Hafsah membanggakan Umar bin Khattab dan Zainab binti Jahasy membanggakan proses perkawinannya yang langsung disuruh Allah kepada Muhammad lewat wahyu. Safiyah mengadu kepada suaminya, ia tidak dapat menerima penghinaan seperti itu. Rasulullah membela Safiyah agar menjawabnya sebagai berikut: “Suamiku Muhammad, Ayahku Harun dan Pamanku Musa”. Setelah Safiyah mengembalikan kata-kata pamungkas ini, para istri Nabi yang lain tidak berani menjelek-jelekkan Safiyah. Abu Aiyub al-Anshari pernah menceritakan,

“Pada malam pertama perkawinan antara Nabi dengan Safiyah, saya berjaga-jaga semalam suntuk di pintu rumah Rasulullah. Saya takut Safiyah akan membalas dendam kepada Rasulullah, karena gara-gara Islam, ayahnya tewas. Rupanya Safiyah benar-benar mencintai Rasulullah, dan tidak terjadi apa-apa terhadap suaminya”. Saat Rasulullah menjelang wafat, Safiyah duduk di sisi beliau. Tiba-tiba Safiyah berkata; Ya Rasulullah, sekiranya apa yang kau rasakan saat ini berpindah kepada diriku, aku rela karena Allah!”. Istri-istri rasulullah yang lain saling memandang. Rasulullah bersabda.”Demi Allah ia jujur berkata begitu”. Setelah terjadi fitnah antara kaum Muslimin, Safiyah terjun ke jalan sambil memegang gamis Nabi. Ia berseru kepada kaum muslimin, “Wahai kaum muslimin, mengapa kau bersengketa? Lihatlah gamis Rasulullah masih baru! Bersatulah!” Ia juga telah berusaha membantu Usman yang terkepung, bersama Ali bin Abi Thalib, Hasan dan Husein. Kaum pemberontak tidak berani menghalangnya. Safiyyah wafat pada tahun 50 H. Beliau dimakamkan di perkuburan Baqi’ bersama sejumlah istri-istri Nabi yang lain. Kiranya Allah telah meridhainya. Dan syurgalah tempatnya di Yaumil Qiamah nanti.

110 meter, masjid itu begitu kesohor di antara empat masjid terapung di dunia: masjid di Jeddah (rumah nenek moyang Siti Hawa), di Dubai dan Masjid Tengku Tengah Zaharah, Trengganu. Keberadaan masjid seluas 1,8 hektare itu terdiri dari bangunan utamanya adalah masjid dengan menara setinggi 35 meter, tempat wudhu lakilaki dan perempuan serta tempat jajanan. Bangunannya didominasi warna krem muda. Namun interior kubahnya biru dan putih. Ukurannya sekitar 25 x 30 meter dan berdaya tampung 3.500 jamaah. Lantai satu untuk jamaah laki-laki dan di atas jamaah perempuan. Boleh dikatakan Masjid Selat Melaka merupakan masjid termewah di Melaka saat ini. Mihrabnya terbuat dari kayu hitam. Ukurannya lebih besar dibanding masjid-masjid kebanyakan. Satu kursi di tengahnya. Seluruh lantainya tertutupi ambal empuk. Lampu impor menggelantung di tengah kubah. Jika malam, masjid ini terlihat cukup megah karena dibalut lampu warna-warni. Kemudian, meskipun angin berembus kencang di dalam masjid, jamaah masih dimanjakan kipas angin. Ada 25 kipas berdiri, 20 bertengger di dinding bawah, 16 di empat pilarnya. Selebihya di teras dan lantai dua. Menara masjid yang dibangun setinggi 35 meter dilengkapi lampu merah. Kenapa dipasang lampu merah? Menara itu berfungsi sebagai tempat peringatan bagi pesawat yang melintas di kota sekaligus alat

Jangan Dengarkan ... peringkat utang, serta peran dalam hubungan internasional yang semakin diperhitungkan,’’ kata Presiden. Dia menyebut, kunci sukses bagi Indonesia adalah stabilitas politik, kerukunan sosial, kepemimpinan dan kemitraan. “Sehingga ada pepatah mengatakan, berat sama dipikul, ringan sama dijinjing,” kata Presiden. Begitupun, meski telah mencapai prestasi di beberapa bidang, Indonesia masih tetap harus bekerja keras untuk menutupi kekurangan. Beberapa kekurangan itu antara lain perbaikan infrastruktur, hambatan investasi, pemberantasan korupsi yang perlu ditingkatkan, dan penanggulangan bencana alam. Pada bagian lain, Presiden minta pihak berwenang dalam memberantas korupsi tidak terkesan menjebak dan membiar-

Nenas Buah Bergengsi ... “Ini nenas khusus untuk sembahyang, adanya saat menjelang Tahun Baru Imlek. Hari biasa, nenas ini tidak ada dan pohonnya tidak berbuah. Makanya, kalau petaninya beruntung, harga nenasnya sangat mahal. Kalau yang cukup bagus dan anaknya banyak, harganya bisa Rp 150.000. Dibelinya saat pagi hari, memang seperi itu kepercayaannya,”kata Andi yang mengaku nenas ini datang dari daerah Klumpang, Hamparanperak, Deliserdang. Ada juga dari kawasan Pancurbatu. Ia meneruskan usaha yang dirintis ayahnya. Sehingga warga Tionghoa yang akan membeli nenas untuk berbagai keperluan sembahyang langsung saja memesan padanya. Di Pasar Ramai Thamrin Medan, nenas untuk sembahyang Tahun Baru Imlek juga banyak dijual, tetapi kebanyakan yang kecil dan sifat buahnya tunggal. Harganyapun bervaria-


Jumat 20 Januari 2012

kan dalam pelaksanaan tugas. ‘’ Jangan terkesan dijebak dan dibiarkan,’’ kata Presiden, dan menambahkan saat ini ada kesan pejabat pusat dan daerah ragu-ragu dalam membuat kebijakan karena khawatir tindakan tersebut tergolong korupsi. Untuk itu, Presiden minta para penegak hukum yang mengetahui tentang delik korupsi untuk memberikan pendampingan dan konsultasi terhadap pejabat yang ragu itu. Selain itu, Presiden minta semua pihak untuk menghentikan korupsi dan kolusi di sektor pajak dan perencanaan APBD maupun APBN. Presiden juga minta segala bentuk penggelembungan anggaran di semua instansi termasuk TNI Polri untuk diberantas. ‘’Bahkan semua bentuk pungutan liar agar dihilangkan,’’ katanya dan mengajak agar kita menghentikan korupsi.

ler Masjid Selat ini. Sampai-sampai wisatanya pun meraih pengakuan UNESCO sebagai warisan dunia, adalah prakarsa Ketua Menteri Melaka YAB Datuk Seri Hj Mohd Ali Bin Mohd Rustam. Peletakan batu pertama masjid ini pada 2003. Hanya dalam tempo tiga tahun pembangunannya tuntas kemudian diresmikan Pertuan Agong XII Tuanku Syed Putra Jamalullail pada November 2006. Di negeri yang sebagian lautnya disulap menjadi daratan tidak sedikit menyumbang pendapatan daerah, masjid-masjid yang telah berusia ratusan tahun dibangun bergaya Melayu-Jawa. Masjid Kampung Hulu sebagai masjid tertua misalnya, desainnya menunjukkan ciri khas masjid-masjid di Pulau Jawa. Kubahnya tidak bulat melainkan berbentuk piramida bersusun tiga dan di puncaknya bercungkup kecil. Sementara masjidmasjid yang dibangun belakangan sudah memadukan gaya Arab-Melayu. Selain untuk ibadah, rancangan masjid baru itu semuauntukmenggaetwisatawan. Termasuk penulis yang sangat penasaran merasakan suasana Masjid Selat Melaka. Dari kejauhan Selat Melaka apabila kita berwisata laut dengan menggunakan ductour, mobil dua fungsi darat dan laut peninggalan Portugis, mengantarkan kita melihat anggunnya bangunan masjid bergaya Arab-Melayu yang sengaja dibangun berasimetris di garis pantai. Karena berhalaman luas yang juga timbunan laut menjadi daratan, bangunannya sangat menonjol mengarah ke laut lepas. Aturan ketat Meski terbuka untuk umum, petugas masjid memberlakukan aturan ketat, terutama bagi pelancong perempuan. Bila auratnya terbuka, mereka dilarang masuk masjid. Batas kunjungannya hanya sampai di halaman luar masjid. Jangankan warga asing, muslimah yang berpakaian tidak sopan juga dilarang masuk masjid. “Pengunjung muslimah kalau tidak pakai tudung dilarang masuk,” kata Zainul, petugas masjid. Meski demikian pelancong perempuan yang pakai kasual dan T-shirt diarahkan ke ruang ganti pakaian. Pihak masjid memberikan tudung yang sudah dipersiapkan untuk pelancong lokal dan turis. Itulah Melaka, meski masjid menjadi objek wisata, adab masuk masjid tidak bisa ditawar-tawar. Kini, Melaka menjadikan imbauan agama agar muslim shalat berjamaah dan memakmurkan masjid menjadi ajakan ampuh menggaet turis. *Muhammad Thariq

si, ada yang Rp 5.000, ada juga seharga Rp 25.000.Nenas-nenas itu dikemas dalam satu wadah atau mangkuk cantik. Banyak juga nenas kecil dengan tekstur buah liris merah dan daunnya liris putih sedikit merah. Lily, warga Tionghoa yang sedang membeli nenas mengaku jika nenas-nenas ini memang sangat diperlukan untuk sembahyang. Kata Lily, nenas lain yang digunakan saat Imlek termasuk nenas kertas, harganya antara Rp 80.000 sampai Rp 250.000 perbuah. Tergantung Kepercayaan Ketua Paguyuban Sosial Marga Tionghoa Indonesia, Halim Loe,SE menyebutkan, nenas dalam bahasa Tionghoa disebut Onglay, artinya raja-raja yang datang. Kehadiran nenas sebagai salah satu buah yang dipilih untuk sembahyang, karena dianggap ada raja yang datang. “Ini tradisi dan kepercayaan, karena itu beragam jenis dan tekstur nenas yang dipilih untuk sembahyang, tergantung pada

kepercayaan. Kalau model nenas yang banyak pengikutnya, atau banyak anak-anak di sekelilingnya paling banyak dipilih,’’ kata Loe. Kata Loe, nenas itu hanya ada saat menjelang masa Tahun Baru Imlek, entah apa yang membuat hal itu bisa terjadi. ‘’ Tapi tetap saja hal ini sebagai suatu kepercayaan dan perlambang bahwa pergantian tahun itu selalu menjadi sebuah harapan yang baru bagi manusia. Imlek atau pergantian tahun tentu menjadi sebuah harapan baru untuk jadi yang lebih baik dan lebih beruntung,”kata Loe. Paling tidak, menurut Loe, sang petani nenas. “ Tetapi, ada juga nenas kertas untuk dibakar. Saat saya masih kecil, tradisi bakar nenas kertas ini berlangsung dalam keluarga kami, sekarang tidak lagi. Bukan berarti kami tidak percaya, tapi begitulah tradisi,”kata Loe di Sekretarian PSMTI Kota Medan Jl. Muchtar Basri Medan, kemarin. (m37)

pengingat shalat bagi nelayannelayan yang sedang menangkap ikan. Menurut Suhaimi, pemandu ducktour, Masjid Selat tidak pernah sepi dari pelancong lokal dan asing. “Setiap hari seribu pelancong datang untuk shalat dan berwisata,” katanya kepada Waspada, Minggu (15/1). Pengunjung tertarik dengan keindahan desain eksterior dan interiornya yang lebih modern dan fasilitasnya juga lengkap. Begitu juga hembusan angin laut begitu terasa mengibas-ngibas siapa saja yang shalat dan berwisata ke masjid tersebut. Deburan ombak dan panorama laut memperteguh kekusyukan ibadah karena kita berdiri di tengah indah dan luasnya laut kekusaan Ilahi, yang tak berujung dipandang mata. Selepas shalat kita pun dapat bergegas menjorok ke palataran luar masjid untuk menikmati taman, pemandangan laut lepas yang biru dan pulaupulau kecil yang bertengger di sana. Dua pintu megah terbuka menghadap arah laut lepas, baik arah Utara dan Selatan. Gedung-gedung menjulang dan jalan layang dibangun di atas permukaan laut pasti tidak luput dari rekaman mata. Spontan syaraf kepala pun mengendur. Warisan dunia Masjid ini membuktikan kepada dunia bahwa Melaka tidak pernah kehabisan objek wisata. Bagaimana tidak, Melaka satu dari tiga negeri bagian yang tidak memiliki sultan mampu ‘menyulap’ sungai, laut sampai bangunan-bangunan tua peninggalan penjajahnya menjadi objek wisata termasuk yang popu-

Luar Negeri

WASPADA Jumat 20 Januari 2012

Iran: Mudah Untuk Lakukan Serangan Ke Kapal Induk AS TEHERAN, Iran (Waspada): Pejabat militer Iran menegaskan, “mudah bagi Angkatan Laut kami” untuk menghadapi konfrontasi di Teluk Persia dengan Amerika Serikat dan mengklaim, persenjataan Iran sangatlah canggih. Laksamana Farhad Amiri mengatakan, Iran memiliki kapal selam dieselnya yang sangat canggih dan sanggup melakukan serangan dari dasar laut. Amiri menjelaskan, kapal selam Iran tidak hanya kuat dalam segi persenjataan.

“Sebagai contohnya, bila sebuah kapal selam muncul di Teluk Persia, hal itu akan menjadi ancaman terburuk bagi musuh. Itulahyangmenjadikekhawatiran bagi AS. Kapal selam Iran memiliki suara mesin yang halus dan sangat sulit untuk terdeteksi di

radar karena memiliki teknologi yang canggih. Kapal selam kami juga sanggup menembakkan torpedo,” ujar Amiri, seperti dikutip FNA, Kamis (19/1). “Ketika kapal selam kami berada di dasar laut, kami dapat membidik kapal induk yang ada di wilayahTeluk Persia,” tambahnya. Pada awal Januari ini, Komandan Militer Iran Mayjend Ataollah Salehi mendesak AS agar tidak mengirimkan armada tempurnya ke Teluk Persia setelah Iran selesai menggelar latihan militer. Iran juga merencanakan

Ledakan Bom Mobil Di Pangkalan Militer AS Dan NATO, 7 Tewas KANDAHAR, Afghanistan (AP): Seorang penyerang bunuhdiri meledakkan satu kendaraan bermuatan peledak di luar satu gerbang pangkalan operasi Amerika Serikat dan NATO Kamis (19/1), yang menewaskan tujuh warga sipil. Serangan itu merupakan bom bunuhdiri kedua dalam beberapa hari terakhir ini di selatan Afghanistan, kata beberapa pejabat. Di bagian lainnya, pihak berwenang Afghanistan melaporkan Kamisbahwalongsortelahmenewaskan29orangdikawasanpegunungan sebelah timurlaut negeri

itu.Taliban menyatakan bertanggungjawab atas serangan yang terjadi setelah Kamis tengah hari itudigerbangkePangkalanUdara Militer Kandahar yang menyatakan mereka bermaksud untuk meledakkan satu iring-iringan kendaraan NATO. Dua saksimata mengatakan kepada The Associated Press bahwa mereka memperkirakan mobil bom bunuhdiri itu berusaha untuk mengenai pasukan AS karena dia meledakkan bahan peledaknya pada saat dua truk pick up melintas, yang mereka katakan selalu digunakan pasu-

Myanmar Lakukan Perundingan Gencatan Senjata Dengan Kachin YANGON, Myanmar (AP): Pemerintah Myanmar dan pemberontak suku Kachin bertemu Kamis (19/1) untuk merundingkan gencatan senjata guna mengakhiri konflik bersenjata beberapa bulan dekat perbatasan sebelah utara dengan China, namun pertemuan awal tidak menemukan terobosan besar. Setelah dua hari perundingan, satu tim tingkat tinggi pemerintah Myanmar dan para anggota Organisasi Kachin Merdeka telah menyepakati untuk melanjutkan perundingan kemudian dan sementara menunggu jadwal perundingan masing-masing pihak memberikan informasikepihaklainsebelumpengerahanpasukanpemerintah,demikian menurut seorang pejabat resmi yang ikut dalam perundingan tersebut. Perundingan itu merupakan usaha terakhir oleh pemerintah sipil baru Myanmar untuk mengakhiri konflik etnis yang cukup lama di negeri itu. Menghentikan bentrokan etnis merupakan tuntutan penting para pemerintah Barat yang menjadi syarat bagi pencabutan sanksi yang dikenakan terhadap negara tersebut selama dikuasai junta.Pekanlalu,pemerintahjugatelahmenandatanganisatugencatan senjata dengan pemberontak Karen di timur Myanmar, dalam satu langkah besar menuju diakhirinya salah satu pemberontakan bersenjata terlama di dunia. Perundingan lain dilaporkan berlangsung dengan kelompok etnis Shan, Karenni dan Chin. Salah seorang mediator terkemuka Kachin, Pendeta Saboi Jum, mengatakankepadaTheAssociatedPressbahwaperundinganitudiadakan di lintas perbatasan di Ruili di provinsi Yunnan, China. (m10)

Turki Bertekad Perkuat Hubungan Ekonomi Dengan Iran ANKARA, Turki (Antara/ Xinhua-OANA): Kementerian lingkunganhidupTurkimenyatakan negaranya bertekad untuk memperkuat hubungan ekonomi dan perdagangan dengan Iran dan negara-negara kawasan lainnya,katakantorberitasemi-resmi Anatolia pada Rabu (18/1). Pernyataan kementerian tersebut dikeluarkan setelah pertemuan tertutup antara Menteri LingkunganHidupdanUrbanisasi Turki Erdogan Bayraktar dan tamunya Menteri Luar Negeri Iran Ali Akbar Salehi Rabu petang. Turki dan Iran berencana untuk bersama-sama mendirikan petajalan baru dalam berbagai bidang dengan fokus khusus pada hubungan ekonomi dan perdagangan, kata kementerian lingkungan. Kementerianmenambahkan bahwaperdaganganantarakedua negara mencapai AS$10,7 miliar padatahun2010danAS$14,9miliar dalampertama11bulantahun2011. Sebelumnya Rabu sore, PMTurki RecepTayyipErdoganjugamengadakanpembicaraandenganmenteri luar negeri Iran.

Thailand Angkat Musuh AS Sebagai Menteri BANGKOK, Thailand (Waspada): PM Thailand Yinguck Shinawatra tetap mengangkat sebagai menteri seorang yang dimasukkan Amerika Serikat ke dalam daftar hitamnya. NalineeTaveesin menduduki salah satu kursi menteri, meski asetnya sudah dibekukan oleh Paman Sam. Nalinee diduga merupakan seseorang yang memberikan dukungan finansial dan logistik ke mantan Presiden Zimbabwe Robert Mugabe. Menurut Kementerian Keuangan AS, Nalinee adalah seorang yangsempatmelakukanbeberapa transaksipembelianrealestatedan berlian dengan istri Mugabe. NamunYingluck menegaskan, pengangkatanNalineesebagaimenteri adalah tindakan berdasarkan konstitusi. “Sangatironis,NalineeTaveesin adalahorangyangsempatberpartisipasidalamserangkaiantindakan korupsi.Dirinyabahkanmendukung rezimkorupdiAfrika,”ujarKementerianKeuanganAS,sepertidikutip AFP, Kamis (19/1).(ok)

kan khusus Amerika, yang meninggalkan pangkalan tersebut. Koalisi mengatakan tidak ada pasukan NATO yang tewas dalam serangan itu. Tidak ada informasi tentangpasukanasingyangcedera akibat serangan tersebut. JurubicaraTalibanQariYousef mengatakanbahwapasukanNATO melepaskan tembakan setelah ledakan bom tersebut dan bahwa merekahanyamembunuhtigadari tujuh warga sipil yang tewas itu. Koalisi membantah pernyataan itu, dengan mengatakan tidak ada pertempuran setelah ledakan tersebut. “Tidak ada serangan menyusul ledakan dan tidak ada gangguan terhadap rencana operasi di pangkalan itu,” kata koalisi. Sehari sebelumnya, serangan bom bunuhdiri menewaskan tujuh polisi dan dua warga sipil di provinsi Helmand, Afghanistan Selatan, Rabu, kata seorang pejabat. “Enam warga sipil dan dua polisi juga cedera” dalam pengeboman oleh penyerang bersepeda motor itu, yang sasarannya sebuahkendaraanpolisidika-wasan pasardidistrikKajakipadasorehari, kataDaudAhmadi,jurubicaragubernur provinsi tersebut. Dalam serangan kedua di provinsi itu dua jam kemudian, seorang pejabat intelijen, dua pengawaldanseorangwargasipiltewas akibatledakanranjau,tambahnya. “Deputi kepala NDS (Direktorat Keamanan Nasional) distrik Nad Ali,duapengawalnyadanseorang warga sipil tewas hari ini ketika sebuahranjaukendalidarijarakjauh yangdipasangolehmusuhmeledak di distrik Nad Ali,” katanya. Taliban mengklaim bertanggung jawab atas serangan kedua, namun serangan pertama juga memiliki ciri-ciri kelompok garis keras itu.(m10)

latihan militer yang cukup besar di dekat Selat Hormuz pada Februari mendatang. Sementara itu, dutabesar Iran untuk PBB Mohammad Khazaee mengatakan, penutupan Selat Hormuz yang merupakan jalur pasokan migas dunia hanyalah sebuah pilihan bila keamanan Iran terancam. “Tidak ada keputusan untuk memblokir SelatHormuz,kecualibilakeamanan nasional Iran benar-benar terancam,” ujar Khazaee, seperti dikutip Bloomberg, Kamis. “Kami yakin, Selat Hormuz harus menjadi perairan bebas berlayar dan selalu aman. Namun, bila negara-negara asing mencoba untuk menggangguTeluk Persia, tentu saja kami berhak mempertahankan kedaulatan kami,” tambahnya. Khazaee mengatakan, saat ini Iran masih melakukan proses pengayaan uranium dan menempatkan fasilitas nuklirnya di bawah tanah. Hal ini disebabkan karenaadanyaancamanserangan dari AS dan juga Israel. “Hal ini tidak menunjukkan bahwa kami

melakukan sesuatu yang ilegal. Kami tidak pernah dan tidak akan pernah membangun persenjataan lewat program nuklir,” imbuhnya. Selamatkan lagi nelayan Angkatan Laut AS mengumumkan, pihaknya telah memimpin operasi penyelamatan untuk membantu nelayan Iran yang tengah berada di Teluk Oman. Operasi penyelamatan itumerupakanyangketigakalinya ditengah meningkatnya ketegangan hubungan antaraWashington dan Teheran. Menurut AS, sebelumnya sebuah helikopter jenis Seahawk dari kapal induk USS Dewey yang tengah berpatroli menyaksikan sebuah perahu milik nelayan Iran tenggelam di kawasan Teluk Oman.Dalaminsidenituseorang nelayan Iran terlihat tengah terombang ambing di lautan, sementara beberapa nelayan lain berusaha menolongnya. Setelah berkoordinasi dengan kapten kapal, maka tim penyelamat pun diturunkan.(ok)

Pakistan Tolak Utusan AS ISLAMABAD, Pakistan (CNN): Pemerintah Pakistan menolak kunjungan seorang utusan AS, kata pejabat senior Pakistan kepada CNN. Tidak jelas apakah Utusan Khusus AS Marc Grossman telah menjadwalkan kunjungan sebelumnya atau apakah dia sedang merencanakannya, tapi biar apapun, Pakistan memintanya untuk tidak datang saat ini. “Kunjungannya bisa membakar sikap antiAmerika dan menimbulkan masalah dengan pemerintah, yang telah dikelilingi badai,” kata pejabat itu Rabu (18/1). Jubir Deplu AS Mark Toner minggu ini membenarkan bahwa Grossman ingin pergi ke Pakistan, namun pemerintah Pakistan menolakuntuksementarawaktu.PresidendanPMPakistanbertemu dengan para pemimpin militer dalam pertemuan terpisah akhir minggu ini untuk usaha mencairkan ketegangan. Militer dan pemerintah terkurung dalam pertikian setelah terungkap usaha diam-diam pemerintah tahun lalu untuk menangkal kemungkinan kudeta militer dengan membatasi kekuasaan angkatan bersenjata lewat bantuan Washington. Pemerintah membantah tuduhan itu, namun MA menyelidiki skandal itu dan temuannya bisa mengancam Presiden Asif Ali Zardari dan partai berkuasanya.(m23)


5 Sarjana Pengangguran Maroko Bakar Diri Protes Di Rabat RABAT, Maroko (AP): Lima pria pengangguran Maroko membakar diri mereka di ibukota Rabat sebagai bagian dari unjukrasa luas di negeri tersebut sehubungan dengan kurangnya lapangan kerja, terutama bagi para lulusan perguruan tinggi, demikian menurut aktivis pembela hak azasi manusia Kamis (19/1). Tiga orang mengalami luka bakar cukup parah dan dirawat di rumah sakit. Bakardiritelahmenjadisenjatadantaktikmemprotes di Timur Tengah dan Afrika Utara selama tahun lalu. Desember 2010, seorang penjual sayur diTunisia membakar diri untuk memprotes penganiayaan oleh polisi. Aksi bakar dirinya menjadi pemicu pergolakan yangmenggulingkanpemerintahdanmenimbulkan gerakan yang serupa di berbagai negara di kawasan itu. Warga Maroko itu merupakan bagian dari gera-

kan‘sarjana pengangguran,’ satu kelompok persatuan di seluruh negeri tersebut yang menjadi wadah jutaan sarjana pengangguran yang menuntut pekerjaan. Unjukrasa itu selalu dibubarkan polisi dengan kasar dan di beberapa kota telah menimbulkan perlawanan dan bentrokan panjang. Sekitar 160 anggota gerakan itu menduduki satugedungKementerianPendidikanTinggiselama dua pekan di Rabat, sebagai bagian protes mereka. Para pendukung akan membawakan mereka makanansampaiduaharilaluketikapasukankeamanan menghentikan mereka. Pihak berwajib mencegah mereka menerima makanan dan air, sehingga lima orang itu pergi keluar untuk mendapatkan makanan dan mereka mengancam akan membakar diri jika mereka dihentikan,” kataYoussef al-Rissouni dari Asosiasi HAM Maroko. (m10)

Para Aktivis: Pasukan Syria Ditarik Mundur Dari Zabadani BEIRUT, Lebanon (AP): Para aktivis dan saksimata mengatakan pasukan Syria telah ditarik mundur dari satu kota wisata di pegunungan dekat ibukota Damaskus yang telah jatuh ke tangan kelompok oposisi. Kota terkepung Zabadani telah menghadapi gempuran dan telah menjadi saksi terjadinya pertempuran sengit antara pasukan tentara dan para pembelot militer selama enam hari lalu. Aktivis Fares Mohammad mengatakan tank tentara Syria dan kendaraan lapis baja yang telah mengepung Zabadani telah ditarik Rabu malam ke satu asrama militer kira-kira 7 km jaraknya. ParapendudukmembenarkanKamis(19/1)bahwa penembakan telah mereda sejak Rabu tengah hari dan pengepungan juga dikurangi meski pos pemeriksaan masih tetap ada. Tidak ada komentar dariparapejabatSyriatentangpertempurandiZabadani,yangberadadekatperbatasandenganLebanon.

Sementara itu, Rusia, China dan Iran menjadi pihak yang akan menolak intervensi asing terhadap Syria. Rusia bahkan bersumpah akan menghadang setiap intervensi militer yang ditujukan ke Syria. Pejabat Militer Iran Brigjend. Qasem Soleimani mengatakan,diatidakakanmembiarkanrezimPresiden Bashar al Assad runtuh. Menteri Luar Negeri Rusia SergeiLavrovjugamenegaskan,negaranyasiapmemveto segala bentuk resolusi Dewan Keamanan PBB yang memberikan mandat Barat untuk menyerbu Syria.“Negara-negaraBarattidakakanmendapatkan wewenangDKPBBuntukmelakukanserangan,”ujar Lavrov, seperti dikutip The Associated Press, Kamis. Seninlalu,RusiamengajukanrancanganResolusi DKPBByangbertujuanuntukmenghindaripenggunaan kekuatan militer terhadap Syria. Namun, para diplomat Barat mengatakan, draf itu tidak mengecam aksi Presiden Assad yang melakukan pembungkaman terhadap demonstran. (m10)

Pasokan Dari India Ke Kashmir Terhenti, Salju Tutupi Jalanan SRINAGAR, India (AP): Para pejabat mengatakan pasokan makanan dan bahan bakar ke lembah Kashmir telah terhenti setelah salju tebal menutupi satu-satunyajalankebagianIndiayangdipertikaikan di daerah Himalaya. PetugaslalulintasHemantKumarLohiamengatakan hampir 2.000 kendaraan yang membawa bahan bakar, minyak lampu, bensin dan pasokan makanan telah terhenti di jalan sepanjang 300 km itu. Pihak berwenang terpaksa membagikan jatah gasuntukmasakuntukmembantumengatasikeku-

rangan bahan bakar. Jalanraya yang rawan longsor itu telah ditutup selama beberapa hari, tetapi dibuka pada suasana cuaca membaik Rabu (18/1) untuk memungkinkan sekitar 300 truk melaluinya ke Srinagar, kota utama di Kashmir yang dikuasai India. Biasanya ribuan truk melakukan pengiriman pasokan bahan kebutuhan itu setiap hari. Musim dingin yang mengganggu di kawasan itu, ketika temperatur jatuh ke tingkat minus 19 derajat Celsius. (m10)


Pentas Demokrasi Aceh

WASPADA Jumat 20 Januari 2012

Calon Independen Belum Boleh Ikut KOTA LANGSA ( Waspada): Meski keputusan Mahkamah Konstitusi (MK) nomor 35/PUU-VIII/2010 membolehkan calon independen mengikuti Pemilihan Umum Kepala Daerah (Pemilukada) di Aceh, di mata ahli hukum Universitas Samudra Langsa (Unsam) Syahrul Atan, keputusan tersebut belum bisa dilaksanakan.

KIP Aceh Utara Siap

Waspada/Muhammad Hanafiah

KETUA KIP Aceh Abdul Salam Poroh bersama Bupati Aceh Tamiang H. Abdul Latief, Wabup Aceh Tamiang H. Awaluddin dan unsur Muspida Plus setempat serta berbagai komponen lainnya menabuh gendang rebana pada acara launching Pemilukada Bupati/Wakil Bupati Aceh Tamiang yang berlangsung di Tribun Utama Bekas Arena MTQ XXX Aceh, Selasa (17/1).

Gendang Pemilukada Aceh Tamiang Mulai Ditabuh KUALASIMPANG (Waspada): Gendang Pemilihan Umum Kepala Daerah (Pemilukada) bupati dan wakil bupati Aceh Tamiang yang dijadwalkan akan berlangsung 9 Juni 2012 mulai ditabuh di Kabupaten Aceh Tamiang. Penabuhan gendang Pemilukada tersebut mewarnai acara Launching Pemilukada Bupati Aceh Tamiang/Wakil Bupati Aceh Tamiang di Tribun Utama bekas arena MTQ XXX Aceh yang berlokasi di belakang kantor bupati setempat, Selasa (17/1) Ketua Komisi Independen Pemilihan ( KIP) Provinsi Aceh Abdul Salam Poroh pada acara launching tersebut menyatakan suara gendang yang telah ditabuh dalam rangka menyambut rencana pelaksanaan Pemilukada Bupati/Wakil Bupati Aceh Tamiang yang telah dijadwalkan akan berlangsung 9 Juni 2012 harus terus menerus ditabuh dan jangan berhenti ditabuh. Ketua KIP Provinsi Aceh itu juga menyatakan begitu juga suara gendang (gong) yang telah ditabuh pihaknya dalam rangka menghadapi Pemilukada Gubernur Aceh/Wakil Gubernur Aceh dan bersama 17 kabupaten/kota lainnya yang dilaksanakan serentak di Provinsi Aceh supaya terus menerus ditabuh. “Kami sudah berulangkali menabuh gong untuk pelaksanaan Pemilukada Gubernur/ Wakil Gubernur Aceh bersama 17 kabupaten/kota lainnya yang dilaksanakan serentak di Aceh, terakhir telah kami tabuh gong

untuk pelaksanaannya serentak untuk Pemilukada Gubernur/ Wagub Aceh bersama 17 kab/ kota lainnya yang akan dilaksanakan pada 16 Februari 2012 dan jadwal ini kita harapkan jangan berubah lagi,sebab sudah tiga kali ditunda pelaksanaannya, makanya suara gong Pemilukada tersebut harus terus menerus kita tabuh dan jangan berhenti,” ungkap Salam. Akibat adanya penundaan Pemilukada gubernur/Wagub Aceh bersama 17 kab/kota lainnya, terang Salam, spanduk ataupun baliho yang sudah dipasang pihaknya di berbagai lokasi yang strategis di Aceh terpaksa diturunkan lagi karena adanya perubahan jadwal. Menurut Ketua KIP Aceh itu, pihaknya sudah sangat bertoleransi memberikan kesempatan bagi pihak-pihak yang belum mendaftarkan diri sebagai pasangan calon gubernur/ wagub Aceh bersama 17 kab/ kota lainnya. “Soal tunda menunda Pelaksanaan Pemilukada di Aceh ,kami sudah sangat toleransi memberikan kesempatan kepada saudara-saudara kita yang belum mendaftarkan diri,” katanya. Sedangkan untuk Pemilukada Bupati/Wakil Bupati Aceh Tamiang yang direncanakan 9 Juni 2012 kita berharap tidak akan ada penundaan dan gendangnya harus terus menerus ditabuh karena Pemkab Aceh Tamiang, DPRK Aceh Tamiang dan masyarakat Aceh Tamiang s er t a K I P A ce h Tam i a ng

menyatakan siap untuk pelaksanaan Pemilukada di daerah ini dan anggarannya juga disediakan Pemkab Aceh Tamiang. Karena itu Salam meminta masyarakat Aceh Tamiang dan berbagai komponen lainnya di Aceh Tamiang agar mensukseskan pelaksanaan Pemilukada di Aceh Tamiang. Sebelumnya Bupati Aceh Tamiang H. Abdul Latief pada acara launching yang diselenggarakan KIP Kabupaten Aceh Tamiang itu mengharapkan kepada pasangan calon bupati/ wabup Aceh Tamiang yang akan mencalonkan diri supaya tidak melakukan kampanye hitam atau menjelek-jelekan sesama pasangan calon. “Wujudkan Pemilukada Bupati/Wakil Bupati Aceh Tamiang yang damai dan berkualitas guna melahirkan pemimpin yang mampu membawa Aceh Tamiang ke depan menjadi lebih baik,” tegas Latief. Acara launching tersebut dihadiri Bupati Aceh Tamiang H. Abdul Latief, Wabup Aceh Tamiang, H. Awaluddin, Ketua DPRK setempat, Rusman, tokoh masyarakat, Ketua Parpol, Unsur Muspida Plus Aceh Tamiang dan undangan lainnya. Acara launching itu juga ditandai penarikan kain selubung Pemilukada Aceh Tamiang dan penabuhan gendang rebana oleh Ketua KIP Aceh Abdul Salam Poroh, Ketua KIP Aceh Tamiang Izuddin, Bupati Aceh Tamiang, Wabup Aceh Tamiang dan unsur Muspida Plus. (b23)

Keputusan MK Bagian Konsolidasi Perdamaian BANDA ACEH (Waspada): Keputusan sela MK membuka kembali pendaftaran calon dinilai bukan gerakan tunda Pemilukada, melainkan gerakan penyelamatan perdamaian dan demokrasi di Aceh. “Pilkada tahun 2012 adalah bagian yang tak terpisahkan dari Pilkada tahun 2006, yang merupakan bagian dari resolusi konflik, tegasWakil Ketua komisi III DPR RI M Nasir Djamil, S.Ag melalui BlackBerry Messenger (BBM), Selasa (17/1). Karenanya, kata Anggota dewan pemilihan Aceh ini, keputusan MK menjadi bagian untuk mengkonsolidasi perdamaian yang bertujuan untuk mewujudkan Aceh yang aman dan sejahtera dalam bingkai Negara Kesatuan Republik Indonesia. Karenanya partai lokal (Parlok) dan partai nasional (Parnas) yang belum mendaftar diharapkan segera memanfaatkan

kesempatan ini. Adapun persoalan regulasi atau payung hukum Pilkada Aceh bisa menyusul untuk dibahas setelah adanya keputusan MK yang final. Sekretaris DPW PAN Aceh Tarmidinsyah Abubakar, SE memberi apresiasi atas dibukanya kembali pendaftaran calon Kepala Daerah (KDH) oleh Mahkamah Konstitusi (MK). Bila keinginan semua pihak terakomodir, Edo panggilan akrab pria ini yakin pelaksanaan Pilkada di Aceh akan berjalan aman, tertib dan lancar. “Bila sudah terakomodir, masih tetap ada intimidasi, siapa pun dia harus ditindak tegas,” katanya kepada Waspada, kemarin. Ditanya kemungkinan PAN Aceh berkoalisi dengan partai lain untuk ikut mendaftarkan calon Gubernur/Wakil Gubernur, Tarmidinsyah tidak menafikan keinginan itu. “Bisa saja

PAN berkoalisi dengan Partai Golkar atau bisa juga dengan Partai Aceh,” katanya. Untuk kepastiannya, kata dia, harus dilihat dinamika perkembangan dalam beberapa hari ke depan. Sementara itu, Aminullah Usman, SE Ak, MM, salah seorang calon wali kota Banda Aceh bisa menerima keputusan sela MK yang membuka kembali mendaftaran calon. Hanya saja, kata dia, jadwal Pilkada ke depan harus lebih pasti. “Kita harap ini perubahan jadwal Pilkada yang terakhir,” ujar mantan Dirut PT BPD Aceh itu. Perubahan jadwal Pilkada, kata dia, akan membebani jumlah pengeluaran. “Costnya sudah pasti membengkak. Tapi, untuk berjalannya demokrasi dalam Pilkada di Aceh, harus kita dukung,” kata Aminullah Usman yang maju berpasangan dengan Tgk H Muhibban HM Hajjat. (b01/b05)

KIP Diminta Tutup Celah Gugatan BANDA ACEH (Waspada): Keputusan sela MK yang memerintahkan KIP Aceh untuk membuka kembali pendaftaran bagi para calon kepala daerah di seluruh Aceh, ternyata tidak hanya disambut baik oleh Partai Aceh (PA) dan para kandidat yang belum sempat mendaftar, tetapi juga dari kalangan masyarakat. Sebagaimana disampaikan Ketua Umum Pengurus Besar Rabithah Muta’allimin Pidie SeAceh (PB-RAMPI), pihaknya menyambut baik keputusan sela MK dalam menyikapi polemik Pilkada Aceh tersebut. “Semoga keputusan ini bisa dimanfaatkan untuk mendaftar bagi yang belum mendaftar atau mendukung calon lain yang mendaftar, sehingga proses demokrasi berjalan dengan baik,” kata Tgk. Mukhtar Syafari, S.Sos.I, kepada Waspada, Rabu (18/1). PB-RAMPI menilai diterimanya gugatan pihak penggu-

gat tentang tahapan pelaksanaan Pilkada di Aceh mengindikasikan ada yang tidak beres terhadap landasan hukum yang digunakan KIP Aceh, sehingga sangat rentan diterimanya gugatan oleh MK. “Karena itu, kami atas nama masyarakat Aceh meminta kepada KIP Aceh agar melaksanakan Pilkada sesuai dengan UUPA. Kalau memang UUPA mengamanahkan Pilkada sesuai qanun, maka mestinya KIP berpedoman secara utuh kepada qanun tersebut, agar tidak terjadi multi tafsir,” sebut Tgk. Mukhtar. Terkait itu pula, PB-RAMPI mengharapkan kepada DPRA agar segera mengesahkan Qanun Pilkada Aceh yang relevan, dengan mengakomodir calon perseorangan. Kalau bisa, qanun ini segera disahkan sebelum berakhirnya masa jabatan Gubernur Aceh sekarang untuk menghindari adanya indikasi penolakan terhadap calon

perseorangan pada saat Pj. Gubernur nanti. “Pengesahan qanun baru juga untuk menjadi solusi bagi pemerintah yang menolak menganggarkan dana pilkada, seperti yang terjadi di Kabupaten Pidie, karena alasan belum adanya landasan hukum (qanun),” katanya. Selanjutnya, sebut Tgk. Mukhtar, ke depan KIP Aceh diminta agar menutup rapat adanya peluang diterimanya gugatan-gugatan oleh MK, yang berakibatkan kepada bergesergeser jadwal atau pembatalan hasil Pilkada Aceh yang dapat berakibat kerugian bagi calon dan anggaran. “Kami juga meminta kepada semua kontestan Pilkada Aceh agar berkompetisi dengan cara-cara santun dengan mengedepankan percerdasan politik dan menghindari timbulnya konflik bagi rakyat Aceh,” demikian Tgk. Mukhtar Syafari. (b04)

LHOKSUKON (Waspada): Terkait putusan sela Mahkamah Konstitusi yang memperpanjang masa pendaftaran calon peserta Pemilukada Aceh 2012, KIP Aceh Utara menyatakan siap melaksanakan putusan itu, dengan membuka kembali masa pendaftaran untuk ketiga kalinya alias pendaftaran jilid III. “Pada prinsipnya kami siap membuka pendaftaran sesuai putusan sela MK. Tapi mekanisme detilnya belum jelas,” kata Ketua KIP Aceh Utara, Muhammad Manan kemarin. Manan menambahkan, sejauh ini tahapan Pemilukada yang dijalankan pihaknya sudah selesai tahap tender cetak kertas suara dan tinggal menunggu pengumuman pemenang tender. (b19)

Pasalnya sesuai dengan azas lex posteriori derogat lex priori (peraturan hukum yang baru mencabut yang lama) jelas calon independen tersebut belum boleh mengikuti Pemilukada Aceh karena belum ada undang-undang yang baru mengatur masalah tersebut. Hal tersebut disampaikan Syahrul Atan, saat menjadi pembanding pada acara seminar bulanan yang dilaksanakan di Fakultas Hukum Unsam yang bertemakan Kajian yuridis calon independen dalam pemilihan kepala daerah di Aceh perspektif hukum tatanegara, yang disampaikan Fuadi, SH, MH, kemarin. Syahrul mencontohkan soal perubahan Undang-undang (UU) nomor 32 tahun 2004 ten-

tang pemerintah daerah yang diubah menjadi UU no 12 tahun 2008, atas dasar keputusan MK nomor 5/PUU-V/2007 yang dimintakan Lalu Ranggalawe anggota Dewan Perwakilan Rakyat Daerah (DPRD) Kabupaten Lombok Tengah. “Seharusnya ketika MK menyatakan pasal 256 UU no 11 tahun 2006 tentang Pemerintahan Aceh( UUPA) tidak memiliki kekuatan hukum yang mengikat, pemerintah Indonesia segera membuat undang-undang yang baru sebagai payung hukum pelaksanaan keputusan Mahkamah Konstitusi (MK) nomor 35/PUU-VIII/2010 tersebut,” ujarnya. Namun sampai saat ini menurutnya, payung hukum

pelaksanaan Pemilukada Aceh masih mengunakan UU nomor 12 tahun 2008, sehingga otomatis demi hukum pasal 256 UU PA secara yuridis masih berlaku. Dia menambahkan, dalam amar kuputusan MK nomor 35/PUU-VIII/2010 bukan mencabut pasal 256, tetapi menyatakan pasal tersebut tidak memiliki kekuatan hukum yang mengikat lagi, sehingga jelas bukan mencabut. Dia mengharapkan pemerintah segera membuat Undang-undang yang baru penganti UU nomor 11 tahun 2006 yang tidak mencantumkan lagi pasal 256 , sehingga pelaksanaan Pemilukada di Aceh dapat berjalan normal karena memiliki payung hukum. (b 22)

KIP Langsa Siap Laksanakan Perintah MK KOTA LANGSA (Waspada): Kendati menimbulkan pro dan kontra terkait keputusan sela yang dikeluarkan Mahkamah Konstitusi (MK) soal Pemilihan Umum Kepala Daerah (Pemilukada) di Aceh yang mengharuskan Komisi Independen Pemilihan (KIP) Aceh membuka kembali pendaftaran calon kepala daerah, Ketua KIP Kota Langsa menyatakan siap melaksanakan keputusan sela tersebut. “Insya Allah kami siap melaksanakan semua keputusan MK terkait pelaksanaan Pemilukada di Aceh,” ujar Ketua KIP Kota Langsa Agusni AH yang dihubungi Kamis (19/1). Meski mengaku siap melaksanakan keputusan MK tersebut, Agusni mengatakan keputusan sela MK tersebut sangat sulit diimplementasikan dengan batas waktu tujuh hari untuk membuka kembali pendaftaran bagi calon kepala daerah baik dari jalur perseorangan maupun partai politik. Menurutnya, untuk waktu normal saja memerlukan tenggang masa antara 1,5 hingga 2 bulan guna melaksanakan semua tahapan pencalonan. Namun demikian, KIP Kota Langsa siap menjalankan tahapan tersebut sesuai dengan jadwal yang ada sebagaimana telah ditetapkan bersama KIP Aceh. (b22)

PNS Harus Netral PEURELAK (Waspada): Jajaran Pegawai NegeriSipil (PNS) Pemkab Aceh Timur diminta senantiasa bersikap netral dan tidak terlibat dengan politik praktis serta memihak salah satu pasangan calon. Demikian dikatakan Bupati Aceh Timur Muslim Hasballah saat melantik puluhan pejabat struktural eselon II, III dan IV di lingkungan Pemkab Aceh Timur, beberapa waktu lalu. “PNS harus bersikap netral dengan tidak memihak salah satu pasangan calon, namun hal tersebut bukan berarti kehilangan hak pilih untuk dapat memilih salah satu pasangan yang terbaik untuk memimpin Aceh ke depan pada umumnya, dan Aceh Timur khususnya,” ujarnya. Selanjutnya kepada para pemangku jabatan dan juga seluruh PNS di lingkup Pemkab Aceh Timur, bupati juga berpesan untuk terus pro aktif meningkatkan kemampuan dan kualitas diri, karena kualitas sumber daya manusia (SDM) aparatur saat ini merupakan modal untuk melaksanakan pemerintahan yang bersih dan bebas korupsi, kolusi dan nepotisme. (b22/b24)

Demokrat Aceh Timur Jagokan Prof Amhar IDI (Waspada): Partai Demokrat menjagokan Prof Dr H Amhar Abubakar sebagai calon Bupati Aceh Timur periode 2012-2017 karena faktor latar pendidikan yang tinggi. Hasil survei lembaga yang dibiayai Dewan Pimpinan Pusat (DPP) Partai Demokrat pasangan Amhar-Samsul mendapatkan peringkat pertama dari sejumlah kader lain yang ikut dijagokan. Menurut Ketua DPC Partai Demokrat Aceh Timur Mirnawati, Selasa (17/1), selain Prof Dr H Amhar Abubakar memiliki pendidikan tinggi, pasangan yang dijagokan inipun memiliki kemampuan dan program yang Islami dalam membangun Kabupaten Aceh Timur ke depan, apalagi selama ini Amhar Abubakar juga tidak asing di mata masyarakat. Mirnawati menambahkan, Amhar Abubakar juga dinilai memiliki jaringan yang bagus dalam mengakses NGO di luar negeri seperti program air bersih yang direncanakan menjadi program utama jika jabatan Bupati Aceh Timur periode 20122017 dipercayakan rakyat untuk Amhar Abubakar dan Samsul. “Kita hanya menawarkan yang terbaik di mata Partai Demokrat untuk rakyat Aceh Timur. Selaku pengurus di DPC-PD Aceh Timur tugas kita hanya untuk menyukseskannya hingga terpilih dan dilantik,” papar Mirnawati. (b24)

Panwaslu Ajak Masyarakat Proaktif BIREUEN (Waspada): Tahapan Pemilihan Umum (Pemilu) Gubernur dan Wakil Gubernur Aceh, periode 2012-2017 hampir memasuki tahapan kampanye. Karenanya, untuk memastikan perhelatan lima tahunan ini berlangsung jujur dan adil, Panitia Pengawas Pemilu (Panwaslu) Kabupaten Bireuen mengajak masyarakat untuk lebih proaktif mengawasi setiap tahapannya. Imbauan ini disampaikan Ketua Divisi Pengawasan Panwaslu Bireuen Agusni Ismail, SP kepada Waspada di ruang kerjanya, Selasa (17/1). Dia menyebutkan, keberadaan personel Panwaslu tentunya tidak dapat berbuat banyak tanpa adanya dukungan dari masyarakat. “Informasi atas dugaan adanya pelanggaran Pemilukada pada setiap tahapannya perlu adanya peran aktif masyarakat untuk melaporkan kepada kami (Panwaslu-red), baik itu dilakukan oleh pasangan calon gubenur dan wakil gubenur berserta tim kampanyenya, ataupun yang dilakukan oleh oknum penyelenggaranya,” harap Agusni. Dia mencontohkan, pada tahapan kampanye ada beberapa hal yang yang menjadi fokus pengawasannya dan dimensi yang harus diperhatikan, antara lain; bentuk kampanye, waktu dan tempat kampanye, pihak yang boleh dan tidak boleh terlibat kampanye, dan larangan-larangan kampanye seperti adanya keterlibatan PNS ataupun TNI/Polri sebagai peserta kampanye.(b17)

4.034 TPS Rawan BANDA ACEH (Waspada): Kapolda Aceh Irjen Pol Iskandar Hasan mengatakan, dari 9.768 Tempat Pemungutan Suara (TPS) yang akan digunakan untuk Pemilihan Kepala Daerah di Aceh pada 16 Februari mendatang, 4.034 di antaranya masuk kategori rawan. Dari jumlah tersebut, 3.020 TPS masuk rawan satu dan selebihnya 1.041 TPS lainnya termasuk rawan dua. Untuk mengamankan TPS-TPS tersebut, pihak Kepolisian Daerah Aceh akan menempatkan lebih banyak personelnya dibanding TPS yang masuk kategori aman. “Kategori TPS rawan, misalnya dilihat dari tingkat ancaman kriminalitas dan jarak tempuh menuju tempat pemungutan suara, seperti membawa kotak pemungutan suara menyeberangi sungai dua kali,” kata Iskandar Hasan di Banda Aceh, Selasa (17/1). Menurut Kapolda, TPS yang masuk kategori aman pihaknya akan menempatkan dua orang personel kepolisian dan delapan orang Linmas (Perlindungan Masyarakat) untuk mengamankan empat TPS. Sedangkan untuk TPS Rawan I akan ditempatkan dua polisi dan empat Linmas per dua TPS, dan kategori Rawan II ditempatkan dua polisi dan dua anggota Linmas menjaga satu TPS. (b05)

Waspada/Muhammad H. Ishak

TANDATANGAN: Kapolres Aceh Timur AKBP Drs Ridwan Usman membubuhkan tandatangan di atas spanduk besar sebagai tanda mendukung aksi Pilkada 2012 berjalan lancar dan damai di Aceh Timur oleh ratusan massa dari berbagai elemen sipil di Idi, Aceh Timur, Kamis (19/1) .

Massa Gelar Aksi Pilkada Damai IDI (Waspada): Ratusan massa dari berbagai pelosok di Aceh Timur melakukan aksi damai meminta agar Pilkada Aceh dilaksanakan tepat waktu dan sesuai dengan prosedur yang ada. Aksi itu dilakukan di depan Masjid Agung Darussalihin, Kota Idi, Kamis (19/1). Dalam aksi damai tersebut, massa juga melakukan menandatangani sebagai aksi dukung Pilkada Aceh dan mengutuk keras atas tindakan sekelompok orang yang memotong dan merubuhkan tower listrik yang mengakibatkan masyarakat rugi, karena tidak normalnya arus listrik yang dipasok dari Sumatera Utara. Aksi itu mengatasnamakan Forum Masyarakat Aceh Timur yang terdiri dari berbagai unsur/elemen. Massa menyatakan sikap bersama mendukung Pemilukada Damai dengan empat point sikap untuk diindahkan secara bersama oleh seluruh lapisan/elemen masyarakat

daerah ini dan Aceh umumnya. Dalam deklarasi Pemilukada damai yang dilangsungkan di seputaran Jalan Petua Husein Idi Rayeuk atau seputaran Kantor Setdakab Aceh Timur menyatakan sikap mengutuk keras tindakan penembakan kekerasan yang dilakukan pihak-pihak tidak bertanggungjawab di Aceh. Massa juga mendukung Pilkada damai dan demokratis, mendorong pihak penegak hukum untuk mengusut tuntas kasus penembakan dan kekerasan di Bumi Serambi Mekkah. Massa juga mengajak seluruh elemen masyarakat daerah itu untuk bersatu padu dalam mewujudkan Aceh yang damai dan Pemilukada berjalan damai. Hadir dalam deklarasi itu antara lain Bupati Aceh Timur diwakili Asisten II, Ir M Yasin, Dandim 0104 AT, Letkol Inf Mohamad Hasan, Kapolres Aceh Timur AKBP Ridwan Usman, Ketua MPU Tgk H

Bukhari Hasan. Usai membacakan butir pernyataan sikap oleh Koordinator Deklarasi A Viust, BSc, secara bersama sama tokoh yang hadir baik dari unsur Muspida, ulama maupun elemen lainnya menandatangani butir pernyataan sikap tersebut yang tertuang dalam sebuah spanduk panjang. Adapun elemen yang menyatakan sikap mendukung aksi damai ini antara lain Front Pembela Tanah Air, Komite Peralihan Aceh (KPA), Forum Komunikasi Anak Bangsa (Forkab), Ketua Forum Imum Mukim, Pemuda Panca Marga (PPM), Perstauan Guru Republik Indonesia (PGRI), Karang Taruna, Patriot Nasional (Patron), Forum Pemuda Pendukung Perdamaian RI-GAM, Pimpinan Dayah Serambi Mekkah, Pimpinan Dayah Al Maimanah, FKPPI Aceh Timur, Koordinator Camat Aceh Timur, Dharma Wanita Persatuan Dinas Pendidikan Aceh Timur. (b24)

Polres Gayo Lues Siap Amankan Pilkada BLANGKEJEREN (Waspada): Jajaran Polres Gayo Lues menyiapkan 206 polisi untuk pengamanan Pilkada di Kabupaten Gayo Lues. Kapolres Gayo Lues AKBP Sofyan Tanjung kepada Waspada, Rabu (18/1), mengatakan pihaknya telah menyiagakan sebanyak 206 personel dan 125 cadangan, tujuannya untuk mengamankan pelaksanaan Pilkada. “Jauh hari kita sebelumnya telah siap mengamankan Pilkada Gayo Lues, kalau untuk personel kita sudah cukup,” ujarnya. Dalam mengantisipasi pengamanan Pemilukada pihak kepolisian Gayo Lues menempatkan beberapa personel

dalam tiga kategori, yakni kriteria Aman, Rawan I, Rawan II. Dijelaskannya, untuk kriteria aman ditugaskan 2 personel setiap TPS, sedangkan kriteria rawan I dan II, ditugaskan 4 personel dan 8 Linmas dalam satu TPS. Selain itu ditambah pasukan TNI dan Brimob sebagai pengamanan siaga. Dikatakan Kapolres, walaupun kondisi Gayo Lues tidak seperti daerah pesisir Aceh lain, namun kewaspadaan perlu ditingkatkan. “Kalau untuk pengamanan terhadap sasaran Petrus seperti pekerja/ tukang khususnya suku Jawa, kita telah siapkan pengamanan di base camp tertentu dan mereka selalu dipan-

tau oleh pasukan Brimob,” jelasnya. Dia berharap semua elemen masyarakat yang sudah punya hak memilih sesuai dengan hati nurani tidak terprovokasi dengan hal-hal lain. Apabila masyarakat mendapat informasi yang mengacaukan pelaksanaan Pemilu, maka segera melaporkan ke pihak kepolisian untuk mencegah terjadinya kekacauan, terutama di tingkat kediaman masing-masing. “Ini Pemilu damai, jangan sampai terprovokasi dengan peserta Pilkada yang berbuat tidak wajar, hindari perselisihan paham antar sesama simpatisan bakal calon,” imbaunya. (cjs)

PA Bireuen Belum Tentukan Balon Bupati BIREUEN (Waspada): Dewan Pengurus Wilayah Partai Aceh (DPW PA) Kabupaten Bireuen belum menentukan bakal calon (Balon) pasangan bupati dan wakil bupati untuk mengikuti Pemilu Kada. Kendati demikian, Seretaris DPW PA Bireuen Muzakkir Zulkifli, Kamis (19/1), mengakui sudah ada beberapa nama balon. “Namun itu masih sebatas

wacana, belum ada penentuan secara resmi,” ucapnya menanggapi pertanyaan sejumlah wartawan. Dia menjelaskan, dalam menentukan bakal calon bupati, PA akan melakukan melalui musyawarah yang diikuti oleh seluruh pengurus mulai tingkat kabupaten hingga tingkat desa. Pada kesempatan itu, dia

juga membantah semua isu yang menggelinding sekarang kalau partainya sudah menetapkan balon untuk bupati periode 2012-2017 di Kabupaten Bireuen. Menurutnya, PA akan mengusung balon yang dinilai mampu membawa Bireuen ke arah yang lebih baik dan keputusan itu akan dilakukan melalui musyawarah partai. (b17)

Panwas Lhokseumawe Bongkar 50 Baliho LHOKSEUMAWE ( Waspada): Petugas dari Panwaslu Kota Lhokseumawe bersama KIP dan Pemerintah Kota Lhokseumawe, Kamis (19/1) membongkar 50 baliho kandidat wali kota dan wakil wali kota setempat. “Kita menilai, para kandidat telah melanggar aturan, karena jauh hari kita telah menyurati para calon untuk membongkar baliho. Baliho-baliho tersebut sudah tidak boleh ada di sepanjang jalan, sejak mereka dite-

tapkan sebagai calon. Sesuai tahapan yang telah ada, kampanye baru dapat dilakukan pada 30 Januari mendatang,” kata Samsul Bahri, Divisi pengawasan Panwaslu Kota Lhokseumawe, Kamis (19/1). Kata Samsul, pelanggaranpelanggaran tersebut dicatat dan dilaporkan ke Komisi Independen Pemilihan (KIP), karena Panwas cuma bertugas mengawasi dan melaporkan, penindakan ada di KIP.

Baliho calon yang dipasang di pingir-pinggir jalan merupakan kampanye di luar jadwal yang telah ditetapkan dan ini merupakan bentuk pelanggaran administrasi. Ruas jalan yang disisir petugas, Kamis (19/1) berada di tiga kecamatan yakni Kecamatan Banda Sakti, Muara Dua, dan Muara Satu. “Kami meminta para kandidat untuk menghargai setiap aturan yang telah ditetapkan,” kata Samsul Bahri. (b18)


WASPADA Jumat 20 Januari 2012


JK: Konversi BBM-Gas Bisa Timbulkan Kekacauan JAK ARTA ( Waspada): Mantan Wakil Presiden Jusuf Kalla mengingatkan konversi bahan bakar minyak (BBM) ke gas (BBG) perlu persiapan matang. Jika tidak, konversi ini malah menimbulkan kekacauan. “Kalau hanya sekadar bicara langsung mau konversi 1 April, mana bisa. Itu bisa menimbulkan kekacauan,” kata Kalla usai acara Silaturahmi Tokoh Bangsa

Ke-3 di Kantor PP Muhammadiyah, Jakarta, Kamis (19/11). Menurut JK, konversi BBM ke gas berbeda dengan konversi minyak tanah ke gas karena minyak tanah bukan dipakai pada barang bergerak. “Kalau mobil mau dikonversi kan mobil bergerak seperti ke Bandung, ke Bogor, ke Semarang, kalau kehabisan gas dan di sana tidak ada fasilitas bagaimana caranya? Bagaimana da-

patnya? Kalau pom bensin kan di mana-mana ada,” jelasnya. Untuk itu, diperlukan persiapan infrastruktur yang baik dan dibuat secara lengkap. “Bisa bertahap dan harus mencakup seluruh wilayah Indonesia, jangan separuh-separuh,” kata dia. Jika pemerintah tetap memaksakan konversi ini, Kalla menilai masyarakat akan marah dan akan terjadi kekacauan.

BNP2TKI Sambut Dua TKI Bebas Dari Pemancungan JAKARTA (Antara): Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI) menyambut lagi dua TKI yang terbebas dari pemancungan di Arab Saudi yakni Neneng Sunengsih binti Mamih Ujan dan Mesi binti Dama Idon. Deputi Kepala BNP2TKI Bidang Perlindungan Lisna Yoeliani Poeloengan, di Jakarta, Kamis (19/1), menjelaskan Neneng dan Mesi berangkat dari Bandara King Abdul Azis, Jeddah, dengan menggunakan pesawat Saudi Airlines SV 820. Sebelumnya dua TKI yang juga selamat dari hukuman pancung yakni Bayanah binti Banhawi telah pulang ke tanah air pada 28 Desember lalu dan Jamilah binti Abidin Rofi’i alias Juariyah binti Idin Rofi’i telah pulang pada 29 Desember lalu. Lisna yang juga anggota Satuan Tugas (Satgas) Penanganan WNI/TKI Terancam Hukuman Mati Di Luar Negeri menyebutkan Neneng, TKI asal Desa Bojong Kalong RT 03/03, Kecamatan Nyalindung, Sukabumi, Jawa Barat, dibebaskan dengan jaminan dari pengacara sedangkan Mesi, asal Kampung Pasir Ceuri RT 01/02 Kelurahan Cibenda, Kecamatan Ciemas, Sukabumi, Jawa Barat, dibebaskan setelah mendapat pengampunan dari Raja Abdullah. Neneng Sunengsih, pemilik paspor Nomor AP 482271, berangkat menjadi TKI Penata Laksana Rumah Tangga (PLRT) melalui Pelaksana Penempatan TKI Swasta (PPTKIS) PT Jasmindo Olah Bakat dan Al Rawabi Recruitment Office. Setelah bekerja 11 bulan pada keluarga Asraf Roja Al Rajan, pada Mei 2011, Neneng ditahan Kepolisian Al Jouf, sekitar 1.200 km dari Riyadh, atas tuduhan membunuh bayi perempuan majikan dan berusaha melarikan diri. KBRI Riyadh menunjuk

Neneng Sunengsih


pengacara setempat, Naseer Al Dandani, untuk membebaskan Neneng dengan meyakinkan majelis hakim di pengadilan bahwa kesalahan tidak seharusnya ditimpakan kepada Neneng yang tidak memiliki keahlian untuk merawat bayi dalam keadaan sakit parah. Kematian bayi majikan tidak ada unsur kesengajaan dan tidak terdapat bukti kuat bahwa Neneng yang menyebabkan kematian bayi sedangkan majikan tidak mengizinkan jasad bayinya diotopsi. Ketua Satgas Maftuh Basyuni saat berkunjung ke Riyadh pada 24 Desember 2011, melalui pengacara, telah mendesak pihak terkait di Penjara Al Jouf untuk membebaskan Neneng dari penjara. Neneng dibebaskan karena alasan tidak adanya unsur kesengajaan,, tidak ada sidik jari yang membuktikan bahwa TKI Neneng yang menyebabkan kematian anak tersebut, orang tua korban tidak bersedia untuk mayat anaknya diotopsi. Menurut pihak pengadilan kesalahan ada pada ibu bayi yang menyerahkan bayi tersebut ke Neneng yang tidak mempunyai keahlian merawat bayi yang sakit. Sedangkan Mesi, pemilik paspor Nomor AL 613704

berangkat ke Arab Saudi pada 2008 melalui PPTKIS PT Jasebu Prima Internusa dan Amal Al Mubasher Agency. Dia bekerja pada keluarga Abdullah Dhoifullah Haji Al Rugi. Pada 2 Maret 2011, Mesi divonis hukuman mati oleh Pengadilan Umum Saqra, sekitar 250 km dari Riyadh, atas pengakuannya melakukan sihir kepada suami-istri majikannya namun Mesi mencabut dan menolak pengakuan tersebut karena pada saat pembuatan berita acara dia mengaku berada di bawah tekanan. Putusan vonis mati dilimpahkan oleh pengadilan umum Saqra ke pengadilan kasasi. KBRI Riyadh menindaklanjuti berkas perkara ke pengadilan kasasi dan mendapat penjelasan bahwa berkas perkara terdakwa telah dikembalikan ke Pengadilan Umum Saqra dan diberi pertimbangan agar Mesi tidak dihukum mati karena pengakuannya di bawah tekanan. Pada 28 Juli 2011, sidang pengadilan meringankan hukuman mati menjadi hukuman penjara 10 tahun dan 500 kali cambukan. Mesi pada awal Januari 2012 dibebaskan dari hukuman mati atas perintah Raja Arab Saudi.

Proyek Kontroversial Dicurigai Lemahkan DPR JAKARTA (Waspada): Politisi PDI Perjuangan H Irmadi Lubis meminta pimpinan dan Badan Kehormatan serta anggota DPR RI melakukan penyelidikan terhadap kebijakan kesekjenan DPR yang selalu menggulirkan proyek-proyek kontroversial. Penyelidikan itu diperlukan sebab ada kecurigaan, proyek -proyek kontroversial, seperti renovasi ruang rapat Badan Anggaran (Banggar) DPR mencapai Rp20 miliar, renovasi toilet 2 miliar, perbaikan fasilitas parkiran motor Rp3 miliar dan terakhir pengadaan kalender sengaja dilakukan sebagai upaya melemahkan posisi DPR RI. Upaya melemahkan itu harus diwaspadai pimpinan dan anggota DPR. “Saya bukan menuduh, tapi saya pikir pantas untuk curiga dengan bergulirnya proyekproyek kontroversial yang selalu muncul harus diwaspadai sebagai upaya melemahkan DPR secara kelembagaan, apalagi jika memang pemerintah berkepentingan. Bisa saja karena DPR dianggap sangat kuat secara konstitusi dan tidak bisa dilemahkan secara aturan, maka jalan satu satunya melemahkan legitimasi, kepercayaan rakyat, melalui proyek-proyek kontroversial ,” ujar Irmadi Lubis di Jakarta, Rabu (18/1). Mantan anggota DPR periode 1999-2004 dan 20042009 dari daerah pemilihan Sumut ini memaparkan kecurigaannya, sebab walaupun Sekjen DPR sudah berganti, tetapi proyek-proyek kontroversial selalu dimunculkan. “Dulu citra DPR buruk akibat adanya anggaran renovasi rumah dinas, kemudian muncul pengadaan

komputer dan mesin cuci. Periode berikutnya muncul proyek renovasi rumah dan pembangunan gedung baru. Sekarang muncul proyek renovasi ruang rapat Banggar, renovasi toilet, perbaikan fasilitas parkiran motor dan terakhir pengadaan kalender.” Irmadi melontarkan keherannya atas fasilitas ruang Banggar yang direnovasi, terutama kursi yang diimpor dari Jerman. Menurutnya, kursi semewah itu tidak pernah dipakai anggota Parlemen Jerman, tetapi kita di sini begitu mewah. Ini sudah tidak logika. Saya sudah pernah melihat ruangan Parlemen Jerman. Walaupun Jerman merupakan negara maju, kursi yang demikian tidak dipakai, sedangkan kita negara miskin memakai kursi semewah itu. Apa layak? tandasnya sembari mempertanyakan sensivitas kesekjenan. Irmadi mendesak pemerintah untuk menarik Sekjen, sebab Sekjen DPR sebagai penanggunjawab terbukti tidak mendukung program pemerintah dengan menggunakan kursi hasil produk dalam negeri. Apalagi di dalam negeri, semua bentuk kursi sudah bisa dibuat. Melihat kenyataan ini, Irmadi makin curiga bahwa memunculkan proyek-proyek kontroversial sengaja dilakukan sebagai upaya melemahkan DPR secara kelembagaan. Apakah ini tidak merupakan faktor kesengajaan untuk menjatuhkan dan melemahkan DPR? ujar Irmadi. Kalau terus-terusan begini, tambahnya dan legitimasi DPR secara kelembagaan anjlok hingga akhirnya jatuh maka jalan demokrasi kita tidak akan maju-maju. Semakin lama DPR

bukan semakin baik tapi selalu dijatuhkan dan dilemahkan legitimasinya oleh pekerjaanpekerjaan kesekjenan. ”Apa tidak pantas kita mencurigainya, sebab setiap periode sejak jaman reformasi ada saja proyek kesekjenan yang membuat kejatuhan citra DPR. Walaupun Sekjen sudah diganti tetap saja. Ini perlu ditelusui, ada tidak usaha yang sistwmatis dari bergulirnya proyek proyek kesekjenan itu untuk melemahkan DPR?” tandasnya. Dijelaskan Irmadi, semua masalah kebutuhan DPR dalam melaksanakan tugasnya itu dilaksanakan kesekjenan DPR dan kesekjenan itu adalah organ pemerintah. Gedung DPR itu milik pemerintah dan pemerintahlah yang mengelolanya. Ketika ditanya proyek renovasi itu juga tidak diketahui Ketua DPR Marzuki Alie sebagai Ketua Badan Urusan Ru-mah Tangga (BURT), Irmadi mengatakan kemungkinan Ketua BURT bisa kecolongan sebab, bisa saja saat melaporkannya pihak kesekjenan tidak menyerahkan secara rinci dan hanya menyebutkan angka kirakira. “Karena kesibukan, bisa saja kecolongan,” tukas Irmadi. Namun, apapun namanya, memang Ketua DPR sebagai Ketua BURT tidak bisa lepas tanggungjawab. Pasalnya, sesuai tata tertib yang baru Ketua DPR sebagai Ketua BURT. Beda ketika periode 1999-2004, dimana Ketua BURT itu tersendiri. “Kalau dulu tersendiri, tetapi karena Pimpinan DPR merasa banyak kecolongan juga, akhirnya Tatib diubah dan mengamanatkan Ketua DPR jadi Ketua BURT,” ujar Irmadi Lubis. (aya)

“Lebih baik naikkan saja harga BBM-nya, itu lebih jauh mudah. Naikkan saja BBM-nya, apa yang susah, toh sudah pernah naik dulu,” pungkasnya. Sebelumnya, Pemerintah memulai mega proyek konversi ini dengan mengebut pemba-

ngunan infrastruktur bahan bakar gas. Ini salah satu upaya pemerintah mengkonversi penggunaan bahan bakar minyak ke gas di sektor transportasi, sehingga bisa menekan subsidi energi yang mencapai ratusan triliun per tahun. (vvn)

Suami Melinda Dee Divonis 4 Tahun JAKARTA (Waspada): Terdakwa kasus pencucian uang dan pemalsuan identitas, Andhika Gumilang divonis empat tahun penjara oleh Majelis Hakim Pengadilan Negeri Jakarta Selatan. Suami siri Inong Melinda Dee ini terlihat tenang dan hanya sebentar berkonsultasi dengan pengacaranya usai pembacaan vonis. Andhika bungkam tanpa berkomentar apapun. “Saya khawatir dia menerima itu karena emosi saja,” ujar kuasa hukum Andhika Devie Waluyo, di PN Jaksel, Kamis (19/1). Devie menolak putusan itu, karena banyak fakta tidak masuk dalam persidangan. Misalnya tanda tangan blangko kosong. Fakta mengenai ibunya yang tinggal di Capital selama dia menikah. Sebelumnya, Majelis Hakim menjatuhkan vonis empat tahun penjara dan denda sebesar Rp350 juta, subsider 3 bulan kurungan kepada Andhika Gumilang alias Juan Ferrero. “Terdakwa terbukti bersalah terlibat dalam kasus pencucian uang dan penggunaan identitas palsu sebagaimana dalam dakwaan JPU, “ kata Ketua Majelis Hakim Yonisma. Hakim menyebut adanya transaksi pentransferan dana nasabah Citigold Citibank yang diatur Istri sirinya melalui rekening kedua adik Melinda, Ismail bin Janim dan Visca Lovitasari ke rekening terdakwa Andhika Gumilang. “Sebanyak 24 transaksi dengan nilai sekitar Rp 147 juta. Fakta lain, pembelian Mobil Hummer H3 dilakukan Malinda dengan bukti kepemilikan atas nama Andhika Gumilang,” ujar Yonisman. Adik Melinda Dee Divonis Adik kandung Inong Melinda Dee yang menjadi terdakwa kasus pencucian uang nasabah Citibank, Visca Lovitasari dijatuhi vonis 2 tahun 10 bulan penjara oleh Majelis Hakim Pengadilan Negeri Jakarta Selatan. “Mengadili, menyatakan terdakwaVisca Lovitasari telah terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana pencucian uang. Menjatuhkan pidana kepada visca pidana penjara selama dua tahun dan 10 bulan pidana, denda 200 juta apabila tidak dibayar diganti kurungan 2 bulan,” tegas Hakim Ketua Mientriswaty di PN Jakarta S Kamis (19/1). Meski divonis 2 tahun 10 bulan bui, Majelis hakim menetapkan agar terdakwa Visca menjadi tahanan rumah. Pasalnya, terdakwa masih memiliki dua anak yang masih kecil. “Terdakwa juga memiliki suami yang dilakukan penahanan,” tukasnya. (okz)

Kadin, Apindo Setuju Harga BBM Bersubsidi Naik JAKARTA (Waspada): Kamar Dagang dan Industri (Kadin) dan Asosiasi Pengusaha Indonesia (Apindo) lebih menyetujui penaikan harga bahan bakar minyak (BBM) daripada pembatasan. Pengamat perminyakan Kurtubijuga juga mendukung kebijakan penaikan BBM dari pada pembatasan. “Pembatasan itu tetap menggiring bangsa ini akan ketergantung pada minyak,” ujar Kurtubi pada rapat dengar pendapat umum dengan Komisi VII DPR RI di Gedung DPR Jakarta, Kamis (19/1). Ketua Umum Kadin Suryo B Sulisto Kadin mengusulkan membuat dua golongan kenaikan untuk mencerminkan keadilan. Untuk golongan menengah ke bawah kenaikannya Rp1.000, sedangkan untuk pemilik mobil kategori kaya kenaikannya Rp3.000 per liter. (aya)

DPR Desak Kdh Di Sumut Selesaikan Konflik Pertanahan JAKARTA (Waspada): Anggota Komisi III DPR RI Martin Hutabarat mendesak seluruh jajaran kepala daerah dan Badan Pertanahan Provinsi Sumatra Utara untuk segera menyelesaikan konflik pertanahan di Sumut, sehingga tidak lagi jadi bom waktu yang akan membuat keprihatinan. Jika konflik pertanahan dibiarkan terus berkelanjutan, wakil rakyat dari daerah pemilihan Sumut II itu mengkhawatirkan timbulnya kekerasan yang berujung pada konflik yang bisa merengut korban jiwa. “Konflik-konflik pertanahan di Sumut harus segera ditangani dan jangan dibiarkan tanpa upaya menyelesaikannya,” ujar Martin Hutabarat menjawab Waspada di Gedung DPR RI Jakarta, Rabu (18/1). Untuk itu, Martin menyarankan segera dibentuk Tim lintas intansi untuk penyelesaian konflik-konflik pertanahan. Tim ini, katanya harus segera bekerja dan harus berani memberantas mafia pertanahan yang banyak bergentayangan di Sumut. “Kepala pemerintahan di Sumut harus kompak menyelesaikan konflik pertanahan sehingga kasus di Masuji Lampung, tidak terjadi di Sumut,” harap Martin Hutabarat. Sebelumnya Ketua Umum Partai Demokrat Anas Urbaningrum mengatakan, reformasi agraria yang dilaksanakan dengan tepat, adil dan berkepastian hukum adalah jawaban yang efektif atas berbagai kasus sengketa tanah di Indonesia. Kasus-kasus sengketa agraria, menurut Anas, tidak boleh dipandang ringan. Namun, menurut Anas, kasus-kasus sengketa agraria yang muncul jangan sampai dijadikan kuda troya politik untuk mengail popularitas dan menjadi alat tekanan politik. Membela hak-hak tanah rakyat dan mendorong keadilan penguasaan atas tanah harus dilakukan dengan cara yg baik, terukur dan berbasis pada aturan. “Jangan sampai kasus tanah pun dipolitisasi sehingga hanya menguntungkan pihak-pihak tertentu dan di satu sisi juga menyudutkan pihak tertentu tanpa ada keuntungan apa pun untuk rakyat. Jika ada aturan yang kurang mendukung, aturannya perlu diperbaiki dengan orientasi mencari solusi,” tegasnya. (aya)


KONSER KATY PERRY: Penggemar Kety Perry berdandan ala Kety Perry sebelum konser yang bertajuk The California Dreams Tour 2012 di Sentul International Convention Center (SICC), Bogor, Jabar, Kamis (19/1). Penyanyi asal California, AS, tersebut mengawali konser turnya pada 2012 di Indonesia.

ICRC Lindungi Wartawan Di Daerah Konflik JAKARTA (Waspada ): Tugas wartawan sangat banyak sekali tantangannya, terutama yang mendapat tugas di daerah konflik, diantara nya konflik bersenjata antar negara, maupun konflik senjata di satu negara. Sebelum menjalankan tugas jurnalistik di daerah konflik, wartawan juga harus mempunyai bekal yang cukup, guna memperoleh perlindungan, untuk mencari keselamatan jiwa yang diatur dalam perjanjian Jenewa. Bagi wartawan/koresponden perang dalam konflik bersenjata internasional, sesuai dengan Konvensi Jenewa, telah mendapat perlindungan. Untuk itu, angkatan bersenjata yang terlibat konflik bersenjata, wajib mengeluarkan kartu indentitas bagi wartawan/koresponden yang akan meliput kegiatan tersebut,” jelas Rina Rusman, legal Advisere Komite Internasional Palang Merah ( ICRC ) dalam workshop sehari Training for Trainer Media Safety yang digelar Dewan Pers bekerja sama dengan The International Committee of the Red Cross (ICRC) di Gedung Dewan Pers, Jakarta, Selasa (17/1).

Training for Trainer Media Safety diikuti lebih dari 30 perserta sebagai wakil media cetak di Jakarta maupun daerah, media online, radio maupun televisi serta wakil dari organisasi kewartawanan seperti PWI, AJI, IJTI, ATVSI, ATVLI dan PRSSNI. Menurut Rina, wartawan atau koresponden yang terlibat dalam konflik bersenjata, juga memperoleh keuntungan yang setara dengan mendapat perlindungan sebagaimana yang diterima orang-orang sipil, sepanjang mereka tidak ambil bagian dalam peperangan, dapat diakui sebagai orang sipil (tidak berseragam perang, tidak menggunakan senjata). Sebaliknya, apabila keluar dari persyaratan tersebut, maka wartawan/koresponden yang meliput konflik bersenjata, dianggap sedang ambil bagian aktif dalam peperangan, jelas Rina Rusman. Komite Internasional Palang Merah (ICRC), kata Rina, dalam melaksanakan tugasnya, ikut ambil bagian dalam melindungi wartawan/koresponden, masyarakat sipil maupun angkatan bersenjata yang bertikai yang diatur dalam Konvensi Jenewa. Akan tetapi, hal perlindungan

bagi wartawan/koresponden dapat hilang, juga dikarenakan beberapa hal. Seperti mendapat kawalan dari pasukan bersenjata, menyiarkan propaganda perang, menggunakan radio komunikasi operasi perang, mendukung kejahatan perang/ kejahatan manusiawi, atau menuduh suatu pihak telah melakukan pelanggaran berat HAM, melakukan kegiatan mata-mata (spionase) dan ditahan tanpa status tawanan perang. Sementara anggota Dewan Pers Uni Z Lubis mengatakan, Training for Trainer Media Safety merupakan kegiatan awal Dewan Pers di tahun 2012 ini. Dewan Pers akan mendorong perusahaan pers melakukan pelatihan internal tingkat dasar untuk wartawannya. Selain pelatihan tingkat lanjut yang menjadi fokus utama Dewan Pers. Dewan Pers tahun ini, menurut Uni, akan fokus mengadakan pendidikan dan pelatihan wartawan terkait strategi peliputan, isu-isu etika jurnalistik yang banyak dikritik masyarakat, dan persoalan yang belum banyak dipahami wartawan. “Termasuk digital media,” imbuhnya. (j06)

Sport A6 Balas Budi Abidal

WASPADA Jumat 20 Januari 2012

Menangkan Barca Atas Madrid MADRID (Waspada): Eric Abidal tampil mencengangkan di Santiago Bernabeu dengan golnya cantiknya untuk memberi Barcelona kemenangan 2-1 di kandang pemegang gelar Real Madrid pada leg pertama perempatfinal Piala Raja Spanyol. Bek Prancis berusia 32 tahun yang baru memperpanjang kontraknya dengan El Barca tersebut, berlari mengejar umpan lambung Lionel Messi di Stadion Santiago Bernabeu, Madrid, Kamis (19/1) pagi WIB. Abidal kemudian dengan tenang menyorongkan bola melewati kiper Iker Casillas menit 77, sehingga membuat klub juara La Liga dan Liga Champions 2011 itu keuntungan besar jelang leg kedua pekan depan di Camp Nou. Superstar El Real Cristiano Ronaldo menempatkan tim tuan rumah unggul lebih dulu melalui golnya menit 11. Kapten tim tamu Carles Puyol menyamakan skor menit 49 dengan menyundul keras bola umpan sepak pojok Xavi Hernandez. Abidal sempat dikaitkan dengan Arsenal dan Paris Saint-Germain, sebelum meneken kontrak anyar Senin lalu.

“Sebuah trofi kejuaraan memang penting dan saya salah seorang pemain yang sangat menginginkan sebuah piala,” ucapnya. Bintang yang pernah mengidap penyakit jantung itu seolah ingin membalas budi atas kepercayaan yang telah diberikan El Catalan dengan gol kedua yang dia cetak sepanjang karier profesionalnya. Satu gol lagi dia ukir ketika masih membela Olympique Lyonnais. “Sebelumnya, saya hanya pernah sekali mencetak gol di Piala Prancis dan akhirnya saya bisa lakukan kembali di sini. Ini sangat menyenangkan,” beber Abidal dalam AS. Bek kelahiran Lyon pada 11 September 1979 itu lolos dari jebakan offside pemain Los Blancos untuk menyantap assist Messi. “Dia (Abidal) sangat penting bagi kami. Sulit bagi Anda untuk mendapatkan pemain seperti dia pada bursa transfer,” puji pelatih Barca Pep



BEK Barca Eric Abidal (kiri) bergaya merayakan golnya ke gawang Real Madrid dengan rekannya Daniel Alves. Guardiola. “Anda tentu paham opini saya tentang dirinya. Dia sudah diingat oleh para suporter dan pastinya dia masuk dalam para pemain fantastis. Saya berharap dia bertahan lama di sini,” tambah Guardiola. Tetapi menurut entrenador Madrid Jose Mourinho, gol penyama kedudukan dari Carles Puyol yang telah ‘membunuh’ pasukannya. “Kami sudah berada dalam posisi unggul 1-0, itu hasil yang bagus dalam laga dua leg,” tutur Mourinho. “Namun kemudian mereka

Hasil Rabu (Kamis WIB) Real Madrid vs Barcelona Ath Bilbao vs Mallorca

1-2 2-0

Hasil Selasa (Rabu WIB) Espanyol vs Mirandes


mencetak gol balasan lewat skema bola mati. Anda tidak bisa melakukan kesalahan seperti itu saat menghadapi tim berkualitas model Barca. Setelah (gol Puyol) itu, wajar bila pemain kami sedikit gugup,” ujarnya lagi melalui ESPN. (m15/as/espn)

Aksi Idiot Pepe


MADRID (Waspada): Kejadian kontroversial kembali mewarnai laga bertajuk El Clasico antara Real Madrid kontra Barcelona pada laga leg pertama babak perempatfinal Copa del Rey, Kamis (19/1) pagi WIB. Bek Madrid Kleber Pepe (foto), tertangkap kamera menginjak tangan bintang Barca Lionel Messi dalam laga yang dimenangkan tim tamu skor 2-1 di Santiago Bernabeu tersebut. Kecaman dari berbagai pihak pun menghantam bek asal Portugal itu. Bomber Manchester United (MU) Wayne Rooney dalam akun Twitter miliknya bahkan menuding aksi Pepe idiot.

“Pepe. Itu benar-benar idiot. Terkadang, seseorang membuat Anda terpancing,” kecam Rooney. Mengenai gol penentu kemenangan El Barca yang dicetak Eric Abidal menit 77, striker Timnas Inggris itu malah menyebutnya sebagai karma dari perbuatan Pepe. “Ha..ha… Gol itu merupakan karma buat Pepe,” pungkas Rooney. Pemain MU lainnya, Tom Cleverley, pun memberikan komentar serupa melalui jejaring sosial tersebut. “Ayolah Pepe, kamu telah merusak pertandingan,” ucap Cleverley. Gelandang Arsenal Jack Wilshere yang juga menyaksikan

El Clasico tersebut melalui televisi, ikut mengecam. “Tindakan yang buruk dari Pepe!” Tindakan nakal itu dilakukan Pepe ketika Messi sedang duduk di lapangan usai dilanggar Jose Callejon menit 68. Pepe terlihat berjalan kemudian menginjak jari-jari tangan kiri Messi. Menurut Jose Mourinho, entrenador El Real, wajar bila pemain andalannya itu menerima banyak kecaman akibat kelakuannya. “Saya tidak melihat kejadian tersebut. Tetapi bila hal itu memang benar-benar terjadi, maka dia (Pepe) memang pantas mendapatkan kecaman,” sesal Mourinho. (m15/okz/guardian)

BEK AC Milan Luca Antonini menghadang tendangan salto striker Novara Jedaias Neves di San Siro, Kamis (19/1) WIB.

Pato, El Shaarawy Kian Yakin Bertahan Milan Singkirkan Novara ROMA (Waspada): Alexandre Pato keluar dari bangku cadangan untuk membawa AC Milan menang 2-1 pada tambahan waktu atas Novara pada babak 16 besar Piala Italia, Rabu (Kamis WIB) di Stadion San Siro. Tim divisi bawah Novara yang sepertinya mudah disingkirkan Il Diavolo, ternyata mampu memberikan perlawanan sengit kendati berstatus sebagai tamu. Milan lebih dulu memimpin lewat gol Stephan El Shaarawy menit 24. Ivan Radovanovic menghidupkan harapan Novara dengan gol penyama skor yang dicetaknya menit 88. Pato keluar dari bangku cadangan untuk menggantikan penyerang veteran Filippo Inzaghi menit 59. Bomber Brazil itu menyarangkan gol penentu kemenangan menit 100, tetapi keluar lagi dari lapangan karena cedera. Hanya saja melalui golnya ke gawang Novara, Pato beserta El Sharawy makin yakin untuk terus bertahan membela Milan. Pato santer dikabarkan bakal berlabuh ke Paris Saint Germain, sedangkan El Shaarawy disebut-sebut tak betah lagi menghuni bangku cadangan pasukan Massimiliano Allegri. “Saya bertahan. Pelatih Allegri dan wakil Presiden (Adriano) Galliani juga mengatakan itu. Jadi, saya tidak akan pergi Januari ini,” tekad El Shaarawy, seperti dikutip dari Goal. (m15/afp/goal)

Waspada/Yuslan Kisra

KAMIL Sembiring (kanan) dan Hidayat Berutu foto bersama Ketua Umum PSSI Djohar Arifin Husin, Pelatih Timnas U21 Widodo Cahyono Putra (kiri) dan Eddy Harto di Bukit Sentul, Bogor, Kamis (19/1).

Sembiring, Berutu Minta Dukungan Lolos Timnas SENTUL (Waspada): Dua pesepakbola muda berbakat asal Sumut yang tengah mengikuti seleksi akhir Timnas U-21, Kamil Sembiring dan Hidayat Berutu, meminta dukungan dan doa masyarakat di tanah kelahirannya agar bisa mengenakan seragam Merah Putih. Keduanya juga optimis lolos seleksi untuk tampil pada ajang Piala Sultan Hassanal Bolkiah di Brunei Darussalam, 27 Februari5 Maret mendatang. “Ini adalah kesempatan mengenakan seragam ‘Merah Putih’. Selama ini, saya optimis bisa terpilih,” ujar Hidayat, yang diamini Kamil kepada Waspada saat ditemui di Padepokan Voli, Bukit Sentul, Bogor, Kamis (19/1). Kiper dengan tinggi badan 190 cm ini mengaku, semuanya itu tidak lepas dari kehendak Yang Maha Kuasa, sehingga doa dari warga Sumut bisa melapangkan jalan yang diharapkannya. Mengenai harapan berseragam timnas, Hidayat dan Kamil yang juga jebolan dari Akademi Sepakbola Medan United masingmasing punya keinginan lain. Kepada Waspada, Hidayat mengaku ingin menyenangkan ibunda tercinta, Rosni Lubis, setelah ditinggal sang ayah (Saidi Berutu). “Menjadi pemain timnas akan memberi kebahagiaan tersendiri kepada ibu dan saya akan berjuang sekuat tenaga agar bisa terpilih,” ujar Hidayat bersemangat. Sedangkan Kamil mengaku, bisa bermain untuk timnas merupakan impian sejak kecil. Karena itu, kesempatan yang sudah di depan mata tidak akan disia-siakan. Terlebih, karena ini pertama kali baginya mengikuti seleksi timnas. “Harapan saya, bisa masuk timnas dan terus mengenakan seragam Merah Putih hingga senior. Dari hasil seleksi selama beberapa hari, saya optimis bisa terpilih,” ucap Kamil. Ketua Umum PSSI Djohar Arifin Husin, mengaku bangga dengan tekad Hidayat dan Kamil. “Tentunya, kemunculan pemain muda berpotensi asal Sumut lainnya bisa segera menyusul sebab sejak dulu kita tidak pernah absen menyumbang pemain untuk timnas,” beber Djohar. (yuslan)

PON Sumut Tembus Final Piala Inalum 2012 TANJUNGGADING (Waspada): Juara bertahan tim PON Sumut membuka peluang mempertahankan gelar. Herdiantono cs kembali sukses merebut tiket final Turnamen Sepakbola Piala Inalum 2012 di Lapangan Utama Tanjunggading, Kamis (19/1). Kepastian tim asuhan pelatih Rudi Saari itu tampil di partai puncak setelah menaklukkan PS Thamrin Graha Metropolitan (TGM) Medan 3-1. Duel kedua tim di semifinal berlangsung seru. Permainan terbuka yang diterapkan anak-anak PON Sumut kerap merepotkan pertahanan lawan. Tapi hingga babak pertama usai, Sapri Koto cs belum mampu membobol gawang TGM. Sebaliknya, TGM yang hanya sesekali melakukan serangan balik justru mampu mencetak gol lebih dulu di menit 70 lewat tendangan bebas Ardiansyah. Namun keunggulan TGM tidak bertahan lama. Berselang tiga menit, PON Sumut menyamakan skor lewat gol Aidun. PON Sumut terus mengurung pertahanan lawan hingga sukses memperbesar kemenangan melalui gol Sapri Koto dan Bambang Ardianto. Satu tiket ke final kembali akan diperebutkan, Jumat (20/1) sore ini. Tuan rumah Inalum akan menghadapi PSMS U-21 untuk memastikan tampil di partai puncak. (c05)


WASPADA Jumat 20 Januari 2012


KPSI Undang PSSI Hadiri Pra Kongres Jawab Desakan FIFA, AFC MEDAN (Waspada): FIFA dan AFC mendesak PSSI segera menggelar kongres sebagai upaya menyelesaikan permasalahan sekaligus menghindari ancaman hukuman dari Komite Asosiasi FIFA.

Waspada/Austin Antariksa

HADIRNYA gelandang asal Korsel, Inkyun Oh (tengah), akan kembali memperkuat barisan tengah Ayam Kinantan saat melakoni dua laga tandang di Malang dan Lamongan.

PSMS Termotivasi Tandang MEDAN (Waspada): Manajer tim PSMS Medan, Drs Benny Tomasoa, mengaku pasukannya sudah siap dan termotivasi bermain maksimal saat melakoni dua laga tandang lanjutan Indonesian Super League (ISL) di Malang dan Lamongan. Di Stadion Kebun Bunga Medan, Kamis (19/1), dia mengaku, PSMS membawa 18 pemain dalam kondisi terbaiknya guna menghadapi kedua tim asal Jawa Timur itu. Dikatakan, hasil seri dengan dua tim asal tanah Papua, Persiwa Wamena (1-1) dan Persipura Jayapura (0-0), menjadi modal buat Markus Horison cs menghadapi Arema (22/1) dan Persela (29/1). “Memang kita akui Arema dan Persela sulit dikalahkan di kandangnya, tetapi tekad anakanak ingin memberi yang terbaik kepada masyarakat Medan,” ucapnya.

“Hasil yang diperoleh di dua laga kandang terakhir sudah baik, tetapi akan lebih baik lagi kalau meraih nilai di Malang dan Lamongan,” beber Benny. Benny menambahkan, manajemen termasuk Ketua Umum PSMS Drs H Rahudman Harahap MM dan masyarakat Medan sangat mendambakan kemenangan Ayam Kinantan di laga tandangnya. “Bersama CEO PSMS Idris SE, hal ini sudah disampaikan kepada pemain dan mereka pun berjanji akan berjuang mengabulkan harapan tersebut,” katanya. Kembali hadirnya gelandang Korea Selatan, Inkyun Oh, jelas akan menambah kekuatan Ayam Kinantan. Melawan Persipura, Inkyun terpaksa absen karena akumulasi kartu kuning. Kini, Inkyun akan bergabung dengan rombongan PSMS ke Malang, Kamis (19/1) ini.

Pertina Bidik Olimpiade Brazil JAKARTA (Waspada): Ketua Umum PP Pertina terpilih, A Reza Ali, mencanangkan program menuju prestasi yang lebih tinggi bertajuk “Satu Tekad Menuju Olimpiade Rio de Janeiro 2016”. “Kita harus punya target khusus supaya kerja pun fokus. Target kita, ya Olimpiade Rio de Janeiro. Semua kegiatan Pertina harus berorientasi ke sana. Ini akan saya sosialisasikan sampai ke tingkat daerah dan sasana yang ada,” kata Reza di Jakarta, Kamis (19/1). Peluncuran program ini, lanjutnya, dengan harapan agar petinju, pelatih, dan pembina bersemangat tampil di Olim-piade dan meraih prestasi terbaik. Menurut Reza, bidikan Olimpiade di Brazil tersebut dilakukan, karena kesempatan Indonesia meraih prestasi tertinggi memang hanya ada di sana. “Kita juga bisa mempersiapkan petinju dengan baik. Kalau Olimpiade London 2012 ini tentu sulit. Waktu persiapan kita sangat singkat dan kita harus mengikuti babak kualifikasi di Astana, Kazakshtan, April nanti,” beber Reza. Salah satu cara merekrut petinju yang akan dipersiapkan ke Rio de Janeiro, imbuhnya, adalah hasil kejuaraan elit pada Maret nanti, kejuaraan junior (Juli), dan hasil PON 2012 di Riau mendatang. Petinju yang dipersiapkan itu juga akan mengikuti event ASBC (Asian Boxing Confederation) dan AIBA (International Boxing Association) untuk menambah jam terbang, termasuk SEA Games dan Asian Games. (yuslan)

Pengurus Poslab Dikukuhkan RANTAUPRAPAT (Waspada): Ketua Umum Persatuan Sepakbola Labuhanbatu (Poslab), H Tigor Panusunan Siregar, mengukuhkan anggota pengurus Poslab periode 2011-2014, Rabu (18/1) malam. Pengukuhan yang berlangsung khidmat itu dirangkai penetapan pemain dan ofisial tim Poslab mengikuti kompetisi Divisi I Liga Indonesia 2012. Dalam sambutannya, Tigor mengatakan Poslab telah berulang kali membawa harum nama Labuhanbatu di level daerah maupun nasional. “Pemain-pemain Poslab juga telah banyak berkiprah di berbagai klub maupun sebagai pemain nasional,” tutur Tigor, seraya menjelaskan Samin (pemain Poslab 1970-an) pernah menjadi kiper timnas Pra Olimpiade. “Keberhasilan kita meraih juara ketiga Piala Suratin beberapa waktu lalu menunjukkan Poslab juga bisa berprestasi di tingkat nasional. Prestasi itu menjadi tanda bahwa Poslab bisa,” tambahnya. Ketua Harian Suhari Pane menambahkan, Poslab siap bertanding, menang dan kalah dalam kompetisi tahun ini. Pengurus Poslab yang dikukuhkan di antaranya Ketua Harian Suhari Pane, Sekretaris H Sarbaini, dan Bendahara M Safrin Hasibuan. Susunan ofisial Poslab untuk kompetisi Divisi I adalah Andi Suhaimi Dalimunthe (Manajer Tim), Kamal Rintonga (Sekretaris Tim), Turing Ritonga (Bendahara), Zainul Arifin Hasibuan (Pelatih), dan Najaruddin (Masseur). (c07)

Problem Catur Jawaban di halaman A2 8







1 B








Pra Kongres PSSI tersebut mengagendakan persiapan dan menggali pemikiran manifesto PSSI baru yang diperlukan untuk menghadapi kongres sesuai statuta PSSI menuju Kongres Luar Biasa (KLB) 2012. Dari Jakarta, Sekretaris KPSI Hinca Panjaitan menyebutkan pihaknya telah menyurati kedua federasi sepakbola itu pada 31 Desember 2012 tentang tuntutan 2/3 anggota PSSI meminta PSSI menggelar KLB. Tanggapan itu dinilai Hinca menjadi satu pertanda kemenangan moral hukum bagi upaya KPSI mengembalikan PSSI ke jalur yang benar, patuh pada statuta PSSI, dan menghormati putusan hasil Kongres Bali. Dikatakan, Pra Kongres PSSI yang berlangsung selama dua hari nanti memiliki agenda

PSMS IPL Adaptasi Main Malam MEDAN (Waspada): Menatap laga kontra Persema Malang, Senin (23/1) malam, PSMS Indonesian Premier League (IPL) punya persiapan berbeda. Menjalani laga di malam hari nanti tentu baru pertama kali dilakukanVagner Luis cs musim ini. PSMS sudah melakoni empat laga dan semuanya digelar pada sore ini. Namun rencana penayangan laga secara live di Global TV membuat laga digelar di malam hari. Laga ini ditunda hari karena seyogianya digelar pada Sabtu (21/1) besok.

Pelatih Fabio Lopez menyadari itu dan akan mempersiapkan tim untuk beradaptasi. Namun, menurutnya hal itu baru dilakukan sehari jelang laga “Adaptasi satu hari sebelum pertandingan. Minggu (22/1) malam latihan dimulai jam 19.00 WIB. Intinya, kami mempersiapkan hari itu seperti di pertandingan,” ujar Fabio, Kamis (19/1). Tidak hanya adaptasi di lapangan, perubahan jadwal makan juga salah satu bagian dari adaptasi sebelum kick off pukul 19.00 WIB itu.

“Metabolisme tubuh akan menyesuaikan diri sekitar 24 jam. Di hari pertandingan, kami juga latihan pagi,” beber pria berusia 38 tahun itu. Skuad PSMS IPL sendiri sudah tiba di Malang sejak Kamis (19/1). Perjalanan yang panjang menuju Malang membuat Fabio memberikan recovery yang cukup untuk pemainnya. Salah satunya meniadakan latihan Jumat (20/1) pagi. “Besok (Jumat) pagi nggak latihan.. Kalau latihan, artinya pemain harus bangun pagi. Jadinya, kami liburkan mereka

untuk recovery. Lebih baik tidak latihan pagi karena kondisi fisiknya belum pulih benar. Kalau latihan sore, pemain bisa 100 persen fit,” papar pelatih berpaspor Italia itu. (m33)

31 Klub Sumut Pastikan Ikut Kongres Tahunan PSSI, Pra KLB MEDAN (Waspada): Pengurus 31 klub anggota PSSI di Sumut memastikan ikut serta dalam Kongres Tahunan PSSI yang sekaligus Pra Kongres Luar Biasa (KLB) di Jakarta, Jumat (20/1) dan Sabtu (21/1). “Mereka akan didampingi lima tim penggalang, di antaranya Tursilo Hadi, M Idris Nasution, dan Badiaraja Manurung. Menurut rencana mereka bertolak ke Jakarta via Bandara Polonia Medan, Jumat (20/1) ini,” ujar Anggota Forum Komunikasi Klub Anggota PSSI se Sumut Pro Statuta, M Idris Nasution, Kamis (19/1). (m17)

Pengurus 31 Klub Anggota PSSI Sumut Syahnan Harefa, Drs Yunus Larosa (PSN Nias) Risdon Sihotang, Saul Pardede (Pertobasa) Jules Sihombing, Bangun Lumbantobing (Perstu Taput) Marusaha L Toruan, Joharmat L Toruan (PS Humbang) A Fendi Lubis, Yunus Sidauruk (Persesi P Siantar) Pasiona M Sihombing, Sabungan Tambunan(PSSD Dairi) Eko Ariyanto, Saiful Amri Harahap (PSS Simalungun) Petra Jaya Purba, SN Kaban (PSSK Karo) Heri, Bibit SE (Poslab Labuhanbatu) Surya Darma, Lukman (PSTS Tanjungbalai) Muslim, Ismayadi (PSKB Binjai) Sahrul Rambe, Sapwan Pohan (Persebsi Sibolga) Helman Herdadi, Ilyas SPd (PS Batubara) H Mahmud Lubis, Erwin H Pane (Persitas) Haris Yani Tambunan, Rahmat Fauzi (PS Tapsel) Yaman Hidayat, Zefri Lubis (PSKPS P. Sidimpuan) Bachtiar Sibarani, Tony Surbakti (PSTT Tapteng) Aswad Asmara, Edwin Dhani (PSKTS Tebingtinggi) Arifin Sinaga, Syafruddin (PS Rapel Perbaungan) Tursilo Hadi, Muhadi (PS Tri Mantra) Aprilyani, Suprapto (PSL Langkat) Misriadi, Suganda Lubis (PS Sergai) Idris SE, H Iswanda Nanda Ramli (PSMS Medan) Erwis Edi Fauza Lubis, Azwar (PSSA Asahan) Dadang, Bambang Muntono (Bintang Jaya) Sulfiansyah, Seans Habibi (PS Mitra) Cecep Suhendra, Ridwan Lubis (POP Asahan) Budi H Nasution, Muchtar Lubis (PS Madina) Stevi Lim, Yu Abdillah (PS TGM Medan) Erwin Pelos, Nuhadi NP (PSDS Deliserdang) Lintong Samosir, Sulaiman Pasaribu (PS Samosir)

Medan Kirim Tiga Binaragawan Prolab Challenge Championship 2012 MEDAN (Waspada): Pengcab Persatuan Angkat Berat dan Binaraga Seluruh Indonesia (PABBSI) Kota Medan mengirim tiga binaragawan terbaiknya pada Kejuaraan Prolab Challenge Championship 2012. Ketiga atlet yang akan dikirim pada event berlangsung di Jakarta, 21-22 Januari itu adalah Rimba (kelas 65 kg), Arifin (75 kg), dan Andi Gusnadi (80 kg). Mereka akan bersaing dengan binaragawan terbaik di seluruh penjuru tanah air. “Kami berharap atlet bisa mempersembahkan prestasi. Dari kejuaraan itu mereka juga sekaligus menimba pengetahuan dan pengalaman, termasuk meningkatkan jam tanding,” ujar Kabid Binpres PABBSI Kota Medan, Bobby Octavianus, di Sekretariat Jl Mandala by Pass Medan, Kamis (19/1). Sekretaris Umum PABBSI Kota Medan, Lilik Kurniadi, menambahkan ketiga atlet yang akan mengikuti event tersebut telah menjalani persiapan matang sehingga diharapkan dapat tampil maksimal. Sedangkan Arifin, Andi, dan Rimba, mengaku akan berjuang maksimal untuk mempersembahkan prestasi. “Persaingan pada event kali ini cukup ketat, tapi kami akan berusaha, setidaknya di antara kami ada yang masuk peringkat tiga besar,” ucap Arifin. (m42)


Putih melangkah, mematikan lawannya dua langkah.


Ke-18 pemain yang dibawa adalah Markus Horison, Eddy Kurnia, Sasa Zecevic, Novi Handriawan, Ledi Utomo, Ramadhan Saputra, Rahmad,Wawan Widiantoro, Anton Samba, Zainal Anwar, Zulkarnaen, Sulaiman Alamsyah Nasution, M Antoni, Luis Alejandros Pena Sanhueza, Inkyun Oh, Choi Dong Soo, Osas Saha, dan Arie Supriatna. (m17)

Anggota pengurus Forum Klub Anggota PSSI se Sumut Pro Statuta, M Idris Nasution, menyebutkan desakan FIFA dan AFC itu tercantum melalui suratnya tertanggal 13 Januari 2012 ditandatangani Sekjen FIFA Jerome Valcke dan Sekjen AFC Alex Soosay mengacu Pasal 29 ayat 1 statuta PSSI dan merujuk hasil Kongres PSSI 2011 di Bali. “Diharapkan oleh FIFA dan AFC bahwa kongres sebagai forum menyelesaikan permasalahan. FIFA dan AFC menjatuhkan deadline pada 20 Maret mendatang demi menyelesaikan kekisruhan di PSSI,” kata Idris di Medan, Kamis (19/1). Komite Penyelamat Sepakbola Indonesia (KPSI) menjawab desakan FIFA dan AFC tersebut dengan mengundang PSSI hadir pada Pra Kongres PSSI 2012 di Jakarta, 20 dan 21 Januari

koordinasi BLAI dengan Pengprov PSSI dan klub amatir dan rapat pleno manifesto PSSI baru, Liga Amatir, dan KLB. Menanggapi mulai munculnya ketidak percayaan dari kubu yang mendukungnya, Hinca menegaskan KPSI tetap menggelar KLB dan mundurnya Persenga Nganjuk dinilainya tidak ada masalah. Namun pencabutan dukungan Nganjuk tidak semudah itu, karena datanya telah masuk ke AFC dan FIFA. “Tapi yang jelas, KPSI saat ini hanya fokus menggelar Kongres Tahunan PSSI lebih dulu. Dan itu saya pastikan jalan terus,” pungkas Hinca. Saat dikonfirmasi, Ketua KPSI Tony Apriliani mengatakan pemindahan lokasi kongres tidak akan mengubah rencana ataupun agenda yang telah ditetapkan sebelumnya, termasuk waktu pelaksanaannya. “Yang kami undang bukan hanya pemilik suara, tapi seluruh anggota PSSI. Lalu sebelum Kongres Tahunan, kami akan lakukan sidang membahas masukan dari semua kalangan yang dihimpun tim kerja,” kata mantan anggota Komite Eksekutif PSSI itu. (m17)


DUA dari tiga binaragawan PABBSI Kota Medan diapit pengurus PABBSI Medan, Kamis (19/1).

Binaragawan L. Batu Siap Bersaing RANTAUPRAPAT (Waspada): Atlet binaraga asal Kabupaten Labuhanbatu, Davod Sitanggang, menyatakan siap bersaing pada Kejuaraan Prolab Challenge Championship 2012 di Jakarta, 2122 Januari ini. Penampilan Davod yang akan turun di kelas 70 Kg itu juga mendapat dukungan penuh DPD Komite Nasional Pemuda Indonesia (KNPI) dan Komite Olahraga Nasional Indonesia (KONI) Labuhanbatu. Ketua DPD KNPI dan Ketua KONI Labuhanbatu, M Risfan SH dan Zainul Arifin Hasibuan AMd berharap Davod mampu mengukir prestasi. “Prestasi Davod tentu akan menjadi kebanggaan kita semua masyarakat Labuhanbatu dan Sumut,” ucap Risfan, Kamis (19/1). Davod Sitanggang yang juga pengurus DPD KNPI Labuhanbatu itu mengaku sudah mempersiapkan diri untuk tampil di event level nasional tersebut. (a18)



1. Jannah; Tempat kekal bagi umat Muhammad, kecuali yang enggan masuk ke dalamnya. 4. Batu kecil; Tugu yang menjadi sasaran lembaran batu dalam ibadah haji. 6. Bangunan dijadikan kiblat shalat. 7. Karunia; Belas kasih; Kerahiman. 8. Berang, perlu di”siram api”nya dengan wudhu. 9. Jabal. 11. Neraka yang diperuntukkan bagi pengumpat dan pencela yang mengumpulkan harta dan menghitung-hitungnya (QS Al Humazah). 15. Bukit tempat upacara sa’i. 16. Akhir dunia; Bencana maha besar. 18. Hakim yang mengadili perkara yang bersangkut paut dengan agama Islam. 20. Membersihkan dubur atau kemaluan untuk menghilangkan najis. 23. Abu _____, sahabat Rasulullah yang dijamin masuk surga. 25. Orang yang disebut dalam QS 111 akan masuk neraka bersama isterinya, tukang fitnah. 27. Keterangan: Ilmu ____ adalah ilmu ketepatan ungkapan, bagian dari ilmu balaqah. 28. Nama surga utama (mohon yang ini kepada Allah ketika berdoa, kata sabda Rasulullah).


1. Tahan menghadapi cobaan (tidak marah dan tidak putus asa); Tenang. 2. Unsur di dalam jasad yang diciptakan Tuhan. 3. Bawaan Dajjal yang tidak boleh diminum karena itu adalah api. 4. Neraka paling bawah. 5. Penanggalan yang dimulai dengan hijrah Nabi Muhammad dari Makkah ke Madinah. 6. Tenda (Di surga terbuat dari permata). 10. Tempat siksa berapi (Ada tujuh pintu yang jarak satu sama lainnya sejauh 70 tahun perjalanan). 12. Dinding (tingginya di neraka 40 tahun perjalanan). 13. Salah satu jenis permata (berbentuk kemah sepanjang 60 mil untuk orang mukmin di surga). 14. Barang (uang dsb) yang mesti dibersihkan dengan zakat. 17. Kata-kata yang diucapkan oleh wali mempelai perempuan pada waktu menikahkannya. 19. Bersifat Islam: Pemimpin yang _____. 21. Orang yang ahli dalam pengetahuan agama. 22. Kata; Perkataan (bagi Tuhan dan nabi). 24. Siksa Tuhan terhadap manusia di akhirat. 26. Kata untuk menyatakan anak laki-laki dari seseorang.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.




5 6 6 7 9 1 2 5 7 3 2 8 5 9 6 4 2 1 8 5 1 9 2 3 4 *****15



WASPADA Jumat 20 Januari 2012

Hewitt Harapan Aussie MELBOURNE, Australia (Waspada): Cedera Andy Roddick memaksa petenis asal Amerika Serikat (AS) itu mengundurkan diri dari duel babak kedua Australia Terbuka melawan Lleyton Hewitt (foto), Kamis (19/1). Kondisi ini menjadikan Hewitt menjaga asa publik Melbourne Park.

Tiga Dara Mempesona MELBOURNE, Australia (Waspada): Tiga petenis cantik yang kerap menjadi incaran wartawan terus melenggang ke babak ketiga Australia Terbuka berkat kemenangan masingmasing, Kamis (19/1). Ketiga dara cantik itu adalah Maria Sharapova (Rusia), Petra Kvitova (Rep Ceko), dan Ana Ivanovic (Serbia). Tiket babak ketiga diraih Sharapova (foto) dengan menyingkirkan Jamie Hampton. Melawan petenis AS itu, Sharapova yang juga peringkat empat dunia tampil terlalu perkasa hingga menang telak 6-1, 6-0. Jawara Australia Terbuka 2008 itu selanjutnya akan ditantang Angelique Kerber (Jerman). Kvitova, peringkat dua dunia, bertahan setelah kehilangan set kedua untuk mengatasi Carla Suarez Navarro (Spanyol) 6-2, 2-6, 6-4. Setelah pertandingan, Kvitova mengaku bahwa kekhawatiran tersebut dibutuhkannya saat itu. “Ini pertandingan yang sangat penting... bagus saya bisa lolos dan saya menang. Bagi saya secara mental ini sangat berat dan saya harus berjuang, sehingga ini menjadi persiapan untuk laga berikutnya,” kata petenis berusia 21 tahun itu. Sementara itu, Ivanovic meraih kemenangan dua set. Unggulan ke-21 asal Serbia ini mengalahkan Michaella Krajicek (Belanda) 6-2, 6-3 dan akan diladeni Vania King. Secara tak terduga, petenis AS ini menumbangkan Anastasia Pavlyuchenkova (Rusia) 5-7, 6-3. 6-4. Sebelumnya, Serena Williams mengatasi rasa nyerinya dengan menuntaskan perlawanan Barbora Zahlavov-Strycova (Rep Ceko) 6-0, 6-4. Lawan Serena di babak selanjutnya adalah Greta Arn (Hungaria) yang menang atas Dominika Cibulkova (Slovakia) 6-2, 3-6, 10-8. Petenis putri lain yang juga lolos ke babak ketiga adalahVera Zvonareva, Ekaterina Makarova, Maria Kirilenko,Vera Zvonareva (Rusia), Sara Errani (Italia), Marion Bartoli (Prancis), dan Sabine Lisicki (Jerman). (m33/ap)

Spurs Bangkit ORLANDO, AS (Waspada): Kekalahan dari Miami Heat di laga sebelumnya sudah dilupakan Tim Duncan cs. Melawan Orlando Magic, Spurs bangkit dengan kemenangan 85-83 di Amway Center, Kamis (19/1). Spurs tertinggal di kuarter pertama setelah tuan rumah unggul 19-13, sedangkan kuarter kedua Spurs balik memimpin. Persaingan ketat kedua tim pun menjadikan pertandingan berakhir dengan penambahan waktu. Bermain imbang 75-75 di waktu normal, lima menit tambahan benar-benar dimanfaatkan dengan baik oleh tim tamu. Tony Parker menjadi pahlawan Spurs dengan 25 poin dan sembilan assist. Di kubu Magic, Dwight ‘Superman’ Howard meraih 24 angka 25 rebound. Di TD Garden, tuan rumah Boston Celtics ke luar dari mimpi buruk setelah menang 96-73 atas Toronto Raptors. Ini adalah kemenangan pertama tim asuhan Doc Rivers itu dalam enam laga terakhirnya. Rajon Rondo tampil menonjol dengan cetakan 21 poin sebelum cedera pergelangan tangan di akhir pertandingan. Tanpa Chris Paul, LA Clippers sukses mengalahkan Dallas Mavericks. Juara bertahan itu dikalahkan 89-91. Bintang Clippers kali ini adalah Mo Williams dengan torehan 26 poin ditambah Chauncey Billups 21 angka. Top skor Dallas disandang Dirk Nowitzki dan DelonteWest yang sama-sama mendulang 17 poin. Hasil lain: Phoenix Suns vs NY Knicks 91-88, Denver Nuggets vs Philadelphia 76ers 108104, Washington Wizards vs Oklahoma City 105-102, New Jersey Nets vs Golden State 107100, Memphis Grizzlies vs New Orleans Hornets 93-87, Atlanta Hawks vs Portland T’blazers 9289, Minnesota T’wolves vs Detroit Pistons 93-85, dan Sacramento Kings vs Indiana Pacers 92-88. (m33/ap)


Tampil di turnamen dengan jatah wildcard, Hewitt tengah memimpin dua set sebelum Roddick mengalami cedera. Mantan petenis terbaik dunia asal Australia itu unggul 3-6, 63, 6-4 sesaat set keempat hendak dimulai. Namun, kesakitan yang dirasakan Roddick membuatnya memanggil bantuan medis. Sebelumnya, Roddick sempat terjatuh di set pertama sehingga dianggap insiden itu menjadi penyebab petenis Negeri Paman Sam tersebut cedera. Akibat mundur, Roddick menyerahkan tiket babak ketiga kepada Hewitt yang pernah menjadi finalis pada tahun 2005. Di babak ketiga nanti, Hewitt akan ditantang petenis muda

asal Kanada, Milos Raonic. Phillip Petzschner (Jerman) disingkirkan Raonic dengan kemenangan 6-4, 5-7, 6-2, 7-5. Unggulan utama dan juara bertahan, Novak Djokovic, melaju mudah ke putaran ketiga. Petenis Serbia itu mengalahkan Santiago Giraldo (Kolombia) 6-3, 6-2, 6-1 dalam waktu satu jam 42 menit. Selanjutnya, Djokovic bertemu Nicolas Mahut (Prancis) yang menang atas Tatsuma Ito (Jepang) 1-6, 7-6, 6-2, 6-2. Kemenangan ini pun memelihara asa Djokovic yang tengah mengincar gelar ketiga di Melbourne (setelah 2008 dan 2011), atau total gelar keempat di arena grand slam. Hanya empat petenis putra memiliki kesempatan memenangi empat

grand slam sebanyak tiga kali atau lebih di era open, yakni Rod Laver, Pete Sampras, Rafael Nadal, dan Roger Federer. Petenis Prancis Jo-Wilfried Tsonga berhasil meraih tiket babak ketiga usai menundukkan Ricardo Mello (Brazil) 7-5, 6-4, 6-4. Unggulan lain asal Spanyol, David Ferrer, juga melangkah pasti. Peringkat lima dunia ini menumbangkan Ryan Sweeting (AS) 6-7, 6-2, 3-6, 62, 6-3. Ikut menjaga peluang meraih gelar tunggal putra di antaranya adalah Juan Ignacio Chela (Argentina), Janko Tipsarevic (Serbia), Andy Murray (Skotlandia), Gael Monfils (Prancis), dan petenis muda asal Negeri Matahari Terbit Kei Nishikori. (m33/ap)

Pasang Iklan HP. 081370328259 Email:


WASPADA Jumat 20 Januari 2012

Medan Metropolitan


Poldasu Gelar Rekonstruksi Pembunuhan Sales Oli MEDAN (Waspada): Polda Sumut, Kamis (19/1), menggelar reka ulang (rekonstruksi) kasus pembunuhan Robert Yulia alias Adi, 31, sales oli (pelumas) mesin yang ditemukan tewas di dalam mobil Mitsubishi Kuda BK 1419 FL di pinggiran jalan depan Pengadilan Negeri (PN) Kota Balige, Kabupaten Toba Samosir. Reka ulang dengan 18 adegan itu dilakukan di halaman depan Reserse Kriminal Umum Polda Sumut. Adegan dimulai ketika tersangka Mustifal Jaya alias Mus melakukan pembunuhan terhadap Adi dengan cara menusuk leher korban dengan pisau. Kemudian dia membawa uang hasil tagihan oli sebesar Rp14 juta, lalu tersangka membuang senjata tajamnya saat perjalanan menuju Medan. Dalam adegan itu korban diperagakan seorang personel polisi, sementara pelaku terlihat sangat tenang saat memperagakan adegan tersebut. Jenazah Adi, warga Jln. Aksara, Kel. Banten, Kecamatan Medan Tembung, ditemukan hari itu juga, Kamis 13 Oktober 2011 pukul 21:30, oleh personel Polantas di Balige yang curiga melihat mobil itu parkir terlalu lama di pinggir jalan. Saat dicek ditemukan mayat Adi dengan bersimbah darah. Kasubid III Dit Reskrimum Poldasu Kompol Andry Setiawan kepada wartawan menyebutkan, rekonstruksi dilakukan untuk mengetahui detail kronologis peristiwa tersebut. “Hasil penyidikan sementara diketahui tersangka melakukan pembunuhan untuk menguasai uang yang dipegang korban,” katanya. Polisi, kata dia, juga masih melakukan pemeriksaan lebih mendalam kasus itu untuk mencari kemungkinan adanya tersangka lain. Tetapi, sebut Andry, kuat dugaan tersangka merupakan pelaku tunggal. “Tersangka MJ alias Mus merupakan pelaku tunggal, dia akan dijerat pasal 338 junto 365 dengan ancaman hukuman 20 tahun,” ujarnya. Tersangka ditangkap dari persembunyiannya di Desa Karangan Putih, Kecamatan Binuang, Kabupaten Tapin, Provinsi Kalimantan, pada 23 November 2011. Penangkapan Mus berawal dari keterangan saksi-saksi dan alat bukti milik polisi. Namun saat hendak disergap tersangka berusaha melarikan diri. (m27)

Waspada/Surya Efendi

TANAH BERMASALAH: Warga melintas di Jln. Selambo, Medan Amplas, Selasa (17/1). Sebagian besar status tanah Jln. Selambo, Desa Amplas di Kecamatan Medan Amplas masih bermasalah dan menjadi sengketa antara penggarap dan pihak perkebunan. Begitu juga tanah garapan lainnya di sejumlah daerah yang kini menjadi ‘bom waktu’.

Kasus Tanah Merupakan Bom Waktu Rezim Orba

Plt. Gubsu Harus Berani Ambil Keputusan Politik MEDAN (Waspada): Kasus tanah di Sumut merupakan bom waktu yang dibuat rezim pemerintahan Orde Baru (Orba). Kata anggota Komisi A DPRDSU Syamsul Hilal, menyelesaikannya harus dengan keputusan politik dan bukan pendekatan administratif. Di ruang kerjanya, Kamis (19/1), Syamsul Hilal mengatakan, belum melihat adanya titik terang dalam penyelesaian masalah tanah. Benar, Plt Gubsu telah membentuk tim tanah. Namun tugasnya adalah melakukan pemetaan tanah. ‘’Itu

berarti penyelesaian yang akan dilakukan melalui pola pendekatan administratif,’’ katanya. Bayangkan, kata Syamsul, di media massa Direktur Dit Reskrimsus Poldasu Kombes Pol Sadono Budi Nugroho mengatakan, saat ini Poldasu menangani 2.833 kasus tanah. Kalau penanganan satu kasus tanah memakan waktu satu tahun, maka masalah tanah di Sumut tidak akan pernah dapat diselesaikan. Harusnya, menurut Syamsul, Plt Gubsu sebagai perwakilan pemerintah pusat di daerah harus berani mengambil keputusan politik, tentunya terlebih dahulu melakukan pendekatan politik. Plt Gubsu harusnya mengeluarkan pernyataan, semua tanah rakyat yang dilindungi undang-undang dikem-

balikan kepada rakyat. Setelah mengeluarkan pernyataan seperti itu, kata Syamsul, selanjutnya Plt Gubsu memerintahkan Badan Pertanahan Nasional (BPN) mengeluarkan tanah-tanah rakyat yang berada di Hak Guna Usaha (HGU) PTPN dan meminta aparat penegak hukum membantu kelancaran pendistribusian tanah kepada rakyat. ‘’Saya yakin, kalau jalan ini ditempuh, enam bulan masalah tanah bisa selesai,’’ tambahnya. Mengenai tumpang tindihnya kepemilikan lahan, menurut Syamsul, tidak sulit diselesaikan. Sebab, sifatnya kasuistis dan tidak banyak. Yang paling sulit diselesaikan adalah konflik rakyat dengan perusahaan perkebunan. Kalau konflik rakyat dengan pengembang, dapat

segera diselesaikan oleh polisi. Rezim Orba Disebutkan Syamsul, konflik tanah ini merupakan bom waktu yang ditinggalkan rezim orde baru (Orba) sejak pada 1966. Saat itu, banyak sekali tanah-tanah rakyat yang subur diambil pihak perkebunan. Rakyat tidak bisa melawan, karena dihadapkan kepada penguasa. Pada saat reformasi, rakyat kembali menuntut tanah mereka dengan alas hak yang dilindungi Undang-undang Darurat No.8 tahun 1954. Sebenarnya, hak perusahaan perkebunan mengusahaan tanah paling lama berakhir tahun 1980. Yakni setelah ketentuan pemerintah yang hanya membolehkan perpanjangan

izin 20 tahun untuk perusahaan perkebunan berakhir. Pada masa penjajahan, lanjut Syamsul, pemerintah kolonial Belanda lewat Agrarische Wet (hukum agrarian) tahun 1870 memberikan hak Erfpacht (sekarang Hak Guna Usaha) kepada perusahaan perkebunan yang harusnya berakhir tahun 1960. Namun sebelum kontrak berakhir, pemerintah Indonesia, sesudah merdeka, membuat aturan baru yang menyebut, hak Erfpacht yang belum berakhir tahun 1960, dapat diperpanjang maksimum 20 tahun. Dengan ketentuan itu, harusnya izin perusahaan perkebunan berakhir tahun 1980. Pemerintah saat itu tidak boleh

lagi memperpanjang izin NV Deli Maatschappij (yang kemudian menjadi PTPN-IX). Setelah itu, harusnya tanah menjadi objek land reform (reformasi tanah) dengan mengembalikan fungsinya sesuai UU Pokok Agraria No.5 tahun 1960, yakni berfungsi sosial. Kenyataannya, pemerintahan Orba membuat kekeliruan, dengan memberikan perpanjangan izin 25 tahun lagi. Bukan hanya itu, pemerintah lewat kekuasaannya ‘merampas’ sangat banyak tanah-tanah rakyat yang subur. Tidak sedikit rakyat yang melawan menjadi korban. ‘’Itulah yang kemudian sekarang ini dituntut rakyat kembali,’’ demikian Syamsul. (m12)

Dua Pencuri Sepedamotor Ditangkap MEDAN (Waspada): Reskrim Unit Ranmor Polresta Medan menangkap dua tersangka pencurian dan penggelapan sepedamotor dalam penyergapan terpisah di Medan. Tersangka S alias Nardi, 28, warga Mabar, ditangkap di kawasan Sunggal, dan FS, 25, warga Jalan Mawar Tg. Selamat, diciduk di Jalan Ayahanda Medan. Keduanya ditangkap saat transaksi dengan polisi yang menyaru sebagai pembeli sepedamotor, Rabu (18/1). Kasat Reskrim Polresta Medan Kompol MYoris Marzuki didampingi Kanit Ranmor AKP Ronald Sipayung ketika dikonfirmasi, Kamis (19/1) mengatakan, tersangka Nardi merupakan residivis dan saat ini masih menjalani pemeriksaan. “Masih diperiksa untuk diketahui siapa saja sindikat curanmor karena ada beberapa laporan polisi dengan tersangka S alias Nardi,”

ujar Yoris. Informasi di Polresta Medan, tersangka Nardi mencuri sepedamotor Yamaha Mio di depan rumah korban Perlindungan, 43, warga Jln. Jamin Ginting, Pancur Batu, Selasa (17/ 1) dinihari. Saat itu sepedamotor diparkir di depan rumah dalam keadaan stang terkunci. Korban selanjutnya membuat pengaduan ke Polresta Medan. Polisi kemudian mencari keberadaan tersangka dan ‘memancingnya’ dengan cara hendak membeli sepedamotor. “Tersangka yang tidak menyadari pembelinya polisi, menawarkan Mio hasil kejahatan Rp2,4 juta dan disepakati transaksi di kawasan Sunggal,” tambah AKP Ronald Sipayung. Polisi yang melihat keberadaan tersangka di Sunggal, langsung menangkap dan memboyong tersangka ke Polresta Medan bersama barang bukti hasil

kejahatan. Sedangkan tersangka FS, melakukan penggelapan sepedamotor milik temannya J Silitonga, 23 warga Pasar I, Gang Dahlia, Setia Budi, dengan modus meminjam sepedamotor Mio milik korban pada 3 Desember 2011. Karena sudah saling kenal, korban memberikan sepedamotornya, namun tidak dikembalikan lagi. Korban membuat pengaduan ke Polresta Medan. Polisi dan korban kemudian melacak keberadaan tersangka dan ‘memancingnya’ dengan modus ada yang mau membeli sepedamotor. Tersangka yang dihubungi melalui handphone mengajak bertemu di Jalan Ayahanda. “Waktu itu tersangka membawa sepedamotor King. Begitu melihat ada polisi, tersangka mencoba kabur, namun terjatuh dan ditangkap,” sebut Ronald. (m39)


PLT Gubsu H Gatot Pujo Nugroho (dua dari kanan), Kasdam I/BB Brigjen TNI I Gede Samertha (tengah), Sekda Sumut H Nurdin Lubis (kanan), Asisten Tata Pemerintahan Setdaprovsu Hasiholan Silaen, foto bersama dengan Kasi Ops Kostrad Kapten TNI Agus HarimurtiYudhoyono di sela-sela apel gabungan TNI/Polri dan Pemprov Sumut, di Makodam I/Bukit Barisan Jalan Medan-Binjai, Selasa (17/1).

Waspada/Rudi Arman

PULUHAN mahasiswa UHN mendatangi Mapolresta Medan menuntut polisi membebaskan rekanrekan mereka yang diamankan, Kamis (19/1).

Pembunuh Kakak Ipar Dibekuk Di Hotel Melati MEDAN (Waspada): Tersangka berinisial AA, 35, warga Karangsari Medan, yang membunuh kakak iparnya, ditangkap petugas Rersese Kriminal Umum Polda Sumut dari kamar Hotel Melati Jln. Utama, Medan, Kamis (19/1), setelah diburon selama dua bulan. Kepada petugas, tersangka mengaku membunuh kakak iparnya Idah br Hasibuan dengan cara menggorok leher karena dendam. “Saya cerai dengan istri (adik korban) karena ulahnya. Dia yang menyuruh adiknya pergi ke Pekanbaru meninggalkan saya,” kata tersangka. Menurut tersangka AA, sebelum melakukan pembunuhan, dia menghubungi korban minta bertemu di Jln. Sisingamangaraja dengan alasan membicarakan hal sangat penting. Kemudian dia membawa Idah ke Hotel Puteri Hijau, Padangbulan simpang Jalan Selayang, Medan. “Saya tahu, dia curiga karena dibawa ke dalam kamar hotel, tapi tetap saya yakinkan tidak berniat apa-apa,” sebutnya. Di dalam di kamar, AA sempat berusaha mengajak kakak iparnya melakukan hubungan badan, tetapi ditolak. “Akhirnya aku koyak bajunya dan lehernya kutikam pisau, kemudian kugorok,” ujarnya. Setelah itu, AA langsung melarikan diri ke Jln. Mariendal dan mengambil sepedamotor milik korban. Tersangka menjual sepedamotor itu di perbatasan Sumut-Aceh kepada seseorang yang tidak dikenalnya seharga Rp3 juta. Dengan bekal uang itu dia berangkat ke Sibolga untuk menghilangkan jejak, kemudian ke Tarutung. Setelah hampir dua bulan bersembunyi, ayah dua anak itu kembali ke Medan, Kamis (19/1), kemudian menginap di Hotel Melati Jln. Utama, Medan. Namun polisi yang telah memantau keberadaan AA, menangkapnya dengan melakukan penggerebekan kamar hotel tersebut. “Saat ditangkap tersangka sempat melakukan perlawanan dan berusaha kabur,” kata Kasubdit III Dit Reskrimum Polda Sumut Kompol Andry Setiawan.(m27)

Ketua Dharma Pertiwi Ajak Masyarakat Manfaatkan Masjid MEDAN (Waspada): Ketua Dharma Pertiwi Daerah ‘A’ Meria Lodewijk F Paulus memberikan bantuan dana pribadi untuk pembangunan masjid, TPA, dan perpustakaan di Jln. Timor Medan, Senin (16/1) lalu. Pada kesempatan tersebut, Meria mengajak seluruh masyarakat untuk senantiasa memanfaatkan masjid sebagai sarana memperkokoh tali persaudaraan, meningkatkan komitmen dan amal untuk saling membantu. “Mari kita jadikan masjid sebagai pusat kebaikan dan kebajikan, sebagai tempat untuk meluruskan akidah dan menjaga kemurnian ajaran Islam berdasarkan Alquran dan Sunnah,” katanya. Kata Meria, melalui masjid kita juga bisa membasuh kalbu, menjaga kebersihan hati, menaburkan salam keteduhan dan kedamaian kepada siapapun. “Yang paling penting kiranya kita juga bisa menambah zikir dan doa kita, seraya terus menggelorakan Islam sebagai rahmat bagi semesta alam,” ujarnya. Dia juga mengucapkan terimakasih kepada semua pihak khususnya Panitia Pembangunan Masjid, TPA dan Perpustakaan Jalan Timor Medan yang telah bekerja keras, menyumbangkan pikiran, tenaga dan bantuannya sehingga ini bisa terlaksana dengan baik. “Marilah kita berserah diri kepada Allah, semoga niat kita yang tulus dan apa yang telah kita lakukan senantiasa mendapat ridho dari Allah SWT serta diberikan kemudahan dalam menyelesaikan tugas dan pekerjaan kita ke depan,” sebutnya. Sementara itu, Ketua Panitia Pembangunan Masjid Kazidam I/BB Kolonel Czi Hari Soebagijo mengatakan, sumbangan ini akan sangat bermanfaat sekali untuk kelancaran pembangunan masjid, TPA, dan perpustakaan yang sedang dibangun. (h02)

Polisi Amankan 10 Pendemo Di Sekolah Nanyang MEDAN (Waspada): Polresta Medan mengamankan 10 orang pendemo saat melakukan aksi menutut penolakan bangunan sekolah Nanyang Jalan Abdullah Lubis simpang Jalan Sriwijaya, Medan Baru, Kamis (19/1) siang. Mereka yang diamankan diduga sebagai provakator dalam aksi demo warga Jalan Tomat bersama puluhan mahasiswa dari Universitas HKBP Nomensen (UHN). Para pendemo itu diboyong ke Mapolresta Medan berserta perlengkapan demo seperti bendera merah putih, spanduk, kertas karton, dan dua unit pengerasa suara (TOA). Para pendemo yang diamankan di antaranya wanita R Pelita Br Saragih, warga Jalan Darat, Medan Baru, sedangkan sembilan lagi merupakan mahasiswa UHN. Kesepuluh pendemo tersebut masih menjalani pemeriksaan di Satuan Reskrim Polresta Medan.

Seorang warga yang diamankan R Pelita Saragih saat dikonfirmasi wartawan mengatakan, dirinya bersama pendemo yang lain diamankan tanpa diketahui apa penyebabnya, demo yang dilakukan pihaknya memilik surat izin aksi dari kepolisian. “Aku pun gak tahu apa penyebab kami diamankan oleh petugas, kalau masalah izin aksi, kami memiliki yang dikeluarkan oleh kepolisian,” kata boru Saragih. Demo Polresta Sore sekitar pukul 15:30, puluhan mahasiswa HKBP UHN mendatangi Mapolresta Medan, dan melakukan aksi digerbang pintu masuk menuntut polisi agar membebaskan rekanrekan mereka yang diamankan saat melakukan aksi demo di sekolah Nanyang. Massa yang menggelar poster dan penggeras suara melakukan orasi agar polisi berlaku adil dan bijaksana atas aksi yang dilakukan rekan-rekan mereka.

“Kami minta kepada bapak polisi untuk membebaskan teman-teman kami yang diamankan saat melakukan aksi tersebut dan kami minta polisi berlaku adil dan bijaksana,” kata mahasiswa dalam orasinya. Selang sekitar 15 menit melakukan orasi, perwakilan dari Mapolresta Medan menjumpai para pendemo. Pihak kepolisian kemudian menginzinkan perwakilan dari massa aksi untuk masuk kedalam ruang pertemuan di Mapolresta Medan. Setelah dilakukan rapat tertutup untuk menampung aspirasi mahasiswa, kemudian para mahasiswa ini membubarkan diri dengan tertib dari Mapolresta Medan. Sementara itu Kasat Reskrim Polresta Medan Kompol Moch Yoris Marzuki mengatakan, saat ini para pendemo yang diboyong ke Polresta Medan masih menjalani pemeriksaan. “Mereka masih menjalani pemeriksaan,” ujarnya. (m39)


KETUA Dharma Pertiwi Daerah ‘A’ Meria Lodewijk F. Paulus menyerahkan bantuan kepada Ketua Panitia Kabintaldam I/BB Kolonel Inf Samuel Petrus Hehakaya, selaku Ketua Umum Panitia Pembangunan Masjid, TPA dan Perpustakaan Jalan Timor.


Medan Metropolitan

WASPADA Jumat 20 Januari 2012


PEMENANG lomba yang menerima hadiah sebagai juara dalam kegiatan LTQ BAPQAH SIKA Sumut tahun 2012.


Fly Over Jamin Ginting Dibangun Awal Februari MEDAN (Waspada): Pembangunan jembatan layang (fly over) Jln. Jamin Ginting dijadwalkan pada awal Februari 2012. Saat ini, sudah memasuki proses tender dan diharapkan berjalan lancar sehingga dapat meminimalisir kemacatan lalulintas di kawasan Simpang Pos.

Tidak Ada PHK Di RS Haji MEDAN (Waspada): Sekdaprovsu H Nurdin Lubis menjamin tidak akan ada Pemutusan Hubungan Kerja (PHK) terhadap karyawan Rumah Sakit (RS) Haji Medan. Namun demikian dia tidak bisa memastikan seluruh karyawan tersebut akan diangkat menjadi Calon Pegawai Negeri Sipil (CPNS). ”Kita akan berkonsultasi dengan Mendagri maupun Kemenpan terkait solusi terbaik bagi karyawan. Sebab ada ketentuan dan larangan terkait pengangkatan CPNS. Namun saya pastikan tidak akan ada PHK pasca pengambilalihan pengelolaan RS Haji Medan oleh Pemprovsu,” kata Nurdin menjawab wartawan di Kantor Gubernur, Kamis (19/1). Diungkapkannya, dalam ketentuan peraturan perundangundangan ada ketentuan yang melarang pengangkatan honorer menjadi CPNS ataupun pengangkatan karyawan menjadi CPNS. Begitu juga pengangkatan honorer di lingkungan pemerintah. Karena itu, katanya, perlu konsultasi dengan kementerian terkait kemungkinan solusi terbaik bagi karyawan RS Haji Medan. Dikatakannya, saat ini pihaknya juga sedang berkoordinasi dengan Dewan Perwakilan Rakyat Daerah (DPRD) Sumut, terkait payung hukum pengelolaan RS Haji Medan yang sebelumnya dikelola yayasan. Koordinasi dimaksud soal rencana akan diterbitkannya peraturan gubernur (Pergub) terkait teknis pengelolaannya. “Payung hukumnya agar kuat tentu harus peraturan daerah (Perda), namun dikarenakan proses penyusunan Perda bisa memakan waktu lama, maka sedang kami koordinasikan agar didahului dengan Pergub. Untuk Pergub ini tentu harus mendapat persetujuan pimpinan DPRD Sumut,” sebut Nurdin. Nurdin berharap dalam waktu dekat sudah ada persetujuan DPRD Sumut terkait penerbitan Pergub soal RS Haji Medan. Dalam Pergub tersebut, katanya, antaralain mengatur keberadaan RS Haji Medan sebagai Satuan Kerja Perangkat (SKPD) di jajaran Pemprovsu. Sehingga pengelolaan tersebut bisa lebih terarah dengan manajemen yang lebih baik. ”Kami berharap dalam waktu dekat sudah ada persetujuan pimpinan DPRD Sumut terkait Pergubnya. Sehingga awal Februari atau akhir Februari sudah bisa diterbitkan Pergubnya,” ujarnya.(m28)

CWI Gelar Bakti Sosial MEDAN (Waspada): Lembaga Citra Wanita Indonesia (CWI) menggelar kegiatan bakti sosial kesehatan gigi dan mulut, di Aula Desa Baru Kecamatan Batang Kuis, Kabupaten Deli Serdang, Selasa (17/1). Bakti sosial yang diikuti 300 masyarakat itu berupa penyuluhan tentang kesehatan gigi, pembersihan karang gigi dan cabut gigi bagianak-anakmaupunorangdewasa.“Kegiataninidilakukandengan mengerahkan 15 tenaga medis profesional dibidangnya dan dibantu 2 orang dokter gigi. Sedikitnya 300 masyarakat di kecamatan tersebut mendapat pelayanan dan pengobatan gratis, baik anak-anak maupun orang dewasa,” kata Ketua Lembaga CWI Rahmadya. Kepala Desa Baru Zulkarnaen mengucapkan terimakasih dan memberikan apresiasi yang tinggi kepada Lembaga CWI yang memusatkan kegiatan bakti sosial kesehatan gigi dan mulut di Desa Baru. “Sehingga masyarakat mendapat pelayanan dan pengobatan gratis. Kegiatan ini mendapat sambutan dan respon positif dari masyarakat Desa Baru, mereka datang berduyun-duyun dari pagi hingga sore hari,” sebutnya. Juhni, warga Desa Baru, mengatakan, kegiatan pelayanan tersebut baru pertama kali dilaksanakan dan sangat meringankan beban masyarakat untuk mendapatkan kesehatan gigi secara gratis. “Kegiatan ini merupakan pembelajaran bagaimana cara merawat gigi dan mulut dengan baik. Penyuluhan tentang manfaat kesehatan gigi dan mulut sangat dibutuhkan masyarakat kecil seperti kami,” ujarnya. (h02)

“Saya sudah jumpa dengan Ditjen Wilayah I Bina Marga Kementerian PU, Asep. Fly over ini sudah memasuki proses tender di Jakarta. Kita rencanakan awal bulan depan dilakukan peletakan batu pertama,” kata Sekda Kota Medan Syaiful Bahri kepada Waspada di ruang kerjanya, Kamis (19/1). Dijelaskan Syaiful, pembangunan fly over harus segera terlaksana mengingat arus lalulintas di kawasan Simpang Pos sangat padat. “Kita harapkan semua elemen masyarakat mendukung pembangunan tersebut,” ungkapnya. Sampai saat ini, lanjut Syaiful, ada tiga persil yang masih bermasalah. Namun, akan dilakukan proses konsinyasi di Pengadilan Negeri (PN) Medan.”Ketiga lahan itu memang belum diserahkan konsinyasinya ke PN Medan, namun sudah diproses. Kita tinggal menunggu anggarannnya. Tapi ketiga persil ini tidak akan mengganggu pembangunan itu,” ujarnya. Menurut Syaiful, pembangunan fly over Jln. Jamin Ginting sesuai tinjauan Perda Nomor 13 tahun 2011 tentang Ren-

cana Tata Ruang wilayah Medan tahun 2011-2031. Fly over Jamin Ginting di Kelurahan Kuala Bekala, Kecamatan Medan Johor ini ditetapkan sebagai bagian dari sub pusat pelayanan Medan Selayang dalam RTRW Kota Medan. Dari desain teknisnya, fly over Jamin Ginting ini, memiliki panjang keseluruhan 850 meter, panjang struktur jembatan 425 meter, lebar 17 meter, terdiri dari dua jalur. Lebar masing-masing lajur 3,5 meter, lebar marka 0,25 meter dari sisi median dan 0,22 meter dari sisi barier. Lebar frontpage road tujuh meter, tambah trotoar dua meter, lebar daerah milik jalan 37 meter, kemiringan perkerasan dua persen. Jenis pondasi bored pile dia 89 cm. Sedangkan untuk konstruksi perkerasan, concerete 27 meter, lean conceret 10 cm dan tipe kolom hexagonal 2,5 meter. Untuk pembebasan tanah selebar 10 meter, terdiri lima meter kiri dan lima meter kanan jalan. Total persil yang dibebaskan dalam pembangunan fly over Jamin Ginting sebanyak 130 persil. Pembebasan persil sudah selesai dilaksanakan, tinggal tiga lagi akan dikonsinyasi ke PN

Medan. “Proyek pembangunan ini dibiayai APBN di bawah tanggung jawab Kementerian Pekerjaan Umum dalam hal ini Ditjen Bina Marga,” terang Syaiful. Sementara itu, biaya untuk pembangunan fly over Jamin Ginting masih dalam proses ke pemerintah pusat. Sedangkan biaya yang diajukan untuk pembangunan tersebut ke Menteri PU yang diteruskan ke Menteri Keuangan sebesar Rp120 miliar. “Program biaya yang diajukan ke Menteri PU dan Menteri Keuangan sebesar Rp120 miliar. Namun , sampai saat ini masih dalam proses di pemerintah pusat,” kata Kasatker Metropolitan Balai Jalan dan Jembatan Kementrian PU Wilayah Sumut Simalatua Sinaga. Dijelaskannya, anggaran yang dikucurkan pemerintah pusat masih menunggu persetujuan, karena kontrak anggaran tersebut tergolong multiyears. “Jadi anggaran itu bukan tahunan. Sampai saat ini kita masih menunggu persetujuan dari pusat yang kontraknya multiyears.Prosesnya panjang, namanya proses PQ,” demikian Sinaga. (m50)

Pengurus BKOW Sumut Dilantik MEDAN (Waspada):Ketua Penasihat BKOW Sumut Hj Sutias Handayani Pujo Nugroho meminta pengurus BKOW masa bakti 2011-2016 dapat menyusun program kerja yang realistis dan implementatif. ”BKOW hendaknya dapat menciptakan program yang langsung menyentuh masyarakat dengan bekerjasama dengan Biro Pemberdayaan Perempuan Provinsi Sumatera Utara,” ujar Hj Sutias Handayani pada pelantikan Pengurus Badan Kerjasama Organisasi Wanita (BKOW) Sumatera Utara masa bakti 2011-2016, di Aula Martabe, Kamis (19/1). Pelantikan dilakukan Sekda Provsu Nurdin Lubis SH, MHum, yang mewakili Gubsu selaku pembina BKOW Sumatera Utara. Hj Sutias juga meminta segenap pengurus, anggota dan penasehat dapat menghayati tugas dan fungsi BKOW Sumut, sebagai wadah kerjasama bagi organisasi-organisasi wanita di Sumut, sesuai anggaran dasar dan anggaran rumah tangga BKOW. Di antaranya melaksa-

nakan dan mensukseskan program pemerintah, memelihara persatuan dan kesatuan antar organisasi anggota BKOW Sumut, menampung dan mengintegrasikan peran sertanya dalam pembangunan sesuai dengan profesi masing-masing, bersama-sama dengan organisasi dan badanlainnyamenyelenggarakan usaha dan memberdayakan perempuan di berbagai bidang. Sementara itu Plt Gubsu H Gatot Pujo Nugroho dalam sambutannya yang dibacakan Sekda Provsu Nurdin Lubis, mengingatkan BKOW Sumut hendaknya ikut berkiprah dalam pembangunan meliputi bidang ekonomi, sosial, pendidikan, Iptek, lingkungan hidup dan lain sebagainya. ”Kaum perempuan yang tergabung dalam BKOW harus mampu bersinergi dengan pemerintah melalui program kerja nyata,” ujarnya. Plt Gubsu juga berharap BKOW dapat mengaktifkan anggota-anggotanya dalam pemberdayaan perempuan dan masyarakat di Sumatera Utara. Ketua Umum BKOW Su-

mut Kemalawati AE, SH mengatakan, pihaknya akan bekerjasama dengan daerah untuk melaksanakan program yang menyentuh lapisan bawah, terutama bagi kaum perempuan yang terpinggirkan. ”Kami coba hadapi tantangan ke depan, walaupun sulit kami akan coba hadapi terutama dengan adanya para penasehat yang siap membantu,” katanya. Pelantikan Pengurus BKOW Masa Bakti 2011-2015 berdasarkan Surat Keputusan Gubernur Sumut 188.44/958/kpts/2011 tanggal 4 Nopember 2011 tentang Pengurus BKOW Masa Bakti 2011-20116. Susunan kepengurusan antara lain terdiri atas Ketua Umum Kemalawati AE SH (Perwanas), Ketua I Dra Ulfah Marzuki (HWMI), Ketua II Chairul Bariah SH, MHum (Wanita Kosgoro), Ketua III Dewi B J Isnaini SE, MSi, Phd (IWAPI) dan Ketua IV Ny WHL Tobing (PIII), Sekretaris Umum Hj Risnawati Siregar (Kerta Wredatama Provsu), dan Bendahara UmumWita Siskandri (IKASFI).(m28)

MEDAN (Waspada): Untuk lebih mengasah kemampuan dan keberanian peserta didik berlomba, Badan Pembinaan QoriQoriah,Hafiz-Hafizah dan Seni Kaligrafi Alquran (BAPQAH SIKA) Sumatera Utara menggelar Musabaqah Tilawatil Quran (MTQ) ke-4 di Jalan M Yakub Medan,diikuti 240 peserta dengan berbagai bidang. Ketua BAPQAH-SIKA Lagut Sutan Pulungan, Kamis (19/1) menyebutkan, pelaksanaan MTQ internal BAPQAH SIKA itu tidak kalah dengan MTQ tingkat kabupaten/kota. “Bukan hanya dari segi pelaksanaan, tapi kualitas pesertanya tidak kalah, karena peserta binaan BAPQAH SIKA ini nanti juga yang akan berlaga pada MTQ kabupaten/kota dan Provinsi Sumatera Utara,” katanya. Menurut Lagut, MTQ ke-4 ini dikemas lebih luas agar mengetahui sejauh mana hasil binaan BAPQAH SIKA yang tersebar di beberapa daerah di Sumatera Utara dan perguruan tinggi. “Insya Allah tahun 2013 mendatang, MTQ ke-5 akan dilaksanakan di luar Kota Medan. Sudah ada calon tuan rumah yaitu, Kota Binjai dan Serdangbedagai. Saya optimis, momen MTQ ini dapat meningkatkan prestasi dan kualitas dalam pembacaan Alquran,” ujarnya seraya menyebut BAPQAH SIKA telah berusia 15 tahun dengan binaan 900 qoriqoriah, hafiz-hafizah se-Sumatera Utara. Sebelumnya, Ketua Panitia Alamsyah menyampaikan bahwa MTQ diikuti 240 peserta. Mereka berlaga di 5 bidang, masingmasing Tartil Quran diikuti 132 peserta, Tilawah Kanak-Kanak 32 peserta, Tilawah Remaja 30 peserta, Tilawah Dewasa 35 peserta, dan Tilawah Cacat Netra 11 peserta. Mereka binaan BAPQAH SIKA yang ada di Sumatera Utara seperti Medan, Deliserdang, Binjai, Langkat, Sergai, Tebingtinggi, Siantar, Sibolga, Dairi, Labuhanbatu, Labuhanbatu Utara, Padang Sidempuan, Madina, dan perguruan tinggi Unimed, USU, UMSU, UMN, dan IAIN. “Kegiatan ini merupakan persiapan untuk menghadapi MTQ kabupaten/kota dan Sumatera Utara 2012 yang sudah di ambang pintu,” kata Alam sembari menyebutkan, kegiatan didukung oleh Camat Medan Perjuangan penasihat BAPQAH SIKA

Ir H Bustinursyah Ucah Sinulingga. Pemenang lomba Sementara itu, para pemenang lomba seperti disampaikan ketua dewan hakim H Ishak Lubis disaksikan anggota Dra Hj Siti Mariyam Parinduri, Dra Hj Halimatussakdiyah Lubis, H Nurdin LC, Syaifuddin Hazmi Lubis dan HM Basri MA, untuk Tartil Putra, juara I Abdul Rahim Hrp (Medan), disusul Abdul Hamid Lubis (Madina), dan M Assabli Damanik (Dairi). Sedangkan pemenang harapan masing-masing M Khairul Fahmi (Medan), Ahmad Tarmizi (Medan) dan Muthawali Nasution (Deliserdang). Untuk Tartil Putri, juara I Nurjannah Adila (Medan), juara II Leoni Kurnia Sari (Deliserdang), juara III Syafira Fatiha (Medan). Pemenang harapan yakni Kansyah Azzahra (Deliserdang), Siti Azzahra Pasaribu (Medan) dan Fitri Mawaddah (Medan). Kanak-Kanak Putra, juara I M Yandri Piliang (Medan), juara II Abdurrahim Harahap (Dairi), juara III Hadigunawan (Madina). Pemenang harapan, M Nazri (Deliserdang), Assabli Damanik (Dairi), dan Khoiruddin Pane (Medan). KanakKanak Putri: juara I Ayu Arita (P Sidempuan), juara II Ainun Mardiyah (Tebingtinggi), juara III Fahrianti Sukma (Deliserdang). Pemenang harapan, Fitri Mawaddah (Medan), Syafira Rizki (Medan) dan Rahima Aini (Deliserdang). Remaja Putra: juara I Ersyad Anshori (Deliserdang), juara II Endiko Ananta (Medan), juara III Syafron Dalimunthe (Madina). Pemenang harapan Asyaad (Langkat), M Alfi Syahri (Labuhanbatu) dan Ali Akbar (Labura). Remaja Putri: juara I Dewi Fadilah (Medan), juara II Sri Wahyuningsi (Langkat), juara III Arsi Zahiri (Labura). Pemenang harapan, Ulfi Widyasari (Deliserdang), Erni Rapita Sari (Deliserdang) dan Rahmiyatul Mawaddah Lubis (Madina). Dewasa Putra, juara I Muammar Lubis (Madina), juara II Suhaili Daulay (Dairi), juara III Imamuddin Daulay (Medan). Pemenang harapan, Awaluddin (Medan), Ahmad Chumaidy (Deliserdang), dan N Azrai Nasution (Tebingtinggi). Dewasa Putri, juara I Hj Misrahwati (Sergai), juara II Mulyana (Dairi), juara III Marlina Lubis (Deliserdang). Pemenang harapan, Rika Putri (P Sidempuan),Yunita Tanjung (Sibolga) dan Siti Hajar (Deliserdang). Sementara pemenang Cacat Netra H Syafrizal Tanjung (Medan) dan Chomsyaniati (Medan). (m37)

Mufti Masjidil Haram Kuliah Umum Di Ar-Raudhatul Hasanah MEDAN (Waspada): Pesantren Ar-Raudhatul Hasanah Jln. Letjen Jamin Ginting, kembali mendapat kunjungan tamu besar dari negara Timur Tengah. Setelah kedatangan Hakim Agung Peradilan Tinggi Saudi Arabia Prof Hisyam Ibrahim al-Khayyat, serta Pimpinan Yayasan al-’Athiyah Qatar dan Ketua Ikatan Dai Internasional Prof Khaled Hendawy, kali ini Mufti Masjidil Haram Prof Abdurrahman JA Qassas yang berkunjung, Rabu (18/1). Turut dalam rombongan itu Komisaris Majalah Qiblati Prof Mamduh Farhan al-Buhairy dan sejumlah tenaga pengajar dariYayasan Risalah Al-Khairiyah Deliserdang. Rombongan disambut Direktur Pesantren Drs H Rasyidin Bina, MA dan Wakil H Solihin Adin, SAg serta beberapa staf pengajar. Selanjutnya diajak berkeliling kawasan pesantren guna melihat dari dekat perkembangan lembaga pendidikan yang merupakan aset wakaf umat Islam tersebut. Setelah melakukan peninjauan, rombongan tamu beramah-tamah di ruang direktur. Di tengah-tengah acara ramah tamah, Prof Abdurrahman Bin Jamil Bin Abdurrahman Qassas yang juga merupakan staf pengajar pada jurusan Dakwah dan Peradaban Islam di Umm al-Qura University Mekah, berjanji akan mengupayakan untuk membantu urusan santri Ar-Raudhatul Hasanah yang ingin melanjutkan studinya di Umm al-Qura University Mekah.

Mendapatkan tawaran itu, Direktur Pesantren Drs H Rasyidin Bina mengucapkan terima kasih dan apresiasi yang setinggi-tingginya kepada tamu agung tersebut. Selanjutnya Mufti Masjidil Haram tersebut memberikan kuliah umum di depan seluruh santri kelas 5 dan 6. Di hadapan santri dan santriwati kelas 5 dan 6 yang berjumlah 600 siswa, Prof Abdurrahman J.A Qassas memberikan ceramah umum dan nasehat kepada seluruh santri. Dalam ceramah yang menggunakan bahasa Arab itu, dia menyampaikan pesan-pesan untuk para santri mengenai pentingnya menuntut ilmu. Prof Abdurrahman juga menjelaskan, bahwa menuntut ilmu tidak dapat dilakukan dengan sikap sombong, melainkan dengan sikap tawadu’ dan penuh harap untuk dapat mengetahui ilmu yang merupakan sebagian kecil ayat-ayat Allah. Seorang penuntut ilmu tidak boleh untuk menyembunyikan ilmu yang telah ia kuasai. Ia harus menyebarkannya demi kepentingan orang banyak. Di akhir kuliah umum itu, beliau meyakinkan santri untuk berani mencoba meneruskan pendidikan di Umm al-Qura’ University, agar dapat mengembangkan pengetahuan yang telah diperoleh di Ar-Raudhatul Hasanah. Dia juga memberitahu para santri bahwa mereka akan dapat untuk mengikuti proses belajar-mengajar di sana jika telah mempelajari apa yang diajarkan di pesantren. Kunjungan satu setengah jam tersebut diakhiri dengan doa oleh Ustadz H Solihin Adin S.Ag, k kemudian melanjutkan perjalanan ke Yayasan AsSunnah Al-Khairiyah, Deliserdang. (cwan)


ROMBONGAN Mufti Masjidil Haram Prof Abdurrahman JA Qassas saat meninggalkan Pesantren Ar-Raudhatul Hasanah Jln. Letjen Jamin Ginting, usai memberikan kuliah umum di pesantren tersebut.

WASPADA Jumat 20 Januari 2012

Medan Metropolitan


Kendaraan Prajurit Yonkav 6/Serbu Diperiksa MEDAN (Waspada): Seluruh kelengkapan termasuk surat kendaraan dinas dan pribadi yang digunakan prajurit Batalyon Kavaleri (Yonkav) 6/Serbu diperiksa Lapangan Yonkav 6/Serbu Jl. Asam Kumbang, Kamis (19/1). Pemeriksaan yang dipimpin Komandan Yonkav 6/Serbu Letnan Kolonel Kav. Sutrisno Wibowo bekerjasama dengan personel Denpom I/5 Medan ini merupakan tindaklanjut perintah Pangdam I/BB yakni, prajurit TNI harus nol kecelakaan. “Nol kecelakaan ini adalah poin kelima yang ditekankan Pangdam I/BB kepada prajurit. Selain itu, Pangdam menekankan, tugas apapun yang diberikan harus berhasil, tujuan latihan dan pendidikan harus tercapai, dalam pertandingan/perlombaan harus menang dan nol pelanggaran,” ujar Sutrisno. Menurutnya, tujuan pemeriksaan surat

dan kelengkapan kendaraan ini untuk meminimalisir, bahkan hingga ke tingkat nol kecelakan yang melibatkan personel Yonkav 6/Serbu. “Kita tidak ingin personelYonkav 6/Serbu tewas di jalan akibat kecelakaan lalulintas. Karena itu, seluruh kendaraan dinas maupun pribadi yang digunakan personel Yonkav 6/Serbu harus diperiksa,” tegasnya. Sementara itu, Pasi 1/lntelijen Yonkav 6/Serbu Lettu Kav PrimaWahyudi menambahkan, dari hasil pemeriksaan ini, masih ditemukan adanya kekurangan mengenai kelengkapan kendaraan seperti kaca spion, tidak memasang plat nomor polisi dan lainnya. “Ada juga surat-surat kendaraan seperti SIM yang sudah berakhir masa berlakunya, serta beberapa pajak kendaraan yang belum dilunasi. Bagi mereka yang tidak memenuhi kelengkapan kendaraan, langsung diperintahkan untuk melengkapi,” tegasnya. (h02)

Desak Pembongkaran Harapan Square

Warga Surati DPRD Medan


BEBERAPA personil Denpom I/5 Medan memeriksa kelengkapan kendaraan berserta suratnya yang digunakan personel Yonkav 6/Serbu di Lapangan Yonkav 6/ Serbu Jl. Asam Kumbang Medan, Kamis (19/1).

Kejahatan Dengan Modus Bisnis Jam Rolex

Nasabah Bank Mandiri Kehilangan Rp125 Juta MEDAN (Waspada): Aksi kejahatan modus bisnis jam tangan merek Rolex dan menghipnotis korbannya kambuh lagi di Medan. Kali ini, nasabah Bank Mandiri di Jln. KH. Zainul Arifin Medan, menjadi korban, dengan kerugian uang tunai Rp125 juta.

Kejadian Di Desa Aek Kanan Karena Rakyat Kecewa MEDAN (Waspada): Akar masalah terjadinya peristiwa Tanjung Siram, Desa Aek Kanan, Kabupaten Tapanuli Selatan, karena kejenuhan dan kekecewaan masyarakat diduga akibat keberpihakan negara/pemerintah serta aparat penegak hukum kepada pengusaha. Pendapat tersebut dikemukakan praktisi hukum H. Hamdani Hararap, SH, MH kepada wartawan di Medan, Kamis (19/1), menyikapi peristiwa pembakaran dan perusakan rumah berikut mobil milik perusahaan perkebunan PT Tanjung Siram di Tapsel, beberapa hari lalu. ‘’Saya menilai pemerintah alpa dan tidak berbuat maksimal. Bahkan, diduga akibat keberpihakan kepada pengusaha,’’ katanya. Hamdani juga mengaku pernah menangani perkara tersebut hingga ke Mahkamah Agung sampai adanya putusan yang mengalahkan masyarakat. Seharusnya pemerintah dengan kewenangannya mengambilalih dan menghentikan kegiatan di lahan perkebunan yang telah habis masa HGUnya. Kemudian, pemerintah atau negara membagikan hak lanjutan terhadap siapa yang paling berhak sesuai Pasal 2 Undang-Undang Pokok Agraria (UUPA) 1960. Dalam konteks ini, pemerintah harus menghentikan kegiatan di atas lahan tersebut. ‘’Artinya, dalam hal ini kepala daerah sesuai kewenangannya melakukan mediasi,’’ujarnya. Hanya saja, lanjutnya, saat dimediasi seharusnya lahan eks HGU itu diambil serta dikuasai pemerintah/negara agar pengusaha tidak merasa tetap berkuasa atas lahan tersebut. Menurut Hamdani, sekiranya mediasi pun tidak bisa lagi, maka sesuai dengan kewenangannya pula, kepala daerah demi kepentingan negara segera menguasai baik fisik lahan maupun pengelolaan perkebunan itu. Mengenai adanya 10 warga yang ditahan Polres Tapsel, menurut Hamdani hal itu tidak perlu dilakukan sepanjang ada jaminan ketertiban dari masyarakat, tokoh adat, tokoh masyarakat, kepala desa maupun yang bersangkutan. Apalagi sebenarnya kejadian itu berakar pada kekecewaan dan kejenuhan masyarakat atas kealpaan pemerintah.(m34)

Keluarga Besar Bekangdam I/BB Wisata Bersama MEDAN (Waspada): Personel Perbekalan dan Angkutan (Bekangdam) I/BB atas gagasan Kabekang Kolonel CBA Helly Guntoro mengadakan wisata bersama di Pantai Pondok Permai, Kec. Pantaicermin, Kab. Serdang Bedagei (Sergai). Demikian siaran pers diterima Waspada, Rabu (18/1). Dijelaskan, wisata tersebut berlangsung, Minggu (15/1), diikuti seluruh warga Bekangdam I/BB sebanyak 1.200 orang yang terdiri dari 620 organik militer dan PNS dan 580 anggota keluarga prajurit (ibu-ibu Persit) dan PNS. Kolonel CBA Helly Guntoro mengemukakan, tujuan wisata bersama tersebut sebagai ucapan rasa syukur kepada Tuhan atas rahmat dan karunia yang diberikanNya. Selain itu, guna pembinaan satuan terutama personel agar solid sehingga tugas apa pun akan berhasil. Menurut Guntoro, tujuan lain adalah menjalin silaturahim sesama warga Bekang, baik antara atasan dan bawahan atau sebaliknya, agar saling mengenal dan timbul rasa kekeluargaan serta kebersamaan, sehingga tidak ada kesenjangan. Dia menyebutkan, wisata bersama itu memberikan penyegaran atau refreshing dan suasana baru bagi prajurit, PNS, dan keluarga. Sekaligus bersosialisasi dengan segenap warga Bekang dan masyarakat/lingkungan dalam pembinaan teritorial terbatas.(h02)

Peristiwa itu terjadi pada Rabu (18/1) pukul 13:30. Namun korban Bintang Hutagalung, 75, penduduk Jln. Universitas, Padangbulan, melaporkan kasus tersebut ke Polsek Medan Baru, Kamis (19/1) siang. Informasi yang diperoleh Waspada di lapangan, peristiwa itu bermula ketika korban berada di Bank Mandiri di Jln. KH. Zainul Arifin Medan. Tibatiba seorang pria berpakaian rapi menghampirinya. Pria yang mengaku berasal dari Brunai Darussalam ini memperlihatkan daftar sejumlah barang elektronik. Diduga terkena hipnotis, korban menuruti ajakan pria tersebut ke mobilnya. Di dalam mobil, korban bertemu lagi dengan pria lainnya yang mengaku warga negara Indonesia. Kedua pelaku terus membujuk korban agar membeli jam

tangan merek Rolex. Setelah ada kesepakatan, korban yang terkena hipnotis langsung mengambil uang dari Bank Mandiri senilai Rp125 juta. Setelah itu, uang tersebut diserahkan kepada pelaku. Kemudian, korban menerima jam tangan Rolex dari pelaku. Selanjutnya, pelaku mengantar korban pulang ke rumahnya. Setelah menurunkan korban di Jln. Dr. Mansyur, kedua pelaku melarikan diri. Beberapa menit kemudian, Bintang baru menyadari dirinya menjadi korban penipuan. Setelah berdiskusi dengan keluarga dan kerabatnya, akhirnya korban mengadukan peristiwa penipuan tersebut ke Mapolsek Medan Baru, Kamis (19/1) siang. Kapolsek Medan Baru Kompol Dony Alexander, SH, SIK, M.Hum mengatakan, pihaknya tetap mengusut kasus

penipuan dengan modus bisnis jam tangan Rolex. Dalam kasus itu, polisi sudah meminta keterangan korban. Sebelumnya, aksi penipuan dengan modus yang sama juga terjadi di Medan. Tiga pelaku dengan logat Malaysia mengambil sejumlah perhiasan emas dan uang senilai Rp35.500.000 milik Ratna Br Siagian, 65, di Jln. Gatot Subroto Medan. Saat itu, korban dari salah satu rumah sakit di Jln. Putri Hijau Medan hendak pulang ke rumahnya di Jln. Buku. Ketika berjalan kaki menuju Jln. Guru Patimpus, korban didatangi tiga pelaku sembari menawarkan jam tangan Rolex. Korban yang sudah terkena hipnotis akhirnya menyerahkan semua perhiasan dan uang miliknya kepada pelaku. Hingga kini pelaku penipuan tersebut belum berhasil dibekuk. (m36)

Bendahara Disdik Labuhanbatu Dituntut 6 Tahun Penjara MEDAN (Waspada): Bendahara Dinas Pendidikan Labuhanbatu Halomoan alias Lomo dituntut enam tahun penjara dalam perkara korupsi dana sertifikasi guru sebesar Rp2,9 miliar, pada persidangan di Pengadilan Tipikor Medan, Rabu (18/1). Jaksa Penuntut Umum (JPU) dalam tuntutannya menyatakan, terdakwa Lomo diyakini bersalah melakukan tindak pidana korupsi pada pencairan dana sertifikasi guru tahun 2010 senilai Rp2,9 miliar. JPU juga menuntut Lomo dengan hukuman uang pengganti Rp1,57 miliar subsider tiga tahun penjara dan hukuman denda Rp100 juta yang dapat diganti dengan pidana kurungan selama enam bulan. Kata JPU, terdakwa bersalah melanggar Pasal 3 Jo Pasal 18 UU No. 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi sebagaimana telah diubah dengan UU No.20 Tahun 2001 Jo Pasal 55 ayat (1) ke-1 KUHP Jo Pasal 64 ayat (1) KUHP. Disebutkan, Lomo telah mencairkan 10 lembar cek yang telah ditandatangani Plt Kepala Dinas Pendidikan (Kadisdik) Labuhanbatu Agus Susanto Purba, dengan total Rp6,7 miliar. Dana tersebut adalah dana sertifikasi untuk 531 guru tahun 2010.

Namun, setelah cek dicairkan dan uang dipegang Lomo, dia hanya mentransfer ke rekening 298 guru. Sedangkaan dana sertifikasi 233 guru sebesar Rp2,9 miliar tidak ditransfer terdakwa ke rekening guru bersangkutan. Uang tersebut, menurut JPU, sebagian digunakan Lomo untuk kepentingan pribadinya dan sebagian lagi untuk menutupi ketekoran kas dinas. Pada sidang terpisah, terdakwa Agus Susanto Purba, Plt Kadisdik Labuhanbatu, selaku Kuasa Pengguna Anggaran (KPA) telah bekerjasama dengan Lomo dalam pencairan dana Tunjangan Profesi Guru (sertifikasi) periode Juli-Desember 2010, menyampaikan pembelaan (pledoi) secara pribadi. Dalam pembelaannya, Agus Susanto menuding JPU tidak profesional dalam memeriksa perkara ini, bahkan terkesan untuk memenuhi keinginan pihak-pihak tertentu. Sebab, menurut dia, banyak keterangan para saksi di persidangan, termasuk keterangan Lomo dan dirinyasendiriyangdikurangidan ditambahi bahkan diubah jaksa. Agus membeberkan keterangan para saksi, keterangan Lomo dan dirinya yang dimanipulasi jaksa dalam pledoinya

setebal 13 halaman itu. Bahkan, untuk meyakinkan majelis hakim, Agus Susanto memberikan sebuah flashdisk yang berisi rekaman keteraangan saksisaksi di persidangan. Agus Susanto mengungkapkan sembilan lembar cek yang ditandatanganinya telah sesuai dengan dokumen pendukung, seperti Surat Perintah Membayar (SPM) dan Surat Perintah Pencairan Dana (SP2D). Kata dia, ke-9 lembar cek itu bukan untuk membayar sertifikasi guru, tetapi untuk kegiatan lain sesuai yang disebutkan dalam SPM, SP2D, dan daftar peruntukkan yang diajukan bendahara. Ke-9 lembar cek yang ditandatanganinya itu adalah, 1 lembar cek senilai Rp200 juta untuk pembinaan Kelompok Kerja Guru (KKG) dan Musyawarah Kerja Kepala Sekolah (MKKS), 7 lembar cek senilai Rp1,4 miliar untuk pembayaran Bantuan Keluarga Kurang Mampu (BKKM)/Bantuan Siswa Miskin (BSM), dan 1 lembar senilai Rp1,2 miliar untuk pengembalian UP/GU Nihil ke kas daerah. “Dana yang ditarik dengan 9 cek tersebut adalah sesuai mata anggaran yang sudah terbit SP2D-nya,” katanya. (m38)

MEDAN (Waspada): Ekses tidak dihiraukannya imbauan anggota dewan agar pembangunan Harapan Square dihentikan sementara (stanvas), warga Jln. Samanhudi kembali menyurati anggota DPRD Medan Cq Ketua Komisi D agar segera melakukan tindakan. Isi surat tersebut mendesakWali Kota Medan segera membatalkan MoU antara Pemko Medan dengan KSU Harapan Square Nomor : 5113/12726 tanggal 28 Juni 2011 dan melakukan pembongkaran terhadap bangunan stan pusat jajanan tersebut. “Dalam surat itu, masyarakat yang tinggal di Jln. Samanhudi/Jln. H Misbah merasa keberatandenganpembangunanHarapanSquare di areal pemukiman,” ujar Amru Daulay, warga Jln. Samanhudi, Medan, Selasa (17/1). Menurut Amru, pembangunan Harapan Square sangat bertentangan dengan peraturan dan perundang-undangan, baik dari segi tata ruang, tata bangunan, lingkungan, kebersihan, kenyamanan dan keindahan Kota Medan. “Selain itu, pembangunan Harapan Square tidak meminta izin dari warga setempat. Kemudian, keberadaan Harapan Square bertentangan dengan Undang-Undang No. 38 tahun 2004 jo Perwal No. 39, Undang-Undang No. 22 tahun 2009 tentang Lalulintas jo Perwal No. 9 tahun 2009,” jelas Amru. Sementara itu, Lintong Siahaan, warga Jln. Samanhudi menambahkan, anggota dewan dalam hal ini Ketua Komisi D harus jeli melihat masalah tersebut. Sebab, tidak hanya masyarakat setempat yang keberatan terhadap pembangunan Harapan Square, namun organisasi-organisasi pelajar juga ikut menyesalkan pembangunan pusat jajanan tersebut. “Anggota dewan dapat melihat sendiri bentuk penolakan tersebut disampaikan Himpunan Mahasiswa Islam (HMI) dan Ikatan Pelajar Muhammadiyah (IPM). Selain itu, juga ada HKBP Sudirman Ressort Medan dan Paguyuban Warkop Medan (PWM),” tambahnya.

Perdata dan Pidana Di tempat terpisah, Direktur LBH Kongres Advokat Indonesia (KAI) Sumatera Utara Zulham Efendi Mukhtar,SH,CN selaku Kuasa Hukum dari Sugiharto Lim, 62, warga Jln. Samanhudi mengatakan, Pemko Medan dapat diancam dengan KUH Perdata dan KUHPidana terkait masalah pemberian izin atas pembangunan Harapan Square. “Kami akan menyampaikan kepada Ketua Pengadilan Negeri Kelas I-A Medan, perihal gugatan perbuatan melawan hukum yang dilakukan Pemko Medan. Juga menggugat Camat Medan Maimun Said Reza, Koperasi Serba Usaha Harapan Square dan lain-lain,” ujar Zulham. Alasan gugatan, menurut Zulham, para penggugat adalah warga pemilik tanah dan rumah yang berlokasi di Jln. Samanhudi/Jln. H. Misbah Kelurahan Hamdan, Kecamatan Medan Kota Medan. Tata lokasi di seputar lingkungan kediaman penggugat, adalah tata lokasi yang mempunyai nilai budaya dan estetika tinggi serta menjadi impian bagi setiap orang. Dengan dibangunnya Harapan Square di lokasi tersebut, jelas berdampak sangat negatif terhadap tata lokasi yang sudah berbudaya tinggi dan berkualitas itu. Dampak negatif itu secara langsung dirasakan penggugat, karena telah menghambat jalan keluar dan masuk di lokasi tanah penggugat. Sementara itu, Marasamin Ritonga,SH,MH mengatakan, rakyat yang merasa dirugikan bisa melakukan tuntutan melalui ranah hukum hingga ke Pengadilan Tinggi Tata Usaha Negara (PTUN) adanya pembangunan Harapan Square. Menurut Ritonga, Pemko Medan yang pernah melakukan penertiban pedagang di areal tersebut, belakangan memberikan izin kepada pedagang lain untuk membuka usaha. Kebijakan ini menimbulkan kecurigaan di kalangan masyarakat. Sedangkan Camat Medan Maimon Said Reza ketika dikonfirmasi Waspada terkait adanya ancaman gugatan Perdata dan Pidana mengatakan, seharusnya hal tersebut ditanggapi bagian Hukum Pemko Medan. “Saya hanya menjalankan perintah pimpinan. Mengenai adanya ancaman hukum bukan wewenang saya menjawabnya,” demikian Said Reza. (m38/m24/m50)

Bangunan Milik Ketua Fraksi PDIP DPRDSU Terbakar MEDAN (Waspada): Bangunan permaBudiman Nadapdap ditanya wartawan menganen milik Ketua Fraksi PDI Perjuangan DPRD takan, dugaan sementara api berasal dari korsleting Sumut Budiman Nadapdap, di Pasar IV Keca- mesin sanyo air. Dia mengetahui kebakaran itu matan Patumbak, Kamis (19/1) siang sekira ketika berada di kantor DPRDSU, kemudian langpukul 13:00, hangus terbakar. sung ke lokasi kejadian. Kerugian akibat kebakaran Tidak ada korban jiwa, namun kerugian tersebut, menurutnya, mencapai puluhan juta mencapai puluhan juta rupiah. Api dapat rupiah. “Bangunan ini rumah singgah, bisa juga dipadamkan setelah dua mobil pemadam dikatakan sebagai dapur umum para kader PDIP kebakaran milik Pemko Medan melakukan yang ingin berkumpul,” katanya. pemadaman. Kapolsek Patumbak dikonfirmasi wartawan Berdasarkan informasi di lokasi kejadian, mengatakan, masih melakukan penyelidikan api diduga berasal dari korsleting mesin sanyo penyebab kebakaran tersebut. “Masih dilakukan air yang saat itu hendak dihidupkan seorang pemeriksaan, tetapi dugaan sementara api berasal pekerjanya bernama Arif. Seorang saksi, Iwan, dari korsleting listrik,” katanya.(m27) 41,menyebutkan,ketikaituArif menghidupkan mesin sanyo air,tiba-tibapercikanapikeluar dari arah belakang rumah itu. Arif semula tidak mengetahuinya,sampaikemudianapimulai membesar, dan dia kemudian meminta bantuan warga. Warga mendapat laporan itu segera membantu berusaha memadamkan api dengan menyiramkan air, namun api terus membesar. Api baru dapat dipadamkan setelah dua mobil pemadam kebakaran datang ke lokasi. Waspada/gito Dalam peristiwa itu, sejumlah barang-barang elek- SEORANG warga berjalan di atas puing-puing sisa bangunan tronik dan sepedamotor mi- yang terbakar milik Ketua Fraksi PDIP DPRDSU Budiman Nadapdap di Pasar IV, Kecamatan Patumbak, Kamis (19/1). Asal lik salah seorang kader PDIP api diduga karena adanya korsleting mesin sanyo air. ikut terbakar.

Pemerintahan Bersih, Berwibawa Jauh Dari Harapan Rakyat MEDAN (Waspada): Penyelenggaraan pemerintahan bersih dan berwibawa masih jauh dari harapan rakyat. Ditandai masih terjadinya korupsi di kalangan pelaksana negara (birokrat) dan ketidakadilan hukum dirasakan masyarakat kecil. Demikian terungkap dalam diskusi publik diselenggarakan Ikatan Alumni Pascasarjana Universitas Medan Area (IKA PPs UMA), di Kampus II UMA Jln. Setia Budi Medan, Kamis (12/1). Diskusi tersebut menampilkan pembicara pengamat politik yang juga Ketua Program Studi Magister Administrasi Publik (Prodi MAP) Warjio SS MA, PhD, Ketua Jurusan Prodi Ilmu Pemerintahan Drs M Aswin Hasibuan MAP, Wakil Ketua Umum IKA PPs UMA Drs Edy Sofyan MAP, dengan moderator Drs Jhony Koto. Dalam diskusi dihadiri Direktur PPs UMA Prof Retno W Astuti, Wakil Direktur Bidang Kemahasiwaan PPs UMA Muazzul SH, MHum dan sekitar 100 mahasiswa S1 dan S2 itu, juga terungkap para peran legislatif sangat mempengaruhi pelaksanaan tata kelola pemerintahan yang baik dan bersih ,sehingga sistem pengawasan dilakukan legislatif berorientasi berbagai kepentingan.

Warjio mengatakan, Parpol juga memberi andil dalam rekruitmen pemimpin penyelenggara negara, sehingga tata kelola pemerintahan yang diharapkan dalam kebijakan publik, tidak sepenuhnya untuk kepentingan publik. Karena itu, dia mengharapkan Parpol harus memberikan pendidikan politik baik dan beretika, sehingga rekruitmen kepemimpinan yang dilaksanakan semakin tercipta pemerintahan yang berwibawa dan bersih. Hal senada dikatakan M Aswin Hasibuan, pemerintahan bersih dan berwibawa setidaknya memiliki empat kriteria yang harus dilaksanakan. Jika ke empat hal tersebut tak terjadi bisa dikatakan penyelenggaraan pemerintahan jauh dari harapan bangsa, negara dan masyarakat. Kriteria tersebut harus bisa mencerminkan keadilan hukum tanpa diskriminasi, terbukanya lapangan pekerjaan dan berkurangnya pengangguran, rasa aman semakin terjamin dan transparansi yang berkaitan dengan anggaran publik berjalan dengan baik. “Transparansi ini tidak memberikan peluang dan ruang penyalahgunaan anggaran publik dan haru bisa dikontrol masyarakat,” ujar Aswin seraya menyebutkan kampus, media massa dan LSM (NGO) juga berperan dalam penyelenggaraan pemerintahan yang bersih dan berwibawa. (m49)



Tinja Dan Sandal Jepit


Juara Bertahan (PA) Harus Manfaatkan Putusan Sela MK


ingginya suhu politik di Serambi Makkah (Aceh) terkait akan diselenggarakannya Pilkada Gubernur Aceh dan Pilkada Kabupaten/Kota diharapkan bisa menurun dengan keluarnya putusan sela Mahkamah Konstitusi (MK). Menteri Dalam Negeri Gamawan Fauzi pun menegaskan, putusan sela MK tentang perpanjangan pendaftaran pasangan calon Gubernur/Wakil, Bupati/Wakil, dan Walikota/Wakil Walikota dalam Pilkada Aceh selama tujuh hari harus ditaati oleh pihak terkait. Putusan sela MK itu jelas untuk mengakomodir tututan banyak pihak terutama dari pendukung Partai Aceh (PA) yang mendominasi dalam jabatan pemerintahan maupun di lembaga wakil rakyat. Kalau benar sekira 80 persen dipegang anggota PA maka wajar sekali tuntutan PA selaku juara bertahan disahuti dengan positif oleh pemerintah dan MK. Sebab, kalau PA memboikot dipastikan jumlah pemilih yang datang mencoblos sangat sedikit dan yang menang pastilah golput. Tingkat legitimasi kandidat yang menang Pilkada menjadi rendah di mata masyarakat, sekalipun dari aspek legalitas hukum sah berapa pun jumlah pemilih yang datang ke TPS. Oleh karena itu saatnya PA sedikit lunak dengan tuntutannya demi kebaikan bersama dan masa depan Aceh yang semakin cemerlang. Sebab, pemerintah sudah mengalah dan memberi kesempatan bagi kandidat kuat PA untuk mendaftar. Membuka kembali pendaftaran. Sebaiknya disahuti dengan positif. Sebab, menunda-nunda Pilkada juga berdampak negatif, terutama bagi pejabat yang segera mengakhiri masa jabatannya dan tersendatnya pelayanan maupun program pembangunan. Hemat kita, saatnya PA menunjukkan kebesarannya dengan mendaftarkan para calon-calonnya terbaiknya dalam Pilkada Gubernur maupun Walikota dan Bupati. Sebab, peluang calon dari PA cukup besar. Apalagi kalau PA mampu memobilisasi anggota dan simpatisannya. Kans menang di atas 50 persen. Namun Intisari begitu, semuanya terpulang dari kualitas calonnya juga. Karena itu PA harus selektif mengajukan/mendaftarkan calonnya. PilkadaAceh harus diikuti Kalau calonnya bagus dan baik tentulah dan melibatkan semua akan didukung oleh masyarakat. Namun calonnya tidak dikenal, tingkat partai yang ada di Aceh, kalau elektabilitasnya rendah, kredibilitasnya terlebih PA, sehingga kurang, walaupun dicalonkan partai besar tercipta situasi kondusif sulit bisa memenangkan Pilkada yang bebas dan rahasia. Ingat, dan kesejahteraan yang berlangsung rakyat sudah melek hukum dan tahu lama ditunggu dapat se- melihat calon-calon yang bersih dan berkualitas. gera terwujud Kita berharap dari Pilkada yang djadwalkan berlangsung serentak nanti berhasil terpilih pemimpin yang lebih baik, lebih mengerti akan tuntutan rakyat kecil, lebih demokratis, lebih mampu membangun kejayaan Aceh ke depan. Siapa pun calonnya tidak begitu masalah bagi rakyat. Bisa datang dari tokoh politik, pemerintahan, masyarakat, maupun akademisi dll. Jika melihat nama-nama yang bakal bertarung dalam Pilkada Aceh, termasuk menentukan siapa BL-1 periode 2012-2017 maka calon dari PA memiliki peluang paling besar, terlebih sudah memiliki pengalaman dari tokoh masyarakat, politik, dan pemerintahan. Apalagi kalau sosoknya merakyat. Tidak pada masa Pilkada saja dekat dengan rakyat tapi setelah terpilih pun rajin turun ke lapisan bawah. Bisa terjadi, jika PA mendaftarkan calonnya akan terjadi persaingan ketat dengan tokoh-tokoh eks GAM yang juga mendaftar lewat jalur independen, seperti Irwandi Yusuf dan lewat parpol seperti M. Nazar. Dipastikan pula suara dari anggota dan simpatisan PA akan terpecah. Soal siapa yang beruntung akan terlihat dari seberapa serius mereka berkampanye, melakukan tebar citra dan pesona kepada masyarakat/rakyat. Juga tergantung dari program kerja serta dukungan dana yang tersedia. Siapa pun yang menang kita berharap jalannya pemerintahan di Aceh semakin baik, dapat menunjang dan meningkatkan sektor ekonomi sehingga kesejahteraan yang lama ditunggu dapat segera terwujud pasca Pilkada 16 Februari mendatang atau mengalami penundaan beberapa pekan bila terdapat calon-calon yang baru mendaftar setelah putusan sela MK. Begitu pula dengan maraknya aksi kekerasan dan terror berkaitan dengan Pilkada harus dihentikan. Terlepas kasusnya hanya kriminal biasa atau terkait politik dll yang jelas kita sangat prihatin melihat memanasnya dan semakin berkembangnya sikap pro dan kontra terkait Pemilukada Aceh yang sudah di ambang pintu ini. Mari kita jaga bersama-sama sehingga situasi keamanan di Aceh kondusif dan Pemilukada dapat berjalan dengan aman, tertib dan lancar. Salah satu kuncinya adalah dengan ikut sertanya calon-calon dari PA memanfaatkan putusan sela MK.+


Faks 061 4510025


+6285261172936 Dalam bahasa Melayu (Riau) Baginda _ Paduka _ Cerpu artinya adalah terompah Raja atau semisal sandal je pit Raja jadi kalau ada ust mengatakan dalam tausiah nya menyebut: Baginda Rasululah Muhammad Saw artinya (maaf) Terompah Rasulullah Muhammad Saw atau Sandal jepit Rasululah Muhammad Saw _ oleh sebab itu cukuplah gelar Nabi kita _ SAW _ tak usah pakai gelar karangan manusia tak jelas _ yaitu Baginda atau Sayyidina _ kita sebagai muslim yg sholat tak boleh marah atau emosi kalau kebiasaannya atau amalan orang tuanya diluruskan _ di Al Qur’ an sélalu menyebut_ apakah kamu tidak berpikir atau apakah kamu tidak berotak _ oleh sebab itu kita tidak boleh marah marah _ok_ HR Abu Daud Ahmad Nasa’i juga menuturkan ; Nabi Muhammad Saw marah digelar “sayyid” itu kata Nabi sama dng suara setan _ menurut riwayat terompah Nabi berwarna kuning,maka bisa disebut baginda kuning_ mari kita kembali kepada Al Qur’an Hadits sémoga berkenan bagi yg mau mencari ke benaran_Bukan yg mau mencari kemenangan _ dan bersyukurlah masih ada orang yg mau meberi peringatan dengan dalil _ Wassalam gd jhr. +6281264448292 SELAMAT ULTAH yg ke 65 bwt WASPADA. semoga makin succes. +6285275110866 Selamat HUT Hr.WASPADA Ke 65, semoga sukses & jaya sepanjang masa dan makin dekat dihati masyarakat sumut & Aceh ttd Sofyan Parinduri.BA (Ketua Komda LMR-RI Kota Tg.Balai. +6285261172936 Jika Aceh jadi merdeka pasti Negara Aceh dibawah komando negara kuat adidaya dan semua tambang yg ada akan dikuasai oleh negara yg membantu kemerdekan Acéh _ sama nasibnya jika Papua merdeka, begitu juga jika Ambon merdeka sama saja _ negara negara kécil yg baru merdeka apalah daya takkan bisa berdaulat dari bayang bayang negara adi kuasa_oleh sebab itu rakyat jangan mau diajak ikut berontak apalagi jadi teroris_ kalau kamu mati kasihan istri anakmu dan orang tuamu _kalau seandainya merdeka kamu tetap jadi belacan dan janji kemakmuran itu hanya angan angan para pimpinan pemberontak ia hanya ingin menjadi penguasa dinegara kecil dia tidak peduli apakah negara dibawah pimpinañnya berdaulat atau tidak_yg penting dia jadi raja -Islam tidak mengajar kan untuk berontak pemisahan tapi berusahalah utk perbaikan _ sekali lagi jangan mau ikut berontak _ Indonesia cukup tangguh dan sia sia usaha pemberontak _ mari kita bina Indonesia ini menjadi negara Adi Daya _ wass gd jhr. +6285275110866 Mohon kpd KAKANWIL KEMENKUM &HAM Utk turun Ke LAPAS Tg.Balai,guna melakukan tes urine kpd pegawai LAPAS , krn saya duga 45% pegawai lapas pemakai NARKOBA. +6285275437438 Masalah PETRUS di Aceh jangan kait2kan dgn Etnis,memang yg korban Etnis Jawa tapi PETRUS nya belum tentu Etnis Aceh,bisa saja Etnis lain yg sudah tahu seluk beluk Aceh dan udah hafal daerah Aceh !

WASPADA Jumat 20 Januari 2012

Oleh Djoko Sugiarno Adalah mustahil manusia berkualifikasi ketua DPR, bisa tidak tahu besarnya anggaran untuk mengurusi tinjanya sendiri.


asanya belum lama kita menyaksikan bagaimana Ketua DPR RI ngotot ingin membangun gedung baru senilai 1,8 triliun rupiah yang akhirnya gagal karena derasnya protes rakyat. Lho, ternyata keinginan serupa muncul lagi dengan kemasan renovasi ruang kerja Badan Anggaran DPR RI (Banggar) senilai 20 miliar dan penggantian 220 toilet senilai 2 miliar rupiah. Para anggota DPR yang sudah bergaji super, masih terus minta dimanjakan dengan bermacam fasilitas mewah, dan tidak bisa buang hajat jika tidak dengan closet mewah berharga puluhan juta rupiah. Alkisah, tersebutlah seorang remaja bernama Al yang berhadapan dengan hukum karena mencuri sepasang sandal jepit milik anggota kepolisian. Al dituduh mencuri dan diancam hukuman 5 tahun penjara. Idem Nenek Minah yang diganjar 1,5 bulan karena mengambil 3 butir buah Coklat milik PT Rumpun Sari Antan, atau Kisah Tuminem – Suminem yang terancam lima tahun penjara karena mencuri 2 kg Bawang Merah, atau kasus legendaris Sengkon Karta yang sudah menjalani hukuman 10 dan 12 tahun penjara karena perbuatan yang tidak mereka lakukan. Kesemua kasus itu menggambarkan betapa tidak berdayanya kaum dhuafa di depan kedigdayaan hukum. Memang, bagaimanapun, mencuri adalah perbuatan melanggar hukum tanpa perlu menimbang apa yang

dicuri. Tetapi karakter hukum lainnya akan segera mencuat ketika tersangkanya adalah koruptor miliaran rupiah. Ketegasan dan kedigdayaan hukum akan berubah jadi begitu lembut dan penuh toleransi. Azas Praduga Tak Bersalah demikian dominan. Sidangnya berjalan sangat lamban, berlarut-larut dengan jalur yang kian kusut. Kian besar uang terlibat, tambah lambat hukum berjalan. Kalaupun akhirnya jatuh vonis (biasanya cenderung lebih ringan) dan dipenjara, mereka kerap mendapat fasilitas ‘wah’ di dalam penjara, sesuatu yang tak bisa didapat Al, Nek Minah dan Sengkon – Karta. Simak saja apa yang didapat Arthalita Suryani di penjara. Lebih tragis lagi, jika kasusnya melibatkan tokoh (atau partai) penguasa. Segala logika hukum yang meringankan terus diupayakan. Simak bagaimana perjalanan hukum Tommy Soeharto atau kesemrawutan penyelesaian skandal Bank Century yang melibatkan mantan Menkeu Sri

Mulyani. Atau kasus yang sekarang sedang berjalan, Kasus Wisma Atlit Hambalang dan Jaka Baring yang melibatkan Anas Urbaningrum dan Andi Alfian Malarangeng. Diduga kuat, kasus ini akan di-Century-kan, alias dibuat kusut dan mengabur. Maka tak heran jika kelakuan manipulasi seperti kasus rencana pembangunan gedung baru DPR, atau rencana renovasi ruang sidang Banggar berukuran 10 x 10 meter berbiaya 20 miliar, atau renovasi WC para anggota DPR senilai ‘hanya’ 2 miliar ‘saja’. Toilet eksklusif Di banyak desa, sampai saat ini masih dijumpai masyarakat yang membuang hajat di ladang atau lahan terbuka. Di Jakarta bahkan, WC umum yang berderet di sepanjang pinggiran kali masih lazim dijumpai. Tidak semua rumah di ibukota memiliki WC sendiri walau keberadaan WC adalah sebuah kemutlakan. Sebagai tempat membuang sampah organic-fisiologis manusia, WC memang sangat penting dan mutlak diperlukan. Tetapi – juga – karena menjadi tempat sampah fisiologis itulah, WC menjadi tempat yang palng dibenci dan dihindari. Karenanya, jangan heran jika sikap budaya masyarakat Indonesia terhadap WC umum sangatlah tidak baik. Simak saja kondisi WC umum di pasar, terminal atau bahkan bandara. Bau,

becek dan jorok. Grendel pintu hilang, kuncinya rusak pintunya kropos dan kran airnya raib. Masih untung jika airnya mengalir. Maka tidak mengherankan jikaWC‘umum’ di gedung wakil rakyat juga digambarkan rusak dan jorok, sehingga membutuhkan renovasi. Sayangnya, renovasi yang diajukan kesekjenan DPR itu bernilai 2 miliar rupiah. Sebuah besaran yang sangat fantastis hanya untuk mengurus tinja anggota dewan. Dana sebesar itu bisa digunakan untuk membangun ribuan WC umum sepanjang kali Ciliwung. Maka wajar jika masyarakat kemudian bereaksi keras dan mencibiri kebijakan itu. Yang mengherankan adalah reaksi Ketua DPR Marzuki Alie yang malah menunjukkan sikap berang kepada Sekjen Nining Indra Saleh yang dijadikan tameng kritik masyarakat. Marzuki Alie menyatakan tidak tahu dan menyatakan akan memecat Nining jika terus memojokkan anggota dewan. Aksi Marzuki jelas tidak masuk akal, karena segala kebijakan itu harus melalui persetujuan Badan Urusan Rumah Tangga DPR, yang ketuanya ya dia sendiri. Kasihan bangsa besar ini jika dipimpin oleh manusia yang tidak tahu apa-apa. Yang tahunya hanya datang, duduk, diam, duit (baca : bersidang). Kasihan bangsa Indonesia yang hanya sibuk ngurusi kemanjaan wakil rakyatnya yang terus minta fasilitas yang memboroskan anggaran. Kasihan bangsa ini jika hanya disibukkan mengurusi tinja angota DPR dan menghakimi para pencuri sandal jepit. Atau memang kita harus mulai menyadari bahwa para petinggi bangsa ini memang golongan manusia berkualitas tinja dan sandal jepit……keciaan deh lu…. Penulis adalah Pemerhati Sosial Politik.

Trial By The (Blunder) Dewan Pers Oleh Sofyan Harahap Dewan Pers berani menyatakan ACM tidak profesional, maka saya pun tega menandaskan DP ‘’blunder’’ atau membuat kesalahan fatal dalam melakukan penyelesaian kasus pengusiran dan menghalang-halangi pers saat menjalankan tugas mencari berita sehingga membentuk, menggiring, dan bisa menyesatkan opini publik.


ndang-Undang Pers No 40 Tahun 1999 menugaskan Dewan Pers (DP) untuk menjaga KemerdekaanPersdanmenegakkanKode Etik Jurnalistik (KEJ) dengan penuh tanggung jawab. Berkat disahkannya UU Pers ini pula DP dibentuk. Alhamdulillah, perjuangan berat para pendekar kita di bidang pers sudah dapat dilewati dengan penuh semangat tanpa pamrih, berdedikasi tinggi, dan kerja keras tak kenal lelah semasa kepemimpinan Atmakesumah Astraatmadja dan Prof. Ichlasul Amal. Sayakenaldengankeduanya.Dedikasi merekatidakdiragukanlagi.PakAtmapula yang membesarkan hati, ketika kantor Waspada–tempatsayabekerja—diserang oleh sejumlah oknum anggota FKPPI beberapa tahun lalu. Pak Atma langsung telefon dari Jakarta, berulang kali. Saat saya mintapertimbangannyaseputartuntutan pihak FKPPI, Pak Atma tegas menolak, ‘’Bung Sofyan, jangan ladeni jika mereka minta (maksa) macam-macam. Cukup sekali saja muat hak jawab mereka, titik!’’ Meski dengan anggaran terbatas di awal-awal berdirinya DP sudah bekerja optimal, melebihiharapaninsanpersatau orang-orang media. Kecilnya anggaran tidak membuat Atmakesumah dkk berkecil hati. Malah menjadi motivasi untuk beraniberjuang,majutakgentarmembela hak-hak wartawan dan media massa dari pihak-pihak yang ingin mengkriminalisasikan pers nasional dan daerah.‘’Kebebasan pers dandemokrasimemangharus diperjuangkan,’’ katanya. Pesan itu persis seperti pesan pendiriWaspada Moh Said danHj.AniIdrussemasahidupnya,sehingga saya ingat betul. Saya benar-benar merasa tidak sendirian. Dukungan personel DP di masa lalu demikian luar biasa, membanggakan, membuat saya kian tegar memperjuangkan eksistensi idealisme kewartawanan saya, tak putushingga tigadasawarsa lebih menjalankanfungsipersyangmencerdaskan,menjalankanmisisucimembelahakhak rakyat yang tertindas. Bagaimana dengan DP saat ini? Secara langsung saya belum pernah bertemu dengan Prof Bagir Manan. Tentunya, saya sebagaimana juga dengan insan pers lainnya, kepingin bisa bertemu. Namun begitu, saya tetap mengikuti perjalanan dan sepak terjang (progress) DP dari awal berdirinya hingga sekarang dalam menjalankan fungsi dan visi misinya. Saya akui cukup berat, terutama terkait dengan melindungi kemerdekaan pers dari campur tangan pihak lain dan meningkatkan kualitas profesi kewartawanan. Tentu, selain begitu banyak hal-hal yang positif sudah dilakukan DP pastilah ada yang kecewa. Dan saya termasuk di dalamnya. Ada yang mengganjal dan menimbulkan keprihatinan dalam hati, melihat semangat oknum di DP (kok) cenderung menurun dan inkonsistensi, sekalipun anggarannya sudah ditingkatkan bermiliaran rupiah. Walaupun belum pernah bertemu langsung namun saya ‘’hakkul yakin’’ dengan kesungguhan dan keberpihakan Prof Bagir Manan dalam memajukan

kemerdekaan dan kebebasan pers Indonesia, serta enam fungsi Dewan Pers lainnya. Tentu Prof Bagir Manan belum sekelas Pak Atma di bidang pers, tapi saya yakin betul dia bukan salah pilih. Andai saja‘trackrecord’, visidanmisibeliauselaku calon ketua DP tidak baik, pastilah mayoritasdarianggotaDPperiode 2010-2013 tidak memilih beliau. Yang pasti, kehadiran Prof Bagir Manan positif jika didukung oleh orangorang pers kelas pejuang dan memiliki kompetensi.Sebaliknya,eksistensiDPbisa rusak jika diisi orang-orang yang tidak kapabel, petualang, lemah dalam pengawasanterhadapkinerjaoknumbawahannya, apalagi kalau dapat‘’dipermainkan’’ atau ‘diakal-akali’’ oleh stafnya sehingga berdampak buruk bagi masa depan kemerdekaan dan kebebasan pers yang sudah lama diperjuangkan dan didambakan masyarakat. Hal yang saya sebut terakhir itu pun menimpa wartawan saya di Tapsel, Ahmad Cerem Meha (ACM). Blunder Terus terang, saya kecewa berat dengan keluarnya Pernyataan Penilaian dan Rekomendasi (PPR) Dewan Pers Nomor 01/PPR-DP/I/2012 Tentang Pengaduan Ahmad Cerem Meha terhadap PT. Agincourt Resources (PT. AR). Pasalnya, wartawan saya dinilai tidak profesional dan bersikap berlebihan ketika menanggapi pengusiranpimpinanPT.ARagariakeluar dari ruangan mediasi tertutup di PT. AR, 10 Agustus 2011, sehingga divonis melanggar Pasal 2 KEJ. Nah, jika Dewan Pers berani menyatakan ACM tidak profesional, maka saya puntegamenandaskanDP‘’blunder’’atau membuat kesalahan fatal dalam melakukan penyelesaian kasus pengusiran dan menghalang-halangi pers saat menjalankan tugas mencari berita sehingga membentuk, menggiring, dan bisa menyesatkan opini publik. Berikut, inilah sedikitnya enam alasan mengapa saya mengatakan DP ‘’blunder’’ sbb: Pertama, putusan sepihak itu pasti akan berdampak buruk bagi masa depan kebebasan pers kita. Sebab, putusan sepihak DP bisa menjadi yurisprundensi hukum terkait kasus-kasus pengusiran ataumenghalang-halangitugaswartawan di masa mendatang. Kedua, DP tidak perlu jauh-jauh dan mengeluarkan dana besar datang dengan tim besar ke Medan, kalau hanya sebegitu saja (amatiran) penyelesaian pengaduan ACM. Sekira satu jam saja, tanya-jawab. Lantas, muncul di layar komputer draft damai berisi: Kedua belah pihak saling memaafkan, lantas salaman, masalah dianggap selesai. Ketiga, ini yang paling mengherankan saya. Kasus ACM yang diusir dari forum pertemuan oleh PT. AR yang bersengketa dengan masyarakat Tapsel terkait kasus tanah ulayat/adat, perusakan hutan dan lingkungan, sudah dilaporkan ke polisi dan polisi sudah menindaklanjuti kasusnya dengan memanggil semua pihak yang terlibat. Termasuk meminta keterangan dari saksi ahli Dewan Pers/PWI Sumut (H. Ronny Simon). Biasanya, ka-

lau kasusnya sudah berlanjut ke ranah hukum DP menolak menanggapinya lagi. Tapi, kali ini DP ‘’berbaik hati’’ terhadap PT. AR. Ada apa? Mungkin karena tahu kasusnya segera ke pengadilan dan pengaduan ACM di atas kertas bakal menang (karena banyak saksi dari tokoh adat yang membenarkan pengusiran dan menghalangi tugas wartawan oleh PT. AR untuk mendapatkan berita terkait hak masyarakat dan kepentingan publik. Termasuk saksi ahli bersertifikat dari Dewan Pers/PWI pun sudah menyatakan dalam BAP bahwa tindakan petugas PT. AR melanggar UU N0.40/1999). Saya pun melakukan klarifikasi/verifikasi ulang pada Ronny Simon apakah benar ia datang ke TKP (Tapsel) yang jauhnya delapan jam perjalanan untuk mengumpulkan bahan (data) yang dapat dipertanggungjawabkan. Jawaban bung Ronny melegakan saya. Namun semua fakta-data di lapangan terkait arogansi PT. AR dimentahkan tim DP hanya dalam pertemuan sekira satu jam di sebuah hotel di Medan, dengan pihak PT. AR yang diwakili seorang staf. Bukan pelaku utamanya.SedangkanSteviThomasselakumanajerPTARyangmenjadi‘’biangkerok’’masalah tidak penting memenuhi panggilan DP.Saya memaksa ACM datang memenuhi undangan DP guna diminta keterangan agar DP memperoleh gambaran sebenarnya dari tangan pertama, namun semua keterangan dan penjelasan dari saya (saya tegas minta direkam agar dapat didengar olehpetinggiDPdiJakarta)malahdianggap tidakada.Sungguhmengecewakankinerja timDP. Takadapoinapapunseputarpenjelasan dan pertanggungjawaban saya termuat/dimuat dalam putusan DP yang sepihak dan mendiskreditkan itu. Keempat, putusan DP yang menyatakan tidak terjadi penghalangan dalam peliputan jurnalistik terhadap ACM oleh PT. AR melukai hati masyarakat, khususnya komunitas pers di Sumut dan lebih khusus lagi di Tapsel. Masalahnya, DP hanya datang ke Medan, tidak terjun ke lokasi yang sebenarnya. Melayangkan pemanggilan terhadap Penanggung Jawab Waspada, Ahmad Cerem Meha, dan Ketua PWI Perwakilan Tabagsel pada Senin (12/ 12). Tim DP benar-benar tidak profesional. Keterangan dan argumentasi saya dan ACM sama sekali tidak ditanggapi secara proporsional. Menyesal saya datang memenuhi undangan via fax kalau tim DP hanya percaya keterangan pihak PT. AR yang datang dalam pertemuan itu diwakili seorang wanita dari staf humas (bukan orang yang terlibat langsung) dan dalam undangan namanya tidak tercantum. Kelima, saya menilai putusan DP bertentangan dengan ‘’ruh’’ UndangUndang No 40/1999. UUPers itu sendiri sudah tegas meniadakan pemasungan, sensor, bredel oleh siapa pun juga, termasuk oleh negara. Sayangnya, lembaga pengontrol etika profesional kalangan pers pula yang seakan turut menghambat wartawan menjalankan fungsi misi sucinya berpihak pada masyarakat (Tapsel) dalam kasus PT. AR. Pendapat DP tidak terjadi penghalangan peliputan jurnalistik terhadap ACM yang dilakukan oleh PT. AR sebagaimana disebut di dalam UU No. 40 tentang Pers tampak seperti rekayasa oknum sehingga diperlukan kajian ulang dengan membentuk tim independen guna mencari data dan fakta sebenarnya. Bukan hanya berdasarkan keterangan satu pihak saja lantas menyatakan ACM tidak profesional, melanggar KEJ dan tuduhan keji lainnya. Sebab, selain diundang tokoh adat, ACM juga menggantungkan identitas kewartawanannya di

dada. Lagi pula pertemuan itu sarat dengan kepentingan umum, yaitu masyarakat yang dirugikan karena keberadaan PT. AR menimbulkan masalah dan identik dengan kerusakan alam dan lingkungan. Apalagi DP mengaitkannya dengan permintaan damai di luar konteks jurnalistik yang tidak dilakukan ACM. Kalaupun ada pihak yang menunggangi, semisal dari organisasi meminta kerjasama, hal itu seharusnya dijelaskan dan diklarifikasi pada saat pertemuan secara terbuka, sehingga tidak merugikan hak-hak orang lain, seperti saya (Waspada), ACM, dan juga masyarakat pers. Jangan sampai masalah utamanya dihilangkan, dicari-cari masalah baru yang belum tentu benar karena bisa saja itu trik jahat dan jebakan PT.AR. Ini membuat saya shock dan kehilangan selera makan sampai lima hari. Keenam, kesimpulan akhir dengan berat hati saya menyesalkan putusan sepihak DP. Putusan itu harus dikoreksi karena berdampak langsung pada kelanjutan proses hukum. Campur tangan DP merupakan intervensi. Seharusnya, DP menunggu proses persidangan selesai, menaatihukumdankodeetik,tidakmempermalukan saksi ahlinya di Medan. Jika sudah ada putusan pengadilan siapa bersalah baru membuat putusan dengan mengedepankanfaktahukum,saksi-saksi, bukan asumsi dan keterangan sepihak PT.AR belaka agar tidak dicap melakukan: ‘’Trial by The Dewan Pers’’. Dus, kalau dulu ancaman kebebasan pers datang dari satu sisi: penguasa, kini bisa datang dari mana saja. Tidak adil rasanyakalauhanyamenyalahkanpenguasa dan oknum-oknum di kalangan masyarakat saja, tapi ancaman kemerdekaan pers pundapatdatangdanditunggangiinternal pers sendiri, termasuk ‘’blunder’’ dari kalangan oknum DP jika tidak profesional menjalankan tugasnya, apalagi kalau punya ‘vested interest’. *** Penulis adalahWakil Penanggung JawabWaspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Pemprovsu alokasikan Rp1,16T untuk infrastruktur - Tol Medan-T.Tinggi apa kabar? * Walikota Medan canangkan UN jujur 2012 - Jangan ada dusta diantara kita, he...he...he * BKKBN: Budaya dua anak cukuk mulai luntur - Maklum banyak anak, banyak rezeki!


D Wak


WASPADA Jumat 20 Januari 2012


Penyebab Karam Ada Di Peta KOMANDAN penjaga pantai Italia, Cosimo Nicastro, mengatakan batu karang yang ditabrak kapal pesiar Costa Concordia tercetak di peta jalur pelayaran. “Fakta menunjukkan kapal telah menabrak batu karang dan karang ini jelas ada di peta jalur pelayaran. Semua orang tahu ada batu karang di perairan tersebut,” kata Nicastro, hari Rabu (18/1). “Semua orang juga tahu ada batu karang yang berbahaya bagi kapal dan posisinya 150 meter dari pantai.” “Kami ingin tahu mengapa kapten kapal masuk ke perairan ini dan kemudian menabrak batu karang tersebut,” kata Nicastro. Sebelumnya kapten Costa Concordia, Fransesco Schettino, yang membelokkan kapal dari rute normal ke jalur dekat Pulau Giglio, mengatakan peta

yang ia miliki tidak memperlihatkan adanya batu karang. Schettino saat ini menjalani tahanan rumah dan menghadapi dakwaan menyebabkan kematian orang lain namun dia membnantah dakwaan tersebut. Dua puluh sembilan orang masih dinyatakan hilang sementara 11 orang dipastikan tewas setelah Costa Concordia menabrak batu karang di perairan Tuscan, Italia pada Jumat lalu. Petugas penyelamat mengatakan harapan untuk menemukan korban selamat makin tipis. Pencarian penumpang Costa Concordia yang masih

hilang untuk sementara dihentikan pada hari Rabu. “Posisi kapal berubah yang mengindikasikan kapal tersebut bergerak,” kata Luca Cari, juru bicara regu penyelamat Italia “Kami tengah melakukan evaluasi apakah kapal tersebut sudah stabil. Untuk sementara, kami bahkan tidak bisa mendekati kapal tersebut,” imbuh Cari. Para pejabat berharap bisa memulai mengangkat kapal tersebut, termasuk mengambil bahan bakar. Terdapat lebih dari 2.300 ton bahan bakar di lambung kapal Costa Concordia yang tersimpan di 17 tangki. Perusahaan Belanda yang akan mengambil bahan bakar mengatakan proses ini bisa memakan waktu beberapa pekan. Para ahli mengatakan kecil kemungkinan terjadi tumpahan minyak di sekitar lokasi kecelakaan. (bbc/rzl)


KAPAL pesiar mewah Costa Concordia yang karam setelah menabrak batu karang di perairan Tuscan, Italia pada Jumat lalu.

Pasukan Afghanistan Belajar Terbang Kelanjutan Nuklir Jepang Diprotes DUA puluh tahun lalu, pilot Angkatan Udara Afghanistan, Mayor Abdul Aziz membelah angkasa dengan pesawat tempur mematikan buatan Uni Soviet. Sekarang, pada usia 45 tahun, tugas barunya sudah tidak berbahaya atau cukup santai namun berkelas dan masih tetap penting: membantu membentuk dan melatih angkatan udara agar mampu menerbangkan pesawat serta helikopter setelah para mentor Barat mereka pulang ke negara masingmasing. Tantangan untuk membentuk pasukan udara yang modern dan ahli dalam hal teknis di negara yang masih dilanda perang sangat berat dan sekaligus penting setelah keluarnya pasukan Barat. Target yang ingin dicapai adalah Angkatan Udara beroperasi penuh secara independen, dengan 8.000 personil terlatih dan 145 pesawat tempur, pada tahun 2016. Mengajari kader pilot dan kru udara baru untuk menerbangkan pesawat merupakan tugas berat. Namun, Letjen. William Caldwell, yang sampai tahun lalu memimpin misi pelatihan NATO di Afghanistan, menegaskan bahwa melatih ribuan personil pendukung dan personil perawat pesawat merupakan tugas yang lebih penting – jika angkatan udara ini ingin dipertahankan dalam jangka waktu lama. Jika tidak, sejarah akan berulang. Pada tahun 90-an, pasukan NATO dukungan AS memerangi Taliban dengan menerbangkan helikopter-helikopter buatan Soviet yang ditinggalkan di Afghanistan setelah Soviet mundur dari negara itu tahun 1989. “Kepala staff NATO mengatakan kepada saya mereka memiliki 70 helikopter, sebagian besar jenis Mil Mi-17,” kata William. “Dalam periode satu tahun, tidak satu pun di antaranya bisa terbang lagi – bukan karena pesawat itu ditembak di udara, tapi karena orang Afghanistan yang tidak bisa merawat dan menjaganya.” Pasukan pimpinan NATO akan mengakhiri peran tempurnya pada tahun 2014, ketika aliansi tersebut menyerahkan tanggungjawab keamanan kepada militer dan polisi Afghanistan. Namun ribuan pasukan dan penasehat kemungkinan masih tetap tinggal di sana selama beberapa tahun untuk membantu pelatihan dan mengajar pasukan keamanan pemerintah. Negara-negara aliansi telah memasok transport taktis C27A buatan Italia, helikopter tempur Mi-35 dan helikopter transport MI-17. Selain helikopter tempur, satu-satunya pesawat pendukung adalah turboprop Super Tucano A-29. Angkatan Udara Afghanistan terbentuk tahun 20-an dan mencapai puncak jayanya ketika Soviet menduduki negara itu pada tahun 80an dengan memiliki 500 pesawat tempur dan pesawat pembom, helikopter transport dan helikopter tempur. Namun, pesawat-pesawat tersebut menjadi rongsokan, setelah dibiarkan saja oleh Taliban selama perang sipil menyusul mundurnya Soviet, dan luluh lantak di atas permukaan bumi


SEORANG pelatih Afghanistan menjelaskan tentang helikopter buatan Soviet kepada kader pilot dan awak pesawat Afghanistan di universitas angkatan udara di Kabul, Afghanistan. akibat gempuran bom AS sejak tahun 2001. Karenanya ketika korps udara Afghanistan itu dibentuk kembali tahun 2005, pasukan itu harus mulai dari awal lagi. Ribuan ahli dari bidang berbeda, termasuk kepala kru, teknisi mesin dan rangka pesawat, ahli pesawat dan ahli komunikasi, dan pasukan tempur di pangkalan udara – harus direkrut dan dilatih. Pasukan tersebut saat ini memiliki sekitar 5.000 anggota dan 86 pesawat tempur. “Saya senang jadi pilot, tapi saya pilih jadi instruktur karena saya ingin mengabdi bagi negara saya,” kata Mayor Aziz, yang memilih ruang kelas sebagai ganti kokpit pesawat tempur Sukhoi Su-22. “Saya melatih para pelatih yang di masa datang akan mampu melatih semua personil yang dibutuhkan Angkatan Udara, tanpa harus mendapat bantuan dari penasehat

dan pengawas asing.” Dan pencarian untuk mendapatkan personil yang pas menjadi tantangan besar dalam mengembangkan lembaga tersebut. Berlawanan dengan usaha untuk membentuk kembali Angkatan Udara Irak di tahun 90an, yang mendapatkan banyak kader terlatih dan pilot serta ahli mesin berpengalaman dari sebelum invasi AS tahun 2003, tugas di Afghanistan jauh lebih rumit karena pasukan tersebut dibentuk dari dasar – termasuk yang paling dasar sekli seperti mengajari para rekrutmen untuk membaca dan menulis. “Sekitar 85 persen tenaga yang kami rekrut buta huruf,” kata Kolonel Michael T. Needham, panglima Skuadron Penasehat Ekspedisioner Udara ke 738. Satuan instruktur Amerika, Kanada, Jordania dan Portugis membantu, melatih dan

menasehati 230 staff Afghanistan tentang ilmu penerbangan di bandara Kabul untuk memberikan pengetahuan umum, serta pendidikan militer. “Tujuannya adalah membawa mereka ke titik di mana mentor tidak diperlukan lagi,” kata Michael. Satu masalah sangat serius adalah rata-rata pengurangan pasukan udara tahunan mencapai jumlah 20 persen. Meski pun rata-rata tersebut tidak seburuk jumlah tentara Afghanistan yang desersi, hal ini menyulitkan usaha untuk mempertahankan kader terlatih dan personil yang berpengalaman. Para pilot dilatih di Shindand di sebelah barat Provinsi Herat. Sekolah di bandara Kabul menjadi tempat pengembangan keahlian merawat dan memperbaiki pesawat yang dibutuhkan awak pesawat agar pesawat tetap bisa terbang. Syafri/AP

“TAK tahu malu, tak tahu malu,” teriak para pengunjuk rasa saat para pejabat setempat bertemu untuk membahas dibukanya kembali reaktor nuklir Jepang untuk pertama kalinya sejak bencana melanda pembangkit nuklir Fukushima pada tahun lalu. Sekira 20 demonstran anti nuklir berunjuk rasa menentang pertemuan tertutup antara beberapa perwakilan pejabat pemerintah dan pejabat energi Jepang yang membahas hasil tes dari dua reaktor ‘nganggur’ dan merencanakan untuk menjalankan kembali reaktor tersebut. Pertemuan ini dapat dipantau oleh publik dari monitor televisi dalam ruangan terpisah, yang dikatakan demonstran sebagai simbol rencana pemerintah untuk kembali menjalankan reaktor nuklir mereka tanpa input publik. Pertemuan tersebut menurut laporan yang dilansir CNN, Kamis (19/1), digagas oleh lembaga ahli nuklir jepang, anggota pemerintah dan para cendekiawan. “Mereka menutup diri dari masyarakat,” ujar Ayako Sakine, seorang anggota Greenpeace yang merupakan satu dari 20 demonstran. “Ini tidak bisa dimaafkan.” Sementara demonstran lainnya, Greg McNevin, mengatakan sejumlah petugas polisi dikerahkan untuk berjaga-jaga dengan menggunakan kelengkapan anti huru-hara. “Masyarakat mengatakan dengan jelas apa yang mereka mau jika menyangkut masa depan energi nuklir di Jepang,” ujarnya. “Mereka ini tidak diindahkan.” Masahi Goto, seorang profesor di Shibaura Institute of Technology dan anggota panel

JEPANG menghentikan seluruh operasi reaktor nuklirnya sejak terjadi kebocoran pembangkit reaktor nuklir di Fukushima pada Maret tahun lalu akibat gempa dan tsunami. pada Rabu itu, memboikot pertemuan tersebut saat ia mengetahui bahwa masalah ini tertutup dari masyarakat. “Saya tak ingin mengikuti diskusi yang diadakan dalam ruang rahasia,” ujarnya. Nuclear and Industrial Safety Agency, yang merupakan lembaga pengawas nuklir Jepang, dalam hal ini menunjukkan hasil laporan pertemuan tersebut. Laporan tersebut menunjukkan hasil tes dari Kansai Electric Power Company, pemilik dua reaktor yang disebut: Unit No. 3 dan No. 4 di pembangkit perfektur Fukui, barat Jepang. Kansai Electric mengatakan bahwa hasil tes menunjukkan bahwa rektor tersebut mampu menahan guncangan gempa 1,8 kali lebih kuat dibanding gempa perkiraan maksimum di kawasan itu, serta menahan tinggi gelombang tsunami hingga 11,4 meter. Namun persetujuan dari pertemuan itu hanyalah langkah awal untuk pembukaan

Hotel 30 Tingkat Selesai Dalam 360 Jam CHINA membangun sebuah hotel terdiri dari 30 lantai hanya dalam waktu 15 hari. Dan hotel ‘tahan banting dan hemat energi’ itu telah dibuka operasionalnya Rabu (18/1) lalu. Kira-kira Anda berani nginap di sana? Perusahaan China Broad Sustainable Building (BSB) yang mengerjakan pembangunan hotel itu tidak sesumbar soal singkatnya waktu yang mereka butuhkan untuk merampungkan pendirian gedung di Provinsi Hunan itu. Dan hotel ini merupakan wujud dari keberhasilan terbaru BSB, perusahaan konstruksi China yang terkenal dengan efisiensi waktu yang membuat orang terkesima. Diberi nama T30, hotel seluas 17.000 meter bujursangkar itu dibuka 18 Januari lalu, dan disahkan sebagai hotel bintang lima. Hotel tersebut terdiri dari 316 kamar kelas standar, 32 suite, 8 ambassador suite dan 2 presidential suite. Fasilitas lain yang terdapat di sana termasuk satu restoran, bar, tempat kebugaran dan kolam renang di lantai paling atas, ruang parkir di lantai dasar bisa menampung 73 mobil dan bahkan satu landasan helikopter. Untuk pembangunan

keselu-ruhan hotel tersebut total dana-nya menghabiskan 17 juta dolar. Pemilik hotel itu, BSB, adalah cabang dari perusahaan teknologi China Broad Group, yang salah satu prestasinya termasuk mendirikan pavilion sendiri untuk Shanghai Expo di tahun 2010 hanya dalam waktu 24 jam, dan mendirikan bangunan 15 lantai hanya dalam waktu enam hari pada Juni 2010. Teknik Konstruksi Inovatif Sebenarnya tidak perlu heran dengan waktu singkat yang dibutuhkan BSB dalam membangun hotel 30 tingkat itu. Kuncinya adalah teknik konstruksi inovatif yang dikembangkan BSB. 93 Persen gedung tersebut dibangun dengan komponen pra-bangun, jelas Wakil Presiden Broad Group, Juliet Jiang. Juliet mengatakan perusahaan itu mungkin akan bisa mendirikan gedung yang sama dalam waktu hanya 200 jam setelah para pekerjanya semakin ahli. Juliet juga mengatakan, alasan bagi ditekankannya percepatan pembangunan itu adalah untuk ‘menghindari hujan’. Juliet mengatakan BSB tidak khawatir dengan keraguan orang terkait kualitas bangunan yang didirikan dalam waktu sesingkat itu.

INILAH hotel berlantai 30 yang dibangun hanya dalam waktu 15 hari. “Keraguan itu muncul karena mereka tidak paham soal teknologi yang digunakan dalam mendirikan banguan tersebut,” katanya. “Biar saja waktu yang akan membuktikan,” ujarnya. Menurut keterangan pers dari Akademi Peneliti Bangunan China (CABR), T30 dibangun dengan system struktur yang dirancang dan dikembangkan oleh BSB. Model simulasi gedung itu tetap kokoh berdiri ketika diuji dengan serangkaian ujian gempa bumi – mulai dari 7,0 sampai 9,0 skala richter – yang dilakukan CABR Mei lalu.

Perusahaan yang bermarkas di Changsha tersebut mengatakan pihaknya mengembangkan teknologi konstruksi baru pada tahun 2009 – teknologi tersebut mengacu pada ‘gedung tahan banting’ – setelah gempa 8,0 skala richter di Wenchuan menewaskan hampir 70.000 orang di tahun 2008. Broad Group mengatakan, selain tahan terhadap gempa, kokohnya T30 disadur dari sembilan aspek lain, mulai dari konservasi energy sampai penyaringan udara yang komplit. Semua kamar dikatakan

dilengkapi dengan jendela lipat empat, lampu LED dan toilet hemat air. Zhang Yue, pejabat eksekutif Broad, mengatakan kepada majalah The Economic Times ‘cepatnya pembangunan itu berarti mengurangi pembuanganmateridanenergi’. “Udara China 20-40 kali lebih tercemar dibanding Eropa dan hal itu merusak kesehatan dan akan mengimbangi keuntungandaripertumbuhan ekonomi kami,” kata Zhang. Syafri/CNN

kembali dua pembangkit nuklir tersebut. Dan belum akan dimulai hingga lembaga Nuclear Safety Commission — sebuah lembaga pengawas lain, mengevaluasi ulang masalah ini. Pemerintah dan komunitas masyarakat lokal nantinya akan menentukan apakan kedua reaktor tersebut akan kembali dijalankan secara penuh. Jepang mulai menghentikan program energi nuklir mereka sejak bencana kebocoran nuklir di Fukushima pada Maret tahun lalu yang disebabkan gempa dan tsunami.

Setiap 13 bulan, pembangkit reaktor nuklir dihentikan untuk perawatan. Namun jika terjadi bencana, maka reaktor-reaktor nuklir tersebut belum dioperasikan kembali. Hingga kini, hanya lima pembangkit reaktor nuklir yang beroperasi. Hingga April mendatang, jika reaktor-reaktor di Jepang tidak kembali difungsikan, maka negara ini sama sekali tidak memiliki reaktor pembangkit nuklir, yang mana hal ini akan menambah tekanan pada sumber energi mereka. (cnn)

Guru Jujur Kembalikan Uang Rp 90 T SEORANG guru di India kaget bukan kepalang saat memeriksa buku rekening banknya lewat internet. Parijat Saha, nama guru itu, awalnya memperkirakan jumlah tabungannya paling banyak hanya US$ 200 atau sekitar Rp 1,8 juta. Namun apa yang dilihat Saha membuatnya sangat kaget karena di dalam rekeningnya tertera angka US$ 9,8 miliar (Rp 90 triliun). “Minggu malam, saya memeriksa tabungan saya melaui internet. Saya hanya berharap jumlah uang tak lebih dari US$ 200,” kata Saha yang tinggal di kota Balurghat kepada BBC. Karena tidak percaya maka Saha kembali mengecek rekeningnya di mesin ATM terdekat. Hasilnya, sama saja. Saha kini adalah seorang miliarder. Tetapi Saha adalah seorang yang jujur, maka diapun menelepon State Bank of India (SBI) untuk mengembalikan uang tersebut dan melaporkan keanehan ini. “Saya menelepon kenalan saya di bank dan bercanda, mungkin bank sedang kelebihan uang sehingga uangnya mengalir ke rekening saya,” ujarnya. Gaji Saha sebagai guru di Negara Bagian Bengali Barat adalah US$700 atau sekitar Rp6,3 juta. Sehingga tak berlebihan jika Saha terkejut melihat rekeningnya yang memuat jumlah yang hampir sama dengan anggaran pendidikan India sebesar US11,5 miliar setahun. Dibersihkan Sayangnya, pejabat bank yang memiliki motto ‘Perbankan aman bersama SBI’ tak ada yang bersedia mengomentari insiden ini. Namun sejumlah sumber mengatakan bank sudah ‘membersihkan’ uang itu dan uang itu tak akan bisa ditarik meskipun Saha menginginkannya. Manajer SBI cabang Balurghat, Subhashis Karmakar menolak menjelaskan sumber uang itu atau mengapa uang itu bisa masuk ke rekening Saha. “Saya secara khusus diminta untuk tidak berkomentar,” katanya kepada BBC. Kantor regional SBI di Kalkuta dan kantor nasional di Mumbai sudah mendapatkan laporan masalah ini dan sedang mempelajari mengapa insiden itu bisa terjadi. Untunglah kekacauan ini tak merugikan pak guru Saha. Dia akhirnya bisa mengambil uang US$200 miliknya. “Meski saya sudah menerima uang saya, rekening itu masih berisi uang miliaran dolar dan dinyatakan sebagai rekening tidak jelas. Entah sampai kapan saya harus menyimpan uang itu,” ujar Saha. (bbc/rzl)

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

MERCY E230 ‘96 Hijau Met, Km Low, Mulus, BK Mdn, Int. Original, Sprt baru, Sound system, VCD Multi, DVD, MP3, RT, DP 36,5 Jt Angs. 4,2Jt x 23 Hub. (061) 7670.0979 MERCY C180 ‘94 Silver Met, Jok klt, VR 16”, ABS, Airbag, PW, PS, Alarm, BK 333, DP 25 Jt, Angs: 2,76 Jt x 23 Hub. 0852.7507.6512 / Kanda * PROM O BESAR ASTRA DAIHATSU *

All New Xenia DP 15%, Terios DP 20Jt-an, PU DP 8 Jt-an. Luxio, Sirion, Program Hebat dr DAIHATSU. Hub. IQBAL - ASTRA 0813 61007 907 - 0853 6103 1609

DAIHATSU Rocky Th. ‘94 Dijual. AC/Tape. Warna hitam langsung pakai (TP). Hub. 0813 7636 4776

- Rocky Independent ‘97 Htm/Met. H. 95Jt - Taft Independent ‘96 Hijau/Met. H. 80Jt B. Kredit Hub. 6614 976/0812 6076 476


DAIHATSU BARU PAKET MURAH...!! All New Xenia.............DP Mulai 19 Jt-an Terios...........................DP Mulai 20 Jt-an Pick Up........................DP Mulai 8 Jt-an Luxio............................DP Mulai 13 Jt-an Proses Cepat Dan & Data Dijemput Hub. PT. CAPELLA MEDAN JOSUA 081263110820


Gran Max Pick Up 1.3 DP 9 Jt-an Angs. 2 Jt-an Gran Max Minibus 1.3 DP 14 Jt-an Angs. 3 Jt-an Luxio D DP 18 Jt-an Angs. 4 Jt-an All New Xenia 1.0 M DP 24 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 28 Jt-an Angs. 4 Jt-an Sirion 1.3 D DP 24 Jt-an Angs. 4 Jt-an Hub: ERWIN HP. 0812 6315 4132 - 061.77402067

DA I H AT S U Xenia 2008 Li Dijual. 1000cc. Hitam, BK Mdn, AC, PS, PW,Terawat. Hub. Jl. Laksana 55E, Harga 110Jt. Nego. 0813 7083 0826

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DA I H AT S U 1 0 0 % B A R U New Xenia Double Blower Angsuran 3,7Jt-an (4 Thn). Grand Max Pick Up DP 8 Jt-an Angs. 2 Jt-an Terios-Sirion-Luxio-Gran Max MB Ready Stock - Proses Cepat Terima Tukar Tambah Hub. DIKA 0852 7074 7744 - (061) 7744 3877


Beli Honda CRV/Freed Hadiah langsung sepeda motor tanpa diundi. CRV DP 60 Jt-an, Freed DP 40 Jt-an Hub. SUMADI 0852 613 22043 HOLDEN Gemini Diesel Dijual. Th. 89/90. W. Hitam metalic. AC, VR, BR, Kondisi sangat mulus, Rp. 31.500Jt (Nego). Hub. 0813 9642 3289

HYUNDAI Atoz GLS Thn. 2000 Dijual. Warna Hijau met An. Sendiri. Hub. 0812 608 6094

7 CM 8 CM

Rp. 91.000 Rp. 104.000


Carry PU 1.5 FD. Rp. 9Jt-an Angs. 2.696.000,APV Arena Rp. 14Jt-an Angs. 3.880.000,Splash GL Rp. 13 Jt Angs. 3.977.000,Hub. 0812 6540 809 / 77722121 # SUZUKI DEALER RESMI # Carry Pick Up...DP 9 Jt-an } Bonus: DVD Audio, Mega Carry......DP 14 Jt-an ke Film & Aksesoris APV Arena........DP 14 Jt-an Hadiah: Splash..............DP 12 Jt-an Kaca Film Swift ST ............DP16 Jt-an Perking Sensor SX-4.................DP 23 Jt-an & Aksesoris Proses Cepat, Data Dibantu, Kredit 1-5Th. Hub. 0852 6114 6499 - 061.9114 0699


SUZUKI Carry Th. 85/86 Dijual. Alexander W. Masih metalic. Kondisi sangat mulus. Hub. 0853 6172 0189

HONDA Civic Wonder 86/87 Biru metalik, PW, CL, Tape CD, AC Dingin. Harga Nego. Hub. 0853 5870 1896 - 0853 7085 9035 KIA Travello 2010, Silver, BK Medan asli, pakai dari baru. Over Kredit Hub. 0812 603 1688 MITSUBISHI BARU MURAH BUNGA 0%, READY STOCK 0821 6652 9982 MITSUBISHI

S U Z U K I Escudo 2000 Silver, TV, Velg, Gagah 93. Nego. Mdn. Telp. 6619310

MITSUBISHI Pajero Sport 4x2, Eceed ‘10, AT/ Tiptronic, Turbo Diesel, Jok klt asli, Htm, Ban bsr, MP3, CD, Subwoofer, TOT, DP 75Jt, Angs: 7,7 Jt Hub. 0852.7690.3900

TOYOTA Vios ‘03, Tipe G Rp. 110Jt/Nego. 770 63610/ 0813 9663 8992 /Bisa Kredit.

NEW NISSAN Juke, New X-Trail, Grand Livina, March, Murano, Teana. Bisa bantu tukar tambah. Cash/Kredit Hub. MILI (0852 7033 7739) NISSAN Promo Awal Tahun Ready Stock & Bonus. Bunga mulai 0% Juke, Grand Livina, March, X-Trail. DP Ringan, Angsuran Ringan. Hub. DANIL 0821 6323 5812

DAIHATSU Xenia L.1 Thn. 2005 Dijual. W.Hitam, VR, AC, Tape, CD, SL, PW, BR, M. Cantik. H.96Jt. Nego. Zebra Thn. ‘92, W. Merah, K. Karisma. H.21,5Jt. Nego. Hub. 0812 644 3004 /7777 8725.

NISSAN XTrail XT A/T Thn. 2004. Coklat Met, BK Mdn. Rp. 149 Jt. Hub. 91327433 NISSAN Livina XR M/T Thn. 2008. Biru met, BK Rp. 130Jt. Hub. 0853 6161 5977

DAIHATSU Taft Rocky Thn. 94/95, biru metalik, BK Medan, AC, Velg Racing, Mobil bagus, siap pakai. Harga Rp. 70Jt/damai. Peminat serius Hub. 0852 7630 2013 TP.

SUZUKI Jimny 4x4 Dijual. Thn. 89/90 BK Medan, Velg Racing/AC/Jok Kulit. Harga 33Jt. Nego Hub. 0812 6393 235

DIJUAL/OVER KREDIT TOYOTA Avanza G Thn. 2004. Sudah 5x Byr Angs. 3.930.000 x 31 Bln lagi, mobil mulus dan sehat, warna biru balik DP aja. Hub.77288835, HP. 0852 7689 5520 TP.

TOYOTA Corolla All New ‘96 Siap pakai, Hijau Metalic, AC, PW, CL, BK Medan asli, Tanpa perantara, Rp. 69 Jt/nego 0821.6261.7360

TOYOTA KIJANG KRISTA ‘98 Warna asli biru metalic. Mobil jarang pakai. Simpanan. Hub. 0812 6351 859 TP. Pemakai langsung.

TOYOTA Kijang 1.8 LX ‘00 Model LSX, Biru Dongker, AC dgn, Tp, CD, PS, VR, BR, DP 17 Jt, Angs. 2,85 Jt Hub. 0852.7507.6512/ Kanda



PURBA : 0813 9789 4633

TOYOTA 100% BARU Avanza, Innova, Fortuner, Yarris, Hilux. Hub. 0813 7512 7297

T OYO TA I n n o v a G M a t i c Bensin Thn. 2005. Silver, BK Mdn Rp. 145Jt. Hub. 0852 7538 3218 TOYOTA Kijang LX 1.8 Bensin Thn. 2004. AC, VR, PS, CL, Jok kulit, Silver, Plat BM. Rp. 103Jt. Hub. 0812 6594 2789

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di Terimakasih

TOYOTA Kijang Super Long Thn. 1990/1991 Dijual. Warna biru metalik. Harga Nego. HP. 0813 6135 7361 TOYOTA All New Thn. ‘97 warna abu-abu metalik, BK Medan. Peminat Hub. 0852 9655 7768 TOYOTA Kijang LGX ‘97 Bensin. Hijau. BK Asli Medan, BPKB 1 nama, sgt mulus & terawat. Rp. 96,5Jt/Nego. Hub. 0812 60 47 40 10 TOYOTA Kijang Kapsul 1,8cc, W. Hijau met Thn. 2000 Akhir Pjk Baru Mdn. AC, Tape, BR, Jok kulit mulus Original. Body kaleng. BU Hub. HP. 0852 7600 8094 Mdn.

TOYOTA Kijang Kapsul LGX Diesel 2003 Dijual. Mobil siap pakai. Hub. HP. 0813 6153 2044 Maaf TP. TOYOTA Corolla Twincam Th. ‘88 W. Merah (1,6) Dijual segera BU. Harga damai. Lengkap, siap pakai. Hub. Telp. 061.77230319 TP.


SEPEDA MOTOR V E G A ZR Thn. 2011 Dijual. Warna Abu2 hitam mulus. Hub. 0852 6121 9695 - 0852 6210 1135





845.8996 0812.631.6631 Bergaransi/ Setia Luhur 160 F


TOYOTA NEW Avanza New, Rush New, Innova New, Fortuner New, Dyna + Karoseri Hub. 0852 77744401



Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang ATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim TIsms untuk membeli produk anda, dan HA HATIHA TI apabila anda ingin melakukan transaksi HATI jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab

Jumat, 20 Januari 2012


Jaminan: SHM, SK Camat, HGB dan BPKB (Bantu Pelunasan BPKB). 3 Jam Cair 1 Juta 500Juta. Hub. FAMILY FINANCE. 0813 7044 6668 - 0813 7044 6633


821 9951

Jl. Setia Budi No. 2


Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

TERCECER/HILANG TERCECER Surat Akta Penyerahan Penguasaan atas tanah dengan cara Ganti Rugi No. 592.2/0001/DT/2002 Tgl. 20-62002. a/n. Edi Dermawanto. Yang terletak Duzun VII Kel. Kedai Durian Kec. Delitua Luas +/- 80,80


1 (Satu) Buah Surat Keterangan Tanah SKT Bupati Deli Serdang atas nama RAIDJIN SAIMIN NAINGGOLAN (Alm). Tanah terletak di Dusun-III Jl. Binjai Km. 15,2 Desa S.M. Diski Kecamatan Sunggal seluas 518M2. Tercecer pada hari Senin Tanggal 02 Januari 2012 Disekitar Jalan Binjai Km.15,2 Sampai Jalan Binjai Km. 10


1 (Satu) Buah Surat Pernyataan Melepaskan Hak atas tanah Nomor: 593.83/1.327/2010. Atas nama Siti Suhaini. Tanah terletak di Dusun-V Gang Gembira Desa SM. Diski. Kecamatan Sunggal Seluas 315M2. Tercecer pada hari Kamis tanggal 22 Desember 2011 Disekitar Jl. Binjai Km. 14,5 Gg. Gembira sampai Km. 15 Simpang Diski.


Tanah SK Lurah No. 594.1/08/ ST-II/SKT/MA/VI/1993. a/n. HASAN BASRI yang terletak di Jalan Gg. Syukur Brt Ling. XI Kel. Sitirejo-II. Luas. 60m2 TERCECER

1 Buah BPKB Sepeda motor Honda NF 125 TD. No. Pol. BK 4353 WT. An. JHON FERRY SINAGA. Alamat Jl. Persatuan No. 17 P. Siantar.


BPKB Mobil Toyota BK 1428 HN. a/n. Arifin Noor. Alamat Dsn VII / Musy F Saentis. Kec. PS Tuan - D. Serdang. No. Rangka MHFXW42 G 362078868 No. Mesin ITR 6323564


Telah tercecer SK Tanah Camat Medan Johor, Th. 1995. Atas Tanah seluas +/- 165 M2. Yang terletak di Jl. Brigjend. Zein Hamid, Gg. Wakaf, Lingkungan IX, Kel. Titi Kuning. Kec. Medan Johor. Atas nama Edi Utama, SH. Di seputar Jl. Brigjend. Zein Hamid. Jl. Brigjend Katamso, Pada hari Sabtu, Tgl. 7 Januari 2012






SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

TOYOTA Kijang G 94. Long 6 speed. PS, PW, CL, AC, Tape, Body mesin, terawat. Hub. 0812 6538 3162

BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807


Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.


Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347


WASPADA Jumat 20 Januari 2012

07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14:30 Cek & Ricek 15.30 Top 5 16.00 Silet 17.00 Seputar Indonesia 17.30 Dewa 19.00 Binar Bening Berlian 21.30 Mega Sinetron 22.30 Box Office Movie Apocalypto


07.00 SCTV FTV Pagi 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 11.03 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Uya emang Kuya 16.00 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 Garuda Impian 19.00 SCTV Sinetron : ALiya 20.00 Liputan 6 Terkini 20.03 Acara Special : Infotainment Awards 22.30 Liputan 6 Terkini 22.33 Acara Special : Infotainment Awards

07.00 Disney Club 08.00 Layar Pagi 09.00 Cerita Pagi-1 10.30 Kribo 11.00 Sidik 11.30 Lintas Siang 12.00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 16.00 Animasi Spesial 17.45 Animasi Spesial The Owl 18.00 Shaun The Sheep 19.00 Fathiyah 20.00 Tendangan Si Madun 21.00 Cinta Sejati 22.00 Tarung Dangdut 00.00 Premier Preview 01.30 Lintas Malam

07:30 Wooow…! 08:00 Friends (Live) 09:00 Gowes 09:30 Segeeerr 10:30 Dokumenter: Amazon 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang 15:00 Indonesia Super League 2011-2012 17:30 Topik Petang (Live) 18:00 Pesbukers (Live) 19:00 Siapa Takut 20:00 Kisah Dari Langit 21:00 Deal Or No Deal 22:30 Dokumenter: Dangerous Encounter 23:30 Most Incredible Moments 00:00 Telisik 00:30 Topik Malam (Live)

06:00 Fokus Pagi 07:00 KISS Pagi 07:30 Halo Polisi 08:00 FTV Pagi 10.30 Hizteria 11:30 Patroli 12:00 Drama Asia ( K o r e a ) : Dong Yi, Jewel In The Crown 14:00 Drama Asia ( K o r e a ) : Pink Lipstick 15:00 KISS Sore 16:00 Fokus 16:30 Drama Asia (Korea) 18:00 Drama Asia (Mandarin) 19:00 Satria 20:00 Tutur Tinular 22:00 FTV Laga

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Special Program 11.00 Headline News 11.30 Metro Siang 12.05 Metro Siang 13.05 Wideshot 13.05 Wideshot 14.00 Headline News 15.30 Wideshot 16.00 Headline News 16.30 Wideshot 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Eadle Documentary 21.05 Top Nine News 21.30 Kick Andy 23.00 Headline News 23:20 Metro Sports


07:30 Ranking 1 08:30 Bioskop Indonesia 10:30 Ala Chef 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Show Imah 14:30 With Farah Quinn 15:30 Sketsa 16:00 Happy Family 16:30 Sepenggal Sejarah 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 The Hits 21:00 Bioskop TransTV 00:00 Bioskop TransTV 02:00 Reportase Malam

08:00 Penguin Of Madagascar 08:30 Pat & Stan 09:00 Super Hero Kocak 10:00 Obsesi 11:00 Top Banget 11:30 Hot Spot 12:00 Awas Ada Sule 2 13:00 Sketsa Tawa 13:30 Main Kata 14:30 Tamu Gokil 15:00 Steve Ewon Sang Pemburu 15:30 Berita Global 16:00 Top Banget 16:30 Fokus Selebriti 17:00 TomandJerryKids Show 17:30 Spongebob Squarepants 19:00 Film TV 21:00 Big Movies 23:30 Big Movies

06:30 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Jendela Usaha 12:00 Live News Kabar Siang 13:30 Apa dan Siapa 14:30 Kabar Pasar 15:00 Data Dan Fakta 15:30 Nama Dan Peristiwa 16:30 Sport File 17:00 Live News Kabar Petang 19:30 Apa Kabar Indonesia Malam 21:00 Kabar Malam 22:00 Kabar Arena 23:00 Radio Show

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Bruno Mars Bebas Tuduhan Kepemilikan Kokain

Bruno Mars




KONSULTAN NASIONAL Dibutuhkan: 1. Program DIII Teknik Bangunan/Sipil 2. S1 Teknik Sipil

Syarat: - Menguasai Program Komputer XL, Autocat. Lamaran antar langsung Jl. Purwosari / Hiligeo I No. 99 Medan Lewat Simpang Cemara Krakatau LOWONGAN KERJA

Kami sebuah Perusahaan yang bergerak dibidang jasa Angkutan, membutuhkan tenaga kerja yang potensial untuk menempati posisi: 1. Mekanik 2. Las Ketok Cabin 3. Mandor Lapangan Dengan syarat: 1. Laki-laki usia min. 25 tahun (1), (2) & (3) 2. Berpengalaman kerja min. 2 tahun (1) (2) & (3) 3. Pendidikan SMK Tehnik Otomotif (1) 4. Pendidikan min. SMP (2) 5. Pendidikan min. SMU (3) 6. Mengerti mesin Fuso dan Nissan Interculer (1) 7. Mengerti Cabin Fuso dan Nissan Interculer (2) 8. Teliti, loyal, jujur dan bertanggung jawab (1) (2) & (3) 9. Dapat bekerja lembur dan mampu bekerjasama dengan team (1) ( 2) & (3) 10. Berdomisili disekitar Pulo Brayan s/d Belawan (3) 11. Mempunyai kenderaan sendiri (3) Surat lamaran kerja diajukan ke Kantor Harian WASPADA KODE : AUTO, selambat-lambatnya 2 minggu setelah iklan ini terbit

Pelantun Just The Way You Are, Bruno Mars, Rabu waktu AS dinyatakan bebas dari tuduhan kepemilikan kokain. Bintang pop memiliki nama asli Peter Hernandez kedapatan menggunakan kokain di toilet usai manggung di Hotel Hard Rock Las Vegas pada September 2010. Mars harus menjalani hukuman percobaan dengan denda 2000 Dollar, 200 jam kerja sosial di sebuah komunitas, konseling dan tidak terlibat tindakan kriminal selama setahun.

MENDESAK !! SEKOLAH BARU MEMBUTUHKAN GURU TK Min lls SMA, kreatif & suka dunia anak Hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 7623.5314 - 9158.3487 4533.875 - 456.9269



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

BINJAI Dijual 3 (Tiga) Rumah Siap pakai. Di Jl. Bandung Belakang RS Bangkatan Binjai. SHM, PLN, PAM 4x16. Hub. 0812 6369 3303 - 0813 7072 8181


Lokasi Jl. Jala Permai 11 Blok 8 No. 61. Perumnas Griya Martubung Ukuran tanah 7x14. Luas 70m2. Harga 130Jt Nego. Hub. 0852 9614 4408


Rumah permanen, 2 Kamar + Garasi, ull keramik, Cocok buat kantor, Lokasi strategis di Jl. Suka Eka 28 STM Hub. 0813.7083.0826 Tanpa perantara/ SMS


Jalan Tenis No. 7 Medan (blkg Pajak Halat), Kamar Bawah 4, Atas 1, Garasi 2 mobil, Uk. Tanah 13x27,5m, Lokasi Komplek, SHM Hub. 0812.6529.4000 - (061) 736.1563, TP

Britney Spears Kecewa

Keputusan Pengadilan wilayah Clark County itu keluar setelah Mars memenuhi persyaratan tersebut dengan baik, bahkan lebih cepat dari waktu sudah ditentukan. Mars dinyatakanbebasdarisegalahukuman dengan catatan kriminal yang bersih. Musisi berusia 26 tahun itu melesat di tangga lagu pada 2010 setelah berkolaborasi dengan raper B.o.B dengan hits Nothin OnYou dan duet bersama Travie McCoy dalam lagu Billionaire.(ant) Britney Spears/


Lokasi di Jl. Bono dekat Kampus UMSU. Luas Tanah 14x30m, Cocok untuk Rumah kost, Sertifikat Tanah SHM (Sertifikat Hak Milik) Hub.








Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410


KOMPUTER T E R I M A : Laptop Komputer, LCD (0821 6868 5346)

SERVIS: Instal no display, padam, lcd pecah, engsel patah dll. SALHA.COM Jl. Denai no. 118 Jual Laptop. Komputer Seken)









1 Jam Tuntaskan lemas syahwat - Cepat keluar Bergaransi - Inpotensi, diabetes 100% Alami - Tambah ukuran - Ramuan vagina perawan Kembali, hasil bisa cek dr metode: Biotheraphy dan Ramuan Herbal

Office: Mesjid Raya Mdn 600m lurus di Jl. Amaliun No. 125 Bpk. Kosim S.Ag HP. 0812.63700.234 Izin Dinkes: 448/347/2004 TERAPI KEJANTANAN ALAT VITAL PRIA & WANITA PALING SPEKTAKULER DARI PEL. RATU PANTAI SELATAN Ditangani Langsung:






Syarat: - Lulusan S-2 dari Jurusan/ Program Studi: * Matematika * Fisika * Bahasa Indonesia * Bahasa Inggris * Agama * Psikologi * Ilmu Komunikasi * Hubungan Internasional - Disiplin dan memiliki komitmen untuk memajukan dunia pendidikan

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Dengan melengkapi: - Surat lamaran - Daftar Riwayat Hidup - Fotocopy KTP - Pasfoto warna 3x4cm = 2 lembar - Ijazah terakhir (Legalisir) - Transkrip Nilai (Legalisir) Lamaran diantar langsung ke:


ELEKTRONIK REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat

TV LCD 22” LG = 1,5Jt. 32”LCD/LG=2,8JT, 42” 32” LED Samsung= 3,2Jt , 34 Sony = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb 1,7 Jt. 14 - 21=300rb - 650rb, LCD Monitor 22”=800rb. PS1=400rb, PS 2=800rb, DVD 200rb, Vortable = 700rb. Ampli Cina=400rb, Technics, BMB , spk BMB =1.450rb - EQ - TV Mobil - 500rb. LAPTOP, HANDICAM, CAMERA, PROJECTOR

Handicam Sony HI-8=1Jt Mini DV =1,5Jt, DVD=2Jt, Canon Legria=1,5, Camera 5 Mp=12 Mp 500rb - 1,2Jt, Fax=600rb, Printer HP=450rb





TV, LED, LCD, Kulkas, M. Cuci, Handycam DSLR, Laptop, LCD Projector, PS1, 2, & 3. H. Teater, Sound System, dll. HUB. CV. MARKET Tel. 7632 4682, 0812 6539 3000. S. Budi Tj. Sari No. 424 B Psr. IV dkt BNI


Jl. K.L. Yos Sudarso No .3A Tanjung Mulia - Medan Pada bagian: Customer Service

TELP: 082169696868 - (061) 69696868

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0 8 1 2 . 4 0 3 8 . 3 3 3


Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat



Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat


ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan H P. 0 8 2 1 . 6 6 5 5 . 1 2 2 2









Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll

1 Pk Rp. 1.200.000


Jual AC Baru/Bekas 1/2, 3/4, 1 1/2, 2 Pk 1,2Jt. AC Window 1 Pk=800rb. Kulkas 1 Pt-2Pt-600rb - 1,2Jt, 2 Pt. Super Jumbo=1,9Jt. M. Cuci 1 Tb-2 Tb=600rb 1,2 Jt. M. Cuci baru=1,2Jt (2 Tb. 9 Kg) Genset 3000w 2 Jt, 8000 W= 4,5 Jt. Pompa Air, Sanyo - P. Cliner

UD . S E N A N G H ATI Hub. 4517509 - 0821 6322 4343, Jl. Sekip 67 A

STMIK Potensi Utama (Kampus 2)



Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA


SUMATERA UTARA TELP: (061) 9126 3040





HP. 0813 8042 6253



MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201

- Panjang: 13 - 16 - 19 - 22 cm - Diameter: 3.5-4-4.5-5-5.5-6cm - Kuat dan tahan lama - Ejakulasi dini, sphilis/ Raja singa - Mani encer - Lemah syahwat, diabetes, impoten, dl KHUSUS WANITA: - Memperbesar, payudara, terapi perawan/ virgin, kista, lemah kandungan, kanker payudara, ingin mempunyai keturunan, dll PRIA & WANITA Ingin cepat dapat jodoh, penghasilan disegani atasan, menyatukan & memisahkan PIL/WIL, Puter giling, juga melayani pasang susuk, dll --> Bergaransi, hasil permanen alami tanpa efek samping, langsung reaksi ditempat Alamat: Jl. SM. Raja depan Taman Makan Pahlawan No. 130B Medan samping Show Room AUTO 2000. Dibelakang bengkel tambal ban








Melayani berbagai macam keluhan antara lain:

Ayo....!!!segerakirimkanlamaranandadengan mencantumkanno.teleponyangdapatdihubungi paling lambat 2 minggu setelah iklan ini terbit. ke: Email: Jl. Gn. Krakatau No. 115CD, Medan NB: Hanya pelamar yang memenuhi syarat yang akan dipanggil

Lamaran diantar paling lambat pada Hari: Selasa/ 24 Januari 2012 Pukul: 17.00 WIB


HOTEL MADINAH : AL-HARAM (5*) HOTEL MAKKAH : MAKARIM AJYAD (5*) HOTEL JEDDAH : AL AZHAR (5*) Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jama’ah Tertanggung ASURANSI DAFTAR SEGERA Kantor: Gedung Gelora Plaza Lt. 1 Jl. S. M. Raja No. 4/18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488

KRISNA WATER 1. Pemasangan Depot Air Minum Sistem


bangan pada badan amal Hackney yang berhubungan dengan orang-orang muda. Pemerintah Inggris sekarang sangat berhati-hati dengan halhal berhubungan dengan senjata, kriminal dan kekerasan karena khawatir kerusuhan hebat di London terjadi lagi seperti pada Agustus tahun lalu, meskipun peng-gunaan senjata dan kekerasan untuk keperluan syuting video musik atau film.




gram berita televisi London Tonight, Hackney Council mengatakan, dalam kasus ini kami tidak setuju senjata digunakan di Stoke Newington Town Hall meskipun senjata tiruan dan merasa kecewa. Kami akan mengajukan kasus ini dengan perusahaan produksi rekaman. Selanjutnya anggota dewan Ian Rathbone menyarankan pada situs Digital Spy bahwa penyanyi ini harus meminta maaf dan memberikan sum-




Perusahaan Industrial Product Internasional yang terkenal membutuhkan: Dengan kualifikasi sbb: - Pendidikan minimal SMU dan sederajat (lebih disukai D3/ S1 Teknik Mesin/ Kimia - Pendidikan Sarjana Teknik Mesin dan mempunyai pengalaman dan pengetahuan mengenai operasi mesin industri, automotif dan alat berat - Mampu mengoperasikan computer (MS Office) - Memiliki pengalaman marketing atau hubungan baik dibidang pelumas/ lubricants atau produk maintenance industri, spart part, pengangkutan, kontraktor maupun building - Memiliki kendaraan sendiri - Menguasai bahasa Inggris (minimal pasift)

Britney Spears melakukan perjalanan ke Inggris untuk syuting video musik baru singelnya Criminal dan menimbulkan kemarahan pemerintah lokal ketika penyanyi itu berada disana. Video menunjukkan Spears dan temannya Jason Trawick merampok dengan senjata yang membuat tersinggung dan marah anggota dewan lokal sektor London dimana syuting video musik itu berlangsung. Dalam satu statemen pro-



cr agen slrh daerah. Pkt Umroh $ 1.800, Haji $7,500. Dptkan fee $ 100 u/Umroh & $250 u/Haji Khss Hub. 0218356663/ 085697332613

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Teropong Si Bolang 13:00 Laptop Si Unyil 14:00 Dunia Binatang 14:30 Koki Cilik Tamasya 15:00 Home Stay 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Si Gundul 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Dua Dunia 00:00 Wisata Malam **m31/G

1. 2. 3. 4. 5. 6. 7. 8.

FORUM KOMUNIKASI PARANORMAL DAN PENYEMBUHAN ALTERNATIF INDONESIA IZIN DEPKES. 448/15830 - IZIN KEJATI No. B270/DSP5.08 Gendam Asmaradhana (Solusi Kilat) Problem asmra dan rumah tangga Gendam pedotshih (pemutus hubungan asmara dan perselingkuhan PIL dan WIL) Puter Giling (menarik/ memanggil orang yang minggat, kabur) Insya Allah, Suami, Istri atau Pacar dalam waktu singkat akan kembali dengan cepat Asmara Gay/ Lesby/ Hypersex Susuk aura, pemikat, pemanis, pengasihan, kecantikan dan ketampanan Penglarisan dagang, kedai, rumah makan/ restoran jual beli tanah dgn cepat GARANSI Penyembuhan segala macam penyakit medis SAMPAI - non medis (kutukan, keturunan, bawaan dan guna-guna) TUNTAS Keluhan khusus pria (ejakulasi dini dan impotensi) Pengobatan/ penyembuhan bisa jarak jauh

BUKA TIAP HARI DARI PUKUL 08.00 Wib s/d 23.00 WIB Jl. Amaliun, masuk Jl. Nusantara No. 4 Medan (Belakang Hotel Madani SM. Raja di depan Kantor MUI) HP. 0813.6246.7777 0821.6397.9999

Ekonomi & Bisnis


WASPADA Jumat, 20 Januari 2012

Selain Pembatasan BBM

April Tarif Listrik Ikut Naik SEMARANG (Waspada): Masyarakat Indonesia harus kembali mengencangkan ikat pinggang. Pasalnya, selain pembatasan BBM, masih ada lagi kejutan di 2012 ini yang akan membuat, sebagian besar masyarakat terperangah. Bagaimana tidak, di bawah tekanan ekonomi yang semakin besar, tiba-tiba menyeruak informasi tentang rencana pemerintah untuk menaikan lagi Tarif Dasar Listrik (TDL) pada April nanti. Hal ini dibenarkan anggota Komisi VI-DPR Bambang Wauryanto saat berkunjung ke Semarang. Dia mengaku sudah mendengar perihal rencana kenaikan TDL itu, namun DPR belum menyetujuinya. “Saya sudah lihat suratnya,

tapi kalau akhirnya tidak jadi sehabis saya sampaikan ke media ya tidak tahu juga lah,” ucapnya sambil tertawa, di Semarang, belum lama ini. Kenaikan ini kemungkinan akan menyentuh angka 10 persen dari tarif TDL sekarang. “Ini jelas akan mempengaruhi banyak hal, seperti kenaikan harga bahan pokok dan lain lain, mending kalau punya duit dibuat usaha saja, soalnya dibuat deposito juga tidak akan membantu kita karena bunga bank

akan selalu di bawah persentase kenaikan itu,” imbuhnya. Di luar jadi atau tidaknya rencana kenaikan TDL tersebut, Ngargono dari LP2K Jawa Tengah mengingatkan, sebaiknya rencana itu dipelajari dengan baik dan terperinci. “Lha wong PLN saat ini sudah dalam posisi untung kok malah mau naik lagi tarifnya,” kata Ngargono. “Naik sih boleh, tapi jaminan kepada masyarakat untuk mendapatkan kualitas pelayanan PLN apakah akan menjadi lebih baik. Seharusnya DPR-RI menanyakan dulu tanggung jawab PLN dalam hal rasio elektrikfikasi. Rasio ini adalah rasio perbandingan penyaluran listrik di pedesaan, kalau tidak salah sekarang baru 30 persen pedesaan yang tersentuh listrik dari jumlah seluruh populasi desa di Indonesia. Jadi mending

itu dulu lah yang difikirin,” sebut Ngargono. “Belum lagi masalah deklarasi mutu, yang sudah sejak 2004 dicanangkan. Tapi sampai saat ini tidak pernah ada sosialisasi kepada masyarakat. Sekarang saya tanya ke Anda. Apakah Anda pernah tahu bahwa listrik tidak boleh padam lebih dari sekian kali dalam sehari? Pasti banyak yang tidak paham tentang itu, masih banyak lagi deklarasi mutu yang harus disampaikan PLN kepada masyarakat terkait hak untuk mendapatkan mutu pelayanan,” ungkap Ngargono. Maka dari itu, DPR sebagai wakil rakyat seharusnya menagih janji mutu pelayanan kepada PLN. “Ini harus dihembuskan dewan demi kepentingan masyarakat banyak,” tutup Ngargono. (okz)

Pengamat: “Jangan Dipaksakan” J A K A RTA ( Wa s p a d a ) : Belum jelasnya teknis pelaksanaan dan kesiapan infrastruktur menunjang kebijakan pembatasan Bahan Bakar Minyak (BBM) bersubsidi memunculkan dorongan agar pelaksanaannya diundur. “Prinsipnya pembatasan konsumsi premium tidak dapat dipaksakan tanpa memberikan alternatif bahan bakar gas setara, terjangkau, aman dan layak di seluruh Indonesia,” tegas pengamat ekonomi Universitas Gadjah Mada Anggito Abimanyu melalui paparannya, di Jakarta, Kamis (19/1). Dia melihat pengaturan kembali jadwal pelaksanaan pembatasan BBM bersubsidi merupakan langkah bijak jika melihat kondisi saat ini. Opsi yang ditawarkan pemerintah yakni peralihan dari BBM bersubsidi jenis premium ke pertamax atau peralihan dari BBM ke BBG dinilai belum sepenuhnya siap. Terlebih, akhir-akhir ini muncul wacana untuk mempertimbangkan opsi kenaikan harga BBM bersubsidi. Menurutnya, opsi kenaikan BBM bersubsidi Rp500 per liter, perlu dipertimbangkan dengan sistem cash back. “Penjadwalan ulang diperlukan untuk mengakomodasi perluasan opsi,” katanya. Pengaturan ulang jadwal pelaksanaan pembatasan BBM juga bisa mengakomodir pengembangan BBG agar terjang-

kau masyarakat. Pada prinsipnya, kebijakan energi alternatif BBG merupakan langkah tepat mengingat produksi gas dalam negeri memadai dan BBG relatif aman ser ta lebih murah sekaligus ramah lingkungan. Masalah teknis pengadaan alternatif BBG adalah belum adanya kepastian pasokan gas dalam negeri, belum adanya sosialisasi keamanan BBG, dan belum adanya kesepakatan dari ATPM mengenai garansi mobil. Sedangkan untuk pengadaan converter kit memakan waktu lama dan membutuhkan standardisasi seperti SNI atau ISO. Kesiapan infrastruktur semisal jumlah SPBG juga masih sangat minim dan terkonsentrasi di Jakarta, kata dia. Sedangkan untuk masalah sosial-ekonomi, peralihan dari BBM bersubsidi jenis premium ke pertamax berpotensi menimbulkan migrasi pengguna mobil premium ke solar atau ke sepeda motor. Mantan Plt Kepala Badan Kebijakan Fiskal Kemenkeu ini menilai pelaksanaan pengalihan ini juga harus dilakukan serentak di Pulau Jawa dan Bali untuk mengurangi kemungkinan penyelewengan. Pengalihan premium ke pertamax ini perlu mempertimbangkan konversi pelat hitam kendaraan khusus milik UKM ke pelat kuning dan proses perubahan yang mudah dan sederhana. Sebab, jika kebijakan

ini ditetapkan untuk setiap kendaraan pribadi, beban biaya BBM akan dirasakan 52 juta UMKM yang sebagian besar menggunakan pelat hitam berbahan bakar premium. “Pemerintah dapat melaksanakan mengalihkan premium ke pertamax setelah pengalihan pelat UKM selesai atau perluasan infrastruktur BBG telah berjalan,” katanya. Kestabilan energi Terkait menyetabilkan energi, maka akan tercapai bila beralih ke gas. Hal ini disampaikan Pengamat Energi Kurtubi, usai Rapat Dengar Pendapat (RDP) mengenai Masukan tentang Rencana Pelaksanaan Pengaturan Pembatasan BBM Bersubsidi 2012 dengan Komisi VII DPR RI, di Gedung DPR, Senayan, Jakarta, Kamis (19/1). “Kestabilan energi akan tercapai bila kita segera beralih ke gas, mereka yang bertanggung jawab pada energi nasional untuk penggunaan BBG adalah warga negara yang baik,” tegasnya. Menurutnya, jika dikaji ulang, penggunaan gas sangatlah rasional. Alasannya, harga gas saat ini lebih murah dibandingkan BBM. Selain itu, juga lebih ramah lingkungan dan kekayaan gas di Indonesia sangat berlimpah daripada minyak. Di samping itu, menurutnya, pemerintah seharusnya juga memikirkan ketahanan


RAMONO Sukadis, Direktur Bisnis Bank Pundi (ketiga kanan) menandatangangi prasasti peresmian Bank Pundi beserta Asisten III yang mewakili Walikota Pematang Siantar (kedua kiri) disaksikan oleh Pimpinan Bank Indonesia (kedua kanan) dan Sunario, Regional Head Sumbagut Bank Pundi, Kamis (19/1).

energi dalam jangka panjang dan harus mengukur ekonomi masyarakat jika memang nantinya dilakukan perpindahan dari BBM ke BBG. Pengamat Energi Pri Agung Rahkmanto menuturkan pemerintah seharusnya tidak mencampuradukan antara pembatasan BBM subsidi dengan program konversi BBM ke gas. (okz)


Pertumbuhan Ekonomi Indonesia 2012 Melambat J A K A RTA ( Wa s p a d a ) : Pengamat ekonomi Standard Chartered Bank Fauzi Ichsan meyakini pertumbuhan ekonomi Indonesia 2012 hanya 5,8 persen atau turun dari 2011 yang mencapai 6,5 persen. “Krisis ekonomi yang tengah melanda Eropa akan

Harga Emas Turun Usai Menguat SINGAPURA (Waspada): Harga emas kembali turun setelah menguat selama tiga hari berturut-turut. Hal ini akibat harapan akan adanya bantuan dana dari International Monetary Fund (IMF) untuk Eropa. IMF tengah mengkaji untuk menggelontorkan dana sebesar 600 miliar dolar AS membantu negara Eropa yang tersangkut utang. Hal itu akan dibahas oleh 20 anggota IMF mulai Kamis (19/1). Selain itu, negoisasi utang antara Yunani dengan kreditornya kembali dilakukan setelah mengalami jalan buntu pekan lalu. Jika negoisasi ini tidak

mencapai kesepakatan, Yunani akan membuat aturan yang memaksa kreditur memangkas nilai utangnya. Seperti dikutip dari Reuters, Kamis (19/1), bergerak melemah 0,1 persen menjadi 1.657,3 dolar AS per ounce. Sementara harga emas AS juga turun 0,1 persen jadi 1.657,8 dolar AS. Sementara itu, harga emas PT Antam Tbk, seperti dilansir dari, Kamis (19/1), turun Rp3 ribu menjadi Rp504 ribu per gram untuk emas batangan ukuran satu kilogram (kg) dibandingkan Rabu (18/1) yang dibanderol Rp507 ribu per gram. (okz)

Rupiah Menguat Ke Level 9.000 J A K A RTA ( Wa s p a d a ) : Naiknya peringkat Indonesia menjadi investment grade yang dilakukan Moody’s telah menjadi sentimen positif sehingga memperkuat nilai tukar rupiah terhadap dolar Amerika Serikat (AS). AnalisValuta Asing Rahadyo Anggoro menjelaskan kenaikan rating ini menjadi salah satu sentimen yang medorong pergerakan rupiah. “Sehingga investor memilih menanamkan modalnya di Indonesia,” ungkapnya di Jakarta, Kamis (19/ 1). Hal tersebut didukung optimisme petinggi di Eropa yang menyatakan bisa mengatasi krisis. Selain itu, Bank Indonesia (BI) selaku bank sentral masih proaktif dalam menjaga mata uang rupiah di level Rp9.100 per

dolar AS. Sementara Analis Samuel Sekuritas Lana Soelistianingsih menjelaskan beberapa sentimen positif global membuat pasar AS dan sebagian Eropa ditutup naik. Sentimen positif ini kemungkinan menjalar ke Asia, dan termasuk Indonesia. “Rupiah juga berpotensi terus menguat dalam jangka pendek ini pasca kenaikan peringkat utang oleh Moody’s,” jelas dia. Menurut kurs tengah BI, rupiah diperdagangakan di level Rp9.075 per dolar AS, dengan kisaran perdagangan Rp9.030Rp9.120 per dolar AS. Sementara menurut yahoofiinance, rupiah ditutup di level Rp9.075 per dolar AS, dengan range perdagangan Rp9.005-Rp9.065 per dolar AS. (okz)

yang secara simbolis juga turut diresmikan,” ujar Ramono Sukadis, Direktur Bisnis Bank Pundi, Kamis (19/1) melalui siaran persnya. Ramono juga menjelaskan kehadiran Bank Pundi di Pematang Siantar didasari dengan semangat membangun usaha mikro. Peluang pasar kredit UMKM (usaha mikro kecil menengah) di Pematang Siantar cukup besar yang tercermin dari keberadaan pasar tradisional dan pengusaha mikro di luar pasar dengan jenis usaha yang beragam. “Seperti toko bahan bangunan, toko pakaian, apotik, bengkel, sparepart, transportasi, toko makanan-minuman dan lain-lain,” jelasnya. Sejak beroperasi sebagai bank yang fokus pada pembiayaan mikro, Bank Pundi telah mencatat pertumbuhan yang positif, jelasnya. Bank Pundi adalah bank yang secara resmi menggantikan nama PT Bank Eksekutif In-

ternasional, Tbk (Bank Eksekutif) sebagai bagian menyeluruh dari proses transformasi dan rebranding untuk menjadi bank yang fokus dalam segmen usaha mikro, kecil dan menengah (UMKM). Pemilihan nama Bank Pundi mengacu pada filosofi pundi yang merupakan simbol dari perwujudan pencapaian kemakmuran dan masa depan gemilang, katanya. “Sebagaimana pundi tersebut, maka Bank Pundi dapat dimaknai sebagai sinergi kemitraan yang menjembatani keragaman dinamika pengusaha mikro, kecil dan menengah di Indonesia untuk mewujudkan kemakmuran masyarakat Indonesia.” Hasilnya, diyakini akan menjadikan Bank Pundi ke arah yang lebih baik lagi sekaligus menjadi mitra yang dapat dipercaya dalam pengembangan usaha serta memberikan kontribusi kepada peningkatan ekonomi nasional.(m06)

berdampak langsung terhadap Asia, tak terkecuali Indonesia,” kata Fauzi dalam acara Financial Lecture: Pasca-Investment Grade di Hotel Ritz Carlton Pacific Place, Jakarta, kemarin. Fauzi juga memprediksi pertumbuhan ekonomi Indonesia baru akan kembali ke angka 6,5 persen 2013. “Perolehan `investment grade` tidak otomatis meningkatkan kondisi ekonomi Indonesia karena hal ini berkaitan dengan krisis global yang sedang mengancam perekonomian nasional,” kata Fauzi. Menurut dia, perekonomian Eropa dan Amerika Serikat (AS) yang sedang rentan saat ini berujung pada terjadinya resesi global jilid II. “Risiko terburuk dari situasi ini adalah terjadinya gejolak pasar global, sehingga memicu pelarian modal dari negaranegara berkembang, termasuk Indonesia,” kata Fauzi. Selain Indonesia, Fauzi me-

nambahkan, pada 2012 perekonomian China juga akan turun menjadi 8,1 persen dan India 7,4 persen. Bubble Sementara Bank Indonesia (BI) mencatat pertumbuhan kredit di Indonesia tahun lalu 26 persen. Di tahun ini, BI optimistis pertumbuhan kredit akan tetap tinggi. Meskipun begitu, BI perlu mewaspadai potensi bubble yang akan bisa terjadi dua sampai tiga tahun mendatang. “Pertumbuhan kredit kalau sudah dua kali dari pertumbuhan PDB nominal maka disebut tinggi,” ujar Ekonom ISEI (Ikatan Sarjana Ekonomi Indonesia) Mirza Aditiaswara dalam pesan singkatnya di Jakarta, Kamis (19/ 1). Pemerintah mencatat pertumbuhan ekonomi Indonesia di tahun lalu sebesar 6,5 persen dengan asumsi inflasi empat persen, maka menurut Mirza, jika pertumbuhan kredit

mencapai 26 persen sudah termasuk tinggi. “Kalau situasi aman-aman saja seperti tahun 2011 (tidak ada gejolak kenaikan harga BBM atau pun penurunan daya beli masyarakat) maka pertumbuhan kredit tahun ini memang bisa tumbuh 25 sampai 27 persen,” lanjut dia. Namun, katanya, hanya BI yang mengerti kondisi makro ekonomi seberapa besar pertumbuhan kredit akan aman. “(Kredit) bisa tumbuh lebih kencang lagi tetapi ada risiko impor barang konsumsi makin besar, dan jika kredit tumbuh terlalu tinggi ke sektor yang tidak produktif malah akan membuat inflasi dan bubble di dua sampai tiga tahun ke depan. BI yang harusnya lebih tahu kapan kredit disebut tumbuh terlalu tinggi dan boleh berapa tahun kredit tumbuh kencang karena yang bertanggung jawab terhadap makroprudensial,” tandasnya. (okz)

PiJay Optimis Jadi Lumbung Pangan Nasional MEUREUDU (Waspada): Pemerintah Kabupaten (Pemkab) Pidie Jaya (PiJay) optimis dapat menjadikan daerah itu sebagai salah satu lumbung pangan nasional pada 2014. “Kami optimis PiJay dapat menjadi penyumbang produksi beras untuk memenuhi kebutuhan beras nasional di masa mendatang,” kata Bupati PiJayHM Gade Salam kepada Waspada di Meureudu, Kamis (19/1). Sebelumnya juga Gade Salam menyampaikan hal itu di sela-sela pemantauan langsung kesiapan pembangunan pusat perkantoran terpadu Pemkab PiJay di kawasan Cot Trieng, Desa Manyang, Kecamatan Meureudu. Pada kesempatan itu hadirWakil Bupati HM Yusuf Ibrahim, Asisten IAbd Rahman Puteh, Kadis PU Hanief Ibrahim, Kadisperindagkop dan UKM Abubakar, Kadishutbun Bukhari Adam, dan sejumlah wartawan media cetak serta

elektronik. Dijelaskannya, upaya menjadikan PiJay sebagai salah satu lumbung pangan nasional akan tercapai melalui peningkatan pemahaman petani melalui sekolah lapang pengelolaan tanaman terpadu (SL-PTT) dan penggunaan varietas unggul. “K a m i y a k i n d e n g a n meningkatnya pemahaman petani terhadap peningkatan produksi akan mampu menggenjot hasil pertanian di masa mendatang,” katanya. Gade manambahkan peningkatan produksi tersebut juga dilakukan dengan penambahan areal sawah yakni melakukan percetakan 700 hektar sawah baru dan pembenahan infrastruktur pendukung seperti sarana irigasi dan penggunaan teknologi. Dijelaskannya, Pidie Jaya cukup potensi untuk menjadi salah satu kawasan pangan nasional dengan luas lahan yang cukup untuk meningkatkan

produksi. Pidie Jaya memiliki lahan baku pertanian sekira 8.200 hektar dengan produktivitas gabah kering panen (GKG) tahun 2011 sekira 9 hingga 10 ton per hektar (hasil ubinan). Bahkan dari luas areal sawah dan hasil produksi per hektar itu Pidie Jaya bisa surplus 70.000 ton gabah setiap musim. Jika dikali dua musim panen berarti dalam setahun terjadi surplus gabah 140.000, kata Gade Salam. Disinggung masalah kendala dihadapi petani di PiJay selama ini, secara spontan bupati menyebutkan sejauh ini tidak ada kendala petani. Karena sekira 90 persen areal sawah di PiJay memiliki irigasi teknis dan semi teknis. Begitu juga dengan persiapan dan stok pupuk bersubsidi yang dibutuhkan para petani itu selalu tersedia secukupnya di tingkat distributor, penyalur dan pengecer dengan harga jual terjangkau para petani.(b09)

Harga Minyak Bisa Capai Kamar Hotel Di Medan

Bank Pundi Salurkan Kredit Mikro Rp3,1 T 115 Dolar AS Per Barel MEDAN ( Waspada): PT Bank Pundi Indonesia, Tbk (Bank Pundi) mengungkapkan sampai akhir Desember 2011 telah mengucurkan pembiayaan Rp3,5 triliun dengan Rp3,1 triliun di kredit mikro. Hal itu terungkap saat Bank Pundi meresmikan kantornya di Pematang Siantar, yang berlokasi di Jalan Sutomo. Peresmian dihadiri Asisten II Kodya Pematang Siantar Leo Simanjuntak, Pemimpin Bank Indonesia Pematang Siantar Agus Budiono, Direktur Bisnis Bank Pundi Ramono Sukadis dan Sunaryo, Regional Lending Head Bank Pundi, Sunaryo. “Kantor cabang Pematang Siantar merupakan bagian dari 198 kantor yang telah memperoleh izin dari Bank Indonesia di seluruh Indonesia sejak Januari 2011 hingga saat ini. Kantor Pematang Siantar ini membawahi Bank Pundi Tebing Tinggi, Kisaran, Rantau Prapat, Kota Pinang, Padangsidimpuan


Pekerja memindahkan jeruk di gudang importir buah di kawasan Ancol, Jakarta Utara, Rabu (18/1). Menjelang Tahun Baru Imlek 2563, harga jeruk impor mengalami lonjakan hingga mencapai 50 persen, hal tersebut dipicu oleh menipisnya stok jeruk dari importir.

JAK ARTA ( Waspada): Harga minyak diproyeksikan bisa melambung tinggi, menembus level 115 dolar AS per barel. Namun, jika kondisi politik internasional memanas harganya bisa melebihi batas psikologis tersebut. Hal ini disampaikan Pengamat Energi Kurtubi usai Rapat Dengar Pendapat (RDP) mengenai Masukan tentang Rencana Pelaksanaan Pengaturan Pembatasan BBM Bersubsidi 2012 dengan KomisiVII DPR RI, di Gedung DPR, Senayan, Jakarta, Kamis (19/1). Menurutnya, pergerakan harga minyak mentah saat ini dipengaruhi dua faktor, yakni ketergantungan minyak dalam jangka panjang sementara tren produksi energi tak terbarukan tersebut terus menurun. Faktor lainnya, yakni harga minyak dunia saat ini tergantung dari situasi politik di wilayah Eropa dan Amerika

Serikat. “Harga minyak bisa tembus 115 dolar AS per barel. Namun, apabila kalau konflik di Selat Hormuz tidak meluas,” ungkap Kurtubi. Dirinya pun menyesali sikap Indonesia yang masih mempermasalahkan harga minyak yang berkaitan dengan kondisi global. Seperti diketahui, harga minyak saat ini berada di kisaran 101 dolar AS per barel. Sebelumnya, harga minyak mentah Brent langsung naik ke 111 dolar AS pada Senin waktu setempat usai khawatir atas gangguan pasokan, setelah Iran memperingatkan tetangga di Teluk Arab. Terpantau, minyak mentah Brent naik 29 sen menjadi 110,73 dolar AS per barel. Sementara untuk kontrak, membukukan kerugian mingguan sebesar 2,36 persen. Minyak mentah Amerika Serikat (AS) naik 23 sen menjadi 98,93 dolar AS per barel. (okz)

Bertambah 1.000

MEDAN (Waspada): Kota Medan mendapat tambahan 1.000 kamar hotel lagi, dengan bermunculannya hotel-hotel baru yang sekarang dalam tahap penyelesaian. Benny Langen, Executive Asistant Manager (EAM) Asean International Hotel, berbicara dengan wartawan, Rabu (18/ 1). Didampingi Afwandi, Marketing Manager, dia menyebutkan disela-sela acara syukuran 16 tahun Asean International Hotel, bahwa dengan pertambahan kamar hotel mencapai 1.000, harus diakui sebenarnya Medan sudah kelebihan. Namun begitu pun saat ada pertemuan baik tingkat nasional maupun internasional, Medan masih kekurangan, jelasnya. Dia akui perkembangan industri perhotelan sekarang menjadi dilema, karena secara reguler, hotel kekurangan tamu. “Tapi ada kalanya kita malah kekurangan kamar,” tuturnya.

Peringatan 16 tahun Asean Hotel International ditandai dengan mengundang anak yatim dari panti asuhan Islam, Kristen, Hindu dan Budha juga sekaligus hotel ini melakukan renovasi total baik kamar yang tujuannya siap menghadapi tantangan maupun persaingan yang semakin ketat. Benny Langen menambahkan dengan kamar hotel sekarang ini, bukan tidak mungkin bakal terjadi perang tarif. Kalau melihat kunjungan tamu ke Medan serta berlebihnya jumlah kamar hotel, tentu tidak ada pilihan lain, kecuali perang harga tak terelakkan. Asean Hotel International sendiri menghadapi persaingan yang semakin ketat, selain melakukan renovasi, juga memperluas jaringan menjaring tamu termasuk menawarkan fasilitas dimilikinya melalui online serta kerjasama dengan pihak penerbangan. Apalagi

2012 ini hotel berbintang yang lagi dibangun bakal segera beroperasi, tandasnya. Ketika ditanya kenapa investor begitu getol membangun hotel di Medan, dia melihat karena Medan menjadi pusat wilayah barat. Dengan begitu tentu saja bakal banyak konvensi nasional akan diadakan di wilayah ini seperti bulan Desember mendatang, Medan membutuhkan 2.000 kamar, karena bakal ada pertemuan besar di sini. Ditengah kegalauan pihak hotel di Medan sekarang ini, Benny Langen melihat ada titik cerah yang bakal bisa membantu mengisi kamar hotel yaitu dengan adanya rencana penerbangan langsung dari Ipoh dan Malaka, Malaysia, ke Medan. “Kalau bisa terwujud tentu sangat menguntungkan pihak hotel, karena diharapkan banyak turis asal negeri jiran berlibur ke Sumatera Utara”. (m19)

Sumatera Utara

WASPADA Jumat 20 Januari 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:37 12:50 12:38 12:45 12:44 12:41 12:37 12:33 12:40 12:39

‘Ashar 16:00 16:13 16:01 16:07 16:07 16:05 16:01 15:57 16:03 16:02

Magrib 18:36 18:46 18:36 18:41 18:41 18:43 18:37 18:33 18:39 18:37



Shubuh Syuruq


19:48 19:59 19:49 19:54 19:54 19:56 19:50 19:46 19:52 19:50

05:07 05:23 05:08 05:17 04:16 05:08 05:07 05:02 05:10 04:11

05:17 05:33 05:18 05:27 05:26 05:18 05:17 05:12 05:20 05:21

L.Seumawe 12:43 L. Pakam 12:36 Sei Rampah12:35 Meulaboh 12:47 P.Sidimpuan12:34 P. Siantar 12:35 Balige 12:35 R. Prapat 12:32 Sabang 12:50 Pandan 12:36

06:36 06:53 06:37 06:47 06:45 06:37 06:36 06:32 06:39 06:40

Zhuhur ‘Ashar 16:06 15:59 15:58 16:10 15:59 15:59 15:59 15:56 16:12 16:00




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:39 18:35 18:34 18:45 18:37 18:35 18:36 18:33 18:45 18:38

19:52 19:48 19:47 19:58 19:49 19:48 19:49 19:46 19:58 19:51

05:16 05:06 05:06 05:18 05:01 05:04 05:03 05:00 05:24 05:04

05:26 05:16 05:16 05:28 05:11 05:14 05:13 05:10 05:34 05:14

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:36 12:38 12:48 12:40 12:37 12:44 12:32 12:43 12:36 12:35

18:38 18:38 18:44 18:41 18:36 18:41 18:32 18:42 18:37 18:34

19:51 19:51 19:56 19:54 19:49 19:54 19:45 19:55 19:50 19:47

05:04 05:07 05:20 05:09 05:08 05:16 05:02 05:12 05:03 05:05

05:14 05:17 05:30 05:19 05:18 05:26 05:12 05:22 05:13 05:15

Panyabungan 12:33 Teluk Dalam12:40 Salak 12:38 Limapuluh 12:34 Parapat 12:36 GunungTua 12:33 Sibuhuan 12:33 Lhoksukon 12:42 D.Sanggul 12:36 Kotapinang 12:31 AekKanopan 12:33

06:45 06:35 06:35 06:47 06:31 06:34 06:33 06:29 06:53 06:33

16:00 16:01 16:10 16:04 16:01 16:07 15:56 16:06 16:00 15:58

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

SD 056640 Pelawi Dalam Kekurangan Lokal P. BRANDAN (Waspada): Sarana infrastruktur bangunan lokal belajar di SD 056640 Dusun Pelawi Dalam Desa Pelawi Selatan, Kecamatan Babalan Langkat, sangat mendesak untuk penambahan ruang belajar. Menurut Kasek SD 056640 Plawi Selatan, Sandi Sunardi, S.Pd, kemarin, kalau masalah lahan masih tersedia, sedangkan pembangunan yang diharapkan dua ruang belajar lagi. Saat ini dia sedang merancang bangunan kamar mandi/WC di setiap ruang (lokal) sebanyak delapan lokal, tapi yang baru dibuat hanya dua lokal dan tersisa enam lokal lagi. Kata Kasek lagi, programnya ini adalah agar usai ke kamar mandi murid kembali belajar, tidak seperti selama ini, jika murid ke kamar mandi yang berada di luar lokal, biasanya tak masuk lagi ke lokal.(c01)

13 Siswa MTsN Binjai Ikut Olympiade Sains Se Sumut BINJAI (Waspada): 13 Siswa Madrasah Tsnawiyah Negeri Binjai mengikuti Olympiade Sains Madrasah se Sumatera Utara di Padang Sidempuan. Ka. MTsN Binjai, Drs. HM Alfian didampingi Wakil Kabid Kesiswaanselakupenanggungjawab,Drs.Nasruddin,menjelaskan Kamis (19/1), keikutsertaan siswa MTsN Binjai ke Olympiade Sains yang dilaksanakan, Sabtu (21/1) di Padangsidimpuan, untuk menguji kemampuan siswa. 13 Siswa mengikuti tiga mata pelajaran, untuk IPA Riska Putriani, Rasyid Ansyari Gani, Nurwahyuni dan Mitra Prasetyo. Bahasa Inggris Ikhwanul, Dinda, Chairulnisa, Nikmah, Syafa dan Matematika Putri Karina, Hari Permana, Dian Setiawan dan Ainul Husna. Ka. MTsN Binjai, HM Alfian menjelaskan, siswa ke Olympiade SainsmerupakanhasilseleksidandiPadangsidimpuandiharapkan meraih hasil terbaik, sehingga bisa menjadi duta Sumut ke tingkat nasional.(a04)

Polres Sergai Tangkap Oknum PNS Jurtul Kim SEI RAMPAH (Waspada): Polres Serdang Bedagai menangkap oknum PNS berinitial AS, 55, warga Dusun I, Desa Sei Bamban, Kec. Sei Bamban, Kab. Serdang Bedagai menjadi juru tulis (jurtul) judi Kim dan Togel, Selasa (17/1) malam. Diamankan barang bukti telepon seluler, dua lembar kertas berisi nomor tebakan dan uang Rp139 ribu. Menurut tersangka kepada wartawan, dia baru empat hari menjalankan bisnis Kim dan Togel dengan menyetorkannya kepada bandar bermarga S. “Saya baru empat hari menjadi jurtul Kim dan Togel. Omzetnya hanya sedikit,” katanya. Sementara Kasubag Humas Polres Sergai AKP ZN Siregar, ketika dikonfirmasi, Rabu (18/1), membenarkan penangkapan tersangka. “Tersangka dan barang bukti telah diamankan,” kata Siregar.(a08/c03)

Tersangka Cabul Diamankan Polisi TEBINGTINGGI (Waspada): Menolak menikahkan anaknya karena masih berusia di bawah umur, seorang ibu rumah tangga (IRT) melaporkan pacar putrinya ke Polres Tebingtinggi, karena telah melakukan perbuatan cabul. Atas laporan itu, pacar sang anak diamankan petugas, Senin (16/1) malam sekira pukul 20.00. Guna mempertanggungjawabkan perbuatannya, pelaku Her alias Godek, 25, warga Jalan Pulau Sumbawa, Lk. III, Kel. Persiakan, Kec. Padang Hulu, Tebingtinggi terpaksa harus mendekam dalam sel tahanan, kendati ia mengaku sudah berencana akan melamar sang pacar. “Kami saling mencintai, namun ibunya belum siap menerima anaknyakunikahi,alasannyakarenabunga(bukannamasebenarnya) masih kelas II SMA,” ujar pelaku saat menjalani pemeriksaan di ruang unit PPA Polres Tebingtinggi, Selasa (17/1). Pria lajang yang setiap hari bekerja sebagai karyawan bengkel las ketok di Jalan Delima Tebingtinggi itu juga mengakui telah menjalin pacaran dengan bunga 8 bulan lalu. Dua bulan setelah berpacaran, ia telah berhasil merenggut keperawanan bunga di atas sepedamotornya. Saat ‘mejeng’ malam minggu di pinggir jalan tepatnya di depan perkebunan sawit perkuburan China Jalan Baja, Kel. Tambangan, Tebingtinggi. Setelah berhasil memerawani pacarnya, lalu ketagihan sehingga setiap kali bertemu, keduanya sering melakukan hubungan suami istri di berbagai lokasi. Tapi Bunga tidak hamil. Kini pelaku harus mendekam dalam tahanan atas perbuatannya. Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi, S.Ik ketika dikonfirmasi melalui Kanit PPA, Aiptu Ismar Ramadhan mengatakan pelaku diancam hukuman penjara maksimal 15 tahun.(a11)

Tidak Ada Diskriminasi Dalam Proses Pendidikan TEBINGTINGGI(Waspada):Kami tidak menghendaki adanya diskriminatif dalam dunia pendidikan termasuk di sekolah ini. Jangan sampai karena orangtuanya pejabat, pelajar menikmati fasilitas serta perlakuan istimewa dari sekolah, berbeda dengan siswa lainnya. Jika itu terjadi, kita tengah mengajarkan feodalisme kepada generasi mendatang. Demikian Wali Kota Tebing Tinggi Ir. H. Umar Zunaedi Hasibuan, MM dalam amanatnya pada upacara bendera, barubaru ini di SMAN 1 KotaTebingtinggi Jalan Kom.Yos Sudarso. Hadir Wakil Wali Kota H. Irham Taufik, SH, MAP, unsur Muspiko Kadis Pendidikan Drs. H. Pardamean Siregar, MAP dan sejumlah Kadis. Wali Kota, juga memberi motivasi kepada siswa untuk terus memacu prestasi agar menjadi manusia yang berhasil dimasa datang. Dia mengingatkan bahwa SMA yang tertua diTebingtinggi adalah SMAN 1 dan sudah banyak melahirkan jenderal, pejabat penting serta pengusaha-pengusaha sukses. “Semoga anakanak di sini semuanya tetap dapat mengikuti jejak mereka,” katanya disambut tepuk tangan meriah peserta upacara. Usai upacara dilanjutkan dengan penyerahan bantuan alat olahraga dari Kabag Kesra berupa 3 bola voli yang diterima langsung oleh Kepsek SMAN 1 Muhammad Syarif. Sebelum meninggalkan sekolah, Umar Zunaidi sempat ramah tamah dengan seluruh guru. Dikatakan, seluruh guru di kota Tebingtinggi agar meningkatkan mutu serta kompetensi yang disyaratkan memperoleh sertifikasi.(a09)

06:33 06:36 06:50 06:38 06:37 06:45 06:31 06:42 06:33 06:34

Zhuhur ‘Ashar 15:57 16:04 16:02 15:57 15:59 15:57 15:57 16:05 16:00 15:55 15:57




Shubuh Syuruq

18:36 18:44 18:38 18:33 18:36 18:35 18:35 18:39 18:37 18:32 18:33

19:49 19:56 19:51 19:46 19:49 19:48 19:48 19:52 19:50 19:45 19:46

04:59 05:06 05:07 05:03 05:05 05:00 04:59 05:15 05:05 04:59 05:01

05:09 05:16 05:17 05:13 05:15 05:10 05:09 05:25 05:15 05:09 05:11

06:28 06:35 06:36 06:33 06:34 06:29 06:28 06:44 06:34 06:28 06:31

Ketua Tim Menko Polhukam:

Selesaikan Masalah Tanah Dengan Arif LUBUKPAKAM (Waspada): Ketua Tim Kemenko Polhukam, Brigjen TNI Andrie Sutarno mengingatkan Pemkab Deliserdang agar menyelesaikan semua persoalan daerah dengan arif, khususnya masalah sengketa tanah. Pesan itu disampaikan Brigjen TNI Andrie Sutarno saat bersilaturahmi dengan Pemkab Deliserdang di ruang rapat Lantai II Kantor Bupati Deliserdang, Kamis (19/1). Brigjen TNI Andrie didampingiPerwiraPenghubung Kodim 0204 Deliserdang Mayor Inf. Goklas Dongoran diterima Wakil Bupati H. Zainuddin Mars dan unsur Muspida lainnya. Sebelumnya,Wabup H. Zainuddin Mars mengungkapkan bahwa situasi stabilitas di Deliserdangsecaraumumdalamkondisi kondusif. Hanya yang perlu menjadi perhatian semua pihak adalah ekses dari pembangunan bertaraf internasional, yakni waduk raksasa di Sibiru-biru dan khususnya bandara Kualanamu. “Tak tertutupi ekses dari pembangunanbandaraKualanamu, selain masalah jalan adalah masih bertahannya sejumlah kepalakeluargamantankaryawan PTPN 2 di areal bandara,” ujar Wabupmenambahkan,pihaknya

tetap menge-depankan sisi kemanusiaandalammenyelesaikan masalah ganti rugi tersebut, namunkhawatirkarenaadacampur tangan pihak luar yang mempengaruhi warga. Brigjen TNI Andrie menanggapipaparanWabupH.Zainuddin Mars menegaskan, langkah Pemkab Deliserdang harus tetap di atas peraturan yang berlaku agar mempunyai landasan hukumyangkuat.“Semuapersoalan harus transparan, ajak semua elemen seperti Komnas HAM, akademisi dan lainnya untuk duduk bersama menyelesaikan masalahini,mengingatwaktunya hanya 9 bulan sesuai target operasionalbandaraKualanamu,” imbuh Brigjen TNI Andrie. RTRW Hankam Pada kesempatan itu, Brigjen TNI Andrie juga menyampaikan inti pertemuan pihaknya dengan Pemkab Deliserdang adalah mengingatkan soal Rencana Tata Ruang Wilayah (RTRW) perta-

hanan keamanan. “Meski saat ini peraturan perundang-undangan mengenai ini sedang dalam proses, Pemkab sudah bisa mengakomodir soal RTRW Hankam ini,” ingat Brigjen TNI Andrie. Brigjen TNI Andrie beralasan, informasi soal RTRW Hankam penting mengingat kawasan Deliserdang secara historis merupakan salah satu titiktempat pendaratan musuh pada masa Belanda dan Jepang. “Jadi jangan nanti salah menilai TNI akan meminta lahan, ini semua untuk stabilitas nasional, khususnya ketahanan Negara Kesatuan RepublikIndonesiadanRTRWini harusbenar-benarbermanfaatbagi warga sekitar, khususnya warga Deliserdang sendiri,” kata Brigjen TNI Andrie. Pertemuan yang berlangsung sekitar dua jam itu, dihadiri Kapolres Belawan AKBP Hendro Kiswanto, Kasdim 0204/DS Mayor Inf Hendra Wijaya, Waka Kabag REN Polres DS AKP Suharno, SH, M.Hum, Danyon 121 MK Letkol Inf Ayub Akbar, Asisten II Ir Agus, M.Si, Kepala BappedaIrIrmanDj. Oemar,M.Si dan Kadis Infokom Drs Neken Ketaren.(m16/a06)

Empat Tersangka Judi Prapradilankan Polisi TEBINGTINGGI (Waspada): Empat tersangka pelaku judi melalui pengacaranya menggugat Polres Tebingtinggi melalui praperadilan. Mereka beranggapan penangkapan tersebut menyalahi prosedur. Pengacara tersangka melayangkansuratkepadaPengadilan Negeri Tebingtinggi Deli sesuai nomor register No. 01/Pid.Pra/ 2012/PN.TT pada Senin 9 Januri 2012. Perkaranya mulai disidang, Senin (16/1), dipimpin majelis hakimA.Rahardini,SH.Ke empat tersangka judi,Yustinus Hulu, 31, warga Jalan Merpati Blok E, No. 12, Otanigo Hulu, 26, warga Jalan Merpati Blok D, No. 43, Emanuel Hulu, 25, warga Jalan Merpati Blok C, No. 51 dan Joni Herman Mendofa, 23, warga Jalan Merpati

Blok G, No. 10. Ke empatnya tinggal di satu perumahan BTN Griya Bulian Permai, Kel. Pinang Mancung, Kec. Bajenis, Tebingtinggi. Ke empat pelaku judi ‘ceme’ (sebutan jenis permainan judi bagi warga Nias yang menggunakan kartu domino-red) itu tertangkap tangan oleh petugas Sat Reskrim Polres Tebingtinggi saat bermain judi 29 Desember 2012. Mereka mengaku baru saja usai menyaksikan pertandingan bola kaki di televisi,antarakesebelasan Malaysia dan Indonesia. Menurut pengacara ke empattersangka,yakniYantiPerawati Situmorang, SH dan Riky Poltak D. Sihombing, SH, dalam melakukanpenangkapandanpenggerebekan petugas Polres tidak

sesuai prosedur KUHAP Bab V tentang Penangkapan, Penahanan, Penggeledahan Badan, Pemasukan Rumah, Penyitaan dan Pemeriksaan Surat. KapolresTebingtinggimelalui Kasubag Humas, AKP Ngemat Surbakti ketika dikonfirmasi wartawanmengatakan,kasus303 tentang perjudian adalah perkara yang sifatnya tertangkap tangan dan tidak seketika itu harus dilengkapi surat perintah penangkapan. “Petugas hanya dilengkapi surat tugas, dan surat tugas itu juga tidak diberikan kepada tersangka yang akan ditangkap. Kalau menunggu surat penangkapan, tentu pelaku judi keburu kabur,” ucap AKP Surbakti.(a11)

Waspada/Rizaldi Anwar

WABUP Deliserdang H. Zainuddin Mars memberikan paparan di depan Ketua Tim Kemenko Polhukam Brigjen TNI Andrie Sutarno.

Satker Harus Bertanggungjawab Aspal Jalan Lubukpakam-Beringin LUBUKPAKAM (Waspada): Asisten II Agus Ginting dan Kadis Pekerjaan Umum Deliserdang Faisal menegaskan Satuan Kerja (Satker) Bandara Kualanamu harus bertanggungjawab dalam masalah besar yang dialami masyarakat Kecamatan Beringin. Pernyataan kedua pejabat tinggi Pemkab Deliserdangituterungkapsaatmenerimapuluhan masyarakat Beringin yang melakukan demo di depan Kantor Bupati Deliserdang, dan berakhir pada pemblokiran jalan Lubukpakam-Pantailabu, persisnya di depan simpang Ramunia, Dusun Masjid Desa Beringin Kec. Beringin, Deliserdang. “Untuk menyelesaikan permasalahan ini Satker harus dipanggil karena Menhub telah menetapkan kesepakatan dalam pemeliharaan jalan,” tegas Kadis PU Faisal. Faisal juga meminta agar masyarakat Kec. Beringin membantu dan mendukung Pemkab Deliserdang untuk mendesak pihak Bandara. “Kita sudah seringkali menyampaikan aspirasi masyarakat Beringin, namun kita lihat sendiri hingga kini belum ada perubahan. Jadi, intinya, Satker harus bertanggung jawab,” tegas Faisal. Sebelumnya, ratusan masyarakat Beringin yang tergabung dalam Forum Komunikasi Masyarakat Beringin (FKMB) dan Forum Komunikasi Himpunan Pemuda Deliserdang (FKHPDS) berunjukrasa ke Kantor Bupati Deliserdang dan DPRD Deliserdang. Aksi demo yang kesekiankalinya itu menuntut agar Pemkab Deliserdang dan pihak PT. Angkasapura selaku pelaksana pembangunan Bandara tidak tutup mata dan telinga serta bertanggung jawab atas penderitaan yang dialami masyarakat atas dampak proses pembangunan itu dengan membangun kembali jalan yang layak dan aman untuk dilalui. “Pihak Bandara Kualanamu harus segera mengaspal jalan Beringin, jangan janji-janji palsu, kami sudah muak karena terus dibohongi.” teriak kordinator masyarakat Beringin Imran Nasution padaorasinyadidepanKantorBupatiDeliserdang. FKMB juga meminta agar pihak Bandara Kualanamu menghentikan lalu-lalang kendaraan dump truk yang melebihi tonase karena merusak

badan jalan, dan berdebu serta banyak mengakibatkan penyakit bahkan korban jiwa yang disebabkan dump truk tersebut. “Masyarakat sudah banyak menjadi korban, sakit sesak nafas, bahkan ada yang meninggal karena ditabrak dump truk, dan baru-baru ini telah terjadi kecelakaan yaitu dump truk menabrak rumah warga bahkan menabrak sekolah,” teriak Imran lagi. Aksi itu ditengahi oleh Camat Beringin Batara Rival Harahap S.Sos., MSc., agar para pendemo mengirimperwakilannyauntukberdelegasidengan pejabat setempat. Hasilnya, 10 orang dari masyarakat Beringin berdelegasi ke ruangan Asisiten II kantor Bupati yang diterima langsung Asisten II Agus Ginting, Kadis PU Faisal, Camat Beringin Batara R. Harahap dan Kasatpol PP J. Manurung. Camat Beringin Batara Rival Harahap dalam menanggapi warganya yang berunjukrasa itu telah berupaya keras menyampaikan aspirasinya ke pihak Bandara. “Namun pihak bandara hingga kinitidakpernahmerealisasikanpermintaanwarga Beringin,” kata Camat Batara. Aksi unjuk rasa itupun dilanjutkan ke gedung DPRD Deliserdang serta pengunjukrasa turun ke jalan lintas Beringin dengan membakar ban dan menghentikan puluhan dump truk pengangkut material pembangunan bandara. Terpaksa Kadis PU Deliserdang Faisal menyebutkan persoalanjalanLubukpakam-Pantailabumemang ibarat buah simalakama. Begitupun, pihaknya sudahmenganggarkanpengaspalanjalanitutahun ini. “Dengan sangat terpaksa itu kita lakukan menggunakandanaAnggaranPendapatanBelanja Daerah (APBD) Deliserdang, seharusnya ini tanggungjawab Satker, namun imej yang jelek Pemkab,” jelas pemikir di dinas Pekerjaan Umum Deliserdang ini kepada wartawan usai menerima delegasi pendemo kemarin. FaisaldidampingiAsistenIIAgusGintingmeminta kesabaranwargaBeringinkarenajalanmerekasudah menjadiprioritaspihaknya.“Namunnamanyaanggarankansemuabutuhproses,meskiharus‘terpaksa’ itukitalakukan,”ujarnyasambilberlalumeninggalkan ruangan Asisten II, kemarin. (m16/a06)

Warga Syahbandar Minta Galian C Ditutup TEBINGTINGGI (Waspada): Konflik antar warga Desa Penggalian, Kec. Tebing Syahbandar, Kab. Sergai dengan pengusaha galian C terkait dampak yang ditimbulkan dari pengerukan tanah di sana diupayakan penyelesaiannya dengan melakukan pertemuan kedua pihak, difasilitasi Polres Tebingtinggi, Rabu (18/1). Pertemuan untuk mencari solisi terhadap masalah tersebut berlangsung di ruang KP3i Polres dihadiri sejumlah perwakilan warga, pengusaha, Kades, Camat, Danramil 24, Kapolres diwakili Wakapolres Kompol Syafwan Khayat,M.Hum.HadirparaKasat, Kapolsek dan sejumlah perwira. Kapolres Tebingtinggi AKBP Andi Rian Djajadi, S.Ik diwakili Wakapolres Kompol Syafwan Khayat, mengimbau pengusaha Rifan (pemilik tanah), Syamsul, Ucok (pengawas) untuk melengkapi surat-surat izin galian C. Apabila belum lengkap agar aktivitasnya dihentikan atau distop. Camat Tebing Syahbandar, Dingin Saragih, SIP mengatakan, masalah menentukan bisa tidaknyadilokasiituadagalianCadalah kewenangan Pemkab Sergai.

Sejauhinipihaknyabelumpernah mengeluarkan rekomendasi galian C. “Kita akan memberikan rekomendasi, bila pihak pengusaha melengkapi persyaratan – persyaratannya, walau pihak pengusaha pernah datang mengurus izin, namun karena persyaratantidaklengkappihaknyabelum mengeluarkan rekomendasi,” tuturnya. Sementara perwakilan warga, Jhon Eliaman Saragih mengatakan warga kedua desa yakni Desa Penggalian dan Desa Sibulan mengatakan, warga selama ini kesal dengan dampak yang ditimbulkan dari usaha tersebut. Selain menimbulkan kerusakan jalan dari truk-truk pengangkut tanah dan alat berat yang melintas di jalan desa sepanjang 6 km, debu dari truk sering berterbangan ke jalan. Bilamusimhujam,jalanyang rusak menjadi becek, anak-anak sekolah dari Desa Penggalian ke Kota Tebingtinggi banyak terpeleset. Selain itu warga juga terkendala mengangkut hasil bumi.Nilaijualhasilbumimenjadi anjlok karena jalan sebagai urat nadi warga dua desa rusak parah. Karena kesal warga mengatakan

tidak perlu lagi solusi dalam pertemuan itu, melainkan pengusaha bersama alat beratnya angkat kaki dari Desa Penggalian. Sementara Syamsul, pihak pengusaha mengatakan, galian yang mereka lakukan di Desa Penggalian, bukan galian C melainkan merupakan pemerataan tanah. Sementara ini izin yang dipegang baru dari kepala desa. “Persyaratan kami upayakan untuk dilengkapi, biaya pajak kita keluarkan termasuk kepada pemilik tanah. Kalau ditutup berapa kerugian kami,” ucapnya. Dia beralasan jalan Desa Penggalian merupakan jalan umum, bukan hanya dilalui kenderaan miliknya, tapi juga dilalui kenderaan perkebunan. Dia menuding jalan di sana baru sekali diperbaiki kualitas jalan rendah hingga mudah rusak. Setelah mendengar penuturan kedua belah pihak Wakapolres Kompol Syafwan Khayat mengatakanaktivitaspengusahasementara distop, begitu pun nantinya diserahkan kepada pemerintah kabupaten apakah aktivitas pengusaha dapat diteruskan atau tidak. “Kita akan pantau lokasi tersebut,” tegasnya.(a11)

Lesbian Diamankan Polisi STABAT (Waspada): Aparat Polres Langkat meringkus seorang wanita homoseks yang mencabuli seorang perempuan masih di bawah umur, Senin (16/1) malam.TI diringkus di kediamannya Desa Pelawi Selatan Kec. Babalan. Pelaku diringkus setelah orangtua korban mengadu ke Mapolres Langkat Senin siang. Menurut orangtua korban, pada 1 Januari 2012 dia curiga saat tanpa sengaja melihat bagian dada dan perut anaknya Tika (nama samaran), penuh bekas ciuman kemerahan. Tikaterusdidesakpihakkeluargauntukmengatakanapapenyebab bekaskemerahantersebut.Setelahberhari-harididesakperempuan berusia14tahunitubarumengakui,diaseringdicabulitetangganya TI yang juga perempuan, berusia 40 tahun. Mendengar perkataan itu pihak keluarga berang kemudian mengadu ke polisi. Kasat Reskrim Polres Langkat AKP Aldi Subartono, mengatakan kasus lesbianisme itu terus ditindaklanjuti. (a03)


Wasapada/Muhammad Idris

PERWAKILAN warga Desa Penggalian,Kec.Tebing Syah Bandar,Sergai dan pengusaha dipertemukan dalam dialog difasilitasi Polres Tebingtinggi.

Waspada/Rizaldi Anwar

MASYARAKAT Beringin menuntut haknya yang dirampas pelaksana Bandara Kualanamu di depan kantor Bupati Deliserdang, kemarin

DPRD Desak BPK Audit PD Pembangunan Binjai BINJAI (Waspada): Dugaan adanya tindak korupsi di PD Pembangunan Kota Binjai seperti mulai menunjukkan titik terang. Bahkan desakan untuk mengungkap kasus itu disuarakan DPRD Binjai, dengan menyurati Badan Pemeriksa Keuangan (BPK) Perwakilan Sumatera Utara. Suara wakil rakyat yang memohon kepada BPK untuk melakukan audit investigasi terhadap PD Pembangunan Kota Binjai, tertuang dalam surat no. 700-124 tertanggal 17 Januari 2012, tindaklanjut hasil audit BPKP yang menyatakan hasil konfirmasi dengan pihak Penyidik Poldasu, dimana ternyata kasus tersebut telah ditangani penyidik Poldasu sesuai Surat Perintah Penyidik No. Pol: Sprin-Lidik/273/VII/2010/Dlt. “Sehingga tidak ada alasan bagi pihak penyidik baik itu dari Polresta Binjai dan Kejari Binjai untuk tidak proaktif menyikapi kasus tersebut. Jangan hanya tersangka maling ayam saja yang ditangkap, sementara kasus korupsi yang merugikan uang rakyat, pelakunya bebas berkeliaran,” ujar Ketua Lembaga Bantuan Hukum (LBH) Medan, Nuriyono, SH di Medan, Kamis (19/1). Lanjut Nuriyono, surat permohonan DPRD Binjai dan hasil audit BPKP sebenarnya cukup dijadikan bukti awal untuk melakukan penyidikan dan penyelidikan, terkait dugaan korupsi di badan usahan milik Pemko Binjai. Ditambahkan, sesuai hasil audit BPKP PD Pembangunan pada tahun 2009 mengalami kerugian kumulatif Rp9,926,762,594,53 dari modal yang telah dicucurkan Pemko Binjai Rp18,749,998,425,00.

Anehnya dokumen terkait laporan kerugian tersebut tidak tersedia, begitu pula terkait transaksi keuangan tahun 2010 sampai dengan 29 Juli 2010 juga tidak tersedia, sesuai keterangan Direktur PD Pembangunan yang baru, Ir. H. Ayub Saiful kepada tim audit BPKP.“Sehingga tidak ada alasan bagipihakpenyidikuntukmenghentikankasusnya, karena aroma adanya indikasi tindak korupsi itu cukup kental,” kata Nuriyono. “Sebesarkecilapapunkerugianyangdilaporkan oleh direksi PD Pembangunan tapi tetap harus dipertangung jawabkan secara tertulis karena hal itu menyangkut keuangan negara yang harus dipertangung jawabkan kepada rakyat”, tegas Nuriyono menambahkan. Di Poldasu Proses penyelidikan PD Pembangunan Kota Binjai masih ditangani Poldasu, sesuai surat perintah penyelidikan No. Pol; Sprint-Lidik/273/ VII/2010/Dit Reskrim, tertanggal 28 Juli 2010. Dengan demikian BPKP Perwakilan Sumatera Utara sesuai suratnya ke Pemko Binjai 13 Oktober 2011, akan melanjutkan audit menunggu penanganan perkara tersebut. DirektureksekutifLSMP3HBinjaiMuhammad Jaspen Pardede juga mempertanyakan, mengapa satu tahun lebih proses penyelidikan PD Pembangunan Binjai di Poldasu belum tuntas. Dan berharap Reskrim Poldasu melanjutkan proses dugaan korupsi PD Pembangunan yang merugikan keuangan Pemko Binjai hampir Rp10 miliar itu. (m14/a04)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

MTQ Dan Festival Nasyid Labuhanbatu Di Bilah Hulu RANTAUPRAPAT (Waspada): Pelaksanaan Musyabaqoh Tilawatil Quran dan Festival Nasyid Tingkat Kabupaten Labuhanbatu Tahun 2012 akan dilaksanakan di Kec. Bilah Hulu. Demikian dikatakan Plt Sekdakab Labuhanbatu H Ali Usman Harahap SH ketika memimpin rapat persiapan MTQN dan Festival Nasyid Tahun 2012 di ruang data dan karya kantor bupati, Rabu (17/1). Ali Usman mengatakan, persiapan waktu dan lokasi pelaksanaan kedua event ini harus matang dengan memperhatikan peran serta masyarakat. Dijelaskannya, bahwa peran serta masyarakat tidak hanya dalam bentuk dukungan dana tetapi juga dalam bentuk kehadiran meramaikan acara tersebut. “Selama ini, ketika event berlangsung hanya sedikit masyarakat yang hadir sehingga event tersebut terkesan hanya seremonial tanpa kesan apa-apa”, kata Ali Usman. Oleh sebab itu, katanya, camat harus mengerahkan seluruh kepala desa dan lurah untuk selanjutnya dapat mengerahkan masyarakat agar berbondong-bondong menyaksikan kegiatan tersebut. Ali Usman juga meminta seluruh pengurus dalam kepanitiaan, baik panitia kabupaten maupun panitia kecamatan agar senantiasa saling berkoordinasi dan saling membantu dalam kerja sama yang baik, agar pelaksanaan event itu dapat berlangsung sukses. Sementara Asisten Administrasi Ekonomi dan Pembangunan Drs Edi Sampurna Rambe MSi mengatakan, untuk waktu pelaksanaan MTQN dan Festival NasyidTahun 2012 ini dipercayakan sepenuhnya kepada camat. (c07)

WASPADA Jumat 20 Januari 2012

Peluang Penyelewengan Dana BOS Masih Terbuka KISARAN (Waspada): Pengelolaan dana Bantuan Operasional Sekolah (BOS) 2012 masih berpotensi penyelewengan anggaran, sehingga pengawasan harus terus ditingkatkan demi kemajuan kualitas dan mutu pendidikan di Asahan dan menghadapi komunitas ASEAN 2015. “Untuk Asahan, dana BOS mencapai Rp 67 miliar untuk 515 SD dan SMP. Dana itu langsung dikelola pihak sekolah, sehingga peluang penyelewengan dengan motifkegiatanfiktifmasihterbuka lebar.Sedangkanmutupendidikan masih jauh tertinggal,” ujar Anggota Komisi D DPRD Asahan, Syamsul Qodri Marpaung, ditemui Waspada, Kamis (19/1). Menurutnya,penyelewengan itu bisa bermotif pembangunan sekolah yang tidak sesuai, dan kegiatan ekstrakurikuler yang tidak memenuhi standar namun memakan anggaran cukup besar. Sehingga motif seperti harus diwaspadai, agar dana BOS yang disalurkan pemerintah bisa tepat sasaran dengan peningkatan kualitas siswa. “Bila dari segi kelulusan, siswa di Asahan memangtergolongtinggi.Namun bila ditinjau dengan kualitas, dan masukkeuniversitasnegeri,siswa

kita masih tergolong sedikit,” ujar Syamsul. Oleh sebab itu, pihak sekolah harus bisa melakukan inovasi dengan menggunakan anggaran untuk kepentingan peningkatan mutu, terutama di sekolah yang berada di pelosok, harus bisa mampubangkitdenganmeningkat kualitas yang gemilang. “Kita tidak bisa pungkiri, daerah pelosok selalu tertinggal, karena keterbatasan sarana dan prasarana. Oleh sebab itu dana BOS tahun ini diharapkan bisa membantu merekasehinggabisalebihmaju,” katanya lagi. Apa lagi komunitas Asean akan berlaku pada 2015, kata Syamsul, sehingga mutu pendidikan Asahan harus bisa memenuhisatandarnasional.“Disinilah pihaksekolahdiuji,anggarantelah diberikan dan dikelola sendiri berdasarkan kebutuhan. Sehingga, sekolah harus bisa mencetak

generasi yang handal dan siap saing dengan mutu dan kualitas yang teruji,” ucap Syamsul. Sebelumnya, Plt Gubernur Sumut Gatot Pujo Nugroho, dalam sambutannya saat Peluncuran Dana BOS pada 11.604 SD dan SMP se-Sumut dan bantuan 200 Masjid di Kab. Batubara oleh Gubernur, di Kisaran, Rabu (18/ 1), mengatakan, hasil laut dan pertanian masyarakat Sumut terancam diambil oleh pihak luar negeri, terkait pada 2015 komunitas Asean diberlakukan. Oleh sebab itu, bila kualitas masyarakat tidak memenuhi standardalammenghadapimasa tersebut, maka hasil kekayaan alam Sumut akan ditarik mereka dan masyarakat hanya sebagai pekerja. “Mengantisipasihalituterjadi, pemerintah mengucurkan 20 persen dari pembelanjaan untuk pendidikan, dan tahun ini sedikitnya sekitar Rp 1,5 Terliun lebih disalurkan untuk dana Bantuan Operasional Sekolah (BOS) untuk sekolah tingkat SD dan SMP se-Sumut, dengan tujuan untuk memperbaiki dan meningkatkan kualitas pendidikan,” ujar Gatot. (a15)

Zaini Gugat Perusahaan Outsourching BATUBARA (Waspada): Muhammat Zaini, 41, penduduk Dusun II, Desa Pasar VIII, Kec. Air Putih, Kabupaten Batubara, kepada Waspada Kamis (19/1), menyatakan menggugat perusahaan outsourching PT. PKSS Medan dan salah satu bank melalui kuasa hukum Ahmadsyah Bangun SH/M.Ali Imran Lubis SH ke Pengadilan Hubungan Industrial pada Pengadilan Negeri (PN) Medan karena pemutusan hubungan kerja sepihak. Dalam gugatannya Zaini mengaku sudah melakukan upaya damai bipartit namun mene-mukan jalan buntu. Begitu juga upaya tripartit di mana Dinas Tenaga Kerja Kab. Batubara menyarankan PT. PKSS membayar uang pesangon, penghargaan masa kerja, uang pengganti peru-

mahan/perobatan, gaji belum dibayar sampai Maret 2011 total Rp50.534.735. Karena PT.PKSS tidak memenuhi anjurannya ini, Dinas Sosial dan Tenaga Kerja Pemko Medan menyarankan pula PT. PKSS membayaruangpesangon,penghargaan masa kerja, uang penggantiperumahan/perobatan,dan gaji belum dibayar sampai September 2011 total Rp60.883.145, halinijugatidakdipenuhiPT.PKSS. Zaini mengaku bekerja di salah satu bank (turut tergugat-red) selamaduatahunhinggaakhirnya dipindahalihkankepada outsourching PT. PKSS tahun 1997, di mana Zaini tetap bekerja sebagai pengaman asset bank tersebut. Penggugat menerima surat pemberitahuanberakhirnyakontrak tanggal 30 September 2010

secara sepihak dalam posisi masa kontrak kerja belum berakhir. “Saya merasa dirugikan oleh pemutusanhubungankerjasepihak ini, seperti tidak mendapatkan THR tahun 2011 dan gaji dari Desember2010sampaidiajukannya gugatan pada September 2011, dan sampai saat ini,”ujar Zaini. Majelis hakim Pengadilan HubunganIndustrialpadaPNMedandipimpinWahidin,SH,MHdalamsidangRabu(18/1)memeriksa izinpendirianPT.PKSS,sedangkan padasidangsebelumnyaRabu(11/ 1)majelishakimmenolaksaksidari lawan penggugat. “Sidang Rabu (25/1)majelishakimakanmenyampaikan kesimpulan, saya mohon keadilanseadil-adilnya,sayayakin majelis hakim memahami nasib saya yang teraniaya ini. Insya Allah,” ujar Zaini. (a10)

Terserang Di Batubara, Pasien DBD Dirawat Di Tanjungbalai TANJUNGBALAI (Waspada): Seorang siswi SMP kelas II, Chairani Ramadhani, 14, terpaksa dirawatdiRSUDKotaTanjungbalai, Kamis (19/1). Anak itu mulai terserang demam saat berlibur di rumah neneknya di Batubara. Putri kedua dari pasangan Asmawati dan Salim Sunaryo itu mengaku sempat mengeluarkan darah segar saat buang air besar. KetikaituhariMinggu(15/1)gadis ciliktersebutakanmengakhirimasa liburan sekolah di rumah sang nenek di Simpang Dolok, Kec. Limapuluh, Kab. Batubara dan berencanakembalikeTanjungbalai. Menurut pasien, sebelum terjadi pendarahan, gadis cilik warga Kel. Semulajadi, Kec. Datukbandar,T.Balai itu sempat mengalami demam selama tiga hari, namun dia tidak memeriksakan kesehatannya dan juga tak meminum obat penurun panas karena mengira penyakitnya penyakitnya hanya demam biasa dan tak lama pasti akan sembuh. Akan tetapi, kendati badannya tidak cukup fit bocah itu tetap memutuskan pulang keTanjungbalai karena keesokan harinya

dia harus masuk sekolah. Namun sayang,diahanyamampumengikuti pelajaran selama satu hari sebab di hari kedua, Chairani harus dilarikan ke rumah sakit sebab penyakitmulaiparah.“Untunglah cepat saya bawa ke rumah sakit, jika terlambat tidak tahulah apa jadinya,” ujar AsmalWati kepada Waspada. Sementara di ruangan berbeda, seorang anak Dewa Beton, 5,8, warga Desa Kapias Batu 8, Kec. Tanjungbalai, Kab. Asahan juga terbaring lemah di tempat tidur ruangan anak. Anak kesayangan dari pasangan Leni dan Bambang Sutrisno itu telah mendapat perawatan selama tiga hari di rumah sakit Pemko T.Balai. Cucu kedua dari Asmi itu berbeda dengan Chairani karena belum sempat mengalami perdarahan,namundemamyang dideritaternyatacukuplamasejak 20harilalu.Selainpanasyangnaik turunDewajugaterserangpenyakit lainnya seperti batuk, mual, muntah, mencret, nyeri saat menelan,dannafsumakanmenurun. Menurut Asmi, saat ini pulu-

han warga di desanya terserang wabah penyakit demam mulai dari anak-anak sampai orang tua. Namun, baru cucunyalah yang dibawa ke rumah sakit dan dinyatakan demam berdarah. “Lebih dari20orangpenyakitnyahampir samadengancucusaya,kebanyakan sih anak-anak.Tetapi mereka tidak mau memeriksakan kesehatan ke rumah sakit,” tutur Asmi, yang mengaku tidak tahu pasti apakah warga sekampungnya itu positif DBD atau demam biasa. Diungkapkan, petugas kesehatan di sana belum pernah mengadakan sosialisasi atau penyuluhan kesehatan terkait demam berdarah. Sehingga warga tidak mengetahui faktor penyebab DBD dan gejala serta tindakan yang harus diambil. DirekturRSUDKotaTanjungbalaiHjDiahRetnoWdidampingi Kabag Humas Pemko DarulYana Siregarmengatakankeduapasien masih dalam perawatan intensif oleh petugas medis. Disamping itu mereka harus tidur menggunakankelambugunamenghindari penyebaran ke orang lain. (a32)


SEJUMLAH anak di Desa Sidomulyo, Kec. Medang Deras, Kab. Batubara “terpelongo” (terkejutred) melihat kecanggihan laptop. Hal itu membuktikan bahwa desa itu sangat minim sentuhan teknologi.

Nasib Ratusan Honorer Pemkab Labusel Belum Jelas KOTAPINANG (Waspada): Nasib ratusan tenaga honorer Pemkab Labuhanbatu Selatan (Labusel) yang gagal pada seleksi perpanjangan kontrak honorer masih belum jelas. Meski sudah ada kesepakatan bahwa dipekerjakan kembali, namun kenyataannya mereka belum dapat bekerja. Salah seorang tenaga honor di Sekretariat Daerah Pemkab Labusel yang enggan disebutkan nama kepada Waspada, Rabu (18/1) mengatakan, sesuai pengumuman yang dikeluarkan oleh Sekdakab No. 060/91/Orta/2012 tentang Tenaga Honorer, seluruh honorer dipekerjakan kembali pada, Selasa (17/1). Namun kata dia, saat mereka masuk kantor, ternyata pada absensi tidak ada nama mereka. Padahal, harusnya nama mereka ada pada absensi sebagai bukti kehadiran. Anehnya, ada tenaga honorer yang tidak ikut seleksi justru namanya ada di absensi. Parahnya, sebagian honorer yang sebelumnya tidak lulus seleksi juga ada yang namanya sudah masuk dalam absensi. “Inikan aneh, kami disuruh kerja tapi absen nggak ada. Inikan namanya digantung,” katanya. Padahal, kata dia, mereka sudah membawa surat pengumuman yang ditandatangani Sekda

Rusman Syahnan itu sebagai bukti mereka dipekerjakan kembali. Menurutnya, masalah itu sudah dipertanyakan kepada pimpinan Satuan Kerja Perangkat Daerah (SKPD) masing-masing, namun tetap tidak ada kepastian. Karena kesal, sebagian honorer memilih meninggalkan kantor. “Untuk apa kami masuk kalau nggak ada kerjaan. Mending kami pulang,” katanya. Kabag Humas Pemkab Labusel, Milhan Harahap yang dikonfirmasi mengatakan, sejak diterbitkannya pengumuman tersebut seluruh honorer sudah dipekerjakan kembali. Bahkan kata dia, sejak Selasa, seluruh honorer yang sebelumnya dikabarkan putus kontrak telah bekerja kembali. Mengenai absensi yang belum ada kata Milhan,mungkinkarenabelumdibuat.“Tunggulah seminggu ini, kan masih dibenahi lagi.Tapi mereka sudah boleh kerja kok,” kata Milhan. Sementara itu, aksi unjukrasa yang dilakukan ratusan tenaga honorer yang diputus kontrak pada,Senin(16/1)lalumenghasil-kankesepakatan bahwaseluruhtenagahonorerdipekerjakankembali. Hal itu ditandai dengan keluarnya Pengumuman No. 060/91/Orta/2012 yang ditandatangani Sekda Rusman Syahnan. (c18)

FPI Garda Terdepan Kawal Pembangunan Di Batubara LIMAPULUH (Waspada): Front Pembela Islam (FPI) berada di garis terdepan mengawal pembangunan di Batubara. Ketua Majelis Syuro Front Pembela Islam (FPI) Kab. Batubara Muhammad Yusri, SPd didampingi Sekretaris Umum, Hamzah mengatakan itu saat beraudiensi kepada Bupati H OK Arya Zulkarnain SH, MM di ruang kerjanya, Selasa (17/1). “Jangan ada lagi orang atau kelompok bersifat menangguk di air keruh atau mencari kesempatan dalam kesempitan. Maupun isu propaganda mendiskreditkan pemerintah. Jika ada aspirasi tersumbat sampaikan secara santun, karena sebagai masyarakat Batubara menjunjung tinggi adat istiadat.Marikitadukungdankawalpembangunan di segala bidang demi mewujudkan Batubara sejahtera dan berjaya,” ujarnya.

FPI berkewajiban mendukung jalan pembangunan. Sedangkan pengalaman, birokrasi OK Arya yang saat ini sebagai Bupati Batubara diakui semakin mempercepat gerak pembangunan dalam upaya mengejar ketertinggalan. Seperti rencana pembangunan Kawasan Ekonomi Khusus (KEK), yang nantinya membuka peluang pekerja baru bagi masyarakat. Bupati Batubara H OK Arya Zulkarnain SH, MM menyambut baik dukungan diberikan FPI. Di samping membina umat secara bersama terutama generasi muda agar jangan terjebak dengan minuman keras/narkoba yang dapat menghancurkan bangsa. Membangun Batubara dibutuhkan komitmen dari semua elemen masyarakat mewujudkan sejahtera dan berjaya. (a13)

Banggar DPRD T. Balai Tolak Hibah Ke PDAM Tirta Kualo TANJUNGBALAI (Waspada): Anggota Badan Anggaran (Banggar) DPRD Kota Tanjungbalai menolak bantuan hibah tahap pertama yang diajukan Pemko kepada PDAM Tirtakualo sebesar Rp4 miliar tahun 2012. Penolakan itu diungkapkan Hakim Tjoa Kian LiediruangrapatDewan,Selasa(17/1)sehubungan adanya bantuan hibah yang diajukan pihak Eksekutif dalam draft Kebijakan Umum Anggaran dan Prioritas Plafon Anggaran Sementara (KUA PPAS) Tanjungbalai 2012 disampaikan kepada Badan Anggaran DPRD. Menurut Hakim, dalam peraturan perundang-undangan, Pemerintah Daerah tidak diperbolehkan memberikan bantuan berupa hibah bersumber dari APBD ke perusahaan milik daerah.Yangdiperbolehkanialah,meneruskan bantuan

hibah yang diperoleh dari pemerintah pusat dan juga memberikan penyertaan modal. Dikatakan Hakim. yang juga Sekretaris Fraksi PDI Perjuangan DPRD ini, dirinya menolak pemberian bantuan hibah kepada PDAM Tirta Kualo karena tidak menginginkan terjadinya kekeliruan di kemudian hari yang pada akhirnya tersandung pada persoalan hukum. “Kalau mau membuat PDAM Tirta Kualo itu menjadi lebih baik, cari solusi lain apakah melalui caramelakukanpenyertaanmodaldanlainnyayang bersifat tidak bertentangan dengan peraturan dan perundang-undangan berlaku,” pungkas Hakim. Pembahasan KUA/PPAS diikuti seluruh anggota Banggar DPRD, Sekdako Ir. Erwin Pane serta sejumlah Kepala Dinas di lingkungan Pemko Tanjungbalai. (a32)

Kerja Keras Pencari Pakkat Di Labusel PUCUK rotan muda (pakkat) yang biasanya hanya jaditumbuhanliardibantaran sungai Barumun yang membentang di Kab. Labuhanbatu Selatan (Labusel) ternyata dapat mendatangkan rejeki. Lihat saja, di tangan Nuraman Hasibuan, 47, pakkat dimanfaatkan menjadi h mata pencaharian selama bertahun-

tahun. Dan dari pakkat pula, Nuraman mampu membiayai hidup keluarga dan menyekolahkan enam anaknya. Minggu (15/1) petang itu, Nuraman bersama lima orang warga Dusun Sorik, Desa Bange, Kec. Torgamba, Kab. Labusel menyusur dari arah hulu sungai Barumun menumpangi tiga sampanbermesin(boat).Didalam

sampan, terlihat sarat dengan muatan pakkat yang sudah diikat dan terususun rapi. Pakkat bukan sesuatu yang asing bagi masyarakat Labusel. Sejak lama pucuk rotan ini dijadikan lalapan dan sejumlah masakan khas di daerah ini. Rotan ini sebenarnya tumbuhan liar yang pembiakannya bukan sengaja ditanam. Tum-

Waspada/Deni Syafrizal

SEJUMLAH pencari pakkat di Dusun Sorik, Desa Bange, Kec. Torgamba, Kab. Labusel sedang mengangkut pakkat dari dalam perahu. Setiap hari, warga menggantungkan hidupnya dengan mencari pakkat.

buhan ini banyak terdapat di sepanjang bantaran sungai Barumun dan sungai Kanan. Rotantuabiasanyadiambilwarga untuk dijadikan tali atau dijual sebagai kebutuhan perabotan, sementara pucuknya yang masih muda yang akrab disebut pakkat dikonsumsi sebagai lalapan. Nuraman dan teman-temannya, yang umumnya wanita masih menenteng peralatan khusus yang biasa dipakai untuk mencaripakkat,yakniparangdan galah (potongan bambu sepanjang 1,5 meter yang diujung terdapat pengait). Mereka baru saja pulangdarihutanmencaripakkat. Hampir setiap hari sejak pagi Nuramandankawan-kawanmencari pakkat yang banyak terdapat di hutan sepanjang bantaran sungai Barumun dan anak-anak sungai yang bermuara ke sungai terbesar di Labusel ini seperti sungaiSiuppatdandanauSiuppat. Setelah sampan menepi, mereka mendarat dan menurunkan pakkat dari dalam perahu untuk dibawa pulang ke rumah. Nuramanmeletakkanikatanpakkat di atas kepalanya yang sudah dibebat dengan kain. Matanya terus memerhatikan jalan agar tidak terpeleset dan terjatuh. Seperti biasa, hari ini Nuraman berhasil mendapat dua ikat pakkat dan suaminya Idris Harahap, 49, juga mendapatkan dua

ikat pakkat, demikian juga teman satu kelompoknya. “Setiap kali mengambil pakkat di hutan satu orang bisa mendapat dua ikat pakkat,” kata wanita paruh baya yang tak pernah mengenyam pendidikan itu. “Mencari pakkat di hutan lumayan menguntungkan. Tapi kami pergi mencari pakkat sesuai orderan. Kalau lagi diminta ya kami turun, tapi kalau pakkat masih bertahan ya kami libur,” lanjutnya. Di lokasi pencarian pakkat, mereka menggunakan galah untuk mengait pucuk rotan, lalu memotong ujungnya yang masih muda menggunakan parang. Karena sudah terbiasa, potongan-potongan pakkat biasanya merata sepanjang lebih kurang 75 Cm. Meski terbilang sederhana, pekerjaan ini memerlukan kehati-hatian agar tidak tertusuk duri pakkat yang cukup berbisa. Setelah pakkat didapat kemudian durinya dibersihkan laludikumpul.Untukmemudahkan membawanya, pakkat tersebut diikat menggunakan rotan. Setiap satu ikatan pakkat terdiri dari 250 batang atau ruas. Satu ikat pakkat biasanya dibeliolehtokesehargaRp45ribu, sehingga dalam sehari rata-rata Nurahma berpenghasilan Rp90 ribu. Oleh toke, pakkat tersebut kemudian dikumpul di penampungan di Pekan Langgapayung,

Kel. Langgapayung, Kec. Seikanan. Setelah dikumpul, pakkat-pakkat tersebut kemudian didistribusikan ke pasar tradisional yang ada di Labusel. Nurahma menyebutkan, hasil dari mencari pakkat tersebut cukup membantu perekonomian keluarganya dan warga lainnya di Dusun tempatnya bermukim. Dari penghasilanitupulaNurahma berhasil menyekolahkan enam anaknya hingga lulus SMA. “Sekarang anak saya yangmasihsekolahtinggaldua, yang satu SMA dan satu SMP,” imbuhnya. Meskipekerjaaninicukup berat dan berisiko, namun Nurahma mengaku senang menjalankan aktivitas yang sudah diwariskan leluhur merekasecaraturun-temurun itu. Berdasarkan penelusuran Waspada,selaindiDesaBange, kegiatan mencari pakkat juga dilakoni warga yang bermukim di bantaran sungai Barumun lainnya seperti di Desa Sisumut, Kelurahan Kotapinang, Desa Pasir Tuntung, Desa Simongi, Desa Padangri, Desa Teluk Rampah, Desa Hajoran, Desa Sampean dan sejumlah desa lainnya. * Deni Syafrizal Daulay

Sumatera Utara

WASPADA Jumat 20 Januari 2012


Kotanopan –Muarasipongi Sangat Mengkhawatirkan PANYABUNGAN (Waspada) : Jalan Lintas Sumatera (Jalinsum) antara Kotanopan Muarasipongi Kab. Mandailing Natal (Madina) sangat mengkhawatirkan dan butuh penanganan serius. Sebab, hujan deras yang melanda daerah ini dua bulan terakhir, mengakibatkan longsor di beberapa tempat. Longsor terparah terjadi di desa UsorTolang, Hutadangka Kec. Kotanopan, Kab. Madina dan di beberapa titik di Kec. Muarasipongi. Tanah longsor menimpa Jalan Lintas Sumatera, memang bisa di lewati kendaraan bermotor, akan tetapi sampai saat ini, material tanah masih menumpuk di pinggir jalan. Apabila kendaraan mau lewat terpaksa

harus satu arah, kondisi ini tentunya sangat mengganggu penggunajalandandikhawatirkan akan mengundang kecelakaan. Amatan Waspada, Kamis (19/1), di beberapa titik longsor, seperti antara desa Muara Pungkut dan Hutadangka, Usortolang material tanah masih menimbun sebagian badan jalan hampir setinggi 1 m dengan panjang mencapai 100 meter, sehingga sangat sulit dilewati kenderaan roda empat. Pengguna jalan di minta ekstra hati-hati ketika

IDI P. Sidimpuan Harus Beri Pelayanan Prima P. SIDIMPUAN (Waspada): Ikatan Dokter Indonesia (IDI) Cabang Padangsidimpuan harus berupaya penuh memberikan pelayanan prima terhadap masyarakat, juga harus bermanfaat di tengah-tengah masyarakat. Hal itu disampaikan Ketua IDI wilayah Sumut, Dr. Fredy Henri Siregar di hadapan Muspida serta puluhan pengurus Cabang IDI Kota Padangsidimpuan usai dilantik untuk priode kepengurusan 2011-2014 di Padangsidimpuan, Rabu (19/1). Lanjut Dr. Fredy, memberikan pelayanan kesehatan terhadap masyarakat secara professional akan sangat membantu kesehatan warga, utamanya warga miskin. “Kalau pelayanan kesehatan terhadap masyarakat sudah optimal, pastinya mereka tidak akan komplain, dengan demikian marilah kita melayani secara ikhlas. Sebab dokter bukanlah pedagang ataupun pebisnis, rezeki itu akan diturunkan Tuhan bila kita ikhlas melayani masyarakat,” ungkap Dr. Fredi di podium itu. Selain itu kata Fredy, terkait obat untuk kebutuhan warga ketika berobat diupayakan obat generik, di mana obat tersebut sangat terjangkau harganya bagi kalangan masyarakat ekonomi lemah. Hadir dalam kesempatan itu Muspida Kota Padangsidimpuan, di antaranya Wali kota, Drs. H. Zulkarnaen Nasution MM, Kajari, H. Fredi Azhari Siregar, SH. Mhum serta sejumlah kepala dinas dan pengurus IDI Sumut dan Cabang Padangsidimpuan. Wali Kota dalam pidatonya bersedia bekerjasama dengan IDI untukkesehatanmasyarakat.‘’PemkoPadangsidimpuansiapdibarisan depan demi kesehatan masyarakat dengan mendukung program kerja dari IDI Cabang Padangsidimpuan,’’ papar Wali Kota. (c13)

DPC Gapeksindo Palas Terima Gapeksindo Award SIBUHUAN (Waspada): Ketua DPC Gabungan Pengusaha Konstruksi Indonesia (Gapeksindo) Padang Lawas (Palas) Ir. H. Lukman Nasution meraihAnugrah Gapeksindo Award 2011 dengan menyisihkan 27 cabang Gapeksindo se-Sumut. “Alhamdulillah, Gapeksindo Palas yang baru memasuki tahun ke tiga telah berhasil memperoleh penghargaan Gapeksindo Award dengankategoriDPCGapeksindoterbaik,”ujarH.LukmandiSibuhuan, Rabu (18/1). Penyerahan Gapeksindo Award sudah berlangsung di Merlynn Park Hotel, Jakarta, 25 November, di mana penyerahannya dihadiri Penasehat (Ex Officio), Dewan Pertimbangan, Ketua Kehormatan dan Dewan Pimpinan Harian. Kata H. Lukman, Gapeksindo Award diperuntukkan bagi seluruh cabang Gapeksindo yang tentunya memenuhi kriteria yang ditetapkan oleh dewan juri, antara lain, dapat menjalankan administrasi organisasi dengan baik dapat bekerja sama dengan pemerintah dan masyarakat. Dikatakannya, Gepeksindo Palas berdiri pada 2010 lalu dengan beranggotakan 24 perusahaan, dan telah mempersiapkan diri dalam menghadapi persaingan yang makin tinggi dalam usaha penyedia barang dan jasa, di mana dalam waktu dekat akan mengadakan pelatihan terhadap staf teknik yang duduk di berbagai perusahaan. “Dengan adanya pelatihan tersebut, para staf teknik diharapkan mampu melaksanakan pekerjaan pembangunan secara tepat mutu, tepat waktu dan tepat keuangan,” ujar mantan Wakil Ketua DPRD Palas tersebut. (a34)

Waspada/Alam Satriwal Tanjung

PENANGGUNG Jawab PT (Persero) Jasaraharja Samsat Sibolga Tapteng, Ilham Sihombing, SE saat menyerahkan santunan klaim asuransi diterima langsung oleh ahli waris korban Asma didampingi pamannya Zulhandri, Rabu (18/1).

Penyerahan Klaim Asuransi Kecelakaan SIBOLGA (Waspada): PT (Persero) Jasaraharja Samsat Sibolga Tapteng serahkan klaim asuransi kepada ahli waris keluarga korban pasangan suami istri Fahmi Jubir, 42, dan istrinya Dainur alias Nunun, 27, serta dua anak mereka yang masih bocah, Abdullah, 5, dan Robi, 6, yang tewas, Senin (2/1) dalam kecelakaan lalulintas di Jalan Padangsidempuan Km 27-28, Dusun Prancis, Kelurahan Pinangbaru, Kec. Pinangsori, Tapteng. Penyerahan santunan tersebut langsung diberikan Penanggung JawabPT(Persero)JasaraharjaSamsatSibolga,Tapteng,IlhamSihombing, SE, di rumah kediaman korban Jalan Padangsidempuan, Lingkungan III Kelurahan Pandan, Kec. Pandan, Kab. Tapteng, Rabu (18/1). Santunan tersebut diterima langsung ahli waris korban Asma yang masih berusia 7 tahun saat itu didampingi pamannya Zulhandri. Ilham Sihombing dalam kesempatan tersebut mengatakan, sesuai peraturan dan undang-undang, pihak PT (Persero) Jasaraharja wajib memberikan santunan bagi korban lakalantas di jalan raya. Jikakorbanyangmeninggalduniamakayangmenerimaklaimasuransi adalah ahli waris korban, sementara anak ke anak tidak termasuk ahli waris, namun diberikan biaya untuk pemakaman Rp2 juta per jiwa. Besar santunan yang diberikan kepada ahli waris, sesuai undangundang sebesar Rp54 juta dalam bentuk uang kontan. Sementara pihak ahli waris korban mengucapkan terimakasih kepada PT (Persero) Jasaraharja serta semua pihak yang telah memberikan bantuan moril dan materil. Pantauan Waspada anak korban selaku ahli waris saat menerima bantuan tersebut terlihat menangis haru karena sudah ditinggal kedua orangtuanya dan adikadiknya akibat lakalantas beberapa waktu lalu itu. (a24)

melintasi jalan. Pasalnya jika sempat tergelincir, kenderaan bisaterbalikhinggajatuhkeSungai Batang Gadis. Salah seorang warga Usor Tolang, Tarmizi Lubis, 55, mengatakan, tumpukan longsor sudah sempat dibersihkan dinas terkait. Namun sehari setelah dibersihkan, longsor kembali datang dan menimbun badan jalan. Kendaraan sempat tidak

bisa lewat karena tingginya lumpur di jalan. Namun kondisi initidakberlangsunglama,karena warga sekitar turun ke lokasi untuk membersihkan dan mengangkat material tanah. Melihat masih banyaknya material tanah di badan jalan, diharapkan pihak terkait yang mengurusi jalan negara ini agar segera mengangkat material longsor. Sebab kalau di biarkan

terus menumpuk, dikhawatirkan akan mengundang kecelakaan. “Apalagi jalan ini adalah jalan umum satu-satunya alternatif menuju Bukit Tinggi (Sumatera Barat) kalau dari arah Kotanopan. Onggokan material tanah sudah cukup lama berada di sebagian jalan, kalau tidak salah sekitar dua minggu,namunsampaisekarang belum di angkat,” ujarnya. (c15)

PTA Dituduh Serobot Lahan Warga LABUSEL (Waspada): PT SumberTaniAgung(STA)dituduh menyerobot lahan warga, Sutan Mangarahon Harahap, seluas 78 hektardiDusunSinarBulan,Desa Binanga Dua, Kec. Sungai Kana, Kab. Labusel. Waris Sutan Mangarahon Harahap, dan Suman Harahap, kepada wartawan, Kamis (19/1) di Rantauprapat menuturkan, Camat Kota Pinang David Dachi, BA pada 14 April 1982 dengan surat No;544/3.- telah melarang PTSTAmelakukanpenumbangan hutan dan rawa di lorong Sinar Bulan, juga di daerah lainnya karena telah diusahai rakyat. Keputusan itu, katanya, juga diketahui manajer PT STA kala itu, bermarga Ginting, bahwa bahwahutandanrawadiTanjung

Raya, Parnantian, Kalibening termasuk Sinar Bulan tidak termasuk dalam areal Hak Guna Usaha PT.STA. Tetapi, nyatanya hingga saat ini masih dikuasai perusahaan tersebut. Suman Harahap menambahkan, satu bundel berkas kepemilikanlahanayahnya,Sutan Mangarahon Harahap, telah diserahkan kepada Muspika Kec. Silangkitang. Dan pada 17 Januari 2012telahdimintakanpeninjauan areal.Ataspermintaanitu,disepakati bahwa peninjauan lahan dilaksanakan, 24 Januari 2012. Sementara Camat Silangkitang Drs kholil Jufri Harahap mengatakan, hendaknya PT STA dapat menjelaskan secara transparan luas HGU-nya berikut peta letak HGU perkebunan kelapa

sawit tersebut berada. Kepala Desa Binanga Dua RM.Murno juga menyatakan, batas HGU PT STA hanya sampai di batas Sungai dua Besar. Tetapi dengan kondisi yang ada di lapangan, PT.STA telah merangsek ke Desa Binanga Dua. Hal itu berarti perusahaan tersebut telah menyerobot lahan warga. Untuk itu, katanya, dimintakan kepada Bupati Labusel agar dapat memfasilitasi peninjauan HGU PT STA, sehingga masyarakattidakdirugikan perusahaan. Sementara Humas PT STA Tanwin Nasution, sebagaimana dikonfirmasi seperti sebelumsebelumnya,tidakbisadihubungi karean telepon selulernya tidak aktif. Pesan singkat untuk konfirmasi pun tidak berbalas. (a18)

Jalan Sei Balai -Mekar Mulio Hancur SEI. BALAI (Waspada):Warga desa Mekar Mulio Kec. Sei. Balai Batubara lebih dua tahun menderita jalan rusak parah dan sulit dilintasi kenderaan roda empat dan dua. Karena itu, mereka mengharapkan perbaikan jalan menghubungkan ke Sei. Balai tersebut. Menurut warga, Rabu (18/ 1), selama bertahun jalan yang hancur berlumpur menyulitkan warga memasarkan hasil pertanian ke pasar lokal. Bahkan warga berulangkali mengajukan permohonan perbaikan jalan tersebut.Terakhir mereka frustasi

melakukanaksimenanampokok sawit di jalan hancur itu. Aksi protes warga membuahkan hasil, menurut sumber, dalam APBD Batubara 2012 dialokasikan dana Rp.4,2 miliar untuk Kec. Sei. Balai termasuk pembuatan turap dan penimbunanjalanSei.Balai-MekarMulio 1 paket Rp350 juta. Dana terbesar Rp500 juta guna peningkatan jalan Simp. Sei.Bejangkar- Siajam 500 meter, Rp450 juta untuk normalisasi parit Dusun XIII Desa Sei. Balai volume 1500 meter, pembuatan turap ruas jalan Dusun I Desa

Kuala Sikasim 1 paket Rp300 juta, pembuatan leaning jalan Dsn III Perk. Sei. Balai 500 meter Rp350 juta, pengaspalan jalan Dusun I ke Dusun II Desa Tanah Timbul 500 meter Rp300 juta, perkerasan Desa Benteng Jaya - Desa Sukarejo (Sei. Samsu) 1000 meter Rp300juta,peningkatanruasjalan Desa Perkebunan Sei Balai Tanjung Seri Desa Suka Makmur 1.000 meter Rp300 juta, perkerasanjalanDusunIIIBDesaSukaramai 1.000 meter Rp250 juta, dan peningkatan ruas jalan Simpang SMP Sei Balai- DusunV Desa Durian 500 meter Rp300 juta. (a12)

LPAPS Berikan Harapan Anak Batubara LIMAPULUH (Waspada): Lembaga Peduli Anak Putus Sekolah (LPAPS) Kab. Batubara latih 20 anak putus sekolah keterampilan menjahit dan komputer di Desa Simpang Dolok, Kec. Limapuluh, Kab. Batubara. Peluncuran program pelatihanyangdibukaolehKepalaDesa Simpang Dolok OK. Suhaemi, Rabu (18/1) ini dihadiri ketua LPAPS Rustam, S.Ag dihadiri tokoh masyarakat dan pemuda. Dalam sambutannya Rus-

tam mengatakan, LPAPS ini didirikan termotivasi atas tingginya angka anak putus sekolah di daerah Batubara. “Lembaga pemerintahan dan swasta tidak mungkin menerima tenaga kerja yang tidak terdidik dan terlatih, dengan pelatihan ini kita memberikan harapan bagi anak putus sekolah agar tidak putus asa mencari pekerjaan,” ujar Rustam. Ia juga menegaskan bahwa program ini bukan seremonial semata, dalam tahap pertama

ini akan dilatih 20 orang peserta. Masing - masing 10 orang latihan menjahit dan 10 orang bidang komputer. Tokoh masyarakat setempat, Abdul Aziz mengatakan, kantong - kantong anak putus sekolah beradadidaerahpesisirpantai.Iajuga meminta agar anak - anak yang ikut pelatihan memanfaatkan program ini sebaik-baiknya. Sehingga, setelah keluar dari pelatihan tiga bulan ke depan dapat benar - benar trampil. (c05)

Pemkab Paluta Lestarikan Bangunan Bersejarah GUNUNGTUA (Waspada): Tugu Bambu Runcing sejarah perjuangan kemerdekaan di Lapangan Merdeka, Pasar Gunungtua, Kecamatan Padangbolak, Kab. Padanglawas Utara yang sebelumnya diterlantarkan, kini kondisinya terlihat indah dengan cat berwarna merah putih serta dihiasi lampu. AmatanWaspada,Selasa,(17/ 1) bangunan bersejarah yang sebelumnya terlihat kumuh, kotor danbauitu,kinitidaklagidipenuhi sampah. Sekretaris Pemuda Panca Marga (PPM) Paluta, Darwin Siregar mengatakan, semoga ini akan menjadi sejarah sepanjang masa bagi generasi muda di Kab. Padanglawas Utara. “Kami atas nama pemuda berterimakasih kepada bapak Bupati, Drs, H. Bachrum Harahap yang telah

merawat bangunan bersejarah di wilayah Kabupaten Padanglawas Utara,” ucap Darwin. Disebutkannya, tugu bambu runcing ini memberi identitas, bahwa kota Gunungtua selaku ibukota Kabupaten Paluta ini banyak menyimpan sejarah tentang perjuangan melawan penjajah dalam mempertahankan NKRI di wilayah Gunungtua dan sekitarnya. “Tugu ini dibangun untuk mengingatkan kepada seluruh masyarakat, bahwa di daerah Gunungtua,Padangbolaksekitarnya, pernah terjadi sebuah peristiwa pertempuran melawan penjajah dan merupakan sejarah yang sangat luar biasa. Jika hal ini tidak sempat terpikir oleh masyarakat, maka itu sebuah preseden buruk. Harusnya semua pihak harus faham makna

di balik tugu bambu runcing ini,” jelas Darwin. Tambahnya,tuguperjuangan kemerdekaan ini berdiri kokoh didepanLapanganMerdekayang sekarang terlihat terang-benderang di malam hari karena dilengkapi penerangan memadai. Penataan taman dan penghijauan juga membuat tugu ini jauh dari kesan angker dan kumuh lagi. “Diharapkan kepada warga di sekitar tugu agar menjaga dan melestarikan keindahan dan kebersihan tugu tersebut sehingga tetap bersih dan asri,” ucapnya. Senada juga diungkapkan warga sekitar, Adi Siregar, 24, ia mengungkapkan semenjak diperbaiki tugu perjuangan tersebut, kondisi di sekitar Lapangan Merdeka Gunungtua menjadi hidup dan terlihat indah karena dihiasilampusepanjanghari.(a35)

Waspada/Alpin Lubis

MATERIAL tanah masih menumpuk di jalinsum Kotanopan-Muara Sipongi tepatnya antara desa Muara Pungkut dan Desa Tamiang Kec. Kotanopan.

Sidang Perdana Kasus Pembakaran Camp PT SM PANYABUNGAN (Waspada): Pengadilan Negeri(PN)Panyabungan,Selasa(18/1)menggelar sidang perdana kasus pembakaran Camp PT Sorikmas Mining beserta asetnya di Tor Sihayo. Sidang delapan tersangka atas peristiwa pembakaran yang terjadi pada tanggal 29 Mei tahunlaluitu,dimulaidengantahapanpembacaan dakwaan untuk delapan tersangka yang dibuat dalam dua ruang sidang berbeda. Sidang di ruangan pertama yang dimulai sekitarpukulpukul13:30dipimpinlangsungKetua PN, Wenra Rais, SH dan hakim anggota terdiri dariSugengHaryoso,SHdanDharmaPSimbolon, SH. Sedangkan tersangka yang disidangkan yakni, Mulkanuddin,Fatmawati,NurulAsmi,Syarifuddin Lubis. Sedangkan sidang di rungan ke dua untuk para saksi yakni Ali Basra, Zulkarnaen, Andi Pelangi,Zulkarnaen,danAhmadHusein,dipimpin Rahmansyah,SH,danhakimanggotayakniSugeng Haryoso dan Dharma P Simbolon, SH. Dalam persidangan, Jaksa Penuntut Umum (JPU) hanya menyampaikan dakwaan kepada delapan tersangka mulai dari sebelum terjadinya pembakaran. Berdasarkan dakwaan JPU, ke delapan tersangka ada yang terlibat langsung dalam pembakaran, penggerak massa, dan nada

ancaman terhadap perusahaan, serta yang mengutip uang dari warga untuk membeli bensin dan dibawa ke lokasi camp perusahaan yang dimasukkan ke dalam botol air minum mineral dan jerigen. Dalam eksepsinya, ke delapan tersangka membantah atas dakwaan yang disangkalkan. Tersangka dengan tegas mengatakan dakwaan JPU itu tidak benar. Usai mendengarkan eksepsi terdakwa, hakim memutuskan akan melanjutkan persidangan dengan agenda pemeriksaan saksisaksi dan akan dilanjutkan Rabu (25/1). Humas PN Panyabungan, Rahmansyah, SH usai persidangan kepada wartawan mengatakan, ke delapan terdakwa disangkakan beberapa pasal KUHP, yakni pasal 160 jo pasal 55 ayat 1 KUHP, tentang penghasutan dengan lisan atau tulisan di muka umum dengan ancaman hukuman 6 tahun penjara. Pasal 170 ayat 1 KUHP tentang melakukan tindak kekerasan terhadap harta benda di muka umumbaiksecarasendirimaupunsecarabersama dengan ancaman hukuman selama 5,6 tahun penjara. Kemudian pasal 187 KUHP tentang sengaja melakukan pembakaran, membuat letusan atau mengakibatkan banjir ancaman hukuman 12 tahun penjara. (c14)

ANJ Agri Ingin Sejahtera Bersama Masyarakat ANGKOLA SELATAN (Waspada): PT Austindo Nusantara Jaya (ANJ) Agri memiliki sebuah program target pencapaian terhadap masyarakat yang berada di sekitar wilayah usaha perkebunan kelapa sawitnya. “Masyarakat adalah mitra perusahaan, karenanya kami ingin mencapai kesejahteraan bersama masyarakat,” kata Coordinator Public Affair AN Agri, Tri Hidayat, didampingi External Relation Officer, Safari Kelana Putra, dan GM ANJ Agri Siais, Agus Sebayang. Pernyataanituuntukmenyikapiaksiunjukrasa sekelompok orang yang mengaku Kelompok Tani Andalan (KTA) Napa, baru-baru ini di Jalan Desa Simarpinggan, Kel. Napa, Kec. Angkola Selatan, Kab. Tapanuli Selatan. Keinginan ANJ Agri untuk meraih kesejahteraan bersama masyarakat ini, katanya, sangatlah serius dan bukan lips service. Sehingga untuk perwujudannya, ANJ Agri sangat menginginkan sikap saling menghormati dan bekerjasama dengan masyarakat. Dimanapunwilayahusahanya,sebutHidayat, ANJ Agri tetap menghormati hak masyarakat dalam menyampaikan pendapat di muka umum. Tetapi selama tidak melanggar hukum dan mengganggu kepentingan umum. Tidak seperti dilakukan kelompok mengaku KTA Napa yang menghentikan kendaraan di jalan lintas umum. “Sebagai bagian masyarakat patuh hukum, kami mengimbau sekaligus mengajak kelompok pengunjuk rasa dan masyarakat sekitar perkebunan ANJ Agri untuk sama-sama menghormati

putusan hukum yang telah memberikan status HakGunaUsaha(HGU)kepadaperusahaankami,” terang Tri Hidayat. Ia menyatakan, berdasarkan sertifikat HGU BPN Pusat No.01 tertanggal 11 November 2004 dan SK BPN No. 123/HGU/BPN/2004 tanggal 28 Oktober 2004, areal seluas sekitar 8000 hektare diDesaPardomuan,Kec.AngkolaSelatan(dulunya Kec. Siais) ditetapkan sebagai lahan perkebunan. Dalam proses memperoleh HGU tersebut, ANJ Agri telah mematuhi semua proses hukum yang berlaku. Termasuk telah memberikan ganti rugi kepada seluruh kelompok masyarakat yang berhak dalam area tersebut. ANJ Agri juga menghormati hak ulayat masyarakat dengan cara memberikan ganti rugi terhadap lahan KTA Napa. Jumlahnya sesuai dengan klaim yang dianjurkan masyarakat yang telah tergabung dalam KTA Napa tahun 2005. Semua prosedur telah dijalani, tapi masih saja timbul permasalahan dari kelompok mengaku KTA Napa dengan ketua Ahmad Siagian. Mereka menuntut pengambilan lahan yang diberada di HGU ANJ Agri Siais. Anehnya, tuntutan itu muncul setelah 6 tahun dibayarkannya ganti rugi kepada KTA Napa yang saat itu diketuai Zulkifli Hasibuan. “Kami punya bukti hukum dan data valid atas proses kepemilikan HGU tersebut. Kami tegaskan bahwa lahan yang menjadi objek tuntutan kelompok menamakan diri KTA Napa, secara sah dan berdasarkan hukum adalah areal HGU PT ANJ Agri,” tegas Tri Hidayat. (a27)

Rekening PDAM Asahan Di Desa Dahariselebar Naik DAHARISELEBAR, Batubara (Waspada): Ratusan pelanggan PDAM Asahan di Desa Dahariselebar, Talawi, Batubara menjerit karena rekening airnaikmendadaksampai2-3kalilipatdaribiasanya. Selain rekening naik, menurut pelangegan, Rabu (18/1), mereka juga diharuskan memasang meteran yang tidak jelas manfaatnya dengan uang muka Rp.70.000, di mana sisanya diangsur beberapa bulan “Kami tak tahu apa gunanya dipasang meteran, sedangkan jatah giliran air selama 3 jam/ hari, bukan seperti di kota-kota suplai air ke rumah pelanggan 24 jam,” kata Rodia yang mengaku menyesal atas pemasang meteran itu.

Dia mengatakan, diperkirakan pakai meteran bisa mengurangkan pembayaran ternyata bertambah mahal. Biasa rekening Rp42.ribu/bulan, setelahpakaimeterandikenakanRp100 ribulebih/ bulan, bahkan ada yang harus membayar Rp.230 ribu. Sudah pasti pelanggan di pedesaan nelayan itu menjerit keberatan membayar rekening, di tambah lagi pegawai PDAM main ancam, kalau tak dibayar distribusi air di stop/diputus. Menurut sumber, seharusnya pihak PDAM lebih dulu melaksanakan sosialisasi kepada pelanggan, baru diterapkan kenaikan rekening bukan hanya pandai mengelabui pelanggan. (a12)

Terima Pembayaran Utang Dengan Ganja, Dihukum 4 Tahun Penjara

Waspada/Sori Parlah Harahap

TUGU Bambu Runcing merupakan bangunan bersejarah warga Padangbolak yang terletak di Lapangan Merdeka Pasar Gunungtua, terlihat indah dan bersih.

RANTAUPRAPAT (Waspa-da): Menerima 4 bungkus kecil ganja kering sebagai pembayaran hutang sebesar Rp40 ribu, membuat Agus Julianto dihukum 4 tahun penjara dan denda Rp800 juta subsidair 3 bulan penjara oleh Hajelis Hakim dalam persi-dangan di Pengadilan Negeri (PN) Rantauprapat, Rabu (18/1). MajelisHakimjugamenyata-kanbarangbukti berupa4amplopkecilganjakeringdibungkuskertas seberat 6,5 gram serta 2 buah kan-tong plastik dirampasuntukdimus-nahkandanmengembalikan 1 unit sepeda motor kepada terdakwa. Terdakwa Agus Julianto, 24, penduduk Dusun Temukur, Desa Sibito, Kec. Aek Natas, Kab. Labuhanbatu Utara, menurut Jaksa Penuntut Umum (JPU) Emmi F Manurung SH MH dalam tuntutan sebelumnya menyatakan, terdakwa terbukti bersalahmelakukantindakpidanadalamdakwaan subsidair dan melang-gar pasal 111 ayat (1) UU RI No.35 tahun 2009 tentang Narkotika dengan

pidana penjara selama 6 tahun dan denda 800 juta subsidair 6 bulan kurungan. Dalam persidangan sebe-lumnya, Majelis Hakim yang diketuai Dedi SH juga menjatuhkan putusan 7 tahun penjara terhadap terdakwa Muhammad Syahbudi Nasution alias Budi karena terbukti memiliki ganja kering sebanyak 900,50 gram dan denda Rp1 miliar subsidair 3 bulan kurungan. Muhammad Syahbudi, 25, penduduk Dusun Gapuk, Desa Tebing Tinggi, Kec. Pangkatan, Kab. Labuhanbatu terbukti ber-salah sebagaimana dalam dakwa-an primair melanggar pasal 114 ayat (1) UU No.35 tahun 2009 se-suai tuntutan JPU. JPU Erning Kosasih SH dalam tuntutan sebelumnya meminta agar majelis hakim menjatuhkan pidana penjara terhadap terdakwa selama 10 tahun penjara dan denda Rp1 miliar subsidair 6 bulan kurungan. (a18)

Sumatera Utara


WASPADA Jumat 20 Januari 2012

Kawal Truk Bermuatan Dolomit Aktivis LSM Ditodong KABANJAHE (Waspada): Mengaku sedang mengawal truk bermuatan batu dolomit, aktivis Lembaga Swadaya Masyarakat (LSM) Aliansi Peduli Tambang dan Hutan dihadang sejumlah orang bersenjata tajam di Desa Payung Kecamatan Payung Kabupaten Karo. Saat itu, Ketua LSM Syafii Tarigan alias Tarigan Jenggot sempat ditodong dengan sebilah pisau di bagian perutnya. “Saya takut setengah mati. Takut kalau-kalau orang yang menempelkan pisaunya itu ke perut saya silap dan pisau itu akan merobek perut saya,” ujarTarigan

usaimembuatpengaduan diMapolres Tanah Karo, Rabu (18/1). Dikatakannya, Selasa (17/1) sekira pukul 22:00, ia bersama rekannya, Aditiya Sebayang,

Sekdakab Taput Lantik Pejabat Eselon III TARUTUNG (Waspada): Sekdakab Taput Sanggam Hutagalung, MM melantik sejumlah pejabat eselon III, Rabu (18/1) di pandopo Jalan Suprapto Tarutung, dihadiri Kepala BKD Taput Rudolf Manalu dan sejumlah pimpinan SKPD. Pejabat yang dilantik antara lain Hendrik Surbakti, menjadi Kakan Kesbang, Politik dan Perlindungan Masyarakat Taput sebelumnya Kabag Umum dan Perlengkapan, Sostra Sitompul, Inspektur pembantu wilayah IV pada Inspektorat Pemkab Taput sebelumnya Kabag Pemberdayaan Perempuan, Binur Tampubolon, menjadi Kabag Pemberdayaan Perempuan Taput sebelumnya Kabid Perencanaan Pencatatan Sipil dan Kependudukan, Bontor Arifin Hutasoit, menjadi Kabag Hukum dan Organisasi, sebelumnya Camat Siborongborong, dan Oloan Hutabalian, menjadi Camat Siborongborong, sebelumnya Camat Tarutung. Sekda Drs. Sanggam Hutagalung mengatakan, pelantikan dan pengambilan sumpah janji jabatan ini merupakan hal biasa bagi PNS, dalam rkaitan penyegaran organisasi untuk menciptakan kinerja lebih optimal dalam satuan kerja perangkat daerah (SKPD) di lingkungan Pemkab Taput. Karena itu, jabatan adalah sebuah amanah dan kepercayaan yang diberikan tidak hanya dari atasan dan pemerintah daerah, namun jabatan juga merupakan amanah dari Tuhan Yang Maha Kuasa yang kelak akan dipertanggungjawabkan. “Untuk itu kepada pejabat yang baru dilantik, agar benar-benar mampu memperdayakan semua potensi yang ada dimasing-masing SKPD atau unit kerja yang tujuannya untuk mensejahterakan masyarakat,” tambahnya. (c12)

Gadis Dilaporkan Hilang SIDIKALANG (Waspada): Maudin Nainggolan penduduk Jalan Rimo Bunga Desa Sitinjo Kecamatan Sitinjo melaporkan kehilangan putri, Limdes Nainggolan, 17 (foto) ke Polres Dairi. Pengaduan diregistrasi nomor : LP /84/I/2012/SU/Dairi tanggal 14 Januari 2012 menyusul kehilangan Limdes Nainggolan darirumah koskediamanTumbur Tapubolon di Jalan Tigalingga Kilometer 06 Desa Sungai Raya. Kabar menyedihkan itu diketahui Maudin berdasarkan informasiTumbur, kepada wartawan, Rabu (18/1). Dijelaskan, 18 November 2011 sekira pukul 01:00, pintu belakang rumah terdengar dibuka.Tumbur tidak curiga dan berprasangka, mungkin ada sesuatu yang mau dilihat. Namun, ketika keluarga itu terbangun sekira pukul 06:00, ditengok pintu kediaman sudah menganga sedang pelajar kelas II SMA Negeri Sulumboyah itu tidak lagi berada di sana. Hingga kini, Limdes tidak diketahui di mana. Maudin menjelaskan, keberadaan Limdes di sana adalah atas persetujuannya. Itu dikarenanya ketidaksanggupan membiayai pendidikan anak. Suatu ketika, Tumbur meminta dan menyatakan kesiapan membantu serta tinggal di sana. Ciri-ciri Limdes Nainggolan kulit sawo matang, hidung biasa, gigi rata dan teratur, dagu tajam, rambut lurus, perawakan tubuh sedang, kepala lonjong dan telinga anung gandul. Bila ditemukan diharap menghubungi nomor telepon genggam 082102845145 Maudin Nainggolan, 081370965965 Rohot Nainggolan dan 081397782851 Arden Nainggolan. Keluarga akan menanggung segala perongkosan. (a20)

Pencurian Sepedamotor Meningkat STABAT (Waspada): Pencurian sepedamotor meningkat di Kab. Langkat. Lokasi terbaru di depan Kantor Bappeda Langkat di Stabat, Selasa (17/1) waktu maghrib, sepedamotor Yamaha Scorpio BK 3510 RY milik Zamroni raib. Informasi dihimpun, sebelum sepedamotor honorer Pemkab Langkat itu hilang, dia meminjamkannya kepada temannyaTogiranto Sihombing. Beberapa saat kemudian Togiranto mengembalikannya dan menurut dia telah memarkirkan di tempat semula. Namun ketika korban hendak pulang, sepedamotor sudah raib. Atas kejadian itu warga Perumahan Taman Binjai Indah ini mengadu ke Polres Langkat. Sebelumnya empat sepeda motor hilang di Asrama Polres Langkat di Stabat, di Desa Jatisari Kec. Padangtualang dan di parkiran Gedung DPRD. Jajaran petugas Unit Ranmor Polres Langkat telah menyebar beberapa brosur dan spanduk mengimbau pengendara sepedamotor memasang kunci ganda saat parkir.(a03)

Ngisap Sabu Diringkus Polisi TEBINGTINGGI (Waspada): Tersangka pengisap sabu di kamar hotel diringkus aparat Satuan Narkoba Polres Tebingtinggi. Berikut barang bukti satu bungkus kecil plastik putih berisi sabu, satu bong, dua pipet dan mancis. Tertangkapnya AS alias Awal, 40, warga Jalan Jenderal Sudirman, Lk V, Kel. Indrapura, Kec. Air Putih, Kab. Batubara dari informasi bahwa tersangka di kamar hotel SPI di Jalan Medan-Kisaran, Desa Binjai, Kec. Tebingsyahbandar, Kab. Sergai lagi mengisap sabu. KapolresTebingtinggi ketika dikonfirmasi melalui Kasat Narkoba, AKP Telly Alpin, kemarin, membenarkan pihaknya mengamankan tersangka.(a11)

Ngataken Tarigan, Erwin Perangin-angin dan Budi Sembiring bermaksud untuk mengawal satu unit truk jenis colt diesel bermuatan batu dolomit yang hendak dibawa ke Medan. Saat tiba di Desa Payung, truk tersebut ditahan seorang oknum yang belakangan diketahuinya berinisial TP dengan memarkirkan kereta lembu di depan truk. Alasannya, karena mereka tidak membayar retribusi untuk Pendapatan Asli Daerah (PAD). Aksi itusempatmembuatjalanmacat. “Saya tanya kenapa mobil kami ditahan. Katanya, karena kami tidak membayar PAD. Dia

pun mengancam akan memecahkan kepala saya,” tukas Syafii. Tak berhenti sampai di situ, seorang yang tak dikenal mendekati Tarigan dan langsung menempelkan ujung pisau jenis Tumbu Lada (pisau tradisionil Karo-red) di perutnya sembari meminta mereka pergi dari desa tersebut. “Jangan kalian membuat ribut di kampung ini. Pergi kalian dari sini,” kata Syafii menirukan ucapan orang itu. Tidak terima diancam, Tarigan bersama rekannya langsung menuju Mapolsek Payung. Namun, petugas di Polsek tersebut tidak bisa berbuat apa-apa

lantaran personilnya hanya lima orang. Selanjutnya, mereka menghubungi Kapolres Tanah Karo yang langsung memerintahkanKapolsekPayungturun ke lapangan. Kapolres Tanah Karo AKBP Agung Prasetiyoko saat dikonfirmasi, Rabu (18/1) sore, membenarkan peristiwa itu. “Saya langsung perintahkan Kapolsek Payung segera turun ke TKP dan keadaan sekarang sudah kondusif. Kalau ada yang salah akan kita proses sesuai hukum yang berlakudanselanjutnyakitaakankoordinasikan dengan Pemkab dan DPRD Karo,” pungkasnya. (a36)

PLTA Asahan III Segera Terlaksana PLN Dapat Respon Positif Dari Pemprovsu MEDAN (Waspada): Pembangunan Pembangkit Listrik Tenaga Air (PLTA) Asahan III segera terlaksana dan pada awal tahun 2012 ini, muncul harapan baru bagi PT PLN (Persero) Unit Induk Pembangunan PembangkitSumateraIdenganberharap Pemerintah Provinsi Sumatera Utara (Pemprovsu) berkenan menerbitkan izin penetapan lokasi PLTA Asahan III seluas 210 ha di Desa Tangga Kecamatan Aek Songsongan Kabupaten Asahan dan Desa Meranti Utara Kecamatan Pintu Pohan Meranti Kabupaten Toba Samosir. “Beberapa waktu yang lalu PT PLN (Persero) telah diminta untuk memaparkan kesiapan PLN dalam rencana pembangunan PLTA Asahan III. Dihadapan Sekretaris Daerah Provinsi Sumatera Utara, Ketua Bappeda Provinsi Sumatera Utara dan seluruh instansiterkait.Dalampemaparan tersebut, PLN mendapat respon dan tanggapan positif dari Pemprovsu.Halinilahyangmenggembirakan kami dan kami terkesan mendapatkan dukungan penuh dari Pemprovsu di bawah kepemimpinan Gatot Pujonugroho, ST,” kata Manajer PLTA Asahan III Robert Purba, kemarin. Pada pertemuan itu, PT PLN (Persero) telah memaparkan kesiapannya dalam rencana pembangunanPLTAAsahanIII,antara lain telah tersedianya pendanaan proyek dari Loan JICA No.IP-532, selesainya detail disain pada tahun 2006-2008, telah disetujuinya AMDAL PLTA Asahan III

oleh Gubernur Sumatera Utara pada tanggal 19 November 2004 dan saat ini sedang dalam proses pembuatan AMDAL baru mengingat kapasitas unit PLTA bertambah dari 2x77 MW menjadi 2x87 MW,tersedianyarencanakegiatan pembangunan PLTA, dan lokasi PLTA yang telah tersedia sesuai detail disain yaitu di Desa Tangga Kecamatan Aek Songsongan Kabupaten Asahan dan Desa Meranti Utara Kecamatan Pintu Pohan Meranti Kabupaten Toba Samosir. “Seperti kita ketahui, saat ini Pemprovsu sedang dalam periode evaluasi penetapan calon investor untuk pembangunan PLTA Asahan III sampai dengan tanggal 18 Februari 2012. Kami berharap bahwa pada akhirnya nanti, Pemprovsu dapat menunjuk PLN sebagai pelaksana pembangunanPLTAAsahanIIIdengan menerbitkanizinpenetapanlokasi PLTA Asahan III kepada PT PLN (Persero). Sebagai tindak lanjut hasil pemaparan kesiapan PT PLN (Persero) untuk membangun PLTA Asahan III tersebut, juga telah dilaksanakan peninjauan lapanganpada16-17Januari2012 oleh seluruh staf dari instansi terkait, mulai dari Bappeda, BPN, Kehutanan, Biro Pemerintahan, Biro Hukum, Biro Ekonomi, Pertambangan & Energi dan lainlain untuk mengecek kesiapan PLN di lapangan sekaligus mengetahuikoordinatrencanatapak proyek PLTA Asahan III. Dalam kunjungan lapangan

tersebut, kata Robert, pihaknya sudah menggambarkan dan melihat langsung rencana pembangunan proyek PLTA Asahan III mulai dari lokasi intake PLTA sampai ke power house PLTA dan basecamp PLTA yang saat ini sedang memasuki tahapan penyelesaianakhirgedungkantor dan perumahan karyawan PLN serta konsultan konstruksi. Dari kunjungan lapangan tersebut juga dapat dilihat kegiatan pelebaran jalan yang saat ini sedang dilaksanakan. Pelebaran jalan ini tidak hanya untuk keperluan proyek, namun utamanya adalahuntukkeperluanmasyarakat sekitar. Dengan kondisi jalan yangnantinyaakanmulusdengan lebar6meterhotmix,makasangat diyakini dapat meningkatkan perekonomian masyarakat Desa Tangga Kecamatan Aek Songsongan Kabupaten Asahan dan Desa Meranti Utara Kecamatan Pintu Pohan Meranti Kabupaten Toba Samosir. Tersedianya jalan yang menghubungkan Kota Porsea ke kota Puloraja merupakan prasarana umum yang dapat meningkatkan perekonomian masyarakat. “Kamiberharapdalamwaktu yang tidak terlalu lama, dengan dukungan penuh dari Pemprovsu, dapat menerbitkan izin penetapan lokasi PLTA Asahan III kepada PT PLN (Persero), sehingga rencana target operasi PLTA padaakhirtahun2015dapatdipenuhi guna pelayanan energi listrik bagi masyarakat Sumatera Utara,” ujar Robert Purba.(m41)

Bupati Pakpak Bharat Tekankan Penerapan Sistem Manajemen Mutu PAKPAK BHARAT (Waspada): Bupati Kabupaten Pakpak Bharat Remigo Yolando Berutu, MBA menekankan pentingnya penerapan Sistem Manajemen Mutu di jajaran Pemkab Pakpak Bharat. Pernyataan ini disampaikan Bupati saat melauncing Sistem Manajemen Mutu standard SNI ISO 9001:2008 di aula Pemkab Pakpak Bharat kawasan PanoramaIndahDellengSindekaSalak, Kamis (19/1). Bupatiantaralaindidampingi Wakil Bupati Pakpak Bharat, HollerSinamo,MMSekdaPakpak Bharat, Ketua DPRD Pakpak Bharat, Assisten Deputi Pelayanan Pemerintahan Umum Hukum dan Keamanan Kemenpan Ir. Henrumal Panjaitan, Biro Otda Setda Provsu Raider Sinuhaji, pimpinan SKPD, para Camat se-

KabupatenPakpakBharatbeserta tokoh-tokoh masyarakat Pakpak Bharat. Bupati juga menyampaikan tiga hal dalam bekerja yakni berubah menjadi lebih baik, kemudian berbuat serta mudahmudahan akan berbuah menghasilkanbuahyangmanis.Kemudian kegiatan tersebut dirangkai dengan pembacaan ikrar dan penandatangankomitmenolehseluruhjajaranPemkabPakpakBharat. Pada kegiatan tersebut juga dilanjutkan dengan pelaksanaan bimbingan teknis kepada peserta tentang Sistem Manajemen MutuStandardSNIISO9001:2008 yang disampaikan langsung oleh Assisten Deputi Pelayanan Pemerintahan Umum Hukum danKeamananKemenpanBapak Ir. Henrumal Panjaitan. Dalam sambutannya ia me-

nyampaikan kepada Pemerintah KabupatenPakpakBharatbahwa pihaknya telah menyediakan anggaran untuk Pemkab Pakpak Bharat, dan sekaitan itu diharapkanPemkabPakpakBharatuntuk memaksimalkan bantuan dan kerjasama dari pihaknya. Sementara Biro Otda Setda Provsu Raider Sinuhaji pada kesempatan tersebut menyampaikan harapannya agar Pemkab Pakpak Bharat dapat menjadi lokomotif dalam penerapan Sistem Manajemen Mutu Standard SNI ISO 9001:2008 yang kelak dapat diikuti oleh Kabupaten lain. Ketua DPRD Ir. Agustinus Manik dalam sambutannya menyampaikandukunganpihaknya terkait penerapan Sistem Manajemen Mutu Standard SNI ISO 9001:2008 melalui fungsi-fungsi lembaga yang dipimpinnya. (csb)

Proyek Misterius Di Sidikalang SIDIKALANG (Waspada): Sejumlah warga Jalan Sakti Sidikalang Kab. Dairi, merasa heran atas kehadiran proyek pembangunan drainase sekira 200 meter di kawasan itu. Pasalnya, proyek tersebut tidak memiliki plank. Warga jalan Sakti,N .Ruddin Manalu kepada Waspada ,Kamis (19/1) mengatakan, pekerjaan pembangunan proyek drainase itu dimulai awal Desember 2011.Hinggakinibelumrampung. “Darimana asal usul proyek, berapa jumlah dana dan siapa pem-

borongnya, kami tidak tahu. Sebab, plank tidak ada terpajang di lapangan,” sebutnya. Selain kehadiran proyek yang tidak transparan, menurut Manalu, pengerjaannya cukup lamban.Tanah bekas korekan, masih menggunung di pinggir jalan, tidak segera dibuang. Sehingga terjadi penyempitan, karena bahu jalan tidak dapat dipergunaan pemakai jalan khususnya kenderaan bermotor. CamatSidikalang,DrsJunihardi Siregar,dikonfirmasitentangproyek

tersebut, juga mengaku tidak mengetahui asal-usul proyek tersebut. Sebab plank tidak ada. Namun Siregar mengatakan kemungkinanproyektersebutP2KP (Proyek Pembangunan Kawasan Perkotaan).Iamenjelaskan,proyek apapun itu, harus transparan dan pakaiplank.Sehinggamasyarakat tidak bertanya tanya. Sekretaris Dinas PU Cipta Karya,Eddy Banurea,SH dikonfirmasiWaspada,juga mengakui, kurang jelas pengetahui asal usul proyek tersebut. (a20)

FKPPI Langkat Tatap Muka Dengan Dandim BINJAI (Waspada): Ketua PC GM FKPPI Langkat Drs.Yan Syahrin dan rombongan termasuk Ketua FKPPI Kecamatan se Kabupaten Langkat, Rabu (18/1) tatap muka dengan Dandim 0203 Langka Letkol Arh YP Girsang, di aula Makodim 0203 Langkat di Binjai. Dalam pertemuan singkat tersebut Dandim 0203 Langkat Letkol Arh YP Girsang sangat berterimakasih kepada unsur pengurus dan Ketua PC GM FKPPI Kabupaten Langkat, atas kedatangannya bertatap muka. Dandim 0203 Langkat mengatakan, saat ini daerah Kabupaten Langkatbanyakdiwarnaipermasalahandidaerahberupaperampokan bersenjata oleh orang tak dikenal (OTK), kasus pembunuhan, narkoba dan masalah sengketa tanah serta illegal logging yang dilakukan oknum tertentu, yang bisa berdampak membawa bencana alam seperti tanah longsor dan banjir bandeng. “Karena itu kita harus mewaspadai hal-hal itu dan diharapkan anggotaFKPPIbisamenjagaagardaerahkitatetapamandankondusif.” Sementara itu Ketua PC GM FKPPI Kabupaten Langkat Drs. Yan Syahrin mengatakan, pihaknya akan melaksanakan Muscab.(a05)

Waspada/Natar Manalu

PROYEK misterius berupa pembangunan drainase di Jalan Sakti Sidikalang. Selain tidak memakai plank, sejumlah pejabat tidak mengetahui asal-usul proyek ini.

Waspada/Bothaniman Jaya Telaumbanua

PULUHAN massa tergabung dalam Gerakan Mahasiswa Nasional Indonesia Cabang Gunungsitoli – Nias melakukan aksi unjukrasa di KantorWali Kota dan DPRD Kota Gunungsitoli untuk menuntut PTS Poliprofesi yang diduga belum memiliki izin segera ditutup.

Massa GMNI Gunungsitoli Demo Tuntut PTS Diduga Ilegal Tutup GUNUNGSITOLI (Waspada): Puluhan massa tergabung dengan Gerakan Mahasiswa Nasional Indonesia (GMNI) Cabang Gunungsitoli - Nias melakukan aksi unjukrasa damai di halaman Kantor wali kota dan DPRD Kota Gunungsitoli, Kamis (19/1). Mereka menuntut Wali kota Gunungsitoli segera menutup Perguruan Tinggi Swasta ilegal yang tetap beroperasi di Kota Gunungsitoli. Aksi unjukrasa GMNI dipimpin Korwil Kepulauan Nias, Erwin Hulu diawali dengan orasi sebelum akhirnya diterima oleh Wakil Wali kota Gunungsitoli, Drs.Aroni Zendrato didampingi Kepala Kantor Kesbang dan Linmas, Drs. Sinema Gulo dan , Kepala Satpol-PP, Molo’ozaro Harefa DihadapanWakilWalikotaGunungsitoli,GMNI membacakan dan menyampaikan tuntutan serta pernyataan sikap yang isinya beberapa poin yakni: hentikanpembodohanterhadapkaumintelektual, Wali kota Gunungsitoli harus memiliki sikap tegas terhadap masalah ini dan memikirkan solusi terhadap nasib mahasiswa yang berada di PTS ilegal. DPRD Kota Gunungsitoli agar konsisten terhadap hasil Rapat Dengar Pendapat Umum (RDPU) tanggal 09 September 2011 dan memberikansanksihukumterhadappelanggarkeputusan tersebutdanjanganhanyadiammelihatpenderitaan rakyat. Polres Nias harus menindak tegas mafia pendidikan yang membawa dan menfasilitasi PTS yang tidak memiliki legalitas serta agar Polres Nias menindaklanjuti pengaduan mahasiswa PoliprofesidenganNo:B/635A1/XII/2011/Reskrim. DPRD di Kepulauan Nias diimbau untuk merancang dan menetapkan Perda di setiap Kabupaten/Kota tentang peraturan dan syarat

berdiri serta beroperasi sebuah Perguruan Tinggi. Selain itu massa mendesak Pemkab/Pemkot menindak tindak tegas PNS yang mengajar dan menjadi dosen di PTS Ilegal serta menghentikan penindasan dan pembunuhan karakter kepada generasi penerus Kepulauan Nias. Menanggapipernyataansikapyangdibacakan GMNI,WakilWalikota Gunungsitoli menjelaskan Pemerintah Kota Gunungsitoli termasuk Dinas Pendidikan Kota Gunungsitoli tidak memiliki wewenanguntukmenutupPTSPoliprofesikarena yyang paling berwenang untuk itu Dirjen Dikti dan Kopertis Wilayyah I. Sedangkan wewenang PemkoGunungsitoliterkaitPTSPoliprofesisampai saat ini tidak mengeluarkan rekomendasi sebagai dasar keluarnya izin operasional di Kota Gunungsitoli. “MengenaiPoliprofesi,DinasPendidikanKota Gunungsitoli tidak mempunyai wewenang, tetapi yang memiliki wewenang adalah Dirjen Dikti. Maka oleh karena itu, Pemerintah Kota Gunungsitoli hanya memiliki wewenang dengan tidak mengeluarkan izin tempat”, kilahWakilWalikota. UsaimendengarpenjelasandariWakilWalikota Gunungsitoli, massa GMNI secara tertib meninggalkan tempat tersebut dengan mengendarai puluhan sepedamotor sambil mengibarkan bendera dan spanduk melanjut aksinya di Kantor DPRD Kota Gunungsitoli untuk menyampaikan tuntutan dan pernyataan sikap. Pantauandilapangan,selamaberlangsungnya aksi unjukrasa massa GMNI baik di Kantor Walikota maupun DPRD Kota Gunungsitoli terus dikawal oleh puluhan personil polisi dari Polres Nias. (a25)

Tabung Gas Meledak Warkop Terbakar, 3 Luka BERASTAGI ( Waspada): Warung kopi (Warkop) semi permanen berlantai dua milik Dasar Pandia, 50, di Desa Merdeka, Kecamatan Merdeka, Kab. Tanah Karo terbakar diduga akibat tabung gas LPG 12 Kg meledak. Akibat kejadian tersebut tiga orang terluka, salah satunya pelajar SMU,sertakerugianmencapaipuluhanjutarupiah. Informasi dihimpun Waspada Kamis (19/ 1) di sekitarTempat Kejadian Perkara (TKP), rumah berlantai dua tersebut pada lantai dasar difungsikan sebagai warkop. Menurut sejumlah saksi mata, kebakaran yang terjadi Selasa kemarin diduga akibat tabung gas LPG ukuran 12 Kg meledak.. Korban terluka masing-masing Dasar Purba, 50, Ivan Purba,35, dan Riko,16, menderita luka bakar serius, sementara seorang di antaranya terpaksa dilarikan ke salah satu rumah sakit di Medan. “Ledakan keras akibat tabung gas 12 Kg, disertai dengan semburan api membubung tinggi,

spontan menjilati seisi rumah. Diduga karena terjadi secara tiba - tiba, ketiga korban yang berada didalam rumah tak dapat menghindar dari jilatan api,”: terang marga Tarigan. Dikatakannya, beruntung keadaan yang lebih fatal dapat dicegah berkat kesigapan, dan pertolongan dari warga setempat, yang secara spontan berjibaku memadamkan api. Upaya warga tak sia - sia, untuk memadamkan jilatan dari sijago merah. “Setelah api berhasil dipadamkan, barulah dua unit mobil pemadam kebakaran milik Pemkab.Karotibadilokasi.Sementaraketigakorban segera dilarikan warga ke Rumah Sakit.Amanda Berastagi,” terang Nande Irma. Dikatakan Nande Irma, Riko yang masih duduk dibangku SMU terpaksa dilarikan ke salah satu rumkit di Medan. Serta mengakibatkan kerugian puluhan juta rupiah. (c19)

Polisi Tangkap Tersangka Pembacok SAMOSIR(Waspada):SatuanReserseKriminal Polres Samosir menangkap pelaku penganiayaan berinisial BS warga Desa Silalahi Kec. Pangururan dari lokasi tempat tinggalnya setelah buron seminggu ke Medan. Informasi dihimpun Waspada, Kamis (19/ 1), kejadian terjadi saat pelaku dan korban samasama minum dan menimbulkan perasaan tidak senang sehingga pelaku melakukan penganiayaan terhadap Jefri Simbolon (27) dengan cara membacok kepala korban hingga 21 bekas jahitan di sebuahwarungdiDesaSilalahitanggal27Desember

2011 sekitar jam 21.00 WIB. Kasatserse Polres Samosir AKP B.Siahaan kepadaWaspadadiMakoPolresmengatakan,pelaku sudah ditahan untuk menjalanipemerik-saandan melimpahkan berkas ke JPU dalam waktu dekat. Barang bukti yang disita sebilah parang 30 cm. “Sejak ditempati sementara Mako Polres Samosir yang baru 10 Januari 2012, tahanan yang dimasukkan ke sel enam tahanan terdiri lima pria dewasa dan satu wanita dengan perkara kasus Narkoba empat tahanan, satu kasus judi dan satu kasus penganiayaan,” sebutnya. (c11)

Satgas Toba Go Green Gelar Panggung Prajurit PEMATANGSIANTAR(Waspada):Satuantugas (Satgas) Toba Go Green Korem 022/PT mengadakan kegiatan panggung prajurit guna memberikan hiburan kepada para prajurit SatgasToba GoGreen hingga tetap memiliki moril dan semangat tinggi. “Disampingmenumbuhkanjiwakorsasesama prajurit serta menghilangkan rasa capek dan bosan akan pekerjaan yang selama ini dihadapi,” sebut Danrem 022/PT Kolonel Inf Karsiyanto melalui Kasrem 022/PT Letkol Arm Anton Irianto Popang, SH di wisma Simanukmanuk, Parapat, Kabupaten Simalungun,Jumat(13/1)sepertidikutipKapenrem 022/PT Mayor Caj Drs. Prinaldi, Senin (16/1). Pada kesempatan itu, Kasrem mengharapkan selama para prajurit Satgas Toba Go Green berada dan menempati Poskotis di wisma Pemprovsu, Parapat harus ikut menjaga fasilitas yang ada dan jangan sampai merusak fasilitas yang ada, karena fasilitas itu bukan milik Korem 022/PT. Kapenrem menyebutkan sejak pencanangan Toba Go Green berupa penanaman pohon penghijauan di kawasan Parapat 5 Oktober 2010 yang dilakukan Danrem 022/PT Kolonel Inf Karsiyanto sampai sekarang, Korem 022/PT sudah bertekad untuk melestarikan kawasan Danau Toba. Panggung prajurit itu, sebut Kapenrem, diikuti personel Satgas Toba Go Green Korem 022/PT sebanyak 440 orang dengan tujuan untuk mengurangi kejenuhan prajurit selama melaksanakan program Toba Go Green mulai dari penggalian lubangsampaidenganpenanamanbibit.“Kedepan acara panggung prajurit ini akan kita buat secara berkelanjutan.”

Guna menyemarakkan panggung prajurit kaliini,imbuhKapenrem,disampingmengadakan hiburan keyboard, panitia turut mengadakan beberapa jenis perlombaan untuk prajurit yakni lomba menyanyi dengan menyanyikan dua buah lagu terdiri lagu wajib berirama dangdut dan lagu bebas seperti lagu pop dan boleh lagu daerah. “Dalam lomba menyanyi itu dinilai suara, tariannya/joget serta penampilannya. Kemudian lomba dam batu/domino secara berpasangan serta pertandingan catur secara perorangan.” Selesai diadakan perlombaan menyanyi, tim juri terdiri Kopka Nainggolan, Kopda P. Lubis dan Praka Sagala menetapkan Pratu B.Manik dari Yonif 126/KC keluar sebagai juara I dengan nilai 67,83, juara II Serda Lubis dari Yonif 126/ KC dengan nilai 58,83 serta juara III Kopka Mulyadi dari Kodim 0207/Simalungun dengan nilai 50,30. Untuk perlombaan dam batu/domino, juara I pasangan Serda Ilhammudi dengan Pratu Juma Purwanto, juara II pasangan Serma H. Hutasoit dengan Sertu Ompusunggu serta juara III pasangan SermaYudi dengan Serma Agus Fajar. Untuk lomba catur perorangan, juara I Serka Kariaman, juara II Pratu Edi Yudi K dan juara III Serka RP. Pasaribu. Panggung prajurit turut dihadiri para Kasi Korem 022/PT, kepala dinas jawatan jajaran Korem 022/PT, Pasi Intelrem 022/PT, PasiWanwil Sterrem 022/PT, Wadandenkesyah Pematangsiantar, para Danramil jajaran Kodim 0207/ Simalungun serta prajurit Satgas Toba Go Green Korem 022/PT. (a30)


WASPADA Jumat 20 Januari 2012

Jalan Takengen-Bireuen Masih Buka Tutup

Kantor Arsip Gayo Lues Kekurangan Pegawai BLANGKEJEREN (Waspada) : Sebuah arsip sangat penting keberadaannya bagi perjalanan roda pemerintahan kabupaten. Namun bagaimana jadinya jika kantor yang menyimpan arsiparsip penting di Kabupaten Gayo Lues itu keadaannya minim pegawai dan tenaga ahli di bidang arsiparis. Memang diakui Kepala Kantor Arsip dan Perpustakaan Daerah Daminsyar, Kamis (19/1), keberadaan pustaka yang dikelola selama ini kurang diminati masyarakat. Pasalnya, menurut Damin, pertama letaknya agak berjauhan dengan kota dan kedua minat baca masyarakat agak kurang. “Padahal kalau promosi sudah sering kami laksanakan, dengan mengajak masyarakat gemar membaca,“ ujar Damin. Dikatakannya, Kantor Arsip sangat kekurangan pegawai vital, seperti bagian seksi Pengelolaan Khasanah Bimbingan dan Pengembangan dan Sub Tata Usaha. “Karena kekosongan kedua seksi itu, terpaksa kami notadinaskan dari staf yang belum mencukupi pangkat untuk kewenangan itu,” paparnya. Selain itu, Kantor Arsip dan Perpustakaan Daerah berharap peningkatan kelengkapan koleksi buku dan fasilitas penunjang untuk mendorong minat masyarakat berkunjung, seperti menempatkan unit perpustakaan di jantung kota Blangkejeren sebagai akses mudah terjangkau. (cjs)

2011, Arus Kunjungan Wisatawan Ke Banda Aceh Hanya 14,98 Persen BANDAACEH(Waspada) : Menyikapi program pengembangan wisata Banda Aceh, Pemko Banda Aceh melakukan berbagai event pada tahun 2011 antara lain expo Banda Aceh, Festival Krueng Aceh, festival warung kupi dan pembangunan berbagai infrastruktur untuk mendukung kepariwisataan. Kepala Dinas Kebudayaan dan Pariwisata Kota Banda Aceh Reza Pahlevi mengatakan di Banda Aceh, Kamis (19/1), penetapan target kunjungan wisata Banda Aceh tahun 2011 sebanyak 163.000 orang baik dari kunjungan wisata domestik maupun mancanegara. Tapi pencapaiannya hanya sekitar 14,98 persen dan pihaknya akan terus mempromosikan objek-objek wisata di Kota Banda Aceh seperti objek wisata sejarah, objek wisata spiritual dan pantai, objek wisata tsunami seperti museum tsunami, kapal apung dengan kaidah-kaidah bernuansa Islami. Program wisata Banda Aceh tentunya tidak boleh bertentangan dengan penegakan Syariat Islam di Aceh, bahkan lebih menonjolkan objek spiritual seperti Masjid Raya Baiturrahman Banda Aceh, pesantren modern di Aceh Besar, lokasi penyantunan anak yatim dan makam Syiah Kuala.(b31)

JPU Tolak Replik Terdakwa Kasus Penipuan Penerimaan STPDN BLANGKEJEREN (Waspada) : Kamis (19/1) sidang terdakwa Abdiansyah, pelaku penipuan penerimaan tata praja STPDN kembali dilanjutkan di hadapan ketua majelis hakim, Armansyah Putra dan dua hakim anggota, Arpisol, Junita. Agenda sidang pembacaan replik atau tanggapan jaksa penuntut umum terhadap nota pembelaan terdakwa Abdiansyah (tanpa penasihat hukum). Dalam repliknya, JPU membantah semua pembelaan yang dilakukan terdakwa. Beberapa hal menjadi pokok utama yang dilontarkan terdakwa pada nota pembelaan sebelumnya yang menuding JPU tidak cermat dan banyak melanggar berbagai ketentuan, antara lain salah dalam pembuatan gelar, yang tidak dianjurkan KUHAP pasal 143 ayat 2 huruf (a). Sementara JPU menuding terdakwa berkelit atas nota pembelaannya, terbukti menurut keterangan saksi dalam persidangan, saksi ada menghubungi terdakwa melalui HP untuk datang ke rumah korban, pada saat itu korban menyerahkan uang Rp75 juta kepada terdakwa di Bank BRI cabang Blangkejeren dengan mengisi slip setoran. Selain itu, pledoi terdakwa terhadap fakta-fakta hukum di dalam persidangan yang diuraikan terdakwa pada halaman 38 patut ditolak, memperhatikan selama pemeriksaan di persidangan tidak terungkap adanya alasan pemaaf dan pembenar seperti dimaksud dalam pasal 44 KUHP dari perbuatan terdakwa. (cjs)

Hemat Biaya, RSUZA Gunakan Water Treatmen BANDA ACEH (Waspada): Rumah Sakit Umum Zainoel Abidin (RSUZA) Banda Aceh mulai menggunakan sistem water treatmen untuk memenuhi kebutuhan air bersih dan air siap minum di rumah sakit tersebut. Wakil Direktur Administrasi Rumah Sakit Zainoel Abidin Mardiani, Kamis (19/1) mengatakan, RS Zainoel Abidin menjadi rumah sakit pertama di Indonesia yang menggunakan sistem itu. Menurut Mardiani, dengan alat tersebut semua air di kran RSUZA bisa diminum, mulai dari air keran, air westapel dan air di kamar mandi. Menurut Mardiani, penggunaan alat juga untuk meminimalisir air yang terkontaminasi kuman, selain itu alat itu akan membantu menjaga alat-alat rumah sakit. “Kami sudah melakukan lab walaupun kami masih ragu, tapi kami lakukan dua kali dan Alhamdulillah bersih, jadi semua bisa diminum termasuk air di kamar mandi,” katanya. Mardiani menambahkan, kini air yang berasal dari PDAM selanjutnya akan diproses menggunakan peralatan sanitasi buatan Jerman, peralatan dibiayai dengan APBA sebesar Rp844 juta. Kabag Bina Program Rumah Sakit Zainoel Abidin Toni mengatakan, secara teknis penyulingan air itu dimulai dari air PDAM ditampung terlebih dahulu di kolam air rumah sakit, kemudian disterilkan dengan cairan redo yang membunuh semua kuman dan bakteri, sehingga air siap diminum. Menurut Toni, alat itu digunakan karena biaya operasionalnya murah atau hanya Rp10 juta per tahun. (cb01)

31 Wartawan Aceh Lulus Uji Kompetensi BANDA ACEH (Waspada) : Sebanyak 31 wartawan dari berbagai media yang mengikuti Uji Kompetensi Wartawan (UKW) yang dilaksanakan Persatuan Wartawan Indonesia (PWI) Cabang Aceh dinyatakan lulus dan kompeten. Anggota Tim Penguji UKW dari PWI Pusat A Widodo yang membacakan hasil uji kompetensi tersebut mengatakan, dari 35 orang yang diuji, ada empat peserta yang dinyatakan tidak kompoten atau gagal mengikuti UKW. Peserta UKW itu terbagi dalam tiga tingkatan, yakni tingkat Muda (reporter) diikuti tujuh peserta, tingkat Madya (wartawan senior/redaktur) 14 orang dan tingkat Utama (jajaran pemimpin redaksi) diikuti 17 peserta. “Peserta yang tidak lulus pada tingkat Madya dua orang dan pada tingkat Utama dua orang,” papar Widodo. Bagi yang tidak lulus mempunyai kesempatan untuk ikut UKW setelah enam bulan kemudian. Dari 31 yang dinyatakan lulus itu, enam di antaranya wartawan Waspada yang bertugas di Aceh, masing-masing T Zakaria Al Bahri (Muda), Zamzami Surya, Muhammad Zairin dan Iskandarsyah (Madya), Aldin Nl dan Adnan NS (Utama). Ketua PWI Aceh Tarmilin Usman mengatakan, UKW tersebut untuk yang pertama dilaksanakan di Aceh yang diikuti 35 peserta. Ke depan pihaknya akan mengadakan kembali uji kompetensi ini agar semua wartawan bisa mengikutinya. Atal S Depari dari PWI Pusat yang juga anggota tim penguji saat menutup kegiatan itu mengatakan, uji kompetensi itu merupakan implementasi Piagam Palembang 2010 yang ditandatangani 19 perusahaan pers. UKW itu, kata Atal, bertujuan untuk kemerdekaan pers yang profesional, memudahkan perusahaan mengevaluasi SDM wartawannya serta untuk mengingatkan wartawan tentang profesinya. (b06)

C5 BIREUEN (Waspada) : Jalan BireuenTakengon tepatnya di km 25-29 Kecamatan Juli, Bireuen, sampai sekarang masih ditutup dan dibuka pada waktu atau pada jam tertentu sebagaimana yang pernah diumumkan yaitu mulai pukul 08:00-12:00 dan mulai pukul 14:00-17:00, seterusnya dari pukul 17:00-08:00 tetap dibuka. Pasalnya, pembangunan jalan dengan cara memotong bukit hingga sekarang ini belum rampung dibangun. Sehingga warga yang hendak melintas jalan itu sampai sekarang harus melihat jadwal, sehingga mereka tidak tertahan di kawasan itu. Pantauan Waspada, Rabu (18/1) sore, pekerjaan pembangunan jalan dengan memo-

Waspada/Abdul Mukthi Hasan

PULUHAN kendaraan berjalan beriringan di kawasan jalan Bireuen-Takengen km 25-29, beberapa waktu lalu, yang sedang dikerjakan.

Eksplorasi Emas Di Hutan Lindung Aceh

Tujuh Perusahaan Tambang Diizinkan JAKARTA (Waspada): Lembaga Swadaya Masyarakat Greenomics Indonesia membeberkan Aceh hanya memiliki tujuh perusahaan tambang yang memiliki izin melakukan pinjam pakai kawasan hutan dari Menteri Kehutanan. Perusahaan itu diizinkan melakukan eksplorasi emas di hutan lindung, bukan eksploitasi. “Perusahaan tambang yang melakukan eksplorasi atau eksploitasi bahan tambang di kawasan hutan diwajibkan memiliki izin pinjam pakai kawasan hutan dari Menhut. Tidak cukup memiliki Izin Usaha Pertambangan (IUP) saja,” jelas Direktur

Greenomics Indonesia Elfian Effendi, Kamis (19/1) di Jakarta. Elfian menjelaskan, tujuh perusahaan itu sejak Desember 2010 adalah PT Kencana Mineral Mulia, PT Citra Kencana Mineral, PT Tradisi Tirta Kencana, PT Tambang Emas Cemerlang, PT Goldmine Sejati, PT Mandiri Kencana Mineral, PT Sarana Kencana Mineral dan PT Sari Gold Murni. Total luas areal kawasan hutan yang diizinkan tersebut seluas 59.845 hektare. “Jika ada di luar nama perusahaan tersebut, maka perusahaan yang melakukan di hutan lindung adalah ilegal,” tutur pria kelahiran Aceh ini. Merujuk data Dinas Pertambangan dan Energi Aceh tahun lalu, terdapat perusahaan tambang yang memiliki izin eksplorasi atau rekomendasi dari Gubernur Aceh IrwandiYusuf yang

beroperasi di kawasan hutan lindung. Namun data itu tidak menyebutkan nama-nama perusahaan. Terdapat pula perusahaan pertambangan yang melakukan eksplorasi bahan tambang di kawasan hutan lindung tanpa ada izin atau rekomendasi dari Gubernur Aceh dan tanpa ada izin pinjam pakai kawasan hutan dari Menteri Kehutanan. Disebutkan, eksplorasi sebelum izin pinjam pakai kawasan hutan dari Menhut merupakan perbuatan melawan hukum, meskipun sudah ada izin atau rekomendasi usaha pertambangan yang dikeluarkan gubernur atau para bupati/ wali kota. Karena itu, Elfian meminta Dinas Pertambangan dan Energi Provinsi Aceh menginventarisir perusahaan tambang yang beroperasi di dalam dan luar kawasan hutan lindung. (cmh)

Balap Liar Di Banda Aceh, Didenda Rp350-500 Ribu BANDA ACEH (Waspada): Pengadilan Negeri Banda Aceh menjatuhkan hukuman denda kepada 94 pelaku balapan liar di kawasan Terminal Bus Batoh, Banda Aceh, pada 17 Desember 2011. Para pembalap liar itu ditangkap polisi Polresta Banda Aceh pada dini hari, ketika asyik balapan. Para pelaku umumnya anak-anak muda dan bahkan ada yang masih di bawah umur. Kendaraannya ditilang dan dibawa ke Polresta Banda Aceh untuk diidentifikasi.

Hakim tunggal Pengadilan Negeri Banda Aceh Makaroda yang menyidangkan perkara tilang itu, Kamis (19/1) mengatakan, pihaknya telah memutuskan sedikitnya 94 kasus balapan liar dengan hukuman denda bervariasi pada Rabu (18/1). “Kita putuskan hukuman denda kepada pelanggar lalu lintas jalan tersebut ada yang Rp350 ribu, Rp400 ribu dan Rp 500 ribu.Yang denda Rp500 ribu, karena ada catatan di polisi pelaku mengulangi lagi perbuatannya,” katanya.

Sedangkan yang tidak hadir dalam persidangan itu dihukum secara verstek dengan denda Rp400 ribu, selebihnya yang mengikuti sidang umumnya didenda Rp350 ribu. Pantauan Waspada dalam perkara sidang cepat itu para pelaku umumnya mengakui perbuatannya dan tidak protes atas putusan denda yang dijatuhkan hakim. Sementara data di Kejaksaan Negeri Banda Aceh, Kamis (19/1), dari 94 orang yang telah diputus hakim, baru 55 orang yang membayar denda. (b02)

Siswi SMA I Bireuen Juara I Lomba Tulis Puisi Ketokohan Tun Sri Lanang BIREUEN (Waspada): Puisi Sepenggal Kisah Tun Sri Lanang, hasil karya Fathayatul Husna, siswa kelas III akselarasi SMA N 1 Bireuen, terpilih sebagai karya terbaik sekaligus menjadi juara I lomba menulis puisi berthemakan, tentang ketokohan Tun Sri Lanang tingkat siswa SLTA dan Mahasiswa se-kabupaten setempat yang diadakan PAUD Tun Sri Lanang dan Aliansi Penulis Bireuen (AliBi) belum lama ini, Kamis (19/1) diumumkan panitia penyelenggara di Sekretariat AliBi, Cot Gapu. Terbaik kedua dipilih puisi hasil karya Nurhayati Sulaiman, mahasiswi Pendidikan Agama Islam (PAI) STAIN Almuslim, Peusangan, sedangkan juara III adalah karya Dewi Karwina, mahasiswi Universitas Almuslim (Unimus) Peusangan, kabupaten setempat. Ketua PAUD sekaligus dewan juri, lomba menulis puisi, Desi Saifan mengatakan, berdasarkan penilaian pihaknya termasuk mempertimbangkan keputusan para pemerhati seratusan puisi yang diterima dari pengirim pada saat seminar internasional yang diadakan di kantor bupati setempat belum lama ini, karena lomba yang diadakan juga bagian dari rangkaian seminar. Pihaknya juga melalui penyaringan yang sangat ketat atau sangat selektif, akhirnya memutuskan tiga buah karya peserta tersebut dipilih sebagai juara I,2 dan 3. “Kepada juara pertama selain diberikan uang pembinaan Rp 1 juta juga diberikan setifikat, kepada juara 2 diberikan serifikat dan uang pembinaan Rp 750.000, dan kepada juara ketiga diberikan uang pembinaan Rp 500.000 diberikan piagam penghargaan yang

tong gunung itu masih terus dikerjakan dan saat itu sejumlah kendaraan masih antri di sebelah utara, namun beberapa saat jalan itu dibuka dan para pelintas dari Bireuen ke Takengen langsung menerobos kawasan tersebut. Sejumlah pelintas dan masyarakat mengatakan, sepertinya pembangunan jalan ini sudah lama. Namun belum selesai dikerjakan sampai sekarang, sehingga masyarakat yang berkeinginan hendak melintas jalan tersebut agak terhambat. Direktur PT Cipta Karya Bireuen H Saifannur yang coba dihubungi lewat HP belum terhubung. (cb02)

Dokter Jadi Terdakwa, Kasus Dugaan Suami Lakukan Perkosaan BANDAACEH (Waspada) : Kasus seorang wanita yang berprofesi sebagai dokter berinisial YA binti BA, 31, yang dituduh membantu suaminya FR melakukan pemerkosaan terhadap seorang perempuan mulai disidangkan di Pengadilan Negeri Banda Aceh, Rabu (18/1). Namun, dakwaan jaksa penuntut umum itu dibantah keras penasihat hukum terdakwa YA binti BA, Darwis dan Aulia Rahman, dalam eksepsi yang langsung dibacakannya setelah JPU membacakan dakwaan. “Kami membaca BAP terdakwa yang dibuat di hadapan penyidik tidak ada perbuatan yang dilakukan terdakwa kepada saksi korban. Bahkan, sangat jauh berbeda dengan laporan saksi korban, apalagi terdakwa diperiksa bukan atas panggilan yang sah, namun ditangkap terlebih dahulu, sehingga seolah-olah terdakwa sebagai buronan penjahat kelas kakap,” papar Darwis dalam eksepsinya. Penasihat hukum terdakwa juga mempersoalkan terdakwa ketika diperiksa pada tingkat penyidikan di kepolisian tidak didampingi penasihat hukum. Akibat penangkapan dan pemeriksaan terhadap terdakwa yang tidak sesuai aturan KUHAP, menyebabkan terdakwa sempat men-

derita luka memar di wajah. Yang lebih aneh lagi, surat dakwaan JPU yang menyangkut kekerasan atau ancaman kekerasan melakukan perbuatan asusila, dalam surat dakwaan tidak menguraikan adanya keterangan ahli berupa surat Visum Et Repertum, yang membuktikan adanya pemerkosaan baik pada alat kelamin korban maupun luka pada bagian tubuh lainnya. Jaksa Penuntut Umum Mukhzan menyebutkan, terdakwa yang ditahan penyidik sejak 25 Oktober 2011, telah dengan sengaja membantu pemerkosaan yang dilakukan suaminya FR (DPO) di rumah praktik terdakwa di kawasan Lueng Bata, Kota Banda Aceh. Perbuatan tersebut dilakukannya pada 23 Oktober 2011. Menurut jaksa, peran terdakwa adalah membantu mempermudah suaminya melakukan persetubuhan dengan korban yang juga sudah bersuami itu. Perbuatan terdakwa, menurut jaksa, melanggar pasal 56 sub 1e KUHP jo pasal 285 KUHP dalam dakwaan primer serta pasal 289 KUHP dalam dakwaan subsider. Untuk mendengarkan replik dari JPU, majelis hakim diketuai M Arsyad Sundusin menunda sidang hingga, Rabu (25/ 1). (b02)

Dinkes Pidie Biarkan Kasus DBD Meningkat SIGLI (Waspada): Dinas Kesehatan (Dinkes) Pidie dinilai membiarkan kasus Demam Berdarah Dengue (DBD) meningkat di daerah itu. Terbukti sampai pertengahan Januari 2012, tercatat ada tujuh kasus virus dengue yang membawa nyamuk Aedes Aegypty tersebut terjadi di daerah itu. “Karena itu kita berharap Dinkes Pidie bekerja maksimal. Jangan biarkan kasus DBD terus meningkat menyerang warga,” kata Sulaiman, warga Simpang Tiga. Data yang diperoleh di Dinkes Pidie, Kamis (19/1) menunjukkan kasus itu setiap tahun memang terjadi peningkatan. Pada 2009 terjadi 91 kasus, 2010 terdapat 128 kasus, dan 2011 mencapai 156 kasus.

Kasi Pencegahan dan Penanggulangan Penyakit Dinas Kesehatan Pidie Turno Junaidi menjelaskan, meningkatnya kasus DBD setiap tahun itu disebabkan kesadaran masyarakat menjaga kebersihan lingkungan masih kurang. Padahal, pihaknya selalu melakukan sosialisasi kepada masyarakat. Turno mengungkapkan, beberapa daerah yang menjadi endemi DBD antara lain di Kecamatan Kota Sigli, Mutiara Barat, Mutiara Timur, Kecamatan Pidie dan Peukan Baro. Sedangkan Kecamatan Tiro/Truseb dan Batee jarang terdapat kasus DBD.“Kendati begitu pada 2012, dua kecamatan itu mulai terkena virus dengue yang dibawakan nyamuk Aedes Aegypty,” papar Turno.(b10)

Kinerja Pemkab Pidie Lage Baneng SIGLI (Waspada): Pidie Institut menilai kinerja Pemkab Pidie di bawah kepemimpinan Mirza Ismail lamban. Sampai sekarang, Rancangan Anggaran Pendapatan Belanja Kabupaten (RAPBK) 2012 belum dapat dibahas wakil rakyat setempat, karena terlambat diajukan. “Kinerja Pemkab Pidie benar-benar Lage Baneng (bagai kura-kura). RAPBK yang seharusnya diserahkan akhir Desember 2011 dan dibahas awal Januari 2012, baru 16 Januari diserahkan kepada DPRK Pidie. Artinya pembahasan RAPBK tahun 2012 terlambat lagi dibahas,” ujar Koordinator Pidie Institut Muharamsyah, Kamis (19/1). Menurut dia, terlambatnya penyerahan RAPBK itu ke DPRK Pidie hingga berdampak terlambat juga dilakukan pengesahan membuktikan Pemkab Pidie tidak becus menjaga amanah rakyat. “Saya menilai ini jelas ketidakmampuan Pemkab Pidie dalam merancang RAPBK, sehingga terlambat dilakukan pembahasan,” kata Muharamsyah. Kepala Dinas Pengelola Keuangan Dan Kekayaan Daerah (DPKKD) Kabupaten Pidie Amiruddin, Kamis (19/1) menjelaskan, keterlambatan penyerahan RAPBK Pidie 2012 kepada dewan disebabkan terlambatnya penyerahan RKA dari masing-masing Satuan Kerja Perangkat Kabupaten (SKPK) kepada Panitia Anggaran Eksekutif (Panggar).

Waspada/Muhammad Riza

PROYEK pembangunan jalan dan jembatan menyatukan kembali Desa Pusong dengan Desa Jeumeurang, Kecamatan Kembang Tanjong, Pidie yang dipisahkan Muara Kuala Tari, diramalkan tidak akan selesai sesuai target Bupati Pidie H Mirza Ismail awal 2012. Buktinya sampai sekarang bangunan itu masih telantar, Kamis (19/1). Alasan lainnya untuk merancang RAPBK membutuhkan waktu lama, sehingga pengajuan RAPBK pada tahun ini terlambat lagi diserahkan kepada wakil rakyat Pidie untuk dibahas dan ditetapkan menjadi APBK. (b10)

Terpidana Dua Tahun Belum Dieksekusi Kejati Aceh Diduga Sarat Permainan Waspada/Abdul Mukthi Hasan

PENGURUS ALiBi didampingi pengurus PAUD Desi Saifan menyerahkan piagam penghargaan kepada Fathayatul Husna yang memenangkan lomba menulis puisi tentang ketokohan Tun Sri Lanang di Kantor ALiBi, Kota Juang, Bireuen, Kamis (19/1). langsung diserahkan pengurus AliBi, H Razuardi El Ibrahimy dalam acara sederhana di kantor ALiBi dan diterima para pemenangnya. “ katanya kepada Waspada menjelang diumumkan pemenang. Menurut Desi Saifan, hasil karya terbaik anak-anak Bireuen tersebut menjadi milik penyelanggara dan rencananya akan dipublikasikan ke Mayasia dalam waktu dekat ini. “Malaysia adalah negeri asal Tun Sri Lanang, maka karya ini yang telah menjadi ALiBi akan dibukukan dan akan di publikasikan ke negara tetangga itu,” jelasnya. Hal yang sama juga dikatakan, pengurus ALiBi, H Razuardi El Ibrahimy usia menyerahkan hadiah kepada para pemenang. “Berdasarkan keputusan panitia dan penyelenggara puisi ini setelah diumumkan pemenang menjadi milik panitia lomba, jadi tidak bisa digugat lagi bila puisi ini akan dipublikasikan

atau dipasarkan ke Malaysia nanti, karena ini sudah ketentuan sebelumnya,” katanya. Sementara itu, Fathayatul Husna pemenang pertama kepada Waspada usai menerima hadiah, mengaku tidak menyangka hasil karyanya terpilih sebagai juara I, karena sebelumnya dia belum pernah ikut lomba hanya menulis puisi selama ini untuk menyalurkan hobinya saja dan saat ikut lomba tersebut juga tidak ada target untuk menang. “Alhamdulillah saya bisa juara, walaupun sebelumnya saya tidak menyangka, ini rahmat Allah untuk saya, semoga kedua orang tua saya seneng saya menjadi juara ini,” katanya seraya menambhakan uang hadiahnya juga akan disisihkan sedikit untuk anak yatim dan teman-teman di sekolah. “Saya akan terus berkarya, semoga nanti juga menjadi yang terbaik lagi,” kata anak dari pasangan Yusri BudimanHasdian(cb02)

MEDAN (Waspada): Lembaga Swadaya Masyarakat (LSM)Detektif Swasta Pemantau Indonesia Reformasi (d-spire) akhirnya menyurati Jaksa Agung Muda Bidang Pengawasan (Jamwas) Kejaksaan Agung Republik Indonesia terkait belum dieksekusinya terpidana dua tahun penjara atas nama Robby Meyer. “Robby Meyer, bos PT Bintang Bersaudara itu telah ditetapkan Mahkamah Agung terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana pemalsuan surat, penipuan dan penggelapan,”ujar MA Siregar, Divisi Investigasi LSM d-spire, Kamis (19/1) di Medan. Dikatakan, dengan surat bernomor 11.LSMdspire/DI/01.2012, tanggal 16 Januari 2012 itu, pihaknya mendesak Jamwas agar penerapan hukum bagiterpidana Robby Meyer segera dilaksanakan. “Hal ini agar agar hal serupa tidak terjadi kepada para pencari keadilan hukum di negeri ini,” katanya. Menurutnya, jika seluruh rakyat Indonesia wajib menaati hukum, maka institusi hukum juga berkewajiban melaksanakan dan menerapkan hukum, khususnya kepada Robby Meyer. Surat sebanyak dua lembar yang ditembuskan kepada Ketua MA, Kapolri, Kajati Aceh dan Kapolda Aceh itu menguraikan, sesuai dengan surat Nomor 1913/Panmud.Pid/1339K/PID/ 2009tanggal 10 Desember 2010, Mahkamah Agung memutuskan menjatuhkan pidana penjara kepada terdakwa Robby Meyer 2 (dua) tahun penjara dikurangi dengan masa tahanan dan meminta Kejati Aceh melakukan eksekusi terhadap terdakwa Robby Meyer.

Selanjutnya mengacu surat Kejagung RI melalui Jaksa Agung Muda, Pidana Umum (Jampidum) Nomor B-1960/E/Ep.3/07/2011 tanggal 7 Juli 2011, Kejaksaan Tinggi Aceh menyurati Kepala Kepolisian Daerah Aceh dengan Nomor 1713/N.1/Euh.1/07/2011, tanggal 27 Juli2011 perihal Daftar Pencarian Orang (DPO) An Robby Meyer. Bahkan, kata Siregar, LSM d-spire yang sejak awal mengikuti perkembangan penanganan perkara atas pembangunan 167 unit rumah bantuan Catholik Relief Services (CRS), di Desa Rukoh, KecamatanSyiah Kuala, Banda Aceh tahun 2006 itu telah berupaya membantu penegak hukum dengan mengumumkan kepada publik tentang pemberian hadiah Rp5juta bagi anggota masyarakat dan pihak manapun yang memberitahukan keberadaan terpidana Robby Meyer sehinggaberhasil ditangkap petugas di kejaksaan maupun kepolisian. Hal krusial yang dilaporkan kepada Jamwas Kejagung RI itu, lanjut Siregar, berdasarkan hasil konfirmasi wartawan sebagaimana dilansir sejumlah suratkabar terbitan Aceh dan Medan ke Polda Aceh, diketahui Polda Aceh mengaku belum menerima surat Kejaksaan TinggiAceh dengan Nomor 1713/N.1/Euh.1/07/2011, tanggal 27 Juli 2011 perihal Daftar Pencarian Orang (DPO) An Robby Meyer dimaksud. “Sangat tidak masuk akal surat Kejati Aceh itu tak sampai ke Polda Aceh, mengingat jarak antara kantor Kejati Aceh dengan Polda Aceh tidak terlalu jauh.Wajar dugaan muncul adanya permainan di institusi itu,” katanya.(m14)



WASPADA Jumat 20 Januari 2012

Warga Teupin Breuh, Simpang Ulim Tahan Truk Dan Alat Berat


ANAK-ANAK melompat bebas ke sungai dari atas seling jembatan gantung di Desa Rayeuk Pange, Kecamatan Pirak Timu, Aceh Utara, Rabu (18/1). Meski berbahaya, atraksi ini sering dilakukan anak-anak di kawasan itu, terutama ketika air sungai sedang meluap atau ketika musim banjir.

Hasil Survei, Tiga Penyebab HIV/AIDS Di Lhokseumawe LHOKSEUMAWE (Waspada) : Hasil survei yang dilakukan Yayasan Permata Atjeh Peduli menemukan tiga faktor penyebab penyebaran kasus HIV/AIDS di Kota Lhokseumawe. Faktor itu secara transeksual, horizontal dan vertikal.

Secara transeksual yaitu melakukan hubungan seks, baik sesama jenis maupun lawan jenis (homoseksual-heteroseksual), kemudian secara horizontal yaitu kontak antar darah atau produk darah yang terinfeksi seperti pemakaian jarum suntik bersama secara bergantian, tato, tindik, transfusi darah, pisau cukur, transpalantasi organ, perawatan gigi dan alat medis. Selanjutnya, secara vertikal yaitu dari ibu yang terinfeksi HIV ke anak selama mengandung, persalinan dan menyusui. Sur-

Kisruh Politik Terus Coreng Wajah Aceh LHOKSEUMAWE (Waspada) : Seruan untuk menyelamatkan perdamaian Aceh sejak perjanjian Helsinki ditandatangai 15 Agustus 2005, terus diembuskan oleh banyak pihak. Namun, kendati gema seruan begitu besar, realitas politik bisa dikatakan gagal menanggapi seruan itu. Kerugian nyawa, harta, harga diri, terus mencoreng wajah Aceh. “Kita tentu ingin menyimpan masa-masa suram itu hanya sebagai satu penggal sejarah di masa lalu. Bahwa setelah perjanjian damai ini tidak ada lagi perang, Aceh menjadi aman, rakyat bebas melakukan aktivitas tanpa ada ancaman, teror dan penembakan,” kata Pengamat Komunikasi Politik FISIP Unimal Kamaruddin Hasan, Kamis (19/1) berkaitan masalah kekisruhan menjelang Pilkada Aceh. Udara persengketaan (permusuhan) yang telah berakar ini mesti dihentikan, kata dia, digantikan dengan angin perubahaan yang jauh lebih penting. Sebuah prestasi besar bagi Aceh kalau mampu memagari diri dari sindrom kekerasan Pilkada dengan membangun kesepakatan politik tanpa kekerasan. “Aceh perlu berkomitmen demokrasi lokal Pilkada tanpa kekerasan. Aceh harus dibangun dengan semangat kebersamaan tanpa berpihak kepada siapan pun, melainkan harus berpihak kepada rakyat Aceh. Aceh bukan milik kelompok tertentu, Aceh milik orang Aceh,” tegas Kamaruddin yang juga Direktur Development For Research and Empowerment (DeRE-Indonesia). Konsekuensi logisnya, kata dia, kehidupan manusia mensyaratkan perlunya membangun relasi, interaksi, komunikasi, inter-koneksi serta jejaringan dan kerjasama, untuk kemudian satu sama lain hendaknya menjadi saling mengenal. (b14)

vei transeksual yang dilakukan pada wanita pekerja seks (WPS) ditemui 44 WPS melakukan hubungan seks berumur 16-20 tahun (80 persen). Sedangkan tamu yang dilayani sebanyak 60 persen penduduk asli. ‘’Status WPS ini pada umum-nya lajang, yakni didapati 98 persen mengatakan belum menikah,” ucap Ketua Yayasan Khadir, Kamis (19/1). Kemudian 60 persen remaja yang telah melakukan hubungan seks menjawab punya teman spesial lawan jenis (pacar).

Dan 20 persen menjawab mengetahui temannya melakukan hubungan seks di luar nikah. Lokakarya membangun jejaring yang dilakukan di Wisma Lilawangsa, Lhokseumawe oleh Yayasan Permata Atjeh bekerjasama dengan Caritas Germany. Lokakarya dengan tema ‘Satu Hati Satu Langkah Dalam Penanggulangan HIV/ AIDS di Bumi Aceh’ itu dihadiri unsur Pemko Lhokseumawe, paramedis, KPA, TNI/Polri dan LSM peduli HIV/AIDS. Lanjut Khaidir, masalah HIV

dan AIDS bukan hanya masalah sebagian orang, tetapi juga merupakan masalah semua orang dan diharapkan agar ada kerjasama lintas sektor baik di Kota Lhokseumawe dan Aceh Utara dalam hal penanggulangan HIV dan AIDS. Sementara pemateri lain dari Komisi Penanggulangan AIDS (KPA) Aceh Utara dr Makhrozal mengimbau semua pihak harus bersama terlibat dalam pencegahan HIV/AIDS di Aceh. (cmk)

Pertamina EP Field Rantau Ajukan Kasasi Ke MA KUALASIMPANG (Waspada) : Sehubungan dengan hasil sidang putusan yang dipimpin Hakim Ketua, Syukri dan Hakim Anggota Firmansyah danYuheri Salman, tentang perkara gugatan tenaga kerja outsourcing pada PT Pertamina EP Field Rantau yang berlangsung di Pengadilan Negeri Banda Aceh, Pengadilan Hubungan Industrial (PHI) Banda Aceh memutuskan memenangkan gugatan pekerja outsourcing, Selasa (17/ 1). Terkait putusan itu dan seperti yang telah diwartakan Waspada edisi Rabu (18/1), Kepala Layanan Operasi PT Pertamina Region Sumatera –Field Rantau, Aceh Tamiang Tergiah Sembiring di Kualasimpang, Aceh Tamiang, Rabu (18/1) menyatakan, PT Pertamina EP

Field Rantau akan mengajukan upaya hukum kasasi ke Mahkamah Agung (MA). Menurut Tergiah Sembiring, kuasa hukum PT Pertamina EP Field Rantau Ahmad Jabbar, Kaswir dan Fandi Prabudi menghadiri sidang Pengadilan Hubungan Industrial (PHI) di Pengadilan Negeri Banda Aceh untuk mendengarkan pembacaan amar putusan Majelis Hakim sidang dimaksud. Tergiah menjelaskan, setelah memperoleh informasi hasil persidangan dari kuasa hukum PT Pertamina EP Field Rantau di Hotel Hermes Banda Aceh, salah seorang kuasa hukum PT Pertamina EP Field Rantau Teguh Pambudi Utama yang juga Manajer Hukum PT Pertamina EP menyampaikan secara prinsip Pertamina EP

akan patuh terhadap suatu putusan hukum, sepanjang putusan berkekuatan tetap. Tergiah menegaskan, putusan PHI Banda Aceh saat ini belum mempunyai kekuatan hukum tetap dan PT Pertamina EP Field Rantau masih mempunyai hak untuk mengajukan upaya hukum lanjutan yang dijamin oleh undang undang. Field Manajer PT Pertamina EP Rantau Jayasuria melalui Kepala Layanan Operasi PT Pertamina Field Rantau Tergiah Sembiring mengimbau rekanrekan pekerja maupun pekarya agar menjalankan tugas dengan baik sesuai fungsinya serta mematuhi serta menaati aturan dalam menjalankan tugas dan menghindari hal-hal yang dapat menghambat atau merugikan perusahaan. (b23)

Zinatul Mikrajiah, Anak Korban Konflik Kuliah Gratis Di Unimus SUASANA di kampus Universitas Almuslim (Unimus), Peusangan, Bireuen, dua hari lalu menjelang tengah hari dipenuhi mahasiswa dan dosen. Mereka sibuk dengan urusannya masing-masing. Waspada yang datang hendak menemui Kabag Humas dan Kemahasiswaan Zulkifli saat itu di ruangannya untuk menanyakan data mahasiswa dari keluarga korban konflik saat itu juga sedang melayani mahasiswa yang meminta Kartu Rencana Studi (KRS) ditandatanganinya. Di tengah kesibukannya, Zulkifli melihat kedatangan Waspada. Zulkifli menanyakan maksud kedatangan Waspada, baru saja mengatakan maksud untuk mengambil data mahasiswa korban konflik. “Nah ini dia yang kita cari, ini termasuk mahasiswa yang korban konflik yang baru menyelesaikan kuliahnya dan sekarang membantu di bagian Bapel KKM,”


ucap Zulkifli kepada Waspada memperkenalkan gadis yang masuk ke ruangannya. Zinatul Mikrajiah, 26, mahasiswa yang dimaksud. Lalu Zulkifli menyambung pembicaraannya dan menanyakan kembali kepadanya kebenaran dia seorang dari keluarga korban konflik Aceh yang kuliah di Unimus dengan biaya gratis yang ditanggung Unimus. “Benar bang saya mahasiswa korban konflik yang kuliah di Unimus digratiskan oleh

rektor, saya baru saja selesai kuliah 2010, seandainya tidak digratiskan, mungkin saya tidak mampu kuliah, karena orang tua saya yang laki-laki telah meninggal pada masa Aceh dilanda konflik di Cot Timphan, sedangkan saya anak ke-4 dari 9 bersaudara yang mencari nafkah selama ini hanya ibu,” kata anak dari pasangan almarhum Amiruddin dengan Wardiah, warga Desa Lhok Awe-Awe, Kecamatan Kuala. Gadis berwajah manis itu, mulai mengisahkan nasibnya dan dengan lancar dan jelas sambil menjawab setiap pertanyaan yang dilemparkan kepadanya terkait masalah kuliahnya. Pada suatu hari ibunyaWardiah datang menjumpai tokoh GAM di Kecamatan Kuala memohon untuk memasukkan namanya untuk bisa kuliah di Unimus secara gratis. Selain ayahnya juga mantan seorang anggota GAM yang meninggal di Cot Timphan 2001 lalu juga dikategorikan sebagai anak keluarga korban konflik. Singkat cerita, permohonan ibunya itu dikabulkan dan pada

2007 dia resmi menjadi mahasiswa Diploma III Komputer Unimus dan selesai kuliah pada 2010 serta belum lama ini mengikuti wisuda. Setelah selesai kuliah dia diminta membantu kerja di Bapel KKM Unimus hingga sekarang. “Saya mengucapkan terimakasih kepada pihak yang telah membantu saya kuliah di Unimus terutama sekali bapak rektor, sungguh ini suatu rahmat dari Allah yang diberikan kepada saya,” ucapnya. Gadis yang mengaku masih single itu menambahkan, dirinya juga masih berkeinginan melanjutkan kuliah kembali hingga S1, namun karena kemampuan orang tuanya belum memungkinkan dirinya bersabar dan memulai bekerja untuk biaya hidup dan membantu keluarga. “Untuk sekarang saya belum bisa membantu orang tua dan adik-adik saya, untuk sendiri saja masih susah, apalagi untuk sambung kuliah di S1 rasanya masih berat, semoga nanti saya bisa dapat kerja yang menjanjikan sehingga dapat menolong keluarga saya dan

bisa kuliah S1,” ucapnya. Zinatul Mikrajiah mengatakan, dirinya dalam waktu dekat ini akan menjumpai Rektor Unimus H Amiruddin Idris untuk mengucapkan terima kasih atas bantuannya selama ini dan juga kepada orang yang membantunya selama ini. Rektor Unimus H Amiruddin Idris, Kamis (19/1) mengatakan, dirinya berinisiatif membantu mahasiswa korban konflik termasuk Zinatul Mikrajiah berawal diusulkan para tokoh GAM seperti almarhum Tgk Ben, almarhum Cage, Tgk M Yahya Keurumbok, supaya anak-anak dari keluarga korban konflik dapat mengenyam pendidikan di bangku kuliah. “Setelah diusulkan, saya juga melihat anak-anak korban konflik yang ingin kuliah sangat besar, namun mereka kurang biaya, lalu kita berusaha untuk sharing dengan Pemkab, namun hingga kini belum ada juga kita terima bantuan,” katanya seraya menambahkan dirinya juga ada keinginan anak-anak korban konflik itu berprestasi akan dikuliahkan S2. Abdul Mukthi Hasan

SIMPANG ULIM (Waspada): Puluhan warga menahan sembilan truk material dan dua alat berat proyek tanggul bernilai Rp15 Miliar yang dikerjakan PT Pelita Nusa, di Desa Teupin Breuh, Kecamatan Simpang Ulim, Aceh Timur, Kamis (19/1) sekira pukul 13:00. Aksi ini dilakukan warga karena lalu lalang truk material sejak tiga bulan lalu membuat jalan desa itu hancur, sementara pihak perusahaan sendiri terkesan buang badan. “Kami sudah berulang kali minta jalan Waspada/Musyawir diperbaiki, tapi tak digubris. SEORANG siswa SD melintas di depan deretan truk material proyek Paling-paling jalan diratakan tanggul yang ditahan warga di Desa Teupin Breuh, Kecamatan seadanya dengan buldozer, Simpang Ulim, Kamis (19/1) siang. lalu perkara dianggap selesai,” kata Adlan, 28, pemuda Desa Teupin Breuh, tanggul yang dikerjakan PT Pelita Nusa. “Saya kemarin. juga sudah menyarankan ke pihak rekanan “Pokoknya, jika tidak ada jaminan tertulis agar merehab jalan tanggul sebagai jalur aldiatas materai dari pihak rekanan, bahwa jalan ternatif dan usulan ini masih dipertimbangkan kami akan direhab selama pengerjaan proyek oleh rekanan,”sebut Salam, kemarin siang. berlangsung dan diperbaiki total setelah proyek Petugas Lapangan PT Pelita Nusa, Andil, selesai, truk dan alat berat ini akan tetap kami menyatakan, perusahaan memang sudah tahan,”imbuh Adlan. berniat merehab jalan yang rusak. “Abang lihat M Jamil Puteh, 49, tokoh masyarakat Teupin saja sendiri, alat berat sudah kita siagakan di Breuh, menambahkan, jalan yang rusak parah lokasi,”dalih Andil sembari menunjuk ke arah akibat lalu lalang truk proyek sekira 2 kilometer. alat berat tanpa awak di tengah jalan Desa “Kondisinya berbubur lumpur. Jangankan Teupin Breuh. dengan sepedamotor, jalan kaki saja susah. Informasi terakhir diterima Waspada, sekira Bahkan gara-gara kondisi ini, banyak anak usia pukul 14:30 Muspika Simpang Ulim, termasuk SD enggan bersekolah karena mesti menenteng Danramil dan Kapolsek turun langsung ke Desa sepatu dan bajunya sering keciprat lumpur,”urai Teupin Breuh untuk memediasi warga dengan Jamil. Pelita Nusa. Namun sampai berita ini dikirimKepala Desa Teupin Breuh, Salam, membe- kan, sekira pukul 17:00, belum diperoleh narkan sekitar dua kilometer jalan desanya keterangan resmi apakah mediasi itu berhasil rusak parah akibat lalu-lalang truk proyek atau gagal. (b19)

Banjir Wilayah Tengah Aceh Utara Surut LHOKSUKON (Waspada): Banjir akibat meluapnya sejumlah sungai yang melanda wilayah tengah Aceh Utara, meliputi Kecamatan Matang Kuli, Pirak Timu dan Kec. Lhoksukon, sejak Rabu (18/1) pagi, kini sudah surut. “Banjir menyusut perlahan sejak pukul 22:00 dan tadi pagi (Kamis-red) sudah surut total. Tapi petani rugi besar. Akibat banjir, puluhan hektar padi terancam mati,”kata Kepala Desa Rayeuk Pange, Pirak Timu, AbdulWahab, Kamis (19/1). Abdul Wahab berharap pemerintah bersedia meringankan beban petani dengan menyalurkan bantuan benih dan sarana pendukung

pertanian lainnya. Disamping itu, dia juga mendesak Pemkab Aceh Utara mencari solusi permanen agar warga di wilayah tengah Aceh Utara tidak terus dihantui bencana banjir hingga berkali-kali tiap tahun. Berita sebelumnya, ratusan rumah di Kecamatan Lhoksukon, Pirak Timu dan Kecamatan Matang Kuli, tergenang air hingga 80 centi meter akibat meluapnya sejumlah sungai di kawasan itu, Rabu (18/1) pagi. Bahkan hubungan darat antara Desa Rayeuk Pange Pirak Timu dan Desa Teupin Keubeu Matangkuli sempat putus lantaran badan jalan ikut terendam dan warga terpaksa naik rakit. (b19)

Pengangkatan Pejabat Fungsional Bertentangan Dengan Permendiknas LANGSA (Waspada) : Pemerintah Kota Langsa dinilai kecolongan dalam mengangkat pejabat fungsional baik untuk posisi jabatan pengawas sekolah maupun untuk pejabat kepala sekolah. Yang sangat mengherankan, kecolongan ini justru terjadi berulang kali, sehingga layak dipertanyakan kepada kantor Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) sebagai instansi terkait yang memproses pengangkatan. Sumber di Dinas Pendidikan Kota Langsa itu menyebutkan, seorang guru yang dipromosikan menjadi kepala sekolah, usianya paling tinggi 56 tahun. Selain faktor umur, beberapa syarat lain juga harus dipenuhi setiap calon apabila seseorang ingin diangkat menjadi kepala sekolah. Ketentuan tersebut diatur dalam Peraturan Menteri Pendidikan Nasional (Permendiknas) Nomor 28 tahun 2010 pada pasal 2 ayat (2-c). Demikian pula dalam soal pengangkatan pejabat menjadi pengawas sekolah. Dalam Peraturan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (Permeneg PAN) Nomor 21 Tahun 2010 pasal 31 ayat (1-e) menetapkan usia paling tinggi untuk posisi jabatan itu adalah 55 tahun. Lebih dari batas usia itu, tidak dibenarkan. Uniknya lagi, beberapa pejabat yang diangkat untuk kedua

Waspada / Syahrul Karim

WALI KOTA Langsa Zulkifli Zainon (paling kanan) saat mengikuti seminar dengan para kepala sekolah tingkat SD di aula Pemko Langsa belum lama ini. posisi itu, ada yang hampir pensiun. Dalam hubungan ini, kata sumber, pejabat terkait dalam proses pengangkatan harus bertanggungjawab karena mereka yang menjadi “biang” timbulnya pelanggaran dalam pengangkatan pejabat dimaksud. (b21)

Erni, Guru Penerima Ani Idrus Award 2012

Mengabdi Dengan Ikhlas ERNI mendadak bangun dari kursi ketika namanya menggema di Ballroom Hotel Arya Duta Medan. Seiring MC membaca riwayat singkat kinerjanya, Erni sempat melambai tangan ke arah semua hadirin, lalu duduk kembali. Wajahnya sumringah. Lebih-lebih ketika ia dipanggil naik ke panggung. Bahkan sampai acara usai raut guru perempuan itu masih saja mengulum senyum. Hari itu, Minggu 15 Januari 2012. Erni sendiri termasuk salah seorang dari 11 penerima Ani Idrus Award 2011 untuk kategori guru berdedikasi tinggi di daerah terpencil. Penghargaan diserahkan Menteri Pendidikan dan Kebudayaan Mohammad Nuh, didampingi H Prabudi Said selaku Pemimpin Redaksi Waspada, harian yang dirintis H Mohd. Said dan Hj Ani Idrus, sejak 11 Januari 1947 silam. “Ini serasa mimpi Bang. Terus terang, saya tak pernah membayangkan bakal menerima anugerah ini, sekaligus bertemu langsung dengan Pak Menteri. Saya pikir, saya hanya diundang sebagai undangan biasa,” kata Erni. Erni guru sekaligus Kepala SMA Persiapan Negeri 2 Langkahan di Desa Lubok Pusaka, pedalaman Kabupaten Aceh Utara. Wanita ini dilahirkan di Cot Girek, juga pedalaman Aceh Utara, 9 Mei 1970. Dia baru dilantik menjadi kepala sekolah pada 2 Januari 2012. Tapi sudah mengabdi sebagai guru pedalaman 18 tahun lalu dan diangkat menjadi PNS sejak 2005. “Penghargaan Ani Idrus Award ini bukan untuk saya sendiri. Saya yakin ini buah pengabdian ikhlas dari kami semua, termasuk 19 guru SMA Lubok Pusaka yang semuanya masih bakti dan warga Desa Lubok Pusaka. Tanpa mereka, saya bukan apa-apa,” kata ibu dua anak


ERNI diabadikan seusai menerima anugerah Ani Idrus Award 2011 di Ballroom Hotel Arya Duta Medan, 15 Januari 2012. ini. Erni terpilih sebagai penerima Ani Idrus Award 2011 karena dinilai punya kepedulian lebih terhadap kemajuan pendidikan di pedalaman Aceh Utara. Sosok guru satu ini, rela mengorbankan kepentingan pribadi demi sekolah. Bahkan suatu waktu, Erni pernah menjual emasnya demi membeli bangku dan meja belajar untuk murid. Erni juga aktif merintis SMA Lubok Pusaka hingga punya gedung permanen dan sering menjalankan operasional sekolah dengan uang pribadi. Musyawir


WASPADA Jumat 20 Januari 2012


Warga Blang Bladeh Tewas Laka Lantas

Pasca Demo Hotel Lido Graha

Direksi Terima Karyawan Sementara

BIREUEN (Waspada) : H Husen Ibrahim, 54, warga Desa Blang Bladeh, Kecamatan Jeumpa, Bireuen tewas dalam kecelakaan sepedamotor BL 3271 ZS yang dikendarainya bertubrukan dengan sepedamotor JS Wan BL 5701 NM dikendarai Rizaldi Saputra, 16, warga Tumpok Teungoh, Lhokseumawe, Senin (16/1) lalu. Menurut saksi mata,Kamis (19/1) menyebutkan, sepedamotor Ibrahim beriringan dengan sepedamotor yang dikendarai Rizaldi yang berboncengan dengan Khairil Anwar, 17, yang baru pulang dari arah Sigli menuju Lhokseumawe. Tubrukan itu terjadi saat Husen Ibrahim menyeberang jalan ke arah selatan persimpangan Blang Bladeh, sepedamotor yang dikendarai Rizaldi Saputra menubruk sepedamotor Husen Ibrahim dari arah belakang mengakibatkan korban mengalami luka parah di bagian kepala, sedangkan Rizaldi bersama temannya Khairil Anwar mengalami luka serius akibat terjatuh ke aspal. Warga setempat yang melihat kejadian itu langsung memberi pertolongan kepada korban dan dievakuasi ke RSUD dr Fauziah. Akibat luka parah dan pendarahan berat di bagian kepalanya, Husen Ibrahim menghembuskan napasnya dalam perjalanan sebelum tiba di rumah sakit. Kasus kecelakaan yang merenggut korban jiwa sudah ditangani Polantas Polres Bireuen. (b12)

Anggaran APBK Aceh Utara Untuk Bantuan Rumah Duafa Terlalu Minim LHOKSEUMAWE (Waspada) : Bantuan rumah kaum duafa yang dianggarkan dalam APBK Aceh Utara tahun 2012 terlalu minim. Untuk menghindari permasalahan penyaluran bantuan, Dinas Cipta Karya Lhokseumawe terpaksa mengajukan bantuan 6.000 unit tempat tinggal untuk warga kaum duafa dari pemerintah pusat. Kepala Dinas Cipta Karya Aceh Utara, Arifin Hamid, Kamis (19/1) mengaku telah mengusulkan 6.000 unit rumah bantuan untuk warga miskin. Menurutnya, permohonan bantuan rumah dari keluarga miskin jumlahnya membeludak. “Sedangkan jumlah anggaran yang diplot dari dana APBK tidak sesuai,” jelas Arifin. Bantuan dari daerah hanya mampu membantu 27 unit rumah. “Kita sudah mengusulkan 6.000 rumah bantuan duafa kepada pemerintah pusat di Jakarta,” tegasnya kembali. Dengan bantuan itu, diharapkan bisa membantu warga miskin di Aceh yang belum memiliki tempat. (b15)

Bireuen Mulai Bangun Tempat Kir Kendaraan Bermotor BIREUEN (Waspada): Pembangunan sarana tempat Kir atau tempat pengujian kendaraan bermotor di Kabupaten Bireuen direncanakan akan rampung pada 2013. Pembangunan dengan alokasi anggaran mencapai Rp3,73 miliar ini dipusatkan di kawasan Desa Blang Bladeh, Kecamatan Jeumpa. Demikian disampaikan Kepala Dinas Perhubungan Kominfo Bireuen Muhammad Yusuf, Kamis (19/1). Menurutnya, pembangunan gedung untuk keperluan tersebut sudah mendesak, apalagi peralatannya sudah tersedia dari bantuan pemerintah pusat. Selain itu, katanya, pembangunan komplek terminal bus yang dikerjakan secara bertahap kini sudah mencapai tahap pembangunan gedung terminal. “Tahun ini dilanjutkan dengan pembangunan gedung terminal,” kata Yusuf. (b17)

Petani Kopi Gayo Menuju Chenai, India TAKENGEN (Waspada): Untuk menghadiri pertemuan antar pelaku kopi se-Asia Pasifik yang berlangsung 20- 22 Januari ini, sejumlah petani kopi Gayo asal Aceh Tengah dan Bener Meriah mulai beranjak menuju India. “Sebentar lagi kami akan siap menuju Chenai, India. Dan mudah-mudahan dalam pertemuan nanti akan menghasilkan banyak manfaat bagi petani kopi dari daerah Gayo ini,” kata Ketua Tim Rombongan, Mustawalad, via telepon genggam, Kamis (19/ 1) dari Bandara Polonia Medan. Dikatakan, semula pihaknya merencanakan 14 petani yang berangkat menghadiri pertemuan itu. Namun hanya 13 petani menyatakan kesiapan mengikuti pertemuan antar pelaku kopi se-Asia Pasifik itu. “Berbagai negara akan menghadiri pertemuan ini, selain India, kami perkirakan turut hadir berbagai negara lainnya seperti Australia, Cina danVietnam. Kemudian Sri Langka, Papua Neugini, Arab dan lainnya,” ungkapnya. (cb09)

Pagelaran Seni SMAN 2 Lhokseumawe Berakhir LHOKSEUMAWE (Waspada): Pagelaran seni di SMAN 2 Lhoksemawe sejak dimulai Rabu, Kamis (19/1) secara resmi ditutup. Pergelaran seni OSISKA diikuti oleh 83 peserta dari lima cabang seni yang dipentaskan di halaman sekolah itu. “Masing masing kegiatan yang kita perlombakan diantaranya, menyanyi lagu pop solo (perseorangan-red) diikuti oleh 22 siswa, tari tradisional diikuti delapan regu, fashion show diikuti 33 siswa, band dari alumni sebanyak 12 grup serta band dari siswa sebanyak delapan grup,” rinci panitia pelaksana Akmal. Kepsek Ulia Maksum Hasan mengatakan, dalam pergelaran itu berhasil keluar juara sebagai penyanyi solo yaitu M Refki, selanjutnya untuk fashion show yaitu Vadia. Sedangkan untuk tari tradisional yang keluar sebagai juara Tari Rapai Aceh. “Khusus band tidak kami beri penilaian, karena mereka hanya tampil saja,” ucapnya. (cmk)

Waspada/Mustafa Kamal

SEORANG perserta fashion show menununjukkan kebolehannya di hadapan ratusan siswa dan guru di halaman sekolah SMAN 2 Lhokseumawe.

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


LHOKSEUMAWE (Waspada): Pasca demo, para karyawan outsourcing Hotel Lido Graha Lhokseumawe masih mempertahankan sikap melakukan aksi mogok kerja. Sebagai antisipaisi lumpuhnya operasional hotel, pihak direksi Hotel Syukri Ibrahim menerima karyawan baru untuk sementara, Kamis (19/1). Kisruh hotel milik BUMD ini sudah ditangani Pemkab Aceh Utara. Saat ditemui Waspada di hotel setempat, perwakilan pendemo A Danil menegaskan tidak akan masuk kerja sebelum direksi hotel Syukri Ibrahim dicopot dari pucuk pimpinan. “Keputusan kami sudah bulat, kalaupun kami tetap memaksa diri bekerja, tetap saja tidak sinkron nantinya,” ujar Danil. “Buktinya hari ini, kami belum mau masuk kerja dan direksi melarang kami duduk dan berkeliaran di depan hotel apalagi di dalam. Waspada/Mustafa Kamal

PULUHAN karyawan outsourcing Hotel Lido Graha, Lhokseumawe, Kamis (19/1) memilih duduk di area parkir karena tidak diperbolehkan memasuki hotel sebelum mengakhiri masa mogok kerja.

Air Sungai Ujong Pacu Tercemar Amoniak LHOKSEUMAWE (Waspada) : Setelah diteliti petugas di Laboratorium Balai Budidaya Air Payau Ujong Bate, Banda Aceh, Kamis (12/1) menunjukkan, Senin (9/1) air Sungai Ujong Pacu, Muara Satu, Lhokseumawe tercemar amoniak, dengan jumlah kandungan mencapai 39.9 mg/l. Sedangkan standar baku mutu air 0.1.

T Maimun, Kepala Badan Lingkungan Hidup dan Kebersihan Kota Lhokseumawe, Kamis (19/1) membenarkan pihaknya menerima hasil uji coba lab dari Banda Aceh. “Hasil uji lab, pada 9 Januari 2012 menunjukkan, air Sungai Ujong Pacu tercemar amoniak dengan kandungan mencapai 39.9 mg/l. Sedangkan pada hari kedua jumlah kandungan amoniak menjadi 0.416 mg/l. Ini hasil dari lab Balai Budidaya Air Payau Ujong Bate,” kata T Maimun. Ditanya mungkinkah amoniak tersebut berasal dari limbah rumah tangga, Maimun mengatakan, tidak mungkin.

Maimun juga mengaku belum mengetahui pasti darimana amoniak itu bersumber. Karena itu, hasil uji coba lab akan dilaporkanWali Kota Lhokseumawe dan selanjutnya akan dicarikan sumber amoniak itu. Maimun juga mengaku belum mengetahui apakah ikan-ikan yang mati di sungai tersebut juga diakibatkan amoniak, karena belum ada hasil lab tentang hal itu. Seperti diberikan sebelumnya, Sungai Ujong Pacu muaranya di kawasan pabrik Pupuk Iskandar Muda (PIM). Warga menduga, ikan yang mati pada Senin (9/ 1) akibat limbah industri pupuk itu. (b18)

Tingginya Kasus KDRT Dan Sengketa Tapal Batas, LPLHa Bentuk Tim PKPH LHOKSEUMAWE (Waspada) : Masih tingginya angka kasus KDRT dan sengketa tapal batas desa di Kabupaten Aceh Utara, Kamis (19/1), Lembaga Pembelaan Lingkungan Hidup dan Hak Asasi Manusia-Aceh (LPLHa) perlu segera membentuk Tim Peningkatan Koordinasi Pemberdayaan Hukum (PKPH) guna mengatasi masalah kesenjangan sosial di tengah masyarakat itu. Hal itu terungkap dalam paparan yang disampaikan berbagai pihak terkait jajaran Muspika dan Muspida pada acara workshop “Pemetaan” dan program pemberdayaan hukum masyarakat terpadu di aula Setdakab Aceh Utara. Sebanyak 50 peserta workshop terdiri dari unsur polisi, jaksa, dinas, camat, mukim dan keuchik yang mendapat kesempatan bicara ternyata memaparkan hal yang sama tentang tingginya angka kasus KDRT dan sengketa tapal batas desa. Seorang Mukim dari Kecamatan Muara Batu Syamsidar membenarkan selama ini kasus

yang paling banyak terjadi di masyarakat adalah KDRT dan sengketa tapal batas. “Selama ini banyak kasus perceraian atau KDRT yang sering terjadi dan sama halnya dengan sengketa tapal batas desa. Persoalan ini sangat sulit diatasi dan bukan hal tidak mungkin kasus ini terkadang tidak menemukan titik terang penyelesaian,” ungkap Syamsidar. Syamsidar berharap penyelesaian kasus KDRT dan sengketa tapal batas bisa diselesaikan di tingkat desa atau secara adat daripada menempuh ke jalur hukum. Fasilitator Program OfficerICLE – Aceh Saifuddin Idris mengatakan, pihaknya bekerjasama dengan The World Bank melaksanakan program Integrated Community Legal Empowerment atau pemberdayaan hukum masyarakat terpadu. Salah satu tujuan yang ingin dicapai adalah presentasi dan finalisasi hasil mapping serta membuat skala prioritas terhadap kasus sengketa untuk dua tahun mendatang.

Saifuddin sudah mengantongi data kasus KDRT dan sengketa tapal batas setelah melakukan assesmen awal secara bertahap terhadap isu atau sengketa permasalahan tingkat desa. “Tim ICLE melakukan asesmen secara bertahap dan mendatangi 240 desa untuk melakukan pertemuan langsung dengan aparatur desa dan tuha peut di Aceh Besar dan Aceh Utara. Semua pihak memberikan solusi terbaik untuk mengatasi masalah kesenjangan sosial,” katanya Kapolres Aceh Utara AKBP Farid BE didampingi Wakapolres Kompol Siswoyo menyatakan dukungan pihak polisi atas peranan masyarakat membantu menyelesaikan masalah kesenjangan sosial yang terjadi. Wakapolres juga membenarkan jumlah kasus KDRT dan sengketa tapal batas desa selama ini sudah memasuki kategori angka tinggi, setelah maraknya kasus pencurian dengan pemberatan sebanyak 38 kasus dan pencurian sepedamotor sebanyak 58 kasus. (b16)

Makam Panglima Divisi X Kolonel Hussein Joesoef Akan Dipugar BIREUEN (Waspada) : Di masa revolusi 1945, Kota Juang Bireuen dikenal sebagai gudangnya pahlawan. Sayangnya kota Juang Bireuen hingga saat ini tidak memiliki makam pahlawan. Sekdakab Bireuen Razuardi usai Rapat Paripurna-1 2012 DPRK Bireuen, Rabu (18/1) mengatakan, makam Panglima Kolonel Hussein Joesoef bersama istrinya Letda Ummi Salmah di pemakaman keluarga di Desa Glumpang Payong, Kecamatan Jeumpa, Bireuen akan dipugar sebagai makam pahlawan kota Juang Bireuen. Rencana pemugaran makam Panglima Kolonel Hussein Joesoef setelah membaca beberapa artikel yang ditulis H AR Djuli, wartawan Waspada Bireuen, tentang peranan Radio Rimba Raya dalam mempertahankan Republik, Bireuen Gudangnya Pahlawan Tak Miliki Makam Pahlawan dan sebuah artikel lainnya berjudul “Perluk a h Me n z i a ra h i M a k a m Pahlawan ? Menurut Sekda, artikel sejarah perjuangan Divisi X Komandemen Sumatera Langkat dan Tanah Karo berkedudukan di Kota Juang Bireuen dimuat di Harian Waspada sangat bermakna untuk diketahui masyarakat khususnya generasi penerus di kota Juang Bireuen, jangan sampai mereka sebagai generasi penerus bangsa tidak mengetahui sejarah perjuangan para pejuang di kotanya sendiri.

Dok Waspada

KOLONEL Hussein Joeosoef (alm) Panglima Divisi X Komandemen Sumatera Langkat dan Tanah Karo. Dikatakan, Pemkab Bireuen b e r s a m a Da n d i m - 0 1 1 1 / Bireuen memberikan perhatian serius sebagai menghargai jasa pahlawan pejuang untuk memugar makam Panglima Kolonel Hussein Joesoef di Desa Glumpang Payong dan akan membangun kembali menumen tank di Juli Keude Dua, Kecamatan Juli sebagai markas besar Kompi Elit (Kompi Istimewa) Divisi X yang diterjunkan ke Medan Area memblokade serangan agresi Belanda, 65 tahun silam. Perhatian pertama Pemkab Bireuen telah menabalkan beberapa nama jalan di kota Juang Bireuen dengan nama pejuang, Jalan Kolonel Husseiun Joeosoef 1, Jalan Kolonel Hussein Joeosef 2 merupakan jalan protokol menuju pendopo Kan-

tor Bupati Bireuen sekarang, dulu kantor dan rumah Panglima Divisi X. Jalan Mayjen Teuku Hamzah Bendahara, mantan Panglima Kodam-I/IM menuju jalan Sakit Umum dr Fauziah, Jalan Kolonel Muhd Ali Basyah, mantan Bupati Aceh Utara, Jalan Ummi Salmah, Jalan Mayor Abdullah Yakob (d/h jalan Gajah) mantan Bupati Aceh Utara, Jalan Letda Ishak Ibrahim mantan Danki Elit (Kompi Istimewa) Divisi X, Jalan Kolonel Muhammad Syah Asyek, mantan Wagub Aceh. Ketua LegiunVeteran Kabupaten Bireuen Abdul Gani berharap agar Pemkab Bireuen jangan sampai melupakan jasa perjuangan para pejuang baik yang masih hidup maupun yang telah tiada. (b12)

Maka kami saat ini duduk berkumpul di parkiran,” ucap karyawan lain. Ketika disinggung penerimaan karyawan baru akan memperkeruh suasana, Direksi Hotel Syukri mengatakan, penerimaan hanya sementara untuk mengantisipasi lumpuhnya fungsi perhotelan. Karena tidak mungkin gara-gara demo, hotel sampai ditutup. “Para karyawan mengatakan saya tidak transparan. Asalkan mereka tahu, bentuk hotel ini seperti apa. Hotel ini bukan koperasi, setiap income dan outcome harus kita musyawarahkan. Karena tidak semuanya kita harus musyawarahkan. Selama ini, kami selalu diaudit oleh Badan Pemeriksa Keuangan (BPK),” katanya. Pj Bupati Aceh Utara HM Alibasyah mengaku sedang berada di Jakarta hanya membalas pesan singkat kepada Waspada, segera akan dilakukan audit keuangan dan manajemen. (cmk)

Dinas Syariat Islam Bireuen Lestarikan Maghrib Mengaji Ke Desa BIREUEN (Waspada) : Mengaji Alquran bagi masyarakat Aceh bukan barang baru. Sejak zaman dulu masyarakat Aceh mengutamakan mengaji Alquran bagi putra-putrinya di balai pengajian dan rumah-rumah guru ngaji di desanya. Putra-putri zaman dulu semuanya pintar mengaji, dibandingkan dengan putra-putri zaman sekarang banyak yang tidak bisa mengaji, lantaran para orang tua kurang mengutamakan mengaji. Selama ini pengajian di kampung-kampung sudah mulai pudar. Akibat semakin pudarnya pengajian di kampung-kampung, Dinas Syariat

Islam Kabupaten Bireuen sejak 6 Januari 2012 mulai menurunkan tim Wilayatul Hisbah (WH) untuk mensosialisasikan maghrib mengaji ke desa-desa serta melakukan razia sosialisasi penegakan Syariat Islam ke seluruh kecamatan di Bireuen. Kadis Syariat Islam Bireuen DR Saifullah mengemukakan, Kamis (19/1) kevakuman sosialisasi penegakan Syariat Islam dalam tahun 2011 lantaran Dinas Syariat Islam terkendala dana dan sarana mobil patroli yang mengalami rusak berat. Sedangkan patroli sosialisasi penegakan Syariat Islam ke-17 kecamatan di Bireuen butuh mobil patroli yang memadai. (b12)

Gedung Baru DPRK Bireuen Di Cot Gapu Anggarannya Rp 45 M

BIREUEN (Waspada): Pemerintah Kabupaten (Pemkab) Bireuen dalam waktu dekat ini akan membangun gedung Dewan Perwakilan Rakyat Kabupaten (DPRK) di kawasan Stadion Cot Gapu dalam waktu dekat ini. Anggaran yang dibutuhkan mencapai Rp 45 miliar untuk tahap pertama mengalokasikan dana dari APBK Rp 2 miliar dan telah diusulkan dalam RAPBK 2012 ke pihak anggota DPRK. Sedangkan stadion akan dipindahkan ke kawasan Paya Kareung yang belum lama ini telah rampung dibangun lapangannya. Selain itu, Bireuen saat ini tidak ada defisit anggaran. Demikian Sekdakab Bireuen, Ir H Razuardi Ibrahim MT kepada Waspada, Kamis (19/1). Menurutnya, gedung DPRK yang akan dibangun baru di kawasan Stadion Cot Gapu sekarang ini selain berlantai tiga juga akan dilengkapi dengan sarana, ruang kesekretariatan, paripurna, area parkir, mushala, MCK, taman dan alun-alun merupakan rencana yang sebelumnya, namun sekarang karena kondisi ekonomi Bireuen yang mulai membaik setelah semua pihak bekerjasama dengan sekuat tenaga, akhirnya tahun ini rencana itu segera direalisasikannya. “Rp 2 miliar yang diusulkan dalam RAPBK

itu merupakan tahap awal yang akan dibahas oleh DPRK, kita berharap, usulan itu dapat dipenuhi oleh anggota dewan,” katanya. Dikatakan Razuardi, dibangunnya gedung DPRK Bireuen ke lokasi yang baru untuk mendukung kelancaran tugas sehari-hari para pimpinan dan anggota dewan. Karena beban tugas yang dipikul dewan cukup tinggi dan jadwal persidangan yang cukup padat. Sementara gedung dewan saat ini masih kurang layak untuk melaksanakan tugasnya sehari-hari, sehingga perlu dibangun gedung DPRK yang representatif pada lokasi yang luas dan ramah lingkungan. “Setelah usulan kita disetujui atau disahkan oleh DPRK, langsung kita buat perencanaan yang akan dilakukan oleh Dinas Pekerjaan Umum, Pertambangan, dan Energi (PU-Tamben) untuk memulai pembangunannya pada tahun ini,” jelasnya. Kepala Dinas PU-Tamben Bireuen, Ismunandar kepada wartawan secara terpisah mengatakan, pembangunan gedung DPRK yang baru akan memakan waktu sekitar tiga tahun. “Jika usulan rencana pembangunan gedung baru disetujui dan sumber dananya mencukupi, tiga tahun akan rampung dikerjakan,” katanya. (cb02)

Waspada/Abdul Mukthi Hasan

RUAS jalan di kawasan Desa Pulo Ara, Kota Juang, Bireuen, Kamis (19/1) tergenang dan setiap musim hujan menjadi rawan kecelakaan lalu lintas.

Sering Tergenang, Ruas Jalan Di Bireuen Kian Rawan BIREUEN (Waspada) : Sejumlah titik ruas jalan nasional di kawasan Kabupaten Bireuen sekarang ini kian rawan. Pasalnya, selama ini kondisinya sudah berlubang akibat sering tergenang, juga lubang itu sering tertutup dengan air bila hujan turun, sehingga banyak kendaraan terjebak dan terperosok ke lubang itu. Titik ruas jalan nasional yang kian rawan itu adalah di depan Meunasah Desa Geurugok, Gandapura, kawasan Desa CotTunong, kawasan Keude Kutablang, kawasan Desa Bale Kuneng dan kawasan sekolah MAN I Peusangan, kawasan Desa Cot Ijue, Peusangan, kawasan Desa Cureh, Kota Juang. Pantauan, Kamis (19/1), ruas jalan sebelah utara Keude Kutablang yang pernah ditimmbun kini kembali digenangi air, sehingga kendaraan saat melintasi kawasan itu harus menghindarinya. Demikian juga di kawasan antara Desa Cureh dengan Pulo Ara, Kota Juang, pinggir jalannya sebelah selatan dan utara sudah lama setiap musim hujan tergenang, namun masih dibiarkan seperti itu. Bahkan, kemarin, warga sudah berinisiatif

memberi rambu-rambu dengan meletakkan dua ban mobil bekas yang di atasnya dipajang satu bendera partai. Namun menjelang siang seorang ibu yang mengendarai motor dengan memboncengi dua anaknya terjatuh di lokasi jalan yang tergenang tersebut. Sejumlah warga meminta pihak terkait untuk segera menutup sejumlah median jalan di dalam kawasan kota setempat. Karena menurut penilaian mereka di kawasan itu sering terjadi kecelakaan. Median jalan yang minta ditutup warga tersebut di antaranya kawasan median jalan depan Masjid Ikhlas, Geulanggang Teungoh, Simpang Geulanggang Kulam, Simpang Geulanggang Baroe, Simpang Lapangan Voa, Simpang Arjun, dan Kawasan Jembatan Leupe. Kadis Perhubungan, Pariwisata, Komunikasi dan Informatika Bireuen MYusuf secara terpisah mengatakan, pihaknya dalam waktu dekat ini akan menutup sejumlah median jalan nasional kawasan kota yang rawan kecelakaan tersebut. “Median jalan ada 13, nanti akan kita sisakan 4 saja, selainnya kita tutup,” katanya. (cb02)

Lakalantas Di Tikungan Nicah Awe, Dua Tewas SIMPANG ULIM (Waspada): Kecelakaan lalulintas maut sesama pengguna sepeda motor terjadi di tikungan tajam jalan nasional, kawasan Desa Nicah Awe, Kecamatan Simpang Ulim, Aceh Timur, Kamis (19/1) sekira pukul 11:30. Dua orang tewas dan dua lainnya luka ringan. Korban tewas Dahlan Bin Arbi, 30, warga Desa Matang Rayeuk, Kecamatan Simpang Ulim dan Supriadi Saputra, 20, mahasiswa asal Desa Lut Kucak, KecamatanWih Peusam, Kabupaten Bener Meriah. Sedangkan korban luka ringan, istri Dahlan, Zubaidah, 28, dan rekan sekampung Supriadi, Andri Herianto, 20. Dahlan dan istrinya naik sepeda motor Revo

BL 5236 DAC melaju kencang dari Simpang Ulim menuju Kuta Binjei. Setiba di tikungan tajam Nicah Awe, Dahlan kehilangan kendali dan dari arah berlawanan muncul sepedamotor Ninja BL 6775 ZJ yang dikendarai Supriadi dan langsung terjadi tabrakan. Tak lama setelah tubrukan, warga sekitar langsung membantu membawa korban ke Puskesmas Simpang Ulim sekitar 2 km arah barat lokasi kejadian. Namun nyawa Dahlan dan Supriadi tak tertolong. Sementara kedua kendaraan yang terlibat lakalantas diamankan polisi ke Pos Polantas Julok. (b19)

Mimbar Jumat


Gerakan Syahwat Mengikis Budaya Malu Oleh H.M. Nasir Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara Wakil Sekretaris Dewan Fatwa Pengurus Besar Al Washliyah


llah Swt berfirman: Kemudian datanglah setelah mereka “generasi” yang mengabaikan shalat dan mengikuti syahwat (keinginan)nya maka kelak mereka akan tersesat. (QS. Maryam: 39). Ayat di atas menginformasikan kepada kita bahwa akan lahir generasi yang mengabaikan shalat lima waktu disebabkan karena memperturutkan k e i n g i nan untuk memenuhi segala tuntutan duniawi de-ngan menghalalkan segala cara dan pada akhirnya akan terkikislah ras malu. Memperturutkan syahwat (ke-inginan) pada dasarnya sangat pribadi dan tidak terorganisir dalam bentuk gerakan atau organisasi tertentu, akan tetapi jika kita amati secara cermat “patuh syahwat” pada era informasi ini sudah merupakan organisasi tanpa bentuk yang tersusun rapi dan senantiasa siap untuk mengikis budaya malu anak bangsa ini. Nabi Muhammad Saw bersabda: Apabila anda sudah tidak punya lagi rasa malu, maka perbuatlah apa saja yang kamu mau. (HR. Bukhari). Isyarat akan lahirnya gerakan syahwat tersebut telah diprediksi oleh Alquran sebagaimana disebut pada ayat di atas dengan menggunakan kata “khalfun” yang diartikan sebagai “generasi pengganti” generasi sebelumnya. Tafsir Buya Hamka “Al-Azhar” jilid 6 hal.4342 menjelaskan, mereka adalah keturunan anak cucu yang hanya berbangga dengan keharuman nama neneknya, tetapi tidak tahu lagi intisari yang diperjuangkan nenek moyangnya itu. Organisasi syahwat tanpa bentuk tersebut semakin menampakkan jatinya di negeri ini dengan mengatasnamakan “seni”, “budaya”, “kebebasan berekspresi”, dan lain-lain dengan menggunakan terminologi yang samarsamar pada hakikatnya adalah organisasi syahwat, atau dengan meminjam istilah Taufik Ismail “gerakan syahwat merdeka”. Gerakan ini merambah gene-

rasi muda kita dengan begitu cepat sampai ke desa-desa, pelosok-pelosok secara perlahan tapi pasti membentuk kepribadian mereka, mulai dari tutur kata, tingkah laku dan gaya, pakaian dan cara berfikir sampai kepada ideologi bagaikan gelombang tsunami meluluh lantakkan budaya malu, ramah tamah, yang dahulunya merupakan jati diri anak negeri ini. Sungguh merupakan “musibah sosial” yang menuntut kita untuk melindungi umat ini dari kehancuran moral sangat mengkhawatirkan. Dan lebih mengkhawatirkan kita, organisasi syahwat tanpa bentuk dan mengatasnamakan kebebasan berekspresi ini tidak berdiri sendiri, akan tetapi be-

durasi ± setengah jam, tidak sebanding dengan misi “gerakan syahwat” yang menggebu-gebu menyerang benteng pertahanan moral kita yang sudah usang, sekali lagi, sama seperti menepis tsunami dengan sapu lidi atau kedua telapak tangan. Sudah sewajarnya bahkan sudah sampai ke tingkat wajib ‘ain (fardu ‘ain) bagi kepala keluarga, tokoh masyarakat, dan wakil-wakil rakyat untuk memproteksi (melindungi) anak-anak kita dari kehancuran moral yang menjadi target dari gerakan “syahwat bebas” di negeri ini. Benteng pertahanan yang paling efektif untuk menangkis gelombang yang datang bertubi-tubi dari waktu ke waktu, dari kota hingga ke pedalaman adalah membudaya-

Membudayakan rasa malu di tengah kehidupan sehari-hari, karena malu adalah merupakan perhiasan iman. kerja sama bahu-mebahu melalui jaringan yang sudah mendunia dengan fasilitas-fasilitas berteknologi tinggi, bermodal besar yang didanai oleh pengusaha raksasa dan diperkuat oleh ideologi liberal yang melandasinya. Sementara pertahanan moral kita sangat rapuh bahkan nyaris tanpa pertahanan sama sekali. Ibaratkan arus gelombang badai atau tsunami besar yang menghantam rumah-rumah penduduk, kita hanya berusaha menepisnya dengan dua telapak tangan, atau dengan sapu lidi yang seogiyanya hanya dapat menguak buih-buih tsunami saja. Lihatlah chanel-chanel televisi swasta yang menjamur di negeri ini, secara terang-terangan telah mengeksploitasi wanitawanita untuk memasarkan kulit mereka demi keuntungan sepihak pemilik modal dan pengusaha besar tanpa mempertimbangkan aspek moral anak bangsa ini, ceramah Mamah Dedeh dan “Ustadz Jamaah” yang ber-

kan rasa malu di tengah kehidupan sehari-hari, karena malu adalah merupakan perhiasan iman. Nabi Saw bersabda: Iman itu telanjang, sedangkan pakaiannya adalah taqwa, perhiasanny adalah malu, dan buahnya adalah ilmu pengetahuan. (alhadis) Memberdayakan rasa malu dalam kehidupan, dapat dimulai sejak dini, dengan memberikan contoh prilaku yang baik kepada keluarga. Sebagai contoh, jika seorang ibu merasa malu melihat anaknya mempertontonkan auratnya di hadapan orang banyak, sewajarnya dimulai pada dirinya sendiri untuk mencontohkan pakaian yang tidak mempertontonkan auratnya kepada orang lain, sehingga sebelum dia bertindak untuk mencegah orang lain, tidak menjadi bumerang bagi dirinya sendiri. Pepatah Arab ada mengatakan: La tanha an khuluqin wataktia mislahu ‘arin alaika iza fa’alta azhimum (Jangan anda melarang orang berbuat suatu kejahatan sedangkan anda pelakunya adalah suatu aib besar,

dosa besar jika anda lakukan itu. Sebaliknya, jika anda mempermalukan orang lain dengan cara mengeksploitasi aurat wanita, baik di majalah-majalah, situs-situs porno, cerpen-cerpen, novel-novel rangsangan syahwat, televisi, dan di media cetak serta elektronik lainnya, tayangkankanlah aurat ibu kandung anda sendiri, nenek kandung, anak kandung, di majalah-majalah porno atau di situs-situs porno tersebut, dan tontonlah beramai-ramai. Jika anda tidak mau melakukan itu, berarti anda masih mempunyai rasa malu dalam diri anda sendiri dan berikutnya iman anda masih dihiasi oleh rasa malu. Cara memasyarakatkan rasa malu seperti ini telah dicontohkan oleh Rasul Saw, ketika seorang lakilaki datang kepada Rasul Saw untuk diberikan izin melakukan perzinahan, lalu Rasul Saw bertanya kepada laki-laki tersebut: Apakah anda mempunyai seorang ibu? Apakah anda punya anak perempuan? Apakah anda punya saudari perempuan? Laki-laki itu menjawab: benar, saya punya semua itu. Bagaimana jika orang lain menzinahi ibumu, saudarimu, anakmu? Lakilaki itu menjawab: tentu saya murka. Nabi Saw menjawab lagi: demikian pula seseorang yang kamu zinahi, itu tidak lebih dari anak dan ibu atau saudari dari manusia seperti kamu juga. Dengan menginternalisasikan rasa malu ke dalam diri dan keluarga kita seperti dikemukakan diatas maka timbullah keinginan untuk memproteksi anak cucu kita dari keruntuhan moral yang semakin mengkhawatirkan, pada gilirannya desakan-desakan untuk membuat undang-undang perlindungan anak, undang-undang perlindungan moral, undang-undang anti pornografi dan porna aksi, akan disahuti oleh orang-orang masih ada rasa malunya dan belum terkikis oleh “gerakan syahwat” yang diteriakkan pendukungnya. Hanya orang yang masih punya rasa malu mau me-lindungi anak-anak bangsa ini dari kehancuran moral. Wallahua’lam bil ash-shawab.

Mahar Yang Berlebihan Oleh Ferdiana Irwanti Mahasiswa Program Magister Kenotariatan Universitas Sumatera Utara (MKN USU).


ahar merupakan suatu bentuk penghormatan, cinta dan kasih sayang diberikan oleh seorang laki-laki kepada seorang wanita. Islam tidak membatasi jumlah, bentuk ataupun jenis mahar yang diberikan kepada mempelai wanita, karena hal tersebut tidak pernah diataur. Hal ini sama yang ada di dalam Kompilasi Hukum Islam pasal 30 dikatakan bahwa calon mempelai pria wajib membayar mahar kepada calon mempelai wanita yang jumlah, bentuk dan jenisnya disepakati oleh kedua belah pihak. Pemberian mahar bukan sesuatu yang dapat dianggap sepele karena didalam Alquran terdapat ayat yang mengatur mengenai mahar, firman Allah SWT, “Berikanlah maskawin mahar kepada perempuan (yang kau nikahi) sebagai pemberian dengan penuh kerelaan, kemudian jika mereka menyerahkan kepada kamu sebagian dari mahar itu dengan senang hati, maka makanlah (ambillah) pemberian itu (sebagai makanan) yang sedap lagi baik akibat-nya”. (An-Nisa’: 4). Mahar yang telah diberikan seorang laki-laki terhadap wanita yang dinikahinya tidak boleh

diminta kembali karena menjadi harta yang dimiliki secara terpisah dengan seorang suami bahkan orang tuanya pun tidak bisa memilikinya terkecuali diberikan secara ridha. Kewajiban pemberian mahar pada saat sekarang telah disalahartikan. Anggapan mahar adalah sesuatu yang berwujud ataupun memiliki nilai ekonomis yang tinggi. Pendapat ini sangat beralasan karena mahar adalah nafkah awal yang diberikan seorang suami sebelum dimulainya bahtera rumah tangga yang akan dijalani, maka pemberian mahar harus memiliki nilai seperti uang, mobil, rumah, tabungan dan sebagainya. Karena kesalahpahaman inilah yang menyebabkan terjadinya hambatan suatu pernikahan. Padahal Nabi Muhammad SAW mengajarkan agar mahar dapat diperingan dan disederhanakan, hal ini ditujukan pernihakan yang menjadi sunnah dan ibadah dapat segera dilaksanakan. Dari Sahl bin Sa’id r.a. berkata, “Ketika kami berada ditengahtengah para sahabat di dekat Ra-

Konsultasi Al-Quran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI ALQURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H. Yusdarli Amar), 082163203233 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustadz yang saya hormati, Hari apa dan waktu-waktu kapan yang utama kita dalam membaca Alquran? Mohon penjelasan. Dari Hamba Allah . Jawab : Terima Kasih atas pertanyaannya. Sesungguhnya semua hari dan waktu adalah baik untuk membaca Alquran. Hanya saja ada beberapa hari dan waktu yang lebih utama untuk membaca Alquran. Hari yang lebih disukai dalam membaca Alquran adalah: 1. Hari jum’at.yaitu semulia-mulia hari. 2.Hari kamis yaitu hari pembentangan amal dan disunatkan puasa. 3.Hari Senin yaitu hari pembentangan amal dan disunatkan puasa. Bagi seorang penghafal Alquran lebih utama bila ia memulai bacaan pada malam Jum’at dan mengkhatamkannya pada malam kamis. Menurut satu pendapat bahwa seutama-utama waktu membaca Alquran adalah dalam shalat dan dalam masjid. Dan seutama waktu membaca diluar shalat adalah diwaktu malam terutama bagian separuh terakhir dari malam. Jika siang hari maka yang paling utama adalah diwaktu subuh. Jika hari dalam tahun, maka yang paling utama adalah hari arafah dan hari pertama sampai hari kedelapan bulan Zulhijjah. Begitu juga hari-hari dalam bulan ramadhan teristimewa sepuluh terakhir dari bulan Ramadhan. Demikian keterangan dari Pengarang buku Tajwid Quran oleh Abdullah qori ibn haji Sholeh. Klantan 1972. halaman 146.Wallahu A’lam. Al-ustadz H. Ismail Hasyim. MA.

Kesalahan orang tua dalam hal pernikahan adalah ketika penetapan jumlah mahar. Penetapan jumlah mahar ditentukan oleh si calon mempelai wanita, tidak di tetapkan oleh ibu. sulullah saw. tiba-tiba ada seorang perempuan berdiri, lalu menyatakan “Ya Rasulullah, sesungguhnya ia (seorang perempuan) mengubahkan diri kepadamu, maka bagaimana pendapatmu tentangnya”, kemudian bangun (lagi) kedua kalinya, lalu mengatakan, “ya Rasulullah, sesungguhnya ia benar-benar menghibahkan diri kepadamu maka lihatlah bagaimana pendapatmu?”.Kemudian bangunlah ia untuk ketiga kalinya, lantas berujar, “ya Rasulullah, nikahkanlah saya dengannya”. Kemudian beliau bertanya, “ Apakah engkau mempunyai barang sebagai mahar?” Jawabnya, “belum”. maka sabda beliau, “pergilah mencari walaupun sekedar cincin yang terbuat dari besi,” maka dia pergi mencarinya. Kemudian datang lalu berkata (kepada beliau), “aku tidak mendapatkan apa-apa, walaupun sekedar cincin dari besi.” Sabda beliau selanjutnya , “Apakah kamu punya hafalan Alquran?“ Dia menjawab , saya hafal surah ini dan surah ini”, sabda beliau lagi, “ Pergilah, sungguh saya telah nikahkan kamu dengan mahar hafalan Quranmu.”. Dari Abu Said Al-Khudri bahwa Rasulullah SAW menikahi Aisyah dengan mahar alat-alat rumah tangga yang bernilai lima puluh dirham (HR Ibnu Majah). Rasululllah SAW pernah menikahkan anak-anak perempuannya dengan mahar yang murah, Fatimah dengan Ali dengan dengan baju perang, mahar juga diperboleh dibayar secara tunai diawal atau diakhirinya sesuai dengan persetujuan kedua belah pihak bahkan tetap halal bergaul dengan istrinya. Kisah sahabat dan Nabi Mu-hammad sudah cukup menjadi suatu alasan bahwa mahar sama sekali tidak diharuskan memiliki nilai yang tinggi dan juga harus berwujud sesuatu. Dari Aisayah bahwa Rasulullah SAW bersabda,” Sesungguhnya diantara tanda-tanda berkah perempuan adalah mudah dilamar, murah maharnya, dan murah rahimnya.” (HR Ahmad). Sebenarnya tidak ada larangan

untuk memberikan mahar tinggi kepada calon istri karena para sahabat dulunya juga pernah memberikanmahar berupa emas dan Rasulullah tidak pernah mempertentangkan hal itu. Seruan untuk menyegerakan suatu pernikahan adalah tidak main-main karena Rasulullah SAW bersabda “ Apabila datang (melamar) kepada kamu lelaki yang kamu ridhai akhlak dan (komitmennya kepada) agamanya, maka kawinkanlah ia (dengan putrimu).” Di dalam surat An-Nur: 32 Allah berfirman “dan kawinkanlah orang-orang yang sendirian diantara kamu, dan orang-orang yang layak (berkawin) dari hamba-hamba sahayamu laki-laki dan hambahamba sahayamu yang perempuan. Jika mereka miskin Allah akan menjadikan mereka mampu dengan karuniaNya..”. Maka tidak ada suatu alasan sedikitpun mahar yang jadi permasalahan dan yang menunda suatu pernikahan sama juga menentang Allah dan RasulNya. Permintaan jumlah mahar sebenarnya menjadi simpang siurnya siapa yang sebenarnya berhak untuk meminta mahar. Kesalahan orang tua hal pernikahan adalah ketika penetapan jumlah mahar. Penetapan jumlah mahar ditentukan oleh si calon mempelai wanita, tidak ditetapkan oleh ibu. Ibu saat sekarang ini lebih berperan aktif dalam menentukan jumlah mahar karena dianggap telah mengasuh dan membesarkan anaknya sehingga pantaslah mahar untuk sang anak dinilai dengan tinggi, padahal ibu tidak diperbolehkan ikut campur akan hal ini. Sang ayahlah yang berhak menentukan jumlah mahar, tetapi lebih baik suatu perbuatan adalah orang tua sama sekali tidak pernah ikut campur. Hambatan hingga batalnya suatu pernikahan karena meninggikan jumlah mahar telah merusak keyakinan kepada agama kita sendiri. Pernikahan adalah sunnah dan wajib bagi setiap yang sudah dianggap mampu untuk melaksanakannya.

WASPADA Jumat 20 Januari 2012

Shalat Khusu’ Gugurkan Dosa Menjaga shalat agar bisa khusu’ merupakan keharusan, semakin khusu’ shalat kita semakin baik dan insya Allah ibadah kita diterima-Nya, tidak sia-sia. Sebaliknya, shalat yang asal jadi, tidak benar ba-caan dan tata tertibnya bukannya mendapatkan pahala melainkan dosa. Dalam Al-Quran surat Al-Mu’minum (23) Allah SWT berfirman: ’’Sesungguhnya beruntunglah orang-orang yang beriman (yaitu) orang-orang yang khusu dalam shalatnya. Dan orang-orang yang menjauhkan diri dari perbuatan dan perkataan yang tiada berguna.’’ Shalat merupakan tiang agama sehingga tiang itu harus berdiri kokoh sehingga tidak mudah roboh. Kalau shalatnya sudah baik maka perbuatan dan kualitas orang itu pasti baik. Banyaknya kejahatan di muka bumi, termasuk perilaku korupsi disebabkan shalat mereka tidak khusu’. Itu pasti! Maka itu mari kita perhatikan shalat kita yang hanya lima menit dan lima kali sehari semalam. Sebab, waktunya tidak banyak dibandingkan waktu tersisa sehari 24 jam. Rasulullah di masa hidupnya penah menyuruh sahabat mengulang shalatnya sampai beberapa kali karena belum benar/terburu-buru. Maka perlulah kita lebih berhati-hati agar shalat yang kita lakukan sesuai dengan shalatnya Nabi SAW. Justru itu, mari kita terus belajar meningkatkan kualitas shalat kita agar lebih baik dari waktu ke waktu. Mencari kebahagiaan di dunia dan akhirat bisa dilakukan tanpa meninggalkan shalat. Siapa pun yang merindukan kebahagiaan hakiki, kesuksesan sejati, atau kemenangan dalam hidup ini maka selayaknya memperhatikan dan menjalankan shalat dengan khusyuk. Sebab, shalat mengajarkan kita banyak hal kebaikan, bahkan menggugurkan dosa sebagaimana sabda Rasulullah SAW (HR Bukhari), membuat kita tertib, sehat, dan dekat dengan Allah SWT Penguasa Langit - Bumi dan Isinya. (Abdullah Gymnastiar, Refleksi Manajemen Qolbu, 2003, MQ Publishing, Bandung).

Pendistribusian Infak Dalam Alquran Oleh Dr Achyar Zein, MAg Dosen Fakultas Tarbiyah IAIN Sumatera Utara


i dalam Alquran terdapat perintah agar infak didistribusikan di jalan Allah supaya mendapat nilai-nilai spritual seperti keampunan, berkah, rahmat, pahala dan kasih sayang. Sebaliknya, jika infak dilakukan tidak di jalan Allah maka nilai-nilai spritual yang telah disebutkan menjadi nihil sehingga tujuan yang berinfak mudah terpantau. Perintah berinfak “di jalan Allah” dirinci sedemikian rupa dalam Alquran agar pendistribusiannya tidak salah sasaran. Urgensi pendistribusian ini bertujuan untuk mengukuhkan ikatan ukhuwah antara yang memberi dan yang menerima baik ukhuwah senasab maupun ukhuwah sekemanusiaan. Pengaitan kata “di jalan Allah” dalam perintah infak yang terdapat dalam Q.S. al-Baqarah ayat 195 masih bersifat umum dan karenanya diperlukan rincian-rincian secara khusus. Rincian ini dijumpai dalam surat yang sama yaitu pada ayat 215 dan 273 yang memberikan gambaran secara tegas kepada siapa seharusnya infak didistribusikan. Kelompok-kelompok Penerima Infak Mekanisme pendistribusian infak dalam Alquran ditujukan kepada kelompok-kelompok tertentu supaya tujuan infak benar-benar mengena pada sasaran. Rincian yang dibuat oleh Alquran ini seharusnya diperhatikan dengan sungguh-sungguh karena kewajiban mentaati sasaran pendistribusian infak sama dengan mentaati perintah infak itu sendiri. Ku’an adalah termasuk salah satu syarat wajib dalam berinfak sama halnya syarat wajib pada ibadah lain. Dengan demikian rincian yang dibuat oleh Alquran sangat menentukan sah tidaknya infak yang dilakukan oleh sesorang. Adapun kelompok-kelompok yang telah dirincikan oleh Alquran adalah sebagai berikut : Pertama, orang tua (ibu dan ayah) adalah merupakan sasaran infaq sebagaimana disebutkan dalam Alquran karena mereka berperan besar dalam membawa kesuksesan anak-anaknya. Quraish Shihab mensinyalir dalam tafsir al-Mishbah bahwa termasuknya kedua orang tua dalam sasaran pendistribusian infak karena merekalah sebab wujud anak serta yang paling banyak jasanya. Kedua, kaum kerabat yang memiliki hubungan nasab dengan pemberi infaq karena langsung atau tidak langsung mereka juga turut berjasa. Selain itu, penunjukan ini tentu saja didasarkan kepada hikmah pemberian infakyaitu untuk merekat tali persaudaraan agar lebih kuat. Menurut Hamka dalam tafsir al-Azhar lebih baik mendahulukan kaum kerabat dari yang tidak kaum kerabat. Ketiga, anak-anak yatim karena mereka tidak memiliki kemampuan untuk berusaha. Dalam tataran ini infaq yang diberikan kepada anak yatim sebaiknya dikelola oleh orang-orang yang mampu karena anak yatim sendiri dianggap masih belum punya kemampuan untuk mengelola harta. Dalam Alquran disebutkan bahwa pengelolaan harta dapat diserahkan jika mereka telah dewasa. Keempat, orang miskin yang tidak punya kemampuan untuk memenuhi kebutuhan hidup. Mereka diklasifikasikan oleh Alquran kepada dua kelompok yaitu al-sail (kelompok suka mempublikasikan kemiskinannya) dan almahrum (kelompok yang menutupi kemiskinan mereka). Kelima, ibn sabil yaitu orang yang sedang dalam perjalanan baik karena tuntutan kehidupan seperti terkena bencana alam, perang dan lain-lain maupun karena menuntut ilmu pengetahuan. Di dalam kitabkitab fiqh disebutkan bahwa syarat perjalanan yang mereka lakukan bukan untuk berbuat maksiat. Keenam, orang fakir yang terikat di jalan Allah sehingga mereka tidak dapat berusaha. Mereka memiliki sifat menahan diri dari meminta-minta sehingga banyak orang menyangka mereka adalah orang kaya. Orang fakir seperti ini harus diprioritaskan daripada orang fakir yang pamer dengan kefakirannya. Enam kelompok yang disebutkan oleh Alquran ini adalah merupakan rincian dari perintah berinfak di jalan Allah. Melalui rincian ini dapat dipahami infak berkaitan dengan kehidupan manusia. Untuk menentukan bahwa mereka benar-benar berada pada kelompok ini maka

peran penguasa mutlak diperlukan. Perlu dipahami bahwa tujuan yang paling fundamental dari infak adalah perbaikan ekonomi umat. Sebaiknya pemerintah mendirikan sebuah lembaga supaya penerima infak dapat memberdayakan infak yang mereka terima karena infak yang dilakukan selama ini belum signifikan mendongkrak kemiskinan. Untuk merealisasikan tujuan di atas perlu peran aktif semua pihak yaitu pengelola, pemberi dan penerima supaya tujuan infak mudah direalisasikan sehingga angka-angka kemiskinan dapat didongkrak dengan mudah dan akhirnya penerima infaq dapat dilakukan secara bergiliran. Memperanak-tifkan penerima infak berarti telah meminimalisir jumlah penerima memaksimalkan jumlah pemberi. Idealnya, orangorang yang berstatus sebagai penerima infak diharapkan agar tahun berikutnya berstatus sebagai pemberi infak, karena itu infak seharusnya dapat dijadikan sebagai modal. Menyahuti fenomena di atas, perlu merekonstruksi ulang pelaksanaan infak supaya infak tidak lagi ditinjau hanya melalui fiqh yang berbicara pada tataran sah dan tidak sah tapi sudah seharusnya ditinjau melalui perspektif bisnis yaitu efektif atau tidak efektif. Apabila rekonstruksi ini disepakati maka dapat diyakini bahwa infak membawa perubahan besar dalam segala lini kehidupan. Rekonstruksi infak ini dapat dilakukan melalui perombakan prilaku-prilaku yang terjadi di masyarakat dan hal ini harus disahuti dengan kecerdasan bukan dengan kedunguan dan kefanatikan. Kemudian kondisi kemiskinan di masyarakat harus dipahami dengan baik dan benar karena sudah merupakan bahaya latent yang suatu saat dapat saja mengancam stabilitas. Menyahuti akan pentingnya rekonstruksi ini maka para ustaz dan muballigh harus mengambil peran aktif dengan mengalihkan tema ceramah dari lelucon yang tidak bermutu kepada kepentingan infak yang serius. Adapun hal-hal yang paling mendesak untuk direkonstruksi adalah sebagai berikut: Pertama, daripada memberangkatkan orang-orang miskin naik haji maka lebih baik dananya digunakan untuk meningkatkan perekonomian mereka sehingga diri dan keluarganya selamat dari kemiskinan. Apabila dana infaq dikelola dengan baik maka yang bersangkutan dapat menunaikan haji dengan uangnya sendiri karena Allah saja tidak mewajibkan haji bagi yang tidak mampu. Kedua, daripada mengumpul dana untuk membangun menara masjid yang manfaatnya tidak signifikan, maka lebih baik dana tersebut dijadikan modal untuk mengentaskan kemiskinan karena apalah artinya menara megah kalau masyarakat masih banyak yang lapar. Sedangkan mau tidaknya orang ke masjid lebih banyak dipengaruhi faktor iman bukan karena mendengar azan atau tidak. Ketiga, daripada memberikan infak secara merata maka lebih baik dibuat skala prioritas agar dapat lebih efektif. Maksudnya, jika infak berjumlah Rp. 500.000.000,- (lima ratus juta rupiah) sementara yang menerimanya sebanyak seribu orang maka masingmasing mendapatkan lima ratus ribu rupiah yang sama sekali tidak cukup untuk dijadikan modal. Keempat, sebaiknya infak dikoordinir oleh sebuah lembaga yang dapat dipercaya oleh semua pihak agar infak tidak tumpang tindih. Pengelola lembaga ini haruslah orang-orang yang cerdas dan memiliki naluri bisnis bukan diisi oleh orangorang yang hanya bisa menentukan hukum halal dan haram. Penutup Sasaran pendistribusian infak yang disebutkan dalam Alquran adalah kelompok-kelompok yang notabenenya berekonomi lemah. Harapan dari rincian adalah agar infak dapat dijadikan modal. Oleh karena itu, pendistribusian infak harus ditinjau dari berbagai aspek agar dapat berdaya guna dan berhasil guna.

Sebaiknya pemerintah mendirikan sebuah lembaga supaya penerima infak dapat memberdayakan infak yang mereka terima.

Mimbar Jumat

WASPADA Jumat 20 Januari 2012

7 Hal Dimurkai Allah Jangan sesekali menyekutukan Allah SWT dalam hidup dan kehidupan kita. Artinya, hanya Allah yang patut disembah, tempat meminta dan segalanya. Jangan pernah percaya pada dukun, batu cincin dan lain-lain. Hal lain yang juga perlu diantisipasi adalah jangan pernah punya niat melakukan bunuh diri, sebab bunuh diri itu sangan dimurkai Allah SWT. Apalagi memakan harta anak yatim. Sepatutnya anak yatim itu yang kita bantu, bukan malah kita memanfaatkan anak yatim untuk kepentingan pribadi. Juga jangan pernah berpaling bila sudah waktunya melakukan jihad fisabilillah, jangan pernah mundur jika sudah berada di barisan depan perang melawan kemunkaran. Dalam hadits diriwayatkan AlBukhari dan Muslim, dari Abu Hurairah r.a, dari junjungan kita Nabi Muhammad SAW, sabdanya: ’’Jauhlah kamu dari tujuh perkara yang dimurkai dan dibenci Allah yang kelak membinasakanmu’’. Para sahabat bertanya: ’’Apa-apa saja ketujuh hal itu ya Rasulullah?’’. Sabda Nabi SAW: 1. Menyekutukan Allah SWT, 2. Sihir, 3. Bunuh diri, 4. Makan riba, 5. Makan harta anak yatim, 6. Berpaling (lari) dari jihad fisabilillah (peperangan), 7. menuduh perempuan baik-baik melakukan zina.’’ Oleh karena itu ketujuh hal yang dimurkai Allah SWT itu harus kita camkan dengan sebaik-baiknya dalam kehidupan sehari-hari. Jangan sampai kita termasuk di dalamnya, walaupun hanya satu dari tujuh hal yang dimurkai-Nya itu, semoga kita menjadi hamba yang beruntung di dunia dan akhirat. (Al-Ustaz Al-Haji Abdul Halim Al-Hadi, Tajzibu Athraf AL-HADITH, penerbit AlHidayah Publishers, 2006, Kuala Lumpur)

Zikir Komando, Zikir Hafalan Dan Zikir Cetusan Hati Oleh dr Arifin S.Siregar Dokter Spesialis Penyakit Kulit Dan Kelamin


erzikir bertujuan menyebut bentuk-bentuk lafaz atau ungkapan yang sudah diajarkan Nabi SAW dan seraya mengingat, menyadari, membayangkan kebesaran Allah SWT, kekuasaan dan kemampuan Allah SWT, dan sebagainya. Ada perintah Allah SWT melalui Rasul-Nya supaya kita ini banyak melakukan zikir. Namun Allah SWT memberi pedoman berzikir. Pedoman ini ada pada QS Al A’raaf 205 yang artinya: “Ingatlah (berzikirlah) pada Tuhanmu didalam hatimu dengan tidak bersuara keras, dipagi dan petang, sesungguhnya Allah tidak menyukai orang yang menyombongkan diri”. “Mengingat, menyadari, membayangkan” Allah SWT itu, diantaranya dengan cara menyebut ungkapan-ungkapan tertentu yang sudah ditetapkan Allah SW T dan Rasul-Nya Muhammad SAW. Misalnya khusus ketika selesai shalat fardhu sesudah salam dengan menyebut kata: “Astagfirullah”, dilajutkan dengan me-nyebu t “Sub ha n a llah” 33 kali, “Alhamdulillah” 33 kali, “Allahu Akbar” 33 kali dan diakhiri dengan m e n y e b u t “Lailahaillallah” dan seterusnya 1 kali (H.R Muslim). Ungkapan ini jangan dirobah jangan ditambah agar jangan terjebak pada bid’ah (sesat). misalnya menambah kata penyambung (jembatan) antara ungkapan “Subhanallah” dengan ungkapan “Alhamdulillah” atau antara ungkapan “Alhamdulillah” dengan “Allahu Akbar”. Banyak lagi ungkapan-ungkapan lain untuk berzikir (mengingat) Allah SWT. Yang menjadi pengkajian pada tulisan ini adalah bagaimana mewujudkan tuntunan QS Al-A’raaf 205 diatas ketika berzikir. Untuk itu dimasyarakat per wujutannya bermacam-macam: Dan cara perwujutan mengucapkan zikir itu, maka dapat disebut : Pertama : ber-zikir dengan cara komando. Cara ini dimana seorang ustadz, ulama, Kyai, Syekh terlebih dahulu melantunkan ungkapanungkapan zikir dengan suara jahar sehingga dapat didengar dan ditiru dan diikuti oleh jamaah untuk melantunkannya pula serentak, beramai-ramai dengan suara keras/jahar. Jadi para jemaah mengucapkannya adalah atas bimbingan apa yang diperdengarkan. Bukan atas bimbingan hati nuraninya. Kedua: ber-zikir secara rutin. Cara ini si jamaah mengucap ungkapan zikir adalah atas bimbingan hafalannya bukan atas cetusan hatinya. Misalnya dia hafal zikir atau sebuah do’a yang didalamnya ada ungkapan zikir, apa lagi yang ia tidak mengerti apa arti ungkapan zikir itu hanya menghafal kata, misalnya dia sebut “subhanallah” ia tak mengerti apa arti “subhanallah”, atau ia sebut zikir: “Subhana robbika” yang ditujukannya pada Allah SWT yang ia tidak mengerti arti “subhana robbika” yang berakibat menyekutukan Allah SWT, karena artinya: “Maha suci Tuhanmu”, yang berarti ia menuduh Allah itu bertuhan yang sifatnya suci. Atau mengerti artinya, tapi masih tega mengucapkan “subhana Robbika” mengahadapkan untuk Allah SWT karena didorong oleh taqlid (fanatik buta) pada ulamanya yang mengajarkannya. Ketiga: berzikir dengan cetusan hati. Cara ini dimana seseorang menyebut zikir atas cetusan isi hatinya atau bimbingan hati nuraninya. Semua ungkapan zikir yang disebutnya dia mengerti,

dihayati, diresapi (ditasydikkan) dalam hati. Zikir oleh cetusan hati akan mengakibatkan (tercermin) pada wajahnya yaitu kalau pancaran mukanya sedih itu karena penyesalan yang timbul pada dirinya akibat kesalahan yang dibuatnya selama ini, kalau mukanya geram karena merasa kecewa pada apa yang dilihatnya dimasyarakat yang penuh dengan kebatilan, kalau air matanya keluar itu adalah akibat sentuhan pada hatinya oleh ungkapan zikir yang memohon atau minta ampun pada Allah atas dirinya yang hina. Bila disebutnya “Allahu akbar”, maka ungkapan ini menjadi sentuhan pada hatinya atas kebesaran Allah atau atas ciptaan yang kita nikmati melalui apa yang kita lihat. Bila disebutnya “subahanallah”, keluar air matanya karena sentuhan atas kesucian Allah SWT. Atau bila seseorang mengingat kesalahannya, maka ia menyebut “astagfirullah”. Bila iamenerima pujian maka disebutnya: “Alhamdulillah”. Jadi buk a n m e n ye b u t “a s t a g f i r u l lah” atau “Alhamdulillah” karena ajakan si imam atau ustad yang memimpin zikir atau hanya atas hafalan rutinisme. Kalaupun terjadi seperti yang kita lihat langsung atau melalui TV, jemaah menangis setelah melantunkan zikir yang dibimbing ustad, Kyai, Syekh, itu terjadi atas sentuhan karena dilihatnya/ didengarnya ustadnya menangis dengan suara yang sendu dan terisak-isak, maka ia pun turut menangis. Jadi bukan terjadi atas sentuhan hati nuraninya. Buktinya : apa zikir yang diucapkannya hasil dari bimbingan ustad yang didengarnya, dimana ia sendiri tidak mengerti artinya. Dalil untuk kewajiban mengetahui apa arti yang dibaca apakah itu Alquran, shalat, do’a dan zikir yaitu tertuang pada QS An-Nisa’ 43, Allah berfirman: “Wahai segala mereka yang beriman! Janganlah kamu mengerjakan shalat sedang kamu dalam keadaan mabuk sehingga kamu mengetahui apa yang kamu baca (ucapkan)”. Zikir Bersuara Keras: Ketidak bolehan membaca zikir bersuara keras ada diutarakan oleh Rasullah SAW dimana seorang sedang shalat, maka seorang membaca Alquran disampingnya dengan suara terdengar oleh yang shalat maka untuk ini Nabi SAW memberi peringatan bahwa haram hukumnya perbuatan orang membaca Alquran itu, karena Nabi mengatakan mengganggu orang yang sedang bermunajat kepada Allah SWT. Kemudian berzikir berjamaah dengan suara keras berkumpul ramai-ramai tidak ada Sunnahnya. (H.R Abu Daud, Al-Hakim, Malik dikutip dari kitab “DZIKIR JAMA’I oleh: Dr. Muhammad Bin Aburrahman Al-Khumais, hal : 165-166). Imam Syafii dengan tegas menolak zikir dengan suara keras berjemaah dimana hal ini diterangkan oleh Imam An Nawawy dalam kitabnya Al-Majmu’ 3 : 478. Begitu juga Imam Ali Mahfudh dalam kitabnya Al-Ibda : 272-273 megatakan Nabi SAW tidak pernah duduk bersama membaca do’a dan zikir sesudah shalat dengan suara jahar (Demikian diterangkan oleh Prof.Dr. T.M Hasbi Ash Shiddiqq dalam kitabnya: “Pedoman Shalat” hal. 368-369). Para Imam Mazhab tidak membenarkan adanya zikir, tasbih dan taktim dengan satu lantunan dengan suara jahar (dituturkan pada kitab: Dzikir Jama’i oleh: Dr. Muhammad Bin Abdurrahman, Al-Khumais). Sesungguhnya shalat sunat, baca Alquran, zikir, berdoa’ yang disukai Allah SWT adalah dimalam hari atau 1/3 malam.

Zikir oleh cetusan hati akan mengakibatkan (tercermin) pada wajahnya yaitu kalau pancaran mukanya sedih itu karena penyesalan yang timbul pada dirinya akibat kesalahan yang dibuatnya selama ini.


Melacak Corak Keislaman Mohammad Said (2) Oleh Azhari Akmal Tarigan Dosen Fak. Syari’ah IAIN.SU dan Koordinator Tim Penulis Tafsir Al-Qur’an Karya Ulama Tiga Serangkai.


alam otobiografinya Said juga menunjukkan ketidaksukaannya terhadap model penghambaan rakyat kepada sultan atau raja. Sikap menundukkan badan pada saat menghadap raja ditolaknya dengan keras. Sikap ini tentunya lahir dari pemahaman tauhid yang utuh. Tauhid yang tersimpul dalam kalimat, La Ilaha illa Allah, bermakna tidak ada yang pantas dan layak disembah, ditakuti, dan puja melainkan Allah SWT. Di dalam kalimat tersebut ada yang disebut alnafyu (negasi) yaitu kalimat “La Ilaha” dan al-istbat (afirmasi -penegasan) seperti terungkat dalam frasa “illa Allah.” Paham tauhid melahirkan sikap egalitarianisme atau almusawah (persamaan) manusia. Di samping itu, Said juga sepertinya diinspirasi oleh hadis Nabi yang menyatakan bahwasanya, Allah SWT tidak melihat kepada wajah, bentuk tubuh dan apa yang dikenakan manusia di tubuhnya. Allah hanya melihat kepada hati kita dan apa yang kita lakukan. Lewat hadis ini jelaslah bahwa yang membuat kita terhormat dan mulia di sisi Allah sesungguhnya bukanlah halhal yang bersifat primordial dan aksidental belaka, seperti keturunan, harta dan pangkat. Sebaliknya seseorang itu mulia karena prestasi, integritas moral atau amal nyata. Satu hal yang tidak kalah menariknya adalah, Said sangat membenci apa yang disebutnya sebagai “sukuisme”. Ia menyadari “sukuisme” ini ternyata masih dianut oleh sebagian besar rakyat ini. Ada kesan Said marah ketika ia dipecat dari “Oetoesan Sumatra” hanya karena ia tidak satu suku dengan pimpinannya kala itu. Pada hal telah banyak perubahan yang ia lakukan sehingga “Oetoesan Sumatra” bisa tampil lebih baik dari sebelumnya. Said menantang, periksalah “Oetoesan Sumatra” di koleksi Perpustakaan Nasional Pusat di Jakarta dan perhatikan koran tersebut pada saat Said menjabat sebagai Redaksi I. Sejak muda, Said sudah dipengaruhi pemikiran-pemikiran yang bernuansa humanisme. Said kagum pada Mohammad Samin yang dalam pidatonya selalu mengkiritik kezaliman dan penindasan Belanda terhadap kuli-kuli kontrak. Dari sini

bisa dipahami, mengapa akhirnya Said menulis buku yang cukup bagus berkaitan dengan Kuli Kontrak. Membaca otobiografinya secara utuh, kita akan menangkap keresahan yang dialami Said. Ia menyaksikan suasana kehidupan kala itu yang sangat bertolak belakang dengan nilai-nilai kemanusiaan. Penindasan ternyata tidak hanya dilakukan oleh penjajah, tetapi oleh bangsa sendiri. akhirnya, yang menjadi korban adalah orang-orang lemah (dhu’afa dan mustad’afin). Said memilih menjadi pengacara sebagai salah satu alat perjuangan setelah dipecat dari beberapa

Walaupun sebagai ketua umum PNI dengan kesibukan yang luar biasa, perhatian Said terhadap Islam tetap saja besar. Bahkan di dalam Otobiografinya tersebut, Seminar Mengenai Masuknya agama Islam ke Indonesia itu adalah inisiatif Said yang mendapat dukungan dari berbagai kalangan, apakah pejabat, ilmuwan dan masyarakat sendiri. Said kala itu menjadi ketua umum panitia sekaligus sebagai pemrasaran. Sebagai seorang yang meminati sejarah, Said sudah duduk sejajar dengan Hamka, Drs.M.D Mansor, Dr Tujimah dan ilmuan lainnya. Ada yang menarik dari otobio-

Islam bagi Muhammad Said memiliki spirit pembebasan. Terutama pembebasan terhadap orang-orang miskin, lemah, tertindas dan terjajah. terbitan surat kabar. Ia menuliskan, “Dapat dicatat bahwa setelah keluar dari “Oetoesan Sumatra”, untuk beberapa tahun saya membuka peraktek kantor pengaca tanpa diploma (zaakwaarnemer), tapi dapat saya jelaskan bahwa umumnya golongan masyarakat yang saya bantu adalah mereka yang dirugikan oleh golongan haves, terutama dalam menghadapi renteniran yang cukup manja berpraktek dewasa itu di Sumatera Utara”. Informasi ini cukup untuk menjelaskan betapa kuatnya pembelaan Said terhadap orang lemah baik secara politik ataupun ekonomi. Demikianlah, Said dengan satu dan lain alasan telah didaulat tokohtokoh PNI untuk memimpin PNI Sumatera Utara. Tentu saja Said dipilih karena prestasi dan arah perjuangannya yang jelas dalam membela rakyat kecil. Dalam profesi kewartawanannya ataupun posisinya sebagai “pengacara tanpa diploma,” komitmennya membela rakyat kecil tidak diragukan lagi. Ia konsisten untuk membebaskan umat ini dari ketertindasannya. Said bercita-cita membebaskan umat ini dari belenggu yang membuat mereka tidak bisa bangkit di negaranya sendiri.

grafinya, ketika Said berbicara tentang PNI. Ia menuliskan tentang kejatuhannya dari kursi ketua karena di dongkel oleh “saingan politiknya” sewaktu konprensi di Sibolga. Said menginginkan PNI dan Masyumi kala itu “bisa bersama” dalam perjuangannya, karena keduanya memiliki suara mayoritas. Semangat ini telah berhembus dari pusat. Sayangnya, semuanya menjadi hambar, kata Said, karena PNI menjadi condong ke kiri. Hal ini disebabkan karena penampilan tokoh yang disebut Said sebagai ultra revolusioner. Dugaan penulis sebab kejatuhan Said – perlu dibuktikan lewat penelitian seriuskarena ia tetap istiqamah dengan nilai-nilai keislamannya dan mungkin bagi sebagian tokoh PNI kurang dapat diterima. Sebagai kesimpulan awal yang perlu dikaji lebih lanjut, setidaknya ada tiga titik dari babakan sejarah hidup Said yang mencerminkan keislamannya. Pertama, proses pendidikan dari ayahnya yang telah berhasil menampilkan Islam dalam warna yang lain. Said muda juga memiliki pergaulan yang luas dengan tokoh-tokoh Islam kala itu seperti Abdul Malik. Kedua, kekagumannya pada

Sarekat Islam dan tokohnya. Sampai di sini perlu dipisahkan, kekaguman Said sebenarnya hanya pada tokohnya yang telah disebut di muka, bukan pada idiologi partainya. Jika Said kagum dan tertarik pada Sarekat Islam, tentulah Said memilih SI sebagai media politiknya. Ketiga, profesinya sebagai wartawan dan pengacara tanpa diploma, yang semuanya diarahkan untuk membela orang kecil dan tertindas. Sampai di sini, penulis ingin mengemukakan, Islam bagi Muhammad Said memiliki spirit pembebasan. Terutama pembebasan terhadap orang-orang miskin, lemah, tertindas dan terjajah. Islam sejatinya harus mampu membebaskan mereka dari belenggu tersebut. Islam harus mampu membuat mereka bangkit dan tegak di atas kakinya sendiri. Tulisan ini sepenuhnya bersumber dari Otobiografi H. Muhammad Said yang berjudul” Dengan Modal Otodidak Mengembang Masyarakat”. Banyak informasi yang penting dari otobiografi yang belum dipublikasikan ini. Syukurlah, keluarga H. Muhammad Said masih menyimpannya dengan baik. Hal yang menarik bagi saya adalah, ternyata buku dan artikel yang ditulis Moh. Said lebih banyak dari apa yang pernah saya ketahui selama ini. Moh. Said selalu menuliskan apa yang ia rasa dan lakukan. Termasuk perjalanan-perjalanan yang pernah dilakukannya bersama bunda H. Ani Idrus. Melacak Keislaman H. Moh Said ini seperti yang penulis ungkap di artikel ini belumlah lengkap. Tampaknya akumulasi keislaman Moh. Said tersimpul ketika ia melaksanakan ibadah haji atas undangan pemerintah Arab Saudi bersama Presiden Soekarno. Saya tidak tahu, apakah Moh. Said menuliskan refleksi perjalanan spiritualnya kala itu. Tapi saya percaya, Said menuliskannya semua. Dibagian akhir otobiografinya, ia mengatakan, “Semua kesan-kesan ke luar negeri itu kutulis bersambung dalam Waspada, baik mengenai kemajuan dengan maju maupun mengenai serba sedikit kelemahannya dalam politik.” Jelas, perjalan Moh. Said bukanlah perjalanan biasa, melainkan perjalanan reflektif. Mudahmudahan tulisan itu bisa ditemukan. Amin. Wallahu a’lam bi al-shawab.

Karakteristik Umat Nabi Muhammad SAW Oleh Rahmat Hidayat, MA Dosen UNIVA Medan, Mahasiswa Program Doktor Prodi Pendidikan Islam UIN Sunan Gunung Djati Bandung.


llah berfirman dalam Alquran: “Muhammad itu utusan Allah dan orang-orang yang bersama dengan dia adalah keras terhadap orangorang kafir, tetapi berkasih sayang sesama mereka. Kamu lihat mereka rukuk dan sujud mencari karunia Allah dan keridhaanNya. Tanda-tanda mereka tampak pada muka mereka dari bekas sujud. Demikianlah sifatsifat mereka dalam Taurat dan sifat-sifat mereka dalam Injil, yaitu seperti tanaman yang mengeluarkan tunasnya maka tunas itu menjadikan tanaman itu kuat lalu menjadi besarlah dia dan tegak lurus di atas pokoknya. Tanaman itu menyenangkan hati penanam-penanamnya karena Allah hendak menjengkelkan hati orang-orang kafir (dengan kekuatan orang-orang mukmin). Allah menjanjikan kepada orang-orang yang beriman dan mengerjakan amal saleh diantara mereka ampunan dan pahala yang besar”. (QS. Al-Fath: 29). Mengkaji karakteristik umat Muhammad SAW menurut ayat diatas. Allah menginformasikan setidaknya terdapat lima ciri yakni: Pertama; Bersikap Keras kepada orang kafir. Sikap keras yang dimaksud bukan berarti kita tidak boleh saling menghormati, lalu malah saling membunuh, sama sekali tidak. Seorang muslim tetap harus menghormati penganut agama lain selama mereka bisa menghormati kaum muslimin. Akan tetapi, bila mereka bersikap tidak hormat, maka kaum muslimin harus menunjukkan sikap kerasnya. Sebagaimana yang difirmankan Allah dalam Surat Al Kafirun ayat 1-6 yang berbunyi: Katakanlah: “Hai orang-orang kafir, Aku tidak akan menyembah apa yang kamu sembah, Dan kamu bukan penyembah Tuhan yang Aku sembah, Dan Aku tidak pernah menjadi penyembah apa yang kamu sembah, Dan kamu tidak pernah (pula) menjadi penyembah Tuhan yang Aku sembah; Untukmu agamamu, dan untukkulah, agamaku.”

Allah SW T melarang kita bersifat lemah dan selalu berdamai dengan orang kafir (QS Muhammad: 35). Kedua, Berkasih sayang kepada sesama muslim. yaitu

sujud kepada Allah Swt. Mereka rukuk dan sujud (shalat) mencari karunia Allah dan keridaan-Nya. Pelaksanaan ibadah dilandasi oleh rasa keikhlasan, ikhlas adalah ruh setiap ibadah dalam

Sujud yang membekas bukanlah semata-mata kening yang menjadi hitam, tetapi yang pokok adalah ketundukan kepada Allah dan RasulNya serta selalu berusaha memperbaiki diri, keluarga, dan masyarakatnya agar tunduk kepada Allah Swt. kasih sayang dalam persaudaraan yang dilandasi oleh ikatan iman yang hak, yaitu iman kepada seluruh rukun iman. Karakter ini juga dijelaskan Allah SWT; “Sesungguhnya orang-orang mukmin itu bersaudara, karena itu damaikanlah kedua saudaramu (yang berselisih), dan bertakwalah kepada Allah agar kamu mendapatkan rahmat.” (QS alHujurat: 10). Sifat tolong- menolong diantara sesama muslim harus diwujudkan sebagaimana perumpamaan yang disebutkan Rasul saw. dalam satu hadisnya: “Perumpamaan seorang mukmin dalam berkasih sayang adalah laksana sebatang tubuh yang apabila salah satu anggota mengaduh karena kesakitan, maka terasa panaslah keseluruh tubuh dan berjaga-jagalah semuanya tidak mau tidur” (HR. Muslim). Kalau kemudian ukhuwah Islamiyah terasa sulit diwujudkan dan kaum muslimin tidak saling menyayangi, bahkan saling bermusuhan, itu bukan karena ajaran Islam tidak bisa dilaksanakan, tetapi karena keimanan yang belum mantap dihati kaum muslimin. Hal ini karena ukhuwah Islamiyah itu memang hanya bisa diwujudkan oleh siapa saja yang memiliki kemantapan iman. Ketiga, Selalu rukuk dan

Islam, tanpa keikhlasan maka segala amal ibadah akan menjadi sia-sia. Imam Nawawi menjelaskan dengan baik, tiga bentuk ibadah yang masih bernilai ikhlas, yaitu ibadah yang dikerjakan dengan niat takut kepada siksa Allah SWT, mengharap pahala dari Allah SWT, dan yang utama adalah berniat untuk mensyukuri nikmat yang telah dianugrahkan Allah SWT. Syekh Mustafa Masyhur dalam bukunya Al-Hayyatu fi Mihraabi ash-shalih menyatakan, “Nabi Saw. ketika menghadapi persoalan genting, beliau berlindung melalui shalat. Rukuk dan sujud dalam shalatnya dilakukan secara khusyu’ yang membawa rasa dekat kepada Allah. Dan, bersama Allah pula beliau merasa berada dalam keadaan di suatu tempat sandaran yang kokoh sehingga merasakan amat tentram, percaya diri, dan penuh keyakinan serta perasaan damai, sabar terhadap segala bentuk ujian dan cobaan serta rela terhadap takdir Allah swt. Keempat, Selalu mencari ridha Allah Swt. Karena ridha Allah yang dicari, maka segala yang dilakukan disesuaikan dengan yang dikehendaki oleh Allah Swt. Ini merupakan perwujudan dari rasa syukur kepada Allah atas segala nikmat yang diperoleh dan dirasakan.

Dan yang kelima, Memperlihatkan bekas yang positif dari ibadah yang dilakukan dalam kehidupan sehari-hari. Hal ini karena ibadah dalam Islam bukanlah sesuatu yang dilakukan sekedar formalitas saja guna menggugurkan kewajiban, melainkan ibadah itu harus meningkatkan keimanan, kesucian hati dan ketakwaan kepada Allah Swt. Sujud yang membekas bukanlah semata-mata kening yang menjadi hitam, tetapi yang pokok adalah ketundukan kepada Allah dan RasulNya serta selalu berusaha memperbaiki diri, keluarga, dan masyarakatnya agar tunduk kepada Allah Swt. Dengan demikian, bekas yang positif dari ibadah Nabi Muhammad saw adalah dekat kepada Allah dan mempunyai perhatian kepada sesama. Buah dari shalat adalah lahirnya akhlak mulia, yaitu kemampuan menghindarkan diri dari perbuatan keji dan munkar dan mampu berinteraksi dengan baik dengan sesama manusia. Karena itu, maka umat Muhammad SAW tidak cukup hanya memiliki keimanan yang kuat, rasa kasih sayang sesama Muslim dan ketekunan beribadah kepada Allah SWT semata. Umat Muhammad SAW mesti tampil dan berkarakter akhlak mulia, mulia lisannya, mulia pikirannya, mulia hatinya, dan mulia perilaku hidupnya sehari-hari, sebagai buah dari keimanan dan ibadahnya kepada Allah SWT. Ketika karakter akhlak mulia telah menjadi panglima, maka kesuksesan dan kebahagiaan hidup menanti kita, dan Muhammad SAW telah membuktikannya. Semoga kita semua selau dalam lindungan Allah Swt dan dapat menjadi Ummat nabi Muhammad yang selalu menjaga hubungan baik kepada Allah dan menjaga hubungan baik dengan sesama manusia, serta kita selalu berusaha menjadi ummat nabi Muhammad yang mepunyai 5 karakteristik sebagaimana di atas. Amin.. amin ya robbal alamin.


Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Ar-Ridho Jl. A.R. Hakim Gg. Sepakat No. 6 Al-Chairat Jl. A.R Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al.-Makmur Jl. A.R. Hakim Gg. Langgar/Bahagia No. 25 Al-Manar Jl. Laksana No. 47 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Al-Utaminiyah Jl. Utama Gg. H. Syukur No. 1 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jami’ Darul Ikhlas Jl. Batu No. 13 Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. B-A T.S. III Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Dr. Sun Yat Sen No. 71 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl.Denai Gg. Pinang No. 12 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gang I No. 2 Silaturrahim Jl. Emas No. 10 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Gromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Jl. Puri Komplek Masjid Taqwa No. 183 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Muhammad Yahya Drs. H. Nurman Almi H. Arif Muhammad Erde, Lc H. Darwin Zainuddin, Lc, MA Mustamam Batubara Amrizal Azis, S.Pd.I Drs. Syahrum Purba Ali Zuheri Lubis, S.Ag Mahmuddin Nasution, MA H. Yusrizal Yahya Drs. Syafruddin Sinaga Drs. Ade Mustahdi M. Siddiq, S.HI Ir. Abd. Halim Drs. H. Azwardin Nasution Drs. H. Hasan Basri, Lc Drs. H. Bahrum Saleh Hsb., MA Drs. H. Hamid Mashudi Hajar Drs. H. Muslim Wahid Siregar Drs. H. Sunaryo Drs. H. Saleh Umar Drs. H. Hamdan Yazid Khoiruz Zaman, S.HI, S.Pd.I Drs. Asroruddin Saidi Sagala Drs. H. Lukman Hakim, M.Pd Abd. Razak Hasibuan, S.Ag H. Halomoan Lubis, Lc H. Ismail Malik Khairul Saleh Burhanuddin Siagian, MA Husni Mubarak, S.Pd.I Drs. H. Ibnu Hajar Harahap Prof. Dr. A.Yakub Matondang, MA H. Baharudin Isa

MEDAN AMPLAS Al-HidayahMapolda Sumut Jl.S.M. Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I Kel. Harjosari II Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ridho Shobirin Jl. Garu IV Harjosari I Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VIKel. Harjosari I Shilaturrahim Jl. Garu III No. II-G Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II Taqwa Jl. S.M. Raja Km. 5,5 No. 1 Kel. Harjosari-I Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1-B

Prof. Dr. H. NawirYuslem, MA Baharuddin, S.Ag Jalaluddin Sitorus, BA Drs. Jainal Aripingunawan, M., MA Drs. Samsul Anwar Nasution Drs. Isa Anshari, S.Pd.I Kamaruddin Tasik Ishaq Ahmad, S.Ag Harun Ar-Rasyid, Lc M. Tholib Harahap, S.Ag, MA Imam Yazid, S.HI, MA Drs. M. Idris Hasibuan, MA Drs. Razali Umar Batubara Rusli Effendi, S.Pd.I Drs. Ramli, AT Drs. H.A. Mu’in Isma Nst. Drs. H. Arifin Umar M. Yunus Daulay, S.Ag Ir. H. Erwandi Us., M.M.

MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Iklab Jl. Letjend. Jamin Ginting Km. 1,27 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede 42 Nurul Huda Jl. K.H.Wahid Hasyim Asrama Brimob

H. Marajaksa Harahap, S.Ag Drs. H. Syamsuddin Hasan Fauzan, S.Ag Irfan Irawan, S.S. Drs. H. Qamaruddin, S. Dahler Effendi, S.Ag H. Khairul Hamdi, Lc Drs. H. Mukhtar Baijuri Drs. Lisman Lubis

MEDAN BARAT At-Taqwa Jl. Putri Hijau No. 14 Asy-Syafiah Jl. Karya Dalam (Depan kantor Lurah) Al-Furqan Jl. Karya 2 Lingk. XI Kel. Berombak Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Massawa (Arab) Jl. Temenggung No. 2-4-6 Al-Wiraji Jl. Karya Gg. Sosro Lingk. XVI Kel. Karang B. Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Muslimin Jl. Karya Lingk.XVII No.41 Karang Berombak Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Syuhada Komplek Trikora Jl. Danau Toba No. 2 Taqwa Jl. Karya Gg. Madrasah No. 24

Drs. Azrai Nasution H. Hasan M. Matondang Rasoki Batubara Drs. H. Hasan Ritonga, M.Ag DR. Arifinsyah, MA Drs. M. Ja’far Shiddiq Burhanuddin Al Hakim S., MA Slamat Riadi, S.HI Drs. H.M. Ridwan M. Khairil, S.Ag Drs. Abdul Khalik, SH DR. H. RamlanY. Rangkuty, MA Drs. Edi Syahputra Siregar Drs. Abd. Kadir Jaelani

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan

Drs. M. Yiusuf, AG

MEDAN DELI Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Iklas Jl. Alumunium II Lingk. XII Tg. Mulia Al-Jihad Jl. Mangaan I/Jl. Bahagia Raya Lingk. VI Al-Munawwarah Jl. Pulau Batam No. 1 Jam’iyyatush Shoolihin Kel. Tg. Mulia Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia

Drs. Syafaruddin Sarman Drs. Hakimuddin Abdul Kadi Hasibuan Drs. H. As’ad Marlan, M.Ag Drs. Zulparman Lubis, MA Drs.. Yusuf As’ady Drs. Musdar Sa’ban K.H. Mohd. Syukur Nurhadi

MEDAN DENAI Amal Bakti Jl.Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala Al-Amanah Jl. A.R. Hakim Gg. Aman No. 90 Kel. TSM. Al-Ansor Jl. Raya Medan Tenggara Gg. Anshor No. 11 Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Al-Hasanah Perumnas Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Quba Jl. Rawa Kel. Tegalsari Mandala II Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Hijraturridha Jl. Selamat Ujung Gg. Subrak Sp. Limun Nurul Islam Jl. M. Nawi Harahap Nurul Iman Jl. Rawa I Lorong Sedar Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Taqwa Jl. Jermal III No. 10

Drs. H. Muri Damri Hasan Effendi Lubis, S.Ag Drs. Pantis Simamora Drs.H. Anwar Noor Siregar DR. H. Zulheddi, MA Irham Taufik, S.Pd.I Hasan Basri Siregar, S.Pd.I Drs. H. A. Rahman Syamsuddin M. Fadil Drs. Ahmad Suhaemi, MA Drs. H. Darwansyah Simanjuntak Drs. Umar Rifai Hasibuan H.M. Silahuddin, S.Pd.I Drs. H. Naziruddin Idris, Lc H. Baharuddin Nasution, Lc Drs. H. Abdul Djalilsyah, Lc Drs. H.M. Taufik, SH, MM Drs. Syaifuddin Daulay

MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia Zulkifli Rangkuti, S.Ag An-Nur Jl. Budi Luhur No. 75-A Drs. H. Ismail Mukhtar Ar-Raudhah Jl. Persatuan No. 22-AR Helvetia Timur Rajudin Sagala, S.Kom As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Drs. Faisal Lubis Al-Falah Jl. Palem Raya Perumnas Helvetia M. Bahrein AR, S.Pd.I Al-Huda Jl. Balai Desa/Beringin V No. 116 Kel. Helvetia Drs. Eldin H. Zainal, MA Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Tumirin, S.Pd. Al-Hasanah Jl. Setia No. 41 Tg. Gusta Drs. H. Adlan Rifai, S. Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Drs. Khalid Khair Harahap Al-Ikhas Jl. Teratai II Blok 18 Perumnas Helvetia Drs. M. Rais MPd, M.SI Al-Ikhlas Jl. Jongkong Komplek Dolok Sumut Drs. Syahrinal Azhar Lubis Al-Ikhlas Jl. Setia Luhur No. 180 Lingk. XI Dwikora Amrizal, S.Ag Al-Mukhlisin Jl. Bakti Utara No. 21 Lingk. VI Kel. T.Gusta Thamrin Butar-butar, S.Ag Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Drs. Idris Ginting Al-Masturah Jl. Binjai Km. 7,8/Jl.Sekolah No. 29 H. Sarwo Edy, S.Ag Darussalam Jl. Asrama No. 11 Drs. Asman Ali Nur Harahap Ikhlasiyah Jl. Amal Luhur No. 29 Kel. II Dwikora Drs. Ponidi Sabari Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah Drs. Khaidir Sulaiman Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadomo Drs. Matseh Margolang, S.Pd.I Taqwa Jl. Kapten Sumarsono Gg. Safar DR. H. Syahrul Nasution, M.Ag Taqwa Jl. Kamboja Raya No. 319 Blok 4 Perum Helvetia Awaluddin Hasibuan Taqwa Jl. Setia No. 30 Tg. Gustaq Drs. A. Tanjung MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Ainul Iman Jl. Ekawarni I Kel. Gedung Johor

Drs. Abdul Aziz M. Yusuf Marpaung, S.HI

Annazhirin Jl. Karyawisata Kel. Gedung Johor Ar-Raudhah Komplek Risva I Blok V Kel. Gedung Johor Al-Badaar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Al-Ikhlas Jl. Karya Kasih Baru Lingk. X Kel. P. Masyhur Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlisin Jl. Karya Sehati No. 14 Kel. P. Masyhur Al-Muhajirin Komplek Medan Permai Al-Mustafa Jl. Karya Jaya Gg. Karya XII-XIV Baiturrahmah Jl. Karya Jaya No. 101 Pangk. Masyhur Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Sholihin Jl. Karya Jaya No. 160-G Gedung Johor

K.H. Khaidir Abdul Wahab, Lc, MA Drs. Ahmad Saukan H. Nano Wahyudi, Lc Sarbaini, S.HI Agus Irianto, S.Pd.I Nasir Ansori, S.HI Drs. H. Rusli, M. Prof. DR. H. HasballahThaib, MA Ahmad Bardan Abd. Karim, S.Ag Drs. Imron Sinaga Rizaldi Rustam Harahap, S.Pd.I H. Ahmad Faisal Nasution Drs. H. Zahiruddin Nasution Prof. Dr. H. Basyaruddin, MS A. Baihaki S.Phil H. Alfan Arbudy, S.Ag Drs. H. Abidin Azhar Drs. Sugeng Raharjo Fachrurrazy, S.HI Drs. Hasan Muin, S.Pd. Kamidal Wirya, S.Ag H. Syamsul Basri Tamar Abdul Mukmin Dalimunthe, S.Pd.I

MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Huda Jl. Kemiri III No. 28 Simpang Limun Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Al-Mutttaqin Jl. Amaliun/Panduan Tenaga Gg. Tengah Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Ridho Bakti Jl. Air Bersih Lingk. IX, Kel. Sudirejo-I Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7

H. Arif Muhammad Erde, MA Drs. Zainal Arifin Gunawan Drs. Son Haji Harahap Drs. Sofyan Ahmad Mex Zainis Tjaniago H. Muhammad Nasir, Lc, MA Drs. Syahman Hasibuan H.M. Syukur Abrazain, BA Drs.Khudri Lubis Deliman Siregar, S.Ag Drs. Sodiqin DR. H. Sarbaini Tanjung, MA H. Yazid Syamsuddin, Lc Prof. DR. H. NawirYuslem, MA Drs. Sarakal Ahmadi Siregar Drs. Usman Hasibuan SH, MH Drs. H. Kemal Fauzi DR. Askolan Lubis, MA Irham Taufiq

MEDAN LABUHAN Al-Amal Jl. Banten Gg. Amal No. 170 Dusun IX-A Fuji Rahmadi P., MA Al-Husain Jl. Jala Raya Griya Martubung Drs. Suhaimi, MA Baitul Ikhwan Jl. T. Lestari 12/9198 Blok V Gr. Martubung H. Irwansyah, SH Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Drs. Paino MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Jl. Brigjen Katamso Gg. Mesjid No.53 Nurul Muslimin Jl. Juanda (bundaran) Kel. Jati

H. Fazrul Hak, Lc, MA H. Burhanuddin Noor, Lc Drs. H. Irfan Said Batubara Drs. H. Anwar Sayuti Nursyam, S.Pd.I Edi Syahputra, Sir, MA Burhanuddin Al Butary

MEDAN MARELAN Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir

H. Aliyuddin Abdul Rasyid, Lc, MA Drs. H. Yusril Fuad Drs. Ahyarsyam

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Drs. H. Sarbaini Ar-Rahman Jl. Prof. H.M. Yamin SH No. 363 Darwis Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Drs. Kaliman Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Ahmad Supriadi, S.Ag Ar-Ramlah Jl. Sejati No. 16 Drs. Syamsul Bahri Al-Amin Jl. Prof. H.M. Yamin SH, 482 Drs. H. Rumsil Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Amir Saleh Nasution, S.Ag Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 33 Drs. Ahmad Sufriadi Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir H. Yahya Ishak, MA Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Abdul Hamid Harahap, S.Ag Al-Hurriyah Jl. M. Yakub No. 17 Muklis Muaz, S.HI Al-Huda Jl. Malaka No. 117 H. Sutan Syahrir Dalimunthe, S.Ag Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Khairul Fattah, SH Al-Muslimin Jl. Gerilya No. 1 Drs. Mar’i Batubara Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 DR. H.M. Yakob Amin, MA Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Drs. H. Akhiruddin Muhid Ikhwaniyah Jl. M. Yacub No. 3 Mustafa Lubis, S.Pd.I Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Syahlul Amri, S.Ag Ikhlashiyah Jl.Sei Kera No. 314 Kel. Sei Kera Hulu H. Naharman, S.Ag Istiqomah Jl. Bambu Runcing/Pahlawan Drs. H. Musa Yahya Jamik Al-Ikhwan Jl. H.O.S. Cokroaminoto Kel. S.K. Hulu Drs. Fahmi Filham Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Sarman, S.Ag Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Masdar T., S.Ag Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Drs. H. Yahya Zakaria Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Drs. H.M. Gurning Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat H. Nurdin Rustam, Lc Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat Drs. H. Supardi, MA Taqwa Jl. Karantina Ujung Asrama Drs. Muhammad Ridwan MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Annas Kompleks Diskes Jl. Ibus Raya/Jl. Rotan Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Istiqamah Pasar Petisah Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Setia Al-Mukarram Jl. Sikambin Gg. Patimura No. 9 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

Drs. Pangihutan Siregar DR. Akhyar Zein Drs. H. Azhar Azwar Drs. Irwansyah Putra, MA Suwardi H. Usman Lubis Drs. H. Abdul Hadi Aman Rosadi Lubis, BA Drs. M. Syafi’i, Nasution Dr. H. Amnas, SH Ahmad Muttaqin, S.Pd.I Damri Tambunan, S.Pd.I Drs. M. Yamin Lubis

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Assakinah Jl. Polonia (Starban) Komp. Perum TNI-AU Al-Hidayah Jl. Starban Kel. Sari Rejo Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Bakti Jl. Mongonsidi I Baru No 11 Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 Dirgantara Lanud Jl. Imam Bonjol No. 52 Hanudnas III Polonia Komp. Kantor Hanudnas TNI-AU Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

Taqwa Kampus II UMA Jl. Setia Budi No. 79-B

WASPADA Jumat 20 Januari 2012 Dr. Faisar Ananda, MA

MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Jl. Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei.S. Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Badar Jl. Binjai Km. 6,8 Medan Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Raudotussuffah Jl. Pinang Baris Kel. Lalang Riyadhussholihin Jl. Sunggal No.198 K.S.Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km. 13,7 Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Taqwa Sugeng Rejo

Drs. H. Mukhtar Baijuri Drs. A. Suhaili Suwarno Kamidal Wirya, S.Ag Susanto, S.Pd.I H. Windi Chaldun, Lc, M.Hum Syafrizal Harahap, S.HI H. Sailan Nasution Drs. Zulkifli Drs. Abdul Wahab Kalimantan H. Chaliluddin Usman Batubara Prof. DR. H. Hasan Bhakti, MA Bustami, S.Ag Drs. H. Burhanuddin Harahap Drs. Azhar Drs. H.A. Latif Khan Drs. Turman Nasution Prof. DR. Ir. H. Basyaruddin, MS Drs. H. SulthoniTrikusuma, MA Drs. H. Suten Hasibuan Drs. H. Mahmuddin Sirait Drs. H. Syafruddin Dr. Syaiful Akhyar Lubis, MA Drs. H. Amran Bahrum Drs. Syaukani Muda Nasrun Drs. Sarkun Drs. Irhamuddin, MA Prof. Dr. Lahmuddin Lubis, M.Ed Drs. Muhammad Nasution Hasrat Efendi Samosir, MA Drs. Khalidin Musa Abdul Hafiz, S.Pd.I

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Al-A’la Jl. Pembangunan No. 46 Kel. Glugur Darat II Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Kel. Gaharu Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Rabithatul Muslim Lingk. 14 Glugur Kota Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Pulo Brayan Bengkel Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap

Muhammad Ismail, S.Pd.I Drs. H.T. Yusuf Ahmad Yani, S.Ag Zulkhamsyah, S.Pd.I Drs. H. Makmur Situmorang Drs. Zainuri Drs. Hamdan Manurung Drs. Soeparlan Drs. Dasuki Mangunsong Maimun Al Bantani Mohd. Al-Farabi, MA DR. H.M. Sofyan, Lc, MA H. Daroin H. Syarifuddin Elhayat, M.Ag Drs. M. Hasbi Dasopang Drs. M. Labib Maulana Drs. H. Hasan Mansur Nst., MA Drs. Ramli Asmuni Drs. H. Samin Pane Mulyadi Dasopang, S.Ag Drs. H. Bayanuddin Harahap Drs. Ahmad Dairobi Drs. Ahmad Suhaimi Drs. Syamsuddin Matondang Drs. H. Syarifuddin Nasution Husni Mubarak Nasution, S.Ag Drs. Faisal Lubis Khairul Saleh, S.Sos Junaidi, S.Pd.I, M.SI Rusli Khalil Nasution, S.HI Drs. Armiya Yusuf

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan At-Tawwabin Jl. Pimpinan No. 1 Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Falah Jl. Pukat Banting IV No. 10 Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hilal Jl. Belat No. 76-B Al-Ikhlas Lingk. II Kel. Bandar Selamat Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Al-Ishlah Jl. Pukat V Kel. Bantan Timur Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Baiturrahman Kampus UNIMED Jl. Williem Iskandar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Ikhlashiyah Jl. Suluh/Jl. Tempuling No. 20 Kel.Sidorejo Jamik Al-Jihad Jl. Besar Tembung Desa Tembung Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Raya Muslimin Jl. Pukat I No. 1 d\h Jl. Mandailing No.1 Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Kampus I UMA Jl. Kolam No. 1 Medan Estate Taqwa Jl. Letda Sudjono No. 15 Ubudiyah Jl. Taduan No. 109 Kel. Sidorejo

Drs. Abdul Wahab Ismail, SH Drs. H. Nasrun Zakaria, Lc Drs. M. Ginting Drs. H. Sukon Saragih Drs. H. Thaharuddin, AG Drs. Sofyan Lubis M. Andres, S.Ag Drs. H. Mulkan Daulay Munawir, MA Drs. H.M. Yahya Zakaria Drs. Zulfahmi Hutasuhut,S.Ag Muktaruddin, M.Ag Drs. H. Syamsul Hilal Harahap Prof. DR. H. Pagar Hasibuan, MA Febri S. Lesmana, S.Sos.I Drs. Muslim Azhari H.A.Sori Monang Rkt., An-Nadwi, M.Th. Muhammad Yunus Drs. H.M. Yamin Ritonga Drs. Agen Irma Harahap Muh. Anwar Firman Hidayat, S.Ag Drs. H. Ali Imron Hasibuan Junaidi, S.Pd.I, M.SI H. Ali Azmi, Lc, MA Drs. Lisman Lubis Drs. Ali Imran

MEDAN TUNTUNGAN Ar-Rahman Griya Nusa 3 Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hikmah Kompleks R.S. Jiwa Propsu Jl. Tali Air Lk. IV Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Mukhlisin Komplkek Namori Village Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani

Edy Purnomo, S.Ag Drs. H. Solihin Adin Drs. A. Ghozali Rangkuti Jumendra Banurea, M.Ag Budi Muliono, S.Pd.I Drs. Ponu Siregar Nayan Pelis, S.Ag Jauhari Marpaung, S.HI Asmuri Lubis, S.HI Drs. H. Hamdan Hamidi Hrp. Drs. H. Ma’at

DELI SERDANG Ahmad Zaini, S.Ag M. Lukman Hakim Hsb., MA Jainuddin,SE, MA Drs. H. Asnan Simbolon Drs. H. Idris Yusup DR. H. Hamdani Khalifah Drs. H. Ulumuddin Hamsyi Mashur Utama Hasibuan, S.Ag Drs. Poniman H. Jasmi Assuyuthi, Lc

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari H. Ali Imran Nasution, S.Ag Al-Amri Jl. Nusa Indah Asam Kumbang Drs. Nazaruddin Hasibuan Al-Furqon Jl. Setiabudi Pasar I Tg. Sari Drs. Suparmin Sareh Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Drs. H. Sulaiman Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Drs. Agus Suhaidy Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. H. Ali Imron Nasution Al-Ikhlas Pasar 7, Padang Bulan Murtado Sulaiman, S.Ag Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Drs. Yusnan Nasution Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Mahfudz Al-Muhtadun Jl. Karya Sembada No.179 Kom.Koserna Syarifuddin Sinaga, S.Ag Al-Munawwarah Jl. L.Putra No. 19-A Komp. Kejaksaan Drs. Zulkifli Ahsan Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Drs. Suherman Jami’ Jl. Pasar I Lingk. VIII Kel. Tg. Sari H. Salman Alfarisi, MA Muslimin Jl. Setia Budi Kel. Tg. Sari Drs. H.M. Nur Hasibuan Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Sofyan Sirait Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan Drs. Arifin Syah Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Drs. Sugito Kelana Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H. Amir Soleh Nasution Salamiyah Jl. Bunga Kesuma No. 50-D Kel. P.B.S. II Irwanto, S.HI, S.Pd.I Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 PCM Tj. Sari

Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Ainul Yaqin Jl. Pembangunan IV No. 30 Desa Mulrorejo At-Taubah Dusun XX Lr. Pertanian Blok Gading Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC Al-Issyah Hakim Jl. Karya Jaya Kel. Deli Tua Al-Jihad Jl. Pembangunan No. 26 Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Al-Muhajir Jl. Rel Pasar X No. 06 Bandar Khalifah As-Salam Jl. Raya Medan-Namorambe Kel. Deli Tua Baiturrahman Jl. Merica Raya Blok F Per. Simalingkar Baitussalam Dagang Kerawan-Tg. Morawa H.M. Asjro Effendi Jl. Haji Misbah No. 22 Jami’ Lubuk Pakam Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Jl. Besar Km. 11,5 Deli Tua Jami’ Jl. Irian No. 79 Kel. Pekan Tj. Morawa Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr Setia Khairul Fatihin Dusun II Tj. Morawa-A Kec. Tj. Morawa Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Raya Jl. T. Raja Muda No. 26 Lubuk Pakam Raya Jl. T. Raja Muda Lubuk Pakam Syuhada Kec. Galang Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

Mukhlisin, S.HI Drs. Armen, S.Ag Sulaiman Rasyid Ma’arif, S.Pd.I Banta Khairullah, S.Ag Drs. H. Rusli, MR Muhyiddin Nasution Ruslan Batubara Sofyan Pulungan, S.Pd.I M. Nurdin Nasution, S.Pd.I Drs. M. Sarawi, M.Ag A. Faisal Nasution, MA Drs. H. Akdar Bunayya Drs. H. Jasman Risan, S.Pd.I Syaifuddin Nur, S.Ag H. Akhiruddin, Lc Drs. Supardi Lubis Drs. Syafruddin Ahmad Shoim K.H.M. Husein Kasim M. Rozi Drs. H. Jasman M. Darwis Batubara, S.Pd

BINJAI Agung Kota Binjai Amal Jl. H. Agus Salim No. 14 Kel. Jatinegara Amal Jl. T. Imam Bonjol Gg. Cempaka An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahman Turiam Jl. Ikan Kakap No. 1 Tanah Tingi

Drs. H.M. Yusuf Tanjung Drs. H. Muslim Rawi H. Farhan Rawi H. Hamzah Fansuri Drs. H. Baharuddin D., MA (Bersambung ke hal )

Mimbar Jumat

WASPADA Jumat 20 Januari 2012



. FOTO BERSAMA: Plt.Gubernur Sumatera Utara, H Gatot Pujo Nugroho ST (tengah) didampingi Anggota DPD RI, Prof Hj Damayanti Lubis (kelima dari kanan), berfoto bersama para pemenang berbagai kompetisi Muslimat yang diselenggarakan PW Muslimat Al Washliyah Sumatera Utara, dalam rangkaian memeriahkan Hari Ulang Tahun Muslimat Al Washliyah ke 77. Penyerahan hadiah dilakukan langsung Plt.Gubsu pada puncak peringatan HUT Al Washliyah, akhir pekan lalu di Univa Jalan SM Raja Medan.

Refleksi Diri Sebagai Istri, Ibu Dan Ukhti Salah satu keindahan Islam adalah menempatkan segala sesuatu pada tempatnya. Dalam perbaikan agama, umat, bangsa dan negara terdapat dua macam, yaitu perbaikan zahir dan perbaikan yang bersifat internal. Keduanya memegang peranan yang sangat penting. Perbaikan zahir yaitu perbaikan yang berlangsung pada sektor ekonomi, pemerintahan, pertahanan, pembinaan masjid dan tempat-tempat umum lainnya. Sementara perbaikan internal berlangsung di dalam keluarga, yaitu perbaikan masyarakat dengan keshalihahan pribadi, dukungan moril, pendidikan anak, pengurusan rumah tangga, hingga membentuk sebuah kekuatan pribadi dan generasi umat yang tangguh. Berkaitan hal tersebut, peran yang yang telah dilakukan peran Muslimat Al Washliyah, hingga hari ulang tahunnya yang ke 77, boleh dibilang sudah tak sedikit. Untuk itu, Plt Gubernur Sumatera Utara, H Gatot Pujo Nugroho ST menekankan, tentang pentingnya proses refleksi diri di kalangan muslimat. Baik dalam

perannya sebagai istri, sekaligus ibu dan saudara perempuan (ukhti). Hal tersebut disampaikan Plt.Gubsu di hadapan seribuan jamaah Muslimat Al Washliyah yang hadir pada perin g a t a n Ha r i Ul a n g Ta h u n (HUT) ke-77 Muslimat Al-Washliyah Sumatera Utara, akhir pekan lalu di Kampus Univa Jalan SM Raja Km 5,5 Medan. “Mari jadikan refleksi ini untuk memposisikan diri sebagaimana mestinya. Sebagai seorang muslimat, tentu ada tiga hal yang menjadi posisi kaum ibu yang harus disadari dan dijadikan sebagai pemacu untuk memberikan kontribusi terbaik. Posisi itu yakni sebagai seorang istri, seorang ibu dan seorang ukhti,” lanjutnya. Peran dari setiap Muslimah untuk pembangunan umat ini menurut cukup besar. Terlebih lagi menurut Plt.Gubsu, peradaban Islam saat ini berada di simpang batas. Sebab sudah banyak yang tidak sesuai dengan ajaran Islam. Karena itu, semua kita dituntut memberikan kontribusi terbaik, se-

Hatta Rajasa:

Gabungkan Teknologi Dan Kebatinan Menteri Koordinator Bidang Perekonomian Hatta Rajasa meminta ulama dan kyai yang tergabung dalam Jam’iyah Ahlith Thariqot Al Mu’thabarah Annadliyah, turut menggerakkan ekonomi kerakyatan. Menurut dia, para pemuka agama bisa mendorong umat Islam menggabungkan penguasaan teknologi dan kebatinan. Penggabungan keduanya diyakini menghasilkan kekuatan besar di bidang perekonomian. “Ahli Thoriqot dapat membangun kebersamaan dengan umat, dan menjadi pilar pembangunan dengan menggabungkan pikir dan dzikir, sehingga akan mampu membangkitkan perekonomian bangsa,” katanya saat menutup Muktamar ke XI Jamiyah Ahli Thoriqot Al Mu’tabarah Annadliyah di Ponpes Al Munawariyah, Kecamatan Bululawang, Malang, Jawa Timur, Sabtu lalu. Selain Hatta, hadir pula di situ Menteri Kehutanan Zulkifli Hasan, Wakil Gubernur Jatim Saifullah Yusuf serta 8.500 peserta muktamar dari berbagai daerah di Indonesia. Umat Islam, kata Hatta, haruslah menguasai ilmu pengetahuan dan teknologi, namun tidak meninggalkan jalan menuju kebahagiaan akhirat. Dunia dikuasai, akhirat tidak ditinggalkan. Kejayaan umat Islam beberapa abad lalu dihasilkan perpaduan antara kekuatan batin dan juga pengembangan kekuatan pikir. “Umat Islam harus menjadi masyarakat yang berilmu pengetahuan dan berteknologi. Sejarah mencatat tatanan masyarakat dengan sangat berinovasi dan bernuansa kompetensi telah melahirkan kejayaan,” ungkapnya Hatta mencontohkan, seperti sekarang ini pembuatan mobil Esemka oleh pelajar SMK di sejumlah daerah yang perlu didukung dengan penguasaan kebatinan, sehingga perpaduan antara teknologi dengan penguasaan kebatilan bakal menelurkan kekuatan besar. “Ahli Thoriqot mampu menghasilkan kekuatan ekonomi yang sangat besar, dan pemerintah tidak akan tinggal diam, serta akan terus berkomitmen membantu para kyai tersebut,” papar Ketua Umum Partai PAN ini. Ia menuturkan, sebagai Menko Perekonomian pihaknya berkewajiban menata ekonomi bangsa, dan penataan ekonomi menjadi perhatian utama pemerintah. Meski demikian, perlu dukungan para kyai untuk menghasilkan ekonomi yang maksimal. Masih banyak instrumen yang bisa digarap untuk pembangunan perekonomian bangsa, seperti melalui sektor pertanian, perdagangan dan sejumlah sektor lain.(gc/m20) Ar-Raudhah Dusun VII Desa Kebun Balok Kec. Wampu Ar-Raudhah Dusun VII Desa Kebun Balok Kec. Wampu Al-Furqan Lingk. I Musyawarah Kel. Kwala Bingai Al-Huda Kel. Pahlawan Al-Hidayah Jl. Talam No. 28 Kel. Nangka Al-Hilal Jl. Ikan Arwana No. 17 Kel. Dataran Tinggi Al-Mushlihin Kel. Satria Al-Qadar Griya Payaroda Indah Kel. Payaroba Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Jamik Athohirin Kec. Binjai Utara Nurul Falah Jl. S.M. Raja No. 60 Kel. Tanah Tinggi Nurul Yaqin Jl. S.M. Raja Kel. Tanah Tinggi

hingga posisi di simpang ini menjadi titik balik untuk kemajuan peradaban Islam di masa-masa yang akan datang. Terutama Muslimat yang merupakan arsitek peradaban. Hadir juga dalam acara tersebut, Ketua PW Al Washliyah Sumut, Hasbullah Hadi, Anggota DPD RI dari Sumut Prof Hj Damayanti Lubis serta jajaran pengurus PW Al Washliyah Sumut dan sejumlah tokoh Sumatera Utara yang lain.(m28)

SERIUS: Sekitar seribuan ibuibu yang tergabung dalam Muslimat Al Wasliyah terlihat serius mendengarkan mengikuti acara Hari Ulang Tahun (HUT) Muslimat Al Wasliyah ke 77 akhir pekan kemarin di kampus Univa Jln SM Raja Medan. Kaum ibu yang berasal dari berbagai daerah di Sumatera Utara tersebut, mengikuti seluruh prosesi acara dengan duduk lesehan pada tenda terbuka di areal kampus.

BWI Sumut Gelar Seminar Wakaf

Sudarman Sudarman Ardiansyah Al Hafiz Rasyidin, S.Pd.I Asmuri Hafiz, S.Ag H. Misto Drs. H. Zannah Siregar Drs. H. Jannah Siregar Drs. Hasan Tazir Drs. Misnan, MA Drs. H. Jannah Siregar M. Arif, S.HI Drs. Yahya Drs. H. Usminoto Usman Ardiansyah Al Hafiz

TEBING TINGGI Amal Muslimin Kp. Rao Amaliyah Jl. K.F. Tandean No. 344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Lingk. I Al-Hidayah Kampung Keling Kel. Tg. Baru Hilir Al-HIdayah Jl. Jenderal Ahmad Yani No. 50 Al-Hasanah Jl. Kartini No. 16-A Al-Khairani Jl. Baja Lingk. VI Kel. Teb. Tinggi Al-Ihsan Simpang Dolok Kel. Sri Padang Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Kel. Teb. Tinggi Al-Mukhlis Kel. Pasar Baru Kota Teb. Tinggi


WAKAF sebagai salah satu institusi Islam yang sangat penting, ternyata belum sepenuhnya dipahami oleh umat Islam. Pemahaman yang berkembang selama ini baru sebatas pemahaman fiqhiyyah. Di samping itu wakaf dipahami hanya sebatas kuburan, masjid dan madrasah. Padahal, institusi wakaf terutama di negara Timur Tengah dan sebagian Asia telah berkembang sedemikian rupa. Wakaf telah dijadikan pilar penting dalam pemberdayaan ekonomi masya-rakat. Wakaf telah berhasil men-sejahterakan masyarakat. Bangladesh adalah negara yang berhasil mengembangkan wakaf uang. Dalam rangka sosialisasi wakaf lebih-lebih setelah disyahkannya UU Wakaf No 41 tahun 2004 di tambah dengan terbentuknya Perwakilah Badan Wakaf Sumatera Utara, BWI bekerjasama dengan pemerintah Propinsi Sumut dan Kementerian Agama SU menggelar Seminar Nasional tentang Peranan Wakaf dalam Meningkatkan Kesejahteran Umat. Seminar ini akan digelar pada 21 Januari 2012 bertempat di Asrama Haji Pangkalan Masyhur Medan. Demikian informasi yang disampaikan Prof. Dr. H. M.Yasir Nasution selaku ketua BWI di dampingi oleh ketua Panitia Drs. H. Panusunan Pasaribu, H. Kasim Siyo, Syarifuddin Siba SH, Prof. Amiur Nuruddin, Prof. Rita F Dalimunthe, Azhari Akmal Tarigan, Azhar Sitompul dan Abdur Rahman Harahap selaku Sekretaris BWI SU beberapa waktu lalu. Panusunan Pasaribu menambahkan seminar ini akan menghadirkan ketua umum BWI pusat, Prof. Dr. KH. Tolkhah Hasan, Prof. Dr. H. Abdullah Syah MA, Ketua umum MUI SU dan Prof. Dr. H. M. Yasir Nasution selaku ketua umum BWI Sumut. Ketiga pembicara akan mengupas tuntas persoalan wakaf dalam perspektif Alqur’an, Hadis, Sejarah dan Undang-undang. Termasuk peran BWI sebagai lembaga resmi yang mengurusi Wakaf. Di sam-ping itu, dalam konteks Sumut akan tampil Drs. H. Abdurrahmi, M. Hum dan Kepala BPN akan mengkaji peroblematika wakaf di Sumut. Adapun masalah peranan perbankan syari’ah dalam mengelola wakaf uang, akan tampil sebagai nara sumber dari BMI dan Bank Sumut Syari’ah. Seminar akan diikuti oleh pengurus MUI se Sumatera Utara, Kementerian Agama di Kabupaten dan Kota, ketua Ormas Islam, cendikiawan muslim dan akademisi, serta para pengusaha. Seminar akan dibuka oleh Plt Gub-su dan diharapkan akan meluncurkan wakaf uang untuk Sumut yang lebih baik. Demikian Abdurrahman Harahap, MA sebagai sekretaris. Peserta yang telah memperoleh undangan segera konfirmasi ke 081533130505 (Abdur Rahman) dan 08126555144 (Azhar Sitompul).(m38)

STABAT Ar-Raudah Dusun VII Masjid Desa Kebun Balok Al-Furqan Lingkungan I Kel. Kwala Bingai


REFLEKSI DIRI: Plt Gubernur Sumut, H Gatot Pujo Nugroho ST, memberikan sambutan pada HUT Muslimat Al Washliyah Sumut, akhir pekan lalu di Univa Jln SM Raja Medan. Plt Gubsu menekankan tentang pentingnya refleksi diri bagi kalangan Muslimat Al Washliyah berkaitan momentum ulang tahun tersebut. Baik sebagai seorang istri, ibu maupun ukhti (saudara perempuan) serta menjauhi kegiatan siasia seperti bergunjing.

Suyetno H. Ardhu Billi Drs. Safarullah Edi P., MM H.M. Thahir, SH Sofiyan M.S. Drs. H. Ibrahim Harahap Drs. Abdul Khalik, MAP M. Siddik Anshori, S.Pd.I Rahmat Halim Batubara Drs. H. Akhyar Nasution Rudi Kurniawan, S.Pd.I Yusnul Adhry Syahir

Al-Muthmainnah Lingk. I Kel. D.Sundoro Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Istikmal Jl. K.F. Tandean Lingk. III Bandar Sakti Jami’ Jl. Batu Bara Kel. Satria Jami’ Jl. Soekarno-Hatta Kel. Tambangan Hulu Nurul Amal Komplek Kodim Lingk. 04 Kel. Lalang Raya Nur Addin Jl. R. Suprapto No. 126 Syuhada Jl. Iskandar Muda No. 79 Taqwa Jl. Bakti Kel. Satria Kec. Padang Hilir

Apresiasi RoadTo Dakwah Banyak kemajuan dialami Waspada yang merayakan HUT ke-65 pada 11 Januari 2012. Tidak hanya terkait dengan pemberitaan semata, tapi juga berbagai kegiatan sosial, pendidikan, dan dakwahnya. ‘’Saya memberi apresiasi tinggi buat Waspada khususnya kegiatan ‘Road to Dakwah’ di Sumut dan Aceh,’’ ujar Ustadz Drs H Amhar Nasution, MA, (foto) kemarin. Menurutnya, Waspada makin tahun makin berkualitas sehingga menjadi media utama dalam mencerdaskan masyarakat, khususnya umat Islam. Di usianya ke-65 tahun Waspada menjadi jembatan kemajuan iptek dan imtak, jembatan informasi terpercaya di era globalisasi. Ustadz Amhar mengharapkan Waspada tetap kokoh menjalankan motto ‘Demi Kebenaran dan Keadi-lan’. ‘’Tetaplah independen menja-lankan misi sucinya,’’ ujar Ustadz Amhar yang juga dosen STIKP dan USU, serta penceramah tetap di kediaman Kapoldasu, Pangdam I/BB.(m03)

Drs. Aminullah Syamsuddin Harahap Drs. Jakfaroni, SH Zulkifli M. Nuh H.Bustami Saragih, S.Pd.I H.M. Yusuf Rekso Drs. Fikhri Syam, S.Pd.I Drs. Usman Amir H. Nandang Hasanuddin, SH Azray, M.AP Abd. Gani Damanik

INDRAPURA Jami’ Indrapura Kota

H. Zulkifli, R.

KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Al-Hidayah Jl. Cokroaminoto Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Kel. Gambir Baru Kel. Kisaran Timur Jami’ Lingk. I Kel. Bunut Nurul Yaqin Kantor Direksi - Kisaran Siti Zubaidah Jl. Budi Utomo No. 285

H. Abd. Hakim Lubis Dahmul Daulay, S.Ag H. Ahmad Zulhanuddin BB, Lc Bob Yuswardy, S.Pd.I Drs. H.A. Rahman, P. Abd. Hakim Lubis K.H. Alimuddin Siregar, S.Pd.I Drs. H. Edy Sucipto M. Asri H.Azhari Lubis H. Sawaluddin Damanik H. Syawaluddin Damanik, S.Ag

LABUHAN BATU An-Nur Desa Kuala Bangka Baiturrahman Kec. Kualuh Hilir

Usdek Situmorang Muhammad Redho,S.Pd.

Dahsyatnya Amal Jama’i H M Hafez Lc MA Seperti filosofi sapu lidi, kalau masih terurai dalam format lidilidi yang berserakan maka tidak banyak yang bisa diharapkan dari lidi tersebut. Namun manakala lidi itu dapat dikumpulkan menjadi satu kesatuan yang utuh sehingga menjadi sapu lidi yang kuat dan kokoh maka sapu lidi akan menjadi energi yang dahsyat dan banyak sampah yang bisa dibersihkan sehingga besar manfaatnya untuk kepentingan umum. Filosofi ini dibenarkan agama, seperti pernyataan Raulullah SAW “Barang siapa memisahkan diri dari jamaah sejengkal kemudian dia mati maka matinya adalah (mati) jahiliyah”. Dan Allah SWT juga menegaskan dalam ayat Alquran “Dan janganlah kamu menyerupai orang-orang yang bercerai berai dan berselisih sesudah datang keterangan yang jelas kepada mereka, mereka itulah orang-orang yang mendapat siksa yang berat” Bekerja terarah, bersatu padu dan memiliki target yang jelas manfaatnya untuk kepentingan masyarakat dan umat manusia seperti kerja sapu lidi tersebut, inilah yang dikatakan dengan amal jama’i. Ada beberapa variabel amal jama’i di antaranya: kerja kolektif, terorganisir baik, memiliki dasar dan tujuan yang jelas. Apapun kegiatan dan pekerjaan manusia selama dilaksanakan dalam koredor amal jama’i maka akan mempunyai efek atau dampak positif yang besar terhadap kepentingan masyarakat. Untuk membangun negeri dan bangsa yang bermartabat di republik ini haruslah dimulai dengan amal jama’i yang masif, tanpa melihat latar belakang dan organisasi si pelakunya. Karena masih terlalu banyak sampah-sampah yang berserakan di negeri kita, sehingga perlu dituntaskan dengan amal jama’i. Seluruh elemen dan segmen masyarakat harus mengambil peran aktif dan positif untuk membersihkan sampah-sampah yang masih berserakan di berbagai sektor kehidupan. Kalau tidak mengambil peran untuk membersihkannya maka sampah ini akan mendatangkan virus dan bau busuk yang dapat mengancam stabilitas kehidupan berbangsa dan bernegara. Maka peran strategis ini harus menjadi mainstream pemerintah sebagai institusi tertinggi di negeri ini yang berada di garda paling depan. Jangan biarkan terjadi pembusukan di dalam tubuh bangsa hanya karena limbah sampah yang tidak terkelola secara profesional. Karena sampah-sampah politik, birokrasi, hukum, ekonomi, pendidikan, sosial dan sektor lainnya masih perlu penanganan yang serius oleh setiap elemen bangsa. Terutama oleh institusi pemerintah dan masyarakat yang sudah lama eksis di negeri ini perlu ada langkah-langkah konkrit untuk menuntaskannya. Tidak sedikit lembaga yang mempunyai kompetensi tinggi dapat berbuat banyak untuk membersihkan sampah tersebut, karena sampah bangsa ini adalah kemunkaran yang harus dibasmi dengan kesadaran yang tinggi secara kolektif oleh elemen masyarakat. Jangan sampai banyak menelan korban yang melanda dan mengancam anak bangsa karna kelalaian kita. Allah mengingatkan dalam Alquran “Hendaklah kamu takut dengan satu musibah yang menimpa bukan hanya si pelakunya yang zhalim saja...” Lakukanlah tindakan apa saja yang dapat meminimalisir kemungkaran dan dapat menyingkirkan sampah bangsa dengan cara amal jama’i. Kita harus optimis amal jama’i akan menghasilkan energi positif yang dahsyat untuk mengantisipasi kemunkaran yang sedang merjalela di seluruh sektor kehidupan bangsa kita. Upaya maksimal berupa amal kebajikan yang kita kerahkan untuk kepentingan bangsa dan masyarakat akan menolak musibah atau bencana yang akan mengancam negeri ini seperti dinyatakan Allah SWT dalam ayatNya di atas. Amal jama’i adalah satu keniscayaan untuk menebarkan kebaikan dan mencegah kemungkaran yang merebak di tengah masyarakat. Amal jama’i akan mendatangkan keberkahan dari Allah SWT dan kebaikan kepada masyarakat. Tidak ada perbedaan dalam beramal jama’i antara laki-laki dan perempuan, antara satu lembaga dengan lembaga lainnya, antara satu institusi swasta dangan negri, antara suku atau etnis dengan yang lainnya. Semuanya bernilai positif dan akan membawa kebaikan dan keberkahan untuk negeri yang kita cintai Indonesia.

Waspada/H. Suyono

PENGURUS BKM AL-MA’RUF : Pengurus BKM Al-Ma’ruf Kelurahan P.Barayan Darat II Jl. Sidorukun Medan 2011-2014 diketuai H. Misno Lesmana yang telah dikukuhkan belum lama ini komit tetap menjaga kebersamaan dan terus mengembangkan serta memelihara dengan kegiatan shalat berjamaah, shalat Jumat, idul fitri, idul adha, pengajian, majelis ta’lim terus dilaksanakan secara rutin dan khidmat. “Kita terus berupaya menjaga dan meningkatkan hubungan vertical kepada Allah SWT yang kita kenal dengan hablum minallah dan hubungan baik kepada sesama manusia hablum minannas,” kata H. Minso Lesmana.

BATUBARA Ar-Rahman Dusun II Desa Pasar Lapan Jami’ Al Mukhlisin PT. Moeis Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Jl. Raya Medan-Kisaran Km. 108

Masrin Banurea, S.Ag Lukman Yanis Hasan Basri M. Gazali Syafii, S.Ag

TANJUNGBALAI Al-Istiqomah Jl. Anggur Kel. Pantai Johor

H. Ahdar Anwar

A SA HA N Arif - Al Azhim Polres Asahan

Salman Tanjung, M.Ag, MA

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur Kel. Martoba

Ridwan Al-Islam, S.Ag

RANTAU PRAPAT Al-Qodar Jl. Terpisang Mata Atas

H. Muhammad Effendi

SIDIKALANG Agung Kota Sidikalang Al-Muhajirin Jl. Bambu Kuning Blok A No. 59 Talaga Zam-zam Jl. Ahmad Yani Batang Beruh

Karimin Silalahi, S.Ag M. Sanif, S.HI Drs. H. H.B. Bancin, MM

BIREUEN Masjid Agung Bireuen Masjid Taqwa Kec. Gandapura Masjid Besar Kec. Makmur Masjid Besar Kec. Kuta Blang Masjid Besar Kec. Peusangan Masjid Besar Kec. Peusangan Siblah Krueng Masjid Besar Al-Furqan Kec. Kota Juang

DR Saifullah S.Ag M.Pd Tgk H Ismuar Yusuf Tgk Saifuddin Tgk. Busmadar Tgk. Dahlan Bentara Tgk H Lahmuddin Tgk Safruddin

Mimbar Jumat C12 Revolusi Pertanian Muslim

WASPADA Jumat 20 Januari 2012

Melihat keindahan bangunan ini dapat dipastikan Sultan Hasan adalah seseorang yang memiliki nilai seni arsitektur sangat tinggi. BUKU tentang medis-botani telah diproduksi sejak awal peradaban; catatan dari Mesir, Mesopotamia, China dan India mencerminkan tradisi yang ada sebelum manusia menemukan tulisan. Sebaliknya, tidak ada bukti-bukti semacam itu di Barat. Istilah atau kata herbal pertama kali muncul dalam bahasa Yunani pada abad ke-3 SM ditulis oleh Diocles dari Carystus, diikuti oleh Crateuas di abad ke-1 Masehi. Risalah pertanian di Barat pertama kali ditulis berupa ensiklopedia Romawi karya Cato the Elder (234-149 SM) yang isinya tentang obat-obatan dan pertanian yang diberi judul “De Agricultura”. Namun, karena disintegrasi Kekaisaran Romawi, di mana otoritas kerajaan tidak diakui lagi, reformasi terhadap feodalisme menyebabkan kekacauan, perkembangan pertanian menghadapi masa suram sampai datangnya Islam (pada abad ke 7 Masehi). Pada tahun 711 M, semua

wilayah yang berada di bawah kekuasaan Islam menikmati pembangunan ekonomi yang kuat sehingga menghasilkan kekayaan yang diperlukan untuk membiayai perlindungan wilayah yang membentang dari lembah Pyrenees (kawasan pegunungan di barat-daya Eropa yang membentuk perbatasan alami antara Perancis dan Spanyol) sampai perbatasan China. Perlindungan atas karya intelektual merupakan faktor kunci yang menopang perkembangan tersebut dan mengakibatkan ber-kembangnya budaya Islam dan peradaban dunia Muslim. Peradaban Islam ini menjadi momentum dalam menetapkan - meskipun menghadapi ancaman invasi dan perpecahan internal yang terus-menerus langkah be-sar di bidang pertanian, kedokteran dan ilmu pengetahuan. Karenanya dengan tersedianya berbagai macam bahan baku dan metode untuk mengolah bahan-bahan tersebut untuk digunakan sebagai pe-

-Gambar ini bagian dari Kitab al-filaha Ibn al-Awwam yang membahas tentang cara penanaman lebih dari 50 jenis pohon buah-buahan, juga mengulas tentang tanah, pupuk, tanaman okulasi dan penyakit tanaman.

nyembuhan penyakit dan untuk meningkatkan gizi juga bisa dilakukan. Gerakan besar dalam pertanian ini sangat bergantung pada usaha pemerintah pusat dalam mensponsori jaringan luas saluran irigasi. Di kawasan Timur Dekat metode tersebut membawa hasil baik. Namun, di Eropa metode tersebut itu kurang menjanjikan. Di Semenanjung Iberia tingkat subsistensi ekonomi pertaniannya tidak berkembang. Setelah Muslim memegang kendali atas kawasan itu, perlu diambil keputusan dalam menentukan tanaman mana yang penting untuk dikembangbiakkan. Untungnya, keragaman botani Arab sudah luas dan berkembang pesat. Semasa melakukan ekspansi wilayah, kaum muslim menjumpai tanaman dan pohon-pohon, yang sampai sekarang tidak diketahui namanya, sementara para pedagang juga kembali dengan membawa tanaman eksotis, benih dan rempahrempah dari perjalanan mereka. Di antaranya tanaman seperti tebu, pisang dan kapas yang membutuhkan banyak air atau setidaknya musim hujan. Jadi untuk menumbuhkan mereka, sistem irigasi buatan yang luas dibutuhkan. Irigasi buatan sebenarnya lebih dikenal kaum Muslim dibanding sistem rotasi tanaman dari tanah Eropa yang dingin di mana perlu membiarkan tanah tidak ditanami selama beberapa lama, tujuannya untuk memulihkan, selama satu tahun tiga atau empat kali. Namun, irigasi buatan perlu dibangun dengan ketinggian tertentu untuk menjamin aliran air secara terus-menerus. Dalam hal ini, kaum Muslim memiliki keuntungan dari kemajuan yang mereka capai dalam matematika sehingga memungkinkan dilakukan pengukuran ketinggian yang

Waspada Pilar Peradaban Islam (Yang Tersisa Dari Refleksi HUT Ke 65 Harian Waspada) H Ahmad Sabban Al Rahmaniy Rajagukguk MA Dosen, Kandidat Doktor IAIN SU, Tuan Guru Serambi Babussalam Simalungun


alam menyambut dan merayakan HUT ke 65 ini, berbagai prosesi kegiatan penting dan penuh dengan nilai-nilai edukasi, dakwah dan sosial budaya pun dilakukan untuk mengukuhkan peran keumatan dan kebangsaan media ini. Tidak heran, jika harian ini juga mengemas sebuah acara Ani Idrus Award 2011 (penghargaan yang diambil dari nama Pendiri Harian Waspada Ibu Hj Ani Idrus), sebuah acara yang sangat monumental dan mengesankan. Dalam acara ini, 11 Tokoh Penerima Ani Idrus Award 2011 dinobatkan sebagai Tokoh Pendidikan Sumut dan Aceh yang dihadiri langsung oleh Menteri Pendidikan dan Kebudayaan Muhammad Nuh (Waspada, 16/01/ 2012). Apresiasi penting juga datang dari Pemeritah Kota Medan yang meresmikan Jalan Pandu menjadi Jalan Ani Idurs sebagai bentuk penghargaan dan pengabadian ketokohan pendiri harian Waspada ini. Tulisan ini hadir melengkapi berbagai bentuk apresiasi yang diperoleh dan disampaikan kepada harian Waspada dalam rangka HUTnya yang ke 65 tahun. Penulis yang juga termasuk kolumnis, pengamat dan sekaligus ’pencinta’ harian ini merasa bahwa ada sisi lain yang masih tersisa dari eksistensi harian Waspada sebagai media ummat. Penulis memandang – tanpa ingin melebih-lebihkan- bahwa harian Waspada dalam perjalanan panjangnya sampai saat ini ternyata telah menjadi pilar peradaban Islam. Korannya Umat Setidaknya, - umat - termasuk penulis sendiri menyimpulkan beberapa kelebihan argumentatif bahwa harian Waspada menjadi media pilihan umat dikarenakan beberapa hal: Pertama, harian Waspada telah menyampaikan berita dan informasi dengan mengedepankan objektifitas, bermutu, akurat, professional dan elegan. Kedua, pendiri dan pengelola media ini mampu menerbitkan sajian berita dan informasi yang sejalan dengan nilai-nilai budaya (culture of value) bangsa ini khususnya masyarakat Sumut dan Aceh yang merupakan pangsa pasar terbesarnya. Ketiga, media ini menempatkan potisioning yang kuat di hati masyarakat, khususnya para tokoh, akedemisi dan khsususnya masyarakat muslim, dikarenakan media ini memiliki karekteristik tersendiri yang mengedepankan dimensi dakwah (da’wah bi al qalam), sosial budaya dan pendidikan. Keempat, media ini dirasakan ummat menjadi benteng moral, teladan dan pengawal kebu-

dayaannya. Pada sisi lain, umat melihat bahwa terdapat media yang menjadi instrument masuknya budaya barat yang ‘menggerogoti’ kesantunan budaya bangsa. Penetrasi budaya barat yang menghancurkan budaya bangsa sangat efektif jika diprasaranai oleh media bangsa itu sendiri. Namun pembonsaian itu tampak tidak dilakoni oleh harian Was-

sekuler dan pengagum materialisme. Apa yang dikenal dengan permissive society (masyarakat serba boleh) adalah merupakan produk sekularisme, suatu faham yang mengabaikan, melepaskan dan menanggalkan norma-norma agama, nilai-nilai moral dan ketuhanan. Bahkan Rederick C Maredith menggambarkan Permissiveness (kebo-

Penetrasi budaya barat yang menghancurkan budaya bangsa sangat efektif jika diprasaranai oleh media bangsa itu sendiri. pada. Inilah kemudian yang mendasari alasan argumentatif penulis yang menyimpulkan bahwa media ini telah ‘menjelma’ menjadi media ummat. Sangat wajar kemudian, jika media ini bukan hanya sumber berita dan informasi biasa sebagaimana surat kabar pada umumnya tetapi juga bisa menjadi referensi akedemis dan dakwah Islam. Begitulah, kiranya keberlangsungan media ini tetap menuju kejayaan pada masa-masa yang akan datang dengan visi keumatannya. Harian Wasapda Menjadi Pilar Peradaban Islam Memahami peradaban Islam, saat ini telah mengalami distori, jika bukannya telah dikaburi oleh pandangan dunia barat atau mengalami penyempitan bahkan pendangkalan di kalangan umat Islam sendiri. Betapa tidak, model peradaban Islam yang dibayangkan adalah sebuah peradaban fisik dan teknologi semata. Padahal peradaban Islam yang dilukiskan dan dipraktekkan Rasulullah SWT adalah sebuah model peradaban mengesankan, yakni peradaban yang dibangun dengan nilai-nilai kerohanian dan kemanusiaan. Oleh karenanya, sebagaiman penulis kemukakan pada di atas, bahwa harian Waspada hadir di tengah ummat dengan mengawal sistem kebudayaan dan peradaban bangsa yang mayoritas umat Islam. Media ini bukanya hanya ‘menyaring’ jika bukanya ‘menutup rapat’ pintu masuknya paham-paham sekuler dan hedonis tetapi juga mengawal kebudayaan dan norma-norma Islam sebagai modal utama kebangkitan peradaban Islam. Semua tahu bahwa media oleh Barat dan penguasa zholim sering dijadikan sebagai instrument melakukan penyebaran budaya mereka dan sekaligus merusak budaya lokal (bangsa) agar bangsa ini kehilangan jati dirinya. Pada sisi lain budaya barat adalah budaya yang berpaham liberal,

lehan) yang berlaku dalam kehidupan masyarakat barat sebagai “curse of western society” (kutukan terhadap masyarakat barat). Sementara kekuatan dan efektifitas media sebagai sarana propoganda tidak diragukan lagi. Dalam hal ini, John Fitzgerald Kennedy, mantan Presiden Amarika Serikat pernah menyatakan bahwa “ ia lebih takut kepada seorang wartawan ketimbang seribu orang tentara.” Senada dengan ini, Lenin juga pernah berujar, “Waspadalah terhadap kekuatan pers”. (Albert L Hester and Wai Lan J To, Handbook for thirdWord Journalist, 1979: 42) Hal ini disadari karena kekuatan media pers dapat meneggelamkan realitas hingga mempengaruhi berbagai peristiwa. Sebab tarikan pena sang kuli tinta itu bisa merakit sederet tulisan sakti. Memang tulisan adalah “tamannya para Ulama”, begitu pameo klasik dari Ali bin Abi Thalib. Penutup Hemat penulis, harian Waspada dalam kurun waktu yang begitu panjang telah banyak berperan dan berjasa untuk kemajuan dan kecerdasan kehidupan anak bangsa. Media ini juga dengan sajian kontennya yang mengesankan telah ‘menarik’ hati masyarakat, sehingga tidak pelak lagi harian ini memiliki tingkat positioning yang tinggi di tengah ummat. Media ini juga bukan hanya menyampaikan informasi dan berita faktual tetapi juga menjadi media edukasi, dakwah, sosial budaya bahkan politik yang mendidik. Keunggulan lainnya yang sangat penting, bahwa harian Waspada ini dengan sendiri telah hadir dan berperan sebagai media pengawal kebudayaan bangsa yang mayoritas Islam. Untuk itu, tidak berlebihan jika penulis menyimpulkan dan mengapresiasi harian Waspada merupakan media atau korannya ummat sekaligus menjadi Pilar Peradaban Islam.

akurat. Kaum Muslim tidak suka mem-buang waktu melakukan uji coba pertanian serampangan, hasil maksimum mereka capai dengan belajar bagaimana mengidentifikasi tanah yang cocok dan dengan menguasai teknik mencangkok tanaman dan pohon. Dari masjid sampai pasar minggu Para ulama sendiri melakukan eksperimen mereka dan mengajar di mana-mana, termasuk masjidmasjid dan pasar mingguan. Hal ini diperkuat oleh fakta bahwa pada abad ke-12, abad ini dipandang sebagai zaman keemasan Islam dengan munculnya para ulama besar yang ahli dalam bidang botani seperti: · Abu’l Abbas suatu Nabati (Ibnu Rumiyya) 1239 M · Ibnu Baytar (1197-1248 M), Tafsir kitab Diasquridus - Jami ‘almufradat al adwiya wal aghdiya · Al Ghafiqi (d.1166 CE), penulis “mufradat al Kitab Jami ‘“ (materia medica). · Ibnu Al Awwam, penulis “Kitab al filaha” (risalah tentang pertanian) · Ibnu Bajja (w. 1138 M), Kitab al nabat Liber de plantis (transl Latin.), mendefinisikan jenis kelamin tanaman. Karya Ibn Baytar itu ditulis dalam bahasa Arab, Berber, Yunani dan Farmakope Latin sementara Al Biruni memberikan sinonim nama obat dalam bahasa Syria, Persia, Yunani, Baluchi, Afghanistan, Kurdi, India dan lain-lain. Kemampuan linguistik para ulama ini menunjukkan mereka berniat menyebarkan pengetahuan di antara semua bangsa, seperti yang terjadi dengan distribusi kalender pertanian Cordoba pada abad ke-10. Kalender Cordoba adalah contoh dari jenis informasi yang diberikan sebagai bantuan untuk pertanian. Dengan demikian, dalam hampir satu abad penaklukan

- Pe r p u s t a k a a n d i g i t a l y a n g t e rd a p a t d i Pe r p u s t a k a a n Un i v e r s i t a Pr i n c e t o n j u g a menyimpan manuskrip botani Arab dari abad ke-15. Muslim, wilayah yang berada di bawah kendali Muslim telah berubah sangat radikal dan tidak berlebihan jika menggambarkan proses transformasi itu sebagai Revolusi Pertanian Muslim. Unsur-unsur keberhasilan revolusi ini dapat diringkas sebagai berikut. a. Perluasan lahan yang bisa dimanfaatkan dengan membangun irigasi.

b. Penerapan teknik pertanian ditingkatkan berdasarkan informasi yang relevan di seluruh dunia. c. Insentif berdasarkan dua prinsip, yakni pengakuan kepemilikan swasta dan menguntungkan para petani dengan pangsa panen sepadan dengan upaya mereka. d. Teknologi yang lebih maju memungkinkan orang-orang seperti Ibnu Baytar melakukan

percobaan dengan menanam tanaman, ribuan kilometer dari asalnya dan yang sebelumnya tidak pernah bisa dibayangkan bisa tumbuh dalam iklim semigersang atau kering. Pengenalan dan iklimatisasi (penyesuaian kepada iklim tertentu) tanaman baru dan pengembangbiakan serta penyebaran ternak ke daerah dimana mereka sebelumnya tidak diketahui.Syafri/Muslimherc

Kunci Sukses Dan Mulia Perspektif Alquran Oleh Prof Dr H.Asmuni, MA Guru Besar IAIN SU, UMSU Dan Ketua PWM SU.


esuksesan dan kemuliaan sangat penting dalam kehidupan umat manusia. Untuk mendapatkan keduanya, seseorang melakukan aktivitas yang berbeda. Ada yang bekerja keras dengan berdagang tanpa mengenal lelah, mulai terbitnya mata hari sampai terbenamnya. Ada pula yang bekerja keras melalui usaha pertanian, perkebunan dan peternakan. Sebagian orang bekerja keras melalui jual jasa, seperti menjadi agen jual beli tanah, sepeda motor, mobil, rumah dan lain-lain. Mengelola jasa pendidikan mulai dari PAUD (Pendidikan Anak Usia Dini) sampai pada Perguruan Tinggi juga merupakan salah satu usaha dalam memperoleh kesuksesan dan kemuliaan dalam hidup ini. Namun demikian, tidak sedikit orang menempuhnya jalan yang salah dan bertentangan dengan norma-norma ketuhanan dan kemanusiaan. Misalnya, jual beli barang hasil curian, perampokan, barang-barang selundupan, narkoba, ganja dan sebagainya. Tujuan utama dari kesemuanya itu adalah memperoleh kekayaan atau harta benda, sebab kalau orang sudah kaya pada umumnya dipandang mulia oleh orang lain. Konsekuensi sebagai seorang Muslim adalah menyerahkan atau menundukkan diri segala aktivitas kehidupan ini kepada ketentuan Allah. Segala apa yang dilarang Allah wajib dijauhi dan segala apa yang disuruh-Nya dikerjakan menurut kemampuan. Namun dalam kenyataannya ideal konsep itu selalu saja tidak dipatuhi sepenuhnya oleh setiap individu Muslim. Faktornya, juga beranekaragam. Ada orang yang melanggarnya karena tidak mengetahui ketentuan hukum Allah. Ada juga karena tidak mempunyai iman kuat, sehingga hawa nafsu syaitoniyahnya lebih dominan dalam mendorong pekerjaan menyimpang. Akhirnya, aktivitas kehidupannya bergelimang berbagai perbuatan dosa dan melanggar nilai-nilai kemanusiaan. Kadang-kadang malah orang berkata “mencari yang haram saja susah apa lagi yang halal”. Terkait judul di atas, sesungguhnya Allah telah menjelaskannya dalam surat at-Taubah ayat 20: “Orang-orang yang beriman dan berhijrah serta berjihad di jalan Allah dengan harta benda dan diri mereka, adalah lebih tinggi derajatnya di sisi Allah dan itulah or-

ang-orang yang mendapat kemenangan “. Dalam ayat ini dijelaskan oleh Allah bahwa kunci sukses dan untuk mendapatkan kemuliaan di sisi Allah itu ada tiga. Pertama, adalah beriman yang meliputi iman kepada Allah, para

kerjaan, tidak sekedar bersandar kepada eksistensi Tuan, tetapi juga menyakini potensi yang diberikan Tuhan kepada manusia. Antara lain, potensi atau kekuatan diri untuk mampu melaksanakan pekerjaan apapun bentuknya. Hal

Orang yang mengucapkan syahadataian tetapi tidak melaksanakan ibadah shalat lima waktu sebagai manivestasi pengamalan, maka sesungguhnya dia juga bukan orang beriman. Malaikat-Nya, para Rasul, kitabkitab yang diturunkan Allah kepada mereka, hari akhir, dan takdir Allah. Dalam kaitan ini, ada hal yang harus difahami dan diamalkan secara nyata yakni pengertian tentang iman. Asal makna iman adalah percaya, tetapi unsur pokoknya ada tiga yaitu; diikrarkan atau diucapkan dengan lidah, dibenarkan dengan hati dan dilaksanakan dengan anggota badan. Dengan demikian, orang yang mengatakan percaya bahwa Allah itu ada dan alam semesta ini adalah ciptaanNya, tetapi hatinya tidak membenarkannya, maka orang tersebut tidak dikatakan orang yang beriman. Itulah mereka disebut dengan orang yang munafik. Apa yang dikatakannya berbeda dengan apa yang ada di dalam hatinya. Selanjutnya, ucapan dengan lidah dan ketetapan hati kalau tidak disertai perbuatan anggota badan juga tidak memenuhi unsur pokok keimanan. Tegasnya, orang yang sudah mengucapkan syahadataian atau dua kalimah syahadat (asyhadu alla ilaha illallah wa asyhadu anna Muhammadar Rasulullah) akan tetapi tidak melaksanakan ibadah shalat lima waktu sebagai manivestasi dari pengamalan dengan anggota tubuh, maka sesungguhnya dia juga bukan orang yang beriman. Sebabnya, iman itu memiliki tiga unsur pokok yang harus ada yaitu; diucapkan dengan lidah, dibenarkan dengan hati dan dilaksanakan dengan anggota tubuh. Dalam setiap melaksanakan aktivitas apapun bentuknya iman wajib dimiliki, sebab hal itu merupakan sesuatu sangat mendasar. Iman dalam hal melakukan pe-

ini sesuai dengan firman Allah dalam surat ar-Ra’du ayat 11 yang artinya “Bagi manusia ada malaikat-malaikat yang selalu mengikutinya bergiliran, di muka dan di belakangnya, mereka menjaganya atas perintah Allah. Sesungguhnya Allah tidak mengubah keadaan sesuatu kaum sehingga mereka mengubah keadaan yang ada pada diri mereka sendiri”. Faktor kedua, untuk memperoleh kesuksesan dan kemuliaan adalah hijrah seperti yang dinyatakan dengan kalimat “wahaajaruu” pada surat at-Taubah ayat 20 di atas. Makna hijrah secara terminologis adalah pindahnya Nabi Muhammad Saw beserta para sahabatnya dari Makkah al-Mukarramah ke Madinah alMunawarah. Makna hijrah seperti ini dinamakan hijrah makani atau hijrah dari tempat domisi di Makkah ke Madinah. Makna yang dikehendaki Alquran bukanlah terbatas pada hijrah makani tetapi hijrah dalam arti yang luas. Artinya, hijrah dalam pengertian meninggalkan sikap mental dan perilaku yang negatif kepada yang positif. Seseorang yang melakukan hijrah dalam arti pindah dari kampung atau desanya, ke kota besar lalu tidak bisa mengubah sikap mental dan perilakunya yang malas seperti waktu di kampung, pastilah dia tetap hidupnya menderita dan tidak akan mungkin sukses serta tidak akan memperoleh kemuliaan apapun. Tetapi, jika seseorang hijrah dari satu daerah ke daerah lain dan dia juga meninggalkan sikap mental dan perilakunya yang negatif seperti malas menjadi rajin dan giat dalam bekerja, niscaya dia

akan memperoleh kesuksesan dan kemuliaan dalam hidupnya. Ketiga, adalah berjihad di jalan Allah dengan harta dan jiwanya. Jihad dalam Alquran mempunyai makna yang banyak. Antara lain, adalah berperang melawan orang-orang kafir seperti dilakukan Rasulullah SAW dan para sahabatnya dengan motivasi ingin menegakkan agama Allah. Namun demikian, makna jihad seperti itu kata Rasulullah termasuk jihad alashghar atau jihad yang kecil. Jihad yang paling besar kata Rasulullah adalah jihad mengendalikan hawa nafsu. Hal ini sangatlah rasional, sebab hawa nafsu yang tidak terkendali itu dapat membawa kehancuran. Buktinya, ada orang yang sudah sukses dalam membina rumah tangga, tetapi akhirnya keluarganya hancur. Isteri dan anak-anaknya yang pernah hidup serba berkecukupan, akhirnya harus berantakan karena suami atau isterinya selingkuh dengan orang lain. Orang yang selingkuh apapun ala-sannya, adalah termasuk orang yang memperturutkan hawa nafsu dan pasti akhirnya akan hidup berantakan. Logislah kalau Allah memerintahkan untuk menjauhi zina karena perbuatan tersebut adalah keji dan hina. Ketentuan ini dinyatakan Allah dalam surat al-Isra’ ayat 32 yang artinya “Dan janganlah kamu mendekati zina; sesungguhnya zina itu adalah suatu perbuatan yang keji dan suatu jalan yang buruk”. Maksud jihad fi sabilillah dengan harta dan jiwa seperti yang disebut dalam ayat tersebut bukanlah terbatas pada berperang melawan orang kafir dalam rangka menegakkan agama Allah. Akan tetapi juga termasuk menggunakan harta dan kemampuan diri pribadi untuk melakukan segala amal kebajikan menuju pada tegaknya agama Allah. Bentuknya tentu begitu banyak, termasuklah membelanjakan harta untuk dipergunakan membangun sekolah, madrasah, menggaji guru yang mengajarnya, melengkapi sarana dan prasarana sekolah sesuai dengan kebutuhan. Segala upaya sungguh-sungguh sesuai anjuran syariat Islam juga termasuk ke dalam makna jihad fi sabilillah. Wallahu a’lam bissawab.

Waspada, Jumat 20 Januari 2012