Issuu on Google+

Shalat Jumat Di Mana? Lihat halaman C8

WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

JUMAT, Wage, 1 April 2011/26 Rabiul Akhir 1432 H

No: 23463 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,-

Dua Masjid Di Asahan Terbakar Kapolres: Akibat Arus Pendek Listrik AEKKANOPAN (Waspada) : Dua masjid di Kecamatan Aekkuasan, Kabupaten Asahan, diduga dibakar orang tak dikenal, Kamis (31/3) dinihari. Masjid Jami At Taqwa yang terletak di Jalinsum Kelurahan Aekloba Pekan hangus pada bagian mihrab dan mimbar serta sejumlah sajadah dan Al Quran hangus terbakar. Masjid Nur Hikmah yang terletak di Dusun V Desa Aekloba mengalami kerusakan lebih parah.Kerugian lebih seratus juta. Menurut Nazir Masjid Jami’ At Taqwa, Khairul Hasbi di TKP, dirinya mengetahui terjadinya kebakaran sekitar pukul 01:15, karena diberi tahu oleh warga yang mendapatkan informasi dari seorang warga Aekkanopan bernama Fauzan yang melintas di sana. “Kebakaran mengakibatkan mimbar, perangkat sound system, VCD berikut sejumlah sajadah dan kitab Al Quran hangus. Sedangkan mihrab dan langit-langit masjid menjadi hitam karena asap. Kerugian akibat kebakaran ini diperkirakan Rp20 juta,” katanya. Menurut Khairul, pelaku diduga masuk melalui jendela setelah membuka kaca nako yang tidak memiliki jerjak. Baru setelah di dalam masjid, pelaku yang belum diketahui identitasnya itu melakukan aksinya yang membuat heboh masyarakat setempat. Sementara di Masjid Nur Hikmah, kondisinya lebih parah lagi. Seluruh sajadah dan kitab Al Quran sekitar 50 buku habis

Waspada/Syahri Ilham Siahaan

MASJID Nur Hikmah di Desa Aekloba yang kubahnya sudah roboh ke bawah akibat kebakaran, Kamis (31/3).

Waspada/Syahri Ilham Siahaan

Waspada/Syahri Ilham Siahaan

Lanjut ke hal A2 kol. 6

KUBAH Masjid Nur Hikmah yang jatuh akibat kebakaran, Kamis (31/3). Warga menjadi heboh akibat peristiwa itu.

MIHRAB Masjid Jami’ At Taqwa di Kelurahan Aekloba Pekan gosong dan hitam karena kebakaran, Kamis (31/3).

9 Fraksi Keroyok Gatot ‘Saya Akan Berkoordinasi’ MEDAN (Waspada): Penjabat (Pj) Gubsu Gatot Pujonugroho menegaskan dirinya akan berkoordinasi dengan DPRD Sumut terkait pelaksanaan tugas gubernur termasuk pengisian pejabat definitif dan kekosongan jabatan sekitar 200-an eselon III yang tersebar di berbagai Satuan Kerja Perangkat Daerah (SKPD). “Saat ini masih ada perbedaan persepsi maupun pemahaman terkait kewenangan saya dalam menjalankan tugas-tugas gubernur. Karena itu, terlebih dahulu saya akan berkoordinasi dengan DPRD Sumut terkait kewenangan itu,” kata Gatot, Kamis (31/3). Namun, kata Gatot, dirinya akan terus melakukan evaluasi terkait masih ada pejabat-pejabat belum defenitif di jajaran Pemprovsu, termasuk satu posisi eselon II di Dinas Tenaga Kerja dan Transmigrasi Sumut (Disnakertrans) yang saat ini dijabat Plt. Ketika ditanya apakah status Plt eselon III itu menjadi penyebab lambatnya serapan APBD yang sampai saat ini masih ada SKPD yang baru menyerap 3%, Gatot mengatakan, dari rapat evaluasi dengan pimpinan SKPD, tidak ada terungkap permasalahan itu ada pada jabatan yang masih Plt. Masalah lain adalah jabatan baru Gatot Pujonugroho sebagai orang nomor satu di Pemprovsu pasca ditetapkannya status terdakwa kepada Gubsu nonaktif sementara, Syamsul Arifin dalam kasus korupsi APBD Langkat 2000-2007 Rp102,7 miliar dikomentari beragam. Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Sembilan dari 10 fraksi di DPRD Sumut ‘’mengeroyok’’ Gatot Pujonugroho. Fraksi-fraksi itu menilai Penjabat Gubsu itu menyimpan dendam pada Gubsu nonaktif Syamsul Arifin. Sembilan fraksi DPRD Sumut, Kamis (31/3), berkumpul memberikan penjelasan kepada wartawan di gedung dewan. Mereka mengaku terkejut mendengar pernyataan Gubsu nonaktif Syamsul Arifin yang

belum menerima surat pemberhentian sementaranya sebagai Gubsu. Padahal surat tersebut telah dititipkan Sekretaris Mendagri kepada Pj Gubsu Gatot Pujonugroho. Kesembilan pimpinan fraksi

yang berkumpul hari itu di antaranya Budiman Nadapdap (FPDIP), Hardi Mulyono (FPG), Fadli Nurzal (FPPP), Muslim Simbolon (FPAN), Tunggul Siagian (FPD), Restu Sarumaha (FPPRN), Hamamisul Bahsan (Fraksi Hanura). Hadir juga Wakil Ketua dari FPDIP M.Affan dan sejumlah pimpinan fraksi lainnya. Hanya FPKS yang tidak ikut ‘’mengeroyok’’ Gatot Pujonugroho.

Ketua Fraksi PDIP Budiman Nadapdap, mengatakan, Rabu (30/3) delapan fraksi (kecuali PKS dan PD) bertemu dengan Gubsu nonaktif Syamsul Arifin di rumah tahanan Salemba, Jakarta. Tujuannya untuk bersilaturahim pasca keluarnya SK non aktif Syamsul Arifin dan pengangkatan Gatot Pujonugroho sebelumnya Wagubsu menjadi Lanjut ke hal A2 kol. 2

Waspada/Hamdani

Waspada/Hamdani

Zumiran alias Birin

Suriadi alias Adi.

Vatikan: Serangan Sekutu Tewaskan 40 Warga Sipil

LENTERA

Jalan Lurus Oleh H. Ameer Hamzah Tunjukilah kami ya Allah ke jalan yang lurus Jalan yang Engkau limpahkan kepada orang-orang yang Engkau beri nikmat, Bukan jalan orang-orang yang Engkau murkai dan sesat. (QS. al-Fatihah:6-7) MENURUT para mufassirin, jalan lurus itu adalah Syariat Islam. Orang-orang yang berpegang teguh dengan syariat Islam itulah yang selalu berada di atas jalan lurus. Mereka tidak mensyarikatkan Allah, tidak mengingkari Nabi Muhammad sebagai Rasulullah. Rajin mendirikan shalat dengan kusyuk, puasa bulan Ramadhan, mengeluarkan zakat, membantu fakir miskin yang membutuhkan bantuan, memelihara kemaluannya dari perbuatan zina, menolak riba, tidak mau melanggar hak-hak asasi manusia, tidak mau berjudi dan minum tuak. Naik haji bila sudah ada kesanggupan. Lanjut ke hal A2 kol. 6

Saksi Kenali Wajah Pelaku MEDAN (Waspada): Seorang baby sitter yang berada di dalam mobil pasangan Kho Wie To alias Suwito, 36, dan Dora Halim, 32, warga Jalan Akasia I, Kel. Durian, Kec. Medan Timur, mengaku mengenali wajah pelaku penembakan. Informasi di Polresta Medan, Kamis (31/3), saksi waktu kejadian duduk di jok belakang bersama anak korban Cristopin yang betis kakinya terserempet peluru. Sedangkan saksi A, kakinya terkena serpihan kaca mobil yang terkena tembakan. Menurut saksi A yang menjalani pemeriksaan di Reskrim

Unit Jahtanras Polresta Medan, waktu kejadian, dua pria yang mengenakan jaket hitam, tanpa mengenakan tutup kepala atau wajah dengan ciri-ciri tinggi sedang langsung memberondong tembakan dari depan dan mengenai kaca. Setelah itu keduanya bergerak ke samping kiri dan kanan dan menembaki kaca mobil. Saat penembakan itu, saksi mendengar majikan laki-lakinya menyebutkan, “sudah lah” kepada pelaku agar tidak menembak lagi. Lanjut ke hal A2 kol. 1

Sidang Lanjutan Perampokan CIMB

Tim Advokasi: Tak Terkait Teroris

Konflik Libya

ROMA, Italia (Waspada): Sedikitnya 40 warga sipil tewas dalam serangan udara yang dilakukan pasukan Barat di Tripoli, demikian pejabat senior Vatikan di ibukota Libya melaporkan kepada kantor berita Katholik, Kamis (31/3), mengutip keterangan sejumlah saksimata “Apa yang disebut serangan kemanusiaan itu ternyata telah menewaskan puluhan warga sipil di beberapa desa Tripoli,” kata Giovanni Innocenzo Martinelli, Vikaris Apostolik Tripoli. “Saya telah mengutip keterangan sejumlah saksi yang dapat dipercaya. Terutama di kawasan Buslim, sehubungan dengan pengeboman, satu gedung sipil ambruk setelah terkena serangan, yang menyebabkan sekira 40 orang tewas,” katanya kepada Fides, kantor berita yang menjadi perpanjangan tangan misionari Vartikan. Lanjut ke hal A2 kol. 3

Kasus Pembunuhan Pasutri

Waspada/Hamdani

Waspada/Hamdani

Nibras alias Arab.

ABU Yasin satu dari delapan tersangka kasus perampokan CIMB Niaga Medan dan penyerangan Mapolsekta Hamparan Perak sedang berjalan menuju mobil tahanan seusai menjalani persidangan di Pengadilan Negeri Medan, Kamis (31/3).

Waspada/Hamdani

Ghazali alias Abu Yasin

Kolektor Citibank Jadi Tersangka Tewasnya Sekjen PPB JAKARTA (Waspada): Polda Metro Jaya memperdalam kasus tewasnya nasabah kartu kredit Citibank, Sekretaris Jenderal Partai Pemersatu Bangsa (PPB) Irzen Octa, 50. Kasus kematian Irzen yang diduga dianiaya 3 tersangka,

seorang adalah karyawan dan 2 orang kolektor (penagih utang) bank itu. Penyidikannya ditangani Polres Metro Jakarta Selatan. “Polres Jakarta Selatan sedang menelaah apakah ada tindak pidana yang terjadi dalam kasus itu dan kita back up untuk

terus diperdalami,” kata Kabid Humas Polda Metro Jaya, Kombes PoL Baharuddin Djafar kepada wartawan Jakarta, Kamis (31/3). Kasus dugaan penganiayaan yang terjadi di Menara Jamsostek, di salah satu ruang

Malaysia Haramkan Poco-poco MEDAN (Waspada): Malaysia mengharamkan tarian poco-poco.Tarian pergaulan poco-poco yang tenar di Indonesia pada awal tahun 2000-an, ternyata juga populer di Malaysia. Di acara mana pun di negeri jiran, apalagi jika ada orang Indonesia yang hadir, hampir pasti tarian pocopoco ditampilkan. Lanjut ke hal A2 kol. 1

kantor penagihan atau kolektor Citibank, polisi resmi menetapkan B (karyawan penagihan), H dan D (kolektor) sebagai tersangka dan kini dijebloskan ke Rutan Polres Metro Jakarta Selatan. Lanjut ke hal A2 kol. 6

MEDAN (Waspada): Majelis Hakim Pengadilan Negeri (PN) Medan, Kamis (31/3), kembali mengadili tujuh terdakwa kasus perampokan Bank CIMB Niaga Medan, dan penyerangan ke Mapolsekta Hamparan Perak. Kasus itu tidak terkait teroris. Sementara ketatnya pengamanan masih tetap seperti sidang perdana, Selasa (29/3). Ketujuh terdakwa memakai pakaian muslim dan bukan baju tahanan atau sama seperti terdakwa lainnya pada persidangan perdana. Ketujuh terdakwa yang diadili adalah Anton Sujarwo alias Supriyadi alias Iqbal alias Abu Farahat bin Sunardi, Nibras alias Arab alias Amir alias Wawan, Suriadi alias Adi alias Saad , Abdul Gani Siregar alias Gani, Pautan alias Robi dan Khairul Ghazali alias AbuYasin, Pamriyanto alias Suryo Putro.

128 Pengungsi Myanmar Ditempatkan Di Hotel MEDAN (Waspada): 128 Manusia perahu asal Myanmar yang dikirim pihak imigrasi ke Medan, ditempatkan di Hotel Pelangi Jl. Letjen Jamin Ginting, Padangbulan, Kamis (31/3). Para pengungsi sempat terkatung-katung di tengah laut lepas selama enam belas hari dan diselamatkan nelayan Indonesia dengan menggiring ke Aceh. Beberapa hari di Lanjut ke hal A2 kol. 6 Waspada/Mursal AI

Bapeten Jamin Radiasi Nuklir Tak Ke Indonesia MEDAN (Waspada): Kepala Badan Pengawas Tenaga Nuklir (Bapeten) Dr. As Natio Lasman (foto) berani menjamin radiasi nuklir PLTN Fukushima Jepang tidak sampai ke Indonesia, apalagi ke Sumut. ilustrasi/net

Lanjut ke hal A2 kol. 3

Sebelumnya, dalam kasus serupa, PN Medan mengadil enam terdakwa . Dengan demikian, semua terdakwa yang berjumlah 13 orang, sudah menjalani persidangan perdana. Mereka kembali diadili dengan agenda mendengarkan eksepsi dari kuasa hukumnya. Lanjut ke hal A2 kol. 3

TKW Itu Tewas Saat Mencuci Baju UNTUNG tak dapat diraih, malang tak dapat ditolak. Mungkin itulah yang terjadi pada Ria Safitri, seorang Tenaga Kerja Wanita (TKW) asal Jawa Tengah. Dia tewas saat bekerja pada majikannya di Singapura. Ria tewas setelah terjatuh dari jendela dapur apartemen lantai tujuh di Queenstown, Singapura pada 9 September 2010. Setelah melewati proses hukum yang cukup panjang, akhirnya sidang pengadilan koroner memastikan kematian Ria akibat kecelakaan. Wanita berumur 23 tahun itu tewas sekitar sejam kemudian di rumah sakit. Hal ini diungkap dalam sidang pengadilan koroner yang digelar, Kamis (31/3), seperti diberitakan media Singapura, The Straits Times. Lanjut ke hal A2 kol. 1

erampang Seramp ang Waspada/Hamdani

PARA warga Myanmar tiba di Hotel Pelangi di Jalan Jamin Ginting, Kamis (31/3).

- Mainkan terus - He...he...he...

Shalat Jumat Dimana? Lihat Hal. C5-C8

WASPADA Demi Kebenaran Dan Keadilan

ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-8. C1-8) z zHarga Eceran: Rp 2.500,-

Saksi Kenali Wajah Pelaku Penembak Kho Wie Dan Istri

GeRAK Indonesia:

Politik Anggaran Daerah Yang Membangkrutkan

Polisi Awasi Bandara Polonia

Lanjut ke hal A2 kol 3

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999)

http://epaper.waspadamedan.com

JUMAT, Wage, 1 April 2011/27 Rabiul Akhir 1432 H z No: 23463 * Tahun Ke-65

MEDAN (Waspada): Seorang baby sister yang berada di dalam mobil pasangan Kho Wie To alias Suwito, 36, dan Dora Halim, 32, warga Jalan Akasia I, Kelurahan Durian, Kecamatan Medan Timur, mengaku mengenali wajah pelaku penembakan. Informasi di Polresta Medan, Kamis (31/3), saksi waktu kejadian duduk di jok belakang bersama anak korban Cristopin yang betis kakinya terserempet peluru. Sedangkan saksi A, kakinya terkena serpihan kaca mobil yang terkena tembakan. Menurut saksi A yang menjalani pemeriksaan di Reskrim Unit Jahtanras Polresta Medan, waktu kejadian, dua pria yang mengenakan jaket hitam, tanpa mengenakan tutup kepala atau wajah dengan ciri-ciri tinggi sedang langsung memberondong tembakan dari depan dan mengenai kaca. Setelah itu keduanya bergerak ke samping kiri dan kanan dan menembaki kaca mobil. Saat penembakan itu, saksi mendengar majikan laki-lakinya menyebutkan, “sudah lah” kepada pelaku agar tidak menembak lagi. Usai melakukan aksinya, kedua pelaku kabur meninggalkan lokasi. Sedangkan saksi A, membawa anak majikannya keluar dari mobil. Tidak berapa lama berdatangan warga dan polisi, kemudian mengevakuasi pasangan suami isteri yang diduga sudah meninggal ke RS Gleni di Jalan Listrik Medan. Kasat Reskrim Kompol Fadillah Zulkarnaen yang dikonfirmasi melalui Wakasat Reskrim AKP Ruruh Wicaksono mengatakan, dalam kasus ini sudah ada beberapa

Harian Umum Nasional Terbit Sejak 11 Januari 1947

Waspada/Muhammad H. Ishak

CUACA EKSTRIM: Dalam sepekan terakhir kondisi cuaca di Provinsi Aceh, kian memburuk. Akibatnya, nelayan tak melaut, disebabkan ombak melebihi 3 meter disertai angin kencang terus mengancam, sehingga stok ikan kosong di beberapa titik di Aceh. Sementara ikan yang didatangkan dari luar harganya disesuaikan. Tampak seorang pengguna jalan melintas di depan Masjid Besar Baitul Muttaqin Idi Cut, Kec. Darul Aman, Kab. Aceh Timur, Kamis (31/3) sekira pukul 17:00. Menurut warga, cuaca ekstrim itu terjadi setiap hari sejak pukul 16:00 .

BANDA ACEH (Waspada): Gerakan Rakyat Anti Korupsi (GeRAK) Indonesia menilai, kebangkrutan anggaran di sejumlah kabupaten/kota di Provinsi Aceh dipicu beberapa pokok persoalan dalam manajemen pemerintahan, salah satunya kegagalan melakukan terobosan dalam implikasi baik perencanaan maupun pelaksanaan atas anggaran APBK. Hal lainnya adalah dampak dari proses kegagalan dalam mentransformasikan kerja-kerja pemerintahan yang baik dan taat hukum, di sisi lain dampak dari pengaruh tekanan politik di luar struktur kekuasaan dalam pemerintah juga menjadi bagian yang tak dapat dipisahkan, sehingga menyebabkan beberapa daerah saat ini rentan dan miskin anggaran. Ketua Presidium GeRAK Indonesia, Akhirudin Mahjudin, kepada Waspada, Kamis (31/3), mengatakan, kegagalan anggaran di suatu daerah dipicu secara mutlak oleh kesalahan yang terstruktur dilakukan oleh eksekutif dalam perencanaan anggaran yang tidak taat pada azas aturan perundang-undangan misalnya tidak mempedomani UU No 32 Tahun 2004 tentang Pemerintah Daerah dan Permendagri No 13 tahun 2006 jo Permendagri 59 tahun 2007 tentang Keuangan Daerah. “Selain itu, karena pemerintah daerah juga tidak menentukan skala prioritas yang jelas dalam pelaksanaan anggaran tahunan dan kondisi ini sendiri erat kaitannya dengan tekanan dari pihak-pihak tertentu yang cukup berkepentingan dalam anggaran,” imbuhnya. Menurut Akhirudin, ada dua sisi tekanan yang dapat memicu anggaran daerah bermasalah, diantaranya tekanan dari tim sukses pada saat Pemilukada, di mana hampir sebagian para pendukung menuntut Lanjut ke hal A2 kol 7

Dua Masjid Di 9 Fraksi DPRDSU Asahan Terbakar Keroyok Gatot Kapolres: Akibat Arus Pendek Listrik

A E K K A N O PA N (Waspada): Dua masjid di Kecamatan Aekkuasan, Kabupaten Asahan, diduga dibakar orang tak dikenal, Kamis (31/3) dinihari. Masjid Jami At Taqwa yang terletak di Jalinsum Kelurahan Aekloba Pekan hangus pada bagian mihrab dan mimbar serta sejumlah sajadah dan Al Quran hangus terbakar. Masjid Nur Hikmah yang terletak di Dusun V Desa Aekloba mengalami kerusakan lebih parah. Kerugian lebih seratus juta. Lanjut ke hal A2 kol 1

Waspada/Syahri Ilham Siahaan

SEORANG anggota TNI AD berjalan keluar dari Masjid Nur Hikmah di Desa Aekloba yang kubahnya sudah roboh ke bawah akibat kebakaran, Kamis (31/3).

Kasus Perambahan Hutan

Mantan Kadishut Tobasa Divonis Bebas BALIGE (Waspada): Mantan Kepala Dinas Kehutanan dan Perkebunan Alden Napitupulu dalam sidang terakhir di Pengadilan Negeri (PN) Balige, Rabu (30/3) divonis bebas dari segala tuntutan hukum karena tidak cukup bukti atas dugaan kasus perambahan hutan. Namun, sebelumnya terdakwa sempat menjalani

penahanan selama pemeriksaan di Poldasu dan Kejari Balige. Ketua Majelis Hakim David Sitorus didampingi anggota majlis hakim Jhonson Sirait dan Andita dalam putusan setebal 256 halaman selama 2 jam lebih mengatakan, terdakwa tidak terbukti melakukan perbuatan yang didakwakan Jaksa Penuntut

Umum (JPU) KR Tamba, sehingga nama terdakwa mesti direhabilitasi. Sebelumnya JPU KR Tamba menuntut terdakwa Alden Napitupulu selama 1 tahun kurungan penjara karena perbuatannya yang menerbitkan Izin Pemanfaatan Kayu Tanah Milik (IPKTM) pada lokasi Lanjut ke hal A2 kol 1

TAPAKTUAN (Waspada): Sekira 200 warga beberapa desa di Kecamatan Labuhanhaji Timur, Kabupaten Aceh Selatan, Kamis (31/3) menggelar aksi demo ke kantor Camat di kawasan Peulumat, ibukota Kecamatan Labuhanhaji Timur. Mereka menolak kehadiran perusahaan tambang emas PT Bintang Agung Minim (BAM), karena dampaknya sangat merugikan masyarakat. Meski perusahaan itu saat ini masih dalam survey alias eksplorasi. Kahadiran ratusan pendemo disambut Camat Labuhanhaji Timur, Drs. Rahmatuddin, M.Si didampingi unsur

Lanjut ke hal A2 kol 1

Muspika dan tokoh-tokoh masyarakat setempat. Aksi demo berlangsung damai dan tertib, dikawal ketat aparat Polsek dan Koramil Labuhanhaji Timur. Dengan mengusung spanduk dan pamplet berisi menolak kehadiran perusahaan tambang emas tersebut, pendemo juga berorasi mengecam keberadaan perusahan tersebut seraya minta aparat kecamatan dan kabupaten meninjau ulang rekomendasi perizinannya. Se l a i n m e r u s a k l i n g kungan, keberadaan PT BAM Lanjut ke hal A2 kol 7

Waspada/Hamdani

SALAH seorang dari delapan tersangka kasus perampokan CIMB Niaga Medan dan penyerangan Mapolsekta Hamparan Perak sedang menjalani persidangan di Pengadilan Negeri Medan, Kamis (31/3).

Sidang Lanjutan Perampokan CIMB, Tidak Terkait Teroris

WAKIL Bupati Paluta H Riskon Hasibuan bersama Ketua Komisi II DPRD Paluta,Gusman Efendi Siregar sedang memperlihatkan hama tikus hasil buruannya, Kamis (31/3).

Abu Farahat bin Sunardi, Nibras alias Arab alias Amir alias Wawan, Suriadi alias Adi alias Saad, , Abdul Gani Siregar alias Gani, , Pautan alias Robi dan Khairul Ghazali alias Abu Yasin, Pamriyanto alias Suryo Putro. Sebelumnya, dalam kasus serupa, PN Medan mengadil enam terdakwa. Dengan demikian, semua terdakwa yang berjumlah 13 orang, sudah menjalani persidangan perdana. Mereka kembali diadili dengan agenda mendengarkan eksepsi dari kuasa hukumnya. Proses persidangan tetap dengan pegamanan ketat oleh polisi dan Brimob. Kendaraan taktis masih terlihat diparkirkan di depan dan belakang gedung PN. Pemeriksaan terhadap pengunjung masih diberlakukan. Pengamatan Waspada, pada persidangan digelar terpisah itu, UU Nomor 15 Tahun

Tikus Rusak 200 Ha Sawah Di Paluta

Serampang

GUNUNGTUA (Waspada): Puluhan petani di Desa Gunungtua Tonga, Kecamatan Padang Bolak, Kabupaten PadangLawas Utara memberantas hama tikus yang sering merusak tanaman padi warga. Sejauh ini sekitar 200 hektare areal persawahan di wilayah Paluta rusak diluluhlantak tikus. Lanjut ke hal A2 kol 5

- Anjing menggonggong Kafilah pikir-pikirlah ! .... - He.... he....he....

MEDAN (Waspada): Majelis Hakim Pengadilan Negeri (PN) Medan, Kamis (31/3), kembali mengadili tujuh terdakwa kasus perampokan Bank CIMB Niaga Medan, dan penyerangan ke Mapolsekta Hamparan Perak. Kasus itu tidak terkait teroris. Sementara temperatur

pengamanan masih tetap seperti sidang perdana, Selasa (29/3). Ketujuh terdakwa memakai pakaian muslim dan bukan baju tahanan atau sama seperti terdakwa lainnya pada persidangan perdana. Ketujuh terdakwa yang diadili adalah Anton Sujarwo alias Supriyadi alias Iqbal alias

Menlu Libya Membelot, Minta Perlindungan

Jalan Lurus Oleh: H. Ameer Hamzah Tunjukilah kami ya Allah ke jalan yang lurus Jalan yang Engkau limpahkan kepada orang-orang yang Engkau beri nikmat, Bukan jalan orang-orang yang Engkau murkai dan sesat (QS. al-Fatihah:6-7)

Lanjut ke hal A2 kol 2

Sembilan fraksi DPRD Sumut, Kamis (31/3), berkumpul memberikan penjelasan kepada wartawan di gedung dewan. Mereka mengaku terkejut mendengar pernyataan Gubsu nonaktif Syamsul Arifin

Tolak PT BAM, Ratusan Warga Labuhanhaji Timur Demo Camat

Al Bayan

MENURUT para mufassirin, jalan lurus itu adalah Syariat Islam. Orang-orang yang berpegang teguh dengan syariat Islam itulah yang selalu berada di atas jalan lurus. Mereka tidak mensyarikatkan Allah, tidak mengingkari

MEDAN (Waspada): Sembilan dari 10 fraksi di DPRD Sumut ‘mengeroyok’ Gatot Pujonugroho. Fraksi-fraksi itu menilai Penjabat Gubsu itu menyimpan dendam pada Gubsu nonaktif Syamsul Arifin.

Tarian poco-poco.

Malaysia Haramkan Poco-Poco Mengandung Elemen Kristiani Dan Pemujaan Roh Jamaika

MEDAN (Waspada): Malaysia mengharamkan tarian poco-poco.Tarian pergaulan poco-poco yang tenar di Indonesia pada awal tahun 2000-an, ternyata juga populer di Malaysia. Di acara mana pun di negeri jiran, apalagi jika ada orang Indonesia yang hadir, hampir pasti tarian poco-poco ditampilkan. Lanjut ke hal A2 kol 2

LONDON (Antara/ Reuters/AFP): Menteri Luar Negeri Libya Moussa Koussa (foto) tiba di Inggris, Rabu (30/3) untuk meminta perlindungan setelah meninggalkan pemerintah sebagai protes terhadap serangan pasukan Moammar Khadafi pada warga sipil, seorang teman Lanjut ke hal A2 kol 5

Waspada/Sori Farlah Harahap

Bupati Berburu Tikus

Lanjut ke hal A2 kol 5

Berita Utama

A2 Saksi Kenali ... Usai melakukan aksinya, kedua pelaku kabur meninggalkan lokasi. Sedangkan saksi A, membawa anak majikannya keluar dari mobil. Tidak berapa lama berdatangan warga dan polisi, kemudian mengevakuasi pasangan suami isteri yang diduga sudah meninggal ke RS Gleni di Jalan Listrik Medan. Kasat Reskrim Kompol Fadillah Zulkarnaen yang dikonfirmasi melalui Wakasat Reskrim AKP Ruruh Wicaksono mengatakan, dalam kasus ini sudah ada beberapa saksi yang dimintai keterangan selain tiga saksi dari pembantu korban dan baby sitternya, ada seorang pegawai korban, tukang sate. “Polisi sampaisaatinimasihmengumpulkan keterangan saksi-saksi,” jelasnya. Senjata FN dan Barreta Informasi di lapangan, kedua eksekutor menggunakan senjata api jenis FN dengan peluru kaliber 4,5 mm dan Barreta dengan kaliber peluru 2,9 mm. Namun sejauh ini pihak kepolisian belum berani menyebutkan jenis senjata apa, dengan alasan menunggu hasil Labfor Polri Cabang Medan yang sedang menguji balistik peluru yang ditemukan di lokasi kejadian. Sedangkan kemarin, dari lokasi kejadian, polisi menemukan lagi 3 peluru dan hari pertama ditemukan 27 peluru. Kini peluru tersebut diamankan ke Labfor Polri Cabang Medan di Polda Sumut. Kapolresta Medan Kombes Tagam Sinaga yang ditanya perkembangan kasus ini belum bisa memberikan keterangan dengan alasan belum berani banyak ngomong karena belum berhasil mengungkap kasus ini.”Tunggu berhasil dulu la. Sabar ya,” jelasnya. Antisipasi pelarian Untuk mencari keberadaan pelaku pembunuhan suami istri itu, petugas Polresta Medan mengawasi Bandara Polonia, sekaligus mengecek daftar penumpang pesawat. Langkah itu dilakukan untuk mengantisipasi kemungkinan pelarian pelaku melalui transportasi udara. Penjagaan di Bandara Polonia itu atas instruksi Kapoldasu Irjen Pol Wisnu dan Kapolresta Medan Kombes Pol Tagam Si-

TKW Itu Tewas ... State Coroner Victor Yeo menyatakan, Ria tanpa sengaja jatuh saat sedang mengerjakan tugasnya mencuci baju. Tubuhnya terhempas ke lantai dasar. Dalam insiden tersebut, polisi yang mendatangi tempat kejadian perkara menemukan seember pakaian basah di samping mesin cuci di dapur yang jendela-jendelanya terbuka. Dalam sidang koroner ter-

Malaysia Haramkan ... Menurut Mufti Perak, Tan Sri Harussani Zakaria yang mengatakan pihaknya, Jawatan kuasa Fatwa Negeri Perak, telah mengeluarkan fatwa bahwa tarian poco-poco haram. Alasannya, Harussani mengatakan, tarian tersebut memiliki elemen Kristiani. Langkah pocopoco ke kanan, kiri, depan belakang dianggap merepresentasikan bentuk salib. Selain itu, poco-poco juga dianggap mengandung unsur pemujaan terhadap roh yang sering dilakukan di Jamaika. Menanggapi fatwa tersebut, Menteri Besar Perak Datuk Seri Dr Zambry Abdul Kadir mengatakan, kerajaan akan mematuhi fatwa tersebut. Namun, fatwa haram poco-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur:

ungkap bahwa Ria baru mulai bekerja di rumah tersebut pada Juli 2010.Tugas utama Ria adalah mengasuh bayi perempuan berumur 3 bulan yang merupakan putri majikannya. Awalnya, keluarga mengalami beberapa masalah dengan Ria. Sebagian alasan dikarenakan hambatan bahasa. Majikan Ria sempat terpikir untuk mengganti Ria, namun kemudian berubah pikiran setelah melihat cara kerja dan perilaku Ria yang membaik.(Rizal/mujo) poco jadi polemik di Malaysia. Menanggapi keputusan para ulama Perak, mantan Mufti Perlis, Prof Madya Dr Mohd Asri Zainul Abidin justru menganggap, fatwa haram poco-poco tak wajar. “Jika dianggap sebagai tarian yang baik bagi kesehatan, tanpa unsur kepercayaan dan tidak mengandung unsur haram seperti minuman keras dan seks bebas, secara syariat itu dibolehkan,” katanya, Kamis (31/3). “Jika memang ada unsur yang salah, hendaknya meniru Nabi Muhammad, buang unsur yang buruk itu, pertahankan yang baik,” tambahnya. Sebelumnya, ulama negeri jiran itu juga pernah mengeluarkan fatwa haram yoga. Ketua Dewan Fatwa Nasional, Abdul Shukor Husin, mengatakan yoga telah dipraktikkan oleh masyarakat Hindu selama ribuan tahun. Kegiatan ini dianggap menyatukan gerakan fisik dan elemen keagamaan Hindu berupa nyanyian dan pujian, dengan tujuan “bersatu dengan Tuhan”. (VN/m03)

1. ......, Ke3+.

9 Fraksi Keroyok ...

2. Rh3, Mxh5+.

Pj Gubsu. ‘’Itu juga merupakan etika politik Parpol terhadap Gubsu nonaktif,’’ katanya. Namun kemudian, kata Budiman Nadapdap, mereka sangat terenyuh mendengar pernyataan Syamsul Arifin yang mengaku belum menerima surat pemberhentian dirinya. Padahal menurut pengakuanWakil Ketua DPRD Sumut M.Affan, surat itu sudah dititipkan Sekretaris Mendagri kepada Gatot Pujonugroho untuk disampaikan kepada Syamsul Arifin. ‘’Usai menerima SK itu, saya sempat berkelakar lagi dengan mengatakan: ‘’mumpung kita di Jakarta, kita langsung saja mampir ke Salemba,’’ kata Affan. Kepada pimpinan fraksi yang berkunjung ke Salemba, kata Budiman Nadapdap, Syamsul Arifin merasa terpukul dengan perlakuan Gatot seperti itu. ‘’Malah Pak Syamsul bilang: kalau memang saya begitu baunya, Gatot kan bisa menutup hidungnya saat mengantarkan surat saya itu,’’ kata Nadapdap menirukan ucapan Syamsul. Berkaitan dengan peristiwa itu, para pimpinan fraksi berkesimpulan Gatot Pujonugroho tidak memiliki etika dan budaya politik sepertinya dia masih menyimpan dendam kepada Syamsul Arifin. Yang lebih parah dari itu, Gatot dinilai tidak

3. Gh4, MxG+mat.

Jawaban TTS: TTS Topik

Mimbar Jumat (Muat Ulang)

A L- F A S B A K I S K R A A J H A N N W A H

A T I H A H L A L- A N' D A H I S M A A A B A L N U U I N S Y I S P A D A I I B N U S I B A N O A H A H M

M A N I A M E S I L K A Y A R T O A A L L L O B G A I N A I A D I Y

N A L I A F T

A H A R S F I A A H

Jawaban Sudoku: 2 7 9 6 5 3 1 8 4

naga yang disebut-sebut sudah melakukan rapat koordinasi untuk mengungkap para pelaku kejahatan sadis tersebut. Kepala Pos Polisi Bandara Polonia Aiptu Saut Sihombing dan AKP Prianto yang dihubungi wartawan di Bandara Polonia, kemarin mengakui, pihaknya secara intensif mencari data-data penumpang untuk mengetahui, apakah ada pelaku diantara penumpang masuk ke Medan, dalam beberapa hari terakhir sebelum kejadian pembunuhan itu. Selain itu pihaknya berusaha memperoleh data manifest (penumpang) pesawat-pesawat yang berangkat sehari setelah hari kejadian. “Tapi kita mengalami kesulitan mendapatkan manifest penumpang terutama untuk tanggal mundur atau beberapa hari sebelum kejadian karena pihak penerbangan perlu mendapatkan surat permintaan resmi,” kata Prianto. Pantauan wartawan, beberapa petugas dari Polresta Medan dan Poldasu berpakaian preman terlihat berjaga-jaga di Bandara Polonia hingga malam hari. Ikan bakar Sementara itu, puluhan pelayat datang silih berganti ke Yayasan Balai Sosial Angsapura di JalanWaja Medan, Kamis siang, untuk memberikan penghormatan terakhir kepada jenazah Kho Wie To, dan istrinya Dora Halim. Jenazah kedua korban disemayamkan di BlokVIP 4-5. Rencananya, jenazah suami istri tersebut, Jumat (1/4), dibawa ke krematorium di Jalan Medan-Tanjungmorawa untukdikremasikan. Pantauan Waspada, para pelayat umumnya kerabat keluarga,relasidanrekanbisnisyang berasal dari Pelabuhan Belawan. A Boi, 44, seorang rekan korban mengaku sangat kehilangan atas kematian pemilik gudang ikantersebut,sebabselainramah, Kho Wie To memiliki jiwa sosial tinggi. Dia akan membawa ikanikan segar bila kami memesannya bila ada acara bakar ikan. Menurut A Boi, korban memang jarang bergaul dengan warga di sekitar rumahnya karenatiapharipulangnyamalamhari, namun bila warga datang meminta bantuan dia selalu membantu setiap warga dan Kepala Lingkungan. (m39/m32/h04)

5 4 6 7 8 1 3 9 2

1 3 8 2 4 9 5 7 6

8 5 1 9 6 7 4 2 3

7 2 4 1 3 5 8 6 9

9 6 3 8 2 4 7 5 1

6 1 7 3 9 8 2 4 5

3 9 5 4 7 2 6 1 8

4 8 2 5 1 6 9 3 7

saya tegaskan, ini kriminal murni, bukan kasus terorisme,” tegas Irsad. Menurut Irsyad, persoalan ini juga menjadi alasan mereka mengajukan eksepsi atau keberatan atas dakwaan.”Ada delapan terdakwa kita ajukan eksepsi, dua lagi, tidak karena materi dakwaannya, kami rasa tidak perlu dikoreksi, “ tegasnya. Pantauan Waspada pada persidangan terdakwa Abdul Gani Siregar alias Gani dan Pautan alias Roby , terungkap penyerangan ke Mapolsekta Hamparanperak bermotif dendam pribadi dari Taufik Hidayat atas penggerebekan yang dilakukan Densus 88 AT di rumahnya yang mengakibatkan rekannya Ridwan tewas . Dihadapan Majelis Hakim diketuai Karto SH, JPU J Simanullang SH Mhum mengatakan, tewasnya Ridwan alias Iwan membuat Taufik Hidayat marah, kemudian merencanakan penyerangan Mapolsek Hamparan Perak. Taufik menghubungi temantemannya termasuk kedua terdakwa untuk berkumpul di Lapangan Bola Kaki di Tanah Enam Ratus Medan Marelan. Pada 21 September, Taufik, bersama terdakwa dan 11 orang lainnya membahas dan menyusun rencana penyerangan itu. Dalam dakwaan itu, Taufik membagi tugas untuk mensukseskan rencana tersebut. Terdakwa Gani bertugas membakar kantor Mapolsek Hamparan

Perak sedangkan, Pautan diberikan pistol jenis FN sebagai tuga melakukan eksekusi tembak. Namun, saat kejadian, senjatanya macet, hingga peran itu diambil alihTaufik Hidayat , Ucok Gultom, dan Saprol menembak mati tiga polisi Polsek Hamparan Perak yang berada di ruangan berbeda. Dalam aksi itu, terdakwa Gani berperan memecahkan kaca Sentra Pelayanan Kepolisian (SPK) Mapolsek Hamparan Perak dan membakar kantor itu. Pada persidangan lainnya, terdakwa Supriyadi yang didakwa menyembuyikan teroris membantah sebagian materi dakwaan.Bahkan menurutnya, adanya pengajian dalam dakwaan itu adalah fitnah.”Tidak ada pengajian, itu fitnah, “ tegasnya. Di samping itu, ia tidak ada melakukan kegiatan teroris. “ Klien kami membatah sebagian dakwaan JPU, khusus mengenai pengajian, secara tegas dibantah Supriyadi, “ tegas M Irsyad Lubis usai persidangan. Menurut Irsayd, terdakwa Supriyadi didakwa menyembuyikan teroris. Kalau dakwaan teroris tidak bisa dibuktikan JPU, maka klien kami harus dibebaskan. “Kalau kasus permpokan dan penyerangan Polsekta H. Perak bukan bagian dari teroris, maka Supriyadi harus bebas, sebab dia didakwa menyembunyikan teroris. Gimana klien kami memberitahukan ke polisi kalau para terdakwa itu teroris, sedangkan dia tidak kenal sama mereka,“ tegasnya. (m49)

untuk memastikan radiasi nuklir tidak masuk ke tubuhnya, WNI yang menerima radiasi paling besar itu dirujuk ke BATAN (Badan Tenaga Nuklir Nasional). “Kalau ada indikasi radiasi nuklir menyentuh seseorang, radiasi nuklir tersebut akan masuk ke tubuhnya, tapi Alhamdulillah negatif,” jelasnya seraya menekankan, radiasi nuklir bukanlah virus.Jika seseorang menerima radiasi nuklir, tidak akan berdampak pada orang lain. Meski sangat kecil kemungkinan masuknya radiasi melalui udara di Indonesia, lanjutnya, Bapeten dan instansi terkait perlu mengawasi masuknya radiasi ke Republik ini. “Karena sudah jadi kewajiban negara ini mengawasi kondisi pekerja, masyarakat dan lingkungan,” jelasnya. ngan udara pada saat mereka berusaha mendorong ke arah barat, menurut pernyataan kementerian luar negeri. Kementerian “menyesalkan tindakan bermusuhan dari negara-negara koalisi Barat, yang memberikan dukungan kepada kelompok-kelompok bersenjata Al-Qaeda di wilayah timur Libya melalui serangan udara untuk memfasilitasi kemajuan geng-geng itu terhadap Ras Lanouf dan Brega.” Pasukan koalisi melakukan serangan udara terhadap pasukan yang setia kepada Khadafi sehingga memungkinkan kekuatan lawan untuk maju ke barat dari kubu timur Benghazi, yang merebut kembali dalam beberapa hari ini kota-kota Ajdabiya, Brega dan Ras Lanuf. (m10)

Mengenai makanan impor dariJepang,kataLasman,Bapeten bekerjasama dengan BBPOM, Kemensos dan lainnya bersepakat makanan dari Jepang harus ada sertifikat bebas radiasi nuklir. Sudah Banyak Dimanfaatkan Dalam bidang kesehatan, nuklir sudah banyak dimanfaatkan untuk terapi, radio diagnostic dan lainnya. Hanya saja, jika dosisnya terlalu tinggi bisa merusak sel-sel tubuh. “Kalau dikenakan pada sel yang sehat, akan merusak sel-sel tubuh itupun jika dosisnya terlalu tinggi. Tetapi sebaliknya, jika ada sel-sel kanker, jika diradiasi maka sel kanker tersebuttidakakantumbuh,”jelasnya. Banyaknya pemanfaatan nuklir dan beragam resikonya, dalam hal ini diperlukan pengawasan yang bertujuan untuk menjamin kesejahteraan, ketentraman, keselamatan dan kesehatan pekerja serta masyarakat. Maka untuk itu, jelasnya, diperlukan rancangan peraturan untuk menjamin kesejahteraan, keselamatan, dan kesehatan pekerja serta masyarakat. Sedangkan, Kepala Dinas Kesehatan Sumut Dr. Chandra Syafei, SpOG yang hadir pada acara tersebut mengemukakan, adanya rancangan peraturan tersebut, Sumber Daya Manusia tentang pemanfaatan nuklir di bidang kesehatan semakin banyak dan berkualitas. “Saat ini SDM kita masih kurang, mudah-mudahan bisa terpengaruh untuk meningkatkan kemampuan,” jelasnya. (h02)

Sementara itu, komentar beragam itu datang dari Gedung Dewan Provinsi Sumut Jalan Imam Bonjol Medan. Sebagian anggota dewan menyebut jabatan baru Gatot sebagai Pelaksana Tugas (Plt) Gubsu dan sebagian lagi menyebut dengan Penjabat (Pj) Gubsu. Komentar yang beragam ini tak urung membuat Gatot sedikit jengah. “Saya sudah sampaikan permintaan kepada DPRD Sumut untuk melakukan pertemuan membahas masalah ini. Alhamdulillah, usai Jumat (1/4) sekitar pukul 14:00, kita akan melakukan pertemuan,” kata Gatot menjawab wartawan usai menghadiri pengukuhan

Guru Besar Fakultas Ekonomi Universitas Methodist Medan kepada Prof Dr Poltak Sinaga, Msi, di Raz Plaza Medan, Kamis (31/3). Jelaskan kepada DPRD Gatot mengaku dalam pertemuan dengan anggota DPRD Sumut itu akan menjelaskan soal kronologis penetapan status baru kepada dirinya oleh Kementerian Dalam Negeri, pasca Syamsul Arifin ditetapkan menjadi Gubsu nonaktif sementara sampai batas waktu habis masa kepemimpinan bersama dirinya sebagaiWakil Gubsu masa bakti 2008-2013. Di pertemuan ini, Gatot akan melakukan konsultasi dan dengar pendapat kepada seluruh anggota DPRD terkait ber-

bagai masalah dan isu strategis di Pemprovsu. “Salah satunya menyangkut kondisi pelantikan 200-an jabatan eselon III di Pemprovsu yang sampai hari ini belum rampung, termasuk beberapan orang jabatan eselon II, karena pejabat lamanya pensiun,” ungkap Gatot. Masalah lain yang kemungkinan besar juga akan dibahas, menurut Gatot terkait soal percepatan pemanfaatan energi panas bumi (Geothermal). Di Sumut saat ini ada potensi energi panas bumi sebesar 3.600 Mega Watt (MW) atau untuk seluruh Indonesia sebesar 27.000 MW yang merupakan 40 persen dari potensi total Geothermal dunia. (m28)

amanah. ‘’Inilah kemudian yang menyatukan hati fraksi-fraksi untuk bersatu,’’ kata Ketua Fraksi Partai Golkar Hardi Mulyono. Sementara itu Ketua Frkasi PPP, partai pengusung Syamsul Arifin-Gatot Pujonugroho (Syampurno) Fadli Nurzal, menyebukan sangat gelisah dengan kondisi seperti ini. Dia khawatir ke depan akan terjadi ketidakharmonisan angara legislatif dan eksekutif karena sikap Pj Gubsu. Sikapnya yang paling meresahkan lagi adalah tentang pernyataannya di surat kabar beberapa hari lalu. Gatot menyebutkan dia akan mengevaluasi sejumlah SKPD. Kata pimpinan fraksi, ini sangat bertentangan dengan arahan Sekretaris Mendagri saat penyerahan SK Plt lalu. Disebutkan M.Affan, saat mendampingi Gatot Pujonugroho ke Kemendagri, Sekretaris Mendagri menyampaikan kepada Plt Gubsu untuk melakukan tiga hal. Yakni melakukan konsolidasi internal, melanjutkan apa yang dilakukan Gubsu non aktif dan selalu berkoordinasi dengan Mendagri. ‘’Dan Gatot dilarang melakukan pergantian pejabat,’’ kata Affan. Ditambahkan Budiman Nadapdap, disharmoni yang terjadi antara Syamsul Arifin dengan Gatot Pujonugroho, jelas sekali terlihat. Kesannya Plt Gubsu ini dendam kepada Syamsul, dan

akan melakukan perombakan Satuan Kerja Perangkat Daerah (SKPD). PDI Perjuangan, kata Budiman Nadapdap, jauh hari sebelumnya telah mengingatkan Gatot untuk meredam isu disharmoni itu. Caranya dengan mendatangi Syamsul Arifin.‘’Tapi Gatot, tetap tidak bersedia. Malah dia menyatakan akan mengevaluasi 14 SKPD yang diangkat Syamsul sebelumnya,’’ kata Budiman Nadapdap. Ultimatum Melihat sikap Plt Gubsu Gatot Pujonugroho, yang sangat keras ini, pimpinan fraksi-fraksi di DPRD Sumut akhirnya mengeluarkan ultimatum. Yakni, agar Gatot Pujonugroho tidak melanggar aturan, etika dan budaya politik. Bila itu, terjadi, disebutkan Hardi Mulyono, akan merugikan masyarakat Sumut. DPRD Sumut sebagai representasinya masyarakat akan terus mengkritisi masalah ini. Harus diingat, kata Hardi, Syampurno telah menetapkan jargon politiknya ‘rakyat tidak lapar’ ‘rakyat tidak bodoh’ ‘rakyat tidak miskin’ dan ‘rakyak punya masa depan’. ‘’Tapi sekarang ini nyatanya rakyat telah sakit. Paling tidak sakit hati,’’ tambah Budiman Nadapdap. Bukan pribadi Gatot Sementara itu, Penasehat FPKS DPRDSU Sigit Pramono

Asri mengatakan, tidak mungkin Plt Gatot Pujonugroho melakukan balas dendam. Alasannya yang pertama, kata Sigit, dendam bukan pribadinya Gatot. Juga di PKS tidak dibenarkan dendam karena akan menjauhkan kebaikan. ‘’Jadi, sangat tidak mungkin ada balas dendam,’’ katanya. Kepada Waspada melalui telefon selular, tadi malam, Sigit Pramono Asri mengatakan hal yang wajar dilakukannya pertemuan para pimpinan fraksi. Dari Ketua FPKS Hidayatullah, Sigit mendengar kalau PKS tidak diajak dalam pertemuan itu. ‘’Tapi tidak masalah. Asal dialognya dilakukan dengan rasional. Bukan emosional,’’ katanya. Tentang evaluasi yang disebutkan Plt Gubsu? Menurut Sigit, merupakan hal yang wajar bila Gatot melakukan evaluasi. Maksudnya mengavaluasi sejauhmana kinerja para SKPD di jajaran Pemprovsu termasuk yang baru diangkat Syamsul Arifin. ‘’Masak mengevaluasi tidak boleh. Terus ukuran keberhasilan kerjanya apa?’’ kata Sigit. Untuk menyikapi ini, Sigit, meminta para SKPD tetap bekerja dengan profesional. Jangan sampai ada yang terkena penyakit paranoid, yakni ketakukan yang berlebih hingga tidak rasional. (m12)

Tim Advokasi: ... Proses persidangan tetap dengan pegamanan ketat oleh polisi dan Brimob. Kendaraan taktis masih terlihat diparkirkan di depan dan belakang gedung PN. Pemeriksaan terhadap pengunjung masih diberlakukan. Pengamatan Waspada, pada persidangan digelar terpisah itu, UU Nomor 15 Tahun 2003 tentang Penetapan Perpu Nomor 1Tahun 2002 tentang Pemberantasan Tindak Pidana Terorisme masihmelekatdalamdakwaanJPU. Menurut dakwaan JPU, para terdakwa dituduh terlibat dalam aksi perampokan Bank CIMB Niaga dana penyerangan Mapolsek Hamparanperak . Di mana kedua kasus itu mengakibatkan satu anggota Brimob dan tiga polisi meninggal dunia. Masih menurut dakwaa JPU, komando pelaksaanaan kedua kasus itu dipegang Taufik Hidayat yang tewas ditembak Densus 88 dalam penyergapan di Dolok Masihul, Serdang Bedagai, beberapa waktu lalu. Bahkan, penyerangan ke Polsekta Hamparan Perak dipicu dendam Taufik Hidayat atas penggerebekan yang dilakukan Densus 88 di kediamannya. Dakwaan melanggar UU teroris yang diterapkan JPU kepada seluruh terdakwa, dinilai keliru oleh Ketua Tim Advokasi sebagian terdakwa, M. Irsyad Lubis. “Aneh, tidak melaporkan pelaku terorisme juga dikenakan pasal UU Terorisme. “Sekali lagi

Bapeten Jamin ... “Kita sudah kirim orang ke Manado sisi utara Indonesia yang paling dekat dengan Jepang untuk melihat apakah ada perubahan pada kondisi udara, lingkungan. Alhamdulillah tidak ada perubahan, dan hasilnya negatif,” kata Dr. As Natio Lasman kepada sejumlah wartawan usai membuka acara konsultasi tentang Rancangan Peraturan Kepala Bapeten dengan Pemangku Kepentingan di Novotel Soechi, Kamis (31/3). Dia mengakui, berdasarkan hasil scanning di Bandara Soekarno Hatta dan Ngurah Rai Bali, ada seorang WNI terdeteksi menerima radiasi nuklir. Setelah terdeteksi dan dikirim ke Kementrian Kesehatan, lanjutnya,

Vatikan: Serangan ... Para pejabat Libya telah membawa para wartawan asing ke lokasi apa yang mereka katakan korban serangan udara Barat di Tripoli, namun bukti korban sipil belum ada kesimpulannya.Namun, kekuatan Barat mengatakan mereka belum menerima konfirmasi tentang korban sipil. Para pejabat rezim Libya yang diperangi Rabu, mengecam apa yang mereka katakan sebagai dukungan pasukan koalisi kepada kekuatan para lawan politik, yang berupaya mengusir Khadafi dari kekuasaan. Pesawat-pesawat tempur koalisi secara efektif membantu pasukan yang melakukan perlawanan dengan payung sera-

‘Saya Akan ...

128 Pengungsi ... Aceh, Rabu malam mereka diberangkatkan ke Medan menggunakan bus dan tiba di Medan, Kamis (31/3) pagi, dan langsung diinapkan di hotel. “Kami kembali hirup udara segar setelah sampai sekitar pukul 08:00 pagi di Medan dari Aceh dengan menumpang lima bus ber-AC dari Banda Aceh,” kata Mahmud Harun, 22, salah seorang pengungsi Myanmar ketika ditemui bersama temantemannya sesame pengungsi di Hotel Pelangi Jalan Letjen Jamin Ginting Medan. Harun mengaku berangkat dari kampungnya kota Mang Dow, Rohingnya, Myanmar sekitar Januari lalu dikarenakan penindasan dari rezim berkuasa terhadap mereka yang beragama Islam. “Kami dari pihak laki-laki diancam untuk dibunuh oleh pihak kepolisian Myanmar yang mayoritas non-muslim,” kata Harun dalam bahasa Inggris terbata-bata sambil mengakui pindah dari Aceh ke Medan dengan alasan Medan kota besar. Mengenai petualangan mereka yang berada dalam satu perahu tua bermesin dari Mang Dow, Harun mengaku mendapat bantuan dana dari salah seorang pengusaha Muslim bernama M.Yunus.Namun tidak tahu jumlah keseluruhan dari bantuannya untuk pemberangkatan satu kelompok 129 orang. “Memang saya tidak tahu jumlah pasti dari keseluruhan dana bantuan itu, tetapi saya dan rekan-rekan lain merata memperoleh 2000 dolar Myanmar atau sekitar Rp 40 ribu per orang,” katanya dengan mengingat kembali kisah yang cukup menyedihkan ketika mengarungi lautan lepas menuju kota atau negara yang sama sekali tidak mereka ketahui. Alhamdulillah, katanya, kami sampai di

Kolektor Citibank ... “Masih ditelusuri, saksi-saksi yang melihat saat itu siapa saja. Siapa yang terakhir bersama almarhum, itu masih dipelajari,” terang Baharudin. Sebelumnya, Kepala Satuan Reskrim Polres Metro Jakarta Selatan, Ajun Komisaris Besar Budi Irawan, mengatakan sudah ada tiga tersangka yang ditahan sejak Rabu (30/3). Irzen Octa diketahui tewas di halaman Menara Jamsostek pada Selasa (29/3), setelah menanyakan jumlah tagihan kartu kredit yang membengkak hingga Rp100 juta. Menurut korban, tagihan kartu kreditnya semula hanya Rp48 juta. Tidak mendapat penjelasan mengenai hal itu, korban malah dibawa ke ruang bagian penagihan dan dipaksa oleh tiga tersangka untuk membayar. Polisi telah memeriksa lima orang saksi dan mencurigai tiga tersangka itu melakukan tekanan secara fisik dan psikologis hingga korban meninggal dunia. Polisi juga menemukan bercak darah pada kain gorden ruang kantor kolektor Citibank yang diduga darah korban saat masih berada diruangan tersebut. Ketiga tersangka itu terancam dengan Pasal 351 dan 170 KUHP tentang penganiayaan. “Tersangka masih bisa bertambah, kami lihat saja nanti hasil pemeriksaan. Bagimana caracara kekerasan itu dilakukan, saat ini jadi fokus kami,” kata Budi Irawan.

WASPADA Jumat 1 April 2011 Indonesia tepatnya di Aceh. Dalam perjalanan mengarungi laut bersama 129 orang pengungsi, belum termasuk awak boat, Harun mengaku mesin boat yang mereka tumpangi meledak sehingga mereka terkatung-katung selama 16 hari di tengah laut. “Berkat doa kami kepada Allah SWT, kami ditemukan oleh seorang nelayan Indonesia yang sedang menangkap ikan di perairan yang kami sendiri tidak tahu namanya,” ungkap Harun mengisahkan pahit hidup yang dijalani sejak dari kampung halaman di Mang Dow sampai terkatung-katung di tengah laut. Ketika ditanya bagaimana makan selama 16 hari di tengah laut itu, Harun mengatakan sangat terbantu dengan penyaluran makanan dari nelayan Indonesia itu. “Perahu kami yang mogok akibat mesin pecah ditarik oleh nelayan Indonesia yang baik budi itu dengan menggunakan boat penangkap ikan miliknya’’. Kata Harun, tidak semua para pengungsi itu berstatus lajang karena ada beberapa rekannya sudah berumah tangah dengan meninggalkan anak di kampung halaman. “Seperti Muhammad Kasim, dia ini telah beristri dengan meninggalkan lima orang anak hasil pernikahannya dengan seorang wanita yang kini ditinggal di kampung dan bekerja sebagai petani,” kata Harun yang berbicara mewakili rekan-rekannya. “Saya pun tidak tahu lagi bagaimana keadaan kelima anak saya yang paling kecil adalah wanita, masih berusia satu tahun dan paling besar berusia tujuh tahun,” imbuh Kasim mengenang sedih anak-anak di Myanmar yang berangkat dari negara asal sampai satu bulan setengah di Indonesia, tepatnya Aceh, sampai sekarang belum mendapat kabar. Harun mengaku dari 129

orang pengungsi itu tidak satu orang pun memiliki alat komunikasi handphone. Mereka tidak mampu membelinya karena tidak punya uang. Menjawab Waspada mengenai suasana perjalanan dari Banda Aceh menuju Medan, Harun dan rekan-rekannya mengakui cukup enak dan nyaman karena busnya mempunyai seat atau tempat duduk untuk kapasitas 25 orang dan memakai AC. Demikian juga sewaktu menginap di Hotel Pelangi walau masih non-bintang, tetapi sudah nyaman dan memuaskan bagi mereka sebagai pengungsi asing. “Kami tidak tahu seberapa lama kami akan berada di hotel ini, semua itu tergantung dari keputusan pihak IOM (International Organization of Migrant, suatu badan yang berada di bawah UNCR, PBB,” ujarnya. Belum tahun dibawa ke mana Sementara itu, Setia Budi, kepala Seksi Pengawasan Keimigrasian (Wasdakim) pada Kantor Imigrasi Polonia Medan menjelaskan untuk sementara 128 dari 129 pengungsi Myanmar dari etnis Rohingnya (satu masih di Aceh dalam perawatan medis) sejak Kamis (31/3) pagi menjadi tamu Imigrasi Medan. “Kami bersama Kepala Kantor Imigrasi (Kakanim) Polonia Medan Abd.Rahman dan staf UNHCR sudah meninjau lokasi penampungan pengungsi,” ujarnya. Para pengungsi yang selama ini berada di Aceh menjadi tanggung jawab Imigrasi Polonia Medan. “Ini juga berdasarkan instruksi pejabat di Direktorat Imigrasi di Jakarta. Jadi, kami belum terpikirkan mereka ini mau dibawa ke mana, karena kapal motor mereka juga belum tahu saat ini berada di mana,” ujarnya. (m23/m32)

BI: Penagih Bank Harus Gunakan Etika Bank Indonesia (BI) mengimbau agar perbankan nasional menggunakan etika dalam melakukan penagihan ke nasabah. Sebab, perlakuan penagih (debt collector) banyak dikeluhkan nasabah, apalagi sudah terjadi korban meninggal dalam kasus ini. Menurut Kepala Biro Humas BI, Difi A Johansyah, fenomena penggunaan debt collector muncul setelah adanya layanan KreditTanpa Agunan (KTA). Penggunaan debt collector dalam penagihan merupakah hal yang normaldalampraktikperbankan. “Dari dulu sudah diimbau agar perbankan menggunakan etika ketika menagih nasabah” ujar dia di Jakarta, Kamis, (31/3). Sayangnya, Difi melanjutkan, penggunaan jasa debt collector ini tidak diatur oleh regulator perbankan. Namun, nasabah sebaiknya juga berhati-hati agar disiplin membayar tagihan, karena nasabah seperti itu akan masuk dalam daftar Sistem Informasi Debitor (SID). “Kalau dia (nasabah) sudah masuk ke sistem informasi debitor, akan menyulitkan dirinya sendiri. Itu sama juga mereka masuk daftar hitam,” jelas Difi. Dia menegaskan nasabah juga harus memahami bahwa pinjaman merupakan kontrak dan secara hukum harus dibayar. Di lain pihak, bank penagih harus memberitahukan kepada nasabah mengenai tagihan mereka. Setiap bulan mereka harus memberitahukan kepada

nasabah, bisa melalui surat, email atau telepon. “Kalau bank rewel laporkan ke BI,” kata dia. Saat ini, Bank Indonesia sedang mengawasi bank yang menunda pemberitahuan tagihan kepada nasabah, sehingga nasabah merasa dirugikan. Difi mengatakan bank tersebut menunda tagihan hingga jumlah utang nasabah itu melambung. “Alasan bank itu karena nasabah sulit dihubungi,” kata dia. Seperti diberitakan, Polres Jakarta Selatan terus mengembangkan kasus dugaan penganiayaan penagih (debt collector) kartu kredit Citibank yang berujung tewasnya nasabah Irzen Octa, 50, yang juga Sekretaris Jenderal Partai Pemersatu Bangsa (PPB). Korban tewas setelah menanyakan jumlah tagihan kartu kredit yang membengkak hingga Rp100 juta. Menurut korban, tagihan kartu kreditnya semula hanya Rp48 juta. Tidak mendapat penjelasan mengenai hal itu, korban justru dibawa ke ruang bagian penagihan dan dipaksa pelaku untuk membayar. Namun, korban dibawa ke ruang penagihan dan setelah itu tewas. Menurut keterangan polisi, dari hasil visum terdapat tindak kekerasan, karena pembuluh darah bagian belakang kepala korban pecah. Tiga orang sudah ditetapkan sebagai tersangka dalam kasus ini. Tiga tersangka adalah H dan D, petugas bagian penagihan, dan B karyawan bagian penagihan. Mereka dikenakan pasal penganiayaan. (j02/vvn)

Dua Masjid Di Asahan ... terbakar. Bahkan karena besarnya api, kubah masjid tersebut rubuh dan jatuh ke tengah lantai masjid yang ruangannya cukup besar itu. Menurut Johan, nazir di masjid itu, dia tahu ada kebakaran dari para pemuda setempat. “Saat saya melihat, api sudah berkobar hingga ke bagian atas masjid,” katanya. Kepala Desa Aekloba Ponimin mengaku terkejut atas kejadian itu. Karena selama ini daerahnya itu aman dan tenteram dan tidak pernah terjadi gesekan baik intern maupun ekstern umat beragama. Akibat kebakaran itu, kondisi masjid tidak layak dipakai lagi. Wakil Bupati Asahan H Surya bersama Kapolres Asahan AKBP J Didiek Dwi Priantono dan Dandim 0208/AS Letkol Inf Handoko Nurseta serta Kepala Kemenag Asahan H Syafii turun ke lokasi melihat keadaan. Kapolres Asahan meminta warga tetap menjaga suasana kondusif dan tidak terpancing oleh isu-isu yang dapat memperkeruh suasana. Pihaknya berjanji mengungkap kasus itu secepatnya. “Saat ini kami sedang melakukan penyidikan dan meminta keterangan dari berbagai pihak,” katanya. Dalam keterangan tambahan sore hari yang diterima Waspada, pukul 17:00. Dalam kaitan ini, Kapolres menegaskan, kebakaran itu kecelakaan murni karena ada dua kali pemadaman aliran listrik. Sedangkan, Ketua MUI Asahan Usman

Jalan Lurus ... Jalan lurus itu berujung ke surga, sedangkan jalan bengkok (murka, sesat) berujung ke neraka. Tetapi mengapa juga banyak manusia yang masih suka memilih jalan sesat? Mengapa masih banyak yang tidak shalat, berzina, makan riba, minum tuak dan berbuat dosa-dosa besar di dunia ini? Jawabannya adalah karena mereka tidak mengenal hakikat kehidupan. Mereka tertipu dengan kemilaunya dunia ini. Hawa nafsu telah mereka kedepankan, setan terkutuk telah berhasil menggoda mereka sehingga mereka tidak mampu lagi berpikir merdeka. Semua pikiran waras telah tertutup dengan timbunan bisikan hawa nafsu dan bisikan iblis laknatullah. Mereka hanya memikirkan tentang

Effendi mengajak masyarakat Asahan sekitarnya agar bersabar dan menyerahkan proses ini kepada aparat penegak hukum. “Di balik yang tidak kita sukai pasti ada hikmahnya. Jadi percayakan saja masalah ini kepada pihak aparat. Jangan kita terpancing,” kata ustadz alumnus Mesir itu. Pantauan Waspada, masyarakat dari berbagai kecamatan dan dari kabupaten sekitarnya banyak yang datang untuk menyaksikan masjid yang terbakar itu. Sementara pihak kepolisian sudah memasang police line dan berjaga-jaga di dua lokasi terpisah dibantu petugas dari TNI AD. Sejumlah warga yang menyaksikan kejadian itu mengungkapkan kecurigaan mereka atas peristiwa tersebut. Pasalnya, selain kejadiannya yang hampir bersamaan waktunya, barangbarang di dalam masjid juga berada di tempat yang tidak biasanya. Apalagi setiap malam, kedua masjid itu dikunci oleh nazir masjid. Kapolres Asahan AKBP J Didiek Dwi Priantono ditemui Waspada di ruang kerjanya mengatakan, berdasarkan penyidikan awal kebakaran yang terjadi di Masjid At Taqwa dan Masjid Nur Hikmah, Kamis (31/3) dini hari disebabkan konsleting listrik, namun ada dugaan disebabkan lilin yang jatuh saat listrik padam, sehingga membakar sejadah dan Al Quran. Masalah ini, kata Kapolres, telah dibicarakan dengan Bupati Asahan Taufan Gama Simatupang melalui wakilnya Surya. Sehingga kesimpulannya masjid itu akan diperbaiki. (a16/a15/c08) perut dan sebatas hidup di dunia. Mata hati mereka telah buta dengan kehidupan akhirat. Sungguh berbahaya pemikiran yang hanya sebatas hidup di dunia. Manusia seperti itu bisa menjadi drakula yang siap menerkam dan menghisap darah manusia lain yang lemah. Demi perut dan syahwatnya mereka tak segansegan membunuh, memperkosa, merampok dan sebagainya. Allah Azzawajalla menyuruh orang beriman agar meminta kepada-Nya supaya kita selalu berada di jalan lurus. Yakni jalan syariah Islam agar kita selamat di dunia dan akhirat. Allah juga menyuruh kita agar meminta kepada-Nya, supaya tidak menjadi orang-orang yang dhalim dan sesat dan menyesatkan seperti orang-orang yang melanggar syariat Islam.

Berita Utama

A2 Mantan Kadishut ....

hutan –hutan negara sehingga terjadi perambahan hutan. Atas putusan itu, maka JPU yang bertugas menuntut terdakwa perlu ditindak tegas karena tidak cermat melakukan tugasnya. I ni terbukti dalam persidangan, saksi ahli yang diajukan ternyata tidak memenuhi kriteria, sehingga dipertanyakan kapasitasnya oleh majelis hakim, kata penasehat hukum terdakwa Panahatan Hutajulu. Sebelumnya, Alden Napitupulu bersama 7 warga S,KS, LS, HT, ES, JN dan BB dite-

9 Fraksi DPRDSU ....

yang belum menerima surat pemberhentian sementaranya sebagai Gubsu. Padahal surat tersebut telah dititipkan Sekretaris Mendagri kepada Pj Gubsu Gatot Pujonugroho. Kesembilan pimpinan fraksi yang berkumpul hari itu di antaranya Budiman Nadapdap (FPDIP), Hardi Mulyono (FPG), Fadli Nurzal (FPPP), Muslim Simbolon (FPAN), Tunggul Siagian (FPD), Restu Sarumaha (FPPRN), Hamamisul Bahsan (Fraksi Hanura). Hadir juga Wakil Ketua dari FPDIP M.Affan dan sejumlah pimpinan fraksi lainnya. Hanya FPKS yang tidak ikut ‘mengeroyok’ Gatot Pujonugroho. Ketua Fraksi PDIP Budiman Nadapdap, mengatakan, Rabu (30/3) delapan fraksi (kecuali PKS dan PD) bertemu dengan Gubsu nonaktif Syamsul Arifin di rumah tahanan Salemba, Jakarta. Tujuannya untuk bersilaturahim pasca keluarnya SK non aktif Syamsul Arifin dan pengangkatan Gatot Pujonugroho sebelumnya Wagubsu menjadi Pj Gubsu. ‘’Itu juga merupakan etika politik Parpol terhadap Gubsu nonaktif,’’ katanya. Namun kemudian, kata Budiman Nadapdap, mereka sangat terenyuh mendengar pernyataan Syamsul Arifin yang mengaku belum menerima surat pemberhentian dirinya. Padahal menurut pengakuan Wakil Ketua DPRD Sumut M.Affan, surat itu sudah dititipkan Sekretaris Mendagri kepada Gatot Pujonugroho untuk disampaikan kepada Syamsul Arifin. ‘’Usai menerima SK itu,

Dua Masjid ....

Menurut Nazir Masjid Jami’ At Taqwa, Khairul Hasbi di TKP, dirinya mengetahui terjadinya kebakaran sekitar pukul 01:15, karena diberi tahu oleh warga yang mendapatkan informasi dari seorang warga Aekkanopan bernama Fauzan yang melintas di sana. “Kebakaran mengakibatkan mimbar, perangkat sound system, VCD berikut sejumlah sajadah dan kitab Al Quran hangus. Sedangkan mihrab dan langit-langit masjid menjadi hitam karena asap. Kerugian akibat kebakaran ini diperkirakan Rp20 juta,” katanya. Menurut Khairul, pelaku diduga masuk melalui jendela setelah membuka kaca nako yang tidak memiliki jerjak. Baru setelah di dalam masjid, pelaku yang belum diketahui identitasnya itu melakukan aksinya yang membuat heboh masyarakat setempat. Sementara di Masjid Nur

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport.

tapkan Polda Sumut sebagai tersangka perambahan hutan di Kecamatan Nassau, Kab.Tobasa. Terdakwa Alden Napitupulu ditetapkan sebagai tersangka karena menerbitkan IPKTM untuk tujuh tersangka dan sempat menjalani penahanan selama 3 bulan lebih di Poldasu. Izin itu diberikan untuk 75 hektare kawasan hutan di Kecamatan Nassau dan telah melakukan perambahan seluas 8,2 ha sejak diterbitkannya awal Januari 2010. (a22)

Saksi Kenal ....

saksi yang dimintai keterangan selain tiga saksi dari pembantu korban dan baby sisternya, ada seorang pegawai korban, tukang sate. “Polisi sampai saat ini masih mengumpulkan keterangan saksi-saksi,” jelasnya. Senjata FN dan Barreta Informasi di lapangan, kedua eksekutor menggunakan senjata api jenis FN dengan peluru kaliber 4,5 mm dan Barreta dengan kaliber peluru 2,9 mm. Namun sejauh ini pihak kepolisian belum berani menyebutkan jenis

senjata apa, dengan alasan menunggu hasil Labfor Polri Cabang Medan yang sedang menguji balistik peluru yang ditemukan di lokasi kejadian. Sedangkan kemarin, dari lokasi kejadian, polisi menemukan lagi 3 peluru dan hari pertama ditemukan 27 peluru. Kini peluru tersebut diamankan ke Labfor Polri Cabang Medan di Polda Sumut. Kapolresta Medan Kombes Tagam Sinaga yang ditanya perkembangan kasus ini belum bisa memberikan keterangan dengan alasan belum

saya sempat berkelakar lagi dengan mengatakan: ‘’mumpung kita di Jakarta, kita langsung saja mampir ke Salemba,’’ kata Affan. Kepada pimpinan fraksi yang berkunjung ke Salemba, kata Budiman Nadapdap, Syamsul Arifin merasa terpukul dengan perlakuan Gatot seperti itu. ‘’Malah Pak Syamsul bilang: kalau memang saya begitu baunya, Gatot kan bisa menutup hidungnya saat mengantarkan surat saya itu,’’ kata Nadapdap menirukan ucapan Syamsul. Berkaitan dengan peristiwa itu, para pimpinan fraksi berkesimpulan Gatot Pujonugroho tidak memiliki etika dan budaya politik sepertinya dia masih menyimpan dendam kepada Syamsul Arifin. Yang lebih parah dari itu, Gatot dinilai tidak amanah. ‘’Inilah kemudian yang menyatukan hati fraksi-fraksi untuk bersatu,’’ kata Ketua Fraksi Partai Golkar Hardi Mulyono. Sementara itu Ketua Frkasi PPP, partai pengusung Syamsul Arifin-Gatot Pujonugroho (Syampurno) Fadli Nurzal, menyebukan sangat gelisah dengan kondisi seperti ini. Dia khawatir ke depan akan terjadi ketidakharmonisan angara legislatif dan eksekutif karena sikap Pj Gubsu. Sikapnya yang paling meresahkan lagi adalah tentang pernyataannya di surat kabar beberapa hari lalu. Gatot menyebutkan dia akan mengevaluasi sejumlah SKPD. Kata pimpinan fraksi, ini sangat bertentangan dengan arahan Sekretaris Mendagri saat penyerahan SK Plt lalu. Disebutkan M.Affan, saat

mendampingi Gatot Pujonugroho ke Kemendagri, Sekretaris Mendagri menyampaikan kepada Plt Gubsu untuk melakukan tiga hal. Yakni melakukan konsolidasi internal, melanjutkan apa yang dilakukan Gubsu non aktif dan selalu berkoordinasi dengan Mendagri. ‘’Dan Gatot dilarang melakukan pergantian pejabat,’’ kata Affan. Ditambahkan Budiman Nadapdap, disharmoni yang terjadi antara Syamsul Arifin dengan Gatot Pujonugroho, jelas sekali terlihat. Kesannya Plt Gubsu ini dendam kepada Syamsul, dan akan melakukan perombakan Satuan Kerja Perangkat Daerah (SKPD). PDI Perjuangan, kata Budiman Nadapdap, jauh hari sebelumnya telah mengingatkan Gatot untuk meredam isu dishar moni itu. Caranya dengan mendatangi Syamsul Arifin. ‘’Tapi Gatot, tetap tidak bersedia. Malah dia menyatakan akan mengevaluasi 14 SKPD yang diangkat Syamsul sebelumnya,’’ kata Budiman Nadapdap. Ultimatum Melihat sikap Plt Gubsu Gatot Pujonugroho, yang sangat keras ini, pimpinan fraksi-fraksi di DPRD Sumut akhirnya mengeluarkan ultimatum. Yakni, agar Gatot Pujonugroho tidak melanggar aturan, etika dan budaya politik. Bila itu, terjadi, disebutkan Hardi Mulyono, akan merugikan masyarakat Sumut. DPRD Sumut sebagai representasinya masyarakat akan terus mengkritisi masalah ini. Harus diingat, kata Hardi, Syampurno telah menetapkan jargon politiknya ‘rakyat tidak lapar’

‘rakyat tidak bodoh’ ‘rakyat tidak miskin’ dan ‘rakyak punya masa depan’. ‘’Tapi sekarang ini nyatanya rakyat telah sakit. Paling tidak sakit hati,’’ tambah Budiman Nadapdap. Bukan pribadi Gatot Sementara itu, Penasehat FPKS DPRDSU Sigit Pramono Asri mengatakan, tidak mungkin Plt Gatot Pujonugroho melakukan balas dendam. Alasannya yang pertama, kata Sigit, dendam bukan pribadinya Gatot. Juga di PKS tidak dibenarkan dendam karena akan menjauhkan kebaikan. “Jadi, sangat tidak mungkin ada balas dendam,’’ katanya. Kepada Waspada melalui telefon selular, tadi malam, Sigit Pramono Asri mengatakan hal yang wajar dilakukannya pertemuan para pimpinan fraksi. Dari Ketua FPKS Hidayatullah, Sigit mendengar kalau PKS tidak diajak dalam pertemuan itu. ‘’Tapi tidak masalah. Asal dialognya dilakukan dengan rasional. Bukan emosional,’’ katanya. Tentang evaluasi yang disebutkan Plt Gubsu? Menurut Sigit, merupakan hal yang wajar bila Gatot melakukan evaluasi. Maksudnya mengevaluasi sejauhmana kinerja para SKPD di jajaran Pemprovsu termasuk yang baru diangkat Syamsul Arifin. ‘’Masak mengevaluasi tidak boleh. Terus ukuran keberhasilan kerjanya apa?’’ kata Sigit. Untuk menyikapi ini, Sigit, meminta para SKPD tetap bekerja dengan profesional. Jangan sampai ada yang terkena penyakit paranoid, yakni ketakukan yang berlebih hingga tidak rasional. (m12)

Hikmah, kondisinya lebih parah lagi. Seluruh sajadah dan kitab Al Quran sekitar 50 buku habis terbakar. Bahkan karena besarnya api, kubah masjid tersebut rubuh dan jatuh ke tengah lantai masjid yang ruangannya cukup besar itu. Menurut Johan, nazir di masjid itu, dia tahu ada kebakaran dari para pemuda setempat. “Saat saya melihat, api sudah berkobar hingga ke bagian atas masjid,” katanya. Kepala Desa Aekloba Ponimin mengaku terkejut atas kejadian itu. Karena selama ini daerahnya itu aman dan tenteram dan tidak pernah terjadi gesekan baik intern maupun ekstern umat beragama. Akibat kebakaran itu, kondisi masjid tidak layak dipakai lagi. Wakil Bupati Asahan H Surya bersama Kapolres Asahan AKBP J Didiek Dwi Priantono dan Dandim 0208/AS Letkol Inf Handoko Nurseta serta Kepala Kemenag Asahan H Syafii turun ke lokasi melihat keadaan. Kapolres Asahan meminta warga tetap menjaga suasana kondusif dan tidak terpancing

oleh isu-isu yang dapat memperkeruh suasana. Pihaknya berjanji mengungkap kasus itu secepatnya. “Saat ini kami sedang melakukan penyidikan dan meminta keterangan dari berbagai pihak,” katanya. Dalam keterangan tambahan sore hari yang diterima Waspada, pukul 17:00. Dalam kaitan ini, Kapolres menegaskan, kebakaran itu kecelakaan murni karena ada dua kali pemadaman aliran listrik. Sedangkan, Ketua MUI Asahan Usman Effendi mengajak masyarakat Asahan sekitarnya agar bersabar dan menyerahkan proses ini kepada aparat penegak hukum. “Di balik yang tidak kita sukai pasti ada hikmahnya. Jadi percayakan saja masalah ini kepada pihak aparat. Jangan kita terpancing,” kata ustadz alumnus Mesir itu. Pantauan Waspada, masyarakat dari berbagai kecamatan dan dari kabupaten sekitarnya banyak yang datang untuk menyaksikan masjid yang terbakar itu. Sementara pihak kepolisian sudah

memasang police line dan berjaga-jaga di dua lokasi terpisah dibantu petugas dari TNI AD. Sejumlah warga yang menyaksikan kejadian itu mengungkapkan kecurigaan mereka atas peristiwa tersebut. Pasalnya, selain kejadiannya yang hampir bersamaan waktunya, barang-barang di dalam masjid juga berada di tempat yang tidak biasanya. Apalagi setiap malam, kedua masjid itu dikunci oleh nazir masjid. Kapolres Asahan AKBP J Didiek Dwi Priantono ditemui Waspada di ruang kerjanya mengatakan, berdasarkan penyidikan awal kebakaran yang terjadi di Masjid At Taqwa dan Masjid Nur Hikmah, Kamis (31/3) dini hari disebabkan konsleting listrik, namun ada dugaan disebabkan lilin yang jatuh saat listrik padam, sehingga membakar sejadah dan Al Quran. Masalah ini kata Kapolres, telah dibicarakan dengan Bupati Asahan Taufan Gama Simatupang melalui wakilnya Surya. Sehingga kesimpulannya masjid itu akan diperbaiki. (a16/a15/c08)

Malaysia Haramkan ....

Datuk Seri Dr Zambry Abdul Kadir mengatakan, kerajaan akan mematuhi fatwa tersebut. Namun, fatwa haram poco-poco jadi polemik di Malaysia. Menanggapi keputusan para ulama Perak, mantan Mufti Perlis, Prof Madya Dr Mohd Asri Zainul Abidin justru menganggap, fatwa haram poco-poco tak wajar. “Jika dianggap sebagai tarian yang baik bagi kesehatan, tanpa unsur kepercayaan dan tidak mengandung unsur haram seperti minuman keras dan seks bebas, secara syariat itu dibolehkan,” katanya, Kamis (31/3).

“Jika memang ada unsur yang salah, hendaknya meniru Nabi Muhammad, buang unsur yang buruk itu, pertahankan yang baik,” tambahnya. Sebelumnya, ulama negeri jiran itu juga pernah mengeluarkan fatwa haram yoga. Ketua Dewan Fatwa Nasional, Abdul Shukor Husin, mengatakan yoga telah dipraktikkan oleh masyarakat Hindu selama ribuan tahun. Kegiatan ini dianggap menyatukan gerakan fisik dan elemen keagamaan Hindu berupa nyanyian dan pujian, dengan tujuan “bersatu dengan Tuhan”. (VN/m03)

Jalan Lurus ....

makan riba, minum tuak dan berbuat dosa-dosa besar di dunia ini? Jawabannya adalah karena mereka tak mengenal hakikat kehidupan. Mereka tertipu dengan kemilaunya dunia ini. Hawa nafsu telah mereka kedepankan, setan terkutuk telah berhasil menggoda mereka sehingga mereka tidak mampu lagi berpikir merdeka. Semua pikiran waras telah tertutup dengan timbunan bisikan hawa nafsu dan bisikan iblis laknatullah. Mereka hanya memikirkan tentang perut dan sebatas hidup di dunia. Mata hati mereka telah buta dengan kehidupan akhirat. Sungguh berbahaya pemikiran yang hanya sebatas hi-

dup di dunia. Manusia seperti itu bisa menjadi drakula yang siap menerkam dan menghisap darah manusia lain yang lemah. Demi perut dan syahwatnya mereka tak segansegan membunuh, memperkosa, merampok dan sebagainya. Allah Azzawajalla menyuruh orang beriman agar meminta kepada-Nya supaya kita selalu berada di jalan lurus. Yakni jalan syariah Islam agar kita selamat di dunia dan akhirat. Allah juga menyuruh kita agar meminta kepadaNya, supaya tidak menjadi orang-orang yang dhalim dan sesat dan menyesatkan seperti orang-orang yang melanggar syariat Islam. ** ** **

Menurut Mufti Perak, Tan Sri Harussani Zakaria yang mengatakan pihaknya, Jawa1. ......, Ke3+. tankuasa Fatwa Negeri Perak, 2. Rh3, Mxh5+. telah mengeluarkan fatwa bahwa tarian poco-poco ha3. Gh4, MxG+mat. ram. Alasannya, Harussani mengatakan, tarian tersebut memiliki elemen Kristiani. Jawaban TTS: Langkah poco-poco ke kanan, TTS Topik Mimbar Jumat kiri, depan belakang dianggap (Muat Ulang) merepresentasikan bentuk A L- F A T I H A H M A N N A salib. Selain itu, poco-poco A L I L juga dianggap mengandung S A L- A N' A M B E I unsur pemujaan terhadap roh yang sering dilakukan di A K I D A H S A F Jamaika. S K I S M A I L K Menanggapi fatwa terR A A A Y A T sebut, Menteri Besar Perak

Jawaban Problem Catur:

A H

J A B A A N I N W A S P A H I I B N B N O A H

L N U R U N S Y A A L I L D A B A U S I N A A I A H M A D I

T O L A H O A G R I S F I A Y A H

Jawaban Sudoku: 2 7 9 6 5 3 1 8 4

5 4 6 7 8 1 3 9 2

1 3 8 2 4 9 5 7 6

9 6 3 8 2 4 4 8 7 2 6 5 3 9 1 8 5 1 9 6

7 2 4 1 3

6 1 7 3 9 8 2 4 5

3 9 5 4 7 2 6 1 8

4 8 2 5 1 6 9 3 7

Nabi Muhammad sebagai Rasulullah. Rajin mendirikan shalat dengan kusyuk, puasa bulan Ramadhan, mengeluarkan zakat, membantu fakir miskin yang membutuhkan bantuan, memelihara kemaluannya dari perbuatan zina, menolak riba, tidak mau melanggar hak-hak asasi manusia, tidak mau berjudi dan minum tuak. Naik haji bila sudah ada kesanggupan. Jalan lurus itu berujung ke surga, sedangkan jalan bengkok (murka, sesat) berujung ke neraka. Tetapi mengapa juga banyak manusia yang masih suka memilih jalan sesat? Mengapa masih banyak yang tidak shalat, berzina,

WASPADA Jumat 1 April 2011

Calhaj Aceh 38.813

berani banyak ngomong karena belum berhasil mengungkap kasus ini.”Tunggu berhasil dulu la. Sabar ya,” jelasnya. Antisipasi pelarian Untuk mencari keberadaan pelaku pembunuhan suami istri itu, petugas Polresta Medan mengawasi Bandara Polonia, sekaligus mengecek daftar penumpang pesawat. Langkah itu dilakukan untuk mengantisipasi kemungkinan pelar ian pelaku melalui transportasi udara. Penjagaan di Bandara Polonia itu atas instruksi Kapoldasu Irjen Pol Wisnu dan Kapolresta Medan Kombes Pol Tagam Sinaga yang disebutsebut sudah melakukan rapat koordinasi untuk mengungkap para pelaku kejahatan sadis tersebut. Kepala Pos Polisi Bandara Polonia Aiptu Saut Sihombing dan AKP Prianto yang dihubungi wartawan di Bandara Polonia, kemarin mengakui, pihaknya secara intensif mencari data-data penumpang untuk mengetahui, apakah ada pelaku diantara penumpang masuk ke Medan, dalam beberapa hari terakhir sebelum kejadian pembunuhan itu. Selain itu pihaknya berusaha memperoleh data manifest (penumpang) pesawatpesawat yang berangkat sehari setelah hari kejadian. “Tapi kita mengalami kesulitan mendapatkan manifest penumpang terutama untuk tanggal mundur atau beberapa hari sebelum kejadian karena pihak penerbangan perlu mendapatkan surat permintaan resmi,” kata Prianto. Pantauan wartawan, beberapa petugas dari Polresta Medan dan Poldasu berpakaian preman terlihat berjagajaga di Bandara Polonia hingga malam hari. Ikan bakar Sementara itu, puluhan

pelayat datang silih berganti ke Yayasan Balai Sosial Angsapura di Jalan Waja Medan, Kamis siang, untuk memberikan penghormatan terakhir kepada jenazah Kho Wie To, dan istrinya Dora Halim. Jenazah kedua korban disemayamkan di Blok VIP 45. Rencananya, jenazah suami istri tersebut, Jumat (1/4), dibawa ke krematorium di J a l a n M e d a n - Ta n j u n g morawa untuk dikremasikan. Pantauan Waspada, para pelayat umumnya kerabat keluarga, relasi dan rekan bisnis yang berasal dari Pelabuhan Belawan. Namun, pihak keluarga korban belum mau memberikan keterangan terkait peristiwa penembakan tersebut. “Keluarganya belum bisa diwawancarai. Mohon maaf ya karena masih suasana duka,” sebut seorang pria yang mengaku dari pihak istri Dora Halim. A Boi, 44, seorang rekan korban mengaku sangat kehilangan atas kematian pemilik gudang ikan tersebut, sebab selain ramah, Kho Wie To memiliki jiwa sosial tinggi. Dia akan membawa ikan-ikan segar bila kami memesannya bila ada acara bakar ikan. Menurut A Boi, korban mema n g ja r a n g ber ga ul dengan warga di sekitar rumahnya karena tiap hari pulangnya malam hari, namun bila warga datang meminta bantuan dia selalu membantu setiap warga dan Kepala Lingkungan. Pantauan di lokasi kejadian, beberapa personel dari Polresta Medan dan Polsekta Medan Timur masih terlihat berjaga-jaga di sekitar rumah korban. Di depan rumah terlihat dua hio besar dan makanan persembahan yang diletakkan di halaman, sedangkan garis polisi (policeline) masih terpasang. (m39/m32/h04)

Menlu Libya ...

Keberadaan Koussa selama dua hari di negara tetangga Tunisia dilukiskan sebagai “kunjungan pribadi”. Pemerintah Libya mengatakan ia sedang melakukan perjalanan untuk misi diplomatik. Ia masuk ke Tunisia lewat darat melalui perlintasan perbatasan Ras Jdir, Senin, dengan wakil menteri Libya untuk urusan Eropa Abdelati Laabidivia. Beberapa anggota rezim Khadafi, termasuk beberapa menteri dan pejabat senior militer, telah membelot sejak pemberontakan terhadap pemerintahannya yang telah 42 tahun lebih dari satu bulan lalu. Seorang juru bicara pemerintah di ibukota Tripoli membantah spekulasi di beberapa media bahwa Koussa mungkin telah membelot. “Ia sedang dalam misi diplomatik,” tegas juru bicara Mussa Ibrahim. Ia menolak memberikan keterangan lebih terperinci. Kantor kementerian luar negeri Inggris menyatakan mereka tidak tahu apapun mengenai perjalanan yang dilaporkan itu, dan tidak ada pertemuan dijadwalkan.

Tolak PT BAM ...

“Saya sependapat dan saya minta bapak-bapak bersabar, tuntutan ini akan saya tindaklanjuti dengan menyampaikannya kepada Bupati Husin Yusuf,” sebut Camat Rahmatuddin, disambut sorak sorai pendemo. Usai menyampaikan tuntutan dan ditanggapi Camat bersama unsur Muspika, para pendemo yang mayoritas petani membubarkan diri secara tertib, dan kembali ke desa mereka masing-masing.(b19)

Politik Anggaran ...

mendapatkan jatah tahunan atas proyek dan dana hibah. Akibatnya, untuk mengakomodir permintaan itu terjadilah pembengkakan kegiatan sehingga menyebabkan anggaran melebihi dari pendapatan yang ada. Lalu tekanan politik dari parlemen (dewan), dengan memaksakan masuknya program dan kegiatan yang diinginkan anggota parlemen dalam bentuk alokasi dana atas nama aspirasi. “Kedua faktor inilah yang memiliki andil besar terjadinya memicu anggaran daerah bermasalah,” sebutnya.

Menanggapi wacana yang disa m p a i ka n Menda gr i , GeRAK Indonesia menyimpulkan beberapa hal yang harus segera dilakukan pemerintahan lokal di Aceh untuk menimalisir terjadinya kebangkrutan yang dapat memicu kemiskinan di Aceh, yaitu melakukan beberapa kegiatan sehingga dapat menutupi defisit anggaran yang sedang diderita sebagian besar kabupaten/kota. “Maka atas dasar itu, pemerintah daerah harus tegas untuk menolak usulan anggaran aspirasi yang diusulkan oleh anggota dewan,” demikian Akhirudin Mahjudin. (b07)

Sidang Lanjutan ...

melaporkan pelaku terorisme juga dikenakan pasal UU Terorisme. “Sekali lagi saya tegaskan, ini kriminal murni, bukan kasus terorisme,” tegas Irsad. Menurut Irsyad, persoalan ini juga menjadi alasan mereka mengajukan eksepsi atau keberatan atas dakwaan.”Ada delapan terdakwa kita ajukan eksepsi, dua lagi, tidak karena materi dakwaannya, kami rasa tidak perlu dikoreksi,” tegasnya. Pantauan Waspada pada persidangan terdakwa Abdul Gani Siregar alias Gani dan Pautan alias Roby , terungkap penyerangan ke Mapolsekta Hamparanperak bermotif dendam pribadi dari Taufik Hidayat atas penggerebekan yang dilakukan Densus 88 AT di rumahnya yang mengakibatkan rekannya Ridwan tewas. Dihadapan Majelis Hakim diketuai Karto SH, JPU J Simanullang SH Mhum mengatakan, tewasnya Ridwan alias Iwan membuat Taufik Hidayat marah, kemudian merencanakan penyerangan

Mapolsek Hamparan Perak. Taufik menghubungi teman-temannya termasuk kedua terdakwa untuk berkumpul di Lapangan Bola Kaki di Tanah Enam Ratus Medan Marelan. Pada 21 September, Taufik, bersama terdakwa dan 11 orang lainnya membahas dan menyusun rencana penyerangan itu. Dalam dakwaan itu, Taufik membagi tugas untuk mensukseskan rencana tersebut. Terdakwa Gani bertugas membakar kantor Mapolsek Hamparan Perak sedangkan, Pautan diberikan pistol jenis FN sebagai tuga melakukan eksekusi tembak. Namun, saat kejadian, senjatanya macet, hingga peran itu diambil alih Taufik Hidayat, Ucok Gultom, dan Saprol menembak mati tiga polisi Polsek Hamparan Perak yang berada di ruangan berbeda. Dalam aksi itu, terdakwa Gani berperan memecahkan kaca Sentra Pelayanan Kepolisian (SPK) Mapolsek Hamparan Perak dan membakar kantor itu. Pada persidangan lainnya,

terdakwa Supriyadi yang didakwa menyembuyikan teroris membantah sebagian materi dakwaan.Bahkan menurutnya, adanya pengajian dalam dakwaan itu adalah fitnah.”Tidak ada pengajian, itu fitnah,” tegasnya. Di samping itu, ia tidak ada melakukan kegiatan teroris. “ Klien kami membatah sebagian dakwaan JPU, khusus mengenai pengajian, secara tegas dibantah Supriyadi, “ tegas M Irsyad Lubis usai persidangan. Menurut Irsayd, terdakwa Supriyadi didakwa menyembuyikan teroris. Kalau dakwaan teroris tidak bisa dibuktikan JPU, maka klien kami harus dibebaskan. “Kalau kasus permpokan dan penyerangan Polsekta H.Perak bukan bagian dari teroris, maka Supriyadi harus bebas, sebab dia didakwa menyembunyikan teroris. Gimana klien kami memberitahukan ke polisi kalau para terdakwa itu teroris, sedangkan dia tidak kenal sama mereka,” tegasnya. (m49)

Tikus Rusak 200 Ha ....

ekor hama tikus dapat dimusnahkan. Bupati Padanglawas Utara Bachrum Harahap mengatakan, pola pemberantasan tikus menjelang musin tanam dinilai sudah tepat. Karena nantinya populasi tikus pada saat tanaman padi berkembang bisa berkurang. Pola penaggulangan hama tikus bukan saja dilakukan berburu, namun setelah diburu menjelang musim tanam tentu populasinya akan berkurang. Ketua Komisi II DPRD Paluta Gusman Efendi Siregar yang juga turut dalam kegiatan

berbur u menambahkan, kegiatan tersebut tepat untuk meningkatkan pendapatan petani agar terhindar dari gangguan tikus Saimah Harahap, 45, salah seorang petani mengatakan, sejauh ini keberadaan hama tikus sudah merusak sekitar 10 hektare areal sawah di Gunungtua Tonga. Akibatnya, hasil panennya berkurang. “Biasanya hasil panen saya bisa mencapai 700 kaleng padi, setelah adanya hama tikus paling dapat 52 kaleng,” keluhnya. Sedangankan data di Di-

nas Pertanian dan Tanaman Pangan (DPTP) Kabupaten Kabupaten Padanglawas Utara akhir tahun 2010, hama tikus sudah merusak hingga mencapai 200 hektare lahan sawah di 3 Kecamatan di wilayah Paluta, yakni Kecamatan Padang bolak 133 hektare, Padang Bolak Julu 35 hektare, Hulusihapas 25 hektare. “Yang yang paling parah terjadi di KecamatanPadang Bolak,” kata Kepala Dinas Pertanian dan Tanaman Pangan (DPTP) Kabupaten Padanglawas Utara H Amin Husin Harahap. (a35)

mengatakan pada Reuters. “Ia telah membelot dari rezim itu,” kata Noman Benotman, seorang teman dan pengamat senior di kelompok pemikir Quilliam di Inggris. “Ia tidak senang sama sekali. Ia tidak mendukung serangan pemerintah pada warga sipil,” tegasnya. “Ia akan minta perlindungan di Inggris dan mengharapkan ia akan diperlakukan dengan baik.” Koussa adalah satu dari para pejabat penting Khadafi dan arsitek peralihan dramatis kebijakan luar negeri Libya yang telah membawa negara itu ke masyarakat internasional setelah bertahun-tahun sanksi. Ia menuju London Rabu setelah dua hari tinggal di Tunisia, tanpa memberikan keterangan mengenai kemungkinan motivasi dari kunjungannya. Koussa meninggalkan tempat peristirahatan Djerba “menuju London dengan sebuah penerbangan Swissair pada pukul 14 waktu setempat (pukul 1200 GMT),” kantor berita Tunisia TAP melaporkan.

2003 tentang Penetapan Perpu Nomor 1 Tahun 2002 tentang Pemberantasan Tindak Pidana Terorisme masih melekat dalam dakwaan JPU. Menurut dakwaan JPU, para terdakwa dituduh terlibat dalam aksi perampokan Bank CIMB Niaga dana penyerangan Mapolsek Hamparanperak . Di mana kedua kasus itu mengakibatkan satu anggota Brimob dan tiga polisi meninggal dunia. Masih menurut dakwaa JPU, komando pelaksaanaan kedua kasus itu dipegang Taufik Hidayat yang tewas ditembak Densus 88 dalam penyergapan di Dolok Masihul, Serdang Bedagai, beberapa waktu lalu. Bahkan, penyerangan ke Polsekta Hamparan Perak dipicu dendam Taufik Hidayat atas penggerebekan yang dilakukan Densus 88 di kediamannya. Dakwaan melanggar UU teroris yang diterapkan JPU kepada seluruh terdakwa, dinilai keliru oleh Ketua Tim Advokasi sebagian terdakwa, M. Irsyad Lubis. “Aneh, tidak Dalam perburuan tersebut, Bupati Padanglawas Utara Bahrum Harahap, Wakil Bupati H Riskon Hasibuan, Ketua Komisi II DPRD Paluta Gusman Efendi Siregar beserta sejumlah SKPD turut serta berbaur dengan petani untuk memusnahkan hama tikus tersebut, Kamis (31/3). Mereka memburu tikus dengan menggunakan alat pengasap untuk memancing tikus keluar dan memasukkan racun tiran ke lubang, kemudian setelah diberi asap dan racun tiran, sedikitnya 900

BANDA ACEH (Waspada): Calon jamaah haji Aceh yang berniat menunaikan rukun Islam ke lima berjumlah 38.813 orang. Sedangkan Kementerian Agama (Kemenag) sudah menetapkan kuota haji Aceh 3.924 orang. Kakanwil Kementerian Agama Aceh, Drs. HA. Rahman TB, Lt, kepada Waspada, Kamis (31/3) mengatakan, sampai dengan Rabu, (30/3) data waiting list jamaah calon haji Provinsi Aceh sudah mencapai 38.813 orang. Menurutnya, sesuai Keputusan Menteri Agama RI No. 29 Tahun 2011, tentang Penetapan Kuota Haji Tahun 1432 H/2011, Provinsi Aceh mendapat kuota 3.924 orang dengan rincian 3.888 orang jamaah haji dan 36 orang petugas daerah. Dia menambahkan, secara nasional total kuota tahun 2011 adalah 211.000 orang jamaah, dengan rincian 194.000 jamaah untuk haji regular dan 17.000 jamaah haji plus. Rahman menjelaskan, jumlah kuota haji Aceh tahun lalu seluruhnya 4.163 orang terbagi 13 kelompok terbang (kloter). Dengan Biaya Perjalanan Haji (BPIH) Tahun 2010 sebesar 3.147 US dolar atau lebih kurang Rp28 juta. Padahal, sebelumnya Kemenag menetapkan kuota Haji Aceh tahun 2010 sebanyak 3.599, terjadi penambahan 488 orang. Dia berharap, hal serupa juga bisa terjadi tahun ini, setidaknya menjadi 5.000 orang. Apalagi, katanya, Menteri Agama H. Suryadharma Ali, di Takengon, Aceh Tengah saat membuka Muswil PPP Aceh menyetujui usul Wagub Aceh untuk menambah kuota Haji Aceh menjadi 5.000 orang. Disebutkan, hal ini akan dapat terealisir jika terjadi penambahan kuota jamaah haji Indonesia yang telah diajukan Menteri Agama kepada Pemerintah Arab Saudi. “Kita berdoa dan berharap janji Menag ini terwujud. Sehingga sedikit mengurangi jumlah waiting list Aceh,” katanya. (b05)

Warnet Betsek Tobasa Dibobol Maling, 19 Unit Komputer Raib

BALIGE (Waspada): Maling beraksi membobol Warnet JD Net di Jalan Sisingamangaraja Balige milik Edwin Panggabean Bendahara Sekretariat Kantor Bupati Tobasa dan membawa kabur 19 unit komputer seharga Rp60 juta, Kamis (31/3) sekitar pukul 05:00. Berbagai informasi yang berhasil dihimpun menyebutkan, pembobolan warnet diduga tersangkanya mantan karyawan yangdipecat sehari sebelumnya. Penjaga warnet, Putri,16, sewaktu menutup warnet sekitar pukul 23:30 telah memastikan pintu terkunci rapat dengan menggunakan rantai besi. Tidak ada terlihat sedikitpun kerusakan pintu warnet, namun rantai besi dengan gembok sebagai alat pengaman pintu tidak kelihatan lagi. Kapolsek Balige AKP Gibson Siagian melalui juru periksa Bripka T Simangunsong membenarkan kejadian dan mengatakan untuk tindak lanjut penyelidikan sudah memeriksa 3 saksi. (a22)

menurut mereka juga merugikan perekonomian masyarakat. Banyak kebun pala, nilam dan tanaman perkebunan lainnya terancam rusak dan lenyap karena masuk areal pertambangan. Menanggapi tuntutan pendemo, Camat Labuhanhaji Timur, Rahmatuddin berjanji menyampaikan aspirasi tersebut kepada Bupati Aceh Se l a t a n , Hu s i n Yu s u f d i Tapaktuan.

Info Parlemen

WASPADA Jumat 1 April 2011

A3

Pembatalan Gedung Baru Harus Lewat Forum Legal JAKARTA (Waspada): Ketua DPR Marzuki Alie mengatakan, Ketua DPR tidak mungkin membatalkan pembangunan gedung karena pembatalan harus dilaksanakan melalui keputusan dari forum yang legal. “Kalau dibatalkan harus lewat forum Badan Urusan Rumah Tangga (BURT) melalui anggota Fraksinya yang berada di alat kelengkapan tersebut, kemudian hasilnya dibawa ke Bamus minta dijadwalkan dalam Rapat Paripurna,” jelasnya baru-baru ini di hadapan sejumlah wartawan di Gedung DPR RI Jakarta. Menurutnya, Ketua DPR akan melaksanakan keputusan tersebut apabila proses tersebut telah dijalankan. “Permintaan yang tidak prosedural agar Ketua DPR membatalkan pembangunan gedung baru, merupakan permainan politik yang membodohi publik, karena mereka tahu Ketua DPR tidak mungkin membatalkan pembangunan gedung tanpa perintah dari keputusan rapatrapat di DPR,” terangnya. Ketua DPR mengatakan, dirinya merasa prihatin dengan pola cara teman-teman anggota fraksi dalam menyikapi rencana pembangunan gedung baru DPR RI melalui media massa. “Saya secara pribadi tidak ada kepentingan apapun tentang setuju atau tidak setuju terhadap pembangunan gedung baru. Fungsi ketua DPR adalah menjalankan keputusan rapat, selanjutnya menginformasikan kepada publik hasil keputusan rapat tersebut jadi dalam hal pembangunan gedung ini bukan keputusan Marzuki Alie, tetapi keputusan rapat,” katanya. Pembangunan Gedung baru telah melalui proses yang cukup panjang. BURT telah menangani rencana ini melalui proses rapat-rapat dan keputusan yang

Ketua DPR RI Marzuki Alie (dua dari kanan) didampingi Sekretaris Jenderal DPR RI Nining Indra (tiga dari kanan) dalam sebuah konferensi pers di Gedung Dewan Jakarta baru-baru ini. diambil juga telah melalui rapat pleno BURT. “Perencanaan pembangunan kawasan parlemen dan Gedung DPR telah masuk dalam Renstra DPR RI 2010-2014 yang juga telah disetujui dalam Rapat Paripurna DPR RI tanggal 29 Juli 2010,” tambahnya. BURT, lanjutnya, merupakan alat kelengkapan DPR, sama seperti alat kelengkapan lain seperti komisi-komisi yang didalamnya terdapat perwakilan fraksi-fraksi. Artinya ma-

nakala alat kelengkapan dewan sudah memberikan keputusan maka hanya bisa dibatalkan melalui rapat paripurna dewan. “Hasil rapat BURT telah disosialisasikan kepada fraksi-fraksi dalam forum rapat konsultasi dengan demikian semua fraksi sudah mengetahui mengenai rencana pembangunan gedung baru ini,” kata Mantan Sekjen Partai Demokrat ini. Menyinggung sikap PDIP yang menyetujui pembangunan gedung baru harus lebih se-

derhana, dia mengatakan, penjelasan tersebut tidak jelas ukuran atau indikatornya. “Ini apakah sekelas RSS, berarti setara bangunan sebanyak 560 RSS,” tanyanya. Sementara menanggapi Fraksi PAN yang meminta melibatkan rakyat Indonesia, Ketua DPR mempertanyakan bagaimana keterlibatan rakyat tersebut, dan ini dapat menjadi pertanyaan prosedur dan mekanismenya. Dia menambahkan, opini yang diberikan berbagai

anggota fraksi maupun dari pihak-pihak lain hanya untuk mencitrakan bahwa Ketua DPR yang juga kader Partai Demokrat tidak berpihak kepada rakyat. “Pencitraan ini juga dikaitkan dengan upaya yang dibangun untuk mencitrakan bahwa pemerintah saat ini dianggap tidak berpihak kepada rakyat,” terangnya. Menurutnya, harga per meter persegi gedung baru DPR, khusus civil dan arsitekturnya

sebesar Rp. 4.6 juta/meter persegi sementara dengan elektrical dan mechanical menjadi Rp7.2 Juta permeter per segi. Coba bandingkan dengan pembangunan Gedung MK yang mencapai Rp9 juta per meter persegi tahun 2007 lalu, Kementerian Perdagangan sebesar Rp8,6 juta permeter persegi pada tahun 2006. “Jangan ngomong asal bunyi (asbun) ini juga tidak ada kolam renang, spa maupun fasilitas mewah lainnya,” tegasnya. (Parle)

Calon Perorangan Munculkan Kader Terbaik Jadi Capres Waspada/ist

ANGGOTA DPD RI utusan Sumatera Utara DR H Rahmat Shah dan Tan Sri Abu Sahid Mohamed dari Group Executive Chairman Maju Holdings saat bertemu Presiden Susilo BambangYudhoyono, di Kantor Presiden, Senin.

Anggota DPD Bawa Investor Menghadap SBY MEDAN (Waspada): Anggota DPD RI utusan Sumatera Utara DR H Rahmat Shah membawa Group Executive Chairman Maju Holdings Tan Sri Abu Sahid Mohamed, bertemu dengan Presiden Susilo Bambang Yudhoyono, di Kantor Presiden, Senin (28/3). “Dalam pertemuan itu, Presiden SBY di dampingi oleh Menko Perekonomian Hatta Rajasa, Menteri Sekretaris Negara Sudi Silalahi, Menteri Pekerjaan Umum Djoko Kirmanto dan Kepala BKPM Gita Wirjawan,” kata Rahmat Shah kepada wartawan di Medan, Rabu (30/3). Menurut Rahmat, dalam pertemuan itu membahas rencana investasi Maju Holding yang telah melakukan survey di beberapa daerah di Indonesia, terutama Provinsi Sumatera Utara, ibukota Jakarta dan Kalimantan, khususnya yang terkait dengan pembangunan jalan tol serta monorel yang diyakini mampu mengatasi berbagai persoalan kemacetan lalu lintas serta pengembangan sarana dan prasarana dan kemajuan daerah yang ada di Indonesia, khususnya di DKI Jakarta. Seperti yang telah dilakukan oleh Maju Holdings di beberapa negara khususnya di Malaysia, turut dalam pembangunan pemindahan ibukota administrasi Putera Jaya yang sebelumnya berpusat di Kuala Lumpur dengan segala infrastruktur seperti jalan tol, terminal bus yang lengkap dan terpadu pertama di dunia dengan investasi sebesar 570 juta ringgit. Kini Malaysia tidak lagi mengalami permasalahan kemacetan seperti yang dialami oleh Jakarta dan kota-kota besar lainnya. Maju Holdings Sdn adalah sebuah perusa-haan yang berdiri sejak tahun 1977, berbasis di Kuala Lumpur, bergerak di lima sektor bisnis utama, yakni manufaktur, engineering, pengembangan property, infrastruktur dan jasa, sedangkan Tan Sri sendiri, telah lama menjalin hubungan dengan keluarga Rahmat. Saat ini mereka ingin mengembangkan usahanya dan bekerjasama dalam membangun infrastruktur, sarana dan prasarana yang memberi solusi kemacetan dan kelancaran pembangunan jalan tol di Indonesia, khususnya di wilayah Sumatera Utara. Menurut Rahmat, Presiden SBY menyambut baik rencana investasi dari Maju Holdings di Indonesia. “Pak Presiden welcome. Sebagai senator dari daerah, saya mengakomodir para investor besar yang berminat membantu kita dan hal ini mekanismenya melalui petunjuk Presiden kepada para menteri-menterinya. Beliau juga akan memberi solusi baik yang tidak banyak menyita biaya, bahkan tidak terfokus kepada investasi saja, pihak Maju Holding juga siap jika ditunjuk sebagai konsultan pembangunan infrastruktur dan yang memberi solusi tanpa biaya,” kata Rahmat. Khusus untuk wilayah Sumatera Utara, Tan Sri telah melakukan survei pembangunan jalan tol Tebing Tinggi serta Binjai. Akan tetapi pembangunan jalan tol tidak visible jika semua dana dan pelaksanaan harus disiapkan oleh investor, namun harus ada sharing dari pemerintah pusat maupun pemerintah daerah, terutama menyangkut pembebasan lahan. Sebab, lanjutnya, jumlah kendaraan yang melintas di jalan tol lebih kurang 15.000 per hari, yang idealnya tidak dibawah 50.000 kendaraan kecuali termasuk jalan tol yang ke dan dari Bandara Kuala Namu menjadi satu paket. Idealnya paket seperti inilah yang ditawarkan kepada para investor, sehingga mereka tertarik. (cwan)

JAK ARTA ( Waspada): Pakar Hukum Tata Negara Irmanputra Sidin berpendapat usulan calon presiden dari jalur perorangan bisa memuculkan kader terbaik dari partai politik menjadi calon presiden (capres). “Jadi, menurut saya calon perorangan bukanlah harus calon diluar parpol, tapi bisa saja orang parpol yang tidak mendapatkan tiket resmi dari parpolnya. Dengan calon perorangan justru parpol dan masyarakat diuntungkan,” ujar Irmanputra di Gedung DPR RI Jakarta, Kamis(1/4). Jika dipahami dengan jernih,

katanya, calon perorangan justru sangat baik,bukanhanya buat parpol tapi juga buat masyarakat. Jalur calon perorangan akan membuka peluang bagi orangorang parpol maju menjadi capres walau tidak mendapatkan tiket dari parpolnya. “Calon perorangan tidak perlu harus meninggalkan baju parpolnya, dia tetap kader parpol yang bersangkutan, hanya jalurnya maju jadi capres saja dari jalur perorangan. Dengan demikian, parpol pun bisa mencalonkan lebih dari satu kader terbaiknya. Dan yang paling diinginkan rakyat lah yang terpilih,” tegasnya. Calon perorangan, tambah-

nya, juga bisa menghindari politik transaksional dan “politik kawin terpaksa” seperti yang terjadi selama, dimana tawar menawar politik sangat kuat dalam mencalonkan capres. Dia mencontohkan calon dari Partai Gerindra Prabowo Subianto yang harus mengalah jadi cawapres, karena perolehan suara partainya tidak cukup untuk mencalonkan capres. Menanggapi kekhawatiran elit parpol, Irman menegaskan tidak ada hubungannya calon perorangan dengan digoyangnya sistem presidensial oleh parlemen. DPR kalau mau jujur menurutnya memang memiliki fungsi untuk “mengoyang” atau

Indonesia Adopsi Teknologi Konstruksi Bangunan Ramah Gempa JAKARTA (Waspada): Sekjen Kementerian Pekerjaan Umum (PU) Agoes Widjanarko mengatakan, Indonesia saat ini telah mengadopsi beragam teknologi konstruksi bangunan ramah gempa, terutama untuk bangunan-bangunan baru sesuai dengan zona gempa di berbagai daerah. “Konstruksi bangunan tahan gempa ini sudah diatur melalui undang-undang, peraturan pe-

merintah, sampai ke peraturan daerah,” kata AgoesWidjanarko saat di Jakarta, Rabu (30/3). Agoes mengatakan, berbeda dengan Jepang yang bangunannya memang dirancang untuk gempa berkekuatan di atas 10 Skala Richter sesuai dengan zona gempa di daerah itu, maka di Indonesia masih dalam skala di bawah itu. “Pemerintah membagi wilayah Indonesia ke dalam

zona gempa sehingga bangunan yang didirikan harus dirancang menghadapi kekuatan gempa di zona tersebut,” ujar Agoes. Dia menjelaskan, tujuan membagi wilayah Indonesia ke dalam beberapa zona gempa untuk efisiensi biaya pembangunannya. “ Karena semakin tinggi skala richternya, tentu semakin mahal biayanya,” paparnya. (j03)

mengkontrol presiden. “Selain itu tidak ada hubungannya bahwa calon dari partai politik tidak digoyang di parlemen,” jelasnya. Bisa jadi, tambah Irman, goyangan parlemen selama ini kepada presiden disebabkan presiden berasal dari parpol, sehingga segala sesuatu yang dilakukan selalu dianggap dipolitisasi, walaupun kenyataannya sangat baik bagi bangsa. Dia juga tidak yakin bahwa calon perseorangan akan menghadapi kesulitan dalam menghadapi parpol dalam penyusunan anggaran. “Kita lihat ada beberapa kepala daerah yang menang di Pilkada melalui jalur perseorangan, sampai saat ini kita belum melihat ada masalah,” katanya. Irman menyindiri orangorang parpol yang menolak calon perorangan. “Masa orang parpol cita-cita tertinggi hanya mau jadi menteri tidak mau jadi presiden? Masa cita-cita elitelit parpol maupun kader-kader parpol untuk menjadi presiden harus dikubur hanya karena tidak mendapatkan rekomendasi parpol? (aya)

Ketua DPR RI Marzuki Alie.

Adv

Kerusakan Bangunan Akibat Gempa Bisa Dihindari JAKARTA (Waspada): Pakar kontruksi bangunan Antonius Budiono mengatakan, sebenarnya bangunan yang rusak akibat gempa bisa dihindari, apabila pelaksanaan pekerjaannya mematuhi ketentuan sesuai kekuatan zona gempa yang direkomendasikan. “Kalau perizinan di Jakarta saya masih percaya karena peraturan untuk mendirikan bangunan sangat ketat. Di sini sudah ada tim independen terdiri dari tenaga ahli, pakar,” katanya di Jakarta, Rabu (30/3). Menurutnya, instansi di kota besar seperti Jakarta ini sudah memiliki tim Penasehat Arsitektur Kota (TPAK), Tim Penasehat Konstruksi Bangunan (TPKB), tim eskalasi, dan lainnya sehingga kualitas bangunan yang didirikan dapat di pertanggungjawabkan. Antonius menuturkan, pola perizinan di Jakarta sudah setara dengan Jepang yang memang sangat ketat karena disana sudah ada badan independen yang bertanggungjawab terhadap pemerintah. “Sekecil apapun pelanggaran yang dilakukan sanksinya sangat ketat,” ujar dia. Antonius mengatakan, dengan gempa yang mencapai 8,9 SR di Jepang tidak ada bangunan yang mengalami kerusakan berarti, kerusakan bangunan dilaporkan terjadi di pesisir akibat terjang tsunami dan bangunan tua yang memang belum dilengkapi teknologi antigempa. Antonius yang juga menjabat Direktur di Ditjen Cipta Karya Kementerian PU mengatakan, dirinya masih mengkhawatirkan penerapan bangunan tahan gempa di daerah-daerah. “Kalau daerah yang pernah mengalami gempa seperti Aceh, Padang, dan Bengkulu telah mengantisipasi kekuatan bangunan melalui Perda dan membentuk pola perizinan yang ketat. Sayangnya, daerah lain yang juga masuk zona gempa belum mengikuti,” ujar dia. Kerusakan yang terjadi akibat gempa di suatu daerah terjadi karena banyak bangunan lama yang belum mengaplikasi teknologi ramah gempa, seperti menggunakan Kontruksi Sarang Laba Laba(KSLL) yang merupakan kelompok konstruksi pondasi dangkal. “Tapi ada juga daerah yang zonanya perlu dikoreksi kembali,” imbuh Antonius. Dikatakannya, bangunan ramah gempa dengan menggunakan KSLL tidak harus dibatasi tingginya, karena sangat tergantung kepada kekuatan pondasi dan struktur keseluruhan. (j03)

Medan Metropolitan

A4

WASPADA Jumat 1 April 2011

Menghamburkan Uang Rakyat 100 Anggota DPRDSU Tambah Mobil Dinas Baru MEDAN (Waspada): Fasilitas untuk anggota DPRD Sumut bertambah lagi. Setelah menempati gedung baru senilai Rp185 miliar, mereka dimanjakan lagi dengan pemberian mobil baru, yakni Toyota Kijang Innova. Wartawan memperoleh data pada tahun anggaran 2011 ini, uang rakyat yang dialokasikan dalam APBD akan dipakai lagi untuk mengadakan 60 mobil dinas atau mobnas dengan anggaran Rp15 miliar. Dengan masuknya 60 mobil dinas baru nanti, berarti genap 100 anggota DPRD Sumut menikmati fasilitas mobil. Sebelumnya, 40 mobil dinas baru

sudah diberikan kepada pimpinan dewan (Toyata Fortuner), ketua dan sekretaris fraksi, ketua komisi serta para ketua alat kelengkapan dewan (Toyota Innova). Untuk sama-sama menikmati fasilitas, sebentar lagi seluruh anggota dewan juga memperoleh mobil dinas. Ketua DPRD Sumut Saleh Bangun saat ditemui wartawan mengakui adanya pengadaan

mobil dinas tersebut. Katanya, pengadaan itu atas usulan anggota dewan kepada pimpinan. ‘’Kita sudah konsultasi ke Depdagri dan disetujui dengan syarat disesuaikan dengan keuangan daerah,’’ ujarnya. Melukai hati rakyat Wakil Ketua DPW Partai Amanat Nasional (PAN) Sumut Hendra Cipta kepada Waspada, Kamis (31/3), mengatakan, pengadaan mobil dinas untuk anggota dewan itu sangat melukai hati rakyat karena kepentingannya belum mendesak. Permintaan fasilitas mobil dinas dewan, kata Hendra, ha-

nya bentuk penghamburan uang rakyat. Alasannya, karena tidak ada anggota dewan yang sekarang ini yang tidak punya mobil. ‘’Tidak mungkin anggota dewan tidak sanggup beli mobil. Bahkan banyak diantara mereka yang punya mobil lebih dari satu,’’ kata Hendra Cipta. Menurut Ketua Litbang PAN Sumut ini, masih banyak permasalahan Sumut yang harusnya menjadi prioritas dewan. Sebut saja misalnya masalah pendidikan, kesehatan, tenaga kerja dan lainnya. Harusnya, kata Hendra,

dewan lebih berpikir untuk produktif melakukan fungsifungsinya hingga benar-benar dirasakan rakyat. ‘’Kalau itu dilakukan, tidak ada masalah bagi rakyat angota dewan dapat mobil dinas,’’ katanya. Anehnya sekarang, anggota dewan, menurut Hendra Cipta, membanding-bandingkan pula fasilitas yang didapat eksekutif. Misalkan saja camat yang mendapat mobil dinas. ‘’Ini aneh. Bukannya dewan menjalankan fungsi pengawasannya, malah membandingkan dirinya dengancamat,’’tambahHendra.(m12)

Pembenahan Birokrasi Pemprovsu Mutlak MEDAN (Waspada): Memasuki tahun ketiga pemerintahan Syamsul Arifin-Gatot Pujonugroho (Syampurno) belum terlihat perbaikan yang berarti, terutama berkaitan dengan kinerja pembangunan di Sumatera Utara. Masyarakat mulai kehilangan kepercayaan kepada pemerintah daerah karena janjijanji rakyat tidak lapar, rakyat tidak bodoh, rakyat punya masa depan belum menunjukkan hasil. Untuk itu, pengangkatan Gatot Pujonugroho sebagai Penjabat Gubsu diharapkan dapat

melakukan perbaikan yang signifikan di jajaran birokrasi. Hal ini disampaikan pengamat politik yang juga Direktur Rumah Politik Andalas, Ahmad Taufan Damanik dan Koordinator ‘nBASIS Shohibul Anshor Siregar secara terpisah di Medan, kemarin. Menurut Damanik, fakta yang ada sekarang ini, Sumut didera masalah korupsi yang semakin merebak, dana pembangunan yang tidak maksimal serapannya, koordinasi antar daerah yang tidak terurus mau-

AJA IAIN Teken MoU MEDAN (Waspada): Memperingati Hari Pers Nasional (HPN) Ke-65, Asosiasi Jurnalis Alumni (AJA) IAIN Sumut menggelar seminar jurnalis tentang bagaimana peran dan fungsi dalam pembangunan dirangkai dengan penandatanganan memorandum of understanding (MoU) di kampus IAIN Sumut Jalan Willem Iskandar Medan Estate, Senin (28/3). Hadir pada acara tersebut Rektor IAIN Sumut, Prof. Dr. H. Nur Ahmad Fadhil Lubis MA, Pembantu Rektor IV Prof. Dr. H. Ramli Abdul Wahid, MA, Ketua AJA IAIN Sumut Suasana Nikmat Ginting SHi,Wakil Ketua Drs. Hamdani Nasution, Sekertaris Suhayri Ramadhan, Ketua Dewan Pakar AJA IAIN Sumut Drs. H. Erwan Effendi, Penasehat AJA Drs. Yose Rizal Saragih, Msi, Kabag PRT Makmun, Kasubbbag Humas IAIN Sumut Dra. Zainarti MM, Moderator Husni Ritonga, MAg dan undangan mahasiswa lainnya. MoU yang dilakukan tersebut tentang bagaimana membangun pencitraan IAIN yang baik di tengah- tengah masyarakat. Serta bagaimana membangun program yang bisa meningkatkan sumber daya manusia (SDM) di lingkungan civitas akademik IAIN Sumut. Setelah MoU dilakukan, seminar tentang jurnalis dalam rangka memperingati Hari Pers Nasional (HPN) dipandu oleh Moderator Husni Ritonga MAg, dengan nara sumber Prof. Dr. H Nur Ahmad Fadhil Lubis dan dari PWI Sumut, Direktur Pendidikan dan Pelatihan Mayjen Simanungkalit. (m26)

Zikir DanTausiyah Di Masjid Agung MEDAN (Waspada): Majelis Dzikir Az-Zikra Sumatera Utara kembali akan menggelar acara dzikir bersama sekaligus mendengarkan tausiyah yang disampaikan Ustadz H Ahmad Rizal asal Jakarta, di Masjid Agung Medan, Minggu (3/4) pukul 07:30. “Kita sengaja kembali mengundang Ustadz Ahmad Rizal untuk menyampaikan tausiyah berjudul ‘Meraih Impian Lewat Sholawat’,” kata Ketua Az-Zikra Sumut H Rizal Mahaputra, Kamis (31/3). Menurut Rizal, Islam sangat menganjurkan agar setiap muslim senantiasa berzikir kepada Allah SWT dan sebagai makhluk sosial hidup bermasyarakat dengan saling menolong. Dzikrullah merupakan jalan untuk mencapai ketaqwaan atau buah zikir adalah ketaatan. “Semakin tekun dan khusyu seorang hamba berzikir diharapkan akan semakin taat (bertaqwa). Berarti orang beriman adalah orang yang berzikir. Semakin beriman akan semakin banyak zikir, kurang iman akan kurang zikir, tidak beriman tentu tidak akan berzikir,” ujarnya. Disebutkan Rizal, acara nantinya diawali dengan sholat sunnah Tasbih dilanjutkan zikir bersama dan doa. Sebelum mendengarkan tausiyah disampaikan Ustadz Ahmad Rizal dikumandangkan ayat-ayat suci Al-Qur’an. (cwan)

pun birokrasi Pemprov Sumut yang justru semakin jauh dari asas profesionalitas. “Ini tentu tidak terlepas dari kasus yang dialami Syamsul Arifin, terutama sejak ia ditahan di Jakarta,” kata Taufan yang juga pengajar di Universitas Sumatera Utara (USU). Setelah Gatot Pujonugroho diangkat sebagai penjabat Gubsu, lanjutnya, diharapkan ada perbaikan yang siginifikan di jajaran birokrasi. Juga diperlukan percepatan pembangunan khususnya pembenahan infrastruktur baik jalan raya, irigasi, gedung-gedung pendidikan, rumah sakit dll. Juga diperlukan koordinasi antar daerah yang baik sehingga meski pun daerah-daerah tingkat dua memiliki desain pembangunannya sendiri, tetapi dibutuhkan koordinasi dari pemerintah provinsi untuk mensinergikan gerak pembangunan menuju suatu entitas provinsi yang bergerak ke depan. Menurut Damanik, Penjabat Gubsu ini pun dihadapkan pada tantangan masalah-masalah agraria, masalah perburuhan dan masalah-masalah sosial lainnya. Persoalan anakanak miskin, remaja yang kehilangan harapan karena putusa sekolah dan tidak punya alternaif juga mesti menjadi perhatian serius. Kompleksitas masalah di Sumut sangat tinggi dengan dinamika politik yang tinggi pula. Karenanya, dibutuhkan pemimpinan yang cakap, cergas dan mampu mengayomi keragaman yang ada di Sumut. “Karena itu, langkah-langkah awal yang sudah mulai dilakukan Plt Gubsu yakni evaluasi internal birokrasi sudah tepat. Sebab, salah satu masalah pokoknya adalah kinerja birokrasi Pemprovsu yang selama ini justru terkesan kurang pro-

fesional di dalam penempatannya,” tukas Taufan. Berkaitan dengan evaluasi ini, ujar taufan lagi, Plt Gubsu tentu memiliki wewenang yang penuh sebagaimana diatur di dalam pasal 34 ayat 1 UU 32/ 2004 mau pun pasal 130 ayat 1, PP No. 6 tahun 2005 yang menyatakan bahwa jika Kepala Daerah diberhentikan sementara maka Wakil Kepala Daerah menjalan tugas dan fungsi Kepala Daerah. Karena itu, dengan wewenang penuh yang dimiliki, pembenahan birokrasi pemerintahan dapat dilakukan segera oleh Gatot. Namun, tentu saja pembenahan birokrasi ini mesti mengedepankan dua aspek penting. Pertama, sistem meritokrasi, yakni menempatkan orang sesuai dengan kemampuannya, bukan berdasarkan suka atau tidak suka, meski tentu saja indikator loyalitas kepada Gatot juga penting,” katanya. Berkaitan dengan Sekda yang sedang diperoses di Depdagri, Taufan menyatakan, memang ada sedikit kesulitan karena proses sudah berjalan sebagian, yakni pengajuan tiga nama dan sudah terjadi fit and profer test, yang semua proses tersebutnya sayangnya tidak melibatkan Gatot. Padahal, sangat dibutuhkan kesesuaian di antara Sekda dengan Plt Gubsu nantinya, apalagi kalau nanti Gatot bahkan menjadi gubernur definitif. Bukan arogan Sementara itu, pakar sosiologi politik dari UMSU Shohibul Anshor Siregar mengatakan, ancaman Gatot Pujonugroho tentang pencopotan pejabat di jajaran Pemprovsu hasil KKN yang disampaikannya barubaru ini dengan SKPD, merupakan upaya yang serius dan bu-

kan gertak sambal. Menurut Siregar, bahkan bukan cuma pejabat hasil KKN, pejabat yang tidak profesional pun akan mendapat sorotannya secara serius. Bagaimana pun juga Gatot seorang politisi yang relatif sudah banyak menimba pengalaman dan dia tahu akan berbuat apa di tempat dan di waktu yang mana. “Sungguh, saya yakin dia akan melakukan itu. Saya amat tidak setuju jika itu disebut sebuah arogansi. Itu sebuah keniscayaan belaka. Ingatlah Syamsul Arifin sewaktu apel pertama setelah resmi menjabat Gubernur tanggal 17 Juni 2008. Waktu itu ia menegaskan akan melakukan pergantian sejumlah kepala dinas dengan dalih selain untuk meningkatkan kinerja juga dalam upaya menerapkan PP Nomor 41 tahun 2007 tentang Organisasi Perangkat Daerah,” ujarnya seraya menambahkan siapa siapa yang berani bilang Syamsul Arifin itu arogan? Sudah tepat Siregar yang juga Koordinator Pengembangan Basis Sosial Inisiatif & Swadaya (n’Basis) mengatakan tekad itu sudah tepat, malah jika tidak melakukan perbaikan birokrasi itu malah Gatot Pujonugroho akan ditenggelamkan oleh kecanggungannya sendiri di tengah buruknya iklim birokrasi. Catatlah bahwa Sumatera Utara kini sudah memiliki seorang calon Gubernur yang akan bertarung pada pemilukada 2013 namanya Gatot Pujonugroho. Modalnya ya kinerja selama ditinggal Syamsul Arifin. Seratus persen Gatot Pujonugroho akan menjadikan kesempatan ini sebagai kampanye sepanjang waktu dengan obsesi memberi pelayanan terbaik kepada masyarakat,” ujarnya. (m13)

Sugianto Situmeang Dikeluarkan Dari F.SPTI-K.SPSI MEDAN (Waspada): Dewan Pimpinan Pusat (DPP) Federasi Serikat Pekerja Transport Indonesia, Konfederasi Serikat Pekerja Seluruh Indonesia (F.SPTI-K.SPSI) secara resmi memecat dan mengeluarkan Sugianto Situmeang dari jabatan dan keanggotaan F.SPTI-K.SPSI di daerah ini. Hal itu disampaikan seorang Ketua DPP F.SPTI-L.SPSI Iwan Patar Smanjuntak, SH didampingi Barita Tambunan di Sekretariat DPD F.SPTI-K.SPSI Sumut Jalan Panglima Denai, Kamis (31/3).“Pemecatan dan pengeluaran Sugianto Situmeang secara resmi tertuang dalam Surat Keputusan Nomor : 023.DPP F.SPTI-K.SPSI/III/2011 ditandatangani Ketua Umum DPP H. Aceng Eno Mulyono dan Sekretaris Jenderal Karmen Siregar,SH tertanggal 23 Maret 2011,” ujarnya. Surat itu ditembuskan kepada DPP K.SPSI di Jakarta, Gubernur Provinsi Sumut, Kapoldasu, Kadisnaker Sumut, Bupati/Walikota Se Provinsi Sumut, Kapoltabes/Kapolresta Se Provinsi Sumut, Sundinaker Kabupaten/Kota Se Provinsi Sumut, DPC F.SPTI Se Provinsi Sumut dan instansi terkait. Kata Iwan dan Barita, berdasarkan penelitian, pengamatan dan analisa DPP F.SPTI-K.SPSI Sugianto Situmeang melakukan tindakan yang merugikan organisasi. Kejadian itu dialami Ketua Umum DPP F.SPTI Bapak H. Aceng Eno Mulyono dan Sekjen DPP F.SPTI Karmen Siregar,SH di Hotel Semarak Internasional Jalan SM Raja Medan. Saat itu, Sugianto Situmeang membawa massa dan melakukan pemukulan terhadap anggota Satgas DPD F.SPTI-K.SPSI di depan Ketua Umum DPP F.SPTI-K.SPSI Aceng Eno Mulyono dan Sekjen DPP F.SPTI-K.SPSI Karmen Siregar beserta fungsionaris DPP lainnya yang hadir pada pertemuan saat itu. Sementara itu, Sugianto Situmeang ketika dihubungi melalui telepon selularnya 0811655672 tidak menjawab.(m24)

Hari Ini Pencanangan Sekolah Bebas Sampah Sekolah Eria Bersih Berkat Kesadaran Tinggi MEDAN (Waspada): Hari ini, Jumat ( 1/ 4), pencanangan sekolah bebas sampah. Untuk itu, kemarin, sosialisasi dan peninjauan langsung ke berbagai sekolah dilakukan Kepala Dinas Pendidikan Kota Medan, Drs Hasan Basri MM ke berbagai sekolah. Menurutnya pencanangan sekolah bebas sampah ini sebagai tindak lanjut dari apa yang telah disampaikan Walikota Medan Drs H Rahudman MM saat menyampaikan pidatonya pada kegiatan Gerak jalan sehat bersama PWI di Istana Maimon 27 Maret lalu. Dengan keinginan itu, tentu saja lembaga pendidikan mempunyai arti yang sangat penting untuk melaksanakan program bebas sampah ini. Sekolah yang dikunjunginya SMPN 11 Medan. Di sekolah ini, nampak bersih dan penempatan sampah sudah pada tempatnya. Kepala SMPN 11, Khairani, menyebutkan di sekolah ini melibatkan petugas kebersihan sekolah dan tetap mewajibkan siswa menjaga kebersihan sekolah. Jika ada yang membuang sampah sembarangan, guru akan memberikan sangsi. Sedangkan di SDN di Jalan Pendidikan Medan,Kadis Pendidikan menilai lingkungan sekolah masih nampak belum bersih. Beberapa peralatan kebersihan nampak tidak layak pakai lagi. Di samping itu, parit dan sekitar sekolah nampak tidak berfungsi. Hasan Basri mengingatkan pihak sekolah agar meningkatkan kebersihan lingkungan serta menata tempat sampah serta mulai membe-

rikan sosialisasi pada seluruh siswa tentang arti kebersihan.Terhadap saran ini, seorang kepala sekolah SDN 060879 Yeni Kalsum Siregar berjanji akan melakukan pembenahan kebersihan lingkungan sekolah ini. Eria tanamkan kesadaran Wakil kordinator Perguruan Swasta Eria di Jalan SM Raja Medan, Drs H Rukzaidan mengatakan, program kesadaran kebersihan lingkungan sekolah telah lama terbangun di sekolah itu. Sejak dilaksanakan masa orientasi sekolah, hal utama yang ditanamkan kepada siswa, bagaimana menumbuhkan kemauan dan kepedulian siswa untuk membuang sampah pada tempatnya. Siswa, kata dia, perlu contoh agar mereka berbuat. Karena itu, petugas kebersihan berupaya untuk tidak lalai dengan aktivitas memungut sampah dan meletakkan pada tong sampah. Prilaku itu dicontoh oleh siswa yag selalu membuang sampah pada tempat yang tersedia. “Sekolah sebagai sarana pendidikan bagi anak, jika di sini mereka mau bersih, tentu di rumah mereka bisa melakukan hal yang sama. Alhamdulillah, meskipun ada beberapa petugas kebersihan yang selalu mengangkut sampah dan tidak ada yang tercecer, namun siswa perlu sadar untuk tidak membuang sampah pada tempatnya. Jadi, ada pendidikan yang langsung mereka terapkan untuk menjaga lingkungan tetap bersih, terutama dari gerbang sekolah hingga mereka masuk ke kelasnya untuk belajar,”kata Rukzaidan.(m37)

Senin, Sidang Tuntutan Ramli

Ittihadul Muballighin Gelar Sayembara Pidato MEDAN (Waspada): DPW Ittihadul Muballighin Sumut akan menggelar sayembara pidato yang berlangsung di aula kantor tersebut Jalan Pimpinan Gg. Mawar Medan mulai 3 dan 4 April 2001, kata Pimpinan DPW Ittihadul Muballighin Ibrahim Isa bersama ketua panitia Ahmad Harmen Siregar dan sekretaris Ahmad Muhajir, Kamis (31/3). Kegiatan ini dirangkaikan untuk memperingati HUT Ke-35 Ittihadul Muballighin di Sumatera Utara. Sayembara Pidato dengan judul “Tauladani Rasulullah SAW” diperuntukkan bagi remaja pria dan wanita usia 17 tahun. Bagi yang berminat segera mendaftarkan diri ke sekretariat panitia Jalan Pimpinan Gg.Mawar Medan kepada H. Zainal Arefin tel. 061.4151513 atau Nurul Afipah Ibrahim tel. 061.4565320,dengan membawa foto copi KTP, pas foto 2 lembar ukuran 3x4 Cm, serta uang pendaftaran Rp 100.000,-. Sayembara memakai sitem gugur, tidaka ad finalis. Pertemuan teknik 2 April 2001 mulai pkl 09:00 s/d 10:00 wib.(m24)

Waspada/Anum Saskia

PARA siswa di Perguruan Swasta Eria dengan penuh kesadaran memungut sampah di halaman sekolah mereka sebelum masuk kembali ke kelasnya.

Waspada/Sugiarto

KEPALA Dinas Pendidikan Provinsi Sumatera Utara Syaiful Syafri bersama Direktur Politeknik LP3I Medan dan seluruh civitas akademika Politeknik LP3I Medan dari tiga kampus bersiap-siap melakukan pemotongan tumpeng oleh Kepala Kampus Gajahmada Syahril Sutan Saidi, pada peringatan HUT Ke-22 LP3I, Selasa (29/3).

Perayaan HUT Ke-22 LP3I Di Kampus Gajahmada Meriah MEDAN (Waspada): Perayaan HUT ke-22 LP3I di Kampus Politeknik LP3I Gajahmada Medan, Selasa (29/3) lalu dimeriahkan dengan berbagai kegiatan baik kegiatan olahraga, hiburan, maupun perlombaan yang berkaitan dengan seluruh mata kuliah yang ada di kampus tersebut. Acara puncak peringatan HUT ke-22 LP3I tersebut turut dihadiri Kepala Dinas Pendidikan (Disdik) Sumut Syaiful Syafri mewakili Wagubsu, Pembina Politeknik LP3I Medan Fadiya Harry Satwiko, Direktur Akhwanul Akmal, Kepala Kampus Gajahmada Syahril Sutan Saidi, Kepala Kampus Glugur By Pass Surya Hendra Putra, Kepala Kampus Sisingamangaraja Indra Hermawan dan seluruh sivitas akademika Politeknik LP3I Medan. Kepala Kampus Gajahmada Medan Syahril Sutan Saidi mengatakan, dalam memeriahkan HUT ke-22 LP3I tahun ini, Politeknik LP3I Medan Kampus Gajahmada Medan tak hanya berfokus ke kegiatan olahraga. “Tapi kami juga mengcover kemampuan dan bakat mahasiswa di bidang akademik dan seni

budaya dengan menggelar kegiatan seperti, festival band antar SMA/SMK se-Sumut, festival band antar mahasiswa Politeknik LP3I Medan, Speech Contest, Scrable Contest, Typing Contest, Grafic Design, Accounting dan karaoke,” paparnya. Menurut Syahril, kegiatan tersebut dilakukan untuk menggali dan memfasilitasi mahasiswa serta pelajar dalam mengembangkan bakat dan kemampuan mereka sesuai dengan jurusan dan ilmu yang mereka pelajari di kampus. Sementara itu, Syaiful Syafri mengatakan, Politeknik LP3I Medan memiliki konsentrasi mengembangkan kemampuan mahasiswa di bidang administrasi bisnis. “Konsentrasi akademis seperti administrasi bisnis tersebut diharapkan bisa lebih dikembangkan, karena menjadi perhatian pemerintah daerah. Karena dengan konsentrasikonsentrasi akademis seperti itu, dapat membantu percepatan Sumut untuk menjadi pusat pertumbuhan ekonomi di wilayah Barat Indonesia,” jelasnya. Syaiful juga mengatakan, dengan berbagai kegiatan yang

diselenggarakan oleh Politeknik LP3I Medan Kampus Gajahmada Medan merupakan satu hal yang sangat baik. “Untuk menghasilkan generasi yang baik, harus diikuti dengan jiwa dan raga yang baik pula,” ujarnya. Ketua panitia Andika Pinem menjelaskan, pada kegiatan yang bertema ‘Professional to The Best Service’ tersebut juga diikuti dengan penandatanganan MoU dengan 8 perusahaan yang baru bergabung dengan Politeknik LP3I Medan yang berkaitan dengan penempatan magang dan penempatan kerja bagi lulusan Politeknik LP3I. “Diharapkan, LP3I ini makin tua makin profesional,” katanya. Kedelapan perusahaan yang menjalin MoU tersebut, yakni, PT Fuboru Indonesia (Manufacturing), Korek Api Advertising (Advertising dan EO), PT Industri Pembungkus Internasional (Pembuat Kotak Karton), PT Marosa Pitaloka (Konsultan), PT Comtech Agung (IT Solution), PT Centra Mediatama (Media Cetak Nasional), Astra Credit Company (Pembiayaan) dan PT Bank Danamon Indonesia tbk (Perbankan). (m41)

MEDAN (Waspada): Majelis Hakim Pengadilan Negeri Medan menjdawalkan sidang tuntutan terhadap mantanWalikota Medan, Ramli Lubis, terkait kasus dugaan korupsi tukar guling (ruislagh) Kebun Binatang (KBM), Senin (4/4). “Sidang Ramli dijadwalkan Senin depan,” kata Dharmabella Timbasz salah seorang JPU dalam perkara itu, kemarin. Sebelumnya, rencana si-dang pembacaan tuntutan 28 Maret 2011, tetapi harus diundurkan karena tuntutan belum turun dari Kejagung. Hal senada disampaikan Kuasa Hukum Ramli Lubis, Benni Harahap. “Jadwalnya memang Senin depan, dan kami sudah siap menghadapi tuntutan itu,” tegas Harahap. Sementara menjawab Waspada terkait dari pemeriksaan sejumlah saksi yang dihadirkan ke persidangan, menurut Harahap secara umum keterangan saksi tidak ada yang memberatkan terdakwa Ramli Lubis.“Kalau menurut hemat kami, 99 persen, keterangan saksi tidak yang memberatkan klien kami,” ujarnya. Harahap mengatakan, berdasarkan hasil pemeriksaan dari 29 saksi yang hadir di persidangan dan termasuk pemeriksaan di lapangan, boleh disebut 99 persen saksi meringankan terdakwa hanya satu saksi tidak meringankan, yaitu saksi ahli yang dihadirkan oleh Jaksa Penuntut Umum. “Ada juga di antara saksi yang ikut meringankan terdakwa, namun terkesan keterangan mengambang, walau pada kesimpulan akhir mereka menyebut ruislagh Kebun Binatang Medan sudah sesuai prosedur dan menguntungkan Pemko Medan,” tegasnya. Menurut Harahap, saksi yang dinilai tidak meringankan yakni Nasrul Wathon selaku saksi ahli dari auditor BPK yang dihadirkan oleh jaksa, terkait pemecahan NJOP (nilai jual objek pajak) dari satu objek menjadi tiga bagian pada lahan kebun binatang lama dinilai suatu kesalahan . Namun, pendapatnya itu dibantah Marjanto dari Kantor Pajak Pusat juga sebagai saksi ahli dalam perkara itu. Kata Harahap, menurut Marjanto pemecahan NJOP menjadi beberapa bagian dibenarkan dalam undang-undang perpajakan. Saksi ahli Ahli lainnya yakni ahli Hukum Administrasi Negara, Prof. M. Abduh SH, mengatakan ia sudah mempelajari dokumen pelaksanaan ruislagh yang dalam SK tersebut, urutan pertama ada pengarah yaitu Walikota Medan dan Wakil Pengarah Wakil Walikota Medan urutan berikutnya Sekda sebagai penanggung jawab, dan yang ketiga ketua tim Ketua Bappeda Medan dan masing-masing ketua kelompok masing-masing para asisten Pemko Medan. Oleh karenanya, menurut Prof. M. Abduh, saksi ahli bidang admintrasi negara dari USU, ada penanggungjawab tertinggi dalam SK tersebut,

yaitu Walikota Medan selaku pengarah. Fungsi Sekda berdasarkan UU Pemerintahan Daerah Pasal 21 sebagai penanggungjawab administrasi yang dalam pengertian tanggungjawabnya bersifat formal tidak absolut, karena ia melaksanakan tugas sebagaisekretaris daerah sesuai dengan perintah dari pengarah, yaitu Walikota yang telah dijalankan sebaik-baiknya dan telah dipertanggungjawabkan dan bahkan kegiatan ruislagh telah disampaikan ke Kejaksaan Negeri, Pengadilan Negeri dan disyahkan disetujui oleh DPRD Kota Medan. Prof.M.Abduh, SH mengatakan istilah yang salah kalau disebut pengambilalihan tetapi yang benar adalah sebagai bentuk koordinasi atau kontrol kerja dan itu wajar. Di bagian lain dalam persidangan pada hari yang sama saksi ahli hukum pidana Dr. Mahmud Mulyadi SH, M.Hum memberi keterangan tidak ada pelanggaran perbuatan melawan hukum dalam pemecahan NJOP, karena sudah sesuai dengan undang-undang. Tidak bisa dipidana Menyangkut Ramli sebagai terdakwa yang ketika itu sebagai Sekda tidak bisa dipidana, karena yang bersangkutan melaksanakan perintah, kalau pun ada terjadi penyimpangan harus dilihat hirarki siapa yang memberinkan perintah. Saksi ahli dari Julhairi mantan pejabat Kementerian Dalam Negeri yang merupakan utusan Mendagri dalam prores ruislagh dan melakukan peninjauan ke lapangan menyebut secara adminitrasi proses ruislagh KBM sudah sesuai dengan Kepmen-dagri nomor 11 tahun 2001. Seluruh proses sudah terpenuhi dan selain itu kondisi KBM lama merman sudah tidak layak dipertahankan, dan yang baru sudah sangas pantas.”Jika dipertahankan yang lama itu bukan berfungsi sebagai kebun binatang tetapi pengkandangan binatang,” ujarnya. Dari hasil pemeriksaan sejumlah saksi-saksi yang meri-ngankan para terdakwa bahkan ada yang mencabut berita acara pemeriksaan (BAP) dari kantor kejaksaan, yang merasa ada penekanan saat diperiksa antara lain yang mencabut BAP, tercatat Azwanto mantan Camat Me-dan Maimun dan mantan Camat Medan Tuntungan Arjuna Sembiring, Muslimin BEM, M.Tax. Termasuk pula mantan Kadis TRTB Qamarul Fattah yang mencabut BAP berdasarkan keterangan sebelumnya sebagai asumsi pribadinya sehingga tidak tepat dijadikan sebagai keterangan dalam persidangan, termasuk pada sidang pemeriksaan di lapangan yang meringankan para terdakwa karena Majelis Hakim dan JPU menemukan kultur-kontur atau topologi tanah yang sesuai keterangan saksi, yaitu tanah yang rata, tidak rata, curam dan lembah. (m49)

Medan Metropolitan

WASPADA Jumat 1 April 2011

A5

Dugaan Korupsi Retribusi Sampah Rp9 M Kejari Jadwalkan Pemanggilan 151 Lurah MEDAN (Waspada): Posisi 151 kepala kelurahan terancam kasus dugaan korupsi retribusi sampah di Dinas Kebersihan Kota Medan. Tim Pidana Khusus (Pidsus) Kejaksaan Negeri (Kejari) Medan segera memeriksa mereka secara bertahap. “Benar tim saya sudah menjadwalkan pemanggilan para lurah itu,” kata Kepala Seksi Pidana Khusus Kejari Medan Dharmabella Timbasz kepada Waspada, Kamis (31/3), terkait perkembangan terakhir kasus itu. Namun, Dharmabella belum merinci hari dan tanggal pemeriksaan lurah tersebut. Hanya saja, lanjut Dharmabella, pemanggilan mereka sudah diagendakan. “Begitu dipanggil dan diperiksa akan saya kabari,“ tegasnya. Menurut Dharmabella, pe-

manggilan lurah penting untuk mengungkap kasus dugaan korupsi dana retribusi sampah karena petugas pengutipannya di kantor-kantor lurah.”Tim saya tentu butuh keterangan mereka,” kata Dharmabella mempertegas. Dharmabella mengatakan mengenai siapa di antara mereka yang berpeluang menjadi tersangka, hasil pemeriksaan dan alat bukti yang akan menjawabnya.”Kita tidak bisa terburuburu menyebutkan siapa tersangka kasus ini, sebelum ada

Aidan Panggabean Pimpin JBMI MEDAN (Waspada): Aidan Nazwir Panggabean terpilih secara aklamasi sebagai Ketua Umum DPW Jam’iyah Batak Muslim Indonesia (JBMI) Sumut dalam Musyawarah Wilayah (Muswil) VI 26-27 Maret 2011 di Asrama Haji Pangkalan Masyhur Medan. “Alhamdulillah MuswilVI JBMI Sumut sudah terlaksana dengan sukses. Kita juga sudah berhasil memilih secara aklamasi H. Aidan Nazwir Panggabean sebagai ketua umum DPW JBMI Sumut yang baru,” kata Ketua Panitia Muswil H. Parlindungan Pulungan didampingi anggota tim formatur Bustami Manurung kepada wartawan di kantor DPW JBMI Sumut Jalan Alfalah Medan, Senin (28/3). Dikatakan, Muswil VI JBMI Sumut diikuti 21 DPC ditambah 3 DPC yang baru menerima mandat. “Kendati persiapan panitia sangat singkat, namun seluruh agenda Muswil, termasuk perlombaan dan seminar, sukses terlaksana. Demikian juga agenda pemilihan ketua berjalan lancar dan sangat singkat, karena seluruh pengurus DPW, DPC dan termasuk calon ketua sepakat memilih ustadz H Aidan Panggabean sebagai ketua,” tandasnya. Dijelaskan, meski sejak awal sudah ada kesepatan pemilihan ketua secara aklamasi, namun panitia Muswil tetap melaksanakan aturan pemilihan sesuai Ad/ART JBMI, yakni membentuk lima tim formatur yang diambil dari pengurus DPP, DPW dan perwakilan DPC. Komposisi tim formatur yakni, Ketua H. Aidan Nazwi Panggabean (Sekjen DPW JBMI Sumut), Drs. Bustami Manurung, Drs. H. Awaluddin Sibarani Msi, H. Syamsul Manaf Sipahutar dan H. Chandra M Sitompul, SPd (Ketua DPC JBMI Binjai). (m26)

LP2AJA Minta Prioritaskan Pendidikan Anjal MEDAN (Waspada): Ketua Lembaga Peduli Pendidikan Anak Jalanan (LP2AJA) Sumut, Tamrin Harahap meminta pemerintah terutama Dinas Sosial dan Dinas Pendidikan Sumut untuk memprioritaskan keterampilan dan pendidikan anak jalanan atau anjal. Demikian disampikan Tamrin Harahap pada pelatihan Jurnalistik Dasar kepada 40 anak jalanan dan pelajar se Kota Medan yang dilaksanakan di Wisma PHI Sumut Jalan Gantot Subroto Medan belum lama ini. “Dengan pemberian pelatihan ini diharapkan kepada anak jalanan maupun pelajar di Kota Medan memiliki kemampuan yang baik, misalnya di bidang jurnalistik maupun teknik penulisan. Dengan kemampuan itu diharapkan pelajar maupun anak jalanan dapat menyalurkan kreativitas melalui tulisan ataupun bekerja di media massa,” ujarnya. Kabid Pembinaan Politik Dalam Negeri Badan Kesbang Pol Linmas Pemprovsu Ahmad Firdaus Hutasuhut dalam sambutannya menyampaikan apresiasinya dengan program LP2AJA Sumut terutama dalam mengembangkan ilmu di luar jam sekolah kepada anak jalanan dan pelajar. (m26)

Tiga APMS Gabion Ditutup BELAWAN (Waspada): Tiga dari tujuh Agen Premium dan Minyak Solar (APMS) yang beroperasi di Gabion, kawasan Pelabuhan Perikanan Samudera Belawan (PPSB) tutup yakni milik OP 1 dan KUD Mina Makmur 2. Penyebab penutupan ketiga APMS masih simpang siur. Namun ada dugaan penutupan dilakukan Pertamina akibat tidak tepat menyalurankan minyak bersubsidi itu. Asisten Managemen External Relation (Humas) PT Pertamina Pemasaran Regional I Firi Erika membenarkan tentang tidak beroperasinya ketiga APMS tersebut. Dijelaskannya, ketiga APMS itu yakni APMS milik OP berhenti April 2010 dengan alasan permasalahan administrasi dan APMS KUD Mina Makmur berhenti awal 2011 karena ada kelengkapan administrasi yang belum dilengkapi berupa aspek tata bangunan dan safety operasi. “Tapi alokasi minyak solar dari ketiga APMS yang tutup itu dialihkan atau ditambahkan ke empat APMS yang masih beroperasi,” kata Erika. Akibat ditutupnya ke tiga AMPS itu maka empat APMS yang masih beroperasi mendapat penambahan alokasi minyak ratarata tiap bulan menjadi APMS PT Edina 1330 KL, Sugianto 1030 KL, Suriani 554 KL dan PT Sekar Mulia sekitar 300 KL. Sehingga pasokan minyak bersubsidi untuk nelayan masih normal. Mengingat pasokan solar ke nelayan di subsidi pemerintah, Pertaminan lebih mengutamakan tertib administrasi dalam pengalokasiannya. “Kami melayani nelayan berdasarkan data verifikasi kebutuhan yang dikeluarkan instansi pemerintah terkait,” jelasnya. (h03)

alat bukti yang mendukung,” ujarnya. Dharmabella sebelumnya mengatakan, kalau dalam kasus tersebut sejumlah lurah telah diperiksa, namun tidak tertutup kemungkinan mereka akan diperiksa kembali. Meski belum menetapkan tersangka, paling tidak apakah Pidsus sudah membidik oknum tertentu yang dinilai paling bertanggung jawab atas dugaan korupsi itu, Dharmabella, belum merincinya. “Belum, tanpa dibidik pun kalau bukti ada yang pasti status tersangka akan melekat kepadanya. Jadi semua tergantung alat bukti. Pemeriksaan ini juga untuk inventarisasi bukti-bukti tunggakan sampah itu,” tegasnya. Saat ini, kata Dharmabella, timnya tengah meneliti ulang data terbaru terkait retribusi setelah melakukan invetarisasi lagi hingga kerugian negara akibat kasus ini jelas. Sebelumnya, informasi yang diterima Kejari Medan dugaan korupsi retribusi sampah yang tidak disetor dari sejumlah kelurahan pada awal

2010 mencapai Rp9 miliar. Namun, jumlah itu masih diverifikasi pihak penyidik. Proses pengusutan kasus ini dilakukan oleh pihaknya setelah menerima laporan dari masyarakat tentang adanya dugaan korupsi dalamretribusi sampah yang dilakukan sejak tahun 2004-2010. Dugaan korupsi ini diduga dilakukan aparatur kelurahan. Hasil penyidikan sementara yang diperoleh dari keterangan saksi penyelewengan uang tersebut di setiap kelurahan antara kisaran Rp80 juta sampai Rp100 juta. Camat bakal dicopot Secara terpisah Walikota Medan Rahudman Harahap mengancam akan mencopot camat jika membiarkan sampah di lingkungannya. “Medan harus harus bersih dari sampah.” Tidak ada alasan sampah tidak bersih di kecamatan masing-masing. Kata Rahudman, sehari sebelumnya pihaknya sudah instruksikan Wakil Walikota Dzulmi Eldin agar camat yang tidak mematuhi instruksi harus dicopot.

Hal itu disampaikan Rahudman kepada wartawan di Bandara Polonia Medan menjelang bertolak ke Jakarta, Kamis (31/3). Rahudman menegaskan, selama ini produksi sampah di jajaran Pemko Medan mencapai 1.300 m3/hari, hanya 60 persen yang bisa diangkut, sementara 40 persen lagi membusuk di mana-mana dan menyebar bau tidak sedap. Hal tersebut tanggung jawab bersama aparat di jajarannya untuk menangani kebersihan sampah.“Kami sudah memperbanyak tempat pembuangan sampah (TPS) sebelum diangkat ke tempat pembuangan akhir (TPA),” ujarnya didampingi Eldin. Guna mengatasi masalah sampah ini, lanjutnya, Pemko telah menyerahkan 21 mobil pick up kepada masing-masing kecamatan. “Jadi, tidak ada alasan sampah berserakan,” ujarnya. Mobil itu berkeliling mulai pukul 06:00 hingga pukul 08:00 dan pukul 15:00 hingga 15:30 untuk mengangkut sampah. (m49/m32)

Penerbangan Cemaskan Kondisi Cuaca MEDAN (Waspada): Kondisi cuaca saat ini membuat kalangan capten pilot dan crew pesawat menjadi cemas, terutama saat penerbangan hendak landing dan take off melalui landasan pacu Bandara Poloni Medan. Kondisi cuaca sejak seminggu belakangan ini pada sore hari agak gelap akibat pumpunan awanrendah,menyebabkansuasana Bandara Polonia Medan berkabut dan capten pilot terpaksa memutar-mutar pesawat di udara saat akan mendarat. “Gangguan pada penerbangan hingga saat ini belum ada, namun saya merasa cemas dengan kondisi cuaca tersebut,” kata Aria, Capten Pilot penerbangan Lion Air kepada Waspada saat mendarat di Bandara Polonia Medan dari Jakarta, Kamis (31/3). Kata Aria, kebetulan saja pihaknya kadang-kadang mendarat di Medan pada siang dan ada juga pada sore hari. Kecemasan tersebut semakin tinggi, ujar Aria, karena

lampu pemandu pesawat atau Instrumen Landing System (ILS) saat mendarat di ujung landasan pacu (runway) 05 Bandara Polonia Medan dalam kondisi tertutup awan, apalagi dalam suasana hujan deras. “Dapat dibayangkan walau dalam kondisi bagaimanapun, crew harus dapat menenangkan penumpang apalagi pesawat jenis ER-900 jumlah penumpang 217 orang,” ujarnya. Berbahaya Bahkan di tempat terpisah Firman, Kepala Data dan Informasi (Datin) pada Badan Meteorologi Klimatologi dan Geofisika (BMKG)Wilayah I mengakui kondisi cuaca saat ini meningkatkan pumpunan awan menjulang tinggi atau awan Cummulonimbus (CB) menyebabkan intensitas curah hujan meningkat disertai petir dan angin kencang. Kondisi tersebut, lanjutnya, berkaitan pada siang hari terjadi udara labil meningkat suhu udara panas mencapai 34 hingga 35 derajat Celcius, menye-

babkan pada malam bahkan pagi selalu terjadi curah hujan dalam waktu lama. Hal tersebut, kata Firman, memungkinkan penerbangan berputar-putar di udara atau mengalihkan pendaratan (divert) ke bandara lebih dekat dari Bandara Polonia, seperti Bandara antar bangsa Pulau Penang dan Bandara Sultan Syarief Pekanbaru. Kondisi cuaca ekstrim saat ini, diingatkan capten pilot pesawat yang akan mendarat (landing) maupun terbang (take off) di Bandara Polonia Medan mewaspadai adanya awanawan konvektif seperti awan cumulonimbus (CB). Awan tersebut bisa mengancam keselamatan penerbangan. Firman menilai kondisi itu berbahaya bagi pendaratan pesawat apalagi pumpunan gantungan awan CB hanya pada ketinggian lebih kurang 210 feet atau 1,5 Km dari permukaan tanah, menyebabkan jarak tembus pandang terganggu. (m32)

Terdakwa Berpakaian Muslim Hak Asasi MEDAN (Waspada): Ketua Umum Majelis Ulama Indonesia (MUI) Medan Mohd. Hatta menegaskan, Islam tidak pernah mengajarkan untuk mencapai suatu tujuan yang baik harus dilakukan dengan menghalalkan segala macam cara. Di dalam Islam itu sangat tidak dibenarkan, tetapi Islam mengajarkan untuk mencapai suatu tujuan baik harus dilakukan dengan yang baik pula. Hal tersebut dikatakan Ketua Majelis Ulama Indonesia (MUI) Kota Medan kepada Waspada, Kamis (31/3), terkait dengan terdakwa kasus Perampokan Bank CIMB Niaga Medan yang menggunakan senjata api dan hasilnya dibagi-bagi untuk berjihad dalam perjuangan Islam. Hatta yang merupakan mantan Dekan Fakultas Dakwah IAIN ini menyebutkan, kalau ada kelompok-kelompok

tertentu yang mengatasnamakan Islam, kemudian melakukan perbuatan kejahatan, itu tidak bisa digeneralisasikan kepada seluruh umat Islam. “Jangan suka mengeneralisasikan orang yang berpakaian muslim berbuat jahat, terus seluruh umat muslim dikatakan jahat. Jadi, harus ada kearifan dalam menilai hal itu,” ujarnya. Mengenai aksi perampokan Bank CIMB yang mereka lakukan apakah murni perampokan atau ada unsur jihad untuk perjuangan Islam sehingga dikaitkan dengan teroris, Hatta mengatakan hal itu harus dibuktikan di persidangan dan tunggu saja putusan pengadilan, apakah itu benar perampokan atau teroris. Masyarakat kita saat ini sudah dewasa, sehingga diharapkan bisa melihat mana yang benar mana yang tidak, apalagi yang membesar-besarkan masalah itu adalah sekelompok

kecil saja yang pemahamannya terbatas. Mengenai penggunaan simbol-simbol Islam seperti pakaian dan gaya muslim itu merupakan hak asasi orang untuk menggunakannya, apalagi yang menggunakan memang benar-benar beragama Islam. Diharapkan orang yang memakai pakaian muslim disertai dengan jati dirinya akan berbuat baik. “Orang berpakaian muslim itu bagus, meskipun dia telah berbuat salah, namun dia mau bertobat, itu sangat baik,” ujarnya. Mengenai konotasi simbolsimbol Islam yang digunakan oleh terdakwa kasus perampokan Bank CIMB seperti dengan cara berpakaiannya, tidak usah diterjemahkan ke yang lain-lain. Apalagi saat ini informasi sudah tidak terbatas, sehingga masyarakat bisa menilai mana yang baik mana yang tidak. (m41)

Gudang Ikan Awi Normal BELAWAN (Waspada): Aktivitas bongkar dan jual beli ikan di gudang Sarwo atau Putra Belawan Perkasa (PBP) milik orang tua Ko Wie To, 36, alias Awi, korban penembakan 3 OTK di Jalan Akasia 1 No 50, Bambu III Kelurahan Kampung Durian Medan Timur, tetap berjalan normal. Pekerja dan pedagang ikan di daerah itu tetap bertransaksi seperti biasa dan tidak memperlihatkan suasa duka di gudang yang berada di kawasan Pelabuhan Perikanan Samudera Belawan (PPSB) tersebut. Namun, sejumlah orang yang ditemui Waspada, Rabu (30/ 3) di gudang itu, enggan berkomentar panjang terkait tewasnya Ko Wie To, 34, pengelola gudang ikan tersebut. Bahkan beberapa polisi berpakaian dinas dan preman dari Polres Pelabuhan Belawan dan Poldasu juga hilir mudik di gudang tersebut bungkam. Kedatangan aparat hanya melihat kondisi pergudangan korban. “Kalau masalah itu, aku gak tahu tanya yang lain aja,” kata seorang pekerja. Namun dari beberapa orang yang ditemui di PPSB menyebutkan dalam kesehariannya Awi jarang berbicara sehingga terkesan angkuh dan peristiwa yang menimpanya diduga merupakan buntut dari persaingan usaha yang belakangan ini memanas di Belawan akibat maraknya masuk ikan impor. “Awi hanya mau cakap kepada pedagang sedangkan kepada pekerja jarang,” kata seorang pedagang yang tidak bersedia menyebutkan namanya. (h03)

Waspada/Rustam Effendi

AKTIVITAS pekerja dan pedagang di gudang PBP milik KoWie To, 34. Alias Awi korban penembakan OTK di kediamannya Jalan Akasia I No 50, Bambu III Kelurahan Kampung Durian Medan Timur, tetap nomal walau duka menyelimuti keluarga pemilik gudang tersebut, Rabu (30/3).

Waspada/Surya Efendi

KETUA Dewan Pembina Partai Gerindra Prabowo Subianto dan Pembina Partai Gerindra Sumut Rudolf M Pardede ketika menghadiri acara pengukuhan DPC Partai Gerakan Indonesia Raya (Gerindra) se-Sumut sekaligus perayaan HUT ke-3 partai tersebut di Pardede Hall Medan, Kamis (31/3).

Prabowo: Rakyat Ingin Perubahan Rudolf Ketua Dewan Pembina Gerindra Sumut MEDAN (Waspada): Ketua Umum Partai Gerakan Indonesia Raya (Gerindra) Prabowo Subianto menegaskan, keinginan seluruh rakyat Sumatera Utara menjadikan Indonesia sebagai negara maju, makmur, sejahtera dan berbudaya tinggi harus segera direspons seluruh kader partai. Caranya merebut simpati rakyat dan meminta izin rakyat agar para kader partai bisa memimpin negeri ini menuju perubahan lebih baik. “Hanya dengan cara-cara seperti itu seluruh kader Partai Gerindra bisa memenangkan Pemilu 2014 guna melakukan perubahan lebih baik di bangsa ini,” kata Prabowo dalam orasi politik merayakan HUT ke-3 Partai Gerindra di Pardede Hall Medan, Kamis (31/3). HUT ke-3 Partai Gerindra Sumut itu dihadiri ribuan kader partai dari berbagai pelosok daerah. Di antaranya tampak Ketua Dewan Pembina DPD Gerindra Sumut Rudolf M Pardede, Ketua DPD, Ramses Simbolon, Ketua Panitia HUT, Selwa Kumar dan 33 pengurus tingkat Dewan Pimpinan Cabang (DPC) dan Pimpinan Anak Cabang (PAC). “Terus terang kehadiran kalian semua menunjukkan bahwa rakyat Sumut sangat komit untuk perubahan lebih baik bagi bangsa Indonesia di masa depan. Yakinlah hal itu, karena harapan kalian semua juga menjadi harapan partai yang didirikan tiga tahun lalu,” ujar mantan Komandan Jenderal Korps Pasukan Khusus TNI-AD itu. Prabowo memastikan pendirian Partai

Gerindra bukan karena ingin ikut-ikutan meramaikan kancah politik di dalam negeri atau karena ambisi untuk mendapatkan jabatan di pemerintahan. Tapi, karena keinginan dan niat tulus untuk melakukan perubahan lebih baik bagi seluruh elemen bangsa. Sebab, masih sangat banyak anak bangsa ini yang susah mencari makan, susah mencari pekerjaan dan susah meningkatkan kesejahteraannya. Prabowo mengingatkan seluruh kader partai untuk mawas diri terhadap anasir atau orangorang yang hanya ingin nompang cari makan di Partai Gerindra. Prabowo juga mengaku bangga dengan dedikasi Rudolf M Pardede yang begitu nyata ingin melakukan perubahan bagi seluruh rakyat Sumut dan rakyat Indonesia. Pada kesempatan itu Prabowo ikut menyaksikan pengukuhan 21 pengurus PAC Partai Gerindra se Sumut dari 33 yang direncanakan. Menurut panitia pelaksana HUT, pengukuhan 12 pengurus PAC se Sumut lainnya hanya terkendala proses verifikasi internal partai yang dalam waktu dekat segera dituntaskan. 21 pengurus PAC Partai Gerindra se Sumut itu meliputi Nias Utara, Nias, Dairi, Labuhanbatu Utara, Padang Lawas Utara, Gunung Sitoli, Nias Selatan, Serdang Bedagai, Pematang Siantar, Batubara, Medan, Pakpak Bharat, Toba Samosir, Tanjung Balai, Binjai, Tapanuli Utara, Sibolga, Padang Lawas, Humbang Hasundutan, Karo dan Tapanuli Tengah. (m28/chr)

Memperingati HKS 2011

Pusham Unimed Gelar Diskusi Publik MEDAN (Waspada): Berkaitan dengan akan digelarnya diskusi publik memperingati Hari Kesehatan Sedunia (HKS) 2011, Pusat Studi Hak Asasi Manusia Universitas Negeri Medan (Pusham Unimed) bersama Unit Donor Darah (UDD) PMI Kota Medan beraudiensi ke Kantor Dinas Kesehatan Provinsi Sumatera Utara (Diskes Provsu), Kamis (31/3). Audiensi tersebut dipimpin oleh Kepala Pusham Unimed Majda El Muhtaj (foto) diterima Kepala Bidang Pengendalian Masalah Kesehatan (Kabid. PMK Diskes Propsu), dr. Sh.Suryanti, M.Kes, mewakili Kadis yang juga didampingi Sukarni (Kasie. P2P), Suryadi (Kasie WB) dan Heri Ambarita (Kasie. Kesling). “Audiensi ini terkait dengan rencana Pusham Unimed menggelar Diskusi Publik memperingati Hari Kesehatan Sedunia (World Health Day)Tahun 2011. Kegiatan ini akan dilaksanakan pada Kamis 7 April 2011 di Kampus Unimed,” kata Quadi Azam, staf Pusham Unimed, kemarin. Sementara itu, Kabid. PMK Diskes Provsu menyatakan sebagai focal point di bidang kesehatan, tentu saja Diskes Provsu mendukung kegiatan tersebut. “Kegiatan ini sangat penting dan merupakan bentuk kesadaran bersama seluruh komponen masyarakat Sumut dalam mengampanyekan isu-isu kesehatan dunia,” tegas Suryanti. Pada kesempatan itu, Quadi Azam men-

jelaskan, tahun ini WHO menetapkan tema Hari Kesehatan Sedunia “Combat Drug Resistance; No Action Today, No Cure Tomorrow (Lawan Resistensi Obat; Tidak Bertindak Hari ini, Tidak Ada Penyembuhan Esok Hari)”. Di bawah tema inilah, diskusi publik diselenggarakan guna merespons perkembangan terkini di sumut terkait langkahlangkah protektif dan antisipatif menghadapi ancaman bagi iklim kesehatan dunia. “Hak atas kesehatan adalah hak asasi manusia (HAM) dan tentu saja tak terlepaskan dari komitmen dalam merealisasikan kewajiban (obligasi) negara dalam menghormati, melindungi dan memenuhi HAM atas kesehatan,” ujarnya. Diskusi Publik ini dilaksanakan secara konsorsium dengan melibatkan Pusham Unimed, Dinkes Provsu, Aliansi Jurnalis Independen (AJI) Medan, Forum Wartawan Kesehatan (Forwakes), Jaringan Kesehatan Masyarakat (JKM) dan Unit Donor Darah Palang Merah Indonesia (UDD PMI) Kota Medan. Diskusi yang akan diikuti 50 peserta ini terdiri atas DPRD Provsu, Pemprovsu, Divisi Yankum Kanwil Kementerian Hukum dan HAM Sumut, akademisi, mahasiswa, LSM dan media. Akan hadir tiga narasumber, yakni dr. Chandra Syafei, Sp.OG (Kadis Diskes Provsu), Delyuzar Haris (Direktur JKM) dan Majda El Muhtaj (Kepala Pusham Unimed). (m41)

BLAST Sebabkan Anak Rentan Akses Situs Porno ANAK yang cenderung mengalami bosan, merasa kesepian, marah, mengalami stres dan ketegangan atau BLAST (Bored, Lonely, Angry, Stress, Tension) sangat rentan melakukan halhal yang negatif seperti mengakses situs porno. Padahal, jika seorang anak sering mengakses situs porno mengganggu konsentrasi belajar. “BLAST inilah yang menyebabkan anakanak menjadi rentan mengakses situs porno dan menjadi pecandu narkoba, ini tentu akan berdampak pada prestasinya sehingga SDM kita juga nantinya akan berpengaruh,” kata Psikolog di Medan Irna Minauli kepada Waspada, Senin (28/3). Selain terganggunya konsentrasi belajar, lanjut Irna, dampak lainnya yakni prilaku masturbasi akan meningkat atau kasus-kasus pemerkosaan terhadap anak-anak dibawah umur juga akan meningkat. “Mereka yang sudah kecanduan, otomatis akan menarik diri dari lingkungannya, kesempatan untuk berkumpul sama kawan-kawannya menjadi berkurang, prestasi juga akan menurun, hamil diluar nikah juga pasti akan meningkat,” jelas Psikolog dari Universitas Medan Area ini. Banyak hal yang terlibat dalam mencegah anak-anak kecanduan internet khususnya membuka situs porno di antaranya para

orangtua, guru/sekolah serta para pengusaha warnet. Orang tua, lanjutnya, pada masa seorang anakmengenallawanjenis,orangtuaharusseringseringmelakukankomunikasimengenaidampak/ bahaya seks jika dilakukan di luar nikah. “Sekolah juga harus berperan menciptakan situasi yang membuat si anak tidak merasa bosan. Para pengusaha warnet juga seharusnya turut bertanggungjawab terhadap generasi bangsa ini, dengan cara memblokir situs-situs yang dianggap tidak wajar dikonsumsi oleh anak-anak,” terangnya. Dia menambahkan, anak-anak yang suka menonton situs porno cenderung akan terjadi perusakan pada bagian otaknya, sehingga anakanak itu cenderung lebih cepat marah dan konsentrasi belajarnya terganggu. Sementara itu, Ketua Ilmu Komputer USU Poltak Sihombing mengatakan, anak-anak tidak akan bisa mengakses situs porno jika pemblokiran terhadap situs negatif dilakukan oleh para pengusaha warnet. “Jadi bisa diblokir dari providernya. Pemblokiran harus kita tanggapi secara antusias,” jelasnya. Menurutnya, banyak cara yang dilakukan untuk memblokir situs porno. Diantarany blokir situs porno melalui browser seperti internet explorer, melalui software. (h02)

Medan Metropolitan

A6

WASPADA Jumat 1 April 2011

Pencurian Dengan Modus Pecahkan Kaca Mobil Terus Terjadi MEDAN (Waspada): Aksi pencurian barang berharga dengan modus memecahkan kaca mobil terus terjadi di Medan. Kali ini dialami Melva Melani Br Sitompul, 27, penduduk Pondok Surya, Blok II No. 60, Kelurahan Helvetia Timur, Kecamatan Medan Helvetia. Peristiwa pencurian itu terjadi di Jln. Serwijaya Ujung No. 4 A, Petisah, Rabu (30/3) malam. Korban yang kehilangan tas berisikan dompet, uang dan surat berharga lainnya telah membuat pengaduan ke Polsekta Medan Baru. Saksi mata mengatakan,

peristiwa itu terjadi sekira pukul 22:10. Saat itu, korban mengendarai mobil Suzuki Karimun GX BK 1581 HI warna silver mengunjungi temannya di salah satu wisma Jln. Sriwijaya Ujung No.4 A. Kemudian korban memarkirkan mobilnya di pinggir jalan.

Nelayan Edarkan Sabu Ditangkap BELAWAN (Waspada): Seorang nelayan berinisial Sy alias Ud, 42, warga Aceh, yang selama ini mangkal di gudang SBU kawasan Pelabuhan Perikanan Samudera Belawan (PPSB), ditangkap petugas Polsek Hamparan Perak karena memiliki sabu-sabu di Jalan Yossudarso, simpang atap pajak sore Kelurahan Besar Medan Labuhan, Kamis (31/3). Dari tersangka, polisi menyita satu bungkusan berisi narkotika jenis sabu seberat 3 gram, HP dan uang jutaan rupiah sebagai barang bukti. Tersangka diduga pengedar narkoba dari Banda Aceh yang berpura- pura sebagai nelayan pukat cerut. Kepada petugas tersangka mengaku memperoleh sabu itu dari temannya bernama Cekgu (DPO) yang pada tahun 2004 pernah menjalani hukuman selama 4 tahun penjara akibat kasus narkotika tangkapan Polres Kp3 Belawan. Kapolsek Hamparan Perak AKP M Silaen didampingi Kanit Reskrim AKP Irsol mengatakan, tersangka dijerat UU No 35 tahun 2009 tentang Narkotika dengan ancaman kurungan penjara minimal lima tahun. (h03)

Sedangkan tas yang berisikan dompet, uang dan surat berharga lainnya diletakkan di jok mobil tersebut. Setelah beberapa menit mengunjungi temannya, korban bermaksud pulang. Namun korban terkejut ketika mendapati kaca pintu kiri bagian belakang pecah dan tas miliknya hilang. Guna mengusut kasus pencurian tersebut, Kanit Reskrim Polsekta Medan Baru AKP Andik Eko Siswanto, SH, bersama personelnya segera turun ke Tempat Kejadian Perkara (TKP). Saat itu, juga terlihat Kapolsekta Sunggal Kompol Sonny Marisi Nugroho Tampubolon, SH, SIK di lokasi kejadian. Saat ditemui Waspada, korban mengatakan, mobil tersebut ditinggalkan hanya beberapa menit. Sedangkan tas yang hilang tersebut berisikan dompet, uang Rp300.000, dua lembar kartu ATM BRI, dua lembar kartu kredit BII, dua lembar

kartu kredit Bank Mandiri, kartu kredit Bank Mega, dua lembar kartu asuransi Sinar Mas, Kartu Tanda Penduduk (KTP), dua lembar kartu mahasiswa, STNK, SIM-C, SIM-A, kartu Jamsostek. Kapolsekta Medan Baru AKP Doni Alexander, SH,SIK melalui Kanit Reskrim AKP Andik Eko Siswanto,SH, mengatakan, pihaknya sudah menurunkan personel ke lapangan guna mengumpulkan berbagai informasi baik dari penghuni wisma dan warga setempat. Sedangkan pelakunya masih diburon. Berdasarkan catatan Waspada, aksi pencurian dengan modus memecahkan kaca mobil sudah berulang kali terjadi di wilayah hukum Polresta Medan dan hingga kini belum terungkap. Sebelumnya, penjahat menjarah barang berharga di dalam mobil milik Friska Sihombing saat parkir di Jln. Bagerpang Medan. Kerugian yang dialami anggota Polwan

Polresta Medan itu berupa handphone, uang dan surat berharga lainnya. Kemudian, mobil milik Hang Tuah wartawan Harian Waspada dirusak penjahat ketika parkir di Jln. S. Parman. Kerugian yang dialaminya berupa kamera senilai Rp60 juta. Setelah itu, mobil Ford BK 1091 JG dan Avanza BK 1385 KK yang dikendarai pelajar SMA, dirusak penjahat saat parkir di Jln. Brahmana Medan. Dari kedua mobil tersebut, pelaku mengambil handphone dan barang berharga lainnya. Hal yang sama juga dialami Daud Supriady, penduduk Medan Labuhan. Korban mengalami kerugian berupa tas berisikan KTP, kartu ATM, uang tunai Rp1.200.000 dan barang berharga lainnya. Saat itu, korban memarkirkan mobil Avanza warna hitam BK 9532 YY di Jln. Gatot Subroto, Gg. Masjid simpang Jln. Panci Medan.(m36)

LIRA Pantau Penegakan Hukum MEDAN (Waspada): Lumbung Informasi Rakyat (LIRA) Kota Medan akan lebih fokus memantau proses penegakan hukum di daerah ini, karena lembaga swadaya masyarakat itu tidak ingin rasa keadilan masyarakat terusik. “Penegakan hukum yang dilakukan harus mencerminkan keadilan substantif, sebagai cerminan supremasi hukum yang sesungguhnya,” kata Walikota LIRA Medan Ganda Manurung (foto) kepada wartawan di Medan, Kamis (31/3). Ganda Manurung baru terpilih sebagai Waikota LIRA Kota Medan periode 2011–2014 melalui Musda I DPD LIRA Kota Medan yang berlangsung di aula Millenium Plaza, Senin (28/3) lalu, yang turut dihadiri Presiden LIRA Drs HM Jusuf Rizal SE,M.Si dan Gubernur LIRA Sumut H Rizaldi Mavi, MBA. Dia menegaskan, LIRA Kota Medan akan terus mengamati, mencermati, mengkaji dan bersuara terhadap ketidakadilan yang terjadi kepada masyarakat. Menurut penilaiannya, proses penegakan hukum hingga kini masih belum mampu secara optimal memenuhi aspirasi dan harapan masyarakat. Karena itu, LIRA Medan dengan semangat kemandirian dan independensinya bertekad akan terus memantau proses penegakan hukum dan mendukung setiap upaya penegakan hukum yang mengedepankan rasa keadilan masyarakat. Tekad dan komitmen LIRA tersebut, sebutnya, sejalan dengan cita-citareformasiyangsalahsatudiantaranyamewujudkanpenegakan hukum secara tegas dan adil di tengah masyarakat. (cwan)

Poldasu Segera Gelar Kasus Pembongkaran Papan Reklame MEDAN (Waspada): Polda Sumut akan segera menggelar kasus pembongkaran papan reklame milik PT Star Indonesia yang dilakukan Dinas Pertamanan Kota Medan, guna mencari ada tidaknya unsur tindak pidana dalam kasus tersebut. Jika ditemukan unsur pidana, maka penyidik Reserse Kriminal Poldasu akan mengambil keterangan korban dan segera melayangkan surat panggilan terhadap saksi-saksi serta terlapor. Selain itu, penyidik juga akan mengumpulkan barang bukti yang mendukung laporan korban. “Kita pelajari dulu laporannya, lalu akan digelar kasus untuk mengetahui unsur pidananya. Kalau memenuhi unsur, kita panggil dulu saksinya, baru terlapor,” kata Kabid Humas Poldasu Kombes Pol. Hery Subiansauri melalui Kasubbid Dokliput AKBP MP Nainggolan, Rabu (30/3). Kata dia, sesuai laporan PT Star Indonesia, telah terjadi perusakan papan reklame yang dilakukan petugas Dinas Pertamanan Medan. Pelaku, sebutnya, dapat ditahan jika perusakan itu dilakukan lebih dari satu orang.“Bisa, bisa ditahan kalau memang pelaku terjerat pasal 170 KUHPidana, yaitu secara bersama-sama (lebih satu orang) melakukan perusakan,” sebutnya. Tetapi jika hasil gelar kasus tersebut tidak ditemukan unsur tindak pidana seperti perusakan yang dilaporkan PT Star Indonesia, maka pihak kepolisian akan menyarankan pelapor menggugat secara perdata. “Kalau memang tidak ditemukan pidananya, untuk apa kita proses. PT Star Indonesia akan kita sarannya menggugat perdata kasus itu,” kata Nainggolan. Sebelumnya, PT Star Indonesia mengadukan Dinas Pertamanan Kota Medan, Senin (28/3), karena telah membongkar reklame yang terpasang di Jln. S Parman, Medan. Menurut Direktur PT Star Indonesia Iskandar, reklame itu semestinya masih berdiri karena batas izin yang dikeluarkan sampai Desember 2011.(m27)

Polisi Tangkap Tiga Tersangka Curanmor Sering Beraksi Di Binjai Dan Deliserdang

Pencuri DompetTerekam CCTV MEDAN (Waspada): Pencuri dompet berinisial Rd yang terekam CCTV saat melakukan aksinya, diringkus sekuriti swalayan Indomaret di Tasbi II Jalan Setiabudi Medan, Rabu (30/3). Informasi Waspada peroleh di lapangan, pemilik dompet Ilham, 21, warga Tasbi II, dengan mengendarai sepedamotor Yamaha Mio berbelanja di swalayan Indomaret. Sebelum masuk swalayan itu, korban mengambil uang dari dalam dompetnya lalu dompet tersebut ditinggalkan di laci sepedamotornya. Usai belanja, korban pulang ke rumah dan saat hendak mengambil dompetnya tidak ada lagi di laci sepedamotornya. Awalnya dia menduga dompetnya jatuh di jalan. Kemudian korban melakukan pencarian dengan menyusuri jalan yang dilaluinya. Bahkan, korban melakukan pencarian ke lokasi Indomaret tempatnya belanja. Di lokasi swalayan itu, dia sempat menanyakan kepada tersangka perihal dompet tersebut, namun Rd tidak mengakui melihatnya. Sekuriti Indomaret kemudian mengajak korban melihat CCTV yang terpasang di swalayan tersebut untuk mengetahui siapa yang mengambil dompetnya. Ketika hasil rekaman CCTV diputar terlihat jelas tersangka Rd sedang mengambil dompet dari laci sepedamotor Yamaha Mio korban. Selanjutnya korban bersama sekuriti itu mengamankan tersangka Rd dan menyerahkannya ke Polsekta Sunggal. Kapolsekta Sunggal Kompol Sonny Marisi Nugroho Tampubolon, SH,SIK saat dikonfirmasi mengatakan, tersangka masih menjalani pemeriksaan. (m36)

Waspada/Ismanto Ismail

MOBIL Suzuki Karimun GX BK 1581 HI warna silver yang dirusak penjahat ketika sedang parkir di Jln. Sriwijaya Ujung No.4 A, Rabu (30/3) malam.

Waspada/Rudi Arman

TERDAKWA Chairul Ghazali alias Ghozali, terdakwa perampok Bank CIMB Niaga dikawal petugas Kejaksaan dan Brimobdasu berjalan menuju Rutan Polresta Medan, Kamis (31/3) siang.

MEDAN (Waspada): Polsekta Sunggal menangkap tiga tersangka yang terlibat kasus pencurian sepedamotor di Binjai dan Deliserdang, Rabu (30/3). Ketiganya yakni Wyg, 23 dan RL, 27, penduduk Pasar Lama, Kampung Lalang serta DK, 31, penduduk PasarV, Dusun II, Desa Lalang, Kecamatan Sunggal, Kabupaten Deliserdang. Informasi yang diperoleh Waspada di lapangan, penangkapan itu bermula ketika polisi melakukanpatrolidiwilayahhukumPolsektaSunggal guna mengantisipasi tindak kejahatan. Pada saat bersamaan, petugas yang melakukan patroli menerima informasi dari masyarakat bahwa tiga tersangka pencuri sepedamotor sedang berada di kediamannya. Berdasarkan informasi tersebut, polisi segera melakukan pengembangan dan menangkap ketiga tersangka dari kediamannya masingmasing. Selain mengamankan ketiga tersangka, polisi menyita barang bukti sepedamotor Yamaha Vega R dari kediaman Wyg. Kapolsekta Sunggal Kompol Sonny Marisi

Nugroho, SH, SIK, mengatakan, dari hasil pemeriksaan terhadap ketiga tersangka, diketahui mereka terlibat berbagai kasus pencurian sepedamotor di kawasan Binjai dan Deliserdang. “Saat ini, personel Polsekta Sunggal sedang melakukan pengembangan guna mengungkap sindikat pencurian sepedamotor tersebut,” tambahnya. Usai menjalani pemeriksaan, tersangkaWyg mengatakan kepada Waspada, dirinya bersama tersangka DK melakukan pencurian sepedamotor jenis Honda Supra Fit di Binjai beberapa hari lalu. Kemudiansepedamotortersebutdijualdikawasan Marelan dengan harga Rp1 juta. Terakhir, Wyg bersama DK dan RL mencuri sepedamotor Yamaha Vega R milik Sekretaris Desa Sukamaju Herman Tinus Sitanggang, 25. Namun sebelum menjual hasil kejahatan tersebut, ketiga tersangka ditangkap petugas Polsekta Sunggal. “Hasil penjualan sepedamotor curian tersebut bukan untuk kebutuhan rumah tangga, tetapi untuk berfoya-foya,” jelasnya. (m36)

Seorang Terdakwa Dikawal Dua Baracuda Dan Brimob Kasus Perampokan Bank CIMB Niaga MEDAN (Waspada): Seorang terdakwa kasus perampokan Bank CIMB mendapat pengawalan ekstra ketat ketika hendak dititipkan di Rumah Tahanan Negara (Rutan) Polresta Medan, Kamis (31/3) siang. Pantauan Waspada di lapangan, pihak kepolisian mengerahkan dua kendaraan antipeluru jenis Baracuda guna mengapit mobil kejaksaan yang membawa terdakwa Chairul Ghazali alias Ghozali, dua mobil patroli Sat Lantas Polresta Medan serta sejumlah personel Brimobdasu yang dilengkapi senjata laras panjang. Sebelumnya, terdakwa Chairul Ghazali alias Ghazali diboyong ke Rutan Poldasu di

Jln. Sisingamangaraja setelah menjalani persidangan di PN Medan. Kemudian, terdakwa yang berstatus sebagai tahanan Kejari Medan ini, dipindahkan ke Polresta Medan dengan status tahanan titipan. Setibanya di Polresta Medan, personel Brimobdasu bersenjata lengkap mengawal terdakwa Ghazali menuju ke ruang tahanan Polresta. Sebelum dijebloskan ke dalam sel, petugas jaga memeriksa barang bawaan terdakwa. Kapolresta Medan Kombes Tagam Sinaga, SH yang dikonfirmasi wartawan mengatakan, penitipan terdakwa di Rutan Polresta Medan atas dasar permintaan pihak kejaksaan.

Sebelum menitipkan terdakwa, pihak kejaksaan telah menyurati Polresta Medan secara resmi. “Jadi tidak mungkin Polresta Medan menolak penitipan ini. Apalagi Rutan di Poldasu sudah penuh,” jelasnya. Mengenai jangka waktu penitipan terdakwa di Rutan Polresta Medan, Tagam belum bisa memastikannya. Sebab, jika pihak kejaksaan meminta agar terdakwa dipindahkan, maka Polresta Medan akan kembali mengirim terdakwa. “Saat ini penitipan terdakwa di Rutan Polresta Medan menunggu hingga persidangan kasus perampokan Bank CIMB Niaga selesai di PN Medan,” ujarnya. (m39)

Waspada/ist

dr. RobertValentino Tarigan, SPd (lima dari kiri) dan Drs Ramli Siregar (empat dari kiri) diabadikan bersama usai upacara di SMAN 1 Sunggal, baru-baru ini.

Tiga ‘K’ Sebagai Langkah Keberhasilan MEDAN (Waspada): “Tiga ‘K’ sebagai langkah untuk meraih keberhasilan adalah kesempatan, kemampuan, dan kemauan,” kata Pimpinan BT/BS BIMA Indonesia dr Robert Valentino Tarigan, SPd pada upacara di SMAN 1 Sunggal, Jln. Sei Mencirim, Deli Serdang, baru-baru ini. Menurut Valentino, para pelajar masih memiliki kesempatan untuk menentukan pilihannya setelah tamat SMA. “Kesempatan masih terbuka luas. Mau bekerja atau kuliah? Kalau seusia saya tidak mungkin lagi masuk PTN. Artinya, saya tidak punya kesempatan lagi untuk kuliah di PTN,” ujarnya. Sedangkan siswa-siswi SMAN 1 Sunggal mempunyai kesempatan kuliah di PTN.“Masalahnya, punya kemampuan atau tidak? Kemampuan itu akan diperoleh bila ada kemauan,” tambahnya. Saat itu, Valentino menceritakan tentang kisah seorang

siswi salah satu MAN di Jawa yang punya keinginan mendapat beasiswa ke AS (Amerika Serikat). Lalu siswi tersebut mencari guru bahasa Inggris dari sekolah internasional. Setelah ketemu dengan guru yang dimaksud, siswi tersebut menyampaikan hasratnya yang begitu kuat untuk kuliah di AS. Melihat kondisi si siswi, sang guru tidak yakin niat tersebut akan tercapai. Lalu sang guru mengatur jadwal belajarnya hanya tiga kali dalam seminggu dengan masa belajar enam bulan. Usai sekolah, siswi tersebut mendatangi sang guru guna belajar bahasa Inggris. Begitulah yang dilakoni hingga masa masa belajarnya berakhir. Kemudian siswi tersebut mengatakan, “maukah ibu mengirimkan namaku untuk didaftar sebagai penerima beasiswa?” Dalam hatinya, sang guru menangis karena persyaratan siswi tersebut tidak mencukupi.

Namun sang guru tetap mendaftarkan namanya guna mendapatkan beasiswa dan kuliah di AS. Diluar dugaan, siswi tersebut diterima sebagai satu-satunya yang mendapat beasiswa dari Jawa. “Akhirnya sang guru menyadari, bukan kecerdasan saja yang membawa sukses, namun hasrat juga memiliki peranan penting,” cerita Valentino. Sementara itu, Kepsek SMAN 1 Sunggal Drs Ramli Siregar mengatakan, sekolah tersebut sudah berdiri selama enam tahun. Kemudian, menjalin kerjasama dengan BT/BS BIMA selama lebih dari tiga tahun. Pada tahun pertama, lanjut Ramli, SMAN 1 Sunggal meluluskan 101 siswa dengan tingkat kelulusan 100 persen. Tahun kedua 119 siswa (100 persen), tahun ketiga 189 siswa (100 persen). “Tahun keempat (tahun 2011), ada 181 siswa yang diharapkan lulus 100 persen,” ujarnya.(m25)

Waspada/Ismanto Ismail

INTEROGASI: Petugas Juper Reskrim Polsekta Sunggal Brigadir JWK Tarigan,SH, sedang menginterogasi ketiga tersangka pencurian sepedomotor, Rabu (30/3).

Jadi Penulis Togel, Pria 60 Tahun Ditangkap MEDAN (Waspada): Seorang pria berusia Beringin, Deliserdang. Polisi meringkus Susanto 60 tahun ditangkap petugas Polsekta Sunggal alias Ahai, 66,” ujar Kabid Humas Poldasu di PasarVI, Diski, Jln. Binjai, Kecamatan Sunggal, Kombes Pol. Hery Subiansauri, Selasa (29/3). Kabupaten Deliserdang, Kamis (31/3) sore, Dari Ahai, diamankan barang bukti tiga telekarena diduga sebagai penulis judi togel. fon genggam, 10 buku catatan, satu kalkulator. Selain mengamankan tersangka Pj, Sedangkan omset judi bola yang dikelolanya penduduk Pasar VI, Diski, polisi juga menyita bisa mencapai Rp50 juta setiap putaran. barang bukti berupa beberapa lembar catatan Kata dia, setiap pemain yang ingin bertaruh angka togel, alat tulis, uang puluhan ribu rupiah bisa bertemu langsung atau melalui pesan singdan lain-lain. kat. “Biasanya para pemain judi memanfaatkan Informasi yang diperoleh Waspada di pertandingan liga-liga di Eropa,” sebutnya. lapangan, penangkapan tersebut bermula dari Sedangkan togel digerebek di Desa Sidodadi, informasi masyarakat yang diterima Kapolsekta Kec. Beringin. Tersangka Akun alias Kasman. Sunggal Kompol Sonny Marisi Nugroho Dari dia diamankan dua telefon genggam, 11 Tampubolon, SH, SIK. Saat itu, diinformasikan lembar kertas rekap, satu kalkulator dan omset bahwa seorang pria yang berusia lanjut berpro- setiap putaran nomor Rp10 juta. fesi sebagai penulis togel. Sebelumnya, Dit Reskrim Poldasu telah Kemudian, Kapolsekta menurunkan perso- menangkap Rahmad, 46, warga Jln. Setia Luhur, nelnya.Hanyadalamtempo15menit,polisiberha- karena menulis togel. Dari tersangka polisi menyita sil mengamankan tersangka berikut buktinya. uang Rp591 ribu dan satu telefon genggam. Selain Usai menjalani pemeriksaan, tersangka itujugaditangkapAyen,bandartogelyangdiringkus mengaku bekerja sebagai penulis togel selama dari Jln. Pertempuran/Sekata 1, Pulo Brayan.“Polisi lebih dari satu tahun. “Saya terpaksa bekerja menyita uang Rp9.200 ribu, empat lembar catatan sebagai penulis togel sejak tangan kanan saya togel, dua telefon genggam,” katanya. patah akibat ditabrak sepedamotor. Karena tidak Dia menegaskan, jajaran Poldasu tetap bisa kerja berat lagi, maka saya bekerja sebagai komit memberantas segala bentuk perjudian, penulis togel,” ujarnya. baik penulis maupun bandar-bandarnya. Sementara itu, Kapolsekta Sunggal Kompol “Kapolda Irjen Pol Wisjnu Amat Sastro telah Sonny Marisi Nugroho Tampubolon, SH, SIK menegaskan akan memerangi setiap perjudian. mengatakan, pihaknya sedang gencar mem- Bahkan tidak akan memberi tempat samasekali berantas perjudian, pencudengan judi,” sebut Hery. (m36/m27) rian sepedamotor dan kasus kejahatan lainnya. Gebrakan ini sesuai instruksiKapoldasuIrjenPol. Drs. Wisjnu Amat Sastro dan diteruskan Kapolresta Medan Kombes Pol. Tagam Sinaga, SH, serta dilaksanakan seluruh jajaran Polsekta. “Setiap ada info dari warga tentang kasus judi, narkoba dan lainnya, maka segera ditindaklanjuti,” tambahnya Digerebek Sebelumnya,PoldaSumut kembali menggerebek perjudian bola dan togel di dua lokasi terpisah, Senin (28/3) sekira pukul 19:30. Diketahui omset perjudian tersebut berkisar antara Rp10-50 juta. Waspada/Ismanto Ismail “Bandar judi bola ditangkap SEORANG kakek berinisial Pj sedang menjalani pemeriksaan dari Dusun Sepakat Kelurahan Beringin, Kecamatan di Mapolsekta Sunggal, Kamis (31/3) sore.

Agenda

WASPADA Jumat, 1 April 2011

07:30 DAHSYAT 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Seputar Peristiwa 13.00 Sinema Siang Lolly Brokoli 15:00 Cek & Ricek 16:00 BEDAH RUMAH 17:00 Seputar Indonesia 17:30 Silet 18.30 Putri Yang Ditukar 20.15 Mega Sinetron : Anugerah 22.30 BOM : War Of The World

CATATAN

0 7:00 Inbox 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 12:00 Liputan 6 Siang 12:30 SCTV FTV 14:30 Status Selebriti 15:00 Uya Emang Kuya 16:03 Cinta Juga Kuya 16.30 Sensasi Artis 17:00 Liputan 6 Petang 17:30 Uya Emang Kuya 18:00 Islam KTP 20:00 SL Liputan 6 Terkini 21:00 Pesantren & Rock n Roll 22:33 SCTV Musik Karnaval 2011

07.00 Upin & Ipin 08.30 LAyar Liburan Sekolah 10.00 Cerita Pagi 11.00 Sidik 11.30 Lintas Siang 12.00 Cerita Siang 13.00 Layar Kemilau 15.00 Layar Spesial 16.30 Lintas Petang 17.00 Cerita Pilihan 18.00 Animasi Spesial 19.00 Sinema Spesial 19.30 Sinema Pilihan 21.00 Cerita Pilihan 22.00 Udin Bui 23.30 Jendela 00.00 Lintas Malam

07.00 Land Before Time 08.00 Woody Woodpecker 10.30 Sinema Realita 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Buaya Darat 15.00 Djarum Indonesia Super League 2010 - 2011 17.35 Katakan Katamu 18.35 Super Family 19.35 Sinema Spesial 21.30 Pengejar Rahasia 22.30 World Most Amazing Video 00.00 Topik Malam

07.00 Sinema Anak 08.00 Halo Polisi 09.30 FTV Drama 11.30 Patroli 12.00 FTV Siang 14.00 Happy Song 15.00 KiSS Sore 15.30 Fokus 16.30 Cruel Temptation 17.00 Artis Sahabat 18.00 Dia Anakku 19.00 Nada CInta 21.00 Antara Cinta Dan Dusta 22.00 Sinema Sinema 00.00 Angling Dharma 01.00 Fokus Malam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.05 Eleven Show 11.05 Agung Sedayu 12.05 Metro Siang 13.05 Dunia Kita 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Genta Demokrasi 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 21.05 Top Nine News 21.30 Kick Andy 23.00 Headline News 23:20 Metro Sports

A7

07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online (Olga & Jeng Kellin) 14.30 Jail 16.00 Kejar Tayang 17.00 Reportase Sore 18.00 Jika Aku Menjadi 18.45 Sketsa 19.15 Cinta Cenat Cenut 20.30 Bioskop TRANS TV 23.30 Bioskop TRANS TV 00.30 Reportase Malam

06.30 Apa Kabar Indonesia 10.00 Coffee Break 11.00 Menyingkap Tabir 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Mutumanikam 14.00 Yang Terlupakan 14.30 Jendela Usaha 15.00 Kabar Pasar 16.00 Ujung Negeri 17.00 Renungan Hari Ini 17.30 Kabar Petang 19.30 Zona Merah 20.30 Apa Kabar Indonesia Malam 22.30 Jejak Malam 23.30 Kabar Arena

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

08.00 Fanboy & Chum Chum 08.30 Vicky & ampamp 09.00 The Backyardigans 09.30 Obsesi 10.30 Miracle 11.30 Demi Keluarga 12.00 Awas Ada Sule 13.00 Momon 14.00 Petualangan Panji 14.30 Bonar Sang Pendongeng 15.00 Hand Made 15.30 Amel Cemal Cemil 16.30 Berita Global 17.00 The PEnguin 17.30 Spongebob 18.30 Mong 19.00 Kanjeng Mami 20.00 Big Movies 22.00 Big Movies

07.30 Selebrita Pagi 08.30 Johny & Lucy 09.00 Scooby Doo 10.00 Jagomatika 11.00 Warna 11.30 Redaksi Siang 12.00 Selebrita Siang 13.00 Laptop Si Unyil 14.30 Dunia Binatang 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Jejak Si Gundul 18.00 Ups Salah Sambung 18.30 Hitam Putih 19.30 On The Spot 20.00 Opera Van Java 22.00 Bukan Empat Mata 23.30 Masih Dunia Lain 00.30 Sport 7 Malam **m31/B

ReelzChannel Tayangkan Miniseri Kontroversi Kennedys

The Kennedys/filmpopper.com SETELAH terkatungkatung nasibnya, miniseri kontroversial The Kennedys akhirnya menemukan ‘rumahnya’. Miniseri dijadwalkan akan disiarkan sebanyak 8 episode dengan mengangkat cerita tentang Sang Presiden AS memang sempat ditolak penayangannya oleh The History Channel. The Kennedys’ mengisah-

kankehidupankeluargaKennedy dan juga tragedi mereka alami akan tayang premiere dunia pada 3 April 2011 di ReelzChannel, demikian dilaporkan situs The Hollywood Reporter. Miniseri dibintangi Greg Kinnear memerankan John F. Kennedy, Katie Holmes (Jacqueline Kennedy), Barry Pepper (Robert F. Kennedy), Tom Wilkinson (Joseph P. Kennedy,Sr) ini disutradarai Jon Cassar.

Skedul semula, History akan menayangkannya di Amerika pada Januari 2011, namun pihak USHistorychannelmengumumkan pihaknya tidak dapat menyiarkan serial itu. Padahal, budget untuk The Kennedys sebesar 25 juta dolar AS sudah dipersiapkan History. Sumber lain menyebutkan History menyiapkan 30 juta dolar AS. Memang, ada banyak tanggapan negatif dari sejarawan berdasarkan skrip awal, yakni ketidakakuratan sejarah dan menyajikan suatu gambaran tak menyenangkan dari keluarga Kennedy. TedSorensen,mantanpenulis pidato untuk Presiden JFK (Jhon F Kennedy), menggambarkan skenario miniseri itu sebagai “pembunuhan karakter”. Jon Cassar, sutradara program miniseri ini mengungkapkan, padaJanuari2011Asosiasi Kritik Televisi mengadakan pertemuan di Los Angeles. Menurutnya itulah alasan mengapa miniseriitutidakbisaditayangkan di History Channel dan sejumlah broadcasterASlainnya.Itukarena pihak penguasa di AS terhubung

dengan keluarga Kennedy menggunakan politik dan pengaruh mereka untuk mencegah agar acara itu jangan sampai disiarkan. Setelahsejumlahbroadcaster lain menolak menerima miniseri tersebut, akhirnya hak siar film itu pun dibeli ReelzChannel. Sejumlah produser dari proyek ambisius terdiri dari 24 eksekutif produser antara lain Joel Surnow dan penulis skenario Stephen Kronish sudah deal dengan saluran TV independen itu. Alasan penolakan dilakukan pemilik History A&E Television Networksadalahsetelahpihaknya meninjau produksi final secara keseluruhan, pihaknya menyimpulkan interpretasi (penerjemahan) kisah dramatik itu tidak sesuai untuk imej History. Tak cocok buat History bukan berarti tak pas buat ReelzChannel. Saluran kabel independen berusia 4 tahun milik Hubbard Communications berkantor di Minnesota bersedia menayangkannya. Beberapa sumber menyebutkan perusahaan itu membuat keputusan besar dengan komitmennya mengeluarkan 30 juta

dolar AS demi film produksi Asylum Entertainment and Muse Entertainment itu. Bukantanpaalasanpengorbanan tersebut. Pasalnya, menurut ReelzChannel pihaknya yakin film itu akan mendongkrak rating dan jadi primadona siaran di jaringan televisiyangtidakpernahterjadi sebelumnya. “Kami akan melakukan kampanye pemasaran besarbesaran. Iklan pun sudah terpasang di teater, TV, online dan brosur,” kata Hubbard. Hubbard bilang pihaknya akan menayangkan dua episode pertama miniseri itu pada 3 April, dan sisa episode selanjutnya pada minggu itu juga. The Kennedys dijadwalkan mengudara di Kanada mulai 6 Maret, namun Hubbard mengungkapkan bagian dari perjanjiannya adalah Reelz mendapatkan hak siar menanyangkan perdana mendunia miniseri itu, makanya masih belumjelasjugakapanprogram acara ini akan tayang di negaranegara lain. (aje)

Diane Lane Cocok Jadi Ibu Superman Aktris Diane Lane dipercaya memerankan Martha Kent, ibu angkat Superman dalam film besutan sutradara Zack Snyder. Warner Bros. Pictures and LegendaryPicturessepertidikutip hollywoodreporter menyebutkanaktrismemulaikariernyasejak tahun 1979 ini memang sudah dipastikan sebagai“satu-satunya ibu Clark Kent yang pernah dikenal”. Diane Lane dipercaya memerankan karakter penting dalam hidup Superman, seperti diungkapkan sutradara film ini. Sang ibu angkat memang salah satu wanita paling dicintai Clark Kent alias Superman. Menurut Snyder, peran dimainkan aktris kelahiran New York City, 22 Januari 1965 itu

merupakanbagianpentingdalam film tersebut. Itu karena Martha Kent dianggap sebagai perempuan yang mampu membentuk manusia yang dikenal sebagai Superman. “Bagian casting ini sangat penting untukku karena Martha Kent adalah wanita yang membantu Superman menjadi apa yang kita kenal sekarang,” kata Snyder. Dalam statemennya Snyder juga menyebutkan, Diane dianggap sangat sesuai memerankan sang ibu yang bijak dan penyayang, sekaligus tangguh bagi sang Superman ini. Snyder juga mengakui pihaknya sangat senang ketika Diane memerankan karakter ini, karena dia menampilkan

Sympathy For Japan ET- 45 Jepang adalah negara paling banyak mempunyai artis penyanyi berkaliberinternasional di Benua Asia, selain Kitaro dan Mayumi Itsuwa masih banyak lagi seperti L’Arc-en-Ciel dengan nuansaJRock palingdigandrungi remaja masa kini. Selain itu, ada juga Utada Hikaru dan Ayumi Hamasaki, sejak awal tahun 2011 di TOP 10 internasional ada Far East Moment dengan genre Hip hop rap dance, group ini terdiri dari anak - anak muda Jepang, Filipina dan Korea. Bagi pengemar warna Jazz tentunyamengenalCasiopeadan SadaoWatanabe, kemudian bagi kolektor Audiophile recording pastiadamengkoleksialbumEmi Fujita dan Lisa Ono dengan nuansa bossanova. Komunitas pencinta musik

di Medan bersama dengan ET.45 mengadakan Charity Sale disambut baik pihak Konsulat Jepang di Medan. Di Outlet ET.45 setiap konsumen membeli CD atau Cassette berlogo Sympathy For Japan, akan diberikan discount sejumlah 20 %, kemudian uang discount tersebut dimasukan kedalam Charity Box.Tujuan misi sosial ini dilakukan ET.45, karena hati kami tergerak untuk memberikan bantuan moril ataupun material kepada bangsa Jepang yang sedang dilanda bencana alam, ujar Siti PR ET.45 di Jalan Gajah Mada Medan. Demikian juga pihak Sony Music dan Universal Music turut mendukung program amal ini dengan memberikan hadiah berupa CD kepada konsumen yang membeli CD dengan logo

Sympathy ForJapandiET.45 Jalan Mangkubumi, hadiah ini juga dibagikan kepada pengunjung yang tidak berbelanja, tetapi mereka tergerak untuk memberikan sumbangan. Dana yang terkumpul akan disumbangkan melalui Konsulat Jepang. Melakukan amal sambil mendengar music orkestra yang berjudul Tears dan Endless Rain ciptaanYoshikidarigroupXJapan, akan menetekan air mata atau silakan mendengar music new age Matsuri dari Kitaro anda akan membayangkan betapa gigihnya orang Jepang, demikian juga kelompok J Rock group band dari Indonesia yang begitu kreatif. Misi sosial seperti ini juga pernah dilaksanakan outlet ET.45 untuk membantu alm Chrisye d a n k o r b a n Ts u m a n i d i NAD.(m19)

Pemilihan Miss Indonesia 2011

kebijaksanaan dan keajaiban dari seorang wanita yang memiliki putra dengan kekuatan di luar bayangannya. Diane Lane akan beradu akting dengan Henry Cavill yang baru-baruinidiumumkansebagai pemeran baru Clark Kent/Superman. Lane juga akan dipasangkan dengan Kevin Costner dalam Man Of Steel, film terbaru Superman tersebut. Kevin menjadi pemeran ayah angkat Clark Kent, Jonathan Kent. Superman:ManofSteeldijadwalkan rilis pada Desember 2012. Catatan karir Lane bertinta emas tatkala dia mendapat nominasiOscarataspenampilannya di film drama tahun 2002, Unfaithful, sebagai istri tak setia alias selingkuhdenganprialain.(ajekoi)

Diane Lane/blogspot.com

Uli Auliani, Sepekan Dua Filmnya Beredar KENDATI terlanjur menjadi ikon seksi dan beradegan berani dalam film horor dan drama thriller, hati artis serba-bisa Uli Auliani, kini tengah berbunga-bunga. Pasalnya, dalam sepekan dua film yang dibintanginya Dedemit Gunung Kidul (DGK) dan Skandal beredar luas di bioskop tanah air. “Keberuntungan tampaknya tengah mengiringi geliat saya di dunia seni peran. Saya tak pernah menyangka dua film saya bintangi bisa diputar di bioskop dalam sepekan. Apalagi kalau mengingat masa lalu, geliat seni peran saya dimulai dari sekedar hobi menjadi foto model alias berpose di gambar mati,” papar Uli Auliani kepada Waspada di Planet Hollywood Jakarta, baru-baru ini. DitemuiselepaspreviewfilmSkandalbesutansutradara Jose Purnomo diperuntukkan penonton bioskop berusia 20tahunkeatasini, daracantikdanseksikelahiranBandung, 20 November 1985 ini, menambahkan lantaran mulai merasa jenuh melakoni karir modeling sejak SMP, dirinya pun merambah dunia seni peran. “Toh, begitu menamatkan SMA di bandung – tawaran main sinetron dan layar lebar mengalir deras. Dan saya pun yang tak puas berpose secara gambar mati merambah gambar hidup di layar kaca dan layar lebar hingga kini,” terang Uli yang dalam film 13 dibintanginya - Skandal beradegan berani dengan Mario Lawalata maupun Mike Lucock. Tentang predikat aktris seksi dan berani spesialis Uli Auliani film hantu dan drama thriller yang terlanjut melekat

Album artis Jepang banyak diminati penggemarnya di Indonesia

padanya, presenter televisi, bintang sinetron, film tengah berjuang menjadi penyanyi profesional ini berkilah, mungkin sudah menjadi peruntungannya. “Walau imej saya di dunia seni peran terkesan kurang positif, tapi begitulah peruntungan saya.Yang jelas, penggemar film hantu dan horor atau drama thriller di tanah air itu cukup banyak. Jadi, sebagai artis saya pun terpanggil untuk menghibur dan memuaskan mereka,” ujar pemeran Mischa dalam film Skandal menjadi artis serba bisa dengan melansir singel I Miss You dan Ku Tunggu Jandamu. Kisah film Skandal produksi Sentra Film, dibuka dengan kejenuhan Mischa (Uli Auliani) dengan kehidupan rumahtangganya dengan Aron (Mike Lucock). Sang suami terlalu sibuk dengan pekerjaan barunya hingga lupa dengan kewajiban memberi nafkah bathin kepada sang istri. Mischa berpikiran buruk dan menyangka suaminya selingkuh dengan sekretarisnya (Laras Monca), kesehariannya malah lebih berwarna dengan kehadiran Vincent (Mario Lawalata). Fotografer ganteng yang juga mantan kekasihnya ini,membuatMischalupakendalidanberulangkalimelakukan perselingkuhan.Akibatnyarumah-tanggadankebahagiaannya di ujung tanduk. “Lewat ketegangan dan drama psycho penuh kejutan sepanjang film Skandal berdurasi 83 menit ini, saya mencoba menarik penonton dewasa berusia 20 tahun ke atas untuk kembali berbondong-bondong ke bioskop,” harap Jose Purnomo, sang sutradara. * (AgusT)

Miss Indonesia 2011 kembali diselenggrakan untuk ke-tujuh kalinya dengan mengusung tema Ragam Cantik Indonesia. Miss Indonesia digelar dalam rangka mencari seorang Miss memiliki Manner, Impresive, Smart dan Social, serta keahlian khusus di bidang seni, modelling, dan olah raga. Persyaratanbagimereka ingin mewujudkanmimpisebagaiMiss Indonesian 2011 adalah wanita WNI, usia 17 – 24 tahun, belum menikah dan mempunyai anak, tinggiminimum165cm,memiliki pengetahuan umum dan wawasan luas, berpenampilan menarik, cantik, cerdas, serta berkepribadian, menguasai bahasa Inggris atau bahasa asing lain/bahasadaerah,mempunyai bakat / keahlian khusus, mengisi

formulir pendaftaran, sehat jasmani. ”Melalui ajang ini kita ingin mencari wanita terbaik Indonesia yang mempunyai sopan santun, budi pekerti dan tentunya karakter yang baik, selain itu ia harus berpenampilan menarik cantik luar dan dalam, berpengalamanluasdanpandai,berjiwa sosial yang tinggi dan peduli akan lingkungan,” tutur Liliana Tanoesoedibjo Founder Miss Indonesia. Wakil dari ke-33 provinsi di Indonesiainiakanberjuanguntuk mendapatkan mahkota Miss Indonesia2011denganmengikuti serangkaian karantina selama 12 hari dan mengikuti acara puncaknyapada3Juni2011untuk mengetahui siapakah akan menjadi Miss Indonesia 2011 dan

menjadi wakil Indonesia di ajang Miss Wolrd 2011. Audisi Miss Indonesia 2011 akandilakukanmulaibulanMaret sampaidenganAprildienamkota audisiyaitu: Yogyakarta,Surabaya, Makassar, Denpasar, Bandung dan Jakarta. Untuk pendaftaran Miss Indonesia 2011 akan sedikit berbeda dari tahun sebelumnya. Apabila tahun-tahun sebelumnya peserta yang lolos administrasi dan dihubungi panitiasajayangikutaudisi,tahun ini calon peserta juga bisa datang langsung ke lokasi audisi mulai pukul 08.00 s.d pukul 14.00 wib untuk mengikuti walk in audition . Informasi pendaftaran bisa juga didapat di www.okezone.com dan www.rcti.tv/ missin-donesia.(m19)

Malam Pesona Tapsel Hibur Pengunjung PRSU Ribuan pengunjung Pekan Raya Sumatera Utara (PRSU) ke 40 mengaku terhibur atas penampilan malam pesona Pemerintahan Kabupaten Tapanuli Selatan dalam pentas seni di Pekan Raya Sumatera Utara (PRSU) ke 40, Senin (28/ 3) di Tapian Daya Jalan Gatot Subroto Medan. Herman salah satu pengunjung asal kota Medan mengaku, penampilan seni dan budaya Tapsel di PRSU ke 40 tahun 2011 ini memberikan hiburan dan edukasi bagi masyarakat Sumatera Utara tentang kekayaan budaya Tapanuli Selatan. "Penampilan mereka sangat bagusbang,senidanbudayayang dipadukandenganberbagaikisah dan cerita dari daerah membuat kami sebagai pengunjung bisa menikmatikekayaanbudayaini," ujarnya dihadapan wartawan. Malam pesona budaya TapselsendiridihadiriolehBupati TapselHSyahrulMartuaPasaribu,

Kadis Pariwisata kota Medan Busral Manan, Ketua Yayasan PRSU Drs Panusunan Pasaribu, Dirut Bank Sumut Gus Irawan Pasaribu dan unsur Muspida Kabupaten Tapanuli Selatan. Dalam sambutannya, H Syahrul Martua Pasaribu menyampaikan,penampilanmalam pesona dari masyarakat Tapsel ini merupakan penampilan dari masyarakat Tapsel tentang berbagaikekayaandanbudayaTapsel yang sangat kaya. Sehingga, kedepan kegiatan seperti ini semakin di tingkatkan keikutsertaannya dan penampilannya harus jauh lebih baik lagi. “Kita berharap ke depannya keikutsertaan Pemkab Tapsel dalam berbagai ajang atau event yang di selenggarakan baik di Propinsi, lokal bahkan tingkat nasional harus terus ditingkatkan. Apalagi penampilan pentas seni dariPemkabTapseldiyakiniselalu mampu menghibur masyarakat karena banyak masyarakat yang

terpukaupadasetiappementasan yang ditampilkan,”ujarnya. Di malam pesona Tapsel di PRSU menggambarkan, cerita tentang kisah cinta muda-mudi di Tapsel yang dimulai dari pematang persawahan saat bekerja di sawah setelah matahari terbit di puncak gunung SibualBuali, Lubuk Raya dan Sanggarudang. Setelah selesai bekerja , di sore harinya, muda-mudi ini pun berlanjut bercinta namun setelah muda-mudi ini pun selesai Sholat Isya. Dalam perjalan cinta yang ditampilkan, muda-mudi ini pun melantunkan pantun-pantun ceria yang dinamakan Sitogol. Setelah menemukan kecokcokan, pasangan muda-mudi itu pun melanjutkan tradisi pernikahandengannamaPabuat Boru yang berlanjut dengan acara Makobar berupa kata-kata nasehat dari dari kedua orang tua untuk mempelai dalam mengarungi bahtera rumah tangga. (m38)

Luar Negeri

A8

WASPADA Jumat 1 April 2011

Pabrik Baterai Racuni Lebih 100 Penduduk Di China

Seorang anak tengah diperiksa oleh dokter di saat ditemukannya lebih 100 penduduk desa keracunan timah./ xinhuanet SEPERTI kita ketahui bersama, saat ini Jepang tengah sibuk berat untuk mengatasi bocornya tiga reaktor dari enam reaktor yang ada di kompleks Pembangkit Listrik Tenaga Nuklir di Fukushima-Ichi Dai akibat tsunami yang ditimbulkan gempa bumi 11 Maret lalu. Para ahli nuklir di negara Sakura itu bekerja mati-matian untuk berusaha menghentikan

‘pelelehan’ ketiga reaktor itu karena dampak dari bocornya reaktor itu saat ini sumber air di Jepang sudah tercemar radiasi sampai ke Tokyo. Susu dan produk makanan lainnya juga sudah tercemar radiasi nuklir. Selasa lalu, Jepang semakin pening setelah didapati rembesan plutonium di tanah di luar kompleks PLTN itu dan radiasi nuklir dilaporkan sudah

mencemari kawasan laut sampai ke China, Seoul dan Filipina. Kalau Jepang menghadapi radiasi nuklir, negara tetangganya juga menghadapi masalah pencemaran lingkungan yang juga tak kalah berbahayanya. Menurut laporan awal minggu ini, emisi timah dari satu pabrik baterai di bagian timur China telah meracuni lebih dari 100 penduduk desa, termasuk di

antaranya 35 orang anak-anak. Kadar timah di dalam darah dari 139 penduduk di satu desa dekat kota Taizhou di Provinsi Zhejiang di kawasan pesisir China dinyatakan telah melewati batas normal, jelas departemen kesehatan provinsi. Tiga orang di antaranya bahkan darahnya mengandung timah tiga kali lebih besar dari batas aman bagi manusia, demikian laporan itu mengungkapkan, meski belum ada yang didapati menderita sakit parah akibat keracunan timah tersebut. Para pejabat menuding pabrik baterai di dekat kawasan itu sebagai penyebabnya. “Pemeriksaan yang dilakukan terhadap pabrik baterai itu memperlihatkan kadar timah dalam gas dan air yang dibuang pabrik itu melebihi dari batas yang diperbolehkan, yang akhirnya menyebabkan kandungan timahberlebihan di tanah sekitar pabrik itu,” kata seorang pengamat lingkungan Jiang Xincai. Penduduk desa diimbau untuk tidak mengkonsumsi makanan yang tumbuh di kawasan itu karena timah juga sudah mencemari air tanah, kata Xinhua. Pabrik baterai itu terletak hanya beberapa meter dari desa tersebut, pabrik itu mulai beroperasi tahun 2005. Proses produksi pabrik itu untuk sementara waktu dihen-

Penduduk India 1,2 Miliar Jiwa INDIA tercatat merupakan tempat bernaung 17 persen dari keseluruhan jumlah penduduk dunia, dengan tingkat populasi penduduk mencapai 1,21 milar jiwa pada tahun 2011. Meski jumlah tersebut terbilang sangat besar, namun lembaga sensus mencatat pertumbuhan itu menurun untuk pertama kalinya dalam 90 tahun terakhir. Populasi penduduk di negara Asia Selatan itu bertambah sebesar 181 juta jiwa dalam 10 tahun terakhir, seperti dikatakan C. Chandramouli, komisaris lembaga sensus. Peningkatan

17,6 persen tersebut turun dari total lonjakan 21,5 persen pada sensus 2001. India terakhir kali menunjukkan penurunan pertumbuhan populasi saat dilakukan sensus tahun 1921. Hasil proyeksi oleh PBB menunjukkan bahwa India bisa melampaui penduduk China yang dikenal memiliki populasi paling banyak, meski Chandramouli mengaku perlu ada analisis yang lebih akurat sebelum India membuat proyeksi sendiri. Demikian hasil sensus penduduk terbaru yang dimulai sejak April tahun lalu. Setelah China, India adalah negara de-

ngan penduduk terbanyak di dunia. Februari lalu, biro pusat statistik China mencatat 1,34 miliar penduduk. Angka yang dirilis, Kamis (31/03), merupakan perkiraan resmi awal yang sekiranya akan dirilis tahun depan. Sensus yang dilakukan ini merupakan upaya penghitungan ke-15 yang dilakukan India sejak tahun 1872. Proyek besar ini melibatkan 2,7 juta petugas sensus, dan merupakan survei menyeluruh pertama termasuk kesejahteraan pada sekitar 300 juta kepala rumahtangga (KK) yang hidup di tujuh ribu kota dan 600.000

desa. India menggelar sensus penduduk setiap sepuluh tahun. Hasil sensus tersebut akan membantu pejabat berwenang untuk mengembangkan kebijakan dan menetapkan anggaran untuk masyarakat India, dimana sebanyak 800 juta orang masih hidup dalam kemiskinan. “Ini menyangkut masalah keprihatinan,” ujar Chandramouli. Hasil sensus ini juga menunjukkan tingkat pendidikan nasional di bidang baca tulis yang naik hingga 74 persen untuk orang yang berusia 7 tahun dan di atasnya, dari sekitar 65 persen dalam sensus terakhir. (ap/rizal)

tikan dan tidak akan dioperasikan kembali sampai masalah pencemaran bisa diatasi, kata Jiang Xincai. Januari lalu, Xinhua juga melaporkan adalah lebih 200 anak-anak di provinsi lainnya juga keracunan timah dari pabrik baterai yang berada terlalu dekat dengan kawasan pemukiman. Keracunan timah terjadi perlahan akibat dari berulangkali terpapar timah dengan kadar kecil. Akibat keracunan timah seseorang akan mengalami gangguan di bagian syaraf dan sistem reproduksi serta ginjal. Selain itu, keracunan timah juga menyebabkan tekanan darah tinggi dan anemia. Dampak paling berbahaya akan diderita anak-anak karena keracunan timah bisa menyebabkan anak kesulitan menguasai pelajaran dan masalah prilaku. Kementrian Lingkungan China menyerukan diambilnya langkah penting untuk mencegah masalah keracunan itu karena kasus tersebut telah menimbulkan kemarahan publik. Di tahun 2009, sejumlah besar pengunjukrasa menyerang pabrik peleburan besi yang mereka tuding sebagai penyebab keracunan timah pada lebih dari 600 anak-anak. Mereka melempari truk pabrik dan merusak pagarnya. Syafri/CNN

Organ tubuh harimau sangat berharga dalam pengobatan tradisional Vietnam.

Pfizer Tarik Obat Salah Label UNIT Greenstone LLC perusahaan obat Pfizer mengatakan, pihaknya menarik dua macam obat yang beredar di Amerika Serikat karena kedua obat itu mungkin diberi label yang tidak sesuai oleh pabrikan di pihak ketiga. Obat Citalopram, obat untuk mengurangi depresi, mungkin diberi label yang tidak pas menjadi Finasteride, obat yang digunakan untuk menyembuhkan

hyperplasia prostat jinak, dan begitu pula sebaliknya, kata perusahaan itu. Greenstone mengingatkan wanita yang tengah hamil sebaiknya tidak menggunakan Finasteride karena efek samping yang bisa menyebabkkan cacat pada janin. Perusahaan itu mengimbau pasien untuk mengembalikan obat tersebut ke apotiknya. Syafri/reuters

Hugo Chavez Raih Penghargaan Jurnalistik MESKI sering bersinggungan dengan media, Presiden Venezuela Hugo Chavez didaulat menerima penghargaan Rodolfo Walsh Prize dari Universitas La Plata, Argentina. Kelompok oposisi dan media di Argentina mengkritik keputusan tersebut. Rodolfo Walsh Prize diberikan kepada Chavez atas komitmen memberikan kesempatan kepada kelompok yang selama ini dibungkam untuk bersuara melalui saluran televisi, radio, dan media cetak. “Inilah demokrasi,” kata Chavez saat menerima penghargaan tersebut, Selasa (29/ 3), seperti diberitakan situs AFP. Dalam pidatonya, Chavez menyatakan penghargaan kepada Argentina atas “debat terbuka” seperti yang terjadi di Venezuela dan presiden yang benar-benar penegak hak asasi manusia serta kebebasan berekspresi, kebebasan pres, dan kebebasan

berpikir. Bukan rahasia lagi Hugo Chavez dan Presiden Argentina Cristina Fernandez satu pandangan soal media. Keduanya memandang kepemilikan kelompok media swasta sebagai ancaman yang lebih besar bagi kebebasan berekspresi ketimbang pengawasan negara atas penyiaran dan media cetak. Presiden Fernandez selama ini berusaha mengubah industri komunikasi di Argentina melalui hukum yang dapat mematahkan monopoli media. Pemerintahnya memaksa penyedia jasa TV kabel menyiarkan saluran milik komunitas, Indian, dan kelompok aktivis lain. Sejak menjadi Presiden Venezuela pada tahun 1999, Chavez mendirikan Telesur Network, jaringan televisi swasta yang disiarkan di seluruh Amerika Latin. Chavez juga melakukan ekspansi pada media pemerintah untuk mendukung kegia-

AP

Presiden Hugo Chavez mendapat penghargaan Rodolfo Walsh Prize dari Universitas La Plata, Argentina, Selasa (29/3) tan politiknya. Sejak itu Chavez terlibat “perang” melawan perusahaan media swasta di Venezuela, yang dituduhnya mendukung segala usaha untuk menggulingkan dirinya dari kursi kepresidenan. Dengan alasan tersebut, Chavez

mengesahkan berbagai peraturan untuk menutup radio dan stasiun televisi kabel yang prooposisi, meski surat kabar dan situs-situs independen masih bisa beroperasi di Venezuela. (rizal)

Masuk Penjara Gara-Gara Jual Bangkai Harimau SEORANG pemilik kebun binatang di Vietnam dijatuhi hukuman tiga tahun penjara gara-gara menjual beberapa ekor bangkai harimau yang mati dalam penjagaannya. Huynh Van Hai dinyatakan bersalah menjual bangkai harimau, yang dibesarkan di kebun binatang yang dikelolanya di Provinsi Binh Duong dekat Ho Chi Minh City, dalam

Gema Internasional

AS Perlu Dana Membiayai ‘Petualangannya’ Di Luar Negeri PERANG apa pun bentuknya, konvensional atau nonkonventional memerlukan persiapan perencanaan dan perhitungan yang matang termasuk untung ruginya apabila suatu negara terjun dalam suatu kancah peperangan. Tapi, apakah kita tahu berapa sebenarnya anggaran yang harus disediakan untuk berperang ini. Tentu saja kita tak pernah tahu berapa besar uang yang harus dikeluarkan hanya untuk memenuhi tuntutan ikut atau terjun ke dalam suatu peperangan. Dan paling penting lagi, dari mana sumber uang yang digunakan untuk berperang. Saya tidak akan mengkaji biaya perang dunia satu atau dua. Pastilah dana yang diperlukan besar sekali. Setelah Perang Dunia II atau tepatnya setelah tahun 1945 masih ada berbagai perang utamanya ‘perang’ berebut pengaruh berdasarkan ideologi, politik, ekonomi. Contoh nyata Uni Soviet sebagai salah satu negara pemenang Perang Dunia II membawa missi memperluas ideologi

komunisme, sedangkan AS menandingi Uni Soviet dan membawa missi demokrasi liberal. ‘Perang’ berlatar belakang ekonomi muncul kebanyakan setelah 1950-an dan untuk memonopoli ekonomi, negara-negara kuat tak segan-segan pula melakukan perang fisik. Dengan mengemban missi berbagai tujuan baik politik maupun ekonomi, informasi dari salah satu media massa internasional membeberkan sumber dana yang diperlukan AS di Afghanistan dan Irak, belum termasuk ikut sertanya AS terjun bersama Inggris, Prancis untuk mengamankan resolusi Dewan Keamanan PBB non-fly zone di Libya agar rezim Moammar Khadafi menggunakan kekerasan terhadaprakyatnyayangmenuntut Khadafi turun takhta. Walau tak disebut secara menditail dan hanya menyebut sumber dana yang digunakan untuk membiayai perang di Afghanistan dan Irak, ternyata dananya dari pinjaman luar negeri ketimbang dana dari warga yang membayar pajak dan

munculnya pendekatan Obama yang akhir-akhir populer di negerinya yaitu pendekatan Tea Party. Penggunaan hutang luar negeri ini pada mulanya ditentang oleh Partai Republik tapi akhirnya disetujui karena, antara lain, debt-funded wars katakanlah di Afghanistan dan Irak lebih mudah dipertanggungjawabkan ketimbang pay-as-you-go wars yang dananya diambil dari pungutan pajak warga. Terbayang perdebatan yang terjadi menegaskan secara umum: memang sudah lama diketahui bahwa perang, di mana pun dilakukan, ibarat dua sisi mata pedang. Masyarakat manusia saling membunuh atau menyiksa satu sama lain, inilah yang dinamakan bencana. Tetapi perang juga membawa perubahan yang menguntungkan karena memobilasi manusia untuk berjuang atau berperang berarti juga memobilisasi mereka bagi tujuan-tujuan politik. Mengapa? Karena itu adalah politik yang akhirnya manusia yang telah dimobilisasi bisa diarahkan untuk kepentingan

politik penguasa, organisasi atau golongan. Konflik berkepanjangan Amerika di Afghanistan dan Irak betapa pun tidak sama. Dalam hal biaya yang dikeluarkan keduanya lebih besar dibanding dengan perangVietnam di mana AS ‘mengambil alih’ peperangan yang ditinggalkan oleh Prancis akhir tahun 1950-an. Tetapi rakyat Amerika tidak meningkatkan kewaspadaannya atau tanggungjawab politik di dalam negeri. Apa tanggungjawab sebenarnya antara protes massa rakyat Amerika terhadap perang Vietnam dan diamnya reaksi publik pada perang di Afghanistan dan Irak? Berbeda dengan perangVietnam, ketakutan terhadap terorisme membuat para pemimpin AS berlindung pada akuntabilitas artinya meminta pertanggungan jawab pemerintah terhadap ancaman terorisme, dan banyak rakyat yang percaya bahwa keterlibatan AS di Afghanistan dan Irak akan meningkatkan teror terhadap Amerika. Untuk membiayai perang

dewasa ini, pemerintah Amerika tidak hanya menghindar dari penggunaan pendapatan pajak bahkan justru memotong pemasukan pajak yang cukup besar sebagaimana dilakukan era presiden Bush tahun 2001 dan 2003. Berkaitan dengan pemilihan pre-siden tahun 2012 belum diketahui langkah dan rencana Obama tentang uang untuk pembiayaan perang yang masih berlanjut di Afghanistan dan Irak ditambah lagi keterlibatan AS dalam perang koalisi terhadap Libya. Tidak diketahui akankah hutang publik akan berlanjut. Tapi diketahui, betapa pun juga, bahwa sampai sekarang pemerintahan Obama dalam situasi cukup ‘menderita’ karena semakin meningkatnya kekeliruan atau kelalaian dalam urusan politik luar negeri karena pemerintah memerlukan “manpower and money” untuk berjuangdidalamberbagaipeperangan.AmerikaSerikattampaknya telah terperosok dalam petualangan luar negeri. (Kosky)

sidang yang berlangsung selama dua hari. Kepada hakim, yang dipimpin Hoang Huy Toan, Huynh Van Hai mengatakan, harimauharimau itu mati wajar, empat ekor mati karena terjangkit flu burung setelah makan ayam yang sakit di tahun 2003 dan seekor lagi mati karena tersedak tulang, kata Toan. Kesalahan Huynh Van Hai adalah: dia tidak melaporkan kematian itu seperti seharusnya. Dia malah menjual bangkai

hewan itu dengan alasan dia butuh uang untuk menyelamatkan harimau lainnya, kata sang hakim. Ternyata, organ tubuh harimau sangat berharga dalam pengobatan tradisional di Vietnam. Dan organ tubuh harimau ini sangat mahal dijual di pasar gelap, di mana 100 gram sumsum tulang harimau dijual dengan harga 1.000 dolar. Kasus ini terungkap di tahun 2006, ketika polisi menemukan satu dari tiga bangkai harimau yang

diangkut dalam taksi. Hakim Toan mengatakan 14 tersangka lainnya terlibat dalam kasus itu, termasuk putra Hai, yang telah dijatuhi hukuman penjara 30 bulan untuk tuduhan yang sama. Kelompok Pelestari Hewan Langka Education for Nature Vietnam memuji keputusan pengadilan sebagai ‘langkah pertama yang penting’ untuk menghentikan perdagangan organ tubuh harimau. Syafri/AP

Selundupkan Narkotika Ke Penjara Lewat Buku Gambar “SEPANDAI-pandai tupai melompat, akhirnya jatuh juga.” Mungkin itulah pribahasa yang cocok bagi para pelanggar hukum ini. Tiga narapidana dan pasangan mereka didakwa melakukan penyelundupan narkotika ke dalam penjara AS dengan modus menggunakan buku gambar, pejabat berwenang mengatakan, Selasa (29/03). Narkotika jenis Subozone, umumnya digunakan untuk perawatan pada kecanduan heroin yang merupakan jenis obat berbahaya yang dikontrol peredarannya. Para tersangka menggunakan modus dengan melengketkan obat tersebut ke dalam buku gambar kemudian mewarnainya, ujar Sheriff Gary Schaffer dari kepolisian Cape May County, New Jersey. Di buku tersebut dituliskan kata-kata “Untuk Ayah” sebelum buku itu dibawa ke penjara Cape May. “Saya telah bertugas

selama 38 tahun, dan saya belum pernah melihat modus seperti ini,” ujar Schaffer. Kasus ini terungkap setelah para petugas panjara mendapat informasi adanya percobaan penyelundupan narkotika ke dalam penjara. Ini merupakan kasus penyeludupan narkotika kedua yang terungkap pada bulan ini. Pejabat penjara Pennsylvania awal bulan ini telah menangkap 11 orang atas kasus penyelundupan narkotika yang disembunyikan di balik kiriman pos atau surat dari pihak keluarga mereka. Meski sistem keamanan terus ditingkatkan oleh pihak berwenang, namun nampaknya hal ini tak membuat para kriminal kehabisan akal dalam usaha melanggar hukum. Menyikapi hal ini, sudah selayaknya para penegak hukum terus menjaga kesiagaan guna menyikapi modus-modus baru dari para pelaku kriminal. (rtr/rizal)

Luar Negeri

WASPADA Jumat 1 April 2011

A9

Tembakan Terdengar Di Latakia Setelah Pidato Presiden Assad DAMASKUS, Syria (Antara/AFP): Tembakan terdengar di kota pelabuhan Latakia, Syria, setelah Presiden Bashar Assad membuyarkan harapan rakyatnya agar diakhirinya kekuasaan darurat puluhan tahun dalam pidato pertamanya selama protes dua pekan. “Tembakan terdengar di daerah selatan Sleibi namun sumbernya belum diketahui,” kata Issam Khoury, seorang wartawan di Latakia. Penduduk kota itu juga melaporkan penembakan dari kendaraan yang melaju ke lokasi aksi duduk, dimana pemrotes mengibarkan spanduk-spanduk yang bertuliskan “Tidak bagi perselisihan, ya bagi perdamaian dan kebebasan”. Laporan itu tidak bisa dikonfirmasi secara independen. Seorang saksimata yang

dihubungi melalui telefon mengatakan, pasukan keamanan melepaskan tembakan untuk membubarkan demonstran yang kecewa pada pidato Assad. Pasukan Suriah ditempatkan dalam jumlah besar di Latakia, sebuah kota pelabuhan yang terletak sekitar 350 kilometer sebelah baratlaut Damaskus, yang telah menjadi salah satu dari dua titik pergolakan utama dalam protes yang semakin keras selama dua pekan ini. Berita itu tersiar tak lama setelah Assad menyampaikan

pidato yang menuduh musuhmusuh Syria melakukan “persekongkolan” untuk menyerang persatuan nasional dan tidak mengumumkan diakhirinya kekuasaan darurat yang telah berlangsung setengah abad, seperti yang diharap-harapkan banyak pihak. Syria bulan ini mulai dilanda protes yang belum pernah terjadi sebelumnya, yang menuntut reformasi besar-besaran di negara yang dikuasai Partai Baath selama hampir 50 tahun itu. Lebih dari 30 orang secara resmi dinyatakan tewas dalam lingkaran kekerasan itu. Namun, sejumlah aktivis mengatakan, 126 orang tewas dalam kekerasan itu — 100

orang tewas pada Rabu saja dalam protes di Daraa, kota suku wilayah selatan yang menjadi simbol penentangan para pemrotes. Pemerintah mengumumkan serangkaian langkah reformasi dalam upaya menenangkan pemrotes, termasuk pembebasan tahanan dan rencana membuat undang-undang baru mengenai media dan perizinan bagi partai politik. Syria juga memutuskan pencabutan undang-undang darurat, yang disusun pada Desember 1962 dan diberlakukan sejak Partai Baath berkuasa pada Maret 1963. Aktivis pro-demokrasi di sejumlah negara Arab, termasuk Syria, terinspirasi oleh

pemberontakan di Tunisia dan Mesir yang berhasil menumbangkan pemerintah yang telah berkuasa puluhan tahun. Buntut dari demonstrasi mematikan selama lebih dari dua pekan di Mesir, Presiden Hosni Mubarak mengundurkan diri Jumat (11/2) setelah berkuasa 30 tahun dan menyerahkan kekuasaan kepada Dewan Tertinggi Angkatan Bersenjata, sebuah badan yang mencakup sekitar 20 jendral yang sebagian besar tidak dikenal umum sebelum pemberontakan yang menjatuhkan pemimpin Mesir itu. Sampai pemilu dilaksanakan, dewan militer Mesir menjadi badan eksekutif negara, yang mengawasi pemerintah

sementara yang dipimpin perdana menteri. DiTunisia, demonstran juga menjatuhkan kekuasaan Presiden Tunisia Zine El Abidine Ben Ali pada Januari. Ben Ali meninggalkan negaranya pertengahan Januari setelah berkuasa 23 ta-hun di tengah tuntutan yang meningkat agar ia mengundurkan diri meski ia telah menyatakan tidak akan mengupayakan perpanjangan masa jabatan setelah 2014. Dia dikabarkan berada di Arab Saudi. Dia dan istrinya serta anggota-anggota lain keluarganya kini menjadi buronan dan Tunisia telah meminta bantuan Interpol untuk menangkap mereka.

Pejabat Uganda: Khadafi Belum Minta Suaka Politik MOSKOW, Rusia (AP): Pejabat senior Uganda mengatakan pemimpin Libya Moammar Khadafi tidak minta suaka politik di negerinya. Menteri Keamanan Uganda Amama Mbabazi, yang bertemu dengan menteri luar negeri Rusia di Moskow Kamis (31/3), mengatakan kepada para wartawan bahwa pihak berwenang lokal sejauh ini belum mengajukan penawaran kepadanya. Kekuatan Barat terus menekan pasukan Khadafi dengan serangan udara pada saat para diplomat berusaha membujuk pemimpin Libya selama 40 tahun itu agar meninggalkan negeri itu tanpa kekuatan militer. Uganda Rabu menjadi negara pertama yang mengajukan penawaran terbuka bagi tempat pengungsian Khadafi. Jurubicara Presiden Uganda Tamale Mirundi, mengatakan pada AP bahwa pemimpinLibyaitudisambutdengantanganterbukadiUganda.(m10)

Kabinet Kuwait Undurkan Diri Karena Krisis Bahrain KUWAIT CITY (AP): Kabinet Kuwait mengundurkan diri Kamis (31/3) sehubungan dengan berbagai krisis regional, demikian menurut kantor berita resmi KUNA. Kantor berita resmi itu mengatakan Kabinet mengundurkan diri karena ‘perkembangan akhir-akhir ini’ dan ‘guncangan negatif terhadap kesatuan, keamanan dan stabilitas nasional negara.’ Pengunduran diri itu nampaknya merupakan usaha oleh tiga menteri Kabinet, anggota keluarga penguasa al-Sabah, untuk menghindari pertanyaan mengapa Kuwait tidak menyumbangkan tentaranya bergabung dengan pasukan Dewan Kerjasama Teluk yang dipimpin Arab Saudi ke Bahrain. Di sana, dinasti Sunni telah dihadapkan pada protes prodemokrasi selama sebulan terakhir yang dipimpin oleh kelompok mayoritas Syiah. Kira-kira 1.500 pasukan dari Arab Saudi, Uni Emirat Arab dan negara Teluk yang dipimpin negara Sunni telah memasuki Bahrain dua mingguj lalu atas undangan monarkhi Bahrain. Raja juga telah menyatakan keadaan darurat dan menindak para pemrotes, yang menewaskan sekurang-kurangnya 20 orang. Parlemen Kuwait termasuk di antara negara yang memainkan politik aktif di dunia Arab.Para anggota Parlemen selalu menantang keluarga penguasa sehubungan dengan dugaan penyalahgunaan kekuasaan dan banyak dugaan negara itu berusaha menutup kebebasan. Pengunduran diri Kabinet merupakan hal yang umum di Kuwait, satu negara anggota penting OPEC. Dalam beberapa bulan terakhir ini, para anggota parlemen oposisi telah meningkatkan tuntutannya untuk menyeret para pejabat senior untuk ditanyai di parlemen. PM Sheik Nasser Al Mohammed Al Sabah — salah seorang sepupu emir Kuwait — selamat dari mosi tak percaya di Parlemen pada tahun 2009 dan Januari tahun ini (2011).(m10)

Jepang Imbau Negara Asing Untuk Bantu Atasi Krisis Nuklir TOKYO, Jepang (AP/Antara/AFP): Jepang meningkatkan perhatiannya kepada negara lain untuk membantunya ketika mereka berjuang untuk menstabilkan instalasi nuklirnya yang porakporanda akibat gempa bumi dan tsunami. Jepang juga berusaha untuk menghentikan kebocoran radiasi yang memperumit usaha untuk menemukan mayat-mayat ribuan orang yang tersapu gelombang besar tsunami. Prancis, Amerika dan pakar internasional - bahkan robot - telah beroperasi di Jepang dan Presiden Prancis Nicholas Sarkozy berkunjung di Tokyo Kamis untuk menemui rekan sejawatnya PM Jepang guna menyampaikan solidaritasnya. Para pekerja berpacu dengan waktu untuk mencari sumber pencemaran air yang telah tergenang di instalasi nuklir Fukushima Dai-ichi sejak kejadian gempa bumi keras yang disusul tsunami 11 Maret lalu. Kebocoran itu selalu memaksa para pekerja untuk meninggalkan instalasi, yang mencegah mereka untuk memulai kembali sistem pendinginan. Tingkat radiasi di sebuah desa di luar zona evakuasi di sekitar tempat pembangkit listrik tenaga nuklir Fukushima yang dilanda gempa, telah tercatat di atas tingkat aman, kata badan pengawas atom PBB. Badan Energi Aton Internasional (IAEA) mengatakan batas aman telah terlampaui di desa Iitate, 40 km di baratlaut Fukushima, jauh di luar zona exclusion (zona larangan masuk) 20 kilometer dan zona “tinggal di dalam rumah” 30- kilometer yang diterapkan oleh pemerintah.(m10)

The Associated Press

PARA PENDUKUNG partai agama Pakistan Jamiat Ulema-e-Islam mengutuk serangan bunuhdiri atas iring-iringan kendaraan pemimpin mereka Maulana Fazal-ur-Rehman, Kamis (31/3) di Bannu, Pakistan. Satu bom jalanan terkena satu iring-iringan kendaraan seorang pemimpin Islam garis keras yang menewaskan banyak orang dan sejumlah lainnya cedera.

Pemrotes Yaman Bertekad Serbu Istana Presiden Hari Ini SANA’A, Yaman (Antara/ Xinhua-OANA): Puluhan ribu pemrotes anti-pemerintah Yaman di ibukota Sana’a berikrar akan menyerbu Istana Presiden hari ini (Jumat 1/4) jika Presiden Ali Abdullah Saleh menolak segera mundur. “Cukup! Cukup!” teriak para pemrotes jalanan yang dipimpin pemuda marah, sambil melambaikan tangan mereka ke arah Istana Presiden. Orang banyak keluar dari tenda-tenda mereka di luar Uni-

versitas Sanaa dan berbaris di sepanjang jalan menuju Istana Kepresidenan untuk pertama kalinya dalam enam pekan, dengan tujuan mendesak Saleh segera meninggalkan istana. “Kami akan terus beraksi sampai Saleh dan rezimnya yang korup pergi,” kata seorang wanita demonstran bernama Sayyida Ahmed kepada Xinhua dalam unjukrasaitu.“Kamiingindiatahu bahwacukupadalahcukup!” Para demonstranmengatakanmereka menolak negosiasi atau pembi-

caraan konsiliasi dengan Saleh setelah 52 pengunjukrasa tewas di lapangan tempat mereka berdemo pada 18 Maret. Sumber-sumber dari partai yang berkuasa dan oposisi mengatakan, Saleh dan pemimpin oposisi melanjutkan pembicaraan untuk mencari penyelesaian akhir yang bermartabat bagi presiden. SebagianbesartuntutanSaleh adalah untuk menjamin kehidupan yang layak bagi keluarganya, dan jaminan bahwa tidak ada

anggota keluarganya akan dituntut setelah dia mundur, yang dianggap sebagai masalah pelik oleh oposisi, terutama setelah ratusan ribu demonstran menyerukan agar menuntut Saleh dan keluarganya atas tuduhan “pembantaian”. Pihak penghimpun aksi protes kepada Xinhua mengatakan bahwa jika Saleh tidak turun pada Kamis, Jumat akan menjadi “Hari Pembebasan” pada saat satu juta pengunjuk rasa akan berbaris ke istana Saleh.

Peta Israel Perlihatkan Hampir 1.000 Bunker Hizbullah JERUSALEM (AP): Militer Israel Kamis (31/3) memperlihatkan sebuah peta yang menunjukkan secara rinci apa yang dikatakannya hampir 1.000 bunker bawah tanah, fasilitas penyimpanan senjata dan tempat pengamatan yang dibangun gerilyawan Hizbullah di Lebanon. Banyak di antara tempattempat di peta itu terdapat di selatan Sungai Litani di Lebanon, zona di mana Hizbullah dilarang menyimpan senjata berdasarkan gencatan senjata dukungan PBB yang mengakhi-

ri perang Israel dengan Hizbullah di tahun 2006. Militer Israel mengatakan Hizbullah mendirikan sekitar 550 bunker, 300 tempat pengamatan dan 100 fasilitas penyimpanan senjata. Menanggapi hal itu, Hizbullah, yang menguasai pasukan angkatan bersenjata terkuat di Lebanon, menuduh Israel tengah melancarkan taktik menakut-nakuti. “Mereka tengah menakutnakuti kami bahwa mereka akan menghancurkan Lebanon. Biarkan mereka melakukannya kalau bisa dan saya katakan

mereka tidak akan mampu,” kata Khodr Noureddine, anggota biro politik Hizbullah.Dia memperkirakan Israel mengungkap peta itu karena pemimpin Hizbullah, Sheikh Hassan Nasrallah, mengatakan kepada kelompok itu bulan lalu untuk mempersiapkan diri menginvasi bagian utara Israel jika perang baru terjadi antara kedua pihak. Israel selama bertahun-tahun menuduh Hizbullah melengkapi senjata mereka dengan bantuan Iran dan Syria, dengan membangun ‘desa-desa roket’ di bagian selatan Lebanon. Hiz-

bullah menembakkan hampir 4.000 roket ke bagian utara Israel selama berlangsung perang tahun 2006, mengerahkan hampir semua persediaan senjata mereka. Namun Israel mengatakan Hijbullah sudah mengisi kembali gudang-gudang senjata dengan senjata lebih canggih. Perbatasan Israel-Lebanon selama ini dalam keadaan tegang namun tenang sejak perang tersebut, yang menewaskan sekitar 1.200 warga Lebanon dan 160 warga Israel, menurut pejabat dari masing-masing sisi.(m23)

Apa Kata Orang Tentang Obama Dan Libya DAVID Gergen adalah seorang pengamat politik senior CNN dan orang yang pernah menjadi penasehat bagi empat presiden AS. Dia adalah seorang professor bidang pelayanan publik dan direktur untuk Pusat Kepemimpinan Publik di Universitas Harvard. Dia telah menghimpun dan meneliti pandangan sejumlah pembaca tentang pidato Presiden AS Barack Obama awal pekan ini. PRESIDEN AS Barack Obama Senin malam lalu menyampaikan pidato tentang kebijakan pemerintahnya untuk melakukan serangan terhadap Libya serta tentang masa depan penggunaan kekuatan militer. Pidato tersebut telah mendapat berbagai tanggapan dari masyarakat Amerika Serikat. Karena aksi militer tersebut menyangkut negara asing, maka tanggapan dari warga asing, bahkan dari dunia juga bermunculan. Ribuan, bahkan mungkin jutaan orang bukan saja menanggapi pidato tersebut, tetapi mereka terlibat dalam perdebatan sengit tentangkebijakanAmerikaitu,tentusebagianbesaradalahmasyarakat Amerika, mereka yang telah menentukan sendiri presidennya. Siapa pun tidak dapat memberikan penilaianyangadilterhadap banyak pandangan yang dilontarkan atau diungkapkan Tapi yang pasti haruslah dihargai tanggapan, pendapat serta pandangan masyarakat terhadap pidato Obama itu. Kini timbul tiga pertanyaan: 1. Apakah masyarakat (anda) yakin presiden membuat hal menarik untuk intervensi militer oleh AS dan mitra koalisinya? 2. Apakah masyarakat (anda) yakin presiden jelas mengenai tujuannya dan apa yang bakal terjadi kemudiannya di Libya? 3. Apakah presiden mengenalkan satu doktrin baru Obama tentang penggunaan kekuatan militer AS yang dilihat masyarakat menarik? Seorang pembaca skeptis (YodarCritch) menulis: “Presiden Obama mungkin telah membuat argumen bahwa pasukan militer diperlukan untuk menegakkan zona larangan terbang PBB dan ‘melindungi’ warga sipil Libya. Namun Obama gagal untuk membuat argumen bahwa militer AS diperlukan. Inilah sesuatu yang diperlukan AS untuk tidak melibatkan diri. Biar saja kekuatan regional yang menanganinya. AS tidak harus terlibat dan ambil bagian dalam setiap aksi militer.” Ada tanggapan lainnya dari pembaca yang mengatakan:“Aku tidak terpengaruh oleh alasan Obama. Jika tujuan kita adalah untukmenyelamatkannyawawargasipilyangtakberdosa,mengapa kita tidak melibatkan diri di Kongo? Survei Komite Penyelamat Internasional menemukan bahwa 5.400.000 orang tewas akibat berbagai hal yang ada kaitannya dengan perang di Kongo sejak tahun 1998 – konflik paling mematikan di dunia setelah Perang Dunia II . Banyak juga penduduk yang mati akibat penyakit. Ribuan orang lainnya di perkosa secara sistematis dan anak-anak dipaksa menjadi tentara. Tentara anak yang berusaha mengelak dari kewajiban militer atau melarikan diri, dibunuh atau disiksa, kadang tindakan itu dilakukan di depan mata anak konflik dunia didokumentasikan sejak PD II Banyak yang telah mati dari penyakit Ribuan orang telah sistematis diperkosa, dan anak-anak dipaksa untuk menjadi prajurit Anak prajurit yang mencoba untuk melarikan diri adalah dibunuh atau disiksa, kadang-kadang di depan anakanak lain, guna mencegah mereka tidak berlanjutnya tindakan desersi di kalangan tentara anak. Mengapa AS tidak campur tangan dalam krisis kemanusiaan ini?. “ Menurut Gergen, banyak pula pembaca lainnya mendapati alasan menarik dari Presiden, seperti dikemukakan salah seorang pembaca (cataylor02): “Negara ini memiliki satu kepentingan dalam urusan dunia. Kita selalu membela kebebasan dan demokrasi, saya mendukung presiden 100 persen. Sebagai anggota NATO kita memiliki tanggung jawab untuk berpartisipasi. Jika dia tidak bertindak, Kongres akan menjeritkan tentang pembiaran Khadafi melakukan pembantaian rakyatnya.” Sang pembaca menutup dengan pernyataan, “Dapatkah kita MOHON menghentikan semua omong kosong kampanyenya dan legislatiflah yang MENGATUR!!!!” Gergen merasa banyak pandangan yang sependapat dengan tanggapan ini, mereka seolah-olah memiliki perasaan yang sama. Suatu hal yang mengejutkan bahwa para pembaca nampaknya terpecah mengenai soal ini, karena terasa — sebagaimana menurut sejumlah komentator lainnya dan memang, banyak Republikan di Kongres — bahwa Presiden Obama telah membuat suatu masalah menarik, tentang kemanusiaan yang menjadi alasan mengapa dia mengirimkan pasukan AS. Tanggapan itu menunjukkan bahwa banyak orang Amerika tidak sependapat sekitar yang satu ini. Seberapa baik presiden mengkomunikasikan tujuannya dan apa yang muncul berikutnya, banyak pembaca ingin memberikan presiden suatu yang sedikit kendor. Pemberi komentar lainnya berpendapat: “Hanya ada satu isu sesungguhnya di sini: seorang presiden Demokrat membuat keputusannya untuk menggunakan pasukan militer, bekerjasama dengan negara lain, maju, menyingkirkan yang lainnya, kemudian mencapai tujuan yang terbatas, dan keluar dengan bersih. Dia tidak menghabiskan banyak dana, meninggalkan ruangan untuk menyiapkan aksi selanjutnya mengenai langkah apa lagi yang akan dipilihnya, mengirimkan satu pesan jelas kepada orang-orang dan tidak ada warga Amerika yang tewas dalam proses tersebut.” Pembaca lainnya (Robert937), memberikan tanggapan yang berhati-hati: “Obama berjalan di satu rentangan tali yang tegang. Untuk melakukan apa yang menurut para pengeritik dia ingin mengambil peran pemimpin dan bahwa baik dia atau orang-orang Amerika tidak menginginkannya. Kita berada dalam peran pendukung dan kita perlu untuk membatasi diri kita sendiri untuk itu. Untuk memegang peran kepemimpinan maka kita akan menanggung beban untuk melakukannya. “ Ada pandangan bahwa tindakan yang dilakukan AS akan menciptakan berbagai masalah pada masa depan (aaronknight): “Saya tidak yakin tujuan untuk masa depan telah dipaparkan dengan jelas. Saya rasa Presiden meletakkan tujuan yang jelas untuk intervensi Libya akan KEMBALI pada waktunya (tujuan mereka jelas telah beroperasi), tapi saya tidak sepenuhnya yakin bahwa saya masih memahami tujuan dari tindakan Libya masa depan. Saya pikir kita perlu memahami lebih lanjut tentang pandangan Presiden pada apa-jika skenario. Seperti apa jika Khadafi ditumbangkan tetapi suku meledak ke dalam perang saudara besar-besaran dan genosida digunakan terhadap satu LAIN? Apakah kita intervensi lebih lanjut, atau kita memperlakukannya seperti Sudan dan Kongo?” Menurut Gergen dia amat prihatin dengan sikap pembaca di atas. Dia berpendapat meski pidato presiden itu telah menerangkan tentang kerja besar yang telah dilakukannya, namun tujuan yang dilakukannya bersama koalisi dalam beberapa minggu ke depan masih kabur. Presiden dikenal dan dihormati karena pemikirannya, keputusannya yang menentukan, tetapi dalam hal ini, akhir dari permainan itu tidak jelas. Mengenai masalah doktrin Obama, respon bervariasi, namun nampaknya seperti ‘Doktrin Obama’ sekurang-kurangnya telah mulai muncul. (mujo)

Sport

A10

WASPADA Jumat 1 April 2011

Inter Klaim Favorit ROMA (Waspada): Gelandang Inter Milan Dejan Stankovic mengklaim, timnya sedang dalam kondisi lebih baik dibanding AC Milan menatap Derby Della Madonnina besok malam di San Siro. “Wajar saja kalau kami yang difavoritkan dalam pertandingan nanti. Lihat saja hasil-hasil terakhir yang telah kami raih,” klaim Stankovic, seperti dilansir AFP, Kamis (31/3). “Kami juga telah berhasil melakoni comeback bersejarah dengan melaju ke Liga Champions. Kami tidak akan berhenti hanya sampai di situ saja,” tekad kapten tim nasional Serbia itu. Milan yang memimpin klasemen Liga Seri A, kini tinggal selisih dua poin di atas Inter. Dalam derbi terakhir mereka di San Siro, I Rossoneri juga keluar sebagai pemenang. Namun sejak pertengahan Desember lalu, ketika jarak kedua tim sempat melebar sampai 13 poin, I Nerazzurri berhasil menipiskan jarak. La Beneamata pun terus menunjukkan performa lebih bagus dari Il Diavolo. “Kami tidak akan membiarkan Milan merebut poin dan menjauh lagi, itu pasti. Hanya saja saya agak mengkhawatirkan kehormatan profesional mereka,” sindir Stankovic. “Mereka tentu ingin membuktikan bahwa tidak siasia menjadi pemuncak klasemen selama 20 minggu. Untuk itu mereka bisa saja menggunakan segala cara demi mempertahankannya,” katanya lagi. Pelatih Milan Massimiliano Allegri sebelumnya mengatakan, Inter memiliki catatan kalah lebih banyak dan lebih me-

JADWAL LIGA SERI A Sabtu, 2 April Brescia v Bologna AC Milan v Inter Milan Minggu, 3 April Napoli v SS Lazio Catania v Palermo Cesena v Fiorentina Chievo v Sampdoria Genoa v Cagliari Lecce v Udinese AC Parma v Bari AS Roma v Juventus

(GMT ) (1600) (1845) (1030) (1300) (1300) (1300) (1300) (1300) (1300) (1845)

AP

Napoli Tepis Ambil Untung Derby Della Madonnina ROMA (Waspada): Presiden Napoli Aurelio De Laurentiis menepis timnya bakal mengambil untung dari Derby Della Madonnina antara AC Milan kontra Inter Milan. Sebab menurutnya, Napoli sendiri menghadapi laga tak kalah seru melawan tim papan atas SS Lazio. “Duel Seri A akhir pekan ini banyak yang bertajuk laga besar,” jelas De Laurentiis. “Semua orang bisa menikmatinya, semoga menjadi pertunjukan besar yang indah dilihat,” katanya lagi, seperti diberitakan Goal, Kamis (31/3). Napoli kini menghuni posisi ketiga, hanya minus satu poin dari tim peringkat dua I Nerrazzurri. Jika Inter kalah dalam derbi Milano di San Siro, berarti Edinson Cavani (foto) dan kawan-kawan bisa menyalip ke posisi dua. Sebaliknya jika I Rossoneri yang menjadi pecundang, Napoli (nilai 59) berarti akan menyamai poin Milan (nilai 62). Tapi itu dengan

Shakira Buka-bukaan GELANDANG Inter Dejan Stankovic (kiri) dan kawan-kawan yakin menaklukkan Milan di San Siro. mungkinkan untuk kalah lagi. Tapi kenyataannya, justru Nerazzurri yang belakangan mencatat hasil meyakinkan. Javier Zanetti cs juga sukses menembus perempatfinal Liga Champions dan masih punya kesempatan merebut Piala Italia. Sebaliknya partisipasi Rossoneri di Eropa itu telah berakhir. Pemilik klub itu pastinya tidak akan senang dengan hanya merebut sebuah piala atas kerja keras mereka tahun lalu dan rawan tanpa gelar musim ini. “Kami akan kerahkan se-

muanya untuk menghadapi Milan. Dengan demikian kami tidak terbebani lagi ketika memainkan laga selanjutnya,” tegas Stankovic. Leonardo aneh Derbi Milan menghasilkan perasaan aneh bagi alenatorre Inter Leonardo de Araujo, yang musim lalu menjadi pelatih Rossoneri. Leonardo selalu kalah dalam derbi Milan. Saat menukangi Rossoneri, dia kalah 0-4 dari Inter. Lantas jumpa pertama musim ini, Inter asuhan Leo-

nardo dipecundangi Il Diavolo 0-2. “Sejak pindah ke Inter akhir Desember lalu, Leonardo telah berubah. Dia membawa perubahan yang signifikan terhadap tim,” bela Stankotic. “Bersama Leo, kami telah melakukan banyak hal yang luar biasa. Kini kami sedang memiliki misi bersama, yaitu menjadi penguasa di Milan,” katanya menambahkan. Menyadari penting sekaligus bergengsinya laga antar tim sekota tersebut, bomber Milan Alexandre Pato me-

AP

BOGOTA (Antara/AFP): Bintang pop Kolombia Shakira buka-bukaan mengenai hubungan

ngaku sangat berharap bisa segera pulih dan tampil lagi membela Rossoneri. “Saya masih mengalami sedikit masalah di pergelangan kaki kiri. Tapi rasanya saya bisa pulih tepat waktu. Saya sangat ingin tampil,” papar Pato. Bomber berjulukan Si Bebek itu absen pada pertemuan pertama, November lalu, lantaran cedera. “Ini terlalu penting untuk dilewatkan. Tahun lalu merupakan tahun yang buruk, saya terpaksa absen karena cedera,” tutur Pato. (m15/ant/afp/tf) wordpress.com

SHAKIRA bermesraan dengan Gerard Pique di Barcelona.

Azzurri Masih Hidup ROMA (Waspada): Alenatorre Italia Cesare Prandelli (foto) yakin, minimnya pemain kelas dunia dalam timnya tidak akan mengurangi kiprah Gli Azzurri untuk mendulang hasil mengesankan. “Setiap orang mengatakan kami sudah mati, tapi kenyataannya kami masih hidup,” papar Prandelli, sebagaimana dikutip dari Ansa, Kamis (31/3). “Kami bisa menjadi tim besar tanpa pemain besar, kendati kami masih memiliki beberapa orang, diawali dengan (kiper Gianluigi) Buffon,” katanya lagi. Setelah membukukan hasil penting 1-0 di kandang Slovenia, Jumat lalu, Azzurri mantap memimpin klasemen Grup C kualifikasi Euro 2012. Pasukan Pran-

delli pun melanjutkan kiprah positifnya dengan menggebuk Ukraina 2-0, Selasa lalu. Hasil itu membawa udara segar di Negari Pizza, kendati banyak yang menyayangkan kurangnya bintang muda berbakat yang naik ke permukaan melalu kompetisi Liga Seri A. “Kritikan yang dilancarkan selama ini merupakan cambuk. Rasa lega saya secara pribadi muncul setelah melihat para pemain tampil sebagai satu kesatuan dalam tim,” papar Prandelli. Dia percaya bahwa unsur persatuan dan kolektivitas merupakan kunci pencapaian keberhasilan tim secara keseluruhan. “Iklim persepakbolaan di negara ini mulai cerah kembali

AP

LPI Kota Medan Tingkat SLTA menghasilkan gelar juara Liga Pendidikan Indonesia (LPI) Kota Medan tingkat SLTA bagi timnya di lapangan PPLP Sumut Jalan Sekolah Pembangunan Medan Sunggal, Kamis (31/3) sore. Zainuddin yang berada di

daerah penalti menyambut umpan crossing dari sisi kanan luar pertahanan Mulia. Sundulan ke tiang jauh mistar Mulia membobol gawang kiper Fahmi Husairi menit 31. Zainuddin juga memperoleh gelar topskor

Waspada/Setia Budi Siregar

KADIS Pendidikan Kota Medan Drs Hasan Basri, Ketua PSSI Medan Drs HM Darwin Syamsul, Kepala Sekolah SMAN 15 Medan Drs Darwin Siregar foto bersama dengan pemain SMAN 15 seusai penyerahan piala di lapangan PPLP Sumut Jalan Sekolah Pembangunan Medan Sunggal, Kamis (31/3).

romantisnya dengan bek sentral Spanyol dan Barcelona, Gerard Pique. “Aku persembahkan ini untukmu matahariku ... Shak,” tulis penyanyi berusia 34 tahun itu dalam pesan di akun twitter-nya disertai satu foto mereka, sebagaimana dikutip Kamis (31/3). Shakira dan Pique, menjadi fokus perhatian media secara intens awal bulan ini. Apalagi setelah sejumlah majalah gosip menerbitkan foto-foto pasangan itu saling berpegangan tangan dan berciuman di Barcelona. Januari lalu, Shakira mengumumkan akhir dari hubungannya selama 11 tahun dengan Antonio de la Rua dari Argentina. Kendati Shakira sudah buka-bukaan, Pique masih berusaha menutupi hubungan asmara mereka. Bek berusia 24 tahun itu dalam konferensi pers 3 Maret lalu di pusat pelatihan Barca mengaku, lebih suka bicara sepakbola dibanding asmara. Tembang Shakira yang paling populer “Waka Waka (This Time for Africa)” menjadi lagu resmi Piala Dunia 2010 di Afrika Selatan, yang dijuarai Spanyol.

Agum: Kompetisi Harus Tetap Jalan

dan rasa pesimistis usai Piala Dunia mulai menghilang,” katanya lagi. Salah satu pemain dalam timnya yang diyakini sebagai bintang berbakat besar adalah bomber AC Milan Antonio Cassano, yang tidak masuk tim pada Piala Dunia 2010 lalu. Prandelli menurunkan Cassano melawan Slovenia. Tetapi dia juga memperingati bomber bengal berusia 28 tahun itu bahwa dia dapat lebih baik lagi bila fisiknya proporsional untuk menunjang kemampuannya. “Dia (Cassano) tau bagaimana cara bertanggungjawab kepada diri sendiri. Hal itu harus ditunjang berbagai kondisi di lingkungannya,” tegas Prandelli. (m15/ansa/ant/afp)

Sundulan Zainuddin Hasilkan Gelar SMAN 15 MEDAN (Waspada): Gol spektakuler melalui sundulan Mohammad Zainuddin membawa SMA Negeri 15 Medan memetik kemenangan 1-0 atas SMA Mulia Medan. Gol Zainuddin sekaligus

syarat, Cavani cs mesti menaklukkan Lazio di San Paolo. “Semua orang bebas mendukung siapapun. Yang saya inginkan pertandingan yang bagus,” tegas De Laurentiis. Pria yang juga berprofesi sebagai produser film ini mengharapkan juga agar pertemuan Juventus dengan AS Roma menjadi laga menarik. Dirinya ingin menonton laga tersebut dan menikmatinya. Milan sempat terlihat hampir memenangi persaingan perebutan poin dari Inter dua minggu lalu, ketika Nerazzurri secara mengejutkan takluk dari Brescia. Namun Rossoneri malah ditahan imbang tim papan bawah Bari, dan seminggu kemudian kalah dari Palermo. Rangkaian kegalan itu membuat Milan sekarang hanya unggul dua poin dari Inter. Il Diavolo juga ditekan Napoli yang terus membuntuti, demikian pula dengan Udinese dan Lazio. (m15/goal/rtr)

dengan 13 gol Mental juara pemain SMAN 15 luar biasa, kendati harus bermain dua kali dalam sehari. Kamis pagi, SMAN 15 memetik kemenangan tipis 1-0 atas SMA Al-Washliyah di babak semifinal. Seyogiayanya semifinal digelar Rabu (30/3) sore, namun akibat hujan lebat terpaksa ditunda. SMAN 15 Medan binaan Drs Darwin Siregar bermain konsisten dengan motivsi tinggi. Mulia yang dihuni para pemain Pusat Pendidikan Latihan Pelajar (PPLP), sebaliknya sulit mengembangkan permainan. “Permainan berimbang. Semangat anak-anak cukup tinggi,” kata Darwin Siregar. Hal senada disampaikan pembina SMA Mulia Drs AE Siregar. “Kita belum beruntung,” ucapnya. Laga final turut disaksikan Kadis Pendidikan Kota Medan Drs Hasan Basri didampingi Ketua Pengcab PSSI Medan Drs

HM Darwin Syamsul, Ketua Umum Badan Pembina Olahraga Pelajar Seluruh Indonesia (Bapopsi) Sumut Sakiruddin SE MM dan sekitar 1000-an penonton yang pada umumnya para pelajar. Posisi ketiga direbut SMA Al-Washliyah setelah memetik kemenangan 6-1 atas SMAN 4. “Kita menyambut gembira pelaksanaan LPI Kota Medan yang dapat perhatian besar pihak sekolah dan kalangan pelajar,” jelas Hasan Basri. Sedangkan Darwin Syamsul mengakui, banyak bibit pemain sepakbola handal di sekolahsekolah. Untuk itu dia mengharapkan kepada SMAN 15 terus mempersiapkan diri dalam menghadapi LPI wilayah Sumut. “Kalau hari ini juara tingkat Medan, esok diharapkan dapat mewakili Sumatera Utara ke tingkat nasional,” harap Darwin. (m18)

JAKARTA (Waspada): Ketua Kehormatan PSSI Agum Gumelar menegaskan, keputusan pembekuan PSSI Nurdin Halid jangan sampai menghentikan roda kompetisi sepakbola nasional di semua level. Termasuk kompetisi level paling atas, yakni Indonesia Super League (ISL) yang saat ini sudah memasuki putaran kedua. “Biar bagaimanapun kompetisi harus tetap jalan dan jangan sampai terhenti,” tegas Agum di Jakarta, Kamis (31/3). Menurut mantan Ketua Umum KONI Pusat ini, sangat merugikan bagi perkembangan sepakbola di tanah air terutama untuk pembinaan berkelanjutan jika kompetisi sampai terhenti. “Kami juga sudah bicara dengan pihak-pihak terkait dengan kompetisi di PSSI guna memberikan keyakinan. Termasuk dengan Joko Driyono (CEO PT Liga Indonesia), tampaknya tidak ada masalah dan kompetisi akan berjalan sesuai jadwal,” tambahnya. Agum dan Ketua Umum KONI dan KOI Rita Subowo, dijadwalkan akan berkunjung ke

Sekretariat PSSI di Senayan Kamis (31/3). Namun kunjungan yang sudah tercium wartawan itu tiba-tiba batal, karena Agum ada tugas mendadak. “Memang ada kegiatan yang tidak bisa ditinggalkan terkait dengan posisi saya sebagai Ketua Umum PEPABRI. Namun saya akan agendakan lagi untuk berkunjung ke sana (Kantor PSSI-red),” jelasnya. “Bagaimana pun, saya ingin memastikan semuanya bisa berjalan sesuai harapan. Dalam artian, jadwal ISL jangan sampai terganggu,” tambah Agum. Sebagai ketua kehormatan PSSI, mantan Danjen Kopassus itu merasa terpanggil untuk menyelamatkan roda kompetisi sepakbola nasional dan juga kesinambungan organisasi PSSI. “Saya siap mengawal PSSI sampai kongres yang nantinya akan melahirkan Ketua Umum baru bisa digelar dengan baik. Niatan ini jangan sampai disalah tafsirkan seolah-olah saya bersedia atau ingin kembali menjadi Ketua Umum PSSI,” tegasnya. (yuslan)

Menpora Bertahan Pada Putusannya JAKARTA (Waspada): Menpora Andi Mallarangeng tetap bertahan pada keputusannya. Dia tidak lagi memfasilitasi PSSI, meski asosiasi sepakbola Indonesia di bawah kepemimpinan Nurdin Halid tetap berkantor di areal Gelora Bung Karno, Jakarta. “Gelora adalah aset milik pemerintah. Dengan dibekukannya kepengurusan PSSI saat ini, maka kami tidak akan memfasilitasi lagi seperti sebelumnya,” tegas Menpora di Jakarta, Kamis (31/3). Pemerintah melalui Pengelola Komplek Gelora Bung Karno, Rabu kemarin, telah mengirimkan surat secara resmi ke PSSI yang salah satu isinya meminta hentikan semua kegiatan di bangunan aset milik negara tersebut. Namun Menpora tidak memberikan batas waktu yang jelas sampai kapan PSSI pimpinan

Nurdin Halid harus meninggalkan kantor yang berada di Pintu X-XI Gelora Bung Karno itu. “PSSI dibawah kepemimpinan Nurdin Halid akan berakhir 19 April nanti. Kita tunggu saja,” kata mantan juru bicara Presiden Susilo Bambang Yudhoyono itu. Ditanya gugatan yang akan dilakukan PSSI terkait dengan pembekuannya, pria asal Makassar itu hanya tersenyum dan memberikan jawaban yang singkat. “Itu biasa,” ucapnya. Untuk masalah penghentian aliran dana untuk PSSI, kata dia, tetap dilakukan hingga kepengurusan PSSI baru terbentuk. Tahun ini dana yang akan dikucurkan ke PSSI sebesar Rp25 miliar. Jumlah tersebut naik Rp5 miliar dibandingkan dana yang diberikan tahun 2010 lalu. (yuslan/ant)

Sport

WASPADA Jumat 1 April 2011

A11

PSMS Urung Dekati Pro Titan MEDAN (Waspada): Rencana PSMS untuk melakukan pendekatan dengan Pro Titan di sisa laga kandang, akhirnya urung dilakukan. Sebab poin yang saat ini diraih Persiraja Banda Aceh dan PSAP Sigli, dinilai tidak mungkin terkejar. Peringkat pertama klasemen sementara Grup I PSAP Sigli dan runner-up Persiraja Banda Aceh yang sama mengantongi 41 poin dari 20 pertandingan, sudah jauh dari tim Ayam Kinantan yang baru mengumpulkan 33 poin dari 19 laga. Hal itu disadari PSMS seperti diungkapkan Asisten Manajer PSMS Benny Tomasoa. Menurutnya, kendati Pro Titan mampu mengalahkan PSAP pada 14 April dan Persiraja 18 April mendatang di Stadion Teladan, poin duo Aceh itu tidak mungkin bisa disusul PSMS atau tim lainnya. “Saya yakin, Persiraja dan PSAP akan otomatis lolos ka-

rena poin mereka sudah jauh di atas. Meski Pro Titan dan PSMS menang menghadapi mereka, poin keduanya tetap saja besar kemungkinan akan bertambah,” ucap Benny. “Karena mereka selanjutnya akan bermain di kandang. Apalagi, harapan kami Persih bisa menahan imbang Persiraja di kandangnya meleset sudah,” katanya lagi. Seandainya Pro Titan dan PSMS mampu mengalahkan Laskar Aneuk Nangroe (julukan PSAP) dan Persiraja, mereka kemungkinan besar bisa memenangkan dua laga kandang pamungkas. Persiraja akan

menghadapi Persires Rengat (9/ 4) dan PS Bengkulu (2/5) serta PSAP menghadapi Persih Tembilahan (9/4) dan PS Bengkulu (6/5). “Dari hitung-hitungan kami, tak perlu lagi melakukan pendekatan dengan Sihar Sitorus (pemilik Pro Titan), karena tidak ada pengaruhnya,” beber Benny. “Dua tim itu (PSAP dan Persiraja) tidak bisa dikejar. Jadi, PSMS harus yakin dengan kekuatan sendiri,” katanya menambahkan. Dikatakan, kendati Persiraja dan PSAP telah melangkah mulus menatap liga super, dia tetap mengharamkan menjalin komunikasi dengan kedua tim itu. “Lagipula tidak mungkin mereka mau memberi. Saat ini mereka pasti menganggap PSMS sebagai harimau kecil yang ketika besar malah akan menjadi ancaman dengan cengkraman-

Klasemen Grup I PSAP Persiraja Persipasi Persih Persita PSMS Persikabo Persitara PSLS Bengkulu Pro Titan PSSB Persires

20 20 20 19 19 19 20 20 19 17 19 19 19

12 13 10 11 9 10 8 7 5 5 3 3 1

5 2 4 1 6 3 4 4 7 5 6 6 3

3 38-16 41 5 35-21 41 6 31-18 34 7 28-22 34 4 27-15 33 6 27-22 33 8 28-26 28 9 25-32 25 7 17-18 22 7 15-21 20 10 18-25 15 10 15-23 15 15 7-52 6

nya,” papar pria 43 tahun itu. Asisten pelatih PSMS Edy Syahputra memprediksi Persita dan Persipasi akan terganjal saat dijamu Persih dan PS Bengkulu dalam partai tandangnya. “Tinggal melihat pertandingan Persipasi dan Persita di luar. Mungkin itu akan jadi peluang bagi kami,” pungkasnya. (m17)

Tekad Menang Bintang Medan Jamu Batavia Di Teladan Besok Malam MEDAN (Waspada): Bintang Medan bertekad membuat tim papan atas Batavia Union menelan pil pahit dalam laga Liga Primer Indonesia (LPI) di stadion Teladan Medan, Sabtu (2/4) malam. Trio mantan pemain PSMS Medan yang kini membela Bintang Medan Decky AC, Dodi Rahwana dan Heri Swondo saat dihubungi di mes Kebun Bunga Medan, Kamis (31/3), mengaku hasil maksimal jadi obat rasa kecewa publik khususnya pendukung fanatik Bintang Medan. Bagi skuad Michael Feichtenbeiner yang menghuni uru-

tan 12 klasemen dengan 10 poin, tidak tertutup kemungkinan akan melonjak ke urutan kedelapan bila Steven Pantelidis cs dapat mengungguli Batavia lebih dari tiga gol. Decky, Dodi dan Heri membantah timnya tengah berada dalam tren yang kurang bagus. “Kami gagal di Malang tidak terlepas akibat beberapa pemain terbaik didera cedera,” dalih mereka. Batavia berada di papan, namun bukan berarti Bintang Medanmindermenghadapi-nya. “Malah akan membuat motivasi kami bangkit untuk mengalahkan tim tamu,” tegas Dodi.

Bintang Medan kembali mengandalkan duet Cosmin Vansea dan Yoseph Ostanika di depan. Pantelidis akan menyeimbangkan lini belakang dan tengah. “Permainan mereka harus segera diredam sejak dari lapangan tengah,” sebut Heri. Batavia Union mengandalkan duet Juan Manuel Cortes danTantan di lini depan.“Mereka disokong Leandro, Javier Rocha dan Abdul Rahman yang bergerak aktif di lini tengah dan selalu memberi umpan lambung langsung mengarah ke gawang lawan,” ungkap Decky, kiper utama Bintang Medan.

Tuan rumah akan membuat gawang tamu kebobolan terlebih dahulu. “Itu terbuka lebar mengingat mereka selalu menumpukan perhatian menyerang sehingga pertahanan selalu terbuka. Ini harus diamanfaatkan,” timpal Heri Swondo. Menanggapi mantan pemain PSMS Hari Syahputra yang menjadi palang pintu Batavia Union, ketiganya tidak mempermasalahkannya. “Dia itu tidak ada apa-apanya, buktinya PSMS sendiri mendepaknya dari skuad di laga putaran kedua Divisi Utama,” klaim Dodi. (m17)

Festival U-13 Piala Yamaha 22-24 April MEDAN (Waspada): Festival sepakbola usia dini bertajuk Yamaha U-13 Football Festival Road To Asean Cup 2011 regional Sumatera Utara kembali akan digelar di Medan, 22-24 April 2011 mendatang. Ketua Panpel H Saryono mengatakan, tim yang ingin bersaing dapat mendaftar langsung ke Sekretariat SSB Sejati Pratama, Jl. Karya Jaya Nomor 1 Medan. “Pendaftaran sudah kita buka hingga 10 April dan setiap tim diperkuat pemain yang usianya di bawah 13 tahun atau kelahiran 1998,” ujar Saryono di-

dampingi Sekretaris Panpel Ir Lukmanul Hakim, Kamis (31/3). Dikatakan, panitia berharap tidak hanya peserta dari Kota Medan yang ikut bersaing, tetapi juga tim-tim dari daerah kabupaten/kota lainnya di Sumut sehingga aroma persaingannya lebih ketat dan lebih banyak muncul pemain-pemain berbakat yang bisa direkrut. “Dari festival ini akan dijaring 15 pemain terbaik yang dipilih oleh tim pemandu bakat. Ke15 pemain itu akan bergabung menjadi satu tim dan menjadi wakil Sumut mengikuti event

yang sama di tingkat nasional bersaing dengan 16 provinsi lainnya di Jakarta pada Mei mendatang,” jelasnya. Nantinya, lanjut Saryono, di tingkat nasional akan kembali dipilih 15 pemain terbaik yang akan bergabung menjadi satu tim dan mewakili Indonesia di tingkat Asean pada Juni 2011 guna menghadapi tim-tim tangguh asal Thailand, Filipina, Vietnam dan lainnya. “Pada 2010, Sumut menjadi penyumbang pemain terbesar dengan terpilihnya enam pemain memperkuat tim Indo-

nesia ke tingkat Asean. Sedangkan pada 2008 lalu, Sumut merebut gelar juara di tingkat nasional dan enam pemain memperkuat tim Indonesia ke tingkat Asean di Vietnam dan sukses tampil di babak empat besar,” jelasnya. Saryono juga berani menjamin segala bentuk KKN tidak akan berlaku di ajang itu. “Sehebat apa pun dia, kalau tidak bermain tidak akan mungkin terpilih. Kami juga tidak akan memberi kesempatan bagi pemainpemain titipan,” pungkas purnawaran TNI AD itu. (m42)

Selamat, Lilik Raih Lisensi A Nasional

Waspada/Setia Budi Siregar

SELAMAT Riyadi (kanan) dan Lilik Suheri lulus memuaskan dalam pelatihan lisensi A nasional.

Problem Catur Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

MEDAN (Waspada): Mantan pemain PSMS Selamat Riyadi dan Lilik Suheri yang meneruskan karir sebagai pelatih sepakbola memperoleh lisensi A nasional dengan hasil memuaskan pada pelatihan di Magelang 13 Februari hingga 13 Maret lalu. Atas kebehasilan itu, keduanya akan menggelar sosialisasi Grass Roots untuk pemain usia dini 10 sampai 12 tahun. Menurut Selamat dan Lilik yang tergabung dalam Kwarta Manajemen, Kamis (31/3), sosialisasi dijadwalkan 1-8 Mei di lapangan Beo Kwarta Law Dendang itu diikuti pelatih dan siswa SSB se-Sumut. Namun pihaknya membatasi SSB yang mengikuti sosialisasi. Adrian Achmad Gho yang akrab disapa Engsin selaku pembina Kwarta Manajemen menyambut gembira atas keberhasilan Selamet dan Lilik memperoleh lisensi A. “Selamet dan Lilik merupakan pelatih PS Kwarta divisi III nasional. Untuk itulah ilmu yang sudah diperolehnya dapat diterapkan kepada klub dan siswa SSB,” tambah Engsin. Selamet mengatakan, di Indonesia baru satu orang yang mengikuti pelatihan Grass Roots di Malaysia pada 2010. Sedangkan pada pelatihan di Magelang yang digawei PSSI, instrukturnya adalah Drs Emral Abus MPd berlisensi AFC. Apakah dimaksud dengan Grass Roots? “Program ini sebaiknya diberikan kepada pemain berusia 10 sampai 12 tahun. Dalam arti pada usia tersebut bukan melatih sepakbola tetapi bermain sepakbola,” tambah Lilik. (m18)

TTS TOPIK

MIMBAR JUMAT (MUAT ULANG)

IMBANG 1-1: Legiun asing Persija Jakarta Oliver Makor (kiri) bertarung seru dengan pemain Persipura Jayapura Imanuel Wanggai pada pertandingan Indonesia Super League di Stadion Utama Gelora Bung Karno, Senayan, Jakarta, Kamis (31/ 3) sore. Tuan rumah Persija ditahan Persipura 1-1 dalam duel bergengsi tersebut. Macan Kemayoran bertahan di posisi tiga klasemen dengan 33 poin dari 18 pertandingan. Sedangkan Persipura kokoh di puncak dengan 41 poin dari 19 laga.

PSSI Aceh Tak Terpengaruh Pembekuan BANDA ACEH (Waspada): Ketua Umum PSSI Aceh Zainuddin Hamid mengaku pihaknya tidak terpengaruh dengan masalah pembekuan PSSI pusat oleh pemerintah. Pihaknya tetap menjalankan fungsinya sesuai amanah undang-undang. “Kita harapkan kisruh itu tidak menganggu dunia sepakbola, apalagi di Aceh. Kami tetap menjalankan peran untuk memajukan sepakbola Aceh dan pembekuan PSSI oleh pemerintah tidak akan berpengaruh

bagi PSSI Aceh,” ujar pria yang akrab disapa Let Bugeh ini. Berbicara masalah pembinaan, dia menilai program yang dicetus Gubernur Irwandi Yusuf dengan mengirim 30 anak-anak Aceh untuk belajar sepakbola di Paraguay selama tiga tahun termasuk sukses. “Program itu bagus dan mereka sudah boleh dikatakan berhasil karena ada 13 anakanak Aceh yang sudah dikontrak sejumlah klub di Paraguay dan Argentina. Informasi yang

saya terima beberapa anak Aceh saat ini juga sedang menjalani tes di berbagai klub di Paraguay dan Argentina,” kata Let Bugeh. Dikatakan, ini menjadi kehormatan bagi anak-anak Aceh bisa bermain di luar negeri. “Kita harapkan mereka bisa memetik pengalaman serta mengasah mental dalam bertanding,” tambahnya. Sementara itu, Wakil Ketua Komisi E DPRA Safwan Yusuf kepada wartawan mengatakan untuk membuktikan keber-

hasilan pendidikan dan pelatihan tersebut perlu pembuktian serta uji coba. “Dalam uji coba itu kita bisa melihat kemampuan mereka,” katanya. Menurutnya, uji coba anakanak Aceh itu bisa dilakukan dengan tim nasional Indonesia yang juga berlatih di luar negeri. “Melihat hasil rekamannya, memang bagus-bagus semua, tetapi untuk membuktikan program itu berhasil perlu uji coba,” pungkas Safwan. (b05)

Tingkatkan Prestasi Atlet WI, TI Simalungun SIMALUNGUN (Waspada): Para atlet wushu dan taekwondo Kabupaten Simalungun yang baru-baru ini mendulang medali emas, perak dan perunggu di Kejuaraan Daerah Sumut, diminta terus meningkatkan kemampuan dan prestasi. Demikian Bupati Simalungun JR Saragih melalui Kepala Dinas Pemuda dan Olahraga Jarinsen Saragih saat menerima audiensi para atlet, ofisial dan pengurus Pengkab Wushu Indonesia ( WI) dan Pengkab Taekwondo Indonesia (TI) Simalungun di ruang Harungguan

Kantor Bupati, Rabu (30/3). Dikatakan, para atlet jangan cepat puas meskipun sudah berhasil meraih medali dalam satu kejuaraan. “Para atlet harus terus mengasah ilmu bela dirinya agar ke depan dapat meraih prestasi yang lebih baik di event yang lebih bergengsi pula,” jelas Jarinsen. Dia pun memberikan apresiasi tinggi kepada para atlet wushu dan taekwondo yang telah mengharumkan daerah Simalungun melalui torehan prestasi dalam beberapa kejuaraan daerah di tingkat provinsi dan

Mendatar

Islam dan ilmuan terkenal dalam sejarah kedokteran. 25. Nuh (tulis dalam bahasa Inggris). 26. Aliran pimpinan Mirza Gulam Ahmad yang berdiri di India tahun 1889 dan di Indonesia tahun 1925 (Menurut fatwa MUI, jamaahnya bukan Islam, sesat dan menyesatkan).

lokal. Sekretaris Umum TI Simalungun Rahmad Sitanggang memaparkan berbagai prestasi yang telah diraih para atlet setempat, di antaranya meraih perak Kejurnas Paskhas Open Tournament III Menpora Cup 2010. Pada Kejurda Taekwondo Open Zein Cup IV Pra Junior & Junior Tebingtinggi 2011 merebut 2 emas, 2 perak dan 5 perunggu. Di Kejuaraan Taekwondo Laskar Merah Putih memperebutkan Piala Walikota Pematangsiantar Pra Junior, Junior

& Senior 2011 menggon-dol 9 emas, 2 perak dan 5 pe-runggu. Sedangkan Ketua WI Simalungun Jesron Sihotang menyampaikan, prestasi yang diraih para atlet wushu setempat pada Kejurda Sumut di Medan 17-20 Maret 2011 lalu meraih 1 emas, 3 perak dan 3 perunggu. Dengan hasil itu, Simalungun naik dari peringkat 7 menjadi peringkat 4 Sumut. Jesron juga melaporkan, pihaknya akan mengirimkan Lavenia Sirait (kelas 56 kg putri) mengikuti Kejuaraan Asia di China. (a29)

Sudoku 1. Surat Al Quran yang di dalamnya terdapat tujuh ayat yang dibaca dalam setiap rakaat shalat. 4. Makanan manis yang disebut dalam QS Al Baqarah ayat 57 diturunkan Allah, selain salwa (sejenis burung puyuh). 7. Surat Al Quran yang ada ayat shalat Inna shalati wa nusuki wa mahyaya wa mamati lillahi Rabbil ‘alamin. 9. Kepercayaan dasar, dogma; Bentuk jamaknya aqa’id. 10. Berbaris rapi dalam shalat berjamaah. 11. Putera Nabi Ibrahim. 14. Singkatan radiyallahu ‘anhu. 15. Kalimat bagian dari surat Al Quran. 16. Bukit tempat Nabi Muhammad menerima wahyu pertama dari Allah tahun 610H. 17. Ucapan seseorang untuk menyatakan kesanggupan melakukan sesuatu, sebagaimana disebut dalam QS Al Kahfi ayat 23-24. 20. Yang ______, arti Al-Khabir, salah satu Asma’ul-Husna. 22. Singkatan Islamic Solidarity Fund (Dana Solidaritas Islam dari Islamic Development Bank untuk tujuan pembangunan). 23. Nama populer Avicenna, filsuf

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

1 8

Menurun

2. Tidak perduli terhadap perintah Tuhan meski percaya adanya Tuhan. 3. Allah. 4. Huruf ke-24 abjad Arab. 5. Huruf pertama abjad Arab. 6. Kota besar di Irak, pernah menjadi kubu militer Umar bin Khattab tahun 638. 8. Ajaran teologi tentang kiamat dan kehidupan sesudahnya. 12. Arti hudan adalah petunjuk, hudan lin nas berarti petunjuk kepada ______. 13. Tidak (Arab). 16. Surga (Arab). 18. Negara Eropa anggota NATO yang penduduknya mayoritas muslim. 19. Arti menurut kata perkata; Berdasarkan arti leksikal. 21. Huruf ke-18 abjad Arab. 23. Berbelas kasihan. 24. Tidak batal.

2 6 8 1 6 7 2 8 3 1 4

9

2 6

9

4 2

7 8 2 6 7 2 1 5 *****22

Sport

A12

WASPADA

Jumat 1 April 2011

Pedrosa Termotivasi

MADRID (Waspada): Rider Repsol Honda Dani Pedrosa (foto) mengaku termotivasi sekaligus siap menjalani balapan di sirkuit Jerez akhir pekan ini, kendati sempat mengalami cedera pada seri pembuka di Losail, Qatar. “Saya sangat termotivasi sekarang. Dalam setiap balapan musim ini, kami selalu bekerja seratus persen,” papar Pedrosa, seperti dikutip Red Bull, Kamis (31/3). “Tetapi ketika balapan di rumah sendiri (Spanyol), kami harus bekerja lebih keras lagi. Sebab mereka (pendukung) selalu menyiapkan acara khusus,” beber Pedrosa. Padahal usai lomba di Losail, Pedrosa mengeluh rasa sakit membuat konstrasinya terpecah selama mengikuti balapan. Kendati demikian, persoalan klasik tersebut tidak mengganggu performanya. Pedrosa pun berha-sil merebut podium ketiga di Qatar. Menatap seri kedua di Je-

rez, motivasinya jadi berlipat ganda. Pedrosa bahkan mengaku sudah tidak sabar menggeber gas motornya di Jerez, sirkuit yang terletak di selatan Spanyol. “Seperti telah saya katakan, saya senang dan begitu semangat. Kami menunggu untuk melihat bagaimana penampilan kami dalam balapan nanti,” ucapnya. “Sampai kami memulai menjumlah kilometer di trek, kami tidak tahu seberapa fit kesiapan kami sebenarnya,” tambah Pedrosa. Mengenai kenangan di Losail, dia mengatakan; “Peristiwa di Qatar benar-benar meninggalkan rasa pahit di mulut saya. Jadi sekarang, ka-

motogp.com

mi harus berhati-hati.” Pedrosa bersama tandemnya Casey Stoner dari tim Repsol Honda mendominasi seri pembuka MotoGP 2011 di Qa-

tar dua pekan silam. Ini memanaskan pembalap Yamaha Racing Jorge Lorenzo, yang menyandang gelar juara bertahan. “Setelah balapan pertama,

kami tidak sabar menanti balapan di Jerez. Dibandingkan Stoner, catatan Loren zo jauh lebih baik ketika tampil di sana,” klaim manejer tim Yamaha Racing, Wilco Zeelenberg. “Musim lalu Lorenzo memenangkan seri balapan di Spanyol untuk kali pertama. Dia pasti berjuang sekuat tenaga seperti di Qatar kemarin, meskipun agak sedikit berbeda,” ujarnya lagi melalui Crash. Jika menang di negerinya sendiri, Lorenzo berarti akan menancapkan milestone penting dalam kariernya. Dia bakal sejajar dengan pembalap tersukses asal negeri Matador, Alex Criville. Juara dunia 2000 itu menang 15 kali sepanjang karirnya, sementara Lorenzo baru 14 kali. Tahun lalu Lorenzo bersaing ketat dengan rekan senegaranya Pedroa yang memacu Repsol Honda. Pekan ini saingannya bertambah, karena performa Stoner pulih lagi pasca menjadi tandem Pedrosa. (m15/okz/rb/crash)

AP

Clijsters Meringis MIAMI, AS (Antara/AFP): Petenis unggulan delapan Victoria Azarenka menumbangkan unggulan kedua dan juara bertahan turnamen tenis WTA dan ATP Miami Masters, Kim Clijsters (foto). Kemenangan di Miami, Kamis (31/3) pagi WIB itu, memastikan langkah Azarenka menembus semifinal turnamen WTA Sony Ericsson berhadiah sembilan juta dolar AS tersebut. Petenis Belarusia itu me-

Djokovic Jumpa Fish MIAMI, AS ( Waspada): Petenis nomor dua dunia Novak Djokovic (foto) menyingkirkan non-unggulan Kevin Anderson dari Afrika Selatan 6-4, 6-2 pada perempatfinal turnamen tenis ATP Masters 1000 berhadiah sembilan juta dollar. Tempur di Miami, AS, Kamis (31/3) pagi WIB, Anderson hanya satu set saja memberikan perlawanan berarti terhadap bintang tenis Serbia tersebut. Djokovic yang telah meme-

nangi 22 pertandingan musim ini, selanjutnya menghadapi petenis Amerika Serikat Mardy Fish pada babak semifinal. Jika dirunut kembali sampai tahun lalu ketika Djokovic terakhir kali menang di final Piala Davis, dia berarti telah menang secara berturut-turut sebanyak 24 kali. Sedangkan Fish kini menggantikan Andy Roddick sebagai petenis AS dengan peringkat tertinggi setelah mengalahkan petenis Spanyol David

Ferrer 7-5 6-2. Peringkat 15 dunia itu secara resmi akan menyalip peringkat delapan dunia Roddick saat pengumuman peringkat petenis dunia ATP yang dimutakhirkan minggu depan. “Saya kira saya tidak akan pernah merasakan bagaimana rasanya menjadi petenis Amerika Serikat dengan rangking tertinggi. Sebab Andy selalu tampil lebih baik dan memiliki prestasi yang sangat cemerlang,” jelas Fish.

Roddick merupakan teman setimnya waktu SMA. “Amerika negara yang besar dan memiliki banyak petenis hebat. Jadi yang bisa saya lakukan adalah tetap fokus dan bermain sebaik-baiknya,” tegasnya lagi. Fish secara mengejutkan melaju ke semifinal saat Ferrer yang biasanya sangat tangguh, terlihat kehabisan tenaga pada set kedua di bawah sengatan sinar matahari Florida. (m15/ant/afp/ap)

Tommy Siap Saingi Pembalap Medan MEDAN (Waspada): Tommy Hermawan, pembalap andalan Tim Honda Tommy Camel asal Tanjung Balai, siap menyain para pembalap handal Medan. Gabung dalam Tim Honda Tommy Camel, dia mengaku sangat bangga namanya dipakai sebagai nama tim. “Senang lah jika nama kita dipakai untuk nama tim. Yang pasti itu menambah semangat bagi saya untuk memberikan yang terbaik bagi tim dan Honda,” tutur Tommy di Medan, Kamis (31/3). Juara Umum kelas 110 cc di Kejurda LA Light tahun lalu itu memastikan diri akan tampil pada Kejuaraan MotorPrix di Sirkuit Lanud Medan pada 3 April 2011. “Ajang MotorPrix ini menjadi kesempatan emas buat saya, jadi mohon doanya dari semua,” harap Tommy. Pembalap peringkat II Pemula MotorPrix Region Sumatera tahun 2008 itu berharap dapat tampil maksimal, setelah timnya yang dipimpin A Siong mengawali kerjasama dengan Honda awal tahun 2011 ini. “Terima kasih atas kerjasama, dukungan dan perhatian yang diberikan Honda kepada Tim Honda Tommy

Camel,” ucap A Siong. Sejak berdiri tahun 1999, tim yang awalnya bernama Camel itu sudah membuktikan kesetiaan dengan selalu menggunakan motor Honda di sepanjang perjalanan timnya, kendati belum mendapat perhatian langsung dari main dealer Honda. Pemberian nama tim Honda Tommy Camel, ternyata khusus didedikasikan A Siong untuk Tommy Hermawan. “Tommy merupakan pembalap yang memiliki kemampuan luar biasa. Harapannya sih dengan nama ini kami dapat mencetak prestasi gemilang, apalagi Tommy juga sudah sangat sehati dengan motor Honda,“ jelas A Siong. Gunarko Hartoyo, Promotion Manager CV. Indako Trading Co selaku main dealer Honda di Sumatera Utara mengungkapkan, pihaknya bangga dengan upaya Tim Honda Tommy Camel untuk tampil maksimal mulai pekan ini. “Kami akan terus memberikan apresiasi dan dukungan penuh pada tim yang telah lama eksis di dunia balap road race, dan berharap Tim Honda Tommy Camel dapat berprestasi seperti tim Honda yang lainnya,” ujar Gunarko. (adv)

Solis Gratis Demi Klitschko BERLIN (Waspada): Juara kelas berat Olimpiade Odlanier Solis (foto) sangat mendambakan pertarungan ulang melawan juara dunia Vitali Klitschko. Sangkin terobsesinya, Solis bahkan siap bertarung tanpa bayaran sekali pun alias gratis. “Saya juga tidak butuh uang untuk pertandingan ulang itu. Saya hanya menginginkan sabuknya,” tegas Solis, seperti dilansir Passauer Neue Presse, Kamis (31/3). “Mari kita bertarung lagi di Koeln. Bagi penonton yang mengeluarkan uang banyak untuk menonton pertarungan kami yang pertama, kini dapat menyaksikan gratis,” katanya lagi. Penantang dari Kuba itu mengalami cedera kaki pada ronde pertama perebutan gelar WBC pada 19 Maret di Koeln, Jerman, sehingga Klitschko menang TKO. Setelah mengalami kekalahan memalukan itu, Solis kini memiliki rencana besar. “Saya selalu menganggap tinju sebagai pekerjaan, tetapi sekarang saya sudah berubah,” papar juara kelas berat Olimpiade 2004 itu. Klitshcko menghajar Solis dengan serangkaian pukulan

DPA

ke wajah dan kepalanya. Solis terjatuh dan terpaksa menjalani operasi di Jerman untuk memperbaiki kerusakan pada urat kakinya. Dia masih butuh operasi kedua pada April sebelum menjalani rehabilitasi dan perawatan lanjutan. Itu berarti Solis tidak dapat naik ring dalam tujuh bulan ke depan. “Saya berharap Vitali sebagai petinju jantan yang menunggu pertandingan ulang dengan saya. Saya memiliki impian dan untuk mewujudkannya saya harus bekerja keras,” tekad Solis. “Saya ingin menjadi juara dunia dan mempertahankannya lama lama sekali. Saya sudah melihat betapa mudah mengalahkan Vitali,” sesumbarnya lagi. (m15/ant/afp)

Waspada/Ist.

JUARA Umum 110 cc Tommy Hermawan (kanan) dan Rifi Fidia Nst (kiri) selaku Juara Umum 125 cc Honda di ajang Kejurda Sumut 2010, diabadikan bersama Gunarko Hartoyo (tengah).

AP

ngalahkan Clijsters yang terlihat meringis menahan sakit dengan skor 6-3, 6-3. Ini merupakan semifinal pertama Azarenka sepanjang tahun 2011. Di semifinal nanti, dia akan berhadapan dengan petenis Rusia Vera Zvonareva, yang sebelumnya menang 75, 6-3 atas petenis Polandia Agienszka Radwanska. Karir kemenangan tertinggi Azarenka diraihnya pa-

da 2009 ketika dia merebut juara di turnamen Key Biscayne. Zvonareva yang dalam turnamen itu ditempatkan sebagai unggulan ketiga mengalahkan Radwanska yang menempati unggulan kesembilan. Dua petenis putri lain yang telah dipastikan maju ke semifinal sekaligus saling bertarung Jumat (1/4) ini petenis Jerman Andrea Petkovic melawan bintang Rusia Maria Sharapova.

Carmelo Angkat Knicks NEW YORK (Waspada): Carmelo Anthony mengangkat New York Knicks dari posisi tertinggal saat menghadapi New Jersey Nets. Torehan 39 poin forward berumur 26 tahun itu membuat Knicks menang dengan skor akhir 120-116 dalam laga NBA, Kamis (31/3) pagi WIB. Tampil di kandang sendiri Madison Square Garden, Knicks sempat tak berdaya pada dua kuarter awal. Nets menyudahi babak pertama dengan keunggulan 10 poin. Pada kuarter ketiga Knicks menyusul dan membuat kedudukan hanya selisih setengah bola 21-22. Laga semakin sengit di kuarter penutup.

Kejar mengejar poin tak dapat terelakkan. Ketika laga tersisa 01:08 menit, kedudukan masih 114114. Tapi tiba-tiba Carmelo melakukan jump shot yang bersarang telak ke dalam ring Nets sekaligus membawa Nets unggul 116-114. Knicks terus menambah keunggulan lewat free throw Toney Douglas dan Chauncey Billups. Nets hanya mampu menambah dua poin melalui Kris Humphries. Carmelo menjadi pengumpul angka terbanyak dengan 39 poin. Torehan serupa juga dibuatnya pada pertandingan sebelumnya. Billups menyusul di tempat kedua dengan raihan 30 poin. (okz)

Sumatera Utara

WASPADA Jumat 1 April 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:33 12:46 12:34 12:41 12:40 12:37 12:34 12:39 12:36 12:36

‘Ashar 15:37 15:54 15:38 15:48 15:46 15:38 15:37 15:32 15:40 15:41

Magrib 18:38 18:51 18:38 18:46 18:45 18:41 18:38 18:34 18:41 18:40

‘Isya

Imsak

Shubuh Syuruq

Kota

19:46 19:59 19:46 19:54 19:53 19:49 19:46 19:42 19:49 19:49

05:02 05:15 05:03 05:09 05:09 05:07 05:03 04:59 05:05 05:04

05:12 05:25 05:13 05:19 05:19 05:17 05:13 05:09 05:15 05:14

L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan 12:31 P. Siantar 12:32 Balige 12:32 R. Prapat 12:28 Sabang 12:46 Pandan 12:33

06:26 06:39 06:27 06:34 06:33 06:31 06:27 06:23 06:29 06:29

Zhuhur ‘Ashar 15:46 15:36 15:36 15:48 15:31 15:34 15:33 15:29 15:54 15:33

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:44 18:37 18:36 18:48 18:35 18:36 18:36 18:33 18:51 18:37

19:52 19:45 19:44 19:56 19:43 19:44 19:44 19:41 19:59 19:45

05:08 05:01 05:00 05:12 05:00 05:01 05:01 04:58 05:15 05:02

05:18 05:11 05:10 05:22 05:10 05:11 05:11 05:08 05:25 05:12

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:33 12:34 12:44 12:37 12:34 12:40 12:29 12:39 12:32 12:31

18:37 18:38 18:48 18:41 18:38 18:45 18:33 18:43 18:36 18:36

19:45 19:47 19:57 19:49 19:46 19:53 19:41 19:52 19:44 19:41

05:02 05:03 05:12 05:06 05:03 05:09 04:58 05:08 05:01 05:00

05:12 05:13 05:22 05:16 05:13 05:19 05:08 05:19 05:11 05:10

Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:30 Parapat 12:32 GunungTua 12:29 Sibuhuan 12:29 Lhoksukon 12:39 D.Sanggul 12:33 Kotapinang 12:27 AekKanopan 12:29

06:32 06:25 06:25 06:36 06:25 06:25 06:25 06:22 06:39 06:26

15:33 15:36 15:51 15:38 15:38 15:46 15:31 15:42 15:33 15:35

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Tewas Gantung Diri

TANJUNGBALAI (Waspada) : Penanggulangan sampah di Kota Tanjungbalai terksan belum maksimal, ini terbukti dengan sampah menumpuk di pinggir jalan karena tidak diangkut petugas kebersihan. Demikian diungkapkan Aktivis LSM AH Sibarani menyikapi persoalan sampah yang menjadi sorotan masyarakat Kota Tanjungbalai, Selasa (29/3). Dikatakan, untuk menuju kota bersih dan asri, hendaknya sampah harus dituntaskan dengan mengoptimalkan petugas kebersihan dan menyediakan tempat penampungan sementara agar sampah tidak berserakan. Disamping itu, tumpukan sampah dan limbah rumah tangga selain merusak keindahan pemandangan, maka keberadaannya menjadi sarang berbagai macam binatang penyebar penyakit seperti lalat dan nyamuk sehingga mengganggu kesehatan. Dikatakan Sibarani, kondisi itu terlihat di beberapa titik, seperti di Jalan Jenderal Sudirman, AhmadYani dan Kim Ban Lie. Di ruas jalan itu sampah berserakan di luar bak penampungan sehingga kucing, anjing dan ayam berlomba mengais sisa-sisa makanan. (a32)

Permainan Biliar Resahkan Warga T.TIRAM (Waspada) : Warga Desa Limalaras Tanjungtiram, Batubara, merisaukan beroperasinya 2 tempat permainan biliaar yang berperasi buka 24 jam diduga dijadikan ajang pertaruhan alias judi. Menurut warga Limalaras, Rabu (30/3), praktik olahraga biliar dijadikan tameng memuluskan permainan judi terselubung Apalagi tempat biliar itu hanya berjarak puluhan meter dari mushala di Dusun II dan III.Warga jadi risau karena sering terjadi keributan bermain sampai subuh hari. Disebut-sebut, operasi biliar itu tidak memiliki izin dari Kadis Budparpora Batubara Sunardi, Kasi Pariwisata Disbudparpora Batubara melalui ponsel, Rabu (30/3) mengatakan, dua tempat biliar di Limalaras belum punya izin dan tidak pernah melapor/mengajukan permohonan izin. Camat Tanjungtiram M Nasir Yuhanan menegaskan, ada 3 arena biliar di kecamatannya belum mengurus izin usahanya ke Disbudparpora Batubara. (a12)

Warga Pematang Rambe Kumpulkan Tandatangan Ucapkan Terimakasih T.TIRAM (Waspada) : Gonjang ganjing soal pengumpulan tandatangan masyarakat Desa Pematang Rambe, Kec.Tanjungtiram untuk maksud tertentu merupakan wujud terima kasih masyarakat untuk disampaikan kepada Pemkab Batubara. ‘’Langkah ini semata dilakukan sebagai wujud kemurnian terimakasih tertulis warga kepada Pemkab. Tidak sedikitpun ada mempunyai niat tertentu. Apalagi sampai menutupi pekerjaan proyek amburadul sebagaimana digaungkan,’’ tutur Ketua Lembaga Pemberdayaan Masyarakat (LPM) Desa Pematang Rambe, Syamsul Effendy alias Kotok, Rabu (30/3). Disamping mengharapkan pembangunan ke depan lebih diperhatikandanditingkatkandiberbagaisektorsebagaimendukung kelancaran roda perekonomian dan kesejahteraan masyarakat. ‘’Jika pembangunan meningkat desa lebih maju dan masyarakat merasa diuntungkan,’ ‘katanya. Penandatanganan tidak hanya dilakukan oleh masyarakat, namun diketahui oleh Kepala Desa dan LPM. (a13)

Warga Minta CV IA Bogak Seberang Ditutup TALAWI(Waspada):WargaJl.BandengDusunII,DesaMesjidlama Talawi, Batubara menyampaikan surat kepada Bupati Batubara agar CV IA Bogak Seberang Tanjungtiram ditutup. Surat ditandatangani 48 warga, tanggal 21 Maret 2011 itu antara lain sejak 1992 keberadaan CV.IA meresahkan warga sekitar Jalan Bandeng menuju ke lokasi pabrik. Pasalnya prah roda sepuluh milik CV.IA pada tengah malam melintas di jalan dengan muatan melebihi tonase merasa tidak nyaman warga. Dengan bukti yang ada, temuan Komisi A DPRD Batubara atas dugaan pencurian pasir kuarsa dilakukan CV.IA berdampak mengancam pemukiman dikikis abrasi menimbulkan keru gian besar dan mereka meminta Bupati Batubara menindak menutup perusahaan tersebut. Untuk mengantisipasi kerusakan Jalan Bandeng tambah parah diharapkan Pemkab Batubara c/q PU dan Pertambangan Batubara memasang portal mencegah truk roda sepuluh dan alat berat ekscavator CV IA. Surat warga itu ditandatangani Kades Mesjidlama Rusli tembu-sannya ke PU Batubara, Dishut Batubara, Komisi A Batubara. (a12)

Zhuhur ‘Ashar 15:31 15:39 15:36 15:33 15:34 15:30 15:30 15:45 15:34 15:28 15:31

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:34 18:41 18:39 18:34 18:36 18:33 18:33 18:43 18:37 18:32 18:33

19:42 19:49 19:47 19:43 19:44 19:41 19:41 19:52 19:45 19:40 19:41

04:59 05:06 05:04 04:59 05:01 04:59 04:58 05:07 05:02 04:57 04:58

05:09 05:16 05:14 05:09 05:11 05:09 05:08 05:17 05:12 05:07 05:08

06:23 06:30 06:28 06:23 06:25 06:23 06:22 06:32 06:26 06:21 06:22

Satu Makam, Dua Raja

Maling Bobol Rumah Pengusaha Angkutan

Penanggulangan Sampah T. Balai Belum Maksimal

06:26 06:27 06:37 06:30 06:27 06:33 06:22 06:32 06:25 06:24

Makam Raja Simargolang XIII Di Pulorakyat Tua

KOTAPINANG (Waspada) : Zainal Abidin, 55, warga Teruna Jaya Kelurahan Setia Muliya Bekasi Utara, Jawa Barat, Kamis (31/ 3) ditemukan tewas posisi leher tergantung dengan seutas tali nilon di dapur rumah orangtuanya di simpang 3 bukit Kotapinang Labuhanbatu Selatan (Labusel). Kapolsekta Kotapinang Kompol AK. Tanjung mengatakan, korban ditemukan setelah berada di Puskesmas Kotapinang. Sementara keterangan dokter Puskesmas, leher korban sudah berwarnabirubekastalinilon,daritelingaadakeluardarahdanpenisnya ada mengeluarkan sperma. “Kematian korban masih misterius, kini dalam penyelidikan, sambil menunggu hasil otopsi nanti” ucap Kapolsekta. Dari hasil otopsi nanti akan terjawab apakah ada unsur penganiayaan atau murni bunuh diri,” katanya. (a19)

LIMAPULUH (Waspada): Rumah pengusaha angkutan tandan buah segar (TBS) kelapa sawit di Dusun I, Desa Perkebunan Tanah Itam Ulu, Kecamatan Limapuluh, Kabupaten Batubara, Senin (28/3) dini hari dibobol maling. Menurut keterangan, pemilik rumah Hendrik Ginting, 36, yang akrab dipanggil Kakek, mengetahui rumahnya dimasuki naling sekira pukul 04:00. Dia tersentak dari tidur lalu keluar dari kamardanterkejutmelihatpinturumahterbuka.Setelahdiamatinya, ternyata sepeda motor HondaVario Tekno BK 3901VAG miliknya tidak ada lagi di tempat. PagiharinyakorbanmembuatpengaduankePolsekLimapuluh atas hilangnya sepeda motor itu. Pengaduannya, No. STPL/92/ III/ 2011/SU/Res/Asa/Sek Limapuluh. Korban mengatakan, di dugapelaku masuk rumah melalui jendela depan ruang tamu, dengan terlebih dulu mencongkel kunci jendela dengan linggis, ungkapnya. Kapolsek Limapuluh AKP Bambang Rubianto, SH ketika dihubungi melalui selularnya,membenarkan kejadian itu, dan dia sudah memerintahkan anggotanya ke TKP guna melakukan penyelidikan. (c05)

B1

Waspada/Rahmad F Siregar

RAJA MARTOLO dan adiknya Raja Marlampo dikebumikan dalam satu makam berukuran 7x4 meter di kampung Pardamaran (Parhutaan) Dusun X, Desa Pulorakyat Tua, Kec. Pulorakyat, Kab. Asahan.

Anggota Samapta Polres L. Batu Dianiaya Dugaan Persaingan Bisnis Judi Dan Dendam Pribadi RANTAUPRAPAT (Waspada) : Diduga terkait persaingan bisnis judi togel di Rantauprapat, sekelompok preman menganiaya Brigpol Sihar Sitorus anggota Samapta Polres Labuhanbatu di depan rumahnya Jalan Olahraga-Estranda Gg. Panahan Kelurahan Siringoringo Kec. Rantau Utara, Labuhanbatu, Rabu (30/3). Pristiwapenganiayaanterjadi sekira pukul 23.00. Saat itu sekelompokpemudaberjumlahtujuh orang sudah ‘cekik’ minuman keras. Berpura-pura seperti ada keributan dan teriakan minta to-

longmengundangperhatian korban untuk melihat dan memberikan pertolongan namun begitu korban mendekati, kelompok pemuda langsungkorbandianiaya hingga babak belur. Pertikiaan yang diduga melibatkanduaanakketuaOKP.Ketua OKP itu pada kejadian itu sempat melerai namun tetap saja penganiayaanberlanjuthinggakorban terkapar dan malam itu juga korban langsung dibawa ke RSU Rantauprapat. Malam itu juga petugas melakukan penyisiran dan membawa empat orang yang diduga turut melakukan penganiayaan ke Mapolres. Kamis (31/3), salah seorang ketua OKP berinisial BH, yang dua putranya diduga terlibat dalampenganiayaanhadirdiMapolres untuk diambil keterangan-

nya. Sementara di Mapolres, kedua anak BH yaitu SH, 32, dan RH,28, warga Aek Matio, Kelurahan Silandorung, Kec. Rantau Utara diduga sebagai otak pelaku dalam pengainayaan itu masih diperiksa secara intensif. Kapoles Labuhanbatu AKBP Robert Kennedy melalui Kasat Reskrim AKP Tito Hutauruk membenarkan penganiayaan tersebut. “ K’Ita masih lidik, kedua anaknya telah kita tahan, sedangkan oknum ketua OKP BH ayah dari kedua tersangka kini masih diperiksa,”jelasnya. Ketika disinggung motif pertikaian karena persaingan bisnis judi. Kasat membantah. “ Itu tidak benar. Pertikaian kemungkinan karena dendam pribadi,” paparnya.(tim)

Polisi Gerebek Rumah Ketua DPRD L. Batu Ketua DPRD: Itu Hanya Gudang MEDAN (Waspada): Rumah Ketua DPRD Labuhanbatu digerebek petugas Satuan Reserse Kriminal Polda Sumut, yang diduga dijadikan lokasi judi toto gelap (togel) Kim dan judi dadu (samkwan). Rumah pribadi berada di Jln. H Iwan Maksum, Desa Ujung Bandar, Kecamatan Rantau Selatan, Labuhanbatu itu digerebek Selasa (29/3) malam sekira pukul 22:00. Penggerebekanberlangsungcepat,sekirasatu jam dengan mengamankan enam tersangka yang mengelola perjudian tersebut. Kapolda Sumut Irjen Pol. WisjnuAmatSastromelaluiKepala Bidang Humas Poldasu Kombes Pol. Hery Subiansauri ditanya wartawan, Rabu (30/3) membenarkan adanya penggerebekan itu. Disebutkan, enam tersangka diduga mengelola perjudian togel ditangkap, berikut sejumlah barang bukti. “Para tersangka dan barang bukti saat ini berada di Mapoldasu guna pemeriksaan dan pengembangan kasus,” kata dia menyebutkan, penggerbekan dilakukan berdasarkan laporan masyarakat. Enam tersangka yang diamankan, Kamaluddin alias Kamal, 28, penduduk Jln. Dewi Sartika, Labuhanbatu, Cecep Hadinata Siregar, 24, penduduk Jln. Juang 45, Labuhanbatu, Irianto alias Anto, 28, penduduk Jln. KLYos Sudarso, Medan, EkaTadar Septiawan Dinata alias Kutek, 25, warga Dusun Bandar Rejo, KelurahanTebing Lingga Hara, Labuhanbatu, Rizal Affandi Siregar, 29, penduduk Jln. Siringo-ringo, Labuhanbatu dan Dedi Arfandi Siregar, 24, warga Labuhanbatu. Sedangkanbarangbuktiyang disita berupa uang tunai Rp3 juta lebih, 40 lembar kertas folio berisi catatanrekaptebakantogelperiode 29 Maret, 66 lembar kertas folio tebakan togel 28 Maret, 33 lembar kertas tebakan 28 Maret, 820 lembar kertas tebakan 27 Maret, empat telefon genggam, empat kalkulator dan lainnya. Kata Hery, ke enam tersangka itu merupakan para pekerja, sedangkan bandarnya berinisial RS yang juga anak pemilik rumah

melarikan diri saat dilakukan penggerebekan. Togel yang dikelolaparatersangkaberoperasi setiap hari, siang dan malam. Pengakuan tersangka, omset setiap putaranpadasiangharimencapai Rp70 juta, sedangkan omset malam hari sekitar Rp30 juta. Seorang tersangka ditanya wartawan, mengaku ikut mengelola togel siang-malam itu selama enambulan.Ditanyarumahyang dijadikan markas judi, diakui mereka milik ketua DPRD Labuhanbatu. Kapolda SumutWisjnu Amat Sastro sebelumnya telah menegaskan akan mempertaruhkan jabatannya untuk memberantas perjudian di wilayah hukumnya. “Judi menjadi salah satu prioritas saya untuk diberantas, saya akan berantas meski jabatan taruhannya,” kata dia. Dia juga mengatakan, akan menindak anggotanya yang terbukti terlibat dalam perjudian itu, termasuk polisi yang membackingnya. “Bukan cuma itu, jika di satu wilayah hukum terdapat praktik perjudian dan dibiarkan sampai kemudian dilakukan penggerebekan, maka empat perwira yang bertanggung jawab di wilayah itu akan dicopot. “Mereka, Kapolres, Kasat Reskrim, Kasat Intel dan Kapolsek setempat,” tegasnya. Informasi lain menyebutkan, selain markas togel, rumah kediaman Ketua DPRD Labuhanbatu Elliya Rosa Siregar itu dijadikan lapak judi dadu (sam kwan) dan jackpot. Perjudian yang disebutsebut dikelola suami ketua DPRD tersebut telah berlangsung lama, bahkan sudah beberapa kali pergantian Kapolres dan Kasat Reskrim Polres Labuhanbatu, tempatitutidakpernahdigerebek. Gudang Ketua DPRD Labuhanbatu menyatakan penggrebekan judi togel anggota Satuan I/Tindak Pidana Umum(Tipidum)Kepolisian Daerah Sumatera Utara (Poldasu) yang disebutkan polisi di rumah pribadinya merupakan gudang. Hal itu dikatakan Ketua DPRD Labuhanbatu Hj Elliya

Rosa Siregar , SPd kepada wartawan saat temu pers di Rumah Dinas DPRD Labuhanbatu Jalan WR Supratman, Kamis (31/3). Menurut Elliya Rosa, rumah yang digrebek polisi yang berada di Jalan H Iwan Maksum, Desa Ujung Bandar, kelurahan Lobu Sona,Kecamatan Rantau Selatan Labuhanbatu, jaraknya sekitar 5 KM dari rumah Dinas Ketua DPRD Labuhanbatu sudah sejak lamatidakditempatikeluarganya, melainkan didiami oleh sejumlah penjaga rumah, karena sudah dijadikan sebagai gudang penyimpanan barang-barang milik keluarganya. “Sejak saya dilantik menjadi ketua DPRD Labuhanbatu, saya tidak pernah tinggal di rumah pribadi (yang digerebek polisi) , karena anak-anak saya pun tidak ada yang mau tinggal di rumah itu. Mereka (keluarganya) pun sudah memiliki rumah masingmasing,” kata Elliya Rosa Lebih lanjut dikatakan, rumah yang dinyatakan polisi telah menggerebek tersebut sudah lama dijadikan sebagai gudang penyimpanan barang-barang, sehinggadijagaolehpekerjasebanyak 4 orang. Maka itu membuat keluarga Elliya Rosa jarang berkunjung ke sana (rumah yang digrebek) karena sudah menjadi penyimpanan barang-barang. “Saya pun baru tahu ada penggerebekansetelahmembaca berita di media massa hari ini, Kamis (30/3). Kami pun tidak ada kordinasi dengan polisi atas penggerebekanitu.Jadisayajelaskan penggerebekan yang terjadi di rumah itu tanpa setahu saya, karenasayatinggaldirumahdinas Ketua DPRD Labuhanbatu,” katanya. Dia juga mengaku, selama ini setiap kegiatan resmi maupun tidak resmi seperti, persiapan Kejuaraan Nasional (Kejurnas) Sarung Tinju Emas (STE), persiapan pembentukan panitia Liga Pelajar Indonesia (LPI), Shalat taraweh bulan puasa bersama masyarakat dan nonton bola bareng (Nobar) bersama warga selalu diadakan di rumah Dinas (Ketua DPRD). (m27/a17)

PULORAKYAT (Waspada) : Makam Simargolang XIII yaitu Raja Martolo dan adiknya Raja Marlampo, berada di tepi aliran Sungai Asahan di kampung Pardamaran (red-dulu Parhutaan) Dusun X Desa Pulorakyat Tua, Kec. Pulorakyat, Kab. Asahan. Raja dan panglima perang Dinasti Simargolang era 1868 itu, dikebumikan di dalam satu makam berukuran 7 x 4 meter tanpa batu nisan. Dan di atas makam mereka, terdapat bangunan segi empat berukuran 2x2 meter yang diduga sebagai tanda. Makam ini sudah sangat tua, dan selain bangunan 2 x 2 meter, juga ditandai dengan beberapa batang pohon kecil. “Jenazah Raja Martolo dan adiknya Raja Marlampo dikebumikan berdampingan dalam satu makam,” kata keturunan Raja Martolo Raja HAzharsyahSimargolang,wargaDesaPulorakyat Tua, Kec. Pulorakyat di makam Raja Simargolang XIII itu Rabu (30/3). Menurutnya, kendati dikebumikan berdampingan, namun Martolo dan Marlampo meninggal dalam waktu berbeda, tapi penyebabnya sama akibat lanjut usia. “Kita belum dapat memastikan, siapa yang pertama meninggal dan dikebumikan di makam ini. Akan tetapi, pada masa mereka, masih menganut paham animisme,” terang Azharsyah didampingi pengurus DPP Parsadaan Raja Simargolang Asahan (Parasima)RajaZulfanirahmadsyahSimargolang, Raja Dedi Armansyah Simargolang dan Kharuddin Simargolang.

Di bagian Selatan dari makam Raja Martolo danRajaMarlampo,terdapatmakamRajaLingsana atau Raja Simargolang XIV. Lingsana merupakan putra mahkota Raja Martolo, dan tercatat sebagai raja terakhir dari Kerajaan Simargolang. Kondisi makam Raja Lingsana hampir sama dengan makam ayah dan pamannya. Perbedaannya, jika makam Martolo dan Marlampo sepanjang 7 meter, maka makam Lingsana mencapai 15 meter dan lebar 5 meter. Selain makam-makam raja, di kawasan PulorakyatTua tersebut sisa-sisa benteng pertahanan yangterbuatdaritanahdenganketinggian5 meter danpanjangpuluhanmeter.Bentengitudibangun tatkalaKerajaanSimargolangbertempurmelawan Belanda. Zulfanirahmadsyah dan Dedi Armansyah Simargolangmenambahkan,berdasarkancatatan sejarah, Raja Martolo memiliki dua adik yakni Raja Marlampo dan Raja Ugub. Hanya saja, keberadaanmakamRajaUgubbelumdiketahui,malah menurut cerita keturunan Simargolang, Raja Ugub tewas akibat dipancung Belanda sehingga jasadnya tidak ditemukan. “Raja Martolo dimakamkan dengan pesta adatselamatigabulan,sedangkanRajaMarlampo dimakamkan melalui pesta adat (mangual) 7 hari7malam,”terangZulfanidanDedi.Dikatakan, kendati Dinasti Simargolang sampai Raja XIV, namun yang lebih terkenal adalah Raja Martolo dan adik-adiknya. Mereka lebih dikenal karena bertempur melawan penjajahan Belanda,” jelas Zulfani. (a14)

Pukat Tarik Mengganas Di Selat Malaka Nelayan Ancam Mogok Massal TANJUNGBALAI (Waspada) : Alat tangkap ikan jenis pukat harimau yang kini berubah nama menjadi pukat tarik atau tarik dua terus mengganas di perairan Selat Malaka sehingga menimbulkan keresahan nelayan dan jika tidak diatasi secepatnya mereka mengancam mogok massal. “Laut adalah ladang kami, dan telah dirusak oleh pukat tarik yang menghancurkan ekosistem dan habitat ikan, dan tidak berapa lama lagi, perairan itu akan kehabisan sumber daya lautnya terutama ikan. Untuk itu, kami meminta agar penghancur alam itu ditangkap,” ungkap Ketua Forum Komunikasi NelayanTradisional Bersatu (FKNTB)TBA Abdul Latif di Gedung DPRD, Rabu (30/3). “Jika aparat penegak hukum di laut tidak melakukan tindakan dan menangkap pukat tarik, pukat net, pukat kantong, dan tarik kapal dua yang beroperasi di wilayah perairan Selat Malaka sampai 14 April 2011, maka 40.000 nelayan yang tergabung dalam FKNB TBA dan ANI Kota Tanjungbalai akan melakukan mogok massal sebagai sikap keprihatinan,” katanya. Hal senada juga diungkapkan Ketua Asosiasi Nelayan Indonesia (ANI) Hamdan Sinaga saat beraudiensi ke DPRDTanjungbalai yang diterima Ketua Romay Noor. Menurut nelayan, alat tangkap tersebut selain

menyapu semua yang ada di depannya mulai dariikanterkecilsepertiterisampaiikangembung, juga merusak terumbu karang sebagai tempat berkembangbiaknya ikan. “Pernah kami teliti di Medan, ternyata jaring jenis pukat harimau itu juga menyapu anak ikan jenis Senangin dan gembung, sehingga ada beberapajenisikanyangtelahpunah,”ungkapSangkot. Disamping itu, Hamdan Sinaga juga mengungkapkan keresahan dan penderitaan para nelayan tradisionil Tanjungbalai Asahan sudah berlangsunglamakarenasetiapharihasiltangkapan semakin sedikit akibat terjadinya penangkapan ilegal (ilegal fishing) tersebut. Selain itu, aparat penegak hukum terkesan tutup mata, sebab pukat terlarang itu juga beroperasi di wilayah tangkapan yang sangat dekat dengan bibir pantai. Sekretaris Komisi C Hakim Tjoa Kian Lie mengaku kecewa atas tanggapan yang diberikan pihak Administrator Pelabuhan (Syahbandar) Tanjungbalai Asahan yang mengatakan bahwa kewenangan mereka sebatas memberikan perizinan kapal layak berlayar dan bukan menyangkut jenis alat tangkapnya. “Menurut Undang-undang, selain mengecek perizinan berlayar, Syahbandar juga berwenang memeriksajenisalattangkapikanyangdigunakan nelayan,” pungkas Hakim. (a32)

Polemik Harus Dihentikan

Kenduri Laut Dengan Melarung Kepala Kerbau Oleh Umat Islam Haram LIMAPULUH (Waspada) : Keputusan Majelis Ulama Indonesia Batubara tentang Kenduri Laut dengan melarung kepala kerbau kelaut yang dilaksanakan di Pantai Belacan, Kamis (24/3) diputuskan sebagai kegiatan yang haram dan pekerjaan yang dikategorikan khurafat. Keputusan MUI Batubara dikeluarkan setelah mendengar secara gamblang kronologis ritual yang dipersiapkan sebelum kenduri laut dilangsungkan berikut foto-foto pelaksanaan. Tiga hari sebelum hari “ H “ sejumlah pawang atau biasa disebut dukun berkumpul membuat pancang di pantai dengan menaikkan bendera empat warna. Satu hari sebelum hari H kerbau yang memiliki syarat tanduknya harus melengkung, berikut tujuh ekor kambing dengan warna hitam betul yang berarti tujuh kecamatan beserta satu ekor ayam putih betul didatangkan ke lokasi. Pada Kamis dinihari kerbau dipotong bersama kambing dan ayam, tetapi kepala, kulit, jantung,limpa,kakidankepalakerbautetapdibiarkan di atas tikar plastik. Ternyata kulit kerbau tadi dijahitkembalidengansebelumnyamemasukkan kepalakambingkedalamkulitkerbau.Selanjutnya oleh para pawang kerbau ini dilarung ke laut.

Berdasarkan kronologi ritual ini Komisi Fatwa yang diketuai H Ridwan Amsal berikut anggota H M.Nasir dihadiri oleh Ketua Umum MUI Batubara H Ghazali Yusuf yang bersidang di Kantor MUI Batubara Perupuk, Kamis (31/3) berdasarkan dalil dan nash dari Al Quran, hadist, tafsir Atthabari, Tafsir Almunir, Ensiklopedia Hukum Islam, serta pendapat ulama terdahulu memutuskan keputusan yang hari ini dibuat adalah keputusan yang khusus untuk acara Kenduri laut hari itu dengan tata cara yang telah dilakukan pada hari itu hukumnya adalah haram, memakan daging sembelihannya haram, mendatanginya juga haram. Sementara itu nara sumber yang juga anggota komisi fatwa MUI HM Nasir mengatakan, sebenarnya dalam konteks kenduri laut dengan tata cara yang telah disebutkan telah jelas hukumnya. Jadi dalam hal membuat keputusan ini MUI Batubara sifatnya hanya mengumpulkan dalil-dalil saja. Ketua MUI H Ghazali Yusuf mengatakan, keputusaniniakandiserahkankepadaMUISumut, karena masalah ini bukan hanya di Batubara saja. (c05)

Enam Tersangka Korupsi Di Asahan Diserahkan Ke Penuntut Umum KISARAN (Waspada): Enam tersangka korupsi di Dinas Tata Kota dan Sekretariat DPRD Asahan, diserahkan dari penyidik ke penuntut umum Kejari, Kamis (31/3) serta berlanjut akan disidangkan di PN Kisaran. Tersangka, PD, SP dan AF yang terlibat dalam penyelewengan dana proyek Penataan Taman Mahoni Kisaran (tahap I) yang bersumber dana dariAPBDAsahan2007,kemudianmantanKabag Keuangan DT, mantan Sekretaris Dewan, SH dan mantan bendaharanya, AR, sekrertariat DPRD Asahan yang diduga melakukan penyelewengananggaranmakanminumanggotadewan pada 2007 sehingga negara menelan kerugian sebanyak Rp 296 juta. “Iniadalahprosesyangdilaluidanselanjutnya akan disidangkan di PN Kisaran, yang waktunya belum bisa ditentukan,” ungkap Kajari Kisaran, Didi Suhardi.SH.MH melalui Jaksa Penuntut Umum dalam kasus itu, Hendri Edison Sipahutar, SH.MH ditemui Waspada. Menurutnyadalampenyelidikandanpenetapan tersangka korupsi, Kejari melakukan investigasi dan pemeriksaan baik itu berbentuk dokumen dan saksi yang dianggap terlibat. Dan fakta-

fakta itu mereka berenam yang bertanggung jawab atas perbuatan yang merugikan uang negara. “Dalam pemeriksaan itu, kita tidak ada pandang bulu, siapapun yang terlibat, semuanya akan kami proses dengan hukum yang berlaku,” ungkap Hendri. Tidak Tandatangan Sementara kuasa hukum mantan Sekretaris Dewan SH dan mantan bendaharanya AR, sekretariat DPRD Asahan, Tri Purnowidodo SH tidak mau menandatangani berita acara penyerahan itu, karena Dodo meminta agar Kejari Kisaran untuk memeriksa Mantan Ketua DPRD Asahan BS, namun hal itu tidak dilakukan. Perbuatan itu menurut Dodo, Kejari telah melakukan penyalahgunaan prosedur sehingga terindikasi menghilangkan saksi pendukung terhadap kliennya. Menanggapi hal itu, Jaksa Penuntut Umum dalam kasus itu, Hendri Edison Sipahutar, menganggap hal itu tidak ada masalah dan penyerahan tetap dilakukan untuk melanjut ke proses sidang. Saksi yang dikatakan Dodo (mantan Ketua DPRD Asahan BS-red), menurut Hendri telah dimintai keterangannya. Serta di dalam sidang nanti saksi itu juga akan dihadirkan untuk memberikan keterangan lebih lanjut (a15)

Sumatera Utara

B2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Tiga Kandidat Bersaing Perebutkan Ketua PP Binjai BINJAI (Waspada) : Tiga kandidat bersaing menjadi Ketua Majlis Pimpinan Cabang (MPC) Pemuda Pancasila Kota Binjai, Periode 2011-2015 dalam Musda PP Kota Binjai 2 -3 April 2011 di pendopo Umar Baki. Disebutkan kandidat Hery Dwanto (Sekretaris PP Binjai), H Bagus Sumarno (Wakil Sekretaris PP Binjai) dan Busrikal alias Ung (Kabid Litbang dan Kaderisasi PP Binjai). Demikian dikatakan ketua Panitia Pelaksana Muscab PP keVII Kota Binjai, M Nasir Sinulingga, SH didampingiWakil Ketua Aan Doeng dan Wakil Sekretaris Nur Irwansyah Putra (Kocu) kepada wartawan di Sekretariat PP Binjai, Jalan Candra Kirana, Binjai, Kamis( 31/3). Sebelumnya, Walikota Binjai HM Idaham,SH.MSi menerima MPC Pemuda Pancasila dan Panitia Muscab, Rabu( 30/3). Ketua MPC PP Binjai Zainuddin Purba didampingi Sekertaris Hery Dwianto, Ketua SC Armansyah, dan Ketua OC M.Nasir Sinulingga serta MPO Edi Karantina melaporkan persiapan Muscab MPC PP 3April2011diPendopoUmarBaki.‘’PersiapanMuscabsudahrampung dan diharapkanWalikota HM Idaham hadir,” ujar Zainuddin Purba. Walikota HM Idaham didampingi Kadispora Djanu Asmadi menyatakan kesedian hadir. Idaham minta pelaksanaan Muscab PP Kota Binjai aman dan tertib. ‘’PP sebagai organisasi pemuda yang punya pengalaman berorganisasi harus menunjukkan kedewasaan dan menjadi panutan bagi organisasi lain,’’harap Idaham. Walikota berpesan, Muscab harus sesuai aturan organisasi.(a04)

Jumat 1 April 2011

Sibolga Selatan Juara Umum MTQ Ke-39

WASPADA

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: H. Akmal AZ. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan).

WASPADA

SIBOLGA (Waspada) : Kecamatan Sibolga Selatan kembali meraih sukses sebagai juara umum Musabaqah Tilawatil Quran (MTQ) ke-39 dan Festival Seni Nasyid (FSN) tingkat Kota Sibolga yang berlangsung sejak 26-28 Maret di lapangan Simaremare Sibolga. Walikota Sibolga HM Syarfi Hutauruk mengajak seluruh kaum muslimindanmuslimattetapmeningkatkanpemahamandanbacaan terhadap Al-Quran. “Sebab kitab Suci Al-Quran bukan sekadar diperlombakan semata, namun lebih dari itu bagaimana kita dapat memperbaiki bacaan, mengkaji dan memahami makna dan kandungannya,” ungkapnya saat menutup MTQ tersebut, Senin (28/3) malam. Penyelenggaraan MTQ ke-39 kota Sibolga tahun 2011 sekaligus sebagai momen untuk mencari dan menentukan qari dan qariah andalan Kota Sibolga baik dalam segi bacaan, pemahaman, penghayatan dan pengamalan Al Quran. Dari seluruh cabang MTQ yang diperlombakan, Kecamatan Sibolga Selatan kembali berhasil merebut peringkat pertama dan ditetapkan sebagai juara umum seperti pada tahun sebelumnya. Sementara peringkat kedua ditempati Sibolga Sambas dan Sibolga Kota pada peringkat ke tiga serta kecamatan Sibolga Utara sebagai juara harapan. (a24)

Waspada/Abdul Khalik

BANGUNAN pagar dan rumah ibadah berada di pinggiran hingga bibir Sei Padang menyalahi sejumlah peraturan. Namun entah bagaimana SIMB pagar itu bisa dikeluarkan intansi terkait. Kakan LH Abdul Rohim terlihat memantau pembangunannya, Kamis (31/3).

RSU Dr Djoelham Berlakukan Retribusi Jasa Umum BINJAI (Waspada): Rumah Sakit Umum Daerah(RSUD) dr Djoelham Binjai mulai memberlakukan Perda No.4 tahun 2011 tentang retribusi jasa umum. Direktur RSU Binjai Drg Susyanto menjelaskan pada wartawan Kamis( 31/3) di ruang kerjanya, dengan ditetapkan Perda No.4 tahun 2011, semua masyarakat umum penentuan pelayanan kesehatan sudah ditetapkan. Semua pelayanan dan pengobatan di RSU dr.Djoelham Binjai sudah diatur dengan Perda No.4 tahun 2011. Berlakunya retribusi jasa umum oleh Dirut Drg Susyanto minta semua petugas pelayanan ditingkatkan. (a04)

Pembangunan Rumah Ibadah Di Sempadan Sei Padang Tanpa Izin Jurtul Togel Besitang Dibekuk

T. TINGGI (Waspada): Pemko Tebingtinggi dinilai terkesan tutup mata terhadap pembangunan rumah ibadah tao pek kong (klenteng) di bantaran Sei Padang. Padahal, bangunan itu tidak memiliki perizinan sama sekali dan melanggar peraturan daerah. Tapi faktanya pembanguan bisa dikerjakan tanpa ada pencegahan dari aparat terkait.

Dari pantauan Kamis (31/3), lokasi klenteng itu berada di Jalan Sei Mati, Link.01, Kel. Brohol, Kec. Bajenis. Rumah ibadah itu diba-

ngun hanya berjarak beberapa meter dari pinggir sungai. Proses pembangunan klenteng itu, terlihat, tahap mendirikan kerangka bangunan berbahan dasar baja. Selain itu, dibangun pula dinding pagar, terdiri dari kawat dan beton yang persis berada di bibir sungai. Selain itu, ada pula bangunan yang menjorok ke badan sungai. Tidak terlihat adanya plank perizinan yang lazim pada setiap proyek bangunan. Pembangunan rumah ibadah itu, diduga telah melanggar Perda Kota Tebingtinggi No.24 Tahun 1998 tentang Retribusi Izin Mendirikan Bangunan. Selain itu, juga melanggar sejumlah peraturan, yakni UU No.32 Tahun 2009 tentang Pengawasan dan Pengelolaan Lingkungan Hidup, UU.

No.26/2009 tentang Tata Ruang Nasional, UU No.7 Tahun 2007 tentang Sumber Daya Air dan UU No.41Tahun 1999 tentang Kehutanan. Selain itu, pembangunan rumah ibadah itu juga tidak dilengkapi dengan SKB 3 Menteri No.9 dan No.8 Tahun 2006 tentangPendirianRumahIbadah. Kepala Kantor P2T Muhammad Fachri membenarkan pihaknyatidakadamengeluarkan izin pembangunan rumah ibadah di bantaran Sei Padang itu. “Kami hanya mengeluarkan izin pendirian pagar,” ujar Fachri. Kasi Tata Ruang Dinas PU Rudiyanto mengatakan, pemberianrekomendasipendirianpagar di bibir sungai berdasarkan pada konsultasi dengan Badan Pertanahan Nasional. Menurut dia, bagi lahan di

bantaran sungai yang ada SHM (surat hak milik) boleh diberikan SIMB pada bangunan yang tidak permanen dan bersifat sementara. Namun, ketika diminta dasar peraturannya, dia, tidak bisa menunjukkannya. Kakan LH Abdul Rohim bersama Kaban Satpol PP Guntur Harahap langsung ke lokasi mengecek keberadaan pagar dan rumah ibadah itu. Dari dialog dengan pemilik bangunan Budi, diketahui pendirian rumah ibadah itu sama sekali tidak memiliki izin.PemilikhanyamemilikiSIMB untuk pembangunan pagar. “Saya tidak tahu kemana harusmemintaizinnya,”ujarBudi. Kakan LH dan Kaban Satpol PP, meminta agar pemilik bangunan mengurus perizinan yang diperlukan baru kemudian meneruskan pembangunan. (a09)

Perjudian Di Pantaigemi Stabat Tidak Tersentuh Hukum STABAT (Waspada): Bertahun-tahun bisnis judi togel dan judi kopyok beromzet belasan juta rupiah seminggu di kawasan Pantaigemi Stabat Kab. Langkat tidak tersentuh hukum, dan beroperasi dibawahpohonsawit, warung hingga di rumah warga. Beberapa hari lalu sejumlah pengurus masjid di Pantaigemi telah berniat ingin memberikan surat keresahan kepada Kapoldasu, namun tidak lebih dari tiga orang yang berani mengadu, selebihnya takut akan adanya intimidasi dari sang bandar mau-

pun pengikutnya. Akibatnya pengajuan surat keresahan itu belum terwujud. Sementara, beberapa pengurus masjid di sana mengaku telah beberapa kali memberi informasi secara lisan kepada aparat Polres Langkat dan Polsek Stabat untuk memberantasnya,namunhingga kini belum ada hasil. ’’Saya siap jika ada aparat kepolisian yang memerlukan bantuan untuk diminta menunjukkan lokasi-lokasi judi di Pantaigemi,’’kata salahseorangpengurus masjid yang bersikukuh

lokasi itu harus ditutup karena hanya akan membawa azab dan kemungkaran, Rabu (30/3). Pantauannya,sekaranganakanak seusai sekolah banyak yang ketagihan judi kopyok, apalagi togel seakan dinanti setiap hari. Informasi lain yang diperoleh, Jumat pekan silam sebagai wujud keresahan, kaum ibu di Pantaigemi telah berniat melempari warung dan rumah pendudukyangdijadikanlokasibermain judi dengan telur ayam dan kotoran, namun upaya tersebut terhambat hujan .

’’Kami sudah sangat resah, tidak ada yang berani menindaknya,’’ kata beberapa di antara mereka, kemarin. Sementara, aparatPolresLangkatmembekuk agen kecil judi togel di Kel. Kwala BingaiStabatdenganbarangbukti tujuh lembar rekapan togel dan uang Rp672.000. Kita akan terus kembangkan, tersangka HA masih mendekam diselMapolres,’’kataKanitJudisila Polres Langkat Ipda Juriadi di sela-sela pemaparan hasil tangkapan, Rabu (30/3). (a03)

Pengusaha Galian C Kutalimbaru Vonis Bebas PANCUR BATU (Waspada): Pengadilan Negeri Klas I Pancur Batu, Kab. Deliserdang memvonis bebas pengusaha galian C Ralius Ginting, di Kec. Kutalimbaru, Selasa (29/3) sore. Ralius Ginting yang menggali tanah timbun di Dusun III Namorangkup, Desa Silebo-Lebo, Kutalimbaru, Deliserdang didampingi kuasa hukumnya Abdi NusaTarigan,SHdanYaminLubis, SH tampak tenang mengikuti persidangan. Sebelumnya, Jaksa Penuntut

Umum (JPU) Rehulina Sembiring menuntut terdakwa Ralius Ginting 1 tahun 6 bulan penjara dan denda Rp. 60 juta serta menyita dua unit alat berat bechoe miliknya. SidangyangdipimpinHakim Dany Tobing, SH dan Imanuel Tarigan sempat tertunda dua jam dari yang dijadwalkan sebelumnya. Sementara JPU Rehulina Sembiring tidak hadir pada persidangan. Hakim memvonis bebas Ralius Ginting karena dakwaan

kabur serta unsur tuntutan tidak terpenuhi. Seusai hakim memvonisnya bebas, Ralius Ginting didampingi kuasa hukumnya meninggalkan ruang sidang. Abdi Nusa Tarigan, SH bersamaYamin Lubis, SH seusai persidangan mengatakan, dari awal menerima perkara yakin kliennya bebas karena perkara tersebut dipaksakan ke pengadilan. Ditegaskannya, berdasarkan keputusanitu,diaakanmenuntut

ganti rugi atas penyitaan dua unit alat berat selama delapan bulan yangpenyitaannyatidakmemiliki alas hukum. Kerugianakibatpenyitaanalat berat tersebut cukup besar. Satu unit alat berat disewakan Rp1,5 juta per hari. Atas kerugian tersebut kita akan menuntut mantan Kapolsek Kutalimbaru AKP Bambang Rubianto, SH, Kacabjari Pancur Batu Ismed Khadafi dan JPU Rehulina Sembiring, tegas Abdi. (c02)

Truk Ekspedisi Dirampok Di Perbaungan PERBAUNGAN (Waspada): Kawanan perampok berjumlah delapan orang,Selasa(29/3) menggasak satu truk angkutan jenis colt diesel BK 8748 BJ di Jalinsum L.Pakam- Perbaungan kawasan Pasiran, 200 meter dari jembatan Sungai Ular, Kec. Perbaungan, Serdang Bedagai. Truk tersebut dikemudikan Hadoi Irwanto alias Iwan,39, dan kernet Doni,19, keduanya warga

Dusun I, Desa Aekloba Pekan, Kec. Aekuasan, Kab. Asahan. Sopir truk saat membuat pengaduan di Mapolsek Perbaungan,Selasa(29/3)sore,mengaku dia bersama Doni dalam perjalanan menuju Medan mengendarai truk colt diesel BK 8748 BJ untuk mengambil barang kelontong untuk dibawa ke Aekkanopan. Setibanyadi kawasanPasiran,

Kel Simpang Tiga Pekan, Kec. Perbaungan, Kab. Serdang Bedagai,yangselamainidijadikan tempat mangkal truk-truk luar kota, tiba-tiba truknya dipepet mobil jenis Avanza. Sopirnya berteriak menyuruh berhenti. Setelah berhenti, 8 lelaki keluar dari mobil dan memukuli mereka, memasukannya ke dalam mobil pelaku dengan tangan diikat ke belakang dan mata

ditutup lakban. Setelah pelaku mengambil uangRp800ribu,2unitHPberikut truk. kerugian diperkirakan lebih Rp110 juta, para korban ditinggal di lokasi. Saat ikatan dapat dibuka, mereka berjalan kaki ke rumah warga. Kapolsek Perbaungan AKP Marluddin, SAg, Rabu (30/3) membenarkan.(c03)

Diduga Gunakan Surat Sakit Palsu Absen Setahun, Staf BKD Tetap Terima Gaji SEI RAMPAH(Waspada): FAH,45, staf Badan Kepegawaian Daerah (BKD) Pemkab Serdang Bedagai bebas menerima penghasilan sebagai PNS, kendati yang bersangkutan hampir setahun tidak masuk kerja. Anehnya, untuk mengelabui kantor tempatnya bekerja, ia diduga menggunakan surat keterangan sakit milik Muhamad Acil,40, warga Perumahan Pondok Nusantara Marindal Medan. “Surat keterangan sakit yang digunakan FAH milik Saya,” kata Acildidampingikorbanpenipuan FAH lainnya kepada wartawan

sembari menunjukkan foto x ray miliknya, Kamis (31/3) di komplek kantor Pemkab Sergai. Ditambahkan, Diana Wahyuni Pasaribu,30, warga yang sama, ia juga menjadi korban penipuan FAH dengan modus meminjam uang sebesar Rp 35 juta dengan jaminan mobil milik orang lain. “IaminjamuangkepadaSaya dengan jaminan mobil, ternyata mobil itu milik orang lain dengan dibuktikan surat LP dari Polsek Serbelawan. Artinya mobil itu dibawa FAH dan pemiliknya melaporkan,” kata Diana yang

akrab disapa Anggi. Mereka merasa kesal dan geram karena telah menjadi korban penipuan FAH, tetapi tidak bisa dibuktikan sceara hukum, sebab tidak secarik surat yang menjadi tanda terima peminjaman uang. “Kami hanya percaya,karenaFAHberjanjiakan mengembalikan setelah sepuluh hari. Tetapi setelah ditunggutunggu malah saya dituduh menggelapkan mobil yang dijadikan jaminan oleh FAH,” jelas Anggi kesal. Kasusini,akhirnyadilaporkan para korban kepada pimpinan

instansi tempat FAH bekerja. Menurut Kepala BKD, Ahmad Zaki, sudah hampir setengah tahun FAH tidak masuk kerja karena sakit. “Ia tidak masuk kerja hampir setengah tahun lebih, dengan alasan sakit dengan dibuktikansuratketerangansakit,” terang Zaki. Sedangkan Kepala Inspektorat Pemkab Sergai, OK Hendry mengatakan akan memproses kasus ini secara internal dan menyarankan para korban membuat surat pengaduan kepada Bupati Serdang Bedagai secara resmi. (a08)

BESITANG (Waspada) : Ir alias Panjang, 34, warga Gg. Aman Link VIII, Kel. Pekan, Kec. Besitang, Rabu (30/3) sore ditangkap aparat Polsek Besitang karena terlibat dalam kasus judi toto gelap (togel). Dari juru tulis togel tersebut, polisi mengamankan barang bukti kertas tebakan angka, handphone, tas sandang, pulpen dan sejumlah uanghasilpenjualankupontebakanangka.Sesuaipengakuantersangka, selama ini ia bekerja dengan seorang bandar judi berinisial He. Ada pun upah yang diterima berdasarkan persentase dari omzet penjualan. apolsek Besitang AKP Sukerman melalui Kanit Reskrim Ipda Abdul Rahman, Kamis (31/3) mengatakan, pihaknya berupaya membersihkan daerah ini dari aktivitas bisnis judi togel dan sejenisnya. (a02)

Memiliki 1 Ons Ganja Diringkus BINJAI (Waspada) : A alias Alung, 23, penduduk Dusun I Jln Pasar Umum, Kelurahan Tandam, Kecamatan Hamparan Perak, Kabupaten Deliserdang memiliki satu ons ganja kering, Rabu (30/ 3) diringkus anggota Serse Narkoba Polres Binjai di Jalan TA Hamzah Kecamatan Binjai Utara. Kini tersangka bersama barang buktinya diamankan di Mapolres Binjai guna pengusutan selanjutnya. Kapolresta Binjai AKBP Rina Sari, Kamis (31/3) melalui Kasubag Humas AKP F Siagian, pihaknya membenarkan penangkapan itu dan menurut F Siagian kasus ini masih dikembangkan dan pihaknya berupaya akan mengejar bandar besar ganja tersebut. (a05)

Kurang Perawatan, Listrik Di P. Siantar Sering Mati P. SIANTAR (Waspada) : Akibat kurangnya perawatan terhadap jaringan maupun terhadap pohon yang mengganggu, aliran listrik PT PLN di Kota Pematangsiantar sering mati mendadak dan jangka waktu matinya sampai berjam-jam serta terjadi pada pagi, siang, sore maupun malam hari. Seringnya aliran listrik mati mendadak sangat merepotkan warga terutama kantor-kantor yang menggunakan alat-alat elektronik seperti komputer dalam bekerja. Manager PLN Cabang Pematangsiantar James H Simanjuntak saat dihubungi melalui Humas James Edward Sirait dan Manejer Rayon Siantar Kota Jonsen Aritonang di kantor PLN Pematangsiantar, Rabu (30/3) menyebutkan, seringnya listrik padam mendadak bukan akibat kurangnya daya hingga ada pemadaman bergilir. “Akibat gangguan orang-orang yang tidak bertanggungjawab, juga bisa membuat aliran listrik terganggu termasuk gangguan binatang seperti baru-baru ini di dekat kantor PLN Cabang Pematangsiantar, ada tupai liar terkena jaringan listrik hingga listrik menjadi padam,” terang Jonsen. (a30)

Tubruk Penjambret, Penarik Betor Dapat Penghargaan T. TINGGI (Waspada) : Seorang penarik beca bermotor (betor) mendapat penghargaan dari KapolresTebingtinggi karena dianggap telah berpartisipasi membantu tugas kepolisian dalam menangkap pelaku penjambetan. Penghargaan yang diberikan, Kamis (31/3) berupa sertifikat penghargaan dan hadiah uang diterima Jurnawi, 40, warga Kebun Buah, Kampung Keling, Kel. Tanjung Marulak Hilir, Kec. Rambutan, Tebingtinggi. Ayah 3 anak tersebut mengaku terharu dan berterimakasih atas penghargaan yang diperoleh tanpa disangkanya itu. Menurut informasi yang diperoleh, peristiwa penjambretan terjadi sekira sebulan lalu pukul 05:00 di Jalan KF. Tandean, Pasar Sakti, Tebingtinggi. Ketika itu korban seorang ibu rumah tangga baru pulang dari Jambi dan hendak menuju Kampung halamannya di Kecamatan Sipis-pis, Kab. Sergai. Sambil menunggu bus penumpang umum, pagi itu korban yang sedang memegang tas sandang, tiba-tiba dari sampingnya datang pengendara sepeda motor langsung merampas tas sandang tersebut. Spontan korban berteriak minta tolong. Jurnawi yang saat itu berada di depan korban melihat dan mendengarteriakanmintatolongdarikorbanspontanmendorongkan dan menabrakkan becanya ke sepeda motor pelaku hingga jatuh. Setelah terjatuh pelaku cepat-cepat bangkit, lalu melarikan diri. Sedangkan tas hasil rampokan dan sepeda motor miliknya tak sempat dibawa lari. KapolresTebingtinggi AKBPRobert HariantoWatratan didampingi Wakapolres Kompol Syafwan Khayat, Kasat Reskrim AKP Lilik Astono, KasatSabharaAKPEGintingmengatakanpenghargaanyangdiberikan kepada Jurnawi karena berpartisipasi membantu tugas polisi menangkap pelaku penjambretan. (a11)

Hari Ini, Pemkab Sergai Bayar Kenaikan Gaji PNS SEIRAMPAH (Waspada) : Berdasarkan Peraturan Pemerintah RI Nomor 11 tahun 2011 tanggal 16 Februari 2011 tentang perubahan ketigabelas atas PP Nomor 7 tahun 1977 tentang peraturan gaji Pegawai Negeri Sipil (PNS) dan surat edaran Kementerian Keuangan Nomor SE-9/PB/2011 tanggal 11 Maret 2011 tentang penyesuaian Besaran Gaji Pokok PNS, Anggota TNI dan Polri, PNS di Serdang Bedagai sudah bisa menikmati kenaikan gaji per 1 April 2011 dengan kenaikan gaji rata-rata tahun ini sebesar 10 persen. Hal ini dikemukakan Kepala Dinas Pendapatan, Pengelolaan Keuangan dan Aset (PPKA) Sergai H Agus Tripriyono, Kamis (31/ 3). (a08)

WASPADA Jumat 1 April 2011

Sumatera Utara Siswa Dan Guru SMKN 3 P. Siantar Mogok Belajar

Tiga Pemuda Diringkus Polisi, Lempari Bus LIMAPULUH (Waspada) : Satuan Reskrim Polsek Limapuluh mengungkap kasus pelemparan bus atau truk yang meresahkan masyarakat pengguna jalan Jalinsum dan menangkap pelakunya. Kepada Waspada, Selasa (29/3) Kapolres Asahan melalui Kapolsek Limapuluh AKP Bambang Rubianto menjelaskan, memang benar kepolisian telah menangkap tiga pelaku pelemparan kaca bus dan truk di wilayah hukum Polsek Limapuluh. MerekaSa alias Ha, 20t, Si alias Ai,20, dan NtM, 24, ketiganya warga Pasar Baru, Simalungun. “Pengungkapan kasus ini berawal saat ketiga pelaku melakukan aksi pelemparan di jalan lintas.Waktu itu mereka lakukan pelemparan terhadap Bus PO Medan Jaya Nopol BK 7445 DK dengan batu koral sebesar mangga yang telah disiapkan sebelumnya,” kata Bambang. (c05)

Tak Ada Toleransi Masuknya Pakaian Bekas TANJUNGBALAI (Waspada) : Kapolres Kota Tanjungbalai AKBP Puja Laksana menegaskan tidak memberikan toleransi terhadap masuknya pakaian bekas (bal) dari luar negeri ke Tanjungbalai. “Segala bentuk kegiatan melanggar peraturan seperti mengimpor pakaian bekas akan kita tindak,” ucap Kapolres, Rabu (30/3). Dikatakannya, mengimpor pakaian bekas merupakan tindakan ilegal dan dilarang pemerintah karena berdampak mematikan perekonomian industri pakaian (garmen) di dalam negeri. Untuk itu, Kapolres meminta kerjasama dengan masyarakat agar menginformasikan jika terlihat aktivitas masuknya pakaian bekas ke wilayah hukum Polres Tanjungbalai, sekaligus menekankan kepada bawahannya agar tidak terlibat dengan kegiatan ilegal tersebut. (a14/a32)

Medang Deras Juara Umum MTQ Batubara SEISUKA (Waspada) : Kecamatan Medang Deras kembali meraih juara umum pada MTQ Batubara ke-4 tahun 2011 di lapangan Otarita Asahan, Kel. Perkebunan Sipare Pare, Kec. Seisuka, Sabtu (26/3). Pengumuman pemenang dibacakan Ketua Dewan Juri Lahuddin Hasibuan pada penutupan MTQ dan Festival Nasyid juara II dan III diraih Limapuluh dan Sesuka selaku tuan rumah. Untuk dewasa putri, Nuraini, Badrus Sama. Sedangkan remaja putri Supra Tiwi (Limapuluh), remaja putra Zia Ridho Ikhwa (Limapuluh). Anak-anak putri/i, Fitri Humairah Ahmadi dan Nanda Erlambang (Medang Deras). CabangTartil putri/ i, Dina Khairani (Medang Deras) dan Mhd Iqbal (Limapuluh). Cabang MTQ Cacat Netra putri/i Sri Eka Handayani (Air Putih), Syahrul (Seisuka). (a13)

Walikota Sibolga Bantu Penderita Cirrhosis SIBOLGA (Waspada) : Walikota Sibolga HM Syarfi Hutauruk bersama Ketua TP PKK Sibolga Hj Delmeria Harun Syarfi Hutauruk dan sejumlah pimpinan SKPD menyerahkan bantuan uang kepada Rupeda br Rambe, 47, penderita Cirrhosis penyakit pembengkakan hati, Senin (28/3) di Gang Sihopohopo, Kel Aek Manis, Sibolga Selatan. Walikotaberharap,danatersebutdapatmembantubiayaperobatan Rupeda br Rambe. Sedangkan Rahimin Pasaribu, 50, suami Rupeda br Rambe mengungkapkan, penyakit yang diderita istrinya itu telah tiga tahun. Kadis Kesehatan Sibolga MYusuf Batubara yang datang bersama Walikota Sibolga menjelaskan, Sirosis hati adalah jenjang akhir dari proses fibrosis hati yang merupakan konsekuensi dari penyakit kronis hati ditandai dengan adanya penggantian jaringan normal denganjaringanfibroussehinggasel-selhatiakankehilanganfungsinya. (a24)

Hari Jadi, Sibolga Gelar Pameran Pembangunan SIBOLGA (Waspada) : Semangat Hari Ulang Tahun Sibolga ke311 pada 2 April 2011 ini tampak meriah. Tidak tanggung-tanggung, Pemko Sibolga menyambutnya dengan menggelar beragam kegiatan. Salahsatunyaadalahpelaksanaanpameranpambangunansebagai wahana penyebarluasan informasi kepada publik atau masyarakat umum sebagai konsumen dan pelaku dunia usaha atas produkproduk unggulan daerah, bisnis, teknologi dan wisata yang ada di Kota Sibolga. Walikota Sibolga HM Syarfi Hutauruk mengatakan, selain sebagai ajang informasi atas hasil-hasil pembangunan yang telah dicapai, pameran itu sekaligus untuk mengevaluasi program pembangunan di masa mendatang menjadi lebih baik. “Pameran ini juga sebagai ajang pembelajaran bagi masyarakat dalam menyerap ilmu pengetahuan dan teknologi yang ditawarkan peserta, sehingga dapat memberikan dorongan bagi pengembangan usaha kerakyatan baik yang berskala kecil, menengah, maupun besar.(a24)

LKPP Dan Pemkab Simalungun Gelar Ujian SIMALUNGUN (Waspada) : Untuk menindaklanjuti penerapan PeraturanPresiden(Perpres)nomor54tahun2010tentangpengadaan/ barang jasa, Pemkab Simalungun melalui Bagian Administrasi Pembangunan bekerjasama dengan Lembaga Kebijakan Pengadaan/ Barang Jasa Pemerintah (LKPP) Pusat di Jakarta melakukan ujian keahlian tingkat pertama/dasar. Ujian keahlian dilaksanakan di Siantar Hotel Pematangsinatar, Selasa (29/3) dengan peserta 110 PNS berasal dari sejumlah Satuan Kerja Perangkat Daerah (SKPD) Pemkab Simalungun. Menurut Kabag Administrasi Pembangunan Kabupaten Simalungun Rohben Purba, dengan adanya ujian dasar ini para peserta dapat mengikutinya dengan sungguh-sungguh dan diharapkan pula mereka dapat lulus. (a29)

Sekdes Dan Staf Camat Main Judi PARMAKSIAN (Waspada) : Tiga Sekretaris Desa (Sekdes) dan satu staf kantor Camat Parmaksian bermain judi di kantor Camat Parmaksian, Kab. Toba Samosir (Tobasa). Akibatnya, keempat orang yang berstatus PNS diamankan Polres Tobasa, Rabu (30/3). Keempat tersangka berinisial JN, 30, JM, 34, SS, 31, dan RM 49. Dari tempat kejadian polisi mengamankan barang bukti 108 lembar kartu remi berwarna biru dan uang taruhan sebanyak Rp 30 ribu. Kabag Ops Polres Tobasa, Kompol SH Siregar, Kamis (31/3) membenarkan. Saat ini para tersangka sudah diamankan di Mapolres Tobasa. Mereka akan dijerat Pasal 303 Sub 303 bis KUHP tentang perjudian dengan ancaman hukuman 5 tahun perjara. (a21)

Rumah Karyawan PMT Dolok Ilir Terbakar SERBELAWAN (Waspada): Bangunan Rumah Pondok G-II Karyawan PTPN IV Pabrik Mesin Tenera (PMT) Kebun Dolok Ilir Kecamatan Dolok Batu Nanggar, Kabupaten Simalungun, ludes dilalap api (Kamis, 31/3) sekira pukul 09.00. Menurut kalangan masyarakat, asal api belum diketahui secara pasti sehingga meluluh luntah dua bangunan semi permanen terbuat dari batu sebagian dan dinding papan. Api begitu cepat melulur bangunan ke dua rumah serta harta benda pemilik rumah termasuk satu sepeda motor. Sekira pukul 10.00 bantuan pemadam kebaran baru datang dari Perkebunan PT. Bridgestone Dolok Merangir Sumatera bangunan sudah rata dengan tanah namun api masih tetap membakar sisa barang-barang rumah yang teringgal. (c17)

B3

Waspada/Edoard Sinaga

MOGOK belajar dilakukan para siswa dan guru SMK Negeri 3 Kota Pematangsianta, Kamis (31/ 3). Mereka menuntut Kepsek dicopot akibat selama kepemimpinanya sangat merugikan para siswa dan guru.

IRT Tewas Digorok Pria Bertopeng Perhiasan Amblas SIDIKALANG (Waspada) : Aksi perampokan disertai pembunuhan sadis menggemparkan warga Jalan Perintis Gang Soalagogo Sidikalang, Kabupaten Dairi. Seorang ibu rumah tangga Clara boru Simanjuntak, 56, warga jalan tersebut ditemukan tewas mengenaskan. Lehernya digorok memanjang hingga nyaris putus. Dada juga ditikam tepat pada ulu hati. Sementara barang perhiasan berupa cincin di jari tangan serta kalung emas di leher lenyap. Menurut penduduk sekitar, korban sehari-hari bekerja sebagai pedagang pisang. Menurut keterangan di lokasi kejadian, peristiwa itu diketahui pertamakaliolehmenantukorban Novrengky Batubara, 41, saat bermaksud menjemput putranya, Johannes Batubara yang berusia

3tahun,Kamis(31/3)sekirapukul 11:00. Sehari-hari,sibuahhatidijaga nenek korban. Sedangkan Novrengky sehari-hari beraktivitas berjualan mi dan gorengan di Jalan Klasen. Novrengkykepadawartawan menjelaskan, saat tiba di rumah, dia melihat pintu depan tertutup. Suara televisi terdengar nyaring. Sebaliknya, pintu belakang menganga terbuka. Ia kaget melihat Johannes tidur tertelungkup. Pakaiannya basah kuyup. Sang ayahmembangunkan,menggendong lalu memanggil mertuanya. “Inang…inang(mertua-red)” ujar Novrengky menirukan. Ucapanitutidakbersahut.Kemudian, ia melangkah menuju kamar. Dia pun percaya ada ketidakberesan. Lemari di ruang itu sudah acakacakan. Bolak-balik ia memanggil sang mertua, tetapi tak ada jawaban. Atas kondisi itu, dia kemudian menelefon sang istri Idawaty Sinambela agar segera pulang. Tak lama berselang, Idawaty tiba tersentak histeris menyaksikan sang ibu sudah tak bernyawa.

Ditemani Novrengky, dia menceritakanbahwaduapriamengenakantopengpenutupmatamemukul dan menghabisi orangtuanya itu. Sementara tidak banyak info yang dapat diperoleh dari si bocah. Kaki kirinya terlihat luka disertai darah kering. Novrengky menambahkan, ia menemukan sebilah pisau di dekat korban. Ia tidak tahu siapa pemilik benda tajam itu. Di sana juga ada sebuah batang kopi diduga dipakai mementung. Kapolres Dairi AKBPYustan Alpiani menjelaskan, pihaknya masih melakukan olah TKP yang diikuti melakukan pemanggilan sejumlah saksi. Seputar kapasitas Johannes,disebutkandapatdigunakan untuk petunjuk. Tidak bolehdijadikansaksisebabmasih di bawah umur.Yustan bertekad mampu mengungkap kasus itu sesegera mungkin. Informasi di kepolisian, kaos warna putih penuh bercak darah ditemukan tim penyidik dari sebuah perladangan kopi sejauh 100 meter dari rumah korban. (a20)

Polsek Aek Nabara Tembak Dua Perampok Bersenpi AEK NABARA (Waspada): NurKalamaliasCharles,38,warga asal Lampung dan Supriono alias Ono, 21, warga Desa N6, Bilahhulu, Labuhanbatu, pelaku perampokan terhadap uang pembelian getah milik Muhammad Amin, warga Desa Pematang Seleng, Bilahhulu, Labuhanbatu, yang dibawa karyawannya Wahid, Kamis (31/3) terpaksa ditembak petugas Polsek Aek Nabara. Kedua rampok bersenjata api itu ditembak karena melekukan perlawanan saat akan diringkus. Duo sekawan itu terkulai tak berdaya setelah empat butir peluru tajam petugas menembus lutut kiri dan kanan mereka dalam drama penangkapan yang terjadi di kawasan Jl Besar Desa Lohsari, Kecamatan Kampung Rakyat, Labusel. Kepada Waspada ,Wahid yang ditemui di Mapolsek Aek Nabara menyebutkan, siang itu dirinya membawa uang sekitar Rp50 juta milik majikannya hendak pergi membeli getah. Di tengah perjalanan tepatnya di kawasanTitiPanjang,DesaPematang Seleng, truk yang dikenda-

rainya diserempet dua pelaku yang mengendarai sepeda motor Yamaha Vega Z bodong warna hitam. Karena tak merasa curiga, Wahidmenghentikankendaraannya untuk melihat kondisi kedua pelaku. Nahas saat membuka pintu pelaku langsung menodongkan pistol ke dadanya dan satu pelaku lainnya mengancam menggunakan pisau. Merasa terancam,Wahid lantas menyerahkan uang yang dibawanya. Setelah mendapatkan uang korban, kedua pelaku langsung tancap gas menuju kawasan Aek Nabara. Sementara korban yang masihtraumalangsungmelaporkan peristiwa itu ke polisi. “Kayak mimpilah, sepeda motor mereka memepet truk dari depan modusnya mereka senggolan, lalu saya diancam pistol,” katanya. Petugas Polsek Aek Nabara langsung melakukan pengejaran. Polisikemudianmendapatikedua tersangka di kawasan Desa N2 Aek Nabara. Melihat petugas mengejar, kedua pelaku kemudian kabur menuju Desa Lohsari. Karena terkepung, kedua

tersangka kemudian melakukan perlawanan, sehingga baku tembak pun tak terelakkan. Namun polisi ternyata lebih lihai menggunakan senjata, empat peluru bersarang di kaki keduanya. Tanpa bisa mengelak lagi, kedua pria itu dibawa ke RS PTPN 3 Aek Nabara untuk mengeluarkan peluru, setelah itu keduanya kemudian digelandang ke Mapolsek Aek Nabara untuk kepentingan penyeldikan. KapolresLabuhanbatuAKBP Robert Kennedy yang ditemui di RS PTPN 3 mengatakan, dari tangankeduatersangkapihaknya mengamankan satu pucuk pistol jenis revolver, uang, dan sepeda motor Yamaha Vega Z. Belum diketahuiapakahkeduatersangka terlibat dalam sejumlah aksi perampokan di wilayah hukum Polres Labuhanbatu, namun melihat aksinya, Kapolres menduga keduatersangkamerupakanpelaku perampokan lintas. Hingga berita ini diturunkan keduatersangkamasihmenjalani pemeriksaan di Mapolsek Aek Nabara. “Melihat aksinya mereka iniperampoklintas,”katanya.(c18)

Ambil Lahan Petani, PT SN Dan Oknum Aparat Diadukan MEDAN (Waspada) : Akibat lahan sawit diambil secara paksa, petani akan mengadukan PT SN bersamaoknumaparatkepolisian yang membacking perusahaan tersebut ke unit Propam Polres Madina. Mengingat perusahaan kelapa sawit PT SN di Kabupaten Mandailing Natal, Kec. Ranto Baek bertindak arogan dengan melakukan pengancaman kepada masyarakat dengan menggunakan oknum aparat kepolisian setempat. “Dalam hal ini kita tidak rela karena seluas 10 Ha lahan kita diambil perusahaan tersebut dengan paksa dan menakut-nakuti pekerja dan masyarakat setempat. Padahal kita sudah meminta secara baik-baik agar PT SN menghentikan kegiatan di lokasi tersebut karena bukan lahan me-

reka,” ujar H Syahruddin di Medan, Kamis (31/3). Namun, lanjutnya, pihak perusahaan dengan membawa oknum aparat kepolisian pada Rabu (30/3) mendatangi buruh yangsedangbekerjadanlangsung menyuruh dan merampas parang babat para pekerja, dan mengangkat kedua tangan serta memaksa mereka berjalan dengan cara jongkok dan menakut nakuti pekerja dengan mengeluarkan tembakan ke udara sebanyak 3 kali. “Hal ini telah menimbulkan trauma terhadap para pekerja dan petani lainnya sehingga takut untuk melakukan kegiatan dan memungkinkan menghilangkan pencariannafkamereka,”ujarnya didampingi kuasa hukumnya Firman Lubis SH. Menurut Firman Lubis SH,

pengacara di Medan bahwa tindakan tersebut telah menyalahi hukum dan berlebihan karena telah melakukan pengancaman, intimidasikepdamasyarakatyang tidak bersalah dengan menggunakan senjata yang dibiayai oleh rakyat dan negara. “Persoalannya mengapa senjata tersebut untuk mengintimidasi dan menakut-nakuti rakyat. Seharusnya aparat negara adalah untuk melindungi bukan sebaliknya membela pengusaha yang belum tentu kebenarannya sampai pengadilan memutuskannya,” ujarnya. Dalam hal ini, lanjutnya, pihaknya akan mengadukan hal tersebut ke unit Propam Polres Madina agar oknum aparat tersebutmendapattindakantegas dari institusinya dan perusahaan PT SN akan dituntut sesuai dengan hukum yang berlaku. (m38)

P. SIANTAR (Waspada): Siswa dan para guru SMK Negeri 3 Kota Pematangsiantar melakukan aksi mogok belajar dan mengajar di depan kantor Kepsek, Kamis (31/3) serta menuntut agar Kepsek dicopot, karena selama enam tahun kepemimpinannyabanyakkutipan-kutipantidakjelasyang sangat membebani para siswa. Seorang guru Hendri E Tampubolon yang dihubungi menyebutkan aksi itu mereka lakukan sesudah aksi unjuk rasa sebelumnya ke DPRD pada Jumat (11/3) menuntut Kepsek dicopot belum ada tindaklanjutnya. Menurut Tampubolon, aksi yang mereka mulai saat jam istirahat pertama itu, bersih dari kepentingan orang-orang tertentu dan tujuannya agar ada perubahan karena krisis kepemimpinan saat ini.“Akibat krisis kepemimpinan itu, hampir tiap tahun mengalami penurunan jumlah siswa yang mendaftar ke SMK Negeri 3,” katanya. Akhirnya, sesudah beberapa lama para siswa melakukan aksi, Kepsek Kartina A Batubara tampil di hadapan para siswa dan langsung disoraki.Turut mendampingi saat itu Sekretaris Dinas Pendidikan Masur Sinaga mewakili Kadis Pendidikan Setia Siagian, Kabag Humas dan Protokoler Pemko Daniel H Siregar, Timbul Panjaitan, SPd dari PGRI serta beberapa orang guru. Beberapa siswa yang diberi kesempatan berbicara menyebutkan saat mendaftar masuk, ada perjanjian tidak dikutip biaya apa-apa, tapi ternyata sesudah masuk, tiba-tiba datang surat kepada siswa untuk membayar biaya observasi Rp 300.000 tanpa persetujuan orangtua maupun rapat dengan orangtua. “Ini tidak adil, kami sebenarnya tidak sanggup

membayar, tapi akibat dipaksa, terpaksa kami membayarnya,” teriak satu siswa. Siswa lainnya menyatakan saat pertama masuk sudah diberi symbol Sekolah Berstandar Internasional (SBI) dan dipaksa dibayar Rp7.000, tapi ada yang mengatakan menjadi Rintisan SBI (RSBI) saja belum layak, karena sekolahnya mirip kandang ayam. “Menulis saja masih pakai kapur tulis dengan papan tulis warna hitam, sedang sekolah yang tidak RSBI saja sudah memakai white board dan menulis dengan spidol.” Kemudian, ada siswa mengungkapkan SMK Negeri 3 sudah mengutip uang praktek kerja lapangan (PKL) Rp125.000, namun tempat PKL masih mengutip biaya PKL lagi dari siswa PKL Rp50.000 per siswa dan siswa lain menanyakan mengapa kenaikan uang Komite Sekolah tidak melalui rapat, tapi langsung ditetapkan sendiri serta mempertanyakan untuk apa uang insidentil yang dikutip dari para siswa. Kepsek SKM Negeri 3 mengatakan, observasi perlu dilakukan seperti kondisi hotel perlu dilihat melalui observasi hingga memerlukan biaya, membantah biaya pendidikan selalu mengalami kenaikandansudahbeberapatahuntidakpernah naik. Mengenai SBI, Kepsek menyebutkan, SMKN 3 masih disiapkan dan akan dievaluasi tahun 2013 dan menuju SBI itu peralatan akan datang tahun 2011 ini. Tentang dana UKN, Kepsek membantah ada bantuan dari pemerintah dan mengenai dana komite akan dipertanyakan kepada Komite Sekolah serta sudah diserahkan ke Inspektorat Pemko. (a30)

Pelaksanaan MTQN Ke-42 Kota P. Siantar Memprihatinkan P.SIANTAR,(Waspada): Pelaksanaan MTQNasional ke 42 tingkat kota Pematangsiantar yang dimulai 30 Maret dan berakhir 2 April 2011 di lapanganUSIjalanSMRajaBarat,Pematangsiantar telah memberikan kesan sangat memprihatinkan dan semakin mundur jika dibanding dengan kegiatan pada tahun sebelumnya. “Pelaksanaan MTQ tingkat kota Pematangsiantar tahun ini sangat memprihatinkan,” sebut Rizky Amanah PN Siregar, mahasiswa Fakultas Hukum USI kepada Waspada, Rabu (30/3). Pernyataan prihatin juga dikemukakan sejumlah ustadz,pengurus masjid dan organisasi Islamdikotaitu,saatmenghadiriacarapembukaan yangdilanjutkandenganpelaksanaanmusabaqah hari pertama, Rabu malam itu. Disebutkan, pelaksanaan kali ini lebih buruk dibanding dengan pelaksanaan yang digelar di tingkat kecamatan-kecamatan sebelumnya. Masalah tempat pagelaran, di lapangan ‘becek’ di halaman kampus USI yang selama ini dijadikan sebagai lokasi parkir kendaraan pada acara-acara di universitas itu. Sementara lapangan yang ada di tempat itu, tidak dapat izin untuk digunakan. Padahal,sebelumnyasudahmenjadikebiasaan, pelaksanaan MTQ nasional tingkat Kota Pematangsiantar tetap dilaksanakan di jantung kota tepatnya dilapangan haji Adam Malik di kota itu.Tidak diketahui konsep kerja Walikota Pematangsiantar, Hulman Sitorus dan wakilnya, Koni Ismail Siregar,sehingga,tahun ini tempat pelaksanaan MTQ sepertinya sengaja jauh ‘dibuang’ ke daerah pinggiran. Selanjutnya,masyarakatyanginginmengikuti kegiatanmusabaqahmengalamihambatandalam haltransportasikelokasikegiatan,karenaangkutan umum, tidak lagi beroperasi setelah pukul 18:00 ke tempat itu. Sehingga dapat dilihat, pengunjung yang hadir pada malam pertama musabaqah dapat dihitung dengan jari tangan. Demikianjugauntukkalanganpejabatmuslim yang ada di Pemko Pematangsiantar, juga yang tampak hanya satu doa orang saja seperti Jumadi,SH (Asisten II) dan Kabag Sosial, Agus Salam Harahap. Sementara Wakil Walikota Drs Koni Ismail Siregar, selaku wakil dari Pemko Pematangsiantar setelah acara pembukaan, Rabu sore, tidak pernah muncul di tempat pelaksanaan. Keprihatinan pelaksanaan MTQ Nasional ke 42 tingkat kota Pematangsiantar semakin lengkap dengan perbuatan PT (persero) PLN Pematangsiantar yang memadamkan aliran listrik ke lokasi kegiatan MTQ tersebut sebanyak dua kali.

Pemadaman pertama terjadi saat acara pembukaan sehingga acara sempat terhenti selama setengah jam lebih. Pemadaman ke dua terjadi lagi,beberapa saat menjelang pelaksanaan musabaqah, tepatnya pada pukul 19:00, yang waktunya cukup panjang. Humas PT (persero) PLN cabang Pematangsiantar James E Sirait yang dihubungi Waspada, Kamis (31/3), membenarkan terjadinya pemadaman listrik sebanyak dua kali.Dan hal itu terjadi, sebut dia, akibat adanya kerusakan pada peralatan listrik yang ada di sekitar jalan Singosari dengan jalan Bali Pematangsiantar. Menurut Sirait, pihaknya sudah mengkoordinasikanmasalahlistrik,terutamakedaerahtempat pelaksanaan MTQ Nasional tingkat Kota Pematangsiantar yang digelar di jalan SM.Raja Barat Pematangsiantar. “Mudah-mudahan tidak ada lagigangguanlistriksampaikegiatanMTQselesai,” sebut Sirait. Pelaksanaan MTQ itu dipusatkan di lapangan Universitas Simalungun USI di Jalan Sisingamangaraja, Kelurahan Bukit Sofa, Kecamatan Siantar Sitalasari dan secara resmi dibuka Walikota Pematangsiantar Hulman Sitorus, SE yang ditandai dengan pemukulan beduk sebanyak 42 kali, Rabu (30/3) sore. Pembukaan MTQ itu diawali pembacaan ayat suci Al-Quran dari H. Hasman Simbolon dan laporan Ketua Panitia Pelaksana MTQ Djumadi SH, yang menyebutkan tujuan diselenggarakannya MTQ itu sebagai persiapan utusan peserta dari Pematangsiantar untuk mengikuti seleksi MTQ tingkat Propinsi Sumut yang akan diselenggarakan pada 30 April sampai 5 Mei 2011 di Asrama Haji Pangkalan Mahsyur Medan serta meningkatkan minat masyarakat mempelajari, mendalami dan mengamalkan isi ayat-ayat Suci Al-Qur’an khususnya di Pematangsiantar. Ketua Panitia menambahkan MTQ itu berlangsung selama empat hari yang dimulai 30 Maret sampai 2 April 2011 dengan lokasi pertandinganadadiduatempatyaknikompleklapangan USI dan Madrasah Ibtidaiyah Negeri (MIN), peserta yang mengikuti MTQ merupakan utusan dari delapan kecamatan dengan jumlah peserta 238 orang terdiri dari Kecamatan Siantar Barat 49 orang, Siantar Timur 33 orang, Siantar Utara 34orang,SiantarSelatan25orang,SiantarSitalasari 29 orang, Siantar Marimbun 21 orang, Siantar Marihat 17 orang, dan Siantar Martoba 30 orang. Semua peserta itu mengikuti semua cabang yang akandiperlombakanyaknicabangTilawah,Tahfiz, Tartil, Syarhil, Fahmil, dan Khattil.(c16/a30)

Polres Dairi Tangkap Tiga Pemain Togel SIDIKALANG (Waspada): Polres Dairi, kembali menangkap tiga orang pemain judiTogel (toto gelap) dan dua pemain judi Jackpot dari tempat berbeda, Rabu (30/3). Hal itu dijelaskan Kapolres, AKBP Yustan Alpiani melalui Kasat Reskrim,AKP Anjasmara Siregar didampingi Kaurbin, Ipda,SP Siringoringo, kepada Waspada,Kamis (31/3). Menurut Anjasmara, tiga pemain togel yang ditangkap antara,RS,48 (juru tulis),warga Dusun Parratusan, Desa Pegagan Julu III, Kecamatan Sumbul.AR,20 (tukang rekap),warga jalan Mereka

Sumbul dan PT,30 (Bandar) warga jalan SM.Raja Sumbul kecamatan Sumbul. Dari tangan tersangka,diamankan barang bukti berupa uang tunai sebanyak Rp 105 ribu,satu unit HP, dua blok kupon, satu hekter dan 18 lembar kode bahasan togel. Pada hari yang sama,dua pemain judi mesin jackpot diamankan yakni MS,40 (pengusaha Jackpot) dan MP,23 (pemain).Keduanya warga Desa Huta Rakyat, Kecamatan Sidikalang, kata Anjasmara. (a20)

Truk Kontra Mobil Pribadi, 2 Wanita Patah Tangan dan Kaki P. SIANTAR (Waspada): Mobil dump truk Mitsubishi Fuso BK 8962 BQ diduga bertubrukan kontra satu unit mobil pribadi Daihatsu Xenia BK 1525 TV hingga mengakibatkan dua wanita patah tangan dan kaki. Keterangan dihimpun menyebutkan tubrukanantarakeduakenderaanituterjadiditikungan manis di jalan umum Pematangsiantar-Seribudolok, Huta Iling, Nagori Merek Raya, Kecamatan Raya, Kabupaten Simalungun pada Rabu (30/ 3) pukul 09:30. Dua wanita yang mengalami patah tangan dankakimerupakanpenumpangmobilDaihatsu Xenia terdiri Rasmina Okta Manalu, 56, warga Perumnas Batu Enam, Kecamatan Siantar, Simalungun mengelami patah tangan kiri dan Salmah Sinaga, 54, warga Kelurahan Pematang Tanah Jawa, KecamatanTanah Jawa, Simalungun mengalami patah kaki kanan. Satu lagi penumpang mobil Daihatsu Xenia, Lenni Prajawati Manurung, 28, warga sama dengan Salmah Sinaga dan disebutkan berprofesi sebagai bidan turut mengalami luka-luka di beberapabagiantubuh.Sesudahmendapatperawatan sementara di Puskesmas Merek Raya, para korban dibawa ke RSUVita Insani, Kota Pematang-

siantar untuk mendapat perawatan intensif. Mobil Daihatsu Xenia yang dikemudikan seorang pria marga Manurung meluncur dari arah Pematangsiantar menuju arah Pematang Raya, sedang mobil dump truk datang dari arah berlawanan. Ketika tiba di tekongan manis itu, diduga kedua mobil itu mengambil jalan terlalu ke kanan hingga bagian kepala sebelah kanan masing-masing mobil bertubrukan. Sesudah kejadian itu, pengemudi mobil Daihatsu Xenia dan mobil dump truk diduga melarikan diri, karena tidak ditemukan sesudah kejadian. Kanit Laka Polres Simalungun Ipda Alsem Sinaga dan Kapos Lantas Raya Aiptu I. Sidabutar bersama sejumlah personil kepolisian turun ke TKP sesudah mendapat informasi tentang kejadian itu dan mengamankan kedua mobil ke Sat Lantas Polres Simalungun, sedang para korban dibawa berobat ke Puskesmas Raya sebelum akhirnya dibawa ke rumah sakit di Pematangsiantar. Kapolres Simalungun AKBP Drs. Marzuki, MM saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak, Kasat Lantas AKP Baginda Sitohang dan Kanit Laka Ipda Alsem Sinaga menyebutkan kejadian itu masih dalam penyelidikan.(a30)

Sumatera Utara

B4 STKIP Tapsel Gegerkan PTS Se Aceh-Sumut P.SIDIMPUAN(Waspada):PrestasitigaanakSTKIPTapselgegerkan dunia PTS se-Aceh-Sumut melalui perlombaan Olimpiade sains, hingga meraih juara. Ketiga mahasiswa yang sedang duduk di semester VI itu, Rini Anggraiani Pakpahan program studi pendidikan Fisika mendapati juara I, Nenni Suryani Program studi pendidikan Biologi meraih juara II dan Dikky Juliansyah Nasution pada studi Matematika meraih juara Harapan III. Perlombaan Olimpiade Nasional Metematika dan Ilmu Pengetahuan Alam yang dilaksanakan Koordinator Perguruan Tinggi Swasta (Kopertis PTS) se-Provinsi Aceh dan Sumatera Utara di Medan dimulai 21 sampai 26 Maret hingga ketiga mahasiswa tersebut mendapati juara masing-masing tiap program studi diperlombakan oleh panitia. Demikian diungkapkan Ketua STKIP Tapanuli Selatan DR H Ali Pada Harahap bersama Ketua Yayasan H Syahrul Hadi Lubis melalui Sahiddin Batubara, dosen Program studi Matematika di kampus biru STKIP Kota Padangsidimpuan, Kamis (31/3). Sahiddin mengungkapkan, ketiga mahasiswa akan mengikuti seleksi tahap II pada 30 hingga 31 maret 2011. Selain itu, pimpinan STKIP dan Rektorat mengatakan, prestasi yang diraih mahasiswanya merupakan bukti nyata dari hasil proses belajar yang selama ini berjalan baik dengan kerjasama seluruh civitas akademik di STKIP. (c13)

Dua Pengecat Ruko Tersengat Listrik PEMATANGSIANTAR (Waspada): Saat mengecat bangunan Ruko Apotek Bersama di Jalan Sutomo, Kota Pematangsiantar, Selasa (29/3) pukul 11:00, dua pekerja, korban Joni, 43, dan Anto, 40, nyaris meregang nyawa akibat kesetrum aliran listrik bertegangan tinggi melalui kabel listrik PLN yang berdekatan dengan Ruko. Keterangan dihimpun dari saksi mata Dedi Sianturi, 32, tukang parkir di lokasi Ruko, menyebutkan, peristiwa itu terjadi ketika kedua wargaKelurahanMelayu,KecamatanSiantarUtaraitusedangmengecat dinding ruko lantai dua dan tiga. Keduanya sengaja menggunakan tangga gantung yang terbuat dari besi untuk memudahkan menjangkau seluruh bagian dinding atas. Menurut Dedi, saat itu, salah seorang pekerja hendak memindahkantanggagantungkedindingberikutnya.Namun,pekerja itu tidak mewaspadai kabel hitam yang mempunyai aliran listrik bertegangan tinggi hingga ketika tangga dipindahkan dan menyentuh kabel listrik itu, tiba-tiba muncul seperti semburan cahaya kemerahan layaknya api dan membuat kedua pekerja terpental. Korban yang jatuh ke bawah dilarikan ke IGD RSUD Dr Djasamen Saragih yang hanya berjarak 100 meter dari lokasi kejadian. (a30)

Kemenag Karo Gelar Festival Anak Shaleh KABANJAHE (Waspada): Kantor Kementerian Agama (Kemenag) Kabupaten Karo bekerjasama dengan Pengurus Daerah Jaringan Pemuda dan Remaja Masjid Indonesia (JPRMI) Kabupaten Karo menggelar Festival Anak Shaleh di Hotel Enasti Berastagi, Selasa (29/3). Perlombaan yang dikhususkan bagi anak-anak berusia 6-12 tahun itu berlangsung meriah, yakni lomba praktik ibadah shalat, hafalan doa-doa pendek dan menceritakan kisah inspiratif bernuansa Islami. Kepala Kantor Kemenag Kabupaten Karo Mardinal Tarigan mengharapkan agar festival tersebut bisa menjadi ajang pendidikan sekaligus perlombaan bagi anak-anak di Kabupaten Karo, dalam mengamalkan ajaran Islam secara utuh. Sebagai juara 1 adalah Zuhaili Izlyn Silalahi, Juara II Agam Achmad S dan Juara III Riyan Alfiandi. Kemudian, Harapan I Dea Puspitasari, Harapan II Nabila Nur Chairiza dan Harapan III Nadila Azzahra. Mereka mendapatkan tropi, piagam penghargaan dan uang pembinaan. (c09)

Ditipu Penelefon Gelap P. SIANTAR (Waspada): Penipuan bermodus menelefon dengan mengabarkan anak/keluarga korban melakukan pembunuhan, muncul di Kota Pematangsiantar. Hal itu dialami Lamria Panggabean, 56, warga Jalan Samosir, Pematangsiantar. Dia menerima panggilan telefon dari seseorang menjelaskan anaknya bernama Anton Silaban membunuh seseorang di Pangururan, Kabupaten Toba Samosir, dan memerlukan uang jutaan rupiah. Keterangan dihimpun dan pengaduan korban di Polres Pematangsiantar, Selasa (29/3) menyebutkan, pria yang mengaku sebagai anak korban itu menyebutkan guna mengamankan dirinya, dia meminta uang Rp2 juta. Korban saat itu hanya memiliki Rp1,5 juta. Kemudian, pria itu mengatakan agar uang itu dikirim ke nomor rekening 0113.01. 050540.50.4 atas nama Ariaman Saputra. Tanpa berpikir panjang, korban langsung pergi ke BRI Unit Jalan Marihat dan mengirimkan uang Rp1,5 juta itu ke rekening itu. Sesudah mengirim uang itu, korban langsung menghubungi anaknya untuk memberitahukan, uang itu sudah dikirimnya. Namun, anak korban merasa terkejut pada saat korban memberitahukan pengiriman uang itu dan menyatakan itu penipuan. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, Rabu (30/ 3) menyebutkan pengaduan korban masih dalam penyelidikan. (a30)

Taput Butuh Rp113 M Untuk Pembukaan Dan Pemeliharaan Jalan TARUTUNG (Waspada) : Pemerintah Kabupaten Tapanuli Utara (Taput) hingga saat ini masih tetap menggulirkan program prioritasnya dalam hal penanganan infrastruktur jalan yakni membuka jalan ke daerah-daerah terpencil dan sentra produksi pertanian. Berikutnya pemeliharaan jalan-jalan yang sudah ada khususnya yang menghubungkan desa dengan ibukota kecamatan dan kecamatan ke kabupaten dengan kebutuhan dana sekitar Rp113 miliar. Demikian upati Tapanuli Utara melalui Kepala Dinas Pekerjaan Umum (PU) Anggiat Rajagukguk MM ketika diwawancarai wartawan baru-baru ini di kantornya. Anggiat Rajagukguk menjelaskan, setiap tahunnya PemkabTaput membutuhkan dana sekira Rp72 miliar untuk pemeliharaan jalan kabupaten yang saat ini panjangnya mencapai 1.063 km. “Ini merupakan kebutuhan dana ideal setiap tahun. Namun kebutuhan ini belum dapat terpenuhi karena keterbatasan dana kabupaten yang selama ini bersumber dari Dana Alokasi Umum (DAU) dan Dana Alokasi Khusus (DAK),” sebut Anggiat. Katanya, kemampuan daerah untuk menutupi kebutuhan dana sebesar Rp72 miliar setiap tahunnya, baru dapat dipenuhi sekira Rp15 miliar dari sumber dana DAU dan DAK. Sementara dana pendukung yang diharapkan bersumber dari APBN tidak dapat dipastikan nominalnya karena setiap tahun selalu berubah. (a21)

mangat memimpin Deliserdang. Begitu juga Suku Karo, Tapanuli dan Nias dari unsur gereja HKBP, GBKP, GKI, GBI, GKI, BNKP, GPDI dan Katolik se Kecamatan Pancur Batu dan Sunggal dipandu Lamhot Raja Gukguk dan A Sihombing yang keseluruhannya mendukung sepenuhnya kegiatan MTQ dan FSN itu. Hal tersebut dilakukan oleh multi etnis dan agama sebagai bukti terpeliharanya kerukunan antar umat beragama di Kabupaten Deliserdang. Dukungan

Jumat 1 April 2011

Sanksi Kemenkeu Memprihatinkan MEDAN (Waspada): Masuknya Kabupaten Padanglawas dalam daftar daerah yang mendapat sanksi penundaan alokasi DAU 2011 membuktikan kondisi kemampuan Pemkabnya makin memprihatinkan dan memalukan. Demikian tanggapan aktivis Badko HMI Sumut Ansor Harahap yang juga Ketua Gema Palas, yang disampaikannya kepada Waspada di Medan, Rabu (30/ 3). Menurut pendapat Ansor, dengan kondisi itu Padanglawas telah mempertontonkan kepada publik dan pemerintah pusat tentang tidak seriusnya Pemkab menjalankan anggaran. Sanksiini,katadia,akibatdaya serapAPBD2010rendahdanmengalami keterlambatan. Realisasi PP 41 tentang Susunan Formasi dan Tata Kerja Perangkat Daerah tidak berjalan sebagaimana mestinya. ‘’Kemudian, keterlambatan menyampaikan RAPBD 2011

sesuai batas waktu yang ditentukan pusat, membuktikan lemahnya kemampuan aparatur merencanakan, merealisasikan dan mengontrolanggaran,’’kataAnsor. Disebutkannya pula, persoalan pokok dan paling mendasar adalah lemahnya kepemimpinan Padanglawas sehingga menimbulkan persoalan itu. Kemudian, fungsi DPRD juga tidak berjalan dalam melakukan fungsi kontrol, legislasi dan budgetingnya dalam mendorong efisiensi dan efektivitas penyelenggaraan anggaran oleh eksekutif. ‘’Kemauan dan kontrol politik DPRD Padanglawas lemah,’’ tegasnya. Di samping itu, lanjutnya, dampak yang terjadi hari ini tidak terlepas akibat tidak jelasnya program pembangunan yang dijalankan pemerintah. Disebutkannya pula, Musyawarah Perencanan Pembangunan (Musrenbang) dari tingkat bawah tidak berjalan, terkontrol dan terkendali dengan baik. Juga,

realisasi sistem atau peraturanperaturan daerah Padanglawas yang belum pada letak dan tata yang baik. Sementara, ujar Ansor lagi, hubungan eksekutif-legislatif bukansalingkontributifsungguhsungguh untuk pembangunan. Sedangkan daya kritis dan sumberdayamasyarakatPadanglawas untuk meneropong tindak-tanduk pemerintah masih rendah dan lemah. Makanya, akibat dari semua ituakhirnyaPadanglawasmenuai masalah hingga sanksi. Salah satunya,sanskidariMenteriKeuangan dengan menunda DAU 25 persen bagi Kabupaten Padanglawas. Meski bukan hal yang baru terjadi di daerah di Indonesia, tambahnya, tetapi bagi Padanglawas sebagai kabupaten baru yang butuh pembenahan dan kesungguhan pembangunan tentu itu sebuah preseden yang memalukan dan memilukan.(m34)

Selambat-lambatnya Awal April Dana BOS Akan Dicairkan SIBUHUAN (Waspada) : Selambat-lambatnya awal April dana Bantuan Operasional Sekolah (BOS) akan dicairkan. Menurut hasil koordinasi dengan Dinas Pendapatan Kabupaten Padanglawas, Kamis (31/3) mulai dicairkan. DemikianmanajerBOSDinas Pendidikan kabupaten Padanglawas,PardameanHasibuan,SPd, Kamis (31/3), menyusul keterlambatan pencairan dan penyaluran dana BOS triwulan pertama yang kini sudah hampir berakhir. Keterlambatan itu.terjadi di-

akibatkan perbedaan teknis pelaksanaan penyaluran dana BOS yang sekarang dimasukkan ke Anggaran Pendapatan dan Belanja Daerah (APBD). Sementara di Kabupaten padanglawas dan beberapa daerah di Sumatera Utara mengalami keterlambatan dalam penyelesaian APBD. Dikatakan dana BOS yang akan disalurkan di Padanglawas untuk triwulan pertama, untuk SD negeri dan swasta sebesar Rp.3.530.275.000, dengan jumlah siswa 35.898 orang. sedang dana BOS untuk SMP negeri sebesar

Rp.930.610.000 dan SMP swasta sebesar Rp. 93.370.000, untuk 7.187 siswa SMP negeri dan swasta. Kadis Pendidikan kabupaten Padanglawas, Ali Irfan Hasibuan, SPd menekankan agar para kepalasekolahpenerimadanBOS agar memanfaatkan anggaran seefisien mungkin sesuai aturan. Selain itu, bagi sekolah yang akan menggunakan dan BOS untuk pembelian buku agar benar-benar membeli buku yang berkualitas standar nasional, katanya. (a33)

SMAN 5 P. Sidimpuan Terapkan Teknik Informasi Komunikasi P. SIDIMPUAN (Waspada) : SMA Negeri 5 Padangsidimpuan akan merapkanTeknik Informasi Komunikasiuntukmeningkatkan kualitas pendidikan, karena penguasaan teknologi saat ini merupakan keharusan, bila kita tidakmampumengikutiperkembangan akan tertinggal. Demikian Kepala SMA Negeri 5 Padangsidimpuan H Suhaimi Harahap, Kamis (31/3). Sebenarnya, kata Suhaimi, dalam menerapkan rencana ini cukup berat, mengingat biaya cukup besar, kemudian para guru juga banyak yang gagap TI. Dalam penerapan teknologi informasi ini, sudah dimulai di

SMA Negeri 5 secara bertahap, dalam waktu dekat ini tiga lokal belajar akan dilengkapi infokus, sebelum sampai ke tahap itu seluruh jendela sekolah harus di lengkapi jerjak besi pengaman, sehingga tidak mudah dicuri orang. “Kita akan melangkah setahap demi setahap sesuai kemampuandana,sehinggaseluruhlokal belajar yang 15 unit bisa dilengkapi, sebelum sampai ke tahap penggunaanparagurujugaharus belajar. Menyinggung kesulitan yang dihadapi, mengingat sebagian besar guru belum menguasainya, menurut Harahap yang sudah

Kejatisu Diminta Usut Proses Lelang Dana Bantuan Bencana Alam Paluta MEDAN (Waspada) : Kalangan rekanan yang mengikuti tendermemintaKejaksaanTinggi Sumut mengusut proses lelang dana bantuan bencana alam di Padanglawas Utara (Paluta) karena tidak sesuai Pepres 54Tahun 2010. “Proses pelelangan itu dianggap cacat hukum,” kata Kuasa Direktur CV Duta Utama Sumatera Hariman Tua Dibata Siregar kepadawartawandiMedan,Senin (28/3). Dijelaskan, banyak kerugian negara yang ditimbulkan dalam proses pelelangan dana bantuan bencanaalamdiPaluta.“Rekanan yang mengajukan penawaran terendah tidak dimenangkan, malah tawaran tertinggi yang dimenangkan panitia lelang,” jelas Siregar. Selain itu setiap sanggahan yang dilayangkan rekanan ke panitia lelang, tapi yang menjawab sanggahan pejabat yang membuat komitmen. “Menurut Pepres54Tahun2010,yangmenjawab balasan sanggahan dari rekanan seharusnya panitia lelang atau unitlayananpengaduan,”jelasnya. Alasannya lanjut Hariman, karena sanggahan yang dibuat rekananditujukankepadapanitia lelang, bukan pejabat pembuat komitmen yakni pejabat Pemkab Paluta. Menurut Hariman, seperti sanggahan yang dilayangkan CV Duta Utama Sumatra (DUS), CV

Chintya Agung (CA), yakni sanggahan pengumuman pemenang lelang pekerjaan rehab/rekonstruksi jalan jurusan Sitonon Gunung Sormin batas Kab. Labuhan Batu (paket 2)danPTCA,CVDUS yang mengikuti (Paket I) yakni Rehab/rekonstruksi jalan jurusan Aek Kundur-Aek Simanat, 11 Februari 2010. Perusahaan pemenang adalah perusahaan dengan penawaran yang lebih besar dibandingkan beberapa perusahaan lainnya. CV DUM dengan penawaran rendah yakni Rp681. 911.000 dan CV CA Rp659.770. 000, tidak layak dijadikan pemenang. Malah CV Sinar Mutiara Madina dengan penawaran Rp746.100.000 yang jauh lebih besardijadikanpemenang.“Kalau yang penawaran rendah dimenangkan bisa menghemat uang Negara,” jelas Hariman Siregar. Begitu juga dengan Paket I, CV CA menawarkan Rp699. 540.000, CV DUS menawarkan Rp721.608.000.Yang dimenangkan panitia lelang CV BatangTura yang melakukan penawaran tinggi Rp795.200.000. CV CA membuat sanggahan, penetapan pemenang harus memuat sekurang-kurangnya nama paket pekerjaan dan nilai total HPS, nama dan alamat penyedia serta harga penawaran atau harga penawaran terkoreksi, nomor pokok wajib pajak dan hasil evaluasi penawaran.(m39)

Kerukunan Umat Beragama Di DS Terpelihara LUBUK PAKAM (Waspada): Pembukaan MTQ ke-44 dan FSN ke-33 Deliserdang di Lapangan DesaTanjung Anom, Kec. Pancur Batu, Senin (28/3) luar biasa. Pasalnya sejumlah elemen masyarakat yang terdiri dari suku Tapanuli (Toba Sahuta) dipandu H Amir Siahaan menyerahkan beras yang dijunjung menggunakan sumpit (Tandok) sebagai ‘Sipirnitondi’ kepada Bupati Deliserdang H Amri Tambunan dan Ketua TP PKK Hj Anita Amri Tambunan agar tetap berse-

WASPADA

yang dilakukan oleh multi etnis dalam pelaksanaan MTQ dan FSN ini menumbuhkan keyakinan segenap program Bupati Amri Tambunan seperti Konsep Cerdas, program GDSM, Ceria dan Bedah 10 ribu unit rumah tidaklayakhunididukungseluruh elemen masyarakat. Bupati Deliserdang H Amri Tambunan dalam setiap kegiatan Pemkab Deliserdang selalu mengimbau agar elemen masyarakat Deliserdang meningkatkan rasa kekeluargaan, kebersamaan

danmeningkatkantoleransiumat beragama ternyata membuahkan hasil. MTQdanFSNtingkatDeliserdang diawali pawai taaruf hingga menjelang pembukaan dimeriahkan dengan Marching Band Perguruan Husni Tamrin, Yon Armed, Al Wasliyah dan Methodist, pasukan berkuda dari Kec. Tanjungmorawa,Tari Sigale-gale dari Delitua, kuda lumping dan reok pono rogo dari Lubuk Pakam dan Barongsai dari Methodist Pancur Batu. (c02)

termasuk Kepala Sekolah senior di Padangsidimpuan itu, sekolah sudah menyiapkan Pusat Sumber Belajar Berbasis Teknologi Informasi Komunikasi (PSBTIK) yang diasuh para guru yang sudahmenguasaiTIsebagai tempat belajar. Saat ini dari 56 guru yang ada, setiap hari berkisar 6 atau 8 guru belajar secara kontinu, cara belajarnya tidak dipaksakan. Contohnya hari ini cukup menghidupkanataumematikan,besok cara masukkan CD dan seterusnya, “Bila sarana TI bisa kita lengkapi saya yakin anak anak kota Salak tidak akan kalah bersaing dengananak-anakdarikotabesar lain di Indonesia. Sebab jika merunut ke belakang sampai era 80an, masih banyak siswa Padangsidimpuan yang menonjol, kemudian di satu saat mendapat kedudukan yang bergengsi, ujar Suhaimi. (a26)

Waspada/Syarif Ali Usman

Kondisi lapisan aspal di jembatan menuju Desa Sipagabu, Kec. Aek Nabara, Barumun, Palas

Gunungtua-Binanga ‘Pesaing’ Aek Latong WARGA Kabupaten Padanglawas Utara punya hak sama dengan warga lainnya di Indonesia ini. Termasuk hak untuk menikmati hasil pembangunan seperti perbaikan ruas jalan yang rusak parah antara Gunungtua dengan perbatasan daerah di Binanga. Kata-kata itu masih terngiang di telinga, padahal yang melontarkannya sudah meninggal dunia. Dialah almarhum Ashar Efendi Hasibuan, anggota DPRD Paluta dari daerah Kec. Simangambat. Semasa hidupnya dan menjabat anggota DPRD, Ashar cukup kritis mengenai persoalan infrastruktur jalan yang rusak parah. Seperti hancurannya jalan provinsi jurusan Gunungtua, Kab. Paluta, ke Binanga, Kab. Padanglawas. Tapi jalan dari Simpang Portibi sampai ke Binanga sampai sekarang masih tetap dipenuhi lubang menganga. Begitu masuk simpang Portibi, lubang besar di kiri, kanan, dan tengah badan jalan sudah menyambut pengendara. Dari sini sopir harus mulai ekstra hati-hati, karena tidak semua badan jalan bisa dilalui dengan mulus. Bila sopir truk kurang hati-hati, bisa-bisa baru sekitar 200 meter berjalan sudah mengalami patah as roda. Seperti yang dialami truk pengangkut alat-alat elektronik dari Jakarta beberapa bulan kemarin.Sedangkanpengendaramobilkecilseperti mobil pribadi, selain menghindari patah as roda juga harus pandai memilih jalan yang 98 persen dipenuhi lubang. Di jalan yang membentang di Kecamatan Padang Bolak, Portibi, dan Barumun Tengah ini banyak juga lubang yang sangat lebar. Paling menakutkanmelintasinyaketikaturunhujanderas. Lobang besar dan dalam akan dipenuhi air, sehingga sulit untuk mengedalikan roda kenderaan agar tidak terperosok. Wajar saja jika warga luar daerah Paluta dan Palas yang melintas disana menyebut kerusakan ruas jalan ini sebanding dengan ruas jalan Aek Latong. Kerusakan jalan yang sangat parah juga terjadi di sepanjang jalan provinsi jurusan Gunungtua ke Langga Payung, Kabupaten Labuhanbatu Selatan. Semua ini berada di wilayah Kab. Paluta yang pemekarannya dari daerah induk Tapanuli Selatan disahkan melalui UU No.37 tahun 2007. Menjelang jembatan Portibi kerusakan jalan sangat parah. Terkadang kendaraan tidak bisa melewatinya karena banyak kubangan. Aspal jalan telah berubah menjadi lumpur dikala hujan dan jadi debu disaat kemarau. Terkadang kemacetan panjang terjadi di jalur itu. Kadang-kadang terlihat ada aktivitas menutup lubang dengan tanah di jalan itu, namun tidak bertahan lama. Jalan provinsi jurusan GunungtuaBinanga dan Gunungtua-Langga Payung merupakan jalur lintas tengah Sumatera. Di Aek Nabara, Jadi Biang Kemacetan KerusakanJalanprovinsimenjadibiangutama kemacetan lalulintas di Kecamatan Aek Nabara Barumun. Kerusakan terparah berada di Gapuk,

Desa Paran Julu. Saat melintasinya, pengemudi khawatir akan keselamatan jiwanya dan kendaraannya. Kerusakan itu berada tepat di Km 22 jalan jurusan Gunungtua-Sibuhuan. Badan jalan mencekung, menciptakan rawa sepanjang 10 meter, luasnya persis selebar badan jalan, dan berkedalaman 60 centimeter. Badan jalan yang rusak itu persis di antara dua tikungan yang terlihat seperti huruf ‘S’. Bagi pengendarayangtidakekstrahati-hati,kendaraannya sangat sering terjerembab ke dasar lubang. Seperti Sabtu (19/3), bus ALS tujuan Sibuhuan terjebakdilubangitudanmenimbulkankemacetan sekitar 1 Km. Berjarak sekitar 500 meter dari lokasi itu, terdapat beberapa tikungan dengan badan jalan yang menyempit akibat bram jalan dikikis air hujan. Akibatnya kecelakaan berupa tabrakan antar truk sering terjadi. Menurut anggota Fraksi PDIP DPRD Palas Haris Haris Simbolon, di jalan sepanjang 8 Km yang terdiri dari beberapa tikungan tajam itu sangat rawan kecelakaan. Badan jalan erosi dan kedalaman lubang jalan mencapati 30 Cm dengan konsisi melebar. Jadi Saluran Air Sementarakerusakanjalanprovinsisepanjang 300 meter di Km 8 Desa Gunung Manobot, KecamatanLubukBarumun,telahberubahfungsi menjadi saluran air. Air itu berasal dari parit jalan yang sudah mengalami pendangkalan. Pada Minggu (20/3), badan jalan digenangi air setinggi 5 hingga 10 centimeter. Pada saat melintasinya, pengendara harus ekstra hati hati, karenabagiandasarlubangjalanitubergelombang atau tidak rata. “Hujan satu jam saja, langsung tergenang semata kaki. Anak-anak saat pulang sekolah terpaksa buka sepatu agar bisa melintasinya,” kata Mora Pasaribu, warga sekitar lokasi. Pada saat tidak hujan, permukaan air di parit jalan hampir rata dengan badan jalan. Hingga kini belummendapatperhatianseriusdariinstansi terkait, meskipun sering dikeluhkan warga dan pengguna jalan. Endi Marini, 26, pengendara sepedamotor dari Sibuhuan, mengaku sering terjungkal di lokasi itu. Kecelakaan tunggal terjadi karena kerusakan jalan ditutupi dan dialiri genangan air. Pengusaha Mengeluh Kondisi kerusakan jalan provinsi di Palas, sudah sejak lama dikeluhkan para pengusaha angkutan barang dan angkutan umum. Mereka mengaku keuntungan dari angkutan sangat terpuruk akibat kerusakan jalan. Kondisi ini mengakibatkan jumlah perusahan angkutan menuju Sibuhuan kian hari semakin berkurang. Pasalnya, keuntungan sudah tidak sebanding lagi dengan biasa perbaikan kerusakan mobil Direksi CV Transport Sibuhuan Bersaudara (TSB), Ucok Hasibuan, mengaku trayek Sibuhuan menuju Sidimpuan sering tidak tepat waktu atau trip tidak terkejar. “Jalan rusak memaksa sopir memperlambat laju kendaraan dan berdampak pada keterlambatan penumpang tiba di tujuan,” ujar Ucok. Bersambung (tim)

Opini

WASPADA Jumat 1 April 2011

TAJUK RENCANA

Antisipasi Pembunuhan Brutal

S

adis, brutal, tak profesional. Itulah komentar masyarakat atas pembunuhan pasangan suami-istri Kho Wie To alias Suwito, 36, dan Dora Halim, 32, di rumahnya Jalan Akasia I No.50, Lingkungan VII, Kelurahan Durian, Medan Timur, Selasa (29/3) malam. Sadis dan brutal karena pelaku langsung memberondong dengan timah panas sehingga korban tewas di tempat (di dalam mobilnya) sepulang makan malam. Tak profesional karena lebih 25 tembakan untuk menghabisi hanya dua orang dalam posisi sulit bergerak di jok mobil. Bandingkan dengan penembakan Direktur PT Rajawali Putra Banjaran Nasruddin Zulkarnaen pada Maret 2009. Cukup dua kali tembakan dan dilakukan saat mobil melaju sehabis korban main golf. Lagi pula, pelaku pembunuhan suami-istri itu tidak menggunakan alat peredam suara sehingga menimbulkan suara tembakan cukup keras dan memerlukan waktu cukup lama di TKP (tempat kejadian perkara). Sayang, warga di sekitar rumah korban lambat datang memberi bantuan sehingga para pelaku dapat meloloskan diri. Lebih disayangkan lagi, warga kurang aktif membantu korban yang dalam kondisi sekarat. Mungkin saja masyarakat sekitar merasa takut diperiksa menjadi saksi di kantor polisi. Dari Kapoldasu diperoleh penjelasan korban Kho Wie To mengalami luka tembakan sebanyak 19 kali dan Dora Halim delapan tembakan.Wajar kalau jenderal berbintang dua ini mengajak seluruh lapisan masyarakat untuk sama-sama menjaga Kamtibmas di Medan pada khususnya dan Sumut pada umumnya. Mengantisipasi ajakan Kapoldasu untuk menjaga keamanan dan ketertiban masyarakat, menurut hemat kita perlu didukung oleh semua pihak. Kerja polisi akan mengalami kesulitan tanpa dukungan dan bantuan masyarakat dalam memberantas patologi sosial berupa tindak kejahatan atau kriminalitas yang semakin beragam, canggih, dan berani. Tantangan buat polisi semakin berat menghadapi tindak kejahatan yang semakin beragam secara kuantitas maupun semakin sadis dan brutal. Polisi baru mendata dua eksekutor penembak mati suami-istri menggunakan senjata berbeda setelah uji Labfor. Kita berharap para pelaku yang diperkirakan menggunakan dua sepedamotor (kereta) dapat segera ditangkap dan diajukan ke pengadilan untuk dijatuhi hukuman berat. Hukuman mati atau setidaknya seumur Intisari hidup pantas dijatuhkan kepada para pelaku yang mengakibatkan dua anak korban kasih sayang dari kedua orang Warga dan polisi perlu kehilangan tuanya. Tidak adanya barang yang diambil antisipasi kejahatan de- pelaku menambah kuat dugaan motifnya kesumat! ngan menghidupkan pos- dendam Sekalipun masyarakat tidak sabar untuk kamling dan razia terha- mendapat berita penangkapan para pelaku secepatnya, namun permintaan Kapoldasu dap geng kereta. Irjen Pol Wisjnu Amat Sastro agar pihaknya diberi waktu yang cukup untuk mengungkap motif sekalipun membekuk para pelaku pembunuhan pasangan suami-istri itu kita nilai normatif. Berat dugaan pelakunya orang bayaran. Siapa yang membayar mereka untuk membunuh korban, tentu saja pihak-pihak yang punya masalah dengan korban, apakah soal pribadi, bisnis, keluarga dll. Kita patut mengacungkan jempol jika polisi berhasil menangkap pelakunya dalam satu minggu. Dengan mengerahkan seluruh kekuatannya Polresta Medan didukung Poldasu bisa menjawab tantangan menangkap para pelaku jika serius, termasuk merazia geng kereta yang semakin meresahkan masyarakat. Polisisudahmengambil keterangan dari tiga orangsaksi yangmelihat dan mengetahui ciri-ciri pelaku pembunuhan. Dari keterangan saksi diharapkan polisi bisa membuat sketsa wajah para tersangka pembunuh sadis tersebut. Masalahnya, apakah para pelaku menggunakan helm, menutupi wajah? Kalau ya, polisi akan sulit untuk membuat sketsa pelaku. Padahal, ciri khas wajah itu sangat penting untuk disebarkan sehingga masyarakat bisa memberi informasi jika melihat tersangka di luaran. Antisipasi masyarakat dan polisi bisa dengan cara menghidupkan poskamling di tempat tinggalnya sehingga kalau melihat gerak-gerik mencurigakan dari orangorang tak dikenal bisa segera ditindaklanjuti, diperiksa identitas dan diteruskan ke polisi jika dirasa perlu. Atau, bagi keluarga yang berpunya/kaya bisa menggunakan petugas satpam menjaga rumahnya. Minimal memasang rekaman CCTV di kediamannya. Kurang sigapnya masyarakat membantu korban pembunuhan, atau di banyak tempat korban perampokan dll, menurut hemat kita bisa disebabkan para korban kurang bersosialisasi dengan masyarakat di sekitar tempat tinggalnya. Jika hubungan baik mereka dengan jiran tetangga terjalin, pastilah tetangga terdekat segera memberi pertolongan, segera membantu begitu mengetahui tetangganya minta tolong atau dalam bahaya. Kehidupan masyarakat etnis China yang cenderung eksklusif, kurang mau bergaul dengan masyarakat pribumi, perlu mendapat perhatian agar membaur. Mereka mengira pasti aman dengan memasang pintu besi berlapis, begitu juga dengan jendela yang tak ubahnya kandang harimau. Faktanya, tetap bisa dijebol penjahat. Terbukti, pelaku masuk ke dalam garasi mobil berkisar 3 orang, dua di antaranya bertindak selaku eksekutor. Setelah mengeksekusi targetnya pelaku kabur meninggalkan lokasi kejadian. Para pelaku diperkirakan sudah melakukan survei, sehingga tahu kapan mobil korban pulang. Saat pintu besi terbuka, di saat itulah sang pembunuh masuk melakukan aksinya. Kejam, brutal, biadab!+

APA KOMENTAR ANDA SMS 081265134674

Faks 061 4510025

Email komentar@waspada.co.id

+6285270025328 BPK Kapolda tolong tindak anggota bapak, seorang Aiptu di Reskrim Polresta Pematangsiantar, yang membeking judi togel dan bola terbesar di Siantar jalan Nagur Kel. Martoba...(Jaya Sinaga Bandar Judi terbesar di Siantar tak terjangkau hukum, sangat meresahkan masyarakat? +628126503285 WAPADA ! , Terimakasih atas pemuatan Iklan dari pak Kapoldasu yang lama (IRJEN POL Drs.OEGROSENO,SH) tapi sayangnya photonya salah (terbalik) . . Trims +6285270526604 Nurdin Halid sudah menyadari dirinya sampah. Kenapa meminta ke SBY agar Menpora dicopot. Bukankah dia pernah mengatakan. presiden sekalipun tak dapat menurunkannya. Ha..ha..ha..mulutmu harimaumu. Dasar tak punya malu... Atau ini jelas politik salah satu partai yang pro Nurdin.. Masyarakat capek dengan permainan kampungan. Indra Q. Medan. +6281375411631 Bravo Bapak.Jaksa salut sama bapak. Yang telah menangkap tangan pemalakan oleh DLLAJR jembatan timbng Sibolangit, tapi perlu bapak ketahui, bukan di jembatan.timbang Sibolangit saja tapi di seluruh jembatan.timbng di SUMUT LLAJR nya rakus dan arogan sama supir2 truc,karena dukung Bapak KAJATI. Bravo buat bapak. +6281362402708 Assalamu’alaikum.W.W. Kpd Yth. 1.Bpk Ka.Disdik Provinsi Sumatera Utara, 2.Bpk Kadis Diknas Medan Jelang Ujian Akhir Nasional (UAN) tahun 2011 ini, jangan ada lagi pengawasan UAN dilibatkan aparat polisi berpakaian dinas, karena membuat sìswa tidak konsentrasi, bila diperlukan mereka cukup dengan pakaian biasa. Wassalam +6281397269015 Kepada Yth: Bang Redaksi mohon dimuat SMS ini, sudah sering terjadi kalau kami transfer uang dari Kantor Pos melalui rekening Shar’e Muamalat, begitu kami butuh uang tersebut menarik kembali dari ATM uang tersebut tidak bisa keluar. Kami sering kecewa. Trimakasih ya Bang ? +6285297614728 Dlm sidang perampokan CIMB TGL 29 pakaian perampok baju muslim. Apakah ini disengaja atau ingin mengskreditkan Islam? +6281370084639 Tai adong dope dabo. Tor PANGOLAT nga’ tarbolus padati.........dst. Dari cucu Datu Janggut Marpayung Aji Rangkuti. Trim’s WASPADA.

B5

Menuntaskan Persoalan Status Ahmadiyah Oleh Dr Nurasiah, MA Secara ilmiah telah disimpulkan bahwa Ahmadiyah adalah suatu paham, aliran, dan sejenis sekte yang muncul dalam agama Islam

M

elihat absurditas (ketidaklogisan) Ahmadiyah menjadi bagiandariIslam,makapilihan tinggal dua lagi bagi Ahmadiyah, yaitu menjadi agama baru atau bubar, apakah bubar itu secara organisasi dan lembaga atau juga keyakinan. Saat ini sejumlah Pemda –sedikitnya tiga Provinsi Jawa Barat, JawaTimur dan Sumatera Barat –telah mengeluarkan perda pelarangan keberadaan Ahmadiyah di wilayah mereka. Tidak ketinggalan Hasyim Muzadi memberikan klarifikasi bahwa keputusan Pemda JawaTimur bukan merupakan suara NU dan bukan faktor becking massa NU, walaupundiakuinyaJawaTimuradalahbasis utama NU. Dikatakannya bahwa sikap NU sendiri adalah melarang menyebarkan dan melakukan kegiatan secara terbuka, bukan memaksakan pembubaran keyakinan. Beberapa Pemda lainnya seperti Sumatera Utara dan Sumatera Selatan hanya memberikan pernyataan mendukung kebijakan Pemda-Pemdadiatasdanbelummengeluarkan peraturan hukum tertulis. Selain kondisi di atas, baru-baru ini kita juga mendapat kabar tentang keberhasilan tokoh-tokohulamadiSukabumidanSubang untuk berdialog dengan sejumlah penganut Ahmadiyah dan mengembalikan mereka ke pemahaman agama Islam.Ternyata, ada indikasi bahwa pemelukan Ahmadiyah oleh sejumlah penganutnya adalah dikarenakan pengelabuan perbedaan antara Islam dan Ahmadiyah itu sendiri. Bagaimanapun, sebelum melihat opsi pembubaran, opsi menjadi agama baru harus dianalisis kemungkinan dan legalitasnya. Ahmadiyah jadi agama baru… ? Pertama sekali, UUD negara Indonesia menyatakan“setiap penduduk diberikan kebebasan untuk memeluk agama dan meyakini kepercayaannya” dan“negara menjamin semua rakyat untuk dapat mempraktikkan ibadah menurut agama dan kepercayaannya”. Ini tampak menjadi modal bagi siapa saja untuk bebas membentuk agama, apapun itu adanya dan bentuknya. Sementara dalam Penjelasan Atas PenetapanPresidenNo1Tahun1965Tentang Pencegahan Penyalahgunaan dan/atau Penodaan dan Penistaan Agama pasal 1 dinyatakan bahwa, “Agama-agama yang

dipeluk oleh penduduk di Indonesia ialah Islam, Kristen, Katolik, Hindu, Budha dan Khong Hu Cu (Confusius).” Artinya, pemerintah dapat juga menyatakan pembatasan agama dan kepercayaan, dan masyarakat tidak dapat sebebasnya mengadopsi segala macam bentuk agama dan kepercayaan. Adapun pengertian agama adalah suatu kepercayaan yang melembaga dan menginstitusi; memiliki aturan ritual tertentu yang terjadwal dan bermakna atau mengandung tujuan tertentu; memiliki figur sentral yang dipandang sebagai pendiri dan pembawa ajaran; serta memiliki ajaran tertentu baik terekspresidalamsuatukitabsuciataudalam bentuk lain. Sekarang, kalau Ahmadiyah hendak diakui sebagai suatu agama, dengan alasan berkembangnya realitas masyarakat, maka pertanyaan pertama adalah apakah Ahmadiyah memenuhi unsur-unsur yang disebut sebagai agama atau hanya merupakan sekte, aliran atau kepercayaan saja ? Secara ilmiah telah disimpulkan bahwa Ahmadiyah adalah suatu paham, aliran, dan sejenis sekte yang muncul dalam agama Islam. Dari sudut pandang otoritas Islam, Ahmadiyah telah divonis bertentangan dengan Islam dan tidak berhak menyandang nama Islam,sementarauntukmenjadiagamabaru Ahmadiyahjugatidaksiapdantidakmemiliki tujuan maupun struktur untuk itu. Hal ini karena karakter dan orientasi mereka hanyalah sebagai ajaran janji keselamatan dan perbaikan moral. Ahmadiyah hanyalah satu contoh dari fenomenapahamkewahyuanberkelanjutan dan ideologi Mahdi (janji penyelamatan) atauide‘RatuAdil’yanglahirdariperutagama Islam.Merekamengklaimpemimpinmereka sebagai seorang yang mendapatkan wahyu dan mendapat gelar nabi. Ia diperintahkan Tuhan melaksanakan tugas Mahdi (reinkarnasi Isa as.), yang dijanjikanTuhan turun ke bumi untuk menghancurkan kebatilan danmenyelamatkanumat,sebabnabisyariat sudahtidakadalagi.Pahaminisangatbanyak kelompok dan jenisnya dan muncul di seluruh agama. Isi ajarannya mungkin dipengaruhi oleh satu agama mana saja atau oleh beberapa agama sekaligus. Secara keseluruhan, bagan aliran keIslaman dapat ditarik kepada dua arah. Pertama, tidak mengklaim pewahyuan dan gelar nabi, yaitu kelompok Syi’ah dan Darul

Arqam. Kedua, mengklaim pewahyuan dan gelar nabi. Kelompok yang mengklaim pewahyuan dan gelar nabi selanjutnya dibedakan lagi; (1).Yang berorientasi politik, (2).Yang berorientasi sosial dan dakwah, (3). Yang berkonsentrasi pada penghayatan dan kemuliaan moral spiritual melalui olah budi pekerti yang bersifat individual. Kelompokkelompok ini ada yang berasal dari luar dan ada yang asli dari Indonesia. Contoh kelompok terakhir yang dari Indonesia adalah Lembaga “Latihan Kejiwaan Subud”. Adapun Ahmadiyah dapat dikelompokkan kepada ajaran klaim pewahyuan dan janji keselamatan (Mahdiisme) yang berorientasi sosial dan dakwah. Aliran Mahdiisme Ahmadiyah berbeda karakternya dengan Aliran Mahdiisme Baha’i yang berorientasi politik dan berakar dari teologi Syi’ah.Baha’imengandungvisisebagai‘Qaim’ dan bergerak dari atas, sedangkan Ahmadiyah sebagai ‘Hakim Pengislah’ yang bergerak dari bawah. Maksudnya, aliran Mahdiisme Baha’i berangkat dari kekecewaan politik dan bercita-cita meraih suatu kemenangan politik, sementara Ahmadiyah tumbuh dari faktor keprihatinan sosial dan kekecewaan terhadap kehidupan keagamaan masyarakat, karenanya berjuang untuk dakwah sosial keagamaan. Karena karakternya yang bergerak dari bawah, yaitu sebagai‘Hakim Pengislah’ dan bukan mengemban misi untuk tampil sebagai pembaharu dan bekerja dari atas (Qa’im), maka Ahmadiyah tidak memiliki keberanian moral, minus modal teologis, dan minim kekuatan pemicu untuk tampil sebagai agama baru. Karena itulah sampai sekarang, tantangan, tawaran dan kesempatanbesaruntukmenjadi‘Agamabaru’tidak pernah bisa diterima Ahmadiyah. Ahmadiyah, bubar saja..? Kalau opsi menjadi agama baru tidak mungkin diterima Ahmadiyah, maka opsi yang tersisa adalah Ahmadiyah seharusnya bubar saja. Lagi pula, pemerintah tidak boleh secaramudahmengabulkanketetapansuatu aliran menjadi agama baru. Hal ini akan membuka kran tuntutan dari setiap sekte atau aliran dalam masyarakat yang jumlahnya tidak terkontrol. Bisa dibayangkan bagaimana kekacauan dan tumpang tindih identitas akan terjadi, terutama bila perbedaan antara agama yang ada tersebut kabur dan tidak dipahami masyarakat. Pengelompokan yang semakin banyak berkonsekuensi pada pengkotak-kotakan masyarakat yang semakin ruwet. Saat ini perhatianpemerintahseharusnyaditumpahkan pada upaya mencari ruang bersama bagi kelompok yang sudah terjadi dan bukan malah menambah kotak-kotak pengelompokan yang akan memunculkan jarak

komunikasi dan mempersempit kesamaan perspektifmasyarakat.Pembentukanagama tentunya juga tidak bisa disamakan dengan pendirian partai atau LSM-LSM. Tugas pemerintah dalam melindungi agama dan kepercayaan harus dalam kerangka menjaga tujuan-tujuan kehidupan berbangsadanberagamaitusendiri,dimana pada hasil akhirnya adalah mengangkat harkat dan martabat kemanusiaan rakyat Indonesia. Karenanya, agama dan kepercayaan masyarakat tertentu di Indonesia tidak boleh kontra-produktif (berlawanan/ mengancam) dengan tujuan kehidupan berbangsa dan pembangunan manusianya. Karena itulah pemerintah melarang ideologi komunis dan pemahaman-pemahaman terorisme dan kekerasan. Juga, aliran-aliran kultus yang anti-sosial, yang mereka ini cenderung tertutup, membentuk kelompok tersendiri dan menghindar dari dialog dan kebersamaan. Jenis-jeniskepercayaaniniterbuktijustru menghancurkan harkat kemanusiaan. Dalam konteks berbangsa ia memunculkan kekacauan dan konflik. Klaim-klaim pengakuan kenabian yang bersifat aliran, lebih sering dari tidak, selalu mengundang percekcokan tajam karena mengajarkan kemutlakan (ultimacy). Pengaku kenabian yang bersifat aliran (tidak bertanggungjawab untukmerumuskansistemagamatersendiri) menghasilkan model kepengikutan yang eksklusifistik dan serba defensif, menampik “orang luar” untuk menyertai mereka dalam panji keselamatan dan kebahagiaan. Sama halnya, potensi kekacauan yang ditimbulkan Ahmadiyah memungkinkan pemerintah untuk membubarkan keberadaan mereka. Kalau pembubaran keyakinan tidak mungkin dilakukan karena tidak ada yang bisa mengatur dan masuk ke wilayah hati dan pikiran seseorang, setidaknya pembubaran legalitas lembaga atau jamaah mereka harus dilakukan dan memiliki dasar yang jelas. Pembiaran keberadaan Ahmadiyah sebagai lembaga atau jamaah akan meng-counter otoritas agama Islam, menghina ajaran agama Islam, dan mencideraihakazasipenganutagamaIslam, yang kebetulan saja menjadi mayoritas di negeri ini. Ini tentu akan menjadi bara dalam sekamyangakanmenyulutapikonfliksecara terusmenerus. Hendaknya tidak dikacaukan bahwa pelarangan Ahmadiyah dikatakan sebagai pencideraan hak azasi minoritas. Masalahnyabukanmayoritasatauminoritas, melainkan pembelotan substansi Islam oleh suatu kelompok. Tuduhan pembelotan ini telah ditetapkan oleh seluruh otoritas Islam seluruh dunia. Penulis adalah Dosen Fakultas Syariah IAIN-SU, Medan

Khadafi = Gajah Mati Karena Gading Oleh Sofyan Harahap Libya ibarat gula,dikerubungi‘’semut-semut’’jahanam!

K

ataseorangteman,nasibnyaNurdin Halid sama dengan Moammar Khadafi. Benarkah? Kalau melihat kekuasaannya ingin direbut dengan cara paksa, mungkin ada kemiripan. Keduanya memang dikenal temperamental dalam memimpin sehingga di PSSI maupun Libya muncul‘’apirevolusi’’dariinternalnyasendiri memicu ketidakpuasan gara-gara model kepemimpinan ‘’diktator’’ ala Nurdin dan Khadafi. Konflik pun tak terelakkan, dipicu masalah politik, ekonomi, dan arogansi kekuasaan,sehinggamengundang pihakketiga campur tangan. Kalau kasus PSSI diambil alih pemerintah (Menpora), sedangkan di Libya diambil alih DK-PBB (AS dan sekutu NATO). Sehingga memang ada benarnya juga menganalogikan nasib Nurdin identik dengan Khadafi. Sama-sama terancam kehilangan kekuasaannya akibat sikap keras dan tabiatnya ingin disanjung, ditakuti, dihormat secara berlebihan. Ibarat pepatah ‘’gajah mati karena gadingnya sendiri’’. Fenomena miris! Surat Khadafi Sebelum tanggal invasi militer udara, pemimpin Libya Moammar Khadafi berupaya melakukan negosiasi komunikasi kepada Presiden AS Barack Obama pada pertengahan Maret lalu, namun tidak digubris, malah tahu-tahu sudah dijawab dengan serangan ‘’barbar’’ pasukan AS dan sekutu ke jantung pertahanan militer Libya, tepatnya Sabtu (19/3), sehari setelah Dewan Keamanan(DK)PBBmengeluarkanResolusi No. 1973/2011 untuk zona larangan terbang bagi pesawat Libya. Padahal, isi surat Khadafi cukup menghormati Obama yang ia anggap anak. BerikutinipenggalansuratKhadafiuntuk Obama:“Sepertitelahsayakatakansebelumnya, jikaTuhan mengizinkan, nanti akan ada perangantaraLibyadanAS,kamuakanselalu ingat anakku bahwa saya akan tetap mencintaimu. Saya tak ingin mengubah pandangan yang saya miliki tentangmu. Seluruh warga Libya kini bersamaku, siap untuk mati baik wanita maupun anak-anak. Saat ini kami berperang tak lain untuk melawan Al-Qaeda yang sering dianggap sebagai Islamic Maghreb. Ini adalah kelompok bersenjata yang melakukan perlawanan dari Libya ke Mauritania, dan terus melewati Aljazair dan Mali ... Jika saja mereka merebut kota-kota di AS dengan kekuatan senjata, katakan padaku apa yang akan kamu lakukan?” DansuratberikutinidilayangkanKhadafi untuk Presiden Nicolas Sarkozy, Perdana Menteri Inggris David Cameron, dan Sekjen PBB Ban Ki-Moon pasca invasi militer pasukan koalisi yang isinya menyatakan:“Libya bukan milikmu, Libya adalah milik kami warga Libya. Resolusi PBB adalah tak benar karena keputusan itu tak mengikuti ketentuan mengenai urusan dalam negeri setiap negara. Ini adalah operasi militer yang mengerikan, agresi yang kejam. Kamu tak memiliki wewenang mengintervensi urusan dalam negeri kami. Siapa yang memberikanmu hak itu? Kamu akan menyesal bila berani mengintervensi negara kami. Negara ini adalah milik kami. Kami tak pernah bisa menembakkan satu pun peluru pada penduduk kami.”

Surat Khadafi itu mengingatkan kita berbagaiupayayangdilakukanbanyakpihak terkaitinvasimiliterASdansekutukeAfghanistan dan Irak tahun 1990an untuk membunuh pemimpin Syekh Omar dan Saddam Hussein. Kecaman mengalir deras dari banyaknegara,namunASdansekutujalanterus dengan programnya menghancurkan kelompok garis keras Islam dan pendukung Saddam. Tanda tanya Kini, sudah hampir dua pekan Libya diserang habis-habisan oleh pasukan sekutu dengan mengerahkan mesin perang pa ling canggih, berupa pesawat tempur model mutakhir sehingga sistem radar dan pertahanan militer, khususnya skadron udara Libya, mengalami kerusakan berat. Diperkirakan sulit bagi Libya untuk melakukan perlawanan secara terbuka dan optimal sekalipun Libya memiliki 300 pesawat tempur. Sikap Libya yang defensif memang banyak disesalkan masyarakat. Seharusnya, pasukan udara Libya berani bertempur habis-habisan dengan pasukan sekutu meskipun akhirnya kalah, tapi kalah secara terhormat membela kedaulatan wilayahnya dari serangan pesawat musuh.Yang pasti menimbulkan kerugian di kedua belah pihak. Kalau tanpa perlawanan seperti terlihat dalamduapekanbelakangan ini, sekutu merasa menang dan tersenyum lebar, dan akan semakin berani menggempur pasukan militer Libya saatnya nanti menghadapi pasukan ‘’pemberontak’’ dari kalangan anti-Khadafi di sejumlah kota yang sudah berpindah tangan. Berita terbaru, pasukan‘’pemberontak’’ anti-Khadafi mengalami kekalahan telak dalam pertempuran darat untuk merebut pelabuhan minyak penting Libya di Ras Lanouf. Sebelumnya mereka juga gagal merebut kota Sirte yang merupakan basis pasukan loyalis pemerintah. Kota kelahiran Khadafi ini masih utuh dalam genggaman pasukan Khadafi walaupun pasukan antiKhadafi dua hari lalu sudah berupaya masuk ingin merebut Sirte sehingga posisi ‘’pemberontak’’ sudah semakin dekat ke jantung ibukota Libya. Dari 22 kota besar di Libya SirtemerupakanpintumasukmenujuTripoli. Dalam tayangan televisi kelihatan pasukan‘’pemberontak’’ kocar-kacir diserang pasukan Khadafi. Milisi ‘’pemberontak’’ merasa kesal terhadap pasukan koalisi yang berjanji akan membantu melumpuhkan pertahanan militer Khadafi lewat serangan udara, namun Selasa (29/3) itu tidak terjadi. Sumpah serapah pun keluar dari mulut para milisi ‘’pemberontak’’ anti-Khadafi terhadap pasukansekutudanNATO.Merekaberharap Sirte dapat ditaklukkan sehingga tinggal 12 kota lagi sebelum sampai pada pertem-

puran klimaks mengambilalihan pemerintahan dari tangan Khadafi di jantung kota Tripoli. Menjadi tanda tanya besar bagi publik mengapa upaya menaklukkan Ras Lanouf dan Sirte tidak didukung sekutu? Kalau saja pesawat tempur sekutu terlebih dahulu memporak-porandakan pertahanan pasukan Khadafi di sana maka pasukan‘’pemberontak’’ anti-Khadafi dapat dengan mudah mengalahkan loyalis pemerintah, maka segera sampai pertempuran besar di Tripoli, dan perang pun bisa dianggap selesai. AS dan sekutu mengumumkan kemenangan dan selanjutnya mengatur siapa yang duduk di pemerintahan‘’boneka sekutu’’ menggantikan Khadafi. Berat dugaan pasukan sekutu sengaja ‘’menggantung’’ peperangan agar berlangsung lebih lama dengan tujuan yang menguntungkanAS,Perancis,Inggrissebagai ‘’biang kerok’’ kejahatan perang di Libya. Langgar format DK-PBB Awalnya, PBB bersikeras penerapanzonalarangan terbang di Libya bertujuan untuk melindungi nyawa warga sipil tidak berdosa di sejumlah kota bagian timur Libya yang bergolak. Khadafi memang tidak main-main dalam memerangi kelompok pro-demokratis yang disebutnya ‘’pemberontak’’ itu. Dengan diberlakukannyazonalaranganterbang, maka pesawat tempur Libya tidak diperbolehkan lagi mengudara menggempur basis ‘’pemberontak’’ untuk menyelamatkan tragedi kemanusiaan. Jika Libya membandel mereka akan diserang oleh pasukan koalisi atas izin DKPBB yang berpatroli udara. Nyatanya, pasukan sekutu bukan berpatroli di atas udara Libya saja, tapi rajin menjatuhkan ratusan rudal tomahawk ke sejumlah wilayah yang diduga menjadi basis kekuatan militer Libya. Janji DK-PBB hanya mengerahkan pesawat jet tempur Amerika Serikat, Perancis, Inggris, Belanda, Kanada dll untuk menjaga wilayah udara Libya agar tidak dilanggar pilot pesawat Libya. Kekuatan angkatan udara Libya diperkirakan sudah lumpuh, namun begitu tidak mudah bagi sekutu dan kelompok ‘’pemberontak’’untukmengalahkanpasukan darat Khadafi dengan persenjataan lebih lengkap. Apakah nanti, koalisi juga akan melakukan intervensi lewat darat? Hal ini sepertinya tinggal menunggu waktu saja. Karenanya dapat dipastikan akan terjadi pertumpahan darah besar-besaran saat pasukan darat koalisi dan ‘’pemberontak’’ memasuki Tripoli, di mana pada akhirnya Khadafi harus rela melihat jatuhnya simbolsimbol kekuasaannya akibat dahsyatnya akselerasi invasi pasukan kavaleri dan infantri koalisi. Penutup Setelah sekian lama ditunggu-tunggu, Selasa(29/3),akhirnyaPresidenSBYberpidato untukmenyampaikansikapIndonesiaterkait

krisis Libya. SBY menyerukan gencatan senjata dan pencarian solusi konflik. Hematkita,pidatoSBYdatar,seharusnya sikap Indonesia bisa lebih tegas meminta AS dan koalisi menghentikan bombardir Libya,mengecamnyakarenasudahmenyimpang dari Resolusi DK-PBB No. 1973. Karenanya harus dihentikan mengingat banyaknyakorbanjiwa,terutamadarikalangan sipil. Dalam perspektif lain, serangan AS dan sekutu-NATO yang konon menelan US$300 juta atau Rp2,6 triliun per minggunya dianggap terlalu murah. Sebab, dana pribadi berikut aset Khadafi yang disimpan di AS saja (sudah dibekukan) mencapai US$33 miliar. Belum lagi di Negara-negara lain. Totalnya bisa lebih 100 miliar dolar. Sepertinya, AS dan sekutu ingin memuaskan napsu perangnya, menjadikan Libya gelanggang eksperimen perang dengan menggunakan dana Khadafi yang melimpah, diperkirakan cukup untuk tiga tahun. Kalau masih kurang lama, AS dan sekutu masih bisa menggunakan uang dari ekspor minyak Libya yang mencapai 1,6 juta barel per harinya, karena cadangan minyak negara terkaya di Adrika itu mencapai 42 miliar barel plus 1,3 triliun meterkubik gas, dan baru sepertiga saja yang dimanfaatkan. Dana melimpah di depan mata itu cukup untuk membayar seluruh biaya perang yang dikeluarkan pasukan sekutu plus bonus selama praktik perang di Libya sampai kapan mereka mau. Libya ibarat gula, dikerubungi ‘’semut-semut’’ jahanam!+ Penulis adalah Wartawan Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Pemko Medan dinilai tak peduli lampu jalan rusak - Hemat listrik mungkin, he...he...he * Jerman hapus utang Indo nesia Rp282 M - Indonesia memang negara betuah * Eddy Syofian: Etika di kalangan PNS mulai pudar - Maklumlah masuk PNS pun payah!

oel

D Wak

Ekonomi & Bisnis

WASPADA Jumat, 1 April 2011

B7

Pertamina Targetkan Kebutuhan 28 Ribu Liter BBM Elpiji Aceh 25 Ton Per Hari Subsidi Diselewengkan JAKARTA (Waspada): Baru tiga bulan pertama tahun 2011, Badan Pengatur Hilir Minyak dan Gas Bumi (BPH MIGAS) melaporkan jumlah penyalahgunaan Bahan Bakar Minyak (BBM) bersubsidi diperkirakan mencapai 28 ribu liter BBM berasal dari 25 kasus dengan tersangka sebanyak 34 orang. Data tersebut diperoleh dari sejumlah operasi pengendalian BBM bersubsidi dilakukan bekerjasama dengan Mabes Polri. Penyalahgunaan BBM bersubsidi bisa dilakukan dalam bentuk kuota melebihi batas, penggunaan tidak sesuai perun-

tukannya, maupun menimbun BBM. “Kalau kita tidak melakukan apa-apa maka 2011 subsidi BBM mencapai 42 juta KL,” kata Anggota BPH Migas Ibrahimm Hasyim disela jumpa pers Sosiasialisasi Pengendalian BBM subsidi di Kementrian Energi dan Sumber Daya Mineral, Jalan Medan Merdeka Selatan, Jakarta, Kamis, (31/3). Data Mabes Polri menunjukan, sepanjang 2010, Polisi telah menindak 161 kasus penyelewengan BBM dengan 220 tersangka dan 187 ribu liter BBM disita.Volume penyalahgunaan BBM bersubsidi tersebut menurun dibandingkan posisi tahun 2009 mencapai 385 ribu liter berasal dari 112 kasus dengan 135 tersangka. Volume penyalahgunaan BBM bersubsidi tersebut masih kalah jauh dibandingkan hasil temuan pada tahun 2008 lalu. Kala itu, aparat kepolisian menggelar operasi besar-besaran

berhasil mengamankan 8,5 juta kiloliter BBM subsidi dengan 1.325 kasus dan 1923 tersangka. Ibrahim mengatakan, BPH Migas mencatat selalu tiga bulan pertama 2011, terdapat sejumlah wilayah di Indonesia memperoleh kuota BBM bersubsidi melebih ketentuan berlaku. Daerah itu diantaranya Sumatera Utara, Sumatera Barat, Sumatera Selatan, Riau, Jambi, Jakarta, dan Banten. Selain menggalang kerjasama dengan Kepolisian, BPH Migas juga telah merintis caracara untuk menekan agar BBM subisidi tidak melebihi kuota. Salah satu caranya adalah membagi kuota nasional menjadi kuota badan usaha (Pertamina, AKR dan Petronas) lalu dibagi kembali menjadi kuota kabupaten/kota lalu dididistribusikan secara tertutup. “Distribusi tertutup itu pernah kita buat untuk solar dijatah 10 ton per SPBU setelah habis tidak akan ditambah lagi.

Sinergi BUMN Tingkatkan Pendapatan Negara JAKARTA (Waspada): Menteri Negara BUMN, Mustafa Abubakar mengatakan, pelaksanaan sinergi antar BUMN akan meningkatkan kontribusi pendapatan untuk negara, selain efisiensi dalam pengelolaan operasional dan bisnis bagi perusahaan Badan Usaha Milik Negara (BUMN). “Sinergi BUMN juga dapat meningkatkan daya saing dalam menghadapi iklim persaingan yang semakin ketat dan meningkatkan kontribusi pendapatan BUMN untuk Negara,” katanya usai menyaksikan menandatanganan kerjasama 37 perusahaan BUMN di Jakarta, kemarin.

Dia menegaskan kerjasama antara BUMN ini akan terus dikembangkan, terlebih dengan adanya Peraturan Menteri Negara BUMN Nomor 5 tahun 2008 tentang pengadaan barang dan jasa di lingkungan BUMN. Seluruh BUMN yang hadir tersebut menyepakati 39 bentuk kerjasama sinergi, terdiri dari 35 Memorandum of Understanding (MoU) dan 4 Perjanjian Kerja Sama Sinergi. Menurut Dirut Bank BNI Gatot M Suwondo, kerjasama seperti ini merupakan komitmen pihaknya memberikan dukungan perbankan dalam peningkatan pelayanan kepada masyarakat/pelanggan.

“Misalnya kartu TITAM yang diterbitkan BNI sudah terintegrasi untuk transaksi prabayar (prepaid) yang bisa digunakan pembelian tiket moda transportasi. Implementasi pertama pertama untuk pembelian tiket Kereta Api Indonesia (KAI), Damri (angkutan bus)dan penyebrangan kapal laut,” jelas Gatot. Pernyataan Gatot ini dikhususkan atas nota kesepahaman kerjasama untuk pembayaran tiket kereta api melalui E-channel BNI, penerbitan kartu pegawai elektronik, fasilitas kredit konsumer pegawai KAI, dan beberapa hal lainnya untuk kemudahan pegawai KAI. (j03)

Yang premium akan kita buat kuotanya seperti apa,” jelas dia. Prinsip dari mekanisme tersebut, lanjut Ibrahim, adalah konsumen akan diarahkan untuk membeli BBM non subsidi (Pertamax cs) jika kuota BBM subsidi telah habis. Namun diakui, cara ini membutuhkan waktu lama untuk mengatur alokasi dan sosialisasi ke SPBU serta masyarakat. “Subsidi kita berikan kuota ke setiap SPBU kemudian kekurangan kita gunakan nonsubsidi. Kalau jatahnya mau habis dipasang pengumuman kuota mau habis,” jelasnya.(vvn)

BIREUEN (Waspada): Sales LPG Aceh dari Pertamina Pusat Robi C Djasmy menyebutkan kebutuhan bahan bakar gas elpiji untuk Aceh 25 ton gas per hari. Untuk pendistrubusian LPG 3 kg secara gratis ke seluruh rumah tangga di Aceh ditargetkan akan selesai Juni mendatang. Totalnya mencapai 987.000 paket tabung gas berserta isinya dan kompor gas beserta perangkat lainnya. Sedangkan khusus untuk Kabupeten Bireuen mencapai 80.150 paket. “Saat ini untuk seluruh Indonesia Pertamina telah menyalurkan 43 juta paket tabung LPG 3 kg beserta perangkatnya. Sedangkan kecelakaan akibat ledakan tabung gas 3 kg tersebut saat ini di bawah nol persen.

Kami berharap kepada masyarakat saat ini masih ada rasa was-was atau rasa takut menggunakan LPG 3 kg, agar tidak perlu takut lagi, karena lebih hemat menggunakan LPG 3 kg atau banyak kuntungannya dari pada menggunakan bahan bakar lainnya,” kata Robi kepada wartawan usai sosialisasi program konversi minyak tanah ke LPG 3 Kg yang diikuti seluruh camat dan sejumlah pegawai di lingkungan Setdakab Bireuen, di oproom kantor Bupati Bireuen, Rabu (30/3). Menurut Robi C Djasmy, sekarang pemerintah pusat hanya mengeluarkan dana untuk subsidi penggunaan LPG 3 kg itu sekitar Rp40 triliun per tahun. Jumlah itu cukup banyak selisihnya dibandingkan dengan subsidi minyak tanah

mencapai Rp97 triliun per tahun. “Sejak pendistribusian LPG 3 Kg tahun 2007 sampai sekarang, pemerintah telah menghemat APBN mencapai Rp25 triliun-Rp30 triliun per tahun, dana tersebut dialihkan untuk kegiatan lainnya diantaranya untuk dana kesehatan dan pembangunan semuanya demi kesejahteraan rakyat,” jelasnya. Sebelumnya, manajer proyek pendistribusian LPG Aceh, Zuanda, dalam sosialisasi mengatakan, pendistribusian LPG 3 Kg sudah mencakup sembilan kabupaten/kota di Aceh yaitu, Aceh Tamiang, Langsa, Aceh Timur, Aceh Utara, dan Lhokseumawe. Selanjutnya Banda Aceh, Pidie Jaya, Aceh Pidie, serta Aceh

BTN Siapkan Rp4,7 Triliun Biayai Rumah Bersubsidi JAKARTA (Waspada): Tahun ini Bank Tabungan Negara (BTN) Tbk, menyediakan dana sebesar Rp4,7 triliun untuk target pembangunan 120 ribu unit perumahan bersubsidi bagi masyarakat berpenghasilan rendah (MBR). “Ini artinya target kami untuk pemberian kredit bagi masyarakat yang berpenghasilan rendah sebanyak 120 ribu debitur yang bisa miliki rumah,” kata Dirut Bank BTN Iqbal Latanro pada paparan kinerja di Jakarta, Rabu (30/3) sore. Menurut Iqbal, sebenarnya target pemerintah tahun 2011 untuk penyediaan rumah bersubsidi bagi MBR sebesar 200 ribu debitur. Diprediksi target tersebut akan bisa terlampaui karena banyak perbankan yang ikut serta melakukan pembiayaan kredit perumahan ini. “Bank lain juga sudah banyak yang mau melakukan

pembiayaan perumahaan murah ini, makanya dari target pemerintah 200 ribu unit itu akan bisa terlampaui. Bagian BTN hanya 120 ribu debitur, sehingga sisanya ditangani bank lain,” tuturnya. Iqbal melanjutkan pada tahun 2010 kredit yang disalurkan oleh BTN mencapai Rp51,55 triliun atau mengalami peningkatan sebesar 26,25 persen dibanding tahun 2009 yang mencapai Rp40,73 triliun. “Pertumbuhan kredit ini jauh lebih tinggi, dibandingkan pertumbuhan industri yang mencapai 22 persen,” papar Iqbal. Kredit dan pembiayaan, menurutnya, masih didominasi olehk KPR sebesar 90,9 persen dan kredit non perumahan sebsar 9,1 persen. “Meskipun kredit tumbuh secara signifikan, namun kita tetap menjaga kualitas kredit. Hal ini terlihat dari kredit bermasalah (Non Performing

Loan/NPL) hanya mencapai 3,26 persen,” tandas Iqbal. Sementara untuk dana pihak ketiga (DPK) meningkat 18,23 persen menjadi Rp47,55 triliun. sedangkan pertumbuhan wholesale dicapai melalui penerbitan obligasi dan sekurisasi aset. Untuk laba 2010, Iqbal menjelaskan, BTN berhasil meraih peningkatan yang diluar dugaan yakni naik 86,73 persen, dari Rp490 miliar tahun 2009 menjadi Rp915 miliar di 2010. “Peningkatan laba ini menunjukkan kinerja BTN lebih dari yang diharapkan,” ujarnya. Sedangkan laba BTN untuk tahun ini, Iqbal optimis akan tembuh ke angkat Rp1 triliun, seiring kondisi ekonomi yang semakin baik. “Kami optimis target laba 2011 bisa sebesar Rp1 triliun karena situasi saat ini sangat kondusif di semua sektor,” tegasnya.

Laba bersih Ditempat terpisah, Bank Central Asia (BCA) Tbk, memperoleh kenaikan laba bersih sebesar 24,6 persen, dari Rp6,8 trliun di tahun 2009 menjadi Rp8,5 triliun di 2010. Penyumbang terbesar kenaikan itu berasal dari pendapatan bunga dan penurunan tarif pajak. Be rdasarkan Undang Undang 36/2008, tarif pajak korporasi telah diubah dari tarif marginal menjadi tarif tunggul. Sehingga tarif korporasi menjadi 25 persen untuk tahun fiskal 2010 dan seterusnya, atau mengalami penurunan 3 persen ketimbang 2009. “Sementara pertumbuhan kredit yang dialami BCA selama 2010, mengalami kenaikan 24,2 persen, dari Rp 112,7 triliun di 2009 menjadi Rp153,9 triliun,” kata Presdir Bank BCA DE Setijoso dalam paparan kinerja 2010. (j03)

BURSA

TRAVEL/ WISATA

PUSAT PENGOBATAN SPESIAL ALAT VITAL

BURSA

BURSA

PROPERTY

Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik RUMAH Dijual Jl. Amaliun/ Jl. Santun No. 12/ 16 Medan, Jl. Menteng 7 Gg. Amal Medan, 0852.6214.0332 0813.7020.7611

RUMAH Baru dijamin murah model 2 KM, KT, SHM, MInimalis di Jl. Purwosari Krakatau, Hrg Rp. 220 Jt/ damai Hub. 0821.6603.3261

RUMAH BARU

Disewakan/ Dijual Jl. Bilal Gg. Krisna Dalam, U. 5x16m, L. Keramik, PLN, Air sumur bor Sertifikat Hub. 0813.6211.2998

RUMAH DIJUAL

Perum. Taman Karya Kasih Indah B-5 Medan Johor, LT. 8x15m, Type 55, SHM, PLN, PDAM, Telkom, AC, 2 KT, 1 KM, 1 Set Sofa Rotan, 2 Set Lemari pakaian, Gorden Jendela, Teras full canopy Hub. 085270016407 - (061) 7627.0684 no SMS

RUMAH DIJUAL

Jl. Cempaka Perum. ACM (Anddreas Cempaka Madani) Blok A No. 2 Gaperta Ujung, Ukuran 10x20m HP. 0813.9655.3865

GRIYA SEJARAH 140 JT

RUMAH PERMANEN DIJUAL

Uk. 11x22, RT 1, KT 3, KM 3, R. Sholat 1, Dapur, Garasi besar Jl. Gatsu depan Kodam I BB, H. Nego Hub. 0812.6477.946 - (061) 847.3165

RUMAH Dijual, LT 185M2, LB +/- 120M2, 3 KT, 2 KM, Full Keramik, Lux, Marelan Psr. IV Barat, Komp. Griya Bestari Permai. Blok A No. 6 Hrg. 275Jt/Damai. Hub. 0813 7737 3601 TP.

Harian

WASPADA TANAH

TANAH Dijual dijamin murah !!! (B.U) di Tengah Kota Lokasi Krakatau Jl. Pasar 3 Gg. Melati Hanya 575 Rb/ mtr Uk. 25x31mtr Hub. 0852.6285.3118

TANAH DIJUAL

Jl. Eka Warni I 15x20m, SHM, Medan Johor, Jl. Bajak IV 10x28, 14x28m, Medan Amplas HP. 0812.6052.5263 - (061) 7656.0999

TANAH KAVLING SHM

UK. 7X29M : 76 JT UK. 11X29M : 120 JT JL. KSATRIA NO. 88 GAPERTA DEKAT SEKOLAH EKA PRASETYA Hub. 0852.6104.7308

TANAH DIJUAL

Tanah seluas 5,126m² (SHM, Pagar keliling, 4 Unit rumah, Lokasi Jl. Terusan -Bandar Setia Percut Sei Tuan Hubungi HP. 0812.600.42711, TP

Type 50 Minimalis, LT. 6x18, 2 KT, 1 KM, PAM, PLN, SHM, Rangka baja, Genting metal, Taman pagar klg Jl. Sejarah/ Karya Jaya, 10 menit dari Airport Hub. 0813.7676.9267

DICARI TANAH EKS PABRIK

DIJUAL SEGERA 2 (DUA) UNIT

TANAH KOSONG ATAU BEKAS PABRIK DENGAN LUAS ± 2 S/D 5 HEKTAR JARAK TEMPUH DARI LOKASI ± 30KM KE PUSAT KOTA MEDAN LEBIH DIUTAMAKAN JIKA ADA GEDUNG PABRIK

Rumah baru Siap huni (SHM), LT. 12,5x20m, Km Tidur 3, Km Mandi 2, T. Garasi, Model minimalis, Full keramik Alamat Kalpataru Komp. Pondok Surya Medan Telp. (061) 7787.7088 (061) 7654.1849

RUK ANCING PERJU ANGAN PERMAI UKOO PPANCING PERJUANGAN 3 TKT - COCOK UNTUK USAHA INTI KOTA DP 120 JT

Sedang dibangun 15 Pintu Ruko Jl. Perjuangan No. 92, Kawasan Pancing, LB. 4x16m, Row depan 7m, Fas. SHM, PLN, PAM, Pintu Press, Cocok untuk usaha, praktek dokter, Warnet, Pengangkutan, Gudang NB: 400meter dari Jalan Pancing, Ruko MMTC, H. 610 Jt, KPR Perbulan 6 Juta, Bisa bantu KPR, 2Tkt, Siap huni, 395 Jt, Sisa 13 Unit HUB: 7772.2123 - 7759.8123 HP HP.. 081.165.1123

HUBUNGI: 0815.3000.615 0812.635.7593 0812.6353.9795 TANPA PERANTARA

KREDIT - TUNAI

MATERIAL

Harian

Kapling Murah - Bunga 0% Khusus Muslim Rp. 15.000.000,(8x15m)

BURSA

KESEHATAN

DP 50% Sisa Rp. 7.500.000 (15x Angs: Rp. 500.000) Tanah Siap Bangun, Tinggi, Rata, Bebas Banjir. Lingkungan Muslim, Surat Dasar - Sertifikat Hak Milik Desa Telaga Sari Kec. Sunggal D/S 7km dari simpang DISKI (Jl. Binjai). 30 menit perjalanan ke USU, Amplas, Al-Azhar lewat pajak Melati. Ada Kapling Depan U Ruko 5x45m

WASIR/ AMBEIEN Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir

H.G.A. FACHRUDIN

Hubungi.

Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881

H. SALIMIK 0812 601 8160

Jl. Binjai Km. 15 (No. 7 AB (Amal Water)

BURSA

KLINIK

PUTRA PASUNDAN RAJANYA PENGOBATAN ALAT VITAL

BUSANA & ASESORIS

PECI MAHKOTA

ANDA GAGAL DITEMPAT LAIN...???

MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan

N

Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

Pasang Iklan Mini

“WASPADA” Telp: 061 - 4576602 TERAPI VITALITAS PRIA

WASPADA

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

Jadikan Pria Jadi Idaman Para Wanita

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL

Cucu Asli Mak Erot Bersama

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna

CALL CENTER: (021) 9862000 0878 8200 0020

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

DITANGANI LANGSUNG

BPK. HARYONO

ASLI DARI BANTEN IZIN DINKES 448/503/III/2008

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI

KLINIK KECANTIKAN AURA PENGOBATAN ALTERNATIF

Hj. AJENG IMAS ADAWIYAH HP. 081374195333 - 085275925588 AHLI KECANTIKAN DARI KOTA BANDUNG

PERAWATAN WAJAH

GURAH KEWANITAAN

- Mengeluarkan Aura (Cahaya Wajah) - Merapatkan vagina - Memperindah Wajah untuk keharmonisan - Memutihkan Kulit Wajah suami-istri - Mengencangkan kulit - Mengatasi keputihan - Mengatasi jerawat/ flek-flek hitam - Mengobati infeksi rahim/ kanker - Mengatasi penyakit kulit rahim/ kista - Menggunakan Cream Sarang GURAH HIDUNG Burung Walet - Melancarkan saluran pernafasan PERAWATAN TUBUH m e m b u a n g l e n d i r- l e n d i r y a n g -Melangsingkan Badan mengandung virus dan membersihkan nicotin, Memerdukan suara -Menaikkan Berat Badan -Mengencangkan Payudara - Keharmonisan Suami/ Istri - Sinusitis MEMPERINDAH WAJAH - Alergi / Asma BUKA SETIAP HARI - Memancungkan Hidung - Penghasihan DARI JAM 09.00 S/D - Membentuk Dagu - Pelaris 20.00 WIB - Membentuk Bibir DENGAN IZIN ALLAH, KAMI INSYA ALLAH SIAP MENGOBATI?: Amandel, Polip tanpa operasi, Kanker payudara, Ginjal, Masalah keturunan, refleksi kaki / badan. Nomor Izin Dinkes: 448/3327/VI/2004 Buka Praktek di Medan:

Jl. Puri Ujung No. 206 Simp. Ismaliyah

Banda Aceh: Jl. Kuta Alam No. 18 Dpn RS Kesdam Bireun/ Aceh Jl. Asrama Putri No. 16 Kp. Baru (0644) 324922 Rantau Prapat WISMA PUTRI. Jl. SM. Raja Tgl. 2 & 4 Setiap bulan Telp. (0624) 23188

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

Jaya. “Sedangkan sejumlah kabupaten/kota lainnya saat ini masih dalam tahap sosialisasi,” katanya. Sementara itu, Direktur Perusahaan Daerah Pembangunan (PDP) Bireuen Kesuma Fachrida memfasilitasi program tersebut mengatakan, tujuan sosialisasi program konversi minyak tanah ke LPG 3 kg, untuk membekali masyarakat dalam menggunakan LPG bersubsidi pengganti minyak tanah. “Ha r a p a n k i t a d a p a t berjalan dengan baik di Kabupaten Bireuen seperti kabupaten/kota lainnya di Aceh,” pungkasnya. (amh)

Pengusaha Bus Batubara Maksimalkan Pelayanan LIMAPULUH(Waspada): Kalangan tokoh masyarakat maupun pengguna jasa angkutan umum di Batubara meminta pengusaha beserta jajaran bergandengan tangan menciptakan pelayanan terbaik kepada masyarakat sehingga mereka merasa lebih aman dan nyaman setiap bepergian. ‘’Ini merupakan bagian dari pelayanan yang harus dijalankan bersama oleh usahawan bus dengan menghindari gontok-gontokan. Apalagi sampai membuka kelemahan dilapangan sehingga membuka peluang bagi pihak tertentu mencari keuntungan,’’ tukas Asbullah, Jhon Adek dan Syahrul tokoh masyarakat Tanjungtiram dan Talawi kepada Waspada, kemarin. Dalam pengamatan di lapangan saat ini mencapai empat usaha otobus Antar Kota Dalam Provinsi (AKDP) yang berbeda melayani trayek ke berbagai daerah mulai dari Tanjungtiram, Tebingtinggi, Medan, Pekanbaru, Dumai, Padangsidimpuan dan Sibolga. ‘’Ramainya usaha otobus ini tidak lain bertujuan untuk memberikan pelayanan kepada masyarakat yang mau bepergian keluar daerah,’’ujarnya. Asbullah yang selama berprofesi sebagai sopir mengatakan terjadinya persaingan antar angkutan umum di Batubara dipicu kecemburuan sosial adanya usaha otobus dapat menyediakan angkutan melayanani masyarakat penumpang melebihi dari jumlah plafon ditentukan. Di samping terjadinya kesemrawutan pengaturan trayek karena belum adanya terminal khusus di Tanjungtiram dalam mengkordinir maupun mengatur jadwal keluar masuknya angkutan umum yang beroperasi. (a13)

Warga Perupuk Pertanyakan Raskin LIMAPULUH (Waspada) : Ribuan keluarga miskin (Gakin) di Desa Perupuk Limapuluh, Batubara, mempertanyakan sudah dua bulan mereka belum dapat jatah beras miskin. Menurut warga Perupuk, Kamis (31/3), tidak diketahui penyebab macetnya distribusi jatah raskin Februari, Maret 2011 sampai hari itu belum disalurkan. Johan, warga Dusun IX Perupuk mengatakan, sudah tiga bulan tak dapat raskin tak jelas mengapa warga miskin dibiarkan begitu saja. Karena warga desa jiran (Gambuslaut,Guntung) jatah raskin berlanjut terus. Warga juga mengaku tak pernah diarahkan membayar harga raskin dulu, biasanya warga membayar saat raskin dibagibagi. Sebaiknya pihak aparat desa mengusahakan dana mengambil raskin di Bulog. Kepala Dusun III Perupuk Samsul mengatakan, warga sudah 3 kali tak dapat raskin. Adlin petugas Bulog Kisaran dikonfirmasi melalui telefon selular, Kamis (31/3) mengaku masalah raskin jatah di Desa Perupuk disebutkan raskin untuk Februari dan Maret 2011 belum diambil. “Kami melayani pendistribusian raskin sistem bayar tunai, terakhir jatah Januari sudah diambil,” terang Adlin. (a12)

B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Espass 1.6 Thn. 2006. W.Silver, body kaleng, BK Medan atas nama sendiri. Mesin sehat, terawat. Hrg. 48Jt. Nego !!!. Hub. 0812 6581 379 DAIHATSU Espass Thn. 97/98. W. Biru metalic, AC, VR, BR, Tape. Kondisi sangat mulus. Pintu sorong. BK 1 tahun lagi. Harga 35,5Jt. Hub. 0821 6604 1073 DAIHATSU Espass Pick Up Thn. 2004. Bak Mega Cargo. 3 Way Super Jumbo Buka kanan kiri. Hitam mulus, seksi, bagus sekali. Body kaleng, mesin sehat, siap pakai. BK Medan Asli. Rp. 43 Juta/Nego. 0812 6578 790 - 777 88 647 NEW DAIHATSU READY.

New Xenia VVTi...............................DP 10 Jt-an New Terios TS....................................DP 15 Jt-an Gran Max PU & MB...........................DP 10 Jt-an Dapatkan diskon & MB...................DP 10 Jt-an Dapatkan Diskon & hadiah Hub. Gery 0813 7694 1988 / 061-77722561

HYUNDAI Accent GLS Thn. 2000. W. Hijau. Over Kredit, Balik DP 23 Jt. Angs. 1,6x25 bln. Cash: 58Jt, BK Mdn, AC, DVD, Sound Alarm. Hub. 0811 656 313 (Nego)

HONDA CITY 1.5 I THN. 98 W. Hitam, AC, Tape, VR, BR, BK Medan Asli, sgt mulus, sehat, original. Harga: 77Jt. Hub. 0813 7618 8118 HONDA Prestige 86 Akhir Dijual Cepat. Warna hitam, AC Dingin, PW, Alarm, EM, Pajak mati 6 tahun. Harga 14,5Juta/ Nego. Hub. 0812 6005 0006

HONDA Jazz 2004 Akhir. IDSI At Matic 1 tgn BK Asli Mdn Jok kulit. DVD AC. Hub. 0812 6392 7300 DIJUAL SALAH SATU Panther High Grade 95. Biru met, Cat mulus, jok baru, lengkap. H. 65/Nego Panther Grand Deluxe 95 Merah met, cat mulus, jok baru, PW. H. 63/Nego Panther Total Assy 93. Hijau, cat mulus, jok baru, P. Window, alarm. Hub. 0812 6568 818 / 7730 5875 H. 53/Nego.

MITSUBISHI Lancer Thn. 82 W. Biru, BK Mdn, AC, Tape, BR, VR, Alarm, mulus, siap pakai. Hub. 0852 6192 7756 MITSUBISHI Lancer SL ‘84 Dijual (Belum Banci). Warna Hijau, AC, Tape, Ban 15, mulus, mesin ok. Harga 18 juta/Nego. Berminat Hub.: 0812 6322 9958, 061-7708 5838 MITSUBISHI Kuda, Diesel Super Exceed Thn 2000, W. Hitam Met, Mulus, Lengkap, Siap pakai, Hrg nego Serius hub. 0812.6415.8848 MITSUBISHI 100% BARU Angs Rp. 3 Jt-an...bawa Pulang L300, (Ready Stock)...Pajero, T120SS L200 Triton, Cold Diesel 74, 73 dan 71 PS. Serius Hub. 0812 653 3319 dan 081 370 765 319

DIJUAL BU

Opel Blazer Thn. 2005 Chevrolet DOHC. VR, Ban Ukrn. 30 Saviro. Kondisi siap pakai. Rp. 78Jt. Hub. 0813 6142 4249 - 0878 6887 7769 OPEL Blazer ‘97. W. Silver, BK Asli Medan, orisinil. Lengkap. Balek DP 25Jt Sisa 1.140.000 x 26 bulan. Harga Cash 50Jt. Hub. 0812 6477 946

SUZUKI Forsa Thn. 90. Warna ungu Full Modifikasi Full Audio. Kondisi ok. Harga 26Jt/Nego. Hub. 0617729 5685 / 0812 6036 8620 DEALER RESMI SUZUKI MOBIL PU 1.5 DP 4 Jt-an Angs. 3.272.000,APV GX Arena DP. 10 Jt-an Angs. 4.058.000,Splash GL DP 4 Jt-an Angs. 3.839.000,Swift ST DP 6 Jt-an Angs. 4. 484.000,SX4 DP 9 Jt-an Angs. 5.161.000,Hub. 0812 654 0809 / (061) 77722121

SUZUKI Escudo 2.0 Thn. 2003. Hitam, BK Mdn Asli Rp. 119Jt. Hub. 0813 7508 8798

5 CM 6 CM

Rp. 65.000 Rp. 78.000

TOYOTA Kijang Krista 2001 Diesel W. Silver. 0813 6212 2339 TOYOTA Kijang Grand Rover Diesel Thn. 98. AC, Tape, VR, PS, PW, CL, Jok kulit. Biru, BK Mdn Mutasi Rp. 70Jt Net. Hub. 0812 6594 2789

TOYOTA Kijang Super G ‘94. Long. Abu2 metalik. Mobil bagus. Komplit, BK Medan. H. 65Jt. Net. Jl. Mahameru 44 Mdn. (Krakatau). 0812 6417 353. DIJUAL SALAH SATU 1.Kijang Commando Shot Thn. 88/89 5 Speed Remote, Alarm. H. 38Jt 2.ISUZU Panther Miyabi Thn. 94 AC, DB, PW, Remot Alarm. P. Steering. Tape. H. 45Jt. 3.Isuzu Panther Bravo cruiser Thn. 94. P. Steering, AC DB, PW, C. Lock, Remot. H. 45Jt. Hub. Ibu Hajjah Mualimah. HP. 061-7757 2509 - 0852 9641 9220

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000

BURSA

RENTAL MOBIL RENTAL MOBIL Avanza, Xenia, Terios, APV, Bisa Mulai Jam 5 pagi. Untuk pesta, dll. 061-6994 7749 Cabang: S. Raja, Sei Bt. Hari. Mandala, RS. Adam Malik RENTAL MOBIL MURAH 1 Hari Rp. 250.000. Hubungi: 061 664 77734, 0852 9616 6601. Maaf Tanpa Perantara.

BURSA

GENERATOR

11 CM Rp. 165.000 12 CM Rp. 180.000

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di

061-4576602. Terimakasih

TOYOTA Capsul LGX Dijual. Silver, Thn. 2000. Diesel. BK Medan Kota. Original. Body kaleng, full musik, LCD, Km. 24.000. Harga 127Jt. Hub. 0821 6085 5592 - 0813 7517 6777

PHOTO COPY

TOYOTA SE Salon 1986 sehat/lengkap. Mulus luar/dalam (originil) siap pakai. Hub. 061-77721957 - 0857 6250 9957 TIMOR OVER KREDIT MURAH

Thn. 97, AC Dingin, VR, RT, Mulus luar dalam, DOHC, Minyak Irit. Kembali DP 23Jt. Sisa 21 bulan. Ang. 1,4Jt. Hubungi: 061-66477734, 0813 9779 1077. Maaf Tanpa Perantara.

BURSA

BUTUH DANA

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik) BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0816.314.1807

BUTUH DANA CEPAT

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

KONSTRUKSI

WC WC 0813 6147 0812 WC JL. SETIA BUDI

0812 60444275

Hub. TUMPAT / SEDOT WC/GRANSI

Setia Budi

TUMPAT/ SEDOT

77442112

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

AMANAH UMROH IZIN USAHA: 503/1099.SK.HO/SL/NT/08

JADWAL HARGA UMROH TAHUN 2011/ 1432H UMROH REGULER 9 HARI USD 1700 APRIL, MEI UMROH REGULER 14 HARI USD 1850 APRIL, MEI UMROH + CAIRO 12 HARI USD 2300 MEI, JUNI HOTEL MADINAH : DALLAH TAIBA, AL-HARAM, SETARAF (5*) HOTEL MAKKAH

: JAWHARAT ANFAL, AL-BUSTAN, SETARAF (4*)

HOTEL JEDDAH : AL AZHAR (5*) JARAK HOTEL KE MESJID ±60 METER Khusus bagi jema’ah dari luar kota nginap di Hotel Madani Gratis Offic: Gedung Gelora Plaza Jl. SM. Raja No. 4/18 Medan Telp. (061) 7326981, 081375031889 Fax. (061) 7326981

BURSA

ELEKTRONIK

PAK ADI

JUAL & BELI Laptop, AC, TV, LCD, PS, Ampli, Spk, AC, Kulkas, Projector, Handycam, Camera, Keyboard, dll. UD SENANG HATI: 4517509 - 69677449- 76804949. Jl. Sekip 67 A

BURSA

HILANG/TERCECER

SERVICE

HILANG TEMBUNG

Surat Tanah Kec. Medan Denai I No. 03/SK-1 K/MD 1987. A/n. ISHAK. Yang terletak di Lingkungan XI Kel. Indra Kasih Kec. Medan Denai. Luas +/- 10x20m

SURAT TANAH HILANG

An. Hj. Gayah No. Set Bupati Deli Serdang No. 17327/A/ I/9 Tgl. 11 Okt. 1973. Dan Surat Pernyataan Ahli Waris Tgl. 23 Mei 1998

Ingin Promosikan Produk Anda

ELEKTRONIK

AC AC

MADINA SERVICE

Isi Freon - Cuci - Perbaikan Bkr Pasang dan Spare Parts AC - KULKAS - MESIN CUCI Hub.061-7797 2065 0813 6149 7921

SERVICE BERGARANSI

Cuci AC, Isi Obat/Freon Bongkar Pasang AC Hub. 0813 7536 4412

7767 7220

BURSA

PERCETAKAN

Harian

WASPADA

WC

11H Umr oh + Cair o Ale xandria Umroh Cairo Alexandria a’ Mi’ Isra’ Mi’rr aj di Masjidil Aqso 12H U + Isr 12H Umr oh + Tur key Umroh urk 15H Umr oh + Dubai & Mar oco Umroh Maroco 11H Umr oh R amadhan Awal Umroh Ramadhan 17H Umr oh R amadhan Akhir Umroh Ramadhan 10H Span yol & Tur ke y Muslim Tour Spany urk

Segera Mendaftar ke: JL. DR. MANSYUR NO. 9B

(Sebelah Cikal USU) Medan Telp. (061) 8222800 (Hunting) - (061) 77477888

BURSA

CV MEGA LINTAS NUSA MEMBUKA

STYLER BREAKER

D/P RINGAN + CASH BACK 15 JUTA Hadiah PARKING SENSOR + KACA FILM SOLAR GARD Kredit 1 s/d 4 Tahun Bisa Tukar Tambah

KREDIT VIA:

Hubungi Dealer

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

MINI & EFEKTIF IKLANKAN PRODUK ANDA

CD

KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)

TELP. (061) 457.6116 - 451.2319 0813.6137.2321 - 0812.6495.8456

BIRO PERJALANAN

UMROH & HAJI PLUS PERJALANAN MULAI FEBRUARI - AGUSTUS 2011

PAKET

UMRAH REGULER UMRAH REGULER UMRAH + DUBAI + TURKI UMRAH + MAROCCO + SPANYOL UMRAH + BRUNEI UMRAH LIBURAN SEKOLAH UMRAH SYA’BAN UMRAH + AQSHA UMRAH AWAL RAMADHAN UMRAH FULL RAMADHAN UMRAH AKHIR RAMADHAN

BURSA

KESEMPATAN BERKARIR

DIBUTUHKAN

Peluang berkarir perusahaan Industri Bisnis & Perdagangan yang bekerja sama dengan Australia membutuhkan SDM yang berpotensi untuk pembukaan kantor cab. baru di wilayah Sumatera akhir tahun akan dioperasikan dengan pilihan posisi: Manager, Asst. Manager, Supervisor & Staff, Siap di Training untuk semua posisi Syarat-syarat: - SMU sederajat, Diploma, S1 (Prioritaskan 2008 ‘9) - Foto copy Ijazah, FC KTP, Pas photo & Surat Lamaran kerja - Umur maksimal 25 thn/ belum menikah & tidak sedang bekerja Lamaran dibuka setiap hari dari Pkl. 10.00 s/d Pkl. 15.00 Wib ke: RAFFISINDO GROUP Alamat: Bambuan arah Pajak Baru Jl. Antara No. 9 Stabat, Gratis tidak dipungut biaya !! mendesak!

Lowongan Kerja

Kami group perusahaan yang sedang berkembang dan ekspansi membuka kesempatan berkarier untuk posisi:

LOWONGAN DIBUTUHKAN

2 orang Tk. Pangkas, Jujur & Dapat dipercaya 60:40, Kondisi banyak langganan dijual juga Alat² pgks komplit Hub. 9158.3383

DIBUTUHKAN WANITA (gadis/ janda), Jaga anak, Prwt orang sakit, Gaji 700 1,4 Jt Hub. “CAHAYA” 0813.9743.5579

Tkg. Pangkas Muslim Ada jaminan, Full AC Hub. 0812.604.4564

PT. Bank Perkreditan Rakyat Bina Barumun. Perusahaan yang Bergerak di Bidang Keuangan/ Perbankan Membutuhkan Segera Tenaga Kerja /SDM untuk Ditempatkan di Bagian 1.Direksi (D) 2.Internal Control (IC) 3.Kabag Operasional (K.Ops) 4.Kabag Marketing ( KM ) 5.Costumer Servis ( CS ) 6.Security ( SC ) Persyaratan Umum : 1.Pria dan wanita berpenampilan menarik 2.Minimal D III ( Segala Jurusan ) 3.Dapat Mengoperasikan Komputer Persyaratan Khusus 1.Direksi : Mempunyai Sertifikasi Direksi BPR Konvensional 2.Internal Control : Min D III Akuntansi, Menguasai Bidangnya 3.Kabag Operasional : Pengalaman Min 2 thn dan Menguasai Akuntansi. 4.Kabag Marketing : Pengalaman Min 2 Thn 5.Costumer Service : Umur Max 27 Tahun 6.Security: SLTA – Memiliki SIM A, Umur Max 27 Tahun Lamaran lengkap + pas foto terbaru paling lambat kami terima tgl : 11 April 2011 Cantumkan kode Posisi yang dilamar dan No Hp. Yang bisa dihubungi PT.BPR Bina Barumun Jl Jend. Sudirman No 29. Sibuhuan Kec, Barumun Kab. Padang Lawas Tlp : 0636 - 421064

JUMLAH 16 HARI 11 HARI 14 HARI 16 HARI 12 HARI 11 HARI 11 HARI 15 HARI 12 HARI 30 HARI 14 HARI

BERANGKAT 01 MEI 2011 01 MEI 2011 01 JUNI 2011 01 JUNI 2011 25 JUNI 2011 25 JUNI 2011 10 JULI 2011 10 JULI 2011 30 JULI 2011 30 JULI 2011 15 AGUSTUS 2011

Jl. Jamin Ginting No. 119 Pancur Batu 20353 Phone: (061) 7780.3003 Fax. (061) 836.2060 Mobile: 0812.605.8936 E-mail: rosaktour_mdn@yahoo.com

Media yang Tepat untuk Iklan Anda

PELUANG BISNIS

FD

HUB: JL. TITIPAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING MEDAN

WASPADA

Hub. 8219951 Jl. Setia Budi No. 2

Telp: 061 - 4576602

Berpengalaman, Profesional

Ingin Promosikan Produk Anda Harian

HP.

“WASPADA”

Media yang Tepat untuk Iklan Anda

09 Mei pr,, 04 Mei 13 Apr 29 J un, 15 J ul Jun, Jul 18 Mei & 27 J un Jun 27 J un Jun 24 J un Jun 26 J un Jun 01 Agt 15 Agt 10 Mei

UMROH PAKET HEMAT RP. 13,5 JT

ANDA TUMPAT - SEDOT

Pasang Iklan Mini

MEMBER OF ASITA

1. UMROH REGULER 9, 13 HARI APRIL - MEI (AWAL PERTENGAHAN AKHIR) 2. UMROH PLUS CAIRO - MESIR 10 APRIL 3. UMROH PLUS AQSHO 10 MEI 4. UMROH PLUS TURKEY APRIL - MEI 5. MANASIK HAJI MULTAZAM SABTU - MINGGU (MESJID AGUNG JL. DIPONEGORO MEDAN) 6. MENGAMBIL PORSI HAJI CUKUP RP. 10.000.000 7. ONH KHUSUS / PLUS 8. SETIAP KEBERANGKATAN DIBIMBING USTADZ BERPENGALAMAN

IZIN DEPAG NO. D658 TAHUN 2010

09H Umr oh dan Ziar ah Umroh Ziarah 11H Umr oh + Bahr ain (Hr g=R e guler) Umroh Bahrain (Hrg Re

Jl. BRAYAN MEDAN

PELATIHAN MEMPRODUKSI DETERJEN, CUCI PIRING, CUCI TANGAN, PEL LANTAI DLL UNTUK LEMBAGA: KOPERASI, PONPES, PNPM, KARANG TARUNA, PENSIUNAN, CALON PEBISNIS DLL MELIPUTI: TEORI + PRAKTEK + PENDAMPINGAN PEMASARAN HUB: 0812.2797.395 - 0856.4334.5336 Tempat Pelatihan Menyesuaikan Domisili Peserta

UMROH MULTAZAM

GELORA INDAH Tour & Travel

WC 0812 642 71725

MOBIL SEDOT

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Orang Bijak akan memilih Penyelenggara Umroh yang Berizin

Jl. Gatot Subroto Medan Ada Garansi

TOYOTA Corolla All New 96. Mobil mulus, siap pakai. Warna hijau metalic, AC, PW, CL, Tape, VR, BR, BK Medan Asli. Tanpa perantara. Harga Rp. 70 Nego Hub. 0813 622 60370

TOYOTA Kijang Super G Thn. 94. Warna Abu2, AC, TP, VR, BR, PW, PS Long. Mulus, siap pakai. Harga Rp. 60Jt/Nego. Hub. 0813 6101 8855

BURSA

BURSA

DICARI Mobil Over Kredit Avanza / Innova/L300 PU/ Carry PU. Cash Pun OK! H. Saiful 0811 613107 / SMS TOYOTA Kijang Super G Short Thn. 1996. BK Mdn Asli, lengkap. Siap pakai. Originil. Hrg. 70 Jt/damai. Hub. 0812 6545 1974

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Jumat, 1 April 2011

LOWONGAN KERJA

Kabag. Operasional Peternakan (OP)

Dengan syarat sbb: - Pria, maks. 35 tahun - Berpengalaman kerja min. 1 tahun - Pendidikan: Dokter Hewan/ Sarjana Peternakan/ S1 Manajemen - Memiliki SIM A atau SIM C - Dapat mengoperasikan komptuer min. Microsoft Office - Ulet, jujur, bertanggung jawab, mau belajar dan berjiwa memimpin

Chief Accounting (CA)

Dengan syarat sbb: - Wanita, maks. 35 tahun - Memiliki pengalaman min. 1 tahun di posisi/ bidang yang sama - Pendidikan: Min S1 Accounting - Menguasai prinsip akuntansi yang berlaku umum di Indonesia - Dapat mengoperasikan komputer min. Microsoft Office - Ulet, jujur, bertanggung jawab, dan berjiwa memimpin Surat lamaran lengkap dan pasphoto 4x6 (satu lembar) ditujukan ke:

JL. PABRIK TENUN NO. 84B MEDAN

Paling lambat 1 minggu setelah iklan ini

LOWONGAN KERJA

Di Toko Kelontong, Wanita, 18 s/d 24 thn, Aq Islam, Rajin, Pembersih, Jujur/ Sopan, Tinggal di tempat kerja, diutamakan penduduk luar kota Medan Hub. 0821.6049.7202

DICARI PERSONAL/ MAHASISWA Yang bisa buat proposal lingkungan hidup UKL-UPL untuk industri es balok lokasi di Sibolga Hub. 0852.7734.9878

DICARI

SARJANA PERPUSTAKAAN, Kwalifikasi: S1, Berpengalaman, Lamaran: CV, Pas photo diantar ke: UNIVERSITAS DHARMAWANGSA Jl. KL. Yos Sudarso No. 224 Medan Telp. 661.3783 - 663.5632

MEMBUTUHKAN SEGERA

Seorang Cleaning service, syaratnya: Pria, memiliki SIM, Sanggup kerja shift, Usia 18 - 24 tahun, Minimal tamatan SMP, bersedia Ijazah di tahan, Tidak sedang kuliah, Tidak bertato, paling lambat satu minggu Lamaran diantar langsung ke: APOTIK K24 Jl. Kapt. Muslim No. 26

BURSA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Ekonomi & Bisnis

B8

WASPADA Jumat 1 April 2011

Nelayan T.Balai Beroperasi Di Laut Asahan Rugikan Pemkab BAGANASAHAN ( Waspada) : Penangkapan ikan yang dilakukan nelayan Tanjungbalai di wilayah perairan Asahan dinilai telah merugikan Pemerintah Kabupaten. “Penangkapan ikan di laut kita jelas merugikan bagi Kabupaten Asahan,” ungkap Bupati Asahan Taufan Gama Simatupang dikonfirmasi Waspada di sela-sela pemusnahan barang bukti oleh Kejari Tanjungbalai di Baganasahan, Kamis (31/3). Dikatakan Taufan, kerugian itu berupa pemberian izin berlayar kepada nelayan yang akan melakukan aktivitas penjaringan ikan di laut Asahan. Dia jelaskan selama ini pemberian izin pelayaran dan penangkapan ikan di wilayah perairan Kabupaten Asahan

masih dikelola Pemerintah Kota Tanjungbalai, sehingga dalam waktu dekat Taufan merencanakan akan mengambil alih kewenangan tersebut. “Bagaimana bisa Pemko Tanjungbalai memberikan izin berlayar kepada nelayan, sedangkan mereka sendiri tidak memiliki laut. Yang punya perairan kan Asahan, jadi kita yang memberikan izin,” ujar Taufan menambahkan dengan beralihnya kewenangan itu kepada Pemkab, maka Pendapatan Asli Daerah Pemkab Asahan diharapkan dapat meningkat. Sementara Kepala Dinas Perikanan dan Kelautan Kota Tanjungbalai M Syafii sehari sebelumnya saat digelar audiensi Asosiasi Nelayan Indonesia

(ANI) dan Forum Komunikasi Nelayan Tradisional Bersatu (FKNTB) di Gedung DPRD Tanjungbalai membenarkan, Pemko Tanjungbalai tidak memiliki laut, namun mayoritas masyarakatnya berprofesi sebagai nelayan dan mencari ikan di perairan Asahan. Akan tetapi tambah Syafii, dalam waktu dekat, pihaknya akan bekerjasama dengan Pemkab Asahan dan Batubara untuk mensosialisasikan kepada nelayan menyangkut perizinan pelayaranan, peralatan tangkap ikan sekaligus memberitahukan peraturan zona larangan berlayar bagi setiap jenis kapal agar nelayan memahami tentang peraturan dan hukum di laut. (a32)

Batas Akhir Penyampaian SPT, Warga Padati Kantor Pajak Waspada/Rasudin Sihotang

KAPAL nelayan Tanjungbalai tengah bersandar di Pelabuhan Teluknibung. Biasanya, kapal-kapal itu mencari ikan di wilayah perairan Kabupaten Asahan. Foto direkam beberapa waktu lalu.

Mobil Pribadi Antri Premium Siap Disindir JAKARTA (Waspada): Berbagai cara diambil PT Pertamina (Persero) untuk mensosialisasikan penggunaan bahan bakar minyak (BBM) jenis Pertamax pada masyarakat. Salah satunya melalui pelatihan operator pemilik Stasiun Pengisian Bahan Bakar Umum (SPBU). “Nanti di SPBU ada imbauan dan melatih operator untuk bilang ‘mulai dari nol ya”, dan kalau ada mobil masuk ke Pre-

mium, maka operator akan bilang ‘tidak salah nih’,” kata Direktur Pemasaran dan Niaga Pertamina, Djaelani Sutomo, di Jakarta, Kamis (31/3). Menurut Djaelani, kampanye ditempuh oleh Pertamina ini bertujuan agar kuota konsumsi Premium pada tahun ini tidak melampaui jatah sudah disiapkan. Selain melalui teguran halus dari operator SPBU, bentuk kampanye lain akan ditempuh Pertamina dengan memasang spanduk-spanduk di seluruh SPBU Jabodetabek berisi imbauan untuk membeli BBM jenis Pertamax. Kampanye lewat tulisan ini akan dilaksanakan mulai 1 April 2011.

Selain itu, Pertamina mulai menyiapkan kampanye berupa imbauan dalam setiap struk pembayaran transaksi BBM. Dalam struk tersebut, Pertamina mengampanyekan penggunaan Pertamax dengan menuliskan kalimat “Premium Adalah untuk Orang yang Berhak Memakainya, dan Jangan Salah Gunakan BBM”. Djaelani menambahkan, perusahaan juga akan segera membatasi pasokan kuota Premium untuk SPBU terletak di sepanjang jalan bebas hambatan. Sebab, kebanyakan mobil yang lewat merupakan kendaraan pribadi. “Secara bertahap akan kami kurangi Premium untuk fokus ke

Mentan Minta Pemilik Kebun Sediakan 10 Persen Lahan Pangan MEDAN (Waspada) : Kementerian Kehutanan diminta akan mewajibkan setiap perusahaan perkebunan baik swasta maupun Badan Usaha Milik Negara (BUMN), menyisihkan 10 persen dari luas arealnya untuk tanaman pangan. Kebijakan sudah dirancang pemerintah, salah satu langkah mengantisipasi krisis pangan bisa terjadi di masa mendatang akibat menyusutnya lahanlahan pertanian tanaman kebutuhan pokok. Demikian penegasan Menter i Pe rtanian (Mentan) Suswono menjawab wartawan di VIP room Bandara Polonia Medan, Rabu (31/3) malam, menjelang bertolak ke Jakarta. Ke depan, katanya, Menteri Kehutanan mengharuskan perkebunan menyisihkan 10 persen dari arealnya untuk tanaman pangan. “Ya, perkebunan swasta dan PTPN,” kata Suswono di Medan bersama Menko Perekonomian Hatta Rajasa menghadiri semarak 100 tahun industri kelapa sawit. Menyinggung tentang moratorium yang didesak anggota

DPR RI Anton Sihombing agar pemerintah menghentikan penambahan lahan baru kelapa sawit, menurut Suswono, moratorium untuk penghentian pemberian areal baru untuk lahan kelapa sawit itu, sementara ini masih sebatas di lahan hutan alam primer dan hutan tanah gambut.. “Moratorium itu lebih ke hutan alam primer dan lahan gambut, kita sudah membuat peraturan Menteri Pertanian menegaskan misalnya lahan gambut kedalamannya sampai tiga meter tidak boleh untuk perkebunan, namun untuk konservasi,” katanya.. Dia mengakui produksi pertanian utamanya tanaman pokok seperti beras memang dipengaruhi berkurangnya lahan-lahan pertanian disebabkan banyaknya peralihan fungsi dari areal tanaman pokok menjadi kelapa sawit. Untuk itulah, kata dia, program Menteri Kehutanan itu untuk mengajak perusahaan sawit swasta dan PTPN ikut menanam tanaman pokok di areal kebun sawitnya.

Moratorium atau penghentian perluasan lahan kelapa sawit itu pun kata Mentan, kemungkinan belum bisa sepenuhnya dilaksanakan, karena masih ada langkah-langkah antisipatif. “Ada pemetaan seluruh daerah, mana potensi yang cocok untuk lahan pertanian, mana yang cocok ditanami sawit, karet dan lain-lain,” katanya lagi. Namun Suswono dengan tegas mengatakan, pemerintah saat ini memang berorientasi untuk lebih mengembangkan lahan-lahan pertanian baru ketimbang lahan perkebunan. Salah satu program pemerintah untuk itu, kata Suswono, adalah pembukaan lahan baru sekaligus pemberian lahan kepada petani dengan memanfaatkan lahan-lahan tidur atau terlantar. Program itu menurutnya belum terlaksana karena Badan Pertanahan Nasional (BPN) masih mengalami kesulitan untuk mendata kepastian areal lahan terlantar dan di sisi lain kesulitan mengeksekusi lahanlahan yang ada. (m32)

PLN Kit SBU Salurkan Dana P3L Rp329,4 Juta MEDAN (Waspada) : PT PLN (Persero) Pembangkitan Sumatera Bagian Utara (Kit SBU), selama satu triwulan I pada 2011, telah berhasil menyalurkan dana Program Partisipasi Pemberdayaan Lingkungan (P3L/CSR) sebesar Rp 329.495.000. Wilayah menjadi alokasi penyaluran dana tersebut meliputi Sumatera Utara, Aceh, dan Riau. Ketua Tim P3L PT PLN (Persero) Kit SBU Gunawan Sidabalok mengungkapkan luasnya wilayah penyaluran tersebut karena meliputi wilayah operasional PLN Kit SBU. “Di Aceh, ada PLTD Lueng Bata, di Propinsi Riau ada PLTA Koto Panjang dan PLTGTeluk Lembu dan beberapa pembangkit di Sumatera Utara, “ katanya ke wartawan di Medan, Kamis (31/3). Menurut Gunawan, secara umum, penyaluran dana P3L bersifat hibah dan diberikan

untuk masyarakat sekitar wilayah pengelolaan PLN Kit SBU dalam bentuk bantuan seperti korban bencana alam, pendidikan,pelatihan, sarana, prasarana umum, sarana ibadah, kesehatan dan pelestarian alam, dengan tujuan dapat meningkatkan taraf hidup warga sekitar. “Ini sesuai dengan visi P3L, yaitu, terwujudnya keharmonisan hubungan PLN dengan masyarakat di sekitar kegiatan PLN sehingga kondisi tersebut akan menunjang keberhasilan kegiatan PLN dalam menyediakan tenaga listrik bagi masyarakat, serta misi berupa membantu pengembangan kemampuan masyarakat di sekitar kegiatan PLN agar dapat berperan dalam pembangunan sehingga secara bertahap masyarakat akan mampu. Dan berbicara tentang P3L, ada empat komponen menjadi fokus PLN dalam penyaluran-

nya, yaitu, community relation, community service, community empowering dan pelestarian alam,” kata Gunawan. Community Relation, berupa kegiatan-kegiatan menyangkut pengembangan kesepahaman melalui komunikasi dan informasi kepada para pihak terkait. Community Services, berupa program bantuan diberikan berkaitan pelayanan masyarakat atau kepentingan umum. Community empowering, merupakan program-program yang memberikan akses yang lebih luas kepada masyara k a t u n t u k m e n u n j a n g kemandiriannya. Pelestarian alam, bertujuan menciptakan pelestarian alam sehingga tidak terjadi kerusakan alam akibat kegiatan manusia. “Khusus pada pelestarian alam, program ini sudah pernah dilaksanakan beberapa tahun lalu,” kata Gunawan. (m38)

Pertamax,” jelasnya. Libur sekolah PT Pertamina (Persero) berencana menambah impor premium untuk bulan Juni 2011, walau pun bahan bakar bersubsidi akan dibatasi. “Untuk mengantisipasi liburan sekolah, impor premium akan dinaikan menjadi enam juta barel,” ujar Direktur Pemasaran dan Niaga Pertamina Djaelani Sutomo saat ditanyai wartawan di gedung

Kementerian ESDM, Jakarta, Rabu (31/3). Djaelani menjelaskan, untuk mengantisipasi liburan kita menaikkan impor premium jadi enam juta perbarel. “Sedangkan untuk bulanbulan biasanya, kita hanya impor lima juta perbarel,” jelasnya. Sebagai informasi, untuk menjelang hari-hari besar biasanya pertamina mengimpor premium lebih banyak lagi, sekitar tujuh juta per barel. (vvn/okz)

Investor Sumut Keluhkan Kekurangan Listrik MEDAN (Waspada) : Investor masih mengeluh berusaha di Sumut, karena tidak terpenuhinya penyerapan arus listrik industri di daerah ini. “Sepuluh tahun ke depan perkembangan industri dan pertambahan penduduk di Sumut tidak seimbang. Sementara kebutuhan daya listrik di Sumut lebih kurang 10.000 mega watt (MW), saat ini daya listrik yang terpenuhi masih terbatas,” kata ketua Konsuil. B Ricson Simarmata, selaku Kepala Wilayah Komite Nasional Keselamatan Untuk Instalasi Listrik (Konsuil) Sumut menjawab wartawan di Bandara Polonia Medan menjelang bertolak ke Palembang, Rabu (31/3). Dia akan menghadiri seminar dan pemeran memperingati hari listrik (1-4/4), dilaksanakan direktur PLN wilayah barat. Kata Simarmata, selama ini para investor membuka usaha disektor industri di Sumut mengeluh tentang kekurangan arus listrik, namun keterbatasan itu selalu diupayakan maksimal. Pada seminar ini dia akan menyampaikan bagaimana ke

depan pemenuhan kebutuhan arus listrik diwilayah barat yang semakin hari makin meningkat perusahaan industri. “Selama ini Sumut kekurangan arus listrik, menyebabkan kalangan industri dan perhotelan mengeluh,” ujarnya. Mantan Rektor Universitas Nommensen Medan ini menegaskan Konsuil dan PLN dalam Undang-undang No. 30/2009 tentang Kelistrikan disebutkan semua instansi pemerintah, perkantoran, plaza dan pasar itu dalam pemasukan arus terlebih dahulu diperiksa oleh Konsuil, baru dapat dialiri listrik. Bila tidak diindahkan, maka pelakunya dihukum lima tahun penjara dan denda Rp 500 juta, berdasarkan aturan undangundang. Sementara rumah tangga setelah 15 tahun harus diuji kelayakan, termasuk industri harus memasang komponen listrik SNI. Hal itu terkait terjadi kebakaran seperti pusat pasar dan perkantoran, akibat banyak cantelan kabel sebabkan daya panas menjadi tinggi, memerlukan pemeriksaan ulang. (m32)

Dua Warga Medan Raih Hadiah Simpedes MEDAN (Waspada): Dua warga Medan Lasmina Sibarani dan Dwi Gatut Satriy nasabah BRI Medan iskandar Muda dan Medan Putri Hijau penduduk Medan meraih hadiah I uang tunai masing-masing Rp 100 juta pada penarikan undian simpedes Semester II/2010, di Restoran Kenanga Indonesia, Jl. Jamin Ginting Km 12,5 Medan Selayang, Selasa (29/3). Penyerahan hadiah I tersebut diserahkan langsung Pgs Pinca PT Bank Rakyat Indonesia (BRI) (Persero) Tbk Kanca Iskandar Muda Pgs Pinca Dadi Kusnadi dan Manejer Bisnis Mikro (MBM) Ary Juwono serta disaksikan ketua panitia Manuaran Sianturi dan Notaris Cah Ayu Tin Trisnawaty , Depsos Sumut, Kanwil BRI Medan serta unsur Muspika. Kata Sianturi, Lasmina Sibarani merupakan nasabah BRI Medan IskandarMuda puluhan tahun dengan No. Kupon 000222206478 menabung di BRI Medan Johor, sedangkan Dwi Gatut Satiy nasabah BRI Medan

Putri Hijau dengan No. Kupon 0002361841 menabung di Unit kerja BRI Pasar Sukaramai. Menyusul Maston Sihaloho nasabah dengan No.Kupon 00010146338 meraih hadiah II uang tunai Rp 75 juta. Kemudian tiga hadiah III uang tunai masing-masing Rp 25juta diraih nasabah Medan Iskandar Muda yaitu Nurasiah, Rosminah Dalimunthe dan Herman. Dan tiga hadiah II uang tunai masingmasing Rp 25 juta diraih nasabah BRI medan Putri Hijau yaitu Rehulina Tarigan/Sedia, Magdelena Br.Sijabat dan Rosmala Dewi Ginting.(m24)

MEDAN (Waspada): Hari terakhir, 31 Maret, penyerahan laporan SPT tahunan 2010 pajak orang pribadi mengalami peningkatan luar biasa oleh para wajib pajak di berbagai Kantor Pelayanan pajak terpadu Pratama Wilayah I Sumatera Utara dibandingkan dengan hari-hari sebelumnya. Karena apabila wajib yang dibuktikan dengan pemilikan NPWP , tidak menyerahkan SPT Tahunan pada batas waktu yang ditentukan itu akan dikenakan sanksi berupa denda Rp100 ribu. Kepala Humas Kantor Pajak Wilayah I Sumatera Utara Joni Purba dalam penjelasannya kepada Waspada Kamis (31/3) di Gedung Keuangan Jalan Diponegoro mengakui walau 31 Maret merupakan batasan penyampaian laporan SPT Tahunan bagi wajib pajak dari Orang Pribadi, namun masih akan ada kebijakan menyurati mereka yang belum menyam-

Kebun Kelapa Sawit Cukup 8 Juta Hektar MEDAN (Waspada) : Anggota Komisi IV DPR RI Anton Sihombing mengatakan, DPR RI akan tegas tahun ini dilakukan moratorium agar luas areal perkebunan kelapa sawit cukup sampai delapan juta hektar. Hal itu disebabkan lahan kebun sawit hanya didominasi petani berdasi dan di sisi lain akan mepersempit lahan pertanian, sehingga mengancam stabilitas produksi dan harga bahan pangan pokok belakangan ini sering terganggu. Menurutnya, data pemerintah yang menyebutkan 40 persen dari total luas areal perkebunan kelapa sawit di Indonesia yakni tujuh juta hektar merupakan milik petani rakyat patut dipertanyakan. Demikian penegasan Anton Sihombing menjawab wartawan di Bandara Polonia Medan menjelang bertolak ke Jakarta di Bandara Polonia Medan, Rabu (30/3). “Kita akan moratorium itu lahan kelapa sawit cukup hanya delapan juta hektar saja. Hampir 40 persen luas kebun sawit di Indonesia milik rakyat, rakyat mana, katanya.

Jadi kita minta inventarisir dulu yang 40 persen itu memang benar petani rakyat,” jelasnya. Banyak orang di daerah tahu persis perkebunan rakyat di daerahnya sebagai seremonialnya saja disebut punya petani tapi sebenarnya pemiliknya pengusaha berdasi. “Kalau areal perkebunan swasta memang itu milik pengusaha. petani berdasi itu pun bukan rakyat bumiputra, malah banyak petani berdasi dari luar negeri,” kata Anton Sihombing. Dia juga heran melihat perbedaan perhatian pemerintah terhadap para petani berdasi dibandingkan masyarakat yang benar-benar petani. “Lihatlah, kalau ada pertemuan pengusaha kelapa sawit Menko Perekonomian dan Menteri BUMN pun dating, sementara kalau kelompokkelompok petani mengadakan kegiatan, mungkin hanya Kepala Dinas Kabupaten saja yang datang,” ujarnya. Dia mengatakan rencana perluasan areal perkebunan sawit malah akan mengurangi

lahan pertanian yang memproduksi bahan-bahan kebutuhan pokok pangan rakyat seperti beras, sayur mayur, kentang, ubi, buah-buahan dan lain-lain. Di Sumut sendiri, kata Anton, tiap tahun terjadi pengurangan luas lahan pertanian akibat banyak lahan-lahan berubah fungsi menjadi areal perkebunan sawit seluas 4 hektar. “Ini kan gawat dan membuat rawan pangan, sementara di pihak lain kalau areal kebun sawit ditambah, yang mendapatkan keuntungan hanya segelintir orang,” katanya. Ketua DPP/Koordinator HKTI (Himpunan Kerukunan Tani Indonesia) Wilayah Sumut itu menambahkan, pemerintah untuk APBN 2012 akan mengucurkan dana untuk sektor pertanian sebesar Rp24 Triliun. Hal itu meningkat signifikan dibanding anggaran pertanian 2011 sebesar Rp13 triliun. Menurutnya, hasil lobi-lobi untuk meningkatkan anggaran membangun sektor pertanian, Sumut akhirnya memperoleh Rp 107 miliar bantuan dari Dirjen PLH Kementerian Pertanian tahun 2011.(m32)

Pelindo I Gelar Pasar Murah Di Belawan M E D A N ( Wa s p a d a ) : Sebagai upaya meringankan beban masyarakat dalam mendapatkan kebutuhan pokok dengan harga murah, Pelindo I yang merupakan Badan Usaha Milik Pemerintah menggelar pasar murah di Rumah Sakit Pelabuhan Medan di Belawan, Rabu (30/3). Pasar murah untuk masyarakat ini secara resmi dibuka walikota Medan diwakili Kepala Dinas Perdagangan Kota Medan Syahrizal Syarief. Dalam kata sambutannya mengucapkan terimakasih kepada Pelindo I atas terselenggaranya pasar murah. Menurut Syarief, Peko Medan sangat mendukung pasar

murah ini karena sangat membantu masyarakat yang saat ini mengalami kesulitan dalam membeli kebutuhan sehari harinya terutama dalam menghadapi kenaikan harga. Dengan pasar murah ini justru diharapkan dapat menekan terjadinya gejolak kenaikan harga. Pemko Medan mengharapkan pasar murah ini dapat dilaksanakan lebih banyak lagi. Senior Manajer Bina Lingkungan Pelindo I yang merupakan panitia dalam pasar murah, Ramli Simanjuntak melaporkan, gelar pasar murah ini merupakan bagian dari rangkaian kegiatan Forum Komunikasi (FK) BUMN Sumut dimana

Harga Emas Di Medan Jenis

2011. Mereka masih antri menunggu giliran untuk menyampaikan SPT Tahunan. “Kami harus sabar menunggu giliran kami karena memang sudah terlambat penyampaiannya dari dua bulan lalu diberi kesempatan melaporkan,” kata kata salah seorang warga yang mengaku sudah memiliki NPWP sejak dua tahun lalu, terutama dikarenakan ingin bebas fiskal yang sering bepergian melihat anaknya di Malaysia. Sementara di KPP Pratama Medan Kota terlihat hampir 40 orang personal dikerahkan untuk melayani warga yang hendak mengisi formulir dan menyampaikan laporan SPT Tahunan 2011. Mereka semua berada selain di counter biasa bagi pelalporan pajak, tetapi juga ditambah pada ruang belakang yang khusus untuk melayani masyarakat yang kurang mengerti mengisi formulir SPT Tahunan Orang Pribadi. (m22)

paikan SPT Tahunan tersebut untuk batas 14 hari, dan setelah itu akan langsung dikenakan sanksi denda. Mengenai jumlah wajib pajak orang pribadi yang menyampaikan SPT Tahunan 2010 pada 2011 ini, Purba belum bersedia mengungkapkan karena data masih belum diterima dan petugas di lapangan yang masih bekerja menerima laporan SPT tahunan orang pribadi. Dia sendiri mengaku di KantorWilayah Pelayanan Pajak Sumut I terdapat delapan Kantor Pelayanan Terpadu (KPP) Pratama yang meliputi, KPP Pratama Medan Kota, Medan Timur, Medan Barat, Medan Polonia, Medan Belawan, Medan Petisah, KPP Pratama Binjai, Lubuk Pakam. Dari pantauan Waspada, terlihat Kantor KPP Pratama Medan Kota dan Medan Polonia masih ramai dengan calon penyampaian SPT Tahunan

Kadar

Valuta Asing Di Medan

Harga

London Murni

99%

Rp398.000

London

97%

Rp386.000

24 Karat

90 s/d 93%

Rp360.000

Emas Putih

75 %

22 Karat

70%

Rp280.000

Suasa

20 s/d 35%

Rp195.000

Pelindo I termasuk didalamnya. Pasar murah ini menyediakan kebutuhan pokok yang telah berbentuk paket yang berisi lima kg beras jenis Kuku Balam, satu liter minyak makan merk Sania dan 1 kg gula pasir impor. Paket ini dijual kepada masyarakat dengan harga murah sesuai dengan ketentuan Menteri BUMN yang menetapkan harg a jual harus 20-25 persen di bawah harga pasar, sementara paket yang digelar Rp50.000. Harga ini lebih murah dibandingkan harga jual dipasaran Rp65.000 karena dalam pasar murah ini Pelindo I memberikan subsidi Rp30.000.000.(m35)

Rp310.000 (m38)

Mata Uang

Jual

Beli

Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

9.140 8.226 8.620 14.068 1.169 104,50 6.679 11.825 2.870

8.890 8.054 8.454 13.783 1.148 101,50 6.445 11.063 2.800

Aceh

C1

WASPADA Jumat 1 April 2011

Ombak Dan Angin Kencang Landa Selat Malaka IDI, Aceh Timur (Waspada): Ombak setinggi 3 meter lebih disertai angin kencang kembali melanda laut Selat Malaka, khususnya di pantai timur Aceh. Sementara itu aktifitas nelayan di beberapa titik di Aceh Timur sepi. Akibatnya, nelayan banyak tidak melaut dan memilih memperbaiki kapal seperti di Dermaga Kuala Idi, Kab. Aceh Timur. Meski demikian, nelayan yang bersikeras melaut diharapkan tetap waspada dan hati-hati cuaca ekstrim yang melanda laut Aceh dalam sepekan terakhir. “Cuaca sedang tak menentu, lebih-lebih dalam sepekan terakhir,” ujar Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui Kasat Pol Air, Aiptu Zainir, Rabu (30/3) di Idi. Dia mengatakan, angin kencang dan ombak besar dalam sepekan terakhir terjadi akibat pengaruh cuaca ekstrem. Akibat cuaca

buruk itu, diharapkan nelayan untuk membawa perlengkapan melaut saat berlayar, seperti baju pelampung sebagai pengaman. Zainir mengatakan, nelayan di Aceh Timur—khususnya—belakangan sudah mulai patuh terhadap aturan melaut, seperti membawa dokumen kapal dan lainnya. “Tapi jangan lupa juga, bahwa kondisi kapal juga harus diperhatikan, sehingga dalam melakukan tangkapan ikan di laut lepas hingga beberapa hari tidak terjadi kebocoran,” ujarnya. Sekjen Panglima Laot Lhok Kuala Idi, Heriansyah secara terpisah membenarkan kondisi laut mulai tidak tenang. “Artinya, cuaca memburuk. banyak nelayan tidak melaut, bahkan beberapa kapal ikan yang melaut saat pulang tidak membawa hasil yang memuaskan,” katanya.(cmad)

Hujan Lebat Guyur Aceh Selatan Ikan Menghilang Dari Pasaran TAPAKTUAN (Waspada): Meski tidak menimbulkan banjir, hujan lebat yang mengguyur kawasan Kabupaten Aceh Selatan dalam tiga hari terakhir, tapi menyebabkan ikan segar menghilang dari daerah penghasil pala tersebut. Pasalnya, para nelayan tradisional tidak berani melaut karena cuaca buruk ditandai ombak besar dan angin kencang. Para nelayan khawatir terhadap keselamatan mereka mencari rezeki di laut lepas. Amiruddin, 30, nelayan di kawasan Gampong Lhok Ketapang, Kecamatan Tapak tuan, mengakui mereka berhenti melaut karena cuaca buruk akibat hujan lebat, ombak besar dan angin kencang. “Kami belum berani melaut, jika kondisi cuaca terus memburuk, karena taruhannya nyawa,” sebutnya seraya menambahkan, hal serupa dilakukan para nelayan kapal pukat cincin dan nelayan motorisasi lainnya. Meski sejak Rabu kemarin, kondisi cuaca

mulai bersahabat dan matahari telah menampakkan diri, namun ikan juga belum muncul di pasaran. Menghilangnya ikan segar ini, membuat panen para pedagang ikan awetan. Ikan hasil tangkapan sebelumnya dijual dengan harga tinggi dua kali lipat dari sebelumnya. Harga jenis ikan karang misalnya, yang sebelumnya Rp25.000 dijual Rp50.000 per kg. Demikian pula ikan tongkol berukuran sedang, sebelumnya Rp15.000 per ekor menjadi Rp30.000. Kadis Kelautan dan Perikanan Aceh Selatan Drs. H. Darisman yang dihubungi terpisah, tidak membantah menghilangnya ikan basah segar itu di daerahnya, karena para nelayan tidak melaut. “Kita telah berkoordinasi dengan para panglima laot, jika kondisi cuaca buruk, para nelayan diimbau tidak melaut karena dikawatirkan menjadi petaka bagi nelayan itu sendiri,” katanya.(b19)

Tindakan Konyol, Pengerahan Massa Tolak Keputusan MK LANGSA (Waspada): Rencana pengerahan ribuan massa yang digagas untuk menolak keputusan Mahkamah Konstitusi (MK) soal calon perseorangan ditanggapi sebagai rencana konyol yang hanya akan mengoyakngoyak demokrasi yang saat ini sedang bersemi di Aceh. “Mengerahkan puluhan ribu orang untuk menolak keputusan MK, dampaknya hanya akan mencabik-cabik demokrasi di Aceh,” ujar Ketua LSM Damai Aceh Kabupaten Aceh Timur Mulyono di ruang kerjanya, Rabu (30/ 3). Mulyono mempertanyakan rencana tersebut, apakah telah memperhitungkan dampaknya bila massa tidak mampu dikendalikan hingga membuat anarkis. ”Siapa yang akan mengalami kerugian bila terjadi tindakan anarkis tentu masyarakat,“ ujar Mulyono, yang memperkirakan nantinya aksi tersebut akan berimbas pada timbulnya kembali konflik yang dapat menggagalkan MoU Perdamaian. Dia mengatakan, keputusan MK yang telah mengakui adanya calon independen melalui Putusan No. 5/PUU-V/2007 tanggal 23 Juli 2007 selanjutnya ditindaklanjuti oleh pembentukan undang-undang melalui perubahan terhadap UU No. 32 Tahun 2004

tentang Pemerintahan Daerah, yaitu dengan UU No. 12 Tahun 2008 tentang Perubahan Kedua Atas UU No. 32 Tahun 2004 tentang Pemerintahan Daerah (selanjutnya disebut UU 12/2008). Dengan demikian, calon perseorangan dalam Pemilukada secara hukum berlaku di seluruh wilayah RI. Mulyono mengingatkan, masyarakat Aceh sudah semakin dewasa dalam berpolitik dan menyikapi situasi politik. Perdamaian yang telah berjalan beberapa tahun belakangan telah menjadi katalis semakin matangnya cara pandang masyarakat mengenai masa depan Aceh. Mentalitas konflik sudah bergeser ke cara pandang demokratis yang mengedepankan dialog, adu visi dan misi serta mengedepankan kompetensi ketimbang adu otot. “Masyarakat sudah semakin cerdas menilai, sehingga bisa menilai aksi pergerakan tersebut untuk kepentingan siapa, kepentingan rakyat atau kepentingan segelintir orang,” ucap Mulyono. Mulyono meyakinkan bila nanti DPRA tetap mengesahkan qanun yang tidak mengakomodir calon independen, maka qanun tersebut dapat dengan mudah digugat pihakpihak yang dirugikan.(b25)

6 Tersangka Curanmor Dan Puluhan Sepedamotor Diamankan KUALASIMPANG (Waspada): Aparat jajaran Polres Aceh Tamiang yang sedang menggelar Operasi Sikat Rencong menyikat enam tersangka yang diduga terkait aksi pencurian bermotor (curanmor) dan mengamankan puluhan sepedamotor serta satu mobil Jeep Daihatsu Feroza BK 999 LI ditemukan jalan kawasan Tamiang Hulu, kini juga sudah diamankan di Mapolres Aceh Tamiang. “Dalam Operasi Sikat Rencong yang saat ini sedang kita laksanakan di wilayah hukum Polres Aceh Tamiang, kita mengamankan 20 sepeda motor berbagai merek dan 5 unit barang bukti yang disita dari tersangka,” terang Kapolres Aceh Tamiang, AKBP Drs Armia Fahmi melalui Kasat Reskrim, AKP Ibrahim kepada Waspada di ruang kerjanya, Rabu (30/3).

Ibrahim menambahkan, sedangkan satu mobil Daihatsu Feroza ditemukan di jalan kawasan Tamiang Hulu karena mobil itu ditinggalkan di badan jalan tanpa pemilik ketika ditemukan polisi.“Sedangkan sejumlah sepedamotor lainnya tanpa surat juga diamankan di Polres Aceh Tamiang,“ imbuh Ibrahim. Menurut Kasat Reskrim, 6 tersangka yaitu Ans, 45, warga Alur Seulebue Kejuruan Muda, Fad, 27, warga Kampung Durian Kec. Rantau, Sel, warga Karang Baru, Jam, warga Rantau, Ras alias wak Lung, warga Sekerak dan Rah, warga Karang Baru. “Tersangka sudah kita jebloskan dalam sel untuk diproses lebih lanjut menurut peraturan hukum yang berlaku,” tegas Ibrahim.(b24)

Waspada/Muhammad Hanafiah

Sejumlah barang bukti berupa sepeda motor berbagai merek dan satu unit mobil Daihatsu Feroza yang berhasil diamankan di Mapolres Aceh Tamiang, Rabu (30/3).

Waspada/Muhammad H. Ishak

Dermaga Kuala Idi, Kab. Aceh Timur, Rabu (30/3) sepi dari aktivitas nelayan. Foto diambil, Rabu (30/3).

Krueng Langsa Meluap Kawasan Rumah Walikota Langsa Terendam L A N G S A ( Wa s p a d a ) : Krueng Langsa meluap lagi, setelah Rabu kemarin luapan airnya merendam kawasan di sekitar Daerah Aliran Sungai (DAS) pada tengah malam kemarin, air Krueng Langsa meluber dan merendam beberapa kawasan termasuk kawasan rumah Walikota Langsa yang berada di Gampong Teungoh, Kecamatan Langsa Kota, Kota Langsa, Kamis (31/3). Banjir merendam sejumlah

kawasan di Kec. Langsa Kota, Kecamatan Langsa Lama, dan Kecamatan Langsa Timur, ketinggian air bervariasi namun di beberapa kawasan ketinggian 1 meter. Damin, 50, salah seorang warga Sidodadi, Kec. Langsa Lama mengatakan, air mulai memasuki kawasan perumahan warga di Gampong Seulalah dan Sidodadi, sejak pukul 02:00 dini hari. “Pada hari Rabu air sempat naik, ketinggiannya

hanya semata kaki orang dewasa, siang hari air surut lagi, tadi malam pukul 02:00 air kembali naik, kali ini tingginya di beberapa tempat hingga sepinggang orang dewasa,” katanya. Banjir akibat luapan air Krueng Langsa kemarin terbilang cukup tinggi. Luapan air terlihat di sekitar ruas jalan A.Yani Kota Langsa, depan Rumah Sakit Umum Daerah (RSUD) serta di depan Bank Negara Indonesia (BNI) 1946,

namun luapan air tersebut tidak mengganggu aktifitas di kedua instansi tersebut. Akibat luapan air itu, aktivitas belajar dan mengajar di beberapa Sekolah Dasar (SD) serta perkuliahan mahasiswa di Universitas Samudra Langsa (Unsam) dan Sekolah Tinggi Agama Islam Negeri (STAIN) Cot Kala di Gampong Meurandeh, Kecamatan Langsa Lama, terganggu. Meski air tak mencapai kedua kampus itu, namun mahasiswa tidak dapat mencapai kampus karena dua rute jalan yang menjadi penghubung ke kampus yang berada di Gampong Seulalah dan Gampong Tengoh terendam banjir, antrian ratusan mahasiswa yang mengunakan kendaraan roda dua dan bus pengangkut mahasiswa terlihat tertahan di pintu jem-

batan Gampong Seulalah dan Gampong tengoh sejak pukul 07:00 pagi. Sampai berita ini diturunkan belum ada laporan korban jiwa akibat banjir itu, menjelang sore ketinggian air terlihat mulai berkurang, dibeberapa kawasan air mulai surut, dan warga bergotong royong membersihkan rumah dari kotoran lumpur yang dibawa air banjir. Kepala Dinas Sosial Kota Langsa, Rizal Efendi kepada para wartawan mengatakan sampai sejauh ini pihaknya terus menyalurkan bantuan kepada para korban banjir berupa bahan makanan. Namun dia tidak dapat merinci jumlah bantuan yang telah disalurkan karena permintaan bantuan terus berdatangan dari para geuchik yang kawasannya terendam banjir. (b25/b23)

Bupati Bener Meriah: PNS Jangan Sombong

Waspada/Samsuar

BANJIR akibat luapan Krueng Langsa merendam kawasan pemukiman di Langsa, Kamis (31/ 3). Tak ada korban jiwa dalam musibah itu.

Ilyas A Hamid Bupati Aceh Utara:

‘Saya Maju Lagi Untuk Perbaiki Kesalahan’ ACEH UTARA (Waspada): Ilyas A Hamid, (foto) Bupati Aceh Utara, Rabu (30/3) siang di gedung DPRK mengatakan, dirinya telah membulatkan tekad kembali maju sebagai calon bupati Aceh Utara pada Pemilukada 2011, untuk memperbaiki kesalahan dan ketidaktahuannya selama lima tahun lalu. “Kemarin saya nyemplung menjadi bupati dan saat itu saya masih buta dengan ilmu pemerintahan dan saya akui kemarin saya cukup bodoh. Tapi setelah beberapa tahun menjadi bupati, saya menjadi tahu dengan segala hal yang menyangkut ilmu pemerintahan. Karena itu, saya bulatkan tekat untuk maju lagi,” ucap Ilyas A hamid lirih. Menjawab Waspada, dia mengaku hingga kini masih menunggu datangnya undangan dari Partai Aceh, untuk melamar dirinya menjadi Balon Bupati lima tahun ke depan. Pasalnya, PA merupakan partai yang telah dibesarkannya bersama temantemannya dulu. Dia juga mengatakan cinta dengan PA. Namun jika undangan itu tidak datang juga, maka terpaksa harus menggunakan jembatan lain, jalur independen (perseorangan). “Saya sudah sampaikan ke wilayah dan saya juga minta izin untuk naik lagi menjadi bupati lima tahun mendatang. Kalau permintaan saya ini dikabulkan, saya bahagia sekali. Tapi kalau tidak, terpaksa mencari alternatif lain, untuk ini saya minta dukungan teman-teman,” ucap orang nomor satu di Aceh Utara itu. Menurutnya, lima tahun ke depan, dia tak mungkin lagi bersama pasangannya selama ini, karena itu diucapkan terimakasih atas segala bantuan dan dedikasinya selama

ini. Ilyas berjanji akan berupaya mencari pasangan ideal yang sama dengan visi dan misinya. Visi dan misi Ilyas A Hamid untuk lima tahun ke depan, akan kembali melanjutkan program yang tersisa, seperti melanjutkan program perkebunan karet di Kec. Sawang, senilai Rp5,6 triliun. Lalu program revitalisasi perkebunan sawit, listrik tenaga air kerjasama dengan pemerintah Cina dalam empat tahun ke depan. Dan segepok pekerjaan rumah lainnya. Untuk itulah, dia nekat menawarkan dirinya kepada rakyat untuk menjadi balon bupati, dan semua kejelekan akibat ketidaktahuannya segera diperbaiki. “Ini semua akan terjadi, jika masyarakat Aceh Utara masih menginginkan saya,” katanya. Diakui, selama ini Aceh Utara mengalami kekurangan anggaran. Kekurangan PAD bukan hanya disebabkan bobolnya kas daerah, namun juga disebabkan, anggaran Otsus semuanya dikelola provinsi. Ini juga bukan kesalahan dari pihak provinsi. Provinsi hanya menjalankan amanah UU tahun 2011. Besarnya dana Otsus tahun 2011 senilai Rp300 miliar. Penyebab lainnya akibat berkurangnya pendapatan dari hasil Migas. “Selama ini, banyak proyek sumber anggaran Otsus yang terbengkalai. Mungkin di seluruh Aceh ada ribuan paket proyek yang terbengkalai. Ini sebabkan lemahnya control. Semua paket proyek tersebut dilaksanakan oleh satu panitia. Jika dana Otsus dibagi-bagi, maka pembangunan akan lebih cepat dilakukan. Untuk menutupi kekurangan anggaran Aceh Utara, saya mencoba melobi berbagai pihak di tingkat pusat,” pungkas Ilyas A Hamid. (cmun)

REDELONG (Waspada) : Bupati Bener Meriah Ir. H. Tagore Abubakar dalam acara pengambilan sumpah pegawai negeri sipil formasi umum dan honorer tahun 2008 di lingkungan Pemkab Bener Meriah, Rabu (30/3) di ruangan aula Pemda Bener Meriah mengatakan PNS jangan menyombongkan di hadapan masyarakat. “Para Pegawai Negeri Sipil jangan sombong karena gaji yang anda terima berasal dari uang masyarakat, PNS sebenarnya adalah pembantu masyarakat,” kata orang nomor satu di Bener Meriah itu, di hadapan 312 CPNS dan honorer yang diangkat menjadi PNS. Dia mengingatkan, PNS berkewajiban melayani masyarakat sebaik mungkin. CPNS dan honorer yang diangkat menjadi PNS jangan menjadikan Kabupaten Bener Meriah ini sebagai batu loncatan,” pinta orang nomor satu di Kabupaten Bener Meriah tersebut saat acara pengambilan sumpah PNS di Aula Pemda Bener Meriah. Sementara itu Kepala Badan Kepegawaian Pendidikan dan Pelatihan Bener Meriah Drs. Padlan dalam laporannya menerangkan, total jumlah keseluruhan pegawai Negeri sipil formasi umum dan honorer tahun 2008 sebanyak 312 orang. “Dengan rincian tenaga pendidikan (guru) golongan III sebanyak 179 orang, golongan II satu orang. Tenaga kesehatan golongan III 10 orang, golongan II 39 orang, dan untuk tenaga tehknik golongan III 33 orang, golongan II 49 orang, dan golongan I sebanyak satu orang,”terang Drs. Padlan selaku Kepala BKPP Bener Meriah.(cih)

Sejumlah Perwira TNI AL Kunjungi Simeulue SIMEULUE (Waspada): Sejumlah perwira menengah TNI AL dari Lantamal Satu Belawan, Rabu (30/3) datang berkunjung ke Simeulue. Misi utama dari kunjungan itu kata salah seorang perwira pertama angkatan laut di sana yakni memaparkan rencana peresmian Pangkalan TNI AL (Lanal) dan mohon doa restu kepada pemerintah serta tokoh masyarakat setempat. Direncanakan peresmian Lanal Simeulue, pada 28 April 2011. Perwira TNI AL yang datang ke Simeulue itu yakni: Asops Lantamal Satu Belawan, Kolonel Laut Tri Satria. Kadisbek Lantamal Letkol Laut Soeharto. Kadisfaslan Lantamal Letkol Laut M. Situmorang . Kadiskes Mayor Laut dr. Haposan. Acara temu ramah digelar di aula pendopo Simeulue. Langsung dipimpin oleh Bupati Simeulue, Drs. Darmili. Setelah acara dilanjutkan acara turun ke lapangan juga mengunjungi Posal Sinabang yang dipimpin Lettu Laut Budi Derajat. Lanal Simeulue direncanakan di Desa Lugu, Desa Bagian Barat Pinggiran Kota Sinabang. Dalam kawasan Teluk Sinabang. (cmr)

Waspada/Muhammad Rapyan

ASOPS Lantamal Satu Belawan, Kolonel Laut Tri Satria memberikan penjelasan dalam pertemuan di Pendopo Bupati Simeulue. Rabu (30/3).

Aceh

C2

WASPADA Jumat 1 April 2011

Jembatan Lapuk Ranjau Di Pedalaman Pante Bidari

Hujan Panjang Ancam Hubungan Medan -Subulussalam

LHOKNIBONG, Aceh Timur, (Waspada): Beberapa jembatan lapuk pada poros jalan antara Lhoknibong-Blang Seunong, Kec Pante Bidari, Aceh Timur, kini menjadi ranjau yang sangat berbahaya bagi pengendara kenderaan roda dua dan empat. Hasil observasiWaspada, Rabu (30/3), ke pedalaman Kec Pante Bidari tersebut, dalam perjalanan yang melelahkan sekitar 15 kilometer ke pedalaman ini, terdapat beberapa jembatan lapuk sangat sangt berbahaya dan acap jatuh korban. Jembatan yang sangat rawan, terjatat antara Dusun Pasi Tinggi – Alue Meunuang, Gampong (Desa) Pantelabu. Menurut keterangan warga setempat, jembatan yang memiliki rentang (panjang) sekitar 30 meter ini, sering terperosok kenderaan roda empat yang membawa sembako masyarakat hari-hari ke pedalaman tersebut. Terkadang berhari-hari berbagai jenis kendaraan roda empat tersangkut di dusun ini, sehingga membuat arus lalulintas ke Desa Blang Seunong terganggu. Diakui, kontruksi jembatan di sepanjang poros jalan ini ratarata memiliki tiang dan leger besi. Namun, kondisi kayu lantai pada umunya sudah sangat lapuk, sehingga tak heran jika kendaraan yang melintasi sering terperosok, kendati belum ada yang kecebur ke bawah karena tertahan leger besi yang masih kuat.(b10)

SUBULUSSALAM (Waspada): Meski hujan panjang mengguyur daerah ini dalam empat hari terakhir, sejak Minggu (27/3) hinggga Rabu (30/3) belum membawa pengaruh berarti bagi arus lalu lintas Aceh – Sumut via Subulussalam dan Pakpak Bharat. Kemungkinan terganggunnya kembali hubungan darat antara kedua provinsi itu masih mungkin terjadi, seperti halnya Feburari silam. Pasalnya, sejumlah onggokan longsor pada kiri dan kanan badan jalan serta genangan air di sejumlah titik masih terjadi. Tak cuma itu, pemukiman penduduk Desa Lae Ikan yang dalam dua tahun terakhir secara rutin mengalami musibah serupa, yakni banjir lumpur akibat satu unit gorong-gorong tidak dibangun maksimal di sana, bahkan banjir hampir mencapai setinggi lutut orang dewasa masuk ke rumah warga yang memaksa mereka mencari tempat lebih aman, nyaris masih menyisakan trauma. Di sisi lain, relokasi rumah penduduk yang sudah pernah didengungkan Pemko Subulussalam, hingga kini belum menunjukkan tanda-tanda terealisasi. Sementara Karlinus, Wakil Ketua DPRK Subulussalam menyampaikan desakan terhadap Pemko Subulussalam untuk merelokasi pemukiman penduduk Lae Ikan berpenghuni sekira 68 KK dan 322 jiwa yang berbatas langsung dengan Lae (baca: sungai) Kombih pada sebelah selatan, karena posisi desa itu sangat terjal, curam dan rawan longsor.(b33)

Wagub Ajak Ciptakan Pemilukada Tanpa Intimidasi

Mantan Bendahara Disdik Bireuen Dihukum 28 Bulan Penjara BUREUEN (Waspada): Mantan bendahara Dinas Pendidikan Bireuen, M. Fauzan, 33, dihukum dua tahun empat bulan penjara atau 28 penjara, di PN Bireuen, Rabu (30/3). M. Fauzan menurut majelis hakim dipimpin Ketua PN Bireuen Safruddin, SH didampingi hakim anggota Zulkarnen, SH, MH dan Safri, SH, terbukti secara sah dan meyakinkan terbukti memenuhi unsur pasal 2 dan 3 UU RI No. 31 Tahun 1999 sebagaimana diubah dengan UU RI No. 20 Tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi. Selain itu, majelis hakim juga menjatuhkan denda Rp50 juta, apabila tidak sanggup membayar harus mengganti dengan tambahan hukuman dua bulan lagi. Terpidana juga diwajibkan mengganti kerugian negara Rp439.203.000. Jika dalam sebulan setelah vonis tak dapat mengganti kerugian negara, maka harta benda akan disita kejaksaan untuk dilelang. Jika hasil lelang tidak mencukupi akan diganti dengan kurungan enam bulan penjara. Putusan itu lebih ringan dari tuntutan jaksa Jaksa Mawardi, SH sebelumnya, yaitu 3 tahun enam bulan. Baik terpidana mau pun jaksa penuntut umm, sama-sama menyatakan menerima putusan majelis hakim tersebut.(amh)

Badai Dan Angin Kencang Ancam Nelayan, Harga Ikan Naik LHOKSEUMAWE (Waspada): Angin kencang dan badai mengancam nelayan di Lhokseumawe, sehingga hanya satu dua nelayan yang berani berlayar. Keadaan ini mengakibatkan ikan langka dengan harga yang melonjak. Banyak dari boat-boat nelayan membatalkan niat untuk menangkap ikan, dan hanya ada satu dua boat pancing yang berlayar, sedangkan biduk-biduk kecil sama sekali tidak lewat, jelas Panglima Laot Muara Satu, Pemko Lhokseumawe, Nasrul, Rabu (30/3). Perubahan cuaca yang demikian drastis, menurut Nasrul, menjadi pukulan berat bagi nelayan, dan 200 nelayan yang bekerja di 70 boat di Naleung Mameh harap-harap cemas. “Tidak saja di laut, di darat pun anginnya sangat kencang sekali,” tegas Nasrul. Beberapa boat yang tetap bersikeras ke laut adalah boat pancing yang berawakkan hanya dua orang, dan dari hasil tangkapan merekalah sebagian ikan beredar di pasar dengan harga yang melambung. Kenaikan harga yang mencapai 50 persen ini cukup mengejutkan konsumen, di mana ikan yang dulunya Rp20 ribu per kg, kini mencapai Rp40 ribu. Tidak saja konsumen tetap yang tidak merasakan danging ikan, nelayan sendiri, selama hari-hari buruk ini juga harus menahan diri dengan lauk tanpa ikan.(b12)

Waspada/M Jakfar Achmad

SATU unit mobil Inova Silver plat B 8039 ZF yang dikenderai Rusli, 25, terperosok beberapa jam di jembatan lapuk Alue Meunuang, Kec Pante Bidari, Aceh Timur, Rabu (30/3).

300 Sumur Gas Terancam Meledak PT POG: Mustahil Meledak, Itu Sumur Tua RANTO PEUREULAK, Aceh Timur (Waspada): Pengeboran Minyak dan Gas oleh PT Pasifik Oil & Gas (POG) terhadap empat titik dan akan berlanjut hingga 15 titik di Desa Mata Ie, Kecamatan Ranto Peureulak, 300 sumur gas peninggalan lama lainnya yang tersebar disejumlah desa dalam Kecamatan Ranto Peureulak dan Peureulak, terancam meledak. Jika kondisi itu tak segera ditanggulangi pihak terkait dan instansi pemerintah daerah,

maka ribuan jiwa masyarakat di Ranto Peureulak, terancam keselamatannya. Padahal seharusnya, PT POG yang kini sedang giat melakukan pengeboran segera menutup sumur gas yang lama, sehingga tidak mengeluarkan gas beracun. Saifullah, 37, warga Ranto Peureulak kepada Waspada Kamis (31/3) mengungkapkan, kondisi sumur minyak di Ranto Peureulak, masih aktif. Meski beberapa diantaranya telah tertutup dan tersumbat, namun sumur minyak itu, nyatanya hingga kini masih diproduksi masyarakat untuk kebutuhan rumah tangga, bahkan dijual dalam skala besar ke kios-kios. Saifullah menyebutkan, jika pihak POG tidak melakukan

pengeboran selain di 15 titik di Desa Mata Ie dan dibeberapa lainnya di kawasan Ranto Peureulak dan Peureulak, maka tidak tertutup kemungkinan saat pengeboran dilakukan secara tinggi disalah satu titik di Desa Mata Ie, maka secara otomatis akan mengalir ke sumursumur lama yang lain. “Kita harap PT POG dan instansi terkait tidak menutup mata terhadap kemungkinan yang dapat membahayakan keselamatan masyarakat. Lebih PT POG telah beroperasi di Ranto Peureulak,” jelas Saifullah seraya menambahkan, kondisi lubang yang sangat berbahaya itu memiliki kedalaman mencapai 150-200 meter. Kata Saifullah, jika selama

DPRK Aceh Timur Dinilai Lalai LANGSA (Waspada) : DPRK Aceh Timur selaku pengawal kinerja Pemkab dinilai telah lalai dalam menjalankan fungsi pengawasannya sebagaimana melekat dalam tugas pokok dan fungsi (Tupoksi) dewan. Kondisi ini menyebabkan roda pemerintahan Aceh Timur berjalan tidak sesuai harapan masyarakat. Hal ini dikatakan Koordinator GeMPAR Aceh Auzir Fahlevi, Rabu (30/3). Dikatakan Auzir, kondisi Pemkab Aceh Timur sangat memprihatinkan. Dibuktikan terjadinya defisit anggaran tiap tahun karena dibebani berbagai hutang baik hutang di IDB sebesar Rp 48,8 miliar, maupun utang di Bank Aceh Rp29 miliar. Sementara pencapaian target Pendapatan Asli Daerah (PAD) tidak maksimal, sehingga pembiayaan kebutuhan rakyat terancam disebabkan faktor defisit anggaran tersebut, kata Auzir. Menurutnya, seharusnya DPRK Aceh Timur perlu mengingatkan pemerintah dengan memberikan solusi untuk mengatasi deficit anggaran, seperti meminta Pemkab Aceh Timur agar menggenjot pemasukan PAD serta memaksimalkan serapan pajak dan restribusi dari berbagai sektor guna meningkatkan pembiayaan daerah. Jika kalangan dewan tidak berperan, maka dipastikan Pemkab Aceh Timur akan mengalami kebangkrutan, mengingat lebih besar pengeluaran daripada pemasukan. Sementara anggota DPRK Aceh Timur dari Partai Golkar, Muslim A. Gani, SH membantah tudingan yang menyebutkan kalangan dewan lalai dalam menjalankan tugas dan fungsinya. “Kami tidak lalai, karena semua tahapan pembahasaan RAPBK telah kami laksanakan dengan baik,” kata Muslim A. Gani. Muslim mengaku Aceh Timur terus mengalami peningkatan defisit anggaran. Bahkan Muslim mengaku masih banyak kelemahan di lingkungan anggota dewan Aceh Timur terutama menyangkut Sumber Daya Manusia (SDM) nya, sehingga anggaran Aceh Timur sulit untuk lepas dari defisit.(ts)

Pemko Sediakan Kran Air Langsung Minum BANDA ACEH (Waspada): Walikota Banda Aceh Ir Mawardy Nurdin M Eng Sc pengoperasian keran air minum langsung pertama kali di Aceh untuk digunakan masyarakat yang berkunjung di Taman Sari Banda Aceh. Pada kesempatan itu Walikota berjanji akan menyiapkan beberapa kran air minum langsung lagi di beberapa ruang publik lainnya di Kota Banda Aceh. “Ke depan akan kita bangun juga di Mesjid Raya, Lapangan Blang Padang dan beberapa ruang publik lainnya” kata Walikota, Selasa (29/3) sore. Dikatakan, kran air ini merupakan salah-satu fasilitas umum yang diperuntukkan bagi masyarakat yang berkunjung ke Taman Sari sebagai servis Pemerintah Kota Banda Aceh. Kualitas air yang dihasilkan telah memenuhi syarat sebagai air minum sesuai dengan surat keputusan Menteri Kesehatan No. 907/Menkes/SK/VII/2002. ”Air ini aman dikonsumsi, jangan takut, rasanya pun enak,” ujar Mawardy. Sementara Kepala PDAM Tirta Daroy Kota Banda Aceh Junaidi, mengatakan air ini bersumber dari PDAM Tirta Daroy dengan bahan menggunakan besi Stainless Steel dan menggunakan sistem filtrasi yakni, Front Filter 5 Mikron (saringan sediment kasar), menggunakan Carbon Aktif untuk menghilangkan bau, rasa dan warna serta Filter Sedimen untuk menghilangkan sediment halus. “Yang perlu diketahui masyarakat adalah kualitas air ini bukan cuma sekelas air bersih, Tapi kualitas air minum,” kata Junaidi.(gto)

Waspada/Muhammad H. Ishak

WARGA tampak memperhatikan kondisi sumur minyak dan gas tua yang dinilai berbahaya saat dilakukan pengeboran oleh PT Pasifik Oil & Gas di Desa Mata Ie, kecamatan Ranto Peureulak, Aceh Timur, lebihlebih sumur gas itu masih mengeluarka percikan saat api. Foto diambil Kamis (31/3).

ini sumur minyak dan gas tersebut terus mengeluarkan gas dan minyak dan diproduksi masyarakat untuk kebutuhan, maka suatu saat akan terjadi getaran dan menimbulkan H2S atau disebut gas beracun yang dapat membahayakan masyarakat dengan radius 1 kilometer. Selain itu, sambung Saifullah PT POG selama ini dinilai juga tidak transparan dalam penerimaan tenaga kerja dan tidak menggantikan areal lahan masyarakat yang rusak akibat proyek tersebut, seperti rusaknya lahan milik Azman alian Ambon, warga Mata Ie, Kecamatan Ranto Peureulak. “Kita menginginkan, investasi pihak luar ini dapat mensejahterakan masyarakat, khususnya pemuda-pemuda setempat,” katanya. Humas PT Pasifik Oil & Gas, Ibrahim melalui Humas Lapangan, Nur Sufi, saat dimintai keterangan kemarin membenarkan, ratusan sumur minyak dan gas di kawasan operasinya PT POG tidak ditutup, sebab sumur-sumur ini tak berbahaya. “Itu sumur lama dan mustahil meledak,” katanya. Menurut dia, saat dilakukan pengeboran pada kedalaman 1200 meter maka seluruh aliran dan minyak akan ditarik seluruhnya ke titik pengeboran. “Terkait penerimaan tenaga kerja yang kami terima tetap transparan dan mengedepankan putra daerah,” tandasnya. Sementara Manager PT POG, Ir. Wiji secara bersamaan menambahkan, pihaknya tetap mengedepankan keselamatan terhadap pekerja dan keselamatan masyarakat disekitar proyek pengeboran. “Sekecil apa pun informasi yang mengancam keselamatan tetap sampaikan ke pihak kami, sehingga hal yang tidak diinginkan tidak terjadi,” tandas Wiji.(cmad)

Terdakwa Kasus Penipuan Sakit Mohon Penangguhan Penahanan BIREUEN (Waspada): Terdakwa kasus penipuan, M. Ali M. Amin dikabarkan sakit di Rutan (Rumah Tahanan) Bireuen oleh Jaksa Edi Mualizar, SH, sehingga tidak bisa dihadirkan mengikuti sidang lanjutan di PN (Pengadilan Negeri) Bireuen, Kamis (31/3). Sidang dipimpin Said Hasan didampingi Zulkarnain, SH, MH dan Safri, SH, akhirnya dilanjutkan Senin depan. Sementara pengacara terdakwa, Hendri Ramadhani, SH memohon kepada majelis hakim untuk melakukan penangguhan penahanan terhadap terdakwa karena harus dirawat. Bahkan, kata Hendri, terdakwa saat ini tergeletak di Rutan Bireuen karena sakit dan belum diketahui penyakitnya. Namun menurutnya terdakwa pernah menderita sakit jantung. Menanggapi permohonan pengacara itu, majelis hakim mengatakan, untuk berobat

bagi tersangka adalah haknya, namun pengacara dan keluarganya harus mengajukan surat permohonan izin berobat. Sedangkan soal penangguhan penahanan harus diteliti terlebih dahulu. “Silakan buat surat permohonan ajukan kepada kami dan lampirkan juga surat dari Kepala Rutan karena itu merupakan hak terdakwa yang diatur dalam undang-undang,” kata ketua majelis hakim. Sedangkan mengenai surat penangguhan, menurut hakim ketua, juga silahkan ajukan, namun kita akan teliti lebih lanjut nanti, karena itu juga ada diatur dalam peraturan atau undangundang. “Namun, yang jelasnya, masalah berobat dulu, kalau nanti diperlukan harus dirawat terus di rumah sakit juga kita akan pertimbangkan dari sisi kemanusiannya,” katanya sambil menutup sidang, dan melanjutkan Senin mendatang.

Ajukan Permohonan Sementara Hendry Ramadhani, pengacara terdakwa mengaku pernah beberapa kali mengajukan penangguhan penahanan, tapi tetap tidak mendapat respon positif. Mengingat kondisi kesehatan kliennya yang semakin memburuk, Hendry mengaku kecewa dengan sikap hakim yang terkesan mempersulit soal penangguhan penahanan yang bertujuan hanya untuk berobat. Apalagi diperkuat dengan adanya surat keterangan dokter yang mengharuskan Ali segera mendapat perawatan medis secara intensif. ”Saya sebenarnya sudah mengikuti prosedur dan mekanisme yang dianjurkan hakim sejak awal, tapi selalu mental. Saat ini klien saya kritis kesehatannya, saya akan mengajukan surat permohonan lagi dan berharap tak dipersulit,” harap Hendry.

Sedangkan menurut Ketua LBH (Lembaga Bantuan Hukum), Rahmat Hidayat, keluarga terdakwa dan istrinya Mutia Sarita kemarin mendatangi LBH Kota Lhokseumawe, minta bantuan memperjuangkan hak mendapat penangguhan penahanan bagi terdakwa karena sakit. “Sejauh ini kami belum bisa mencampuri urusan substansi hukum dan menghormati hukum karena sidang sedang berlangsung. Tapi karena memandang sisi kemanusiaan terhadap kondisi M. Ali yang sedang sakit, maka LBH akan membantu untuk mendapat penangguhan penahanan yang sama seperti masyarakat lain,” tegas Rahmat sambil menambahkan, apalagi keluarganya sudah siap memenuhi syarat baik soal jaminan dan ketentuan lainnya sesuai prosedur yang berlaku.(amh/ b15)

LANGSA (Waspada): Wakil Gubernur Aceh H Muhammad Nazar S.Ag, mengajak seluruh komponen masyarakat Aceh agar menciptakan Pemilihan Umum Kepala Daerah (Pemilukada) yang bebas dan adil tanpa intimidasi. Hal ini diungkapkan Wagub di hadapan ratusan warga ketika menghadiri acara Maulid, Selasa (29/3) di Kecamatan Birem Bayeun Aceh Timur. Dikatakan, Pemilukada merupakan momentum penting yang sebentar lagi segera berlangsung di Aceh, dan harus disikapi secara serius oleh masyarakat. Karena, melalui Pemilukada tersebut akan melahirkan pemimpin yang akan membawa masyarakat Aceh ke arah yang lebih baik. “Dalam hal ini, saya mengajak kita semua untuk menciptakan Pemilukada yang bebas sesuai dengan keinginan dan pilihan rakyat tanpa ada intimidasi dan kriminalisasi,” kata Muhammad Nazar. Dalam hal ini, Wagub juga memperingatkan masyarakat agar jangan mau lagi dibodoh-bodohi oleh calon kepala daerah ketika kampanye. Masyarakat harus lebih jeli dalam menilai sosok pemimpin kedepan, sehingga nasib warga Aceh ke depan akan lebih baik dari saat ini. (ts)

Bupati Serahkan 331 Sepmor Imum Meunasah MEUREUDU (Waspada): Bupati Pidie Jaya, Drs. H. M. Gade Salam menyerahkan 331 unit kenderaan dinas roda dua jenis sepedamotor (Sepmor) kepada Tgk. Imum Meunasah. Upacara yang dihadiri Gubernur Aceh, Irwandi Yusuf serta unsur Muspida Pidie/Pidie Jaya berlangsung di Oproom Setdakab Pidie Jaya. Juga hadir semua Tgk. Imum Meunasah, para kepala desa dari delapan kecamatan. Usai acara rombongan Gubernur dan Bupati serta paraTgk. Imum Meunasah menuju Pendopo Kabupaten untuk penyerahan secara simbolis ke 331 unit sepeda motor kepada 331Tgk. Imum Meunasah. Bupati menyatakan, program pembangunan di daerah yang baru berusia 3,8 tahun itu yang langsung berkaitan dengan permasalahan umum dalam upaya peningkatan ekonomi masyarakat dengan pencapaian visi Kabupaten Pidie Jaya. Karena ini Pidie Jaya akan mengutamakan lima prioritas yang menjadi fokus pemerintah di tahun 2011. Di antaranya peningkatan kualitas pengamalan Syari’at Islam, meningkatkan pelayanan yang menunjang pariwisata, meningkatkan ekonomi kerakyatan, meningkatkan infrastruktur dasar daerah, meningkatkan mutu pendidikan, meningkatkan derajat kesehatan masyarakat, dan pengarusutamaan gender. Menurut M. Gade Salam, tahun ini Syari’at Islam menjadi prioritas dan fokus pembangunan Pemkab Pidie Jaya. Penerapan Syari’at Islam dalam setiap aspek pembangunan kabupaten sudah menjadi komitmen bersama. (b21)

Perlu Pemimpin Mandirikan Daerah BANDA ACEH (Waspada): Calon-calon kepala daerah yang muncul di Aceh pada Pemilukada mendatang, haruslah tokohtokoh yang mempunyai pemikiran bagaimana membuat daerahnya mandiri, terutama dari aspek finansial. Harapan itu disampaikan salah seorang tokoh kawasan baratselatan Aceh, Teuku Raja Keumangan, SH, Rabu (30/3), terkait akan digelarnya Pemilukada di Aceh tahun ini. Menurut dia, seperti sekarang, jika hanya mengharapkan dana yang sedikit dari APBK di seluruh kab/kota, maka diperkirakan dalam lima tahun ke depan daerah tersebut akan bangkrut. “Jadi siapa saja bisa jadi kepala daerah kalau hanya untuk menghabiskan dana APBK. Apalagi dana tersebut hanya cukup untuk operasional pemerintahan dan membayar gaji pegawai,” ujarnya. Karena itu siapa pun yang ingin menjadi kepala daerah haruslah sosok yang mampu menciptakan mesin cetak uang di daerah, baru daerah tersebut bisa mandiri dari aspek finansial. “Soalnya kalau cerita pembangunan, semuanya omong kosong kalau tidak ada uang. Syariat Islam perlu uang, semua perlu uang, pembangunan fisik non fisik semua perlu uang,” ucapnya. Artinya, sebut dia, untuk ke depan Aceh ini haruslah dipimpin oleh tokoh-tokoh kuat yang punya visi jelas, sehingga mampu mengantarkan daerahnya menjadi daerah yang mandiri, terutama dari aspek finansial.(b07)

Dr. Bukhari Mendaftar, Persaingan Kandidat Ketua PAN Agara Memanas KUTACANE (Waspada): Kepastian bakal majunya tokoh muda dr Bukhari SpOG menjadi salah satu kandidat calon Ketua pada Musda PAN akan datang terjawab sudah, setelah secara resmi mendaftar ke panitia, Rabu (30/3). Munculnya nama dr Bukhari Pinim SpOG yang juga mantan Dirut RSU Sahudin Kutacane itu, selain memanaskan suasana juga memperketat persaingan merebut posisi orang nomor satu di partai berlambang matahari tersebut. Berkas pendaftaran dr Bukhari Pinim.SpOG diterima dan diperiksa langsung Sekretaris DPD II PAN Agara Isfandi Pios dan beberapa pengurus DPD PAN Agara lainnya serta panitia penerimaan pendaftaran. Kepada Waspada, usai mendaftar ke panitia di kantor DPD II PAN Agara di kawasan Pulonas, dr Bukhari Pinim SpOG mengatakan, keputusan maju merupakan salah satu cara bagi mantan Dirut RSU Kutacane itu berkiprah memberikan kontribusi pembangunan di bumi sepakat segenep.(b27)

Waspada/Ali Amran

DR. BUKHARI Pinim SpOG (paling kiri) terlihat membuka dan menyeleksi berkas untuk diserahkan pada pantia Musda DPD II PAN Agara.

Aceh

WASPADA Jumat 1 April 2011

C3 Hari Ini 3.895 PNS Nikmati Kenaikan Gaji 10 Persen

Masyarakat Pining Butuh Perbaikan Infrastruktur Jalan Dan Jembatan BLANGKEJEREN (Waspada): Pasca terjadinya bencana alam banjir beberapa waktu lalu, masyarakat Pining masih butuh pembangunan infrastruktur baik jalan maupun jembatan, hal ini akibat seringnya terjadi bencana alam di daerah itu. Pantauan Waspada,Rabu (30/3), selain jembatan utama di Pintu Rime, Kec. Pining ambruk, beberapa ruas jalan juga rusak parah akibat longsor yang tidak pernah berhenti. Di samping itu, beberapa jembatan lainnya yang butuh renovasi antara lain di Desa Uring. Jembatan itu sudah keropos dan susah dilalui. Salah seorang warga Pining Jemalul, 35, kepada Waspada Rabu (30/3) mengatakan, kayu jembatan Uring itu tak layak lagi dilewati karena sudah lapuk dimakan usia. “Masyarakat khawatir akan menelan korban,” jelasnya. Bupati Gayo Lues H. Ibnu Hasim menjelaskan jembatan utama Pintu Rime bantuan pusat itu dikelola provinsi ambruk saat bencana besar 2006. “Kita sudah tak terhitung mengusulkan ke pihak-pihak terkait untuk pembangunan jembatan ini dan jalan provinsi di kawasan itu namun hingga kini belum terealisasi,” jelas Ibnu. Malah kata Ibnu, pihaknya sudah berupaya mengalokasikan otsus tingkat II untuk jembatan itu meski tidak sesuai aturan karena wewenang provinsi. Soal jembatan Desa Uring, Ibnu mengingatkan agar pihak desa mengusulkan ke pihak terkait.(b35/m16)

Kasus Pemerasan Pelaku Khalwat Berakhir Damai LHOKSUKON, Aceh Utara (Waspada): Kasus pemerasan dan penganiayaan terhadap pelaku khalwat yang menyeret Keuchik Desa Blang Gunci dan Mukim Paya Bakong, Kecamatan Paya Bakong, Aceh Utara sebagai tersangka, akhirnya berakhir damai. “Pelapor sudah mencabut laporannya dan kedua tersangka sudah kita bebaskan. Perdamaian itu terjadi antara kedua belah pihak. Kita hanya sebagai mediator,” kata Kapolres Aceh Utara, AKBP Farid, BE melalui Kasat Reskrim AKP Erlin Tangjaya didampingi Kasubbag Humas, Ipda Zam Zami A, Rabu (30/3). Pada kesempatan itu, Kasat Reskrim juga mengimbau masyarakat tidak main hakim sendiri ketika mengamankan pelaku kriminal atau pelanggar hukum, termasuk pelaku mesum dan khalwat. “Serahkan proses hukumnya kepada pihak berwajib. Jangan sekali-kali main pukul,” tandas AKP Erlin. Seperti diberitakan sebelumnya, M Nur Abdullah, 27, pemuda asal Desa Matang Baroeh, Kecamatan Lapang, Aceh Utara, mempolisikan Keuchik Desa Blang Gunci, Ismail A Gani dan Mukim Paya Bakong, Zakaria Is, dengan tuduhan melakukan pemerasan dan penganiayaan.(cmus)

Kasus Pemerkosaan Dilimpahkan Ke Kajari BIREUEN (Waspada): Berkas kasus pemerkosaan seorang siswi yang dilakukan tersangka MN di perkebunan coklat kawasan Desa Kubu Raya, Peusangan Siblah Krueng Bireuen, akan dilimpahkan ke Kejaksaan. Demikian dikatakan Kapolres Bireuen, AKBP HR Dadik J melalui Kasat Reskrim AKP Khairul kepada wartawan, Rabu (30/3). Menurut Kasat Reskrim, sejak kasus itu terungkap tersangka sudah mendekam dalam sel Mapolres Bireuen danadasejumlahpihak berusaha untuk mendamaikan kasus tersebutagartidaksampaikepengadilan.Namun,timpenyidik Polres tidak menampung aspirasi tersebut mengingat korban pemerkosaan adalah anak di bawah umur. Dijelaskan, kasus pemerkosaan anak di bawah umur bukan saja delik aduan, tapi kewajiban aparat penegak hukum untuk menuntaskan dan menyeret tersangka ke pengadilan. Tim penyidik, kata Kasat, telah memeriksa dua teman tersangka yaitu S dan R sebagai saksi. “Sekarang tinggal memperbaiki di mana lembaran berkas yang belum sempurna, paling lambat minggu depan sudah kita serahkan bersama tersangka ke jaksa,” kata Khairul. Sebagaimana diberitakan, MN lelaki beristeri empat yang mengaku beralamat di Desa Cot Seumeurueng, Kecamatan Samatiga Aceh Barat memperkosa siswi SMA di Bireuen di kebun coklat Desa Kubu Raya Peusangan.(amh)

Ulama: Aceh Masih Butuh Lembaga Dakwah BANDA ACEH (Waspada): Wakil Ketua Majelis Permusyawaratan Ulama (MPU) Kabupaten Aceh Tengah Tgk. H. Razali Irsyad, BA menyatakan, Aceh masih banyak membutuhkan lembaga dakwah untuk menyampaikan risalah agama Islam kepada umat. “Untuk membina umat bukan hanya tanggungjawab ulama, melainkan semua pihak melalui lembaga dakwah untuk menyampaikan syiar Islam kepada masyarakat yang masih banyak belum terjangkau,” katanya saat memberikan tauyiah (nasehat) di hadapan warga Lembaga Dakwah Islam Indonesia (LDII) dan masyarakat di Banda Aceh, baru-baru ini. Silaturrahmi itu juga diisi pemberian paket sembako dan santunan untuk fakir miskin dan anak yatim sebanyak 80 orang. Disebutkan, LDII yang merupakan salah satu lembaga juga telah mengambil peran untuk membina umat Islam agar tidak menyimpang dari ajaran yang telah dibawa Nabi Besar Muhammad SAW. “Saya berharap agar ini terus dipertahankan dan bila perlu lebih ditingkatkan lagi, sehingga satu-satunya umat Islam selalu mendapat siraman rohani dan pendidikan agama Islam yang benar,” katanya. Dikatakan, di akhir zaman sekarang ini pengaruh terhadap perilaku umat, khususnya para remaja sangat besar sekali, sehingga dibutuhkan peran lembaga dakwah untuk memberikan pendidikan dan nasehat agama kepada mereka agar tidak terjerumus kepada perbuatan maksiat. Disebutkan, generasi muda merupakan tulang punggung bagi perkembangan agama Islam di masa mendatang. Perkembangan Islam untuk 20 tahun ke depan sangat tergantung perilaku remaja sekarang ini. “Kalau sampai remaja sekarang ini tidak memiliki ilmu dan kefahaman agama yang kuat, maka umat Islam tidak terasa akan hancur,” katanya.(b07)

Waspada/Muhammad Riza

SEORANG dokter jaga di RSUD Sigli sedang merawat salah seorang warga korban keracunan jamur merang, Kamis (31/3).

Santap Jamur Tujuh Warga Kritis

SIGLI (Waspada): Tujuh warga Desa Tungkop Blang, Kecamatan Indrajaya, Kabupaten Pidie kritis setelah mengkonsumsi jamur hutan yang tumbuh di batang melinjo, Rabu (29/3) sekira pukul 21.00. Ketujuh korban keracunan jamur itu terjadi dalam satu keluarga, mereka, M. Dahlan Is, 34 , Khairunnisa, 32, Rizka Nanda Ulfa, 12, Leni Mardiani, 21, Srinovi Rahmadani, 10, dan Fitria Dahliani, 5. M. Dahlan, salah satu korban keracu-

nan jamur kepada Waspada, Kamis (31/ 3) mengataku tidak mengetahui jika jamur yang tumbuh di batang pohon melinjo tidak bisa dikonsumsi karena beracun. Padahal menurut dia, selama ini ia dan keluarganya sering memakan jamur jenis yang tumbuh liar di batang-batang pepohonan yang sudah mati akibat ditebang itu. Ia menduga, terjadinya keracunan ada kemungkinan disebabkan ia dan keluarganya terlalu banyak mengonsumsi jamur tersebut. “ Setelah kami makan, tiba-tiba

Anggota DPRK Dihukum Percobaan

kepala kami pusing dan muntahmuntah. Kemudian tubuh kami lemas,” kata M. Dahlan. Dokter piket IGD Rumah Sakit Umum (RSU) Sigli, drYulfinandar menjelaskan, dari enam pasien yang sempat dirawat pihaknya karena keracunan makan, lima di antaranya sudah sembuh dan bisa pulang. Sedangkan Khairunnisa, istri M. Dahlan masih perlu dirawat secara intensif karena kondisi tubuh pasien masih lemas.(b20)

Unsyiah Kirim Tenaga Pengajar Ke Taiwan BANDA ACEH (Waspada): Rektor Universitas Syiah Kuala (Unsyiah) Banda Aceh Darni M. Daud menyebutkan, teknologi dan informasi sangat penting bagi perguruan tinggi. Pihaknya juga telah mengirimkan sejumlah tenaga pengajar untuk melanjutkan pendidikan di Taiwan. “Karena, bagaimanapun keberadaan ITC di sebuah universitas, khususnya Unsyiah, amat penting dalam rangka meningkatkan kemampuan dosen dan mahasiswa dalam menguasai teknologi informasi dan komunikasi,” kata Darni Daud kepada Waspada, kemarin. Dia menyebutkan, penguasaan ITC adalah mutlak bagi setiap mahasiswa, karena era global ini merupakan kondisi di mana peran ITC begitu besar dalam segala bidang kehidupan. “Hampir dapat dipastikan bahwa bangsa yang menguasai informasi dengan cepat dan akurat akan lebih cepat pula meraih kemajuannya,” ujar Rektor Unsyiah. Darni Daud mengakui bahwa Taiwan adalah salah satu negara yang penguasaan ITC cukup baik. Karena itu, katanya, Unsyiah juga telah mengirimkan

sejumlah tenaga pengajar untuk melanjutkan pendidikan di Taiwan, khususnya dalam bidang ITC ini. Karena itu, tambahnya, jalinan kerjasama ini diharapkan akan berlanjut, terutama antara Unsyiah dengan sejumlah perguruan tinggi di Taiwan. “Ke depan kita akan melanjutkan dengan pertukaran mahasiswa dan dosen,” tegasnya. Dia juga menyampaikan penghargaan dan terima kasih kepada pemerintah dan rakyat Taiwan yang telah menghibahkan fasilitas ITC ini. Bantuan ini, suatu bentuk kepedulian pemerintah dan rakyat Taipe yang sangat berguna dalam mendorong peningkatan kualitas lulusan Unsyiah, khususnya dalam bidang ITC. Gedung Pusat Teknologi Informasi dan Komunikasi (Unsyiah-Taiwan ITC Center), Rabu (30/3) diresmikan dan sekaligus diserahterimakan dari Taipei Economic and Trade Office (TETO) kepada Unsyiah. Penyerahan dilakukan Deputy Representative TETO Mr. Charles Li kepada Rektor Unsyiah Darni M. Daud. Acara ini dihadiri Rektor IAIN, para pejabat Pemerintah Aceh, DPRA, serta sejumlah pimpinan NGO dari Tainwan seperti Tzu

Chi Foundation, Buddha’s Light International Association R.O.C, dan Museum of World Religion Foundation. Charles Li dalam sambutannya mengatakan, bantuan gedung UnsyiahTaiwan ITC Center senilai US$ 2 juta ini merupakan bagian dari bantuan rekonstruksi dan rehabilitasi bencana gempa dan tsunami untuk Aceh dari pemerintah dan rakyat Taiwan yang mencapai US$ 50 juta. Gedung ITC Center ini dibangun dengan teknologi tahan gempa, dan termasuk yang pertama di Indonesia. “Ini tak lain karena Aceh dikenal sebagai daerah rawan gempa,” tegas Li. Dikatakan, dengan dihibahkannya gedung ini yang lengkap dengan perangkat teknologinya, diharapkan jalinan persaudaraan antara pemerintah dan rakyat Taiwan dengan rakyat Indonesia, khususnya Aceh dan Unsyiah semakin erat. “Karena itu, fasilitas ini kita harapkan dapat digunakan oleh masyarakat, terutama para mahasiswa dan tenaga pengajar dari perguruan tinggi lainnya di Aceh,” kata Charles Li. (b05)

Pengurus Lama Jadi Pengurus Baru Kopbun Cut Meutia Keluar Dari Puskobun KOPBUN (Koperasi Perkebunan) sawit Cut Meutia mandiri, Kec. Baktiya, Aceh Utara, menyatakan keluar dari payung kesatuan Pusat Koperasi Perkebunan (Puskobun) dengan alasan Puskobun di kabupaten ini, tak mempunyai kontribusi apa-apa terhadap Kopbun di bawahnya. Pernyataan keluar dari Puskobun tersebut, diumumkan Badan Pemeriksa (BP) Koperasi Unit Desa (KUD) atau Kopbun Cut Meutia, H Syahril Basyah di depan Dinas Koperasi Aceh Utara, PT Perkebunan (PTP) Nusantara I kebun Cot Girek, Muspika Baktiya, para ulama, pemuka masyarakat dan puluhan anggota KUD/Kopbun Cut Meutia, pada acara rapat anggota tahunan (RAT) tahun buku 2010 Kopbun ini, di kantor koperasi itu, Gampong Cinta Makmur, Kec. Baktiya, Aceh Utara, Rabu (30/3). H Syahril Basyah (BP Kopbun Cut Meutia/pemuka masyarakat eks Kewedanaan Lhoksukon, Aceh Utara-red), dengan tegas membeberkan eksistensi Puskobun yang berkedudukan kantor sekretariat di kawasan perkebunan Cot Girek selama ini, tidak lebih dari ajang pengumpulan uang petani sawit yang meliputi puluhan juta per bulan, dari jenis kutipan hasil produksi (penjualan) tandan buah segar sawit (TBS) senilai Rp37,- per kg.

“Selama hampir dua dasawarsa lalu, 8 KUD/Kopbun di kawasan perkebunan Cot Girek, menyetor uang tersebut ke Puskobun setiap bulan, sementara kontribusi Puskobun itu tidak kami rasakan apaapa, alias tidak memediasi kepentingan petani sawit dengan pihak-pihak yang dirasa perlu, selain memprakarsai penjualan TBS kepada toke-toke dengan sistem menangguk fhe,” sebut BP Kopbun Cut Meutia. H Syahril Basyah merincikan storan uang Rp 37,- per kg TBS antara lain, Rp 15,- per kg dikembalikan kepada Kopbun, Rp 10,- per kg untuk dana taktis Puskobun, Rp 10.- per kg untuk dana operasional (OP) Puskobun dan Rp 2,- per kg sawit untuk membuat jalan usaha tani sawit (juts). “5000 ton penjualanTBS/bulan di kawasan 8 (delapan) Kopbun, dapat dibayangkan bebarapa uang yang dikelola oleh Puskobuniniperbulan,”pungkasHSyahrilBasyah. Apa yang dibeberkan pengurus KUD/ Kopbun Cut Meutia pada RAT, Rabu (30/ 3), belum berhasil mendapat konfirmasi dengan ketua Puskobun Aceh Utara, Muridho. Beberapa kali Waspada coba menghubungi via telefon selular, Kamis (31/3) kemarin, ketua Kopbun itu, tak mengangkat handphonenya kendati nada sambungnya aktif. RAT KUD/Kopbun Cut Meutia RAT KUD/Kopbun Cut Meutia, Rabu kemarin, berjalan lancar yang berakhir

dengan serangkaian personalia pengurus lama dikukuhkan kembali menjadi pengurus baru, masa bakti 2011-2013, sekaligus pada hari itu juga Kadiskop dan UKM Aceh Utara, diwakili Kabid Kelembagaan, Zulkhari, SH melantik pengurus tersebut. Dalam laporan ketua KUD/ Kopbun Cut Meutia sebelumnya, Sudarto (ketua Kopbun), menjelaskan Sisa Hasil Usaha (SHU) 2010, Rp 59 juta lebih. KUD/Kopbun ini telah berdiri 22 tahun lalu, dengan jumlah anggota 165 orang dan luas areal perkebunan mencapai 189 hektar yang kini kondisi tanaman sawit sudah mendekati masa repelanting (penanaman baru). Untuk repelanting ini, pihak Kopbun Cut Meutia tak mencari investor. “Kami siap menyerahkan kepada PTP Nusantara I selaku bapak angkat petani peserta PIR/plasma di sini,” kata BP Kopbun ini, H Syahril Basyah menjawab pertanyaan Waspada usai RAT. Pada kesempatan ini ikut menyampaikan sambutan antara lain camat Kec Baktiya, H Fakhrurrazi Araly, SH dan Manajer pembelian TBS PTP Nusantara I, H Ir Al-Masrul yang pada pokoknya menyatakan, PTP Nusantara I siap meremajakan areal kebun sawit petani peserta PIR/plasma di kawasan kebun Cot Girek, Aceh Utara, tersebut. M Jakfar Achmad

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan

15:45

GA 147 Medan/Jakarta

16:20

Y6 537 Medan

19:15

Y6 538 Medan

07:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

AK 305 Kuala Lumpur *

12:20

AK 306 Kuala Lumpur*

12:45

FY 3401 Penang **

14:10

FY3400 Penang **

14:30

Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

KOTA LHOKSEUMAWE (Waspada): Ir. MarwadiYusuf, M.Si, Kepala Dinas Pengelola Keuangan dan Aset Daerah (DPKAD) Kota Lhokseumawe, Kamis (31/3) mengatakan, mulai hari ini, Jumat (1/4) sebanyak 3.895 PNS kota itu nikmati kenaikan gaji 10 persen. Hal itu dilakukan sesuai Peraturan Presiden Nomor 11 Tahun 2011. “Insya Allah, mulai hari ini, kita akan membayar gaji baru kepada seluruh PNS di Kota Lhokseumawe yang berjumlah 3.895 orang,” kata Marwadi. Dalam Surat Edaran Dirjen Pembendaharaan Negara Republik Indonesia Nomor SE-9/PB/2011 tanggal 11 Maret 2011, ditandangani Agus Suprianto, bahwa pembayaran gaji pokok PNS, anggota TNI dan Polri terhitung 1 Januari 2011 yang besaranhya sesuai dengan Perpres tersebut di atas. Menurut Kepala DPKAD itu, karena gaji mulai berlaku sejak 1 Januari, maka setelah selesai pembayaran gaji induk 1 April kekurangan selama periode Januari-Maret akan dibayar dalam minggu pertama bulan April. Rapel diberikan sesuai golongan masing-masing, khusus untuk golongan 3 dan 4, rata-rata memperoleh satu juta lebih. Di sisi lain, Marwadi menjelaskan, meskipun gaji PNS naik 10 persen, PNS tak dapat meningkatkan daya belinya karena inflasi yang terjasdi diLhokseumawe.SejakJanuari2010hinggaJanuari2011,inflasimenembus angka 9.20 persen di atas angka rata-rata nasional. Jadi, dengan kenaikan gaji 10 persen, daya beli PNS tetap sama dengand aya beli pada tahun 2010. Tingginya inflasi di Kota Lhokseumawe disebakan kenaikan harga bahan pangan seperti beras dan bahan-bahan lainnya. Kata Alumnus Magister Ekonomi Pembangunan Universitas Gajah Mada Yogyakarta. (cmun).

Waspada/M Jakfar Achmad

DIKUKUHKAN Manager pembelian TBS PTP Nusantara I, Ir H Al-Masrul (paling kiri, didampingi ketua KUD/Kopbun Cut Meutua, Sudarto) dan camat Baktiya, H Fakhrurrazi Araly, SH (nomor 6 dari kiri), foto bersama serangkaian personalia pengurus lama yang dikukuhkan kembali menjadi pengurus KUD/Kopbun Cut Meutia baru, Rabu (30/3).

LHOKSEUMAWE (Waspada): Anggota DPRK Lhokseumawe H. Jamaluddin M. Ali yang menganiaya Kepala Dinas Perindagkop, Ridwan Alamsyah, dihukum tiga bulan penjara masa percobaan enam bulan, di Pengadilan Negeri Lhokseumawe, Rabu (30/3). Menurut Majelis Hakim diketuai Syamsul Qamar, SH, MH dan anggota Azhari, SH, MH serta M. Jamil, SH, berdasarkan fakta-fakta yang terungkap di persidangan, terdakwa Jamaluddin terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana penganiayaan. Namun majelis hakim tidak sependapat dengan jaksa yang menuntut terdakwa dipidana penjara dengan perintah agar ditahan. Karena tujuan pemidanaan, kata majelis hakim, bukan untuk balas dendam, melainkan supaya yang bersangkutan memperbaiki perilakunya menjadi lebih baik. Dalam pertimbangannya, majelis hakim tidak menyebutkan hal-hal yang memberatkan terdakwa Jamaluddin. Sedangkan hal meringankan, menurut majelis hakim, terdakwa berlaku sopan selama persidangan. Mengakui perbuatannya dan menyesali hal itu. Juga masih bertugas sebagai anggota DPRK Lhokseumawe, memiliki tanggungan keluarga, dan telah meminta maaf kepada saksi korban, Ridwan Alamsyah. Usai membacakan putusan, Hakim Ketua Syamsul Qamar menanyakan kepada terdakwa apakah menerima atau tidak, Jamaluddin langsung menyatakan menerima. Sedangkan Jaksa Fakhrillah, SH yang sebelumnya menuntut Jamaluddin M. Ali enam bulan penjara dengan perintah tahan, menyatakan pikir-pikir. Jamaluddin mulai disidangkan di PN Lhokseumawe 30 Desember 2010, akibat tindakannya meninju Ridwan Alamsyah pada 9 Juli 2010, yang saat itu masih menjabat Kadis Perindagkop Kota Lhokseumawe. Perkara ini dipicu masalah pencairan dana aspirasi anggota dewan yang ditempatkan pada dinas tersebut untuk kelompok usaha kecil.(b17)

Pengungsi Banjir Aceh Barat Mulai Kembali Ke Rumah MEULABOH (Waspada): Memasuki hari ketiga musibah banjir yang melanda tujuh kecamatan di Aceh Barat, Provinsi Aceh, sebahagian besar pengungsi mulai kembali ke rumah. Meski air masih menggenangi pemukiman, namun warga memilih kembali karena tak betah berlama-lama di pengungsian. Pantauan Waspada, beberapa pengungsi yang mulai kembali ke rumah mereka di antarannya pengungsi asal Desa Pasi Masjid Kecamatan Mereubo yang sebelumnya mengungsi di Gedung SMK 2 Meulaboh. Hal serupa juga dilakukan korban banjir yang menghuni perumahan Blang Beurandang I Kecamatan Johan Pahlawan yang sebelumnya mengungsi ke masjid desa setempat. “Di komplek kami air mulai surut jam enam tadi pagi. Jadi kami memilih kembali sambil membersihkan rumah. Kasihan ank-anak kalau lama-lama dipengungsian,”kata Ibrahim warga Blang Beurandang kepada wartawan, Kamis, (31/3). Ibrahim mengatakan, banjir yang terjadi Selasa (29/2) dampak maraknya penebangan liar di Kecamatan Pantoen Reue dan Kaway 16. Dikatakan, warga berharap pemerintah mengambil langkah cepat mengatasi banjir. Selain merendam pemukiman warga banjir yang melanda Aceh Barat juga merusak fasilitas pendidikan, rumah ibadah, dan lahan pertanian warga. Sekolah yang mengalami kerusakan cukup parah yakni SDN Lango Kecamatan Panton Reue. Sementara itu sejumlah sekolah juga terpaksa diliburkan karena air menggenangi pekarangan sekolah. “Belum tahu kapan akan belajar karena selin merusak sekolah, banjir juga masih menggenangi pemukiman warga jadi banyak murid yang juga kena musibah,” kata Rasidien kepala SDN Langgo. Hingga Kamis petang, Badan Penanggulangan Bancana Daerah Aceh Barat menyatakan banjir yang terjadi akibat hujan deras melanda Aceh Barat sejak sepekan terakhir itu mengakibatkan sedikitnya 92 desa terendam banjir. Meski demikian tak ada korban jiwa dalam musibah banjir Aceh Barat. 8 Kecamatan yang terendam banjir diantarannya Kecamatan Johan Pahlawan, Meureubo, Kaway XVI, Woyla Barat, Wolya Timur, Pantee Cermen, dan Panton Rheue. “Sedikitnya 5.447 Kepala Keluarga (KK) atau 20.642 warga mengungsi. Mereka mengungsi di masjid, rumah sekolah dan tenda-tenda darurat,”kata Kepala BPBD T Ahmad Dadek.(cak)

PT. Pos Dan Giro Lhokseumawe Salurkan Rp1,6 M Dana PKH KOTA LHOKSEUMAWE (Waspada): Jhoni Eka Putra, Kepala PT. Pos dan Giro Cabang Lhokseumawe didampingi Swandi kepada Waspada mengatakan, untuk tiga bulan pertama di tahun 2011 pihaknya menyalurkan dana Program Keluarga Harapan (PKH) senilai Rp1,6 miliar bagi para penerima yang tersebar di empat kecamatan dalam wilayah Pemkot Lhokseumawe. Jumlah penerima di tahun 2011 berkurang hingga mencapai 299 RTSM dari jumlah tahun sebelumnya 4.900 orang. Hal ini berdampak positif karena PKH berhasil menekan jumlah keluarga miskin. “Ini berita gembira, karena PKH berhasil mensejahterakan masyarakat di Kota Lhokseumawe. PKH mampu mensejahterakan ekonomi 299 RTSM,” kata Jhoni Eka Putra. Dana PKH diberikan pemerintah untuk membantu rumah tangga miskin dalam bentuk sumbangan dana pendidikan dan kesehatan. Paling tinggi dana itu diberikan kepada RTSM senilai Rp500 ribu dan terendah Rp150 ribu per bulan. Dana tersebut dicairkan setiap tiga bulan sekali. Tahap pertama di tahun 2011 telah selesai, terhitung Januari, Februari dan Maret. Pada saat penyaluran kemarin, 34 penerima tidak mengambil uang tersebut. Tidak diketahui alasannya, namun diperkirakan yang bersangkutan telah pindah atau sudah meninggal. Dana bantuan ini langsung diserahkan kepada ibu rumah tangga. Karena ibu-ibu dianggap lebih mampu menjaga bantuan itu. “Kalau dikasih sama bapak-bapak, bisa-bisa uang itu untuk beli rokok. Bahaya sekali. Jika masih hidup dan masih tinggal di wilayah Lhokseumawe, uang itu masih bisa diambil tapi harus mendaftar ulang. Karena 34 penerima tidak mengambil maka tersisa dana Rp10 juta. Uang itu telah kita kembalikan,” katanya. Jumlah penerima dana bantuan PKH untuk Kecamatan Banda Sakti 1895 orang, Muara Dua 1254 orang, Muara Satu 720 orang dan Blang Mangat 832 orang. Program PKH baru diuji coba di beberapa kabupaten di Aceh, jika berhasil akan diperluas kepada beberapa kab/kota lainnya. Dalam hal ini PT. Pos dan Giro bertindak sebagai penyalur.(cmun)

Mimbar Jumat

C4

Menuju Tafsir Kontemporer

Etika Dalam Berdoa Oleh Nursanjaya, SAg, MPd

D

an apabila hamba-hamba-Ku bertanya kepadamu tentang Aku, maka (jawablah), bahwasanya Aku adalah dekat. Aku mengabulkan permohonan orang yang berdoa apabila ia memohon kepada-Ku, maka hendaklah mereka itu memenuhi (segala perintah-Ku) dan hendaklah mereka beriman kepada-Ku, agar mereka selalu berada dalam kebenaran. (QS. al-Baqarah: 186). Menurut riwayat Ibnu Jarir, Ibnu Abi Hatim, Abnu Mardawaih, Abu Syaikh, dan lain-lain, melalui Jarir bin Abdul Hamdi dari Ubadah as-Sijistani dari as-Sillat bin Hakim bin Mu’awiyah bin Hidah, dari ayahnya, dari kakeknya, berkata: Seorang Arab pedesaan datang kepada Rasulullah SAW., lalu bertanya: “Wahai Rasulullah, apakah Allah itu dekat maka kami berbisik kepada-Nya, atau jauh sehingga kami berseru kepada-Nya?” Mendengar pertanyaan tersebut, Nabi SAW, terdiam sesaat. Kemudian turunlah wahyu (yakni QS. al-Baqarah: 186 tersebut diatas) sebagai jawabannya (Lubab an-Nuqul fi Asbabun Nuzul, as-Suyuthi; catatan pinggir kitab Tanwirul Miqbas min Tafsir Ibnu Abbas, hal. 31). Jadi, karena Allah itu dekat, maka dalam berdoa tidak perlu berteriak-teriak, apalagi dengan menyetel volume microfon setinggi mungkin. Berdoa harus dengan suara yang lembut dan penuh kerendahan hati (lihat dalam QS. al-A’raf: 55). Allah SWT sangat dekat dengan kita selaku hamba-hamba-Nya, jika kita mau mendekat kepada-Nya. Cara mendekatkan diri kepada Allah, tidak lain kecuali dengan selalu memenuhi perintah-Nya yang berupa ibadah mahdhah maupun perintahperintah lain yang berupa amal shalih serta tidak melanggar larangan-Nya. Dalam sebuah hadits qudsi disebutkan: “Dari Anas bin Malik, dari Nabi SAW, dari Rabbnya. Allah ‘azza wa Jalla berfirman: “Apabila seorang hamba mendekat kepada-Ku sejengkal, Aku akan mendekatinya dengan sehasta. Apabila dia mendekati-Ku dengan sehasta, maka Aku akan mendekatinya dengan sedepa. Dan bila dia mendatangi-Ku dengan berjalan, maka Aku akan mendatanginya dengan berjalan cepat (berlari)”. (HR. Bukhari, 4/307). Allah SWT memang sangat dekat kepada hamba-Nya yang mau mendekati-Nya. Maka dalam berdoa, kita harus langsung kepada-Nya, tidak melalui perantara. Sebab, jika memakai perantara justru ini menyerupai perbuatan kaum musyrik yang menjadikan berhala sebagai perantara dalam berdoa kepada Allah. Berhala mereka jadikan perantara dalam pemberian syafaat, mohon keberkatan, petunjuk, dan sebagainya. Bahkan memakai perantara orang mati walaupun orang tersebut Nabi dan Rasul sekalipun, tetap dianggap sebagai perbuatan menyekutukan Allah dan hukumnya adalah syirik. (Tathir al-I’tiqad ‘an Adranil Ilhad, as-Sam’ani, hal. 7). Allah SWT menyindir perbuatan yang demikian dalam QS. Yunus: 18: “Dan mereka menyembah selain daripada Allah apa yang tidak dapat mendatangkan kemudharatan kepada mereka dan tidak (pula) kemanfaatan, dan mereka berkata:

“Mereka itu adalah pemberi syafa’at kepada kami di sisi Allah”. Katakanlah: “Apakah kamu mengabarkan kepada Allah apa yang tidak diketahui-Nya baik di langit dan tidak (pula) dibumi?” Maha suci Allah dan Maha Tinggi dari apa yang mereka persekutukan kepada-Nya (itu)”. Allah SWT menghendaki agar hamba-Nya selalu berdoa, baik pada waktu longgar (senang) maupun pada waktu sempit (sedih). Menurut riwayat dari Abu Hurairah, Rasulullah SAW., bersabda: “Sesungguhnya orang yang tidak mau meminta (berdoa) kepada Allah, maka Allah akan murka kepadanya”. (HR. at-Tirmidzi, jilid 5, hal. 26). Allah tidak menghendaki orang yang hanya berdoa ketika ditimpa kesedihan, tetapi kemudian melalaikannya (tidak mau berdoa) ketika berada dalam kesenangan, sebagaiman dalam firman-Nya: “Dan apabila Kami memberikan nikmat kepada manusia, ia berpaling dan menjauhkan diri; tetapi apabila ia ditimpa malapetaka, maka ia banyak berdoa yang panjang-panjang”. (QS. Fushshilat: 51, lihat juga dalam QS. Yunus: 12). Banyak orang yang keliru dalam memahami pengertian ujibu da’watad-da’i idzaa da’an (Aku memperkenankan doa orang yang memohon apabila dia berdoa kepada-Ku), karena melupakan lanjutan ayat tersebut:…fal yastajibu li wal yu’minu bi (karenanya hendaklah mereka memperkenankan perintah-Ku dan tetap beriman kepada-Ku). Mend-engarkan seruan Allah berarti menaati perintah dan menjauhi larangan. Jika doa kita belum terkabul atau ditangguhkan, kemungkinan syarat yang diinginkan Allah belum kita penuhi dengan baik. Sedangkan manusia tidak akan pernah mengetahui rahasia hikmah yang tersembunyi kecuali apa yang Allah SWT tampakkan. Rasulullah SAW, bersabda: “(yakni) Orang yang berkata demikian: “Aku benar-benar telah berdoa, aku benar-benar telah berdoa. Tetapi aku tidak melihat bahwa (Allah) mengabulkan doaku. Kemudian dia merasa penat (bosan) ketika itu dan meninggalkan doa”. (lihat Riyadush Shalihin, Imam an-Nawawi, hal. 563). Ibrahim bin Adham, menyebutkan ada 10 (sepuluh) hal yang menyebabkan doa tidak dikabulkan, yaitu: (1) mengaku mengenal Allah SWT tetapi tidak memenuhi hak-Nya; (2) membaca kitab Alquran tetapi tidak mengamalkannya; (3) mengaku mencintai Nabi SAW, tetapi tidak menjalankan sunnahnya; (4) mengaku musuh setan tetapi justru mematuhinya; (5) berdoa agar dijauhkan dari neraka tetapi justru melemparkan dirinya ke neraka; (6) berdoa agar masuk surga tetapi tidak membuat bekal persiapan kepadanya; (7) meyakini bahwa kematian adalah kepastian tetapi tidak mempersiapkan diri untuk menghadapinya; (8) sibuk meneliti aib orang lain tetapi lalai dengan aib diri sendiri; (9) menikmati berbagai karunia Allah tetapi tidak bersyukur kepada-Nya; dan (10) menguburkan orang mati tetapi tidak mengambil ibrah dari peristiwa kematian itu. � Penulis adalah Kepala Perpustakaan MAN Langsa, Dosen STAIN Zawiyah Cot Kala Langsa

Konsep Pendidikan Islam Burhanuddin Az-Zarnuji Oleh Raja Dedi Hermansyah

A

l Zarnuji mempunyai nama lengkap Burhanuddin al Islam al Zarnuji. Tanggal kelahirannya tidak diketahui secara pasti, namun tanggal wafatnya terdapat dua pendapat. Ada yang mengatakan beliau wafat pada 591 H/1195 M, dan yang lain mengatakan beliau wafat pada 840 H / 1243 M (Abudin Nata, 2000). Hidup beliau semasa dengan Ridho al Din al Naisaburi, antara tahun 500 – 600 H. tidak ada keterangan yang pasti mengenai tempat kelahirannya. Namun melihat dari nisbahnya, al Zarnuji berdasarkan data dari para peneliti mengatakan bahwa beliau berasal dari Zarnuji, suatu daerah yang dikenal hingga kini dengan nama Afghanistan. Al Zarnuji menuntut ilmu di Bukhara dan Samarkand, dua kota yang menjadi pusat keilmuan dan pengajaran. Saat itu masjid-masjid di kedua kota itu dijadikan sebagai lembaga pendidikan dan ta’lim yang diasuh antara lain oleh Burhanuddin al Marghinani, Syamsuddin Abd al Wajdi Muhammad bin Muhammad bin Abd, dan al Sattar al Amidi. Selain itu, al Zarnuji juga belajar pada Rukn al Din al Firqinani, seorang ahli fiqih, sastrawan dan penyair (w.594 H / 1196 M), Hammad bin Ibrahim, seorang ahli ilmu kalam, sastrawan dan penyair (w. 564 H / 1170 M), dan Rukn al Islam Muhammad bin Abi Bakar yang dikenal dengan nama Khawahir Zada, seorang mufti Bukhara dan ahli dalam bidang fiqh, sastra dan syair (w.573 H / 1177 M) Al Zarnuji selain ahli dibidang pendidikan dan tasawuf juga menguasai bidang-bidang lain seperti sastra, fiqh, ilmu kalam dan sebagainya. Pendidikan pada Masa Burhanuddin al Zarnuji Konsep pendidikan al Zarnuji tertuang dalam karya monumentalnya, kitab “Ta’lim al Muta’allim Thuruq al Ta’allum”. Kitab ini diakui sebagai karya monumental dan diperhitungkan keberadaannya terbukti para peneliti dan ilmuan muslim maupun orientalis menjadikan kitab tersebut sebagai salah satu rujukan. Kemudian selain dari pada itu, content/isi dari kitab ta’lim tersebut kalau diibaratkan seperti sebuah cabai rawit kecil tapi pedas, artinya tidak hanya metode belajar tetapi juga tujuan, prinsip-prinsip dan strategi belajar yang terkandung dalam kitab tersebut didasarkan pada moral religius. Bahkan di negara kita Indonesia setiap lembaga pendidikan klasik maupun modern seperti pesantren tidak pernah ada yang meninggalkan mengkaji dan menjadikan kitab ta’lim sebagai salah satu pegangan dalam mengarungi samudra kehidupan. Pembagian ilmu Al Zarnuji membagi ilmu pengetahuan dalam empat kategori. Pertama, ilmu fardhu ‘ain yaitu ilmu yang wajib dipelajari oleh setiap muslim secara individual. Hal ini berdasarkan hadist nabi tentang mencari ilmu. “Mencari ilmu wajib bagi setiap muslim dan muslimah”. Adapun kewajiban menuntut ilmu yang pertama kali harus dilaksanakan adalah mempelajari ilmu tauhid baru kemudian ilmu lainnya. Kedua, Ilmu fardhu kifayah yaitu ilmu yang kebutuhannya hanya dalam saat-saat tertentu saja seperti ilmu shalat jenazah. Selain itu seperti ilmu pengobatan, ilmu astronomi juga masuk kategori fardhu kifayah. Ketiga, ilmu haram yaitu ilmu yang haram untuk dipelajari seperti ilmu nujum yang digunakan untuk meramal. Keempat, ilmu jawaz yaitu ilmu yang hukum mempelajarinya boleh karena bermanfaat bagi manusia, seperti ilmu kedokteran. Niat dan tujuan belajar; Mengenai niat dan tujuan

belajar, al Zarnuji mengatakan bahwa niat yang benar dalam belajar adalah untuk mencari keridhaan Allah SWT, memperoleh kebahagiaan di dunia dan di akhirat, berusaha memerangi kebodohan pada diri sendiri dan orang lain, mengembangkan dan melestarikan ajaran Islam, dan mensyukuri nikmat Allah SWT. Metode pembelajaran; Dalam kitab Ta’lim Muta’alim al Zarnuji menjelaskan bahwa metode pembelajaran meliputi dua kategori. Pertama, metode yang bersifat etik mencakup niat dalam belajar. Kedua, metode bersifat teknik strategi meliputi cara memilih pelajaran, memilih guru, memilih teman, dan langkah-langkah dalam belajar. Cara memilih pelajaran; bagi orang yang mencari ilmu sebaiknya mendahulukan memilih/mempelajari ilmu yang dibutuhkan dalam urusan-urusan agamanya, seperti ilmu tauhid. Kemudian, cara memilih guru; sebaiknya memilih guru yang lebih alim, wara’ dan umurnya lebih tua. Lalu, memilih teman; mencari teman yang rajin, wara’ dan berwatak baik, mudah faham akan pelajaran, tidak malas, tidak banyak bicara dsb. Adapun langkah-langkah dalam belajar al Zarnuji dalam hal ini mengkhususkan pada aspek teknik pembelajaran, menurut Grunebaum dan Abel, terdapat enam hal yang menjadi sorotan al Zarjuni yaitu the curriculum and subject matter, the choice of setting and teacher, the time for study, dynamic of learning and the student’s relationship to other. Pola hubungan guru dan murid Ada beberapa pemikiran al Zarnuji dalam Ta’lim Muta’allim yang memberi acuan terhadap pola hubu-ngan guru dan murid. Murid tidak akan memperoleh ilmu yang bermanfaat tanpa adanya pengagungan dan pemuliaan terhadap ilmu dan orang yang mengajarnya (guru), menjadi semangat dan dasar adanya peng-hormatan murid terhadap guru. Posisi guru yang mengajari ilmu – walaupun hanya satu huruf – dalam konteks keagamaan disebut sebagai bapak spiritual, sehingga kedudukan guru sangat terhormat dan tinggi, yang memberi konsekuensi bagi sikap dan perilaku murid sebagai manifestasi penghormatan terhadap guru baik dalam lingkungan formal maupun nonformal. Kontekstualisasi hubungan guru dan murid, menurut al Zarnuji, menunjukan bahwa penempatan guru pada posisi terhormat terkait oleh sosok guru yang ideal.Yaitu guru yang memenuhi kriteria dan kualifikasi kepribadian sebagai guru yang memiliki kecerdasan ruhaniah dan tingkat kesucian tinggi, disamping kecerdasan intelektual. Dalam bahasa al Zarnuji, guru ideal adalah guru yang alim, wira’i dan mempunyai kesalehan sebagai aktualisasi keilmuan yang dimiliki serta tanggung jawab terhadap amanat yang diemban untuk menggapai ridho Allah SWT. Pemikiran al Zarnuji berupaya membawa lingkungan belajar pada tingkat ketekunan dan kewibawaan guru dalam ilmu dan pengajarannya. Sedangkan murid sebagai individu yang belajar, menunjukan keseriusan dan kesungguhan dalam belajar sebagai manifestasi daya juang dalam pencapaian ilmu yang diajarkan oleh guru dalam rangka mencari ridho Allah SWT, dan untuk menuai kemanfaatannya. � Penulis adalah Dosen AMIK INTeL COM GLOBAL INDO KISARAN, Mahasiswa Pascasarjana PENDIDIKAN ISLAM IAIN Sumatera Utara

WASPADA Jumat 1 April 2011

I

syarat tentang tafsir kontemporer dapat dilihat dari seruan al-Qur’an yang bersifat universal, seperti ya ayyuha al-nnas dan ya ayyuha allazina amanu. Seruan pertama (ya ayyuha al-nnas) menunjukkan totalitas manusia tanpa dibatasi oleh etnis, kelompok bahkan bangsa. Adapun seruan kedua (ya ayyuha allazina amanu) menunjukkan sifat yang dapat saja berlaku pada diri seseorang tanpa terbatas kepada ruang dan waktu. Kedua jenis seruan ini menunjukkan bahwa pesan-pesan al-Qur’an cocok dan sesuai dikonsumsi oleh siapapun, kapan dan dimana saja. Mengingat bahwa teks-teks al-Qur’an terbatas sedangkan budaya dan peradaban terus berkembang, maka penafsiran terhadap teks-teks tersebut mutlak dilakukan karena sudah ada jaminan bahwa petunjuk yang terbaik adalah petunjuk al-Qur’an, Beranjak dari hal ini maka diyakini bahwa makna ayat-ayat al-Qur’an terus saja bergerak mengimbangi pergerakan perkembangan budaya dan peradaban manusia. Jika hal ini tidak disahuti dengan baik maka pesan-pesan al-Qur’an akan meninggalkan manusia. Dengan kata lain, semakin maju dan lengkap suatu budaya dan peradaban masyarakat maka semakin mudah pula menarik pesanpesan al-Qur’an dalam kehidupan mereka. Oleh karena itu, yang perlu dicari adalah relevansi suatu penafsiran dengan konteks kekinian dan kedisinian. Berdasarkan hal ini perlu sifat yang objektif untuk memilah penafsiran yang sesuai dengan budaya dan peradaban suatu masyarakat. Jika hal ini tidak dijumpai, maka sudah saatnya dilakukan penafsiran lain supaya keaktualan pesan-pesan al-Qur’an semakin jelas. Dalam kehidupan masyarakat kita sekarang terkesan kurang berani melakukan penafsiran yang sesuai dengan budaya dan peradaban kita. Bahkan terkesan ada upaya mengkebiri kemampuan anak bangsa ini dalam menafsirkan al-Qur’an. Sebagai contoh, bagaimana rintangan yang dihadapi oleh Prof. Mahmud Yunus sehingga tulisannya pernah dihambat hanya garagara menterjemahkan al-Qur’an ke dalam bahasa Indonesia. Upaya yang hampir sama masih terasa dalam kehidupan sekarang dengan adanya pihakpihak yang seolah-olah alergi jika

S

ebagaimana data yang diungkapkan oleh Ahmad Sofian, Direktur Pusat Kajian dan Perlindungan Anak (PKPA) Medan, bahwa setiap tahunnya sekitar 2000 anak di Medan terperangkap dalam dunia prostitusi (perzinahan). Dari jumlah ini, sebanyak 40 persen adalah pelajar yang duduk dibangku SLTA dan 30 persen masih duduk di bangku SMP serta sisanya anak yang putus sekolah. Perzinahan yang dikemas secara rapi dengan istilah prostitusi atau pelacuran bukanlah sesuatu yang baru di negara ini. Jika kita lihat sejarahnya - sebagaimana diungkapkan oleh Hull dalam bukunya-dapat dirunut mulai dari masa kerajaan-kerajaan Jawa, di mana perdagangan perempuan pada saat itu merupakan bagian pelengkap dari sistem pemerintahan feodal. Konsep kekuasaan seorang raja digambarkan sebagai kekuasaan yang sifatnya agung dan mulia. Mereka seringkali dianggap menguasai segalanya, tidak hanya tanah dan harta benda, tetapi juga nyawa hamba sahaya. Kekuasaan raja yang tak terbatas ini juga tercermin dari banyaknya selir yang dimilikinya. Perlakuan terhadap perempuan sebagai barang dagangan tidak terbatas hanya di Jawa, kenyataan juga terjadi di seluruh Asia, di mana perbudakan, sistem perhambaan dan pengabdian seumur hidup merupakan hal yang biasa dijumpai dalam sistem feodal. Di Bali misalnya, seorang janda dari kasta rendah tanpa adanya dukungan yang kuat dari keluarga, secara otomatis menjadi milik raja. Jika raja memutuskan tidak mengambil dan memasukkan dalam lingkungan istana, maka dia akan dikirim ke luar kota untuk menjadi pelacur. Sebagian dari penghasilannya harus diserahkan kepada raja secara teratur. Islam melarang zina dan prosesnya Zina diartikan dengan “melakukan hubungan seks antara laki-laki dengan perempuan tanpa ikatan perkawinan yang sah, baik dilakukan atas dasar suka sama suka maupun karena keperluan lain (komersil)”. Perbuatan ini sangat dilarang oleh Allah SWT, sehingga bagi siapapun yang berzina sebagaimana diinformasikan Allah dalam surat Alfurqon ayat 68 dan 69, maka akan mendapatkan dosa dan diazab dengan azab yang berlipat ganda pada hari kiamat kelak. Agar manusia tidak terjerumus pada perbuatan zina, Allah SWT memberikan warning kepada kita agar jangan sampai melakukan perbuatan yang dapat menggiring atau menjerumuskan kita pada perbuatan zina. Hal ini karena perbua-

Oleh Achyar Zein

ada anak bangsa ini yang mencoba memberikan penafsiran yang sesuai dengan budaya dan peradaban kita. Oleh karena itu, mufassir Indonesia seperti Mahmud Yunus, Hasbi As-Shiddieqy, Hamka, A. Halim Hasan dan bahkan Quraish Shihab lebih bergaung di luar negeri ketimbang di negerinya sendiri. Implikasi yang muncul dari upaya pengkebirian ini adalah penilaian yang subjektif sehingga dengan mudah memberi label bid’ah, kafir dan sesat kepada orang-orang yang tidak sefaham dengannya. Padahal, semakin banyak penafsiran maka semakin kaya pula khazanah keilmuwan karena yang diinginkan dari tafsir kontemporer adalah bukan benar dan salah dari suatu penafsiran akan tetapi tingkat relevansinya dengan kehidupan sekarang. Wacana Tafsir Kontemporer Isyarat tentang tafsir kontemporer sudah mulai muncul ketika pertama kali al-Qur’an diturunkan. Turunnya ayat iqra’ (perintah membaca) berkaitan erat dengan kondisi bangsa Arab ketika itu yang mengabaikan tulis baca. Dengan demikian, perintah iqra’ tidak semestinya difahami sebagaimana halnya orang-orang Arab memahaminya pertama sekali ketika alQur’an diturunkan. Jika iqra’ dipahami oleh orang-orang Arab sebagai perintah membaca dan menulis terhadap suatu teks maka dalam konteks kontemporer perintah ini tidak hanya difahami sebatas membaca dan menulis. Diyakini masih banyak makna-makna lain yang tersirat dari kata iqra’ itu sendiri seperti membaca alam, diri, Tuhan dan yang lain-lain. Wacana tentang tafsir kontemporer ini dapat juga dilihat dari cara Rasulullah menafsirkan ayat. Di dalam penafsirannya,

Rasulullah selalu menghubungkan ayat-ayat al-Qur’an dengan budaya dan peradaban masyarakat yang ada pada waktu itu. Sebagai contoh, ketika turun ayat kewajiban zakat terhadap harta maka Rasulullah menunjukkan jenis-jenis harta yang ada pada masa itu. Mu’jizat al-Qur’an adalah mu’jizat yang bersifat maknawiyah yang baru dapat dirasakan jika dipahami secara mendalam. Sebagai mu’jizat ilmiah maka pesan-pesan al-Qur’an tetap saja aktual sepanjang zaman. Berbeda halnya dengan mukjizat hissiyah yang hanya berlaku pada masa tertentu seperti mukjizat Nabi Ibrahim yang tahan dibakar. Sebagai mujizat maknawiyah sudah pasti lafazh-lafazh alQur’an mengandung makna yang fleksibel. Hal ini juga diisyaratkan oleh al-Qur’an yang jika daun-daunan dijadikan kertas, ranting-ranting dijadikan pena dan lautan dijadikan tinta maka makna-makna yang terkandung di dalamnya tidak akan pernah berakhir. Dengan demikian, maka penafsiran terhadap ayat-ayat alQur’an tidak pernah berhenti. Apa yang sudah ditafsirkan oleh generasi terdahulu itulah yang sesuai pada masanya dan belum tentu aktual untuk masa sekarang. Adapun yang perlu untuk dicontoh dari generasi terdahulu adalah semangat mereka dalam menggali pesan-pesan al-Qur’an yang disesuaikan dengan kehidupan pada masa itu. Beranjak dari upaya keras yang dilakukan oleh generasi terdahulu maka sudah merupakan tanggung jawab generasi sekarang untuk mengaktualkan pesan-pesan al-Qur’an dalam kehidupan kontemporer. Jika hal ini tidak dilakukan berarti kita memasung pesan-pesan alQur’an yang shalih li kulli zaman wa makan (sesuai di segala situasi dan kondisi). Ada sebagian orang berpendapat jika kehidupan sekarang dijadikan sebagai alat bantu untuk merekam pesan-pesan alQur’an seolah-olah ada pemaksaan agar al-Qur’an harus disesuaikan dengan kehidupan sekarang. Anggapan ini tentu saja keliru karena pesan-pesan alQur’an sudah pasti sesuai di segala kehidupan. Tugas kita hanyalah mencari titik per-

Empat Bahaya Zina Oleh Junaidi

tan zina tidak langsung terjadi kecuali melalui sebuah proses. Larangan ini termaktub dalam surat Al-isra ayat 32, “Dan janganlah kamu mendekati zina. Sesungguhnya zina itu adalah suatu perbuatan yang keji (fahisyah) dan seburukburuk jalan (cara)”. Rasulullah SAW juga menganjurkan agar umatnya tidak melakukan zina, sebagaimana kisah yang tergambar dalam hadis riwayat Imam Ahmad dalam Musnadnya, “Pernah ada seorang pemuda datang kepada Rasulullah shallallaahu ‘alaihi wasallam seraya berkata, “Ya Rasulallah, izinkan aku melakukan zina!” Maka marahlah para sahabat mendengar pernyataan pemuda tersebut sambil berkata, “Diam kau, diam!” Lalu Nabi shallallaahu‘alaihi wasallam berkata kepada pemuda tersebut, “Mendekatlah!” Lalu ia mendekat dan duduk di samping beliau. Nabi bertanya kepada pemuda tersebut, “Apakah engkau rela jika zina itu menimpa ibumu?” Ia menjawab, “Demi Allah, aku tidak rela dan aku akan mencegah hal itu terjadi.” Maka Nabi bersabda, “Siapapun tidak rela zina itu menimpa ibu-ibu mereka. Lalu apakah engkau rela bila hal itu menimpa kepada anak perempuanmu?” Ia menjawab, “Aku tidak rela dan aku akan mencegahnya.” Nabi pun berkata padanya, “Semua orang tua tidak rela jika hal itu terjadi pada anak-anak perempuan mereka. Lalu apakah engkau rela jika zina itu menimpa saudara perempuanmu?” Lalu ia menjawab, “Tidak, dan aku akan mencegahnya.” Kemudian Nabi berkata, “Semua orang pun tidak ingin hal itu menimpa suadara perempuannya. Lalu apakah engkau suka hal itu terjadi pada bibimu (saudara perempuan dari bapak)?” Pemuda itu menjawab, “Tidak,

dan aku akan mencegahnya.” Nabi berkata, “Semua orang tidak akan suka jika hal itu terjadi pada bibi-bibi mereka. Lalu apakah engkau rela jika hal itu menimpa bibimu (dari pihak ibu)?” Pemuda itu menjawab, “Tidak, dan aku akan mencegahnya.” Nabi shallallaahu ‘alaihi wasallam berkata padanya, “Begitu juga dengan orang-orang lain, mereka juga tidak rela jika hal itu menimpa bibibibi mereka.” Kemudian Nabi shallallaahu ‘alaihi wasallam meletakkan tangan beliau di pundak pemuda itu sambil berdoa, “Ya Allah, ampunilah dosanya, sucikanlah hatinya dan peliharalah kemaluannya.” Pada akhirnya pemuda itu tidak pernah menengok kepada hal-hal yang dilarang (berzina) setelah kejadian itu.” Empat bahaya zina Dalam hadits yang diriwayatkan Thabrani, Rasulullah SAW mengatakan “Takutlah kalian berbuat zina, karena sesungguhnya dalam zina ada empat hal yang sangat membahayakan”. Adapun keempat hal yang dimaksudkan Rasulullah SAW tersebut adalah: Pertama: Menghilangkan cahaya wajah. Perbuatan zina dapat mempengaruhi keceriaan wajah sehingga menjadikannya kusam, kelam, dan tampak layu bagaikan orang yang mengalami kesedihan mendalam. Walaupun wajahnya cantik atau tampan serta kulitnya putih kalau ia seorang pezina maka biasanya tetap saja tidak ada daya tariknya. Dengan kata lain kecantikan dan ketampanannya hilang tertutup oleh perbuatan zina yang ia lakukan. Jadi tidak heran ketika dalam kehidupan sehari-hari ada orang mengatakan “memang wajahnya cantik tapi kok tidak menarik ya?” Kedua: Memutuskan Rezeki. Rezeki dari Allah bisa berupa uang, kesehatan, rumah tangga yang tenteram, hati yang tenang dan lainlain. Lantas, benarkah zina dapat memutuskan rezeki? Untuk menjawabnya penulis sampaikan beberapa data. Ariel dan Luna Maya merupakan dua artis papan atas yang memiliki nilai kontrak miliyaran rupiah, gara-gara melakukan hubungan seks ilegal (zina), maka semua kontrak film dan iklan yang sudah disepakati jadi diputus. Bek Chelsea John Terry yang terpilih sebagai kapten tim nasional

sesuaian dimaksud. Anggapan seperti ini dapat menjebak manusia untuk tidak mempedulikan pesan-pesan alQur’an sehingga apa yang sudah ditafsirkan oleh generasi terdahulu seolah-olah itulah satusatunya kebenaran yang absolut. Supaya tidak terjebak ke dalam anggapan yang seperti ini maka upaya ke arah tafsir kontemporer mutlak diperlukan. Ketika al-Qur’an menyatakan bahwa kehadirannya sebagai petunjuk bagi manusia maka setiap manusia berhak menggali petunjuk-petunjuk dimaksud. Mengingat bahwa pola kehidupan manusia berganti dari generasi ke generasi berikutnya maka tidak semua petunjuk yang didapati oleh generasi terdahulu masih relevan dengan kehidupan generasi sekarang. Petunjuk yang didapati oleh orang-orang terdahulu dari alQur’an -khususnya tentang kehidupan- tentu saja tidak sama dengan petunjuk yang dibutuhkan oleh orang-orang yang hidup pada zaman sekarang. Disinilah letak pentinganya penafsiran kontemporer karena setiap pesan al-Qur’an sudah pasti berkaitan dengan kehidupan manusia (tidak makhlukmakhluk yang lain). Jika manusia adalah makhluk yang memiliki budaya dan peradaban yang berkembang maka sudah pasti al-Qur’an telah mengantisipasinya, jika tidak, maka keaktualkan al-Qur’an akan tergugat. Dengan demikian, maka penafsiran terhadap ayat-ayat al-Qur’an tidak pernah selesai karena kapan dan dimanapun pesan-pesan al-Qur’an tetap saja aktual dalam kehidupan manusia. Penutup Dari wacana di atas, dapat disimpulkan jika ada ayat-ayat al-Qur’an yang tafsirannya tidak relevan dengan kehidupan kontemporer atau bertentangan dengan akal dan hati nurani maka ada yang salah dalam penafsiran tersebut. Oleh karena itu, menjadi kewajiban kita semua untuk mengaktualisasikannya dalam kehidupan kekinian. Upaya ke arah ini memang harus dilakukan karena petunjuk alQur’an tidak akan datang dengan sendirinya kecuali jika manusia berusaha untuk menggalinya. Penulis adalah Dosen Fak. Tarbiyah IAIN SU dan Pengurus el-Misyka Circle) Inggris, akhir-nya harus dicopot dikarenakan skandal seks (zina) yang menimpanya. Secara psikologis dampak negatif dari perbuatan zina adalah menimbulkan rasa takut di hati pelakunya, stress, dan tidak lapang dada. Sehingga, ketika ia sudah menikah maka biasanya rumah tangganya juga jauh dari rasa tenteram, banyak pertengkaran terjadi dan akhirnya menjadi broken home. Ketiga: Mendapat Murka Allah. Orang yang berzina akan mendapat murka dari Allah. Dengan kata lain perbuatan zina merupakan satu cara untuk mengundang murka Allah. Secara logika sederhana, penulis berfikir semakin banyak orang yang berzina di suatu daerah, maka akan semakin besar peluang datangnya azab atau murka Allah di daerah tersebut. Na’udzubillahi min zalik. Karena murka Allah, orang yang berzina akan diperlakukan dengan perlakuan yang tidak sesuai dengan keinginan mereka. Siapa saja yang menginginkan kenikmatan hidup dengan keindahannya, tetapi ia meraihnya dengan cara bermaksiat kepada Allah, maka Allah pasti akan mengadzabnya dengan kebalikan apa yang diinginkannya. Sesungguhnya, semua kenikmatan yang ada di sisi Allah tidak akan bisa diraih kecuali dengan cara mentaati perintah-Nya, karena Allah sama sekali tidak pernah menjadikan suatu kemaksiatan sebagai penyebab untuk memperoleh kebaikan. Keempat: Kekal di dalam Neraka. Bahaya yang keempat ini bahaya yang sangat menakutkan karena siksaan orang yang berzina sangat mengerikan. Sebagaimana hadits Rasulullah SAW yang diriwayatkan Bukhari dari Samurah bin Jundub, bahwa Nabi SAW bersabda kepada kami, “Sesungguhnya semalam telah datang kepadaku dua orang. Lalu mereka membangunkan aku dari tidurku seraya berkata, ‘Ayo pergi!’ Lalu aku pergi bersama mereka. Maka sampailah kami kepada suatu tempat seperti pembakaran. Tiba-tiba terdengar suara ribut dan gaduh. Kami pun pergi untuk mencari tahu tentang apa yang tengah terjadi. Di dalam tempat pembakaran tersebut ternyata berisikan wanita dan laki-laki telanjang, dan terdapat api menjilat mereka dari bawah. Apabila api itu menyambar, mereka berteriak-teriak meminta tolong.” Pada akhir riwayat dijelaskan, bahwa laki-laki dan wanita telanjang tersebut adalah para pelaku zina”. Begitulah keadaan orang yang berzina untuk selamalamanya. Na’udzubillah. � Penulis adalah Dosen PGRA UMSU, Penulis buku Aqidah Islam

Mimbar Jumat

WASPADA Jumat 1 April 2011

Perbankan Syariah Perlu Produk Baru DALAM sosialisasi perbankan syariah beberapa waktu yang lalu di Medan Direktur Direktorat Perbankan Syariah Bank Indonesia (BI) Mulya E Siregar menekankan pentingnya menciptakan sebuah produk baru dalam pengembangan perbankan syariah. Menurutnya pekerjaan tersebut tak mudah, maka perlu kerjasama yang baik antara para pihak terkait untuk menjadikan ekonomi Islam sebagai sebuah solusi ekonomi masyarakat. Menanggapi peryataan tersebut Guru Besar Fakultas Ekonomi Universitas Trisakti Prof Sofyan Syafri Haraharap, mengatakan untuk mempertahankan dan melanjutkan pengembangan perekonomian Islam di Indonesia, maka perlu sinergi antara stakeholder para perbankan syariah. Sambil mengutip perkataan Thomas Kuhn seorang filosof, dia menjelaskan sistem dan keuangan syariah masih dalam tataran individu serta idealisme, belum menjadi sistem yang har-monis untuk menjadi stakeholder yang dapat merambah dan di-percaya oleh lembaga keuangan di dunia. Sofyan menegaskan, peluang untuk mengembangkan dan mere-

visi mekanisme ekonomi syariah tersebut sangat terbuka. Maka dari itu, semua pihak harus berkontribusi dalam mewujudkan dalam sistem yang baku untuk menguasai pasar internasional. “Untuk itu para bankir harus konsisten dalam memberikan pelayanan, servis, esplain dan terbuka,”ungkapnya. Untuk mendukung prose situ semua, Sofyan mengingatkan agar semua akademisi harus terus melakukan penelitian, merubah konsep yang lebih baik dan menyoroti perjalanan kinerja yang berjalan. Selain itu pula, ulama juga harus ikut serta dalam melakukan sosialisasi kepada masyarakat agar mau menjauhkan sistem ekonomi yang penuh dengan riba.

Syafi’i Antonio:

Membangun Bisnis Yang Sehat Dengan Manajemen Syariah Pakar ekonomi syariah Syafii Antonio beberapa waktu lalu di Jakarta mengungkapkan, pemahaman masyarakat muslim Indonesia mengenai konsep syariah masih terbatas hanya pada kegiatan ibadah rutin, padahal konsep syariah meliputi semua aspek kehidupan. Ekonomi syariah juga tidak hanya sebatas pada perbankan syariah, namun mencakup berbagai ruang lingkup perekonomian yang mendasarkan pada pengetahuan dan nilai syariah Islam. Cara pandang itu sudah saatnya diubah dan untuk mengubahnya, ada tujuh konsepsi yang perlu diterapkan. Konsepsi itu akan berjalan efektif jika tiga elemen yakni para teknokrat, ulama dan pemerintah dapat bersinergi. Lebih jauh menurut pakar ekonomi syariah Syafii Antonio, Syariah selama ini masih dianggap sebagi ibadah rutin, seperti sholat,zakat, haji. Syariah itu sendiri harus dipahami secara umum karena dalam bahasa itu bermakna syar’i atau jalan menuju mata air dan jalan menuju kehidupan. Syariah itu juga bukan hanya dari sisi ekonomi, yang dimaksud itu merupakan muamalah. Tugas kita adalah bagaimana mengintegrasikan hukum dan nilai yang kita ambil dari Al-Quran dan As-sunnah masuk dalam kehidupan ekonomi, produksi, distribusi, marketing dan keuangan, itu satu tantangan dalam menginternalisasi nilai-nilai ini. Cara mengembangkan dan merubah paradigma itu di masyarakat, katanya, dia ingin memberikan tujuh langkah yang harus dilakukan. Pertama Konseptual Development, artinya konsepsi-konsepsi dari Al-Quran dan As-sunnah kita gali, sehingga relevan dengan yang kita butuhkan. Kedua, dari sisi Legal Frame Work, bagaimana supaya itu kokoh harus didukung oleh peraturan baik perda ataupun UU, surat keputusan direksi dari level manapun, sehingga bisa kokoh. Ketiga, hal itu nantinya bisa dituangkan ke dalamPolicy (kebijakan). Kita harus membantu supaya itu ter-Akselerasi, kalau memungkinkan ada keterlibatan institusi di dalamnya, sehingga kita tidakduduk di menara gading, tetapi bisa ke lapangan. Kemudian untuk menjadi industri, maka kita harus mendorongnya supaya bisa bergerak. Keenam, Regeneration, kita harus menyiapkan kader-kader untuk memastikan ini bisa berkelanjutan, dan setiap saat kita harus bisa melakukan Sosialisasi,sehingga diketahui oleh banyak orang. Inilah kerja bersama para teknokrat, ulama dan juga pemerintah. Dalam kebijakan perekonomian dia melihat konsep syariah ada yang sudah, ada juga yang belum dan ada juga yang terlambat diterapkan. Yang sudah sedikit menerapkan, di lembaga keuangan dan perbankan, tetapi belum lengkapmisalnya bagaimana menarik dana-dana dari Timur Tengah dengan satu obligasinegara yang berbasis syariah. Negara Singapura, begitu tahu, langsungmelakukan modifikasi pada penerapannya ke dalam sistem yang ada, sehinggabisa memastikan dana-dana Timur Tengah itu masuk. Bahkan Jepang juga melakukan itu, serta salah satu negara bagian di Jerman sudah mulai melirik hal itu, begitu juga dengan China. Saya khawatir Indonesia akan ketinggalandalam hal melakukan deregulasi kebijakan sektor finansial.Walaupunpembinaan perbankan syariah dan pembinaan asuransi syariah sudah ada, tetapi masih belum ditingkatkan. Manajemen syariah itu universal, karena manajemen itu lebih kepada softskill, lebih kepada kebiasaan, norma, strategi. Karena melihat keempat hal ini, maka peluangnya terbuka luas. Terutama dari sisi SDM, sisi operasi,dari sisi pemasaran, dan keuangan. Ini yang standar-standar saja, dan inisemua bisa dimasukan oleh norma manajemen. Hal itu juga seperti dikatakandalam Al-Quran, Sunnah, rukun Islam, rukun iman dan sepanjang sejarah merekamemiliki kebijakan itu. Bahkan dalam ritual seperti doa, sholat,puasa bisa sangat berpengaruh ke dalam efektivitas manajemen terutama untuk pengembangan SDM, serta untuk manajemen keuangan dapat lebih transparan. Cara untuk mengefektifkan manajemen seperti itu untuk efektivitasnya, diperlukan adanya norma perusahaan, apa yang disebut langkah strategis, serta ada yang disebut visi dan misi, maka dari situ dituangkan dalam peraturan kerja kemudian dipadukan dengan sistem manual, yang berasal dari keahlian paling dasar dan hal yang bersifat kuantitatif, serta nilai-nilai yang diadopsi, sehingga ujung-ujungnya bisa kuantitatif. Asalnya normatif kemudian diikat dengan Standard OperatingProcedures (SOP), ujungnya bisa menjadi kuantitatif. Sebagai contohnya melakukan pemasaran, kita harus jujur, tidak boleh berbohong, harus menyampaikan apa adanya, ini sesuatu yang soft. Mengandalkan kejujuran dan apa yang dituangkan dalam brosur, jangan berbicara di luar kandungan yang asli. Dan jika terjadi proses diskon dari harga, harus benar manajemen keuangannya, kemudian ditransfer ke dalam lembaga keuangan syariah. Dan jika dipublikasikan di media, jangan membuka aurat. Itu semua norma tapi menjadi sesuatu yang konkrit dengan satu aturan yang bernama manajemen berbasis syariah.(gc/m20)

“Pemerintah dan para regulator harus mendukung dan adil agar masyarakat dapat meneriman serta tidak disalahkaprah bila ada sesuatu yang masih belum maksimal untuk dijalankan,” tuturnya. Website syariah Sementara itu Badan Pengawas Pasar Modal dan Lembaga Keuangan (Bapepam-LK) resmi meluncurkan website pasar modal syariah di Gedung Bapepam-LK. Kepala Biro Standar Akuntansi dan Keterbukaan Bapepam-LK Etty Retno Wulandari menyatakan, adanya website tersebut dilatarbelakangi oleh keinginan untuk melakukan sosialisasi dan edukasi mengenai pasar modal syariah dengan menggunakan sarana yang cepat, informatif dan efektif. Website pasar modal syariah dapat diakses melalui situs web Bapepam-LK dengan alamat www.bapepam.go.id. Secara umum, konten website tersebut meliputi pengenalan pasar modal syariah, Peraturan Bapepam-LK dan fatwafatwa Dewan Syariah NasionalMajelis Ulama Indonesia (DSNMUI), Daftar Efek Syariah, statistik produk syariah, dan edukasi yang berisi antara lain daftar istilah pasar modal syariah serta publikasi. Bapepam LK berharap, website pasar modal syariah dapat meningkatkan pengetahuan dan pemahaman pelaku pasar dan masyarakat

Ustadz H.Sabam Situmorang:

5 Poin Inti Maulid Nabi Ustadz H.Sabam Situmorang , mantan mualaf, mengatakan sebagai muslim Batak kita harus tetap menjaga Dalihan Natolu, sebagai Undang-Undang adat Batak, akan tetapi ketika adat sudah berbenturan dengan agama, maka utamakan agama. Rasul pernah diajak pamannya untuk menyembah seminggu kepada leluhurnya, seminggu ke masjid. Rasulullah menolak, turunlah ayat kafirun yang artinya (bagimu agamamu bagiku agamaku). Kata Situmorang, dalam acara peringatan Maulid Nabi di kawasan Harian Boho di daerah pinggiran DanauToba, barubaru ini. Ada lima inti dari Maulid Nabi Muhammad Saw, yaitu Rasul sangat cinta kepada kita, terbukti ketika beliau mau wafat, masih mengingat dan memperhatikan umatnya, beliau sangat takut jika umatnya satupun masuk neraka. Maka kita sebagai yang mengaku umatnya seharusnya lebih sayang kepada beliau (Muhammad Saw-red). Dalam hadits Buchari Muslim mengatakan, jangan kamu katakan kamu beriman sebelum engkau lebih mencintai manusia dan anak-anakmu dibandingkan dengan Rasulullah. Kemudian, tegas kepada orang kafir, termasuk sekelompok manusia yang tidak menginginkan kemajuan agama Islam. Sebagai seorang muslim harus mampu memfilterisasi budaya barat yang begitu dahsyat memasuk ruang pikiran generasi muda sampai kepelosok desa. Untuk itu sebagai generasi harapan umat dan bangsa harus siap bersaing dan tidak terkontaminasi dengan budaya yang dapat merusak moral. Sebagai anak Batak muslim semangat belajar harus ditingkatkan sehingga kelak dapat bermanfaat bagi nusa dan bangsa sebagaimana dicontohkan putra daerah pinggiran Danau Toba yang sudah dapat mengharumkan nama daerah seperti Prof.DR. H. Aslim Sihotang ahli bedah mata, H. Husnan Sutumorang mantan kepala BPN mereka putra Harian Boho begitu juga Prof.DR.H.Syawal Gultom Rektur Unimed, putra Onan Runggu dan masih banyak lagi. Lanjut H.Situmorang, mempererat ukhuwah Islamiyah, tanpa membedakan marga, suku terutama diaerah Samosir yang minoritas muslim. Dalam sebuah hadits dikatakan “Al-Muslimu kamisli nahl”…, muslim itu seperti tawon (lebah), yang dimakan yang baik dan tidak mengganggu yang lain, tapi kalau sudah diganggu matipun mau demi mempertahankan ukhuwah dan kebenaran.Sebagai muslim sejati harus saling menasehati dan membantu satu sama lain, termasuk menasehati dalam mencari jodoh kalau sudah mapan, jangan menikah dengan lain aqidah, Haram hukumnya kawin sipil. Intinya muslim sependeritaan. Kemudian mendirikan shalat. Rasul pernah menyampaikan, bahwa perbedaan menonjol antara muslim dan kafir, terletak pada shalatnya. Sebelum shalat harus wudhu’. Orang yang sering wudhu’ pancaran wajahnya laksana Nur atau Cahaya walaupun kita kerja digalung (ladang) shalat tidak bisa ditinggalkan karena itu merupakan sarana berkomunikasi terhadap Maha Pencipta sekaligus menyampaikan segala permasalahan hidup terhadap yang memberi hidup. Sebagai seorang muslim yang rajin mendirikan shalat harus ada bekas shalatnya. Artinya action atau praktek sehari-hari bertindak dan bertingkah laku harus sesuai dengan arahan dan ajaran Islam. Kalau tidak sesuai tingkah dengan perbuatan berarti belum mampu mendirikan shalat tapi baru melaksanakan shalat saja. Sebagai landasan lima poin diatas merujuk dari Surah (Al-Fath:29), demikian ustadz H.Sabam Situmorang.(m24)

DELI SERDANG Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Delitua Jl. Medan-Delitua Km.11,5 Jami’ Al-Ihsan Jl. Imam Abdul Desa Selemak Kec. H.Perak Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Lembaga Pemasyarakatan Klas II-B Jl.Sudirman No.27 Nursa’adah Jl. Medan-Tg. Morawa, Km. 12 Nurul Ikhwan Jl. H.A. Dahlan Tanjung No. 38 Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Taqwa Jl. Diponegoro No. 1 Lubuk Pakam Ukhuwah Jl. Binjai Km 11,2 Dusun II-III Ds. Mulio Reko

A.R. Rambe Drs. H. Mukhtar Effendi Barus Ibnu Salman, S.Ag Drs. Ahmad Riadi Daulay, M.Ag Aisul Siddik, S.Ag Prof. DR. H. Ramli A. Wahid, MA Ilham Syaputra, S.Pd.I Drs. Amin Rasyid Nasution Drs. H. Munawar Kholil Sahyono, AMA

BINJAI Agung Kota Binjai An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahmah Turiam Kel. Tanah Tinggi Al-Hidayah Jl. Talam Kel. Nangka Al-Hilal Jl. Ikan Arwana No. 17 Kel. Dataran Tinggi Darussalam Kel. Tanah Tinggi Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Jamik Athohirin Kec. Binjai Utara Nurul Falah Jl. Sisingamangaraja No. 60 Nurul Yaqin Jl. S.M. Raja Kel. Tanah Tinggi Nurul Amin Al-Washliyah Kebun Lada

Drs. H. Romsil Harahap Romo Rd. H.M. Syafi’i, SH, MH H. Misto, AR Drs. Amiruhansyah Drs. Ardiono H. Nurbain Tuah, Lc Drs. M. Yahya Fachri Nurdin Panjaitan Drs. H. Hasan Tazir Drs. Yunani, H. H. Chandra Matulesi, S.Pd.I

STABAT Ar-Raudah Dusun VII Masjid Desa Kebun Balok Al-Furqan Lingkungan I Kel. Kwala Bingai Istiqomah Pasar Baru Stabat

Al-Hidayah Lingk. 03 Jl. Kunyit Kel. Tg. Marulak Hilir Al-Ikhlas Jl. H.S. Beringin Lingk. 6 Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak Al-Ihsan Simp. Dolok Kel. Sri Padang Kec. Rambutan Al-Jihad Jl. Gunung Arjuna Lk. 01 Kel. Mekar Sentosa Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Al-Mukhlis Jl. Ahmad Yani Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Muthmainnah Lingk. I Kel. D.Sundoro Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir Al-Qomar Perum. Purnama Deli Lingk. V Kel. Bulian Darul Jannah Jl. Bhakti LKMD Lingk. 01 Kel. Lalang Darul Jihad Brimob Jl. Ahmad Yani Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Jami’ Jl. Batu Bara Kel. Satria Nurul Huda Jl. Bukit Bandar Lingk. 03 Kel. Lalang Nurul Islam Jl. Pulau Irian Lingk. 04 Kel. Persiakan Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Jl. R. Suprapto No. 126 Syuhada Jl. Iskandar Muda No. 70 Taqwa Jl. Prof. H.M. Yamin SH, Kampung Keling

Peran Ekonomi Harta Wakaf Oleh Suhrawardi K Lubis AMALAN ibadah wakaf telah dilaksanakan semenjak zaman Rasulullah Saw. Pada masa Khulafa ar Rasyidin ibadah wakaf ini berterusan diamalkan, dan selanjjutnya diamalkan secara berterusan oleh umat Islam di berbagai negara. Dalam sejarah umat Islam, ditemukan bukti bahwa harta wakaf telah memiliki peran sosial ekonomi yang besar dalam masyarakat Islam. Monzer Kahf, (1992: 19) mengemukakan telah didapat informasi bahwa wakaf di Istambul, Jerussalem, Kairo dan kota-kota lainnya meliputi sebahagian besar dari keseluruhan wilayah yang digunakan masyarakat. Bahkan di Indonesia, pada masa kerajaan Aceh (berdiri pada 1511 Masehi) ibadah wakaf banyak diamalkan oleh masyarakat. Kerajaan Aceh mempunyai Kanun Meukuta Alam atau Kanun al-Asyi. Dalam Kanun ini dikemukakan ada satu institusi bernama Balai Meusara yang memiliki fungsi untuk mengelola wakaf (Irsyad, 2009: 3-4). Demikian juga di negara-negara lain banyak ibadah wakaf ini diamalkan dan berperan dalam aktivitas ekonomi masyarakat. Untuk lebih jelasnya peran ekonomi harta wakaf diberbagai negara dijelaskan secara singkat seperti masa Daulah Uthmaniah, Mesir, Saudi Arabia, Amerika, dan Malaysia. Daulah Uthmaniah Seperti dipetik Irsyad (2009: 4), Ghio mengemukakan bahwa Muradja d’Ohson seorang peneliti dan observer bangsa Eropa yang menetap di Turki menyebutkan pada masa pemerintahan Daulah Uthmaniah di Turki, sekitar sepertiga dari tanah yang digunakan untuk lahan pertanian merupakan harta wakaf. Bahkan sumber lain menyebutkan ¾ (tiga perempat) dari jumlah bangunan dan tanah merupakan harta wakaf yang digunakan untuk kepentingan umat (Irsyad, 2009: 5). Informasi dan data di atas sesuai dengan pernyataan Syaikhul Islam pada masa itu yang mengemukakan bahwa selama masa itu pendapatan harta wakaf memberikan sumbangan yang besar terhadap pendapatan negara (Yildiz, 1984: 53). Uraian di atas, memperlihatkan bahwa harta wakaf dan institusi wakaf dari perspektif ekonomi sangat produktif dan memberi sumbangan yang bermakna terhadap pendapatan negara pada masa itu. Harta wakaf di Mesir Mesir merupakan salah satu negara yang cukup serius dalam pengelolaan harta wakaf (Irsyad, 2009: 15). Dari pengelolaan wakaf mampu memberikan sumbangan besar dalam bidang sosial dan pendidikan. Hal ini dibuktikan dengan adanya ribuan pelajar dan mahasiswa dari berbagai negara menuntut ilmu di Universitas Al-Azhar dengan biaya dari hasil harta wakaf (Depag RI, 2005(b): 74). Selain untuk membiayai pelajar dan mahasiswa, hasil wakaf juga digunakan untuk membiayai seluruh aktivitas Universitas, termasuk mendatangkan guru besar dari berbagai negara. Diperoleh informasi, bahwa harta di Wakaf Mesir memberikan sumbangan yang besar kepada negara. Bahkan dana wakaf Universitas al-Azhar diinvestasikan di berbagai bidang usaha produktif, termasuk di Perusahaan Penerbangan. Harta wakaf di Saudi Arabia Di Arab Saudi peran ekonomi harta wakaf di antaranya ditunjukkan dengan pengelolaan institusi wakaf yang maju dan produktif di sekitar masjidil Haram di kota suci Makkah dan di sekitar Masjid Nabawi di kota suci Madinah. Di sekeliling kedua masjid tersebut dibangun berbagai sarana dan prasarana ekonomi produktif dan memberikan sumbangan yang sangat berarti untuk kemajuan ekonomi. Lahan yang ada disekitar dua masjid tersebut dibangun berbagai sarana, seperti hotel, apartemen, rumah sakit, restoran, pusat-pusat perbelanjaan, pusat pemerintahan dan lain-lain (Depag RI, 2005(b): 6). Model pembangunan dan penggunaan wakaf seperti ini menjadikan harta wakaf bersifat produktif, dan akan memberikan kontribusi yang besar untuk pembangunan ekonomi umat Islam. Harta wakaf di Amerika Di Amerika, sebagai sebuah negara sekuler dan

Drs. Burhan Faisal Emil Sofyan, S.Pd.I Rahmad Halim Aminullah, S.Pd.I Aliansyah Drs. H.M. Ghazali Saragih H. Asdi Akmal Nasution Drs. Abd. Khalik, M.AP Yusnan H. Saman, M. Syafril Purba, S.Pd Febri Novindra Drs. M. Ridwan Syam Ponirin Burhan, S.Pd.I Ramadhan Lubis H. Sakan, M. Drs. H. Ibrahim Harahap Wan Irfan Ansori, S.Pd.I H. Mohd. Thohir, SH Ahmad Syarif, S.Pd Yahya Hakim, S.Pd

INDRAPURA Jami’ Indrapura

H. Abd. Rahman Lubis Saiful Bahri Sinaga H.M. Amin Lubis Muslim Istiqomah H. Nandang Hasunudin, SH M. Idris

Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Al-Hidayah Jl. Cokroaminoto Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Kel. Gambir Baru Kel. Kisaran Timur Jami’ Baiturrahim Kel. Kisaran Naga Jami’ Lingk. I Kel. Bunut

jumlah umat Islam yang relatif sedikit, pengelolaan harta wakaf cukup berkesan. Salah satu pihak yang melakukan pengelolaan dan pengembangan wakaf adalah Kuwait Awqaf Public Foundation (KAPF). Lembaga ini telah ber-hasil membina The Islamic Cultural of New York (ICCNY). Bahkan dikemukakan (Depag RI, 2005c: 10) pendapatan sektor derma yang berhasil dihimpun di Amerika Serikat dari tahun 1990 hingga 1999 mencapai jumlah US31,9 miliar.Dengan dana sebesar itu tentunya akan memberi manfaat yang besar terhadap pembangunan umat Islam. Harta wakaf di Malaysia Sebagai sebuah negara Islam, Malaysia memiliki harta wakaf yang cukup banyak dan tersebar luas di seluruh penjuru negeri. Pengelolaan wakaf dilakukan oleh masing-masing Majlis Agama Islam Negeri. Di Malaysia, harta wakaf selain digunakan untuk keperluan peribadatan, juga digunakan untuk kepentingan pendidikan. Bahkan ada juga yang digunakan untuk kepentingan ekonomi, seperti untuk pembangunan apartemen, pertokoan, stasiun pengisian bahan bakar/ SPBU, kebun kelapa, dan sebagainya (Muhammad Syukri Salleh & Abdul Hamid Md Tahir, 1985). Bahkan Utusan Malaysia seperti dipetik Ahmad Azrin Adnan dan Wan Mohd Yusof Wan Chik (2009: 3), melaporkan bahwa pengurus wakaf Majlis Agama IslamWilayah Persekutuan (MAIWP) telah membangun tanah wakaf miliknya di kawasan segi tiga emas Jalan Perak Kuala Lumpur untuk membangun menara MAIWP pada awal Juni 2007. Projek pembangunan tanah wakaf terbesar di Malaysia itu telah membangun bangunan gedung setinggi 34 tingkat dengan biaya RM151 juta (sekitar 450 milyar rupiah). Selain itu, Jabatan Wakaf, Zakat dan Haji (JAWHAR) telah pula memastikan 24 projek komersial untuk dibangunkan di atas tanah wakaf di seluruh negara yang bakal dilaksanakan sepanjang Rancangan Malaysia keSembilan (RMK-9). Dengan pengelolaan wakaf seperti itu, tentunya harta wakaf memiliki potensi yang besar untuk pemberdayaan ekonomi umat di Malaysia. Sekaitan dengan manfaat ekonomi wakaf ini, M. Yasir Nasution (2004: 76) mengemukakan bahwa terjadi mobilititas, baik dari sudut sosial, politik dana ekonomi akan terjadi secara natural dan seimbang dalam kehidupan masyarakat, karena ada aset abadi yang dapat dimanfaatkan oleh semua orang terutama yang memerlukan. Oleh karena itu, kesempatan untuk maju dalam bidang ekonomi, pendidikan, sosial dan politik akan terbuka luas ke lapisan bawah. Bagaimana dengan harta wakaf di Indonesia? Dewasa ini, di Indonesia banyak terdapat harta wakaf, namun harta wakaf tersebut belum memberikan kontribusi dalam kehidupan sosial ekonomi masyarakat. Hal ini terjadi karena tidak ada modal untuk mengembangkan dan menggunakan harta wakaf yang ada. Untuk itu diperlukan modal. Salah satu cara memperoleh modal untuk pengembangan harta wakaf yang ada, ialah dengan mengembangkan wakaf dalam bentuk uang tunai. Wakaf dalam bentuk uang tunai dalam tradisi Islam di sebut “Waqf al-Nukud”, dipopulerkan juga dengan cash waqf. Pada masa pemerintahan Dinasti Usmani di Turki wakaf wang ini telah berjalan untuk pembiayaan dan perawatan aset wakaf (Ahmet Tabakoglu, 1992: 9) Oleh karena itu, sudah saatnya pula wakaf tunai dilaksanakan dengan baik dan berterusan di Indonesia. Dengan itu akan ada dana abadi potensial yang sangat besar yang dapat dimanfaatkan untuk pemberdayaan harta wakaf untuk aktivitas ekonomi dan kesejahteraan umat. Penutup Dari uraian di atas dapat dikemukakan bahwa harta wakaf mempunyai potensi yang besar untuk berperan membangun ekonomi umat dan kesejahteraan masyarakat. Dengan itu diharapkan ibadah wakaf akan bernilai sedekah jariah kepada orang yang berwakaf dan memberikan kontribusi kepada ekonomi umat. Semoga! Penulis adalah Ketua Laziswa PWM-SU, Ketua Umum HIMNI-SU, Ketua DMI-SU, Peserta PhD ISDEV-USM

Majelis Zikir Di Masjid Raya Al-Mashun MENYIKAPI berbagai perkembangan akhirakhir ini yang menyudutkan umat Islam dengan berbagai istilah negatif, Islam Teroris,Islam Anarkis, dan istilah lainnya, perlu disampaikan kepada umat bahwa istilah tersebut merupakan salah satu cara “musuh-musuh” Islam untuk melemahkan daya juang umat Islam terutama bagi mereka yang kurang pemahamannya tentang iman dan Islam. Demikian antara lain isi tausiyah yang akan disampaikan Ustadz H.M.Nasir, Lc, MA pada acara berzikir berjamaah di Mesjid Raya Al Mashun Medan hari Minggu 3 April 2011, jam 8.00 Bahkan tambah Ustadz H. M.Nasir,Lc.MA yang juga pimpinan Majelis Zikir Ulul Albab Sumut “ awal bulan Maret sampai sekarang, saudara kita di Libya sedang dibombardir oleh pasukan AS dengan para koalisinya, mereka ingin menjadikan Libya sebagai Taliban Jilid II, dan sebagai umat Islam sudah selayaknya kita mendoakan saudara kita agar diberi pertolongan oleh Allah SWT dalam

Abd. Azis Nur

KISARAN Drs. H. Usminoto Usman H. Abdussalam, Lc Kholid, S.Ag

TEBING TINGGI Amal Muslimin Kp. Rao Amaliyah Jl. K.F. Tandean No.344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taufiq Jl. Jend. Sudirman Kel. Sri Padang At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Al-Abidin Jl. Kom. Yos Sudarso Kel. Lalang

mengenai pasar modal syariah. ‘’Sehingga dapat meningkatkan keterlibatan pelaku pasar dan masyarakat dalam kegiatan pasar modal syariah,’’ harap Etty. Lebih lanjut ia menyampaikan, keterlibatan pelaku pasar dan masyarakat ini diharapkan mampu mengakselerasi pengembangan pasar modal syariah di Indonesia. ( Agus Y) Kemudian untuk memberikan sertifikasi profesi bagi para manager Koperasi Jasa Keuangan/Koperasi Jasa Keuangan Syariah (KJK/KJKS), pemerintah merasa ‘overload’, pasalnya hingga saat ini para pelaku KJK/KJKS yang terdiri dari para manager yang telah mendapatkan sertifikasi berjumlah 600. Padahal jumlah KJK/KJKS yang ada selama ini berjumlah 3600 lembaga. “Maka saya rasa butuh kerja yang sangat besar dalam mensertifikasi profesi itu,”terang Hendrianto Asisten Bidang Deputi Sumber Daya Manusia Kementerian Koperasi dan UKM. Agar semua KJK/KJKS memperoleh sertifikasi, Hendrianto mengatakan dalam mengatasi masalah tersebut ia mendorong pihak swasta untuk bekerjasama dalam melakukan standarisasi profesi bagi KJK/ KJKS seluruh Indonesia. Itu strategi yang ingin ia lakukan. Dalam laporannya Hendrianto menjelaskan dalam melakukan sertifikasi para pengelola koperasi hanya baru Koperasi Simpan Pinjam (KSP) dan belum Unit Simpan Pinjam (USP) jadi sangat besar tugas melakukan sertifikasi tersebut. Padahal target sertifikasi bagi KSP itu adalah 2014 sudah selesai. “Belum lagi saat ini ada Koperasi Jasa Keuangan Syariah (KJKS) yang jumlahnya sangat banyak sekali terutama di pulau Jawa,”tuturnya. (m06)

C5

H. Edy Sucipno, S.Ag Amin Hidayat, S.Ag Drs. H. Imran Mahdin, MA Nono Astono Drs. Lahuddin Hasibuan Drs. H. Abdur Rasyid Drs. H.Nummad Adham Nst.,SH, MA H. Salman Tanjung, MA, Lc Drs. H. Zulhaidir H. Ahmad Kosim Mrp., M.SI Asri, HS

menghadapi serangan pasukan Amerika dengan koalisinya yang sebenarnya sangat menyalahi resolusi Persatuan Bangsa Bangsa (PBB)”. Ustadz H.M. Nasir, Lc, MA juga akan menyampaikan materi Dialog Interaktif dengan judul “Kewajiban Suami terhadap Istri”. Materi tersebut penting terutama menyikapi berbagai informasi tidak saja di kalangan para selebritis, namun sudah sampai di kalangan sebagian Ustadz dan Muballigh. Untuk mengetahui lebih mendalam isi tausiyah dan Dialog Interaktif bulanan yang akan disampaikan Al Ustadz H.M.Nasir,Lc, MA, Majelis Zikir Ulul Albab Sumut, bersama Gema MadinahMekkah (GADIKA) Sumut dan Bank Syariah Mandiri (BSM), mengajak kaum muslimin muslimat khususnya di kota Medan sekitarnya untuk menghadiri zikir berjamaah di Masjid Raya Al Mashun Medan. Pembaca ayat suci Alqur’an Hamsar Sinaga, S.H.I. S.Pd.I. (h01)

Nurul Yaqin Kantor Direksi - Kisaran Siti Zubaidah Jl. Budi Utomo No. 285

H.A. Qosim Marpaung H. Syawaluddin Damanik, S.Ag

LABUHAN BATU An-Nur Desa Kuala Bangka Baiturrahman Kec. Kualuh Hilir

Syahrul Efendi Khairul Azhar, BA

BATU BARA Jami’ Al Mukhlisin PT. Moeis Nurul Huda Desa Tanah Tinggi Kec. Air Putih Quba Tanjung Kubah Kec. Air Putih Syuhada Sukaraja Jl. Raya Medan-Kisaran Km. 108

Asy’ari, S.Ag Hasan Basri Iriansyah Tugimin, S.Pd

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur Kel. Martoba

H. Zulkarnain Nasution, S.Ag

RANTAU PRAPAT Al-Qodar Jl. Terpisang Mata Atas

Muhammad Sabri, S.Ag

SIBOLGA Al-Munawar Sibolga Jl. Tapian No. 10-A

Ghazali Melayu

BIREUEN Masjid Agung Bireuen Masjid Taqwa Kec Gandapura Masjid Besar Kutablang Masjid Besar Peusangan Masjid Besar Peusangan Siblah Krueng Masjid Besar Peusangan Selatan Masjid Besar Al-Furqan Kec Kota Juang Masjid Ridha Kec. Jeumpa Masjid Besar Kec. Kuala Masjid Besar Baitul Huda Kec. Juli Masjid Besar Peulimbang Masjid Baitunnur Peudada Masjid Baiturrahim Kec Jeunieb Masjid Al-Mabrur Kec Pandrah Masjid Besar Kec Simpang Mamplam Masjid Besar Samalanga

Tgk Muh Ishaq Tgk H Jamaluddin Idris Tgk A Rahman Tgk H Mursyid Yahya Tgk H Ismail Sarong Tgk Basri Abdullah Tgk M Salem Tgk Sahibil Tgk Syech Zubaili Tgk Azmi Sayuti S.Pd.I Tgk M Yusuf Ahmad Tgk H Mansur Suaidi Tgk Ali Mustafa Tgk Mahdi Ule Gle Tgk Mahdi Arongan Tgk Mukhtar

Mimbar Jumat

C6 A

Dakwah Islam Di Brunei Darussalam

ndai satu lembaga atau organisasi Islam dari negara tetangga berkunjung ke Sumatera Utara untuk melihat perkembangan dakwah Islam, apa kirakira yang bisa kita pertunjukkan. Jika mereka mengunjungi MUI baik tingkat propinsi atau kab/kota, informasi dan data apa yang bisa disajikan ? Jika mereka berkunjung ke Dewan Dakwah Islamiyyah SU, apa pula yang bisa kita informasikan ? Jika mereka berkunjung ke Dewan Masjid SU, seberapa lengkap data kita tentang masjid, kegiatannya, manajemennya, dan pengaruhnya dalam pengembangan masyarakat Islam ? Pertanyaan ini terus meng-hantui saya pada saat berkunjung ke Brunei Darussalam beberapa hari yang lalu. Beberapa hari yang lalu, Dewan Dakwah Masjid Al-Ridwan Jln. Ayahanda Medan, di bawah pimpinan Dr. H. Emir El-Nawi, Sp.M melaksanakan lawatan ke Brunei Darussalam. Turut serta dalam rombongan tersebut pengurus Masjid AlRidwan, H. Adlin SH, Syarifullah Ali Ahmad, H. Kasim. SH, Mohammad Dahlan, Drs. H. Masri Sofnar, Dr. Taufiq Mahdi, Sp.OG, Ustaz H. Rafiq Bin Abdurrahman, Ustaz H. Ali Murthada dan saya sendiri. Selama di Brunei kami mengunjungi Pusat Dakwah Islam, Hal ehwal Masjid, Mufti dan Dar al-Ifta’ serta Museum Kerajaan Brunei Darussalam. Kami juga sempat meninjau perkampungan Dakwah di Temburung Brunei dan beberapa aktifitas dakwah di Bandar Sri Begawan. Bagi saya, Brunei adalah satu contoh negara yang serius memi-kirkan Islam sebagai agama resmi negaranya. Mereka berupaya untuk menata dakwahnya sedemikian rupa agar dakwah memberi dampak yang nyata terhadap perbaikan kehidupan masyarakat baik pada dimensi emosional- spiritual, sosial, ekonomi dan budaya. Artikel ini akan menjelaskan bagaimana dakwah Islam di Brunei. Mudah-mudahan, ada pelajaran yang bisa kita ambil dan terapkan di kota Medan khususnya dan propinsi ini pada umumnya. Salah satu tempat yang kami kunjungi adalah Pusat Da’wah Islamiah Kementerian al Ehwal Ugama Negara Brunei Darussalam. Saat ini lembaga tersebut dipimpin oleh Dayang Hajah Hasnah Binti Haji Omar selaku Pengarah Pusat Da’wah. Lembaga ini mulai beroperasi pada 1 Januari 1985 dan diresmikan oleh Paduka Seri Baginda Sultan Haji Hassanal Bolkiah Mu’izzaddin Waddaulah (nama dan gelar yang selalu mereka sebut tanpa ada kesalahan) pada tanggal 16 September 1985. Pusat Dakwah memiliki Visi yang dalam teks aslinya disebut

J

WASPADA Jumat 1 April 2011

(Catatan Perjalanan 7-10 Maret 2011)

Oleh Azhari Akmal Tarigan

dengan, “Memperkasa kerasmian dan amalan ugama Islam sebagai cara hidup yang lengkap dan sempurna bagi mencapai Negara Zikir dan baldatun thaiyyibatun wa rabbun ghafur (Negara yang aman ma’mur dan Tuhan yang maha pengampun). Adapun misinya adalah menjadi sebuah institusi penyebaran agama Islam dan ajaranajarannya bagi memenuhi kewajiban pelaksanaan konsep amarma’ruf nahi munkar di negara tersebut. Membaca visi dan misinya, tentu ada yang berbeda dengan apa yang kita pelajari selama ini. Sederhananya, visi itu adalah sebuah cita dan impian dan perumusannya selalu diawali dengan kata benda. (misalnya sebagai lembaga terdepan dan seterusnya). Sedangkan misi biasanya diawali dengan kata kerja. (menyebarkan, mengembangkan dan sebagainya). Tentu hal ini tak perlu dipersoalkan. Yang paling penting adalah apa yang mereka lakukan untuk Islam itu sendiri. Dalam sesi tanya jawab, saya sempat menanyakan arti Negara Zikir. Ternyata negara zikir yang mereka maksud bukan sebatas amalan atau ibadah lepas shalat. Memang mereka memiliki zikir-zikir khusus yang sering diamalkan setelah shalat ataupun dalam berbagai institusi seperti lembaga pendidikan dan lembaga-lembaga resmi lainnya. Di antara zikir yang populer dalam mazhab Syafi’i adalah apa yang mereka sebut dengana ratib al-‘Athas. Namun bagi saya yang cukup menarik adalah negara zikir yang mereka maksud sesungguhnya nama lain dari Islam Kaffah. Negara sangat peduli dengan agama dan karena itu negara selalu berupaya untuk menerapkan Islam dalam berbagai bidang kehidupan. Negara sungguh-sungguh memperhatikan keberagamaan masyarakatnya. Di Brunei perkembangan ekonomi Islam cukup baik, apakah itu lembaga perbankan Islam, asuransi Islam, zakat, wakaf, infaq dan sada-

qah. Negara juga menjamin bahwa seluruh makanan yang masuk ke Brunei adalah makanan halal. Berkaitan dengan daging sembelihan misalnya, mereka memiliki aturan yang ketat. Jika daging itu berasal dari negara lain, mereka akan meninjau langsung proses penyembelihan di tempat asalnya bahkan sampai kepada proses pengirimannya ke Brunei. Tidak kalah menariknya, di Brunei rokok dan merokok juga dilarang. Kendati demikian, tetap saja ada masyarakat Brunei yang secara diam-diam dan sembunyi-sembunyi melanggar aturan itu. Yang jelas, jika merokok di tempat-tempat umum, mereka dikenakan denda lebih kurang 1000 $B. Pusat Dakwah juga memiliki badan yang bertugas untuk menyeleksi berbagai informasi yang masuk ke Brunei. Lembaga ini disebut dengan “Bahagian Penapisan dan Pameran.” Badan ini bertugas untuk memeriksa segala macam informasi yang masuk apakah lewat buku-buku, DVD, VCD, dan lainnya. Buku-buku agama berasal dari luar Brunei tidak mudah masuk. Mereka harus memastikan terlebih dahulu bahwa buku yang masuk tidak bertentangan dengan ajaran Islam khususnya Islam Ahl-Sunnah wa al-Jama’ah mazhab Syafi’i. Pusat Dakwah juga memiliki bidang pameran. Kami sempat di ajak untuk meninjau ruang pameran yang berlantai dua. Tampaknya ruang tersebut memang dipersiapkan untuk para pelawat (pelancong). Di dalamnya kita akan menemukan informasi yang berhubungan dengan Islam Brunei. Sejarah masuknya,para pendakwah, hubungan Brunei dengan Kalimantan, dan seterusnya. Di sanalah kita akan mengetahui, Sultan Brunei tersebut memiliki hubungan darah dengan Rasulullah melalui Sayyidah Fathimah. Saya tidak sempat mencatat silsilahnya karena terlalu panjang. Di pameran juga ditemukan berbagai buku-buku yang pernah di larang. Saya juga melihat VCD-VCD asal Indonesia yang telah ditapis dan di larang beredar di Brunei. Demikian pula benda-benda yang dipandang merusak akidah umat. Segala jenis jimat, mantra yang pernah beredar di Brunei di koleksi. Di Pameran kita juga melihat selop yang berlafaz Allah. Motif baju kaos yang bertuliskan Allah. Bahkan ban mobil yang modelnya bertuliskan lafaz Allah. Bendabenda itu dilarang di Brunei karena dipandang menghina Tuhan yang agung. Banyak lagi yang bisa kita

pelajari. Pesannya hemat saya hanya satu. Pusat Dakwah memiliki tanggung-awab besar untuk memastikan rakyat Brunei menerima informasi ajaran Islam yang benar dan dari sumber yang benar pula. Setidaknya menurut Islam yang mereka anut yaitu Islam Ahl al-Sunnah Mazhab Syafi’i. Hal yang membuat saya salut adalah, Pusat Dakwah juga memiliki badan penerbitan. Lewat badan inilah berbagai informasi keagamaan di sajikan. Badan ini menerbitkan banyak buku yang berhubungan dengan amaliah peraktis umat. Tidak itu saja, penerbitan ini juga sebagai pembanding atas informasi yang salah. Ketika film Fitna yang menghina Rasul itu beredar dan menjadi berita yang heboh di Brunei- juga di negara Islam lainnya-, mereka langsung membahasnya dan menerbitkan buku kecil yang dibagikan ke masjid-masjid, pustaka, sekolah dan majlis-majlis ta’lim. Tujuannya agar masyarakat mendapat informasi yang jelas dan dapat dipertanggungjawabkan. Satu hal yang membuat kami tersentak adalah dakwah yang dilakukan kepada non muslim. Di Brunei, Islam adalah agama resmi. Tidaklah mengherankan di dalam amanatnya, Sultan menyatakan “Islam sebagai ugama resmi negara. Islam juga dijadikan amalan cara hidup yang sempurna selaras dengan Melayu Islam Beraja.” Kendati demikian, agama lain semisal Kristen, boleh diamalkan oleh pemeluknya tetapi tidak boleh diajarkan dan disebarkan. Bahkan disekolahsekolahpun yang siswanya non muslim, yang diajarkan adalah agama Islam. Bahkan mereka juga diharuskan memakai kerudung. Tidak kalah menariknya, bagi mu’allaf, dewan dakwah menyiap-kan program-program untuk mem-bina akidah dan fikih mereka. Ada program 10 hari, satu bulan dan seterusnya. Pendeknya, orang yang telah memeluk Islam tidak dilepaskan begitu saja. Bahkan mereka juga disantuni oleh negara, terlebih-lebih bagi mereka yang sudah tidak produktif lagi. Dakwah untuk mu’allaf ini hemat saya perlu untuk dicontoh dan diterapkan di Indonesia, khususnya di Medan. Banyak hal yang sesungguhnya dapat dipelajari dari Brunei. Pointnya, hemat saya adalah, Islam bagi mereka bukan sekedar keyakinan tetapi juga tata dan cara hidup. Mereka berusaha untuk mematu-hinya dan mengamalkannya. Lebih dari itu. Mereka juga mengelola dan menata sehingga manajemen Islam benar-benar teraplikasi dalam kehidupan dakwah. � Penulis adalah Koordinator Tim Penulis Tafsir Al-Qur’an SU dan Penasehat Dewan Dakwah Masjid Al-Ridwan Medan.

Bencana Alam Antara Azab Atau Cobaan

epang terkejut sekaligus berduka diterpa Tsunami yang cukup dahsyat. Korban berjatuhan dengan infrastrukur hancur yang cukup banyak yang sebelumnya tidak pernah terpikirkan masyarakat Jepang. Dalam konteks tanah air peristiwa yang sama telah menjadi pengalaman yang mesti direnungkan bangsa ini. Berbagai peristiwa bencana alam yang telah menimpa datang silih berganti, gempa tektonik yang melanda Aceh dan sebagian Sumatera yang diiringi tsunami. Belum selesai, longsor dan banjir bandang melanda berbagai daerah di Indonesia.Yogyakarta pun tidak terlewatkan dari gempa bumi yamg memakan korban tidak sedikit dan bencana yang lainnya yang telah banyak melanda negeri ini.

Oleh Watni Marpaung, MA

Serangkaian beragam bencana alam di tanah aiar merupakan fenomena yang menjadi pertanyaan

Konsultasi Al-Quran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Al-Quran, yang meliputi: tajwid, fashohah, menghafal Al-Quran, Ghina (lagu) Al-Quran, Hukum dan ulumul Al-Quran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustaz, Tanda waqaf antara lain adalah huruf lam kecil yang berarti dilarang berhenti, bagaimana membacanya kalau tanda lam itu ada diakhir ayat, misalnya dalam surat Al-fatihah ayat 2,3 dan 6?. Bagaimana kalau kehabisan nafas karena ayat panjang? Misalnya dalam suratYasin ayat 47? Bagaimana cara mengulangnya?. Dari Azhar di jalan Singosari Medan. Jawab : Terimakasih atas pertanyaanya. Dalam buku-buku tajwid singkat atau diakhir halaman mushaf Al-qur’an selalu ditulis adanya tandatanda waqaf. Diantara tanda waqaf itu adalah tanda lam kecil yang artinya la waqfa fi hi, maksudnya “tidak waqaf pada kata ini”. Di bukubuku tajwid tertulis makna nya adalah “dilarang waqaf”, “tidak boleh waqaf”, “bukan tempat waqaf”, “isyarat tidak baik waqaf”. Yang kami ketahui makna dari itu semua adalah bukan pelarangan total, mungkin bahasa yang tepat makna dari tanda waqaf lam itu adalah tidak baik waqaf. Nawawi Ali menyatakan maksud tidak boleh waqaf adalah bila ibtidak dari kata berikutnya, tetapi jika diulang dari tempat waqaf atau kata sebelumnya maka waqaf pada kata itu tidak dilarang. (Nawawi Ali, Pedoman Membaca Al-Qur’an. hal 143). Kami juga mendengar penjelasan dari KH. Muhsin Salim, bahwa waqaf pada tiap-tiap ayat merupakan sunnah dan dicontohkan oleh Rasulullah, apalagi surat Al-Fatihah. “Ummu salamah berkata Rasulullah apabila membaca Al-qur’an seayat-seayat, seperti bismillahirrahmanirrahim kemudian waqaf, kemudian mengucapkan Alhamdulillah robbil ‘alamin kemdian waqaf, arrahmanirrahim kemudian waqaf”. (Makki Nasr. Nihayatul qauli mufid, hal 161). Jadi, kalaupun ada tanda lam kecil diatas nomor ayat, tidak mengapa untuk waqaf, tetapi jika sekiranya panjang nafas dan makna ayat belum sempurna jika berwakqaf dikata itu, alangkah baiknya untuk dilanjutkan, tetapi khusus untuk surat al-fatihah yang terbaik adalah satu ayat waqaf satu ayat waqaf. Kalau ayat panjang, nafas habis, maka tidak mengapa waqaf pada lam kecil itu, tetapi hendaklah dicari tempat memulainya yang tepat, seperti surat yasin ayat 47 itu, kalau benar habis nafas tidaklah mengapa waqaf pada kata rozaqo kumullah, dan hendaklah dimulai dari kata anfiqu. Wallahu A’lam. Al-Ustadz H. Ismail Hasyim, MA

besar. Indonesia berpenduduk mayoritas muslim tidak pernah absen dengan berbagai bencana dan bencana. Apakah Allah tidak sayang lagi sehingga menurunkan cobaan yang tidak henti-hentinya, atau memang masyarakatnya yang sudah jauh dari petunjuk-Nya Allah Swt menjadikan manusia ke permukaan bumi adalah untuk mengabdi dan tunduk hanya kepada Allah. Tidak ada satu pun kegiatan dan aktivitas manusia terkecuali hanya diperuntukkan mengagungkan dan membesarkan asma Allah. Ini tercermin dari pernyataan Allah dalam surat Al-Dzariyat ayat 56 “Dan tidaklah kuciptakan jin dan manusia hanyalah untuk mengabdi kepadaKu.” Oleh sebab itu, fitrah manusia pada hakikatnya adalah hamba, pelayan Allah di permukaan bumi. Maka keingkaran dan pembangkangan kepada-Nya merupakan tindakan yang berada di luar koridor fitrah manusia itu sendiri. Di samping itu pula, Allah Swt memerintahkan manusia untuk taat dan patuh yang diiringi dengan fasilitas yang diberikan Allah dalam kehidupannya. Seluruh kebutuhan zahir dan batin diberikan kepada manusia untuk memudahkan mereka melaksanakan perintah dan menjauhi segala laranagan-Nya. Bahkan jaminan yang diberikan kepada manusia selama nyawa masih dikandung badan Allah akan tetap memberikan rezeki kepadanya seirama dalam surat al-isra’ ayat , “Dan tiada satu binatang melata pun dipermukaan bumi melainkan Allah yang memberikan rezeki kepadanya.” Dalam kaitannya dengan peristiwa di atas, seharusnya manusia bertanya dan mengevaluasi kembali, apakah mereka masih berada dalam jalan fitrah atau ketaatan. Atau malah sudah keluar dan melakukan pelanggaran-pelanggaran kepada perintah Allah. Sehingga mengakibatkan kemurkaan Allah terhadap mereka. Sebagai ilustrasi, seorang tuan yang telah membiayai hidup para pelayannya secara keseluruhan, yang kemudian menuntut agar mereka dapat bekerja dengan baik dan selalu patuh kepada aturan yang ditetapkan kepada mereka. Pada saat para pelayan sesuai dengan tuntutan sang tuan maka tidak mustahil sang tuan akan memberikan riword (hadiah) yang lebih besar dari gaji yang diterima mereka. Namun sebaliknya, para pelayan yang yang membangkang dan selalu ingkar kemungkinan besar akan mendapatkan sanksi dan hu-

kuman dari tuannya. Korupsi yang merajalela dan semakin terstrukur, ditambah lagi akhlak bangsa yang sudah jauh dari tuntunan agama, pergaulan bebas, free sex, dan lain sebagainya menyempurnakan kebobrokan bangsa ini. Mungkin bencana alam berupa gempa tektonik disertai tsunami yang melanda saudara di mana pun termasuk Jepang merupakan salah satu cara Allah untuk memberikan peringatan kepada hamba-hamba-Nya. Cobaan atau Azab Paling tidak menanggapi kejadian yang dialami saudara-saudara di tanah air dan Jepang setidaknya ada dua pandangan. Pertama, menyebutkan bahwa apapun bentuk bencana yang terjadi semua itu cobaan dari Allah kepada hamba-hamba-Nya. Bagi mereka Allah Yang Maha Pengasih Dan Penyayang tidak mungkin mengazab hamba-Nya sehingga mereka sengsara dan menderita. Tetapi semua itu adalah cobaan yang diberikan Allah agar manusia dapat melakukan introsfeksi diri lebih jauh terhadap perbuatan mereka yang telah lalu. Kedua, mereka yang melihat bahwa bencana alam yang dialami oleh saudara-saudara kita merupakan bahagian azab yang sifatnya duniawi, yang diberikan tempatnnya di dunia ini. Apabila kita analisis lebih jauh dari kedua pendapat di atas, pada hakikatnya Allah tidak pernah menimpakan bala atau musibah kepada hamba-Nya dengan semena-mena sekalipun Allah Swt berkuasa untuk melakukannya. Namun musibah itu datang bahkan silih berganti disebabkan oleh manusia itu sendiri. Hal ini disinyali al-Qur’an dalam surat AlRum ayat 41 “Telah nyata kerusakan di darat dan di bumi disebabkan perbuatan manusia. supaya Allah merasakan kepada mereka sebahagian dari (akibat) perbuatan mereka, agar mereka (kembali ke jalan yang benar. Namun demikian faktor non-fisik pun tidak kalah pentingnya dalam mendatangkan bencana di permukaan bumi. Perbuatan manuisa yang selalu ingkar dan durhaka kepada Tuhan, perzinaan yang semakin merajalela seolah-olah bukan hal yang tabu lagi. Semakin menjamurnya tempattempat yang menyediakan fasilitas mesum, korupsi, dan pengabaian syariat Allah. Bagaiman tidak menjadi penyebab datang bencana dan tsunami atau bahkan lebih dahsyat lagi. Paling tidak bencana yang telah melanda saudara kita di jepang dan di Indonesia dapat dijadikan sebagai pelajaran bagi orang-orang yang beriman dan beramal saleh sekaligus hukuman dan sanksi terhadap orang-orang yang melakukan maksiat dan kenistaan.

Alasan Nabi Sayang Kucing Menyayangi binatang sangat dianjurkan, apalagi kucing karena Nabi Muhammad SAW sangat sayang pada binatang rumah ini. Nabi menekankan di beberapa hadisnya bahwa kucing itu tidaklah najis. Bahkan, kita diperbolehkan untuk berwudhu menggunakan air bekas minum kucing karena dianggap suci. Lantas kenapa Rasulullah SAW yang buta baca-tulis, berani mengatakan bahwa kucing suci, tidak najis? Lalu, bagaimana Nabi mengetahui kalau pada badan kucing tidak terdapat najis? Para pecinta kucing membenarkan pada kulit kucing terdapat otot yang berfungsi untuk menolak telur bakteri. Otot kucing itu juga dapat menye-suaikan dengan sentuhan otot manusia. Pada permukaan lidah kucing tertutupi oleh berbagai benjolan kecil yang runcing, benjolan ini bengkok mengerucut seperti kikir atau gergaji. Bentuk ini sangat berguna untuk membersihkan kulit. Ketika kucing minum, tidak ada setetes pun cairan yang jatuh dari lidahnya. Hasil penelitian, lidah kucing sendiri merupakan alat pembersih yang paling canggih, permukaannya yang kasar bisa membuang bulu-bulu mati dan membersihkan bulu-bulu yang tersisa di badannya. Selain itu, hasil yang diambil dari kulit luar tenyata negatif dari kuman, meskipun dilakukan berulang-ulang.Cairan yang diambil dari permukaan lidah juga memberikan hasil negatif dari kuman. Hanya sekali kuman yang ditemukan saat proses penelitian, kuman itu masuk kelompok kuman yang dianggap sebagai kuman biasa yang berkembang pada tubuh manusia dalam jumlah yang terbatas seperti, enterobacter, streptococcus, dan taphylococcus. Jumlahnya kurang dan 50 ribu pertumbuhan. (Sumber/dikutip dari kumpulan hadis shahih).

Ijtihad, Atau Memindahkan Mazhab? “ Tidak sepatutnya bagi orang-orang yang mukmin itu pergi semuanya ke medan perang. Mengapa tidak pergi dari tiap-tiap golongan di antara mereka beberapa orang untuk memperdalam pengetahuan mereka tentang agama untuk memberi peringatan kepada kaumnya apabila mereka telah kembali kepadanya agar mereka dapat menjaga diri …”.Alquran surah at Taubah ayat 122.

Oleh Fachrurrozy Pulungan

S

epakat para ulama, baik yang disebut sebagai kalangan modernis maupun kalangan tradisionalis bahwa, perlunya kembali kepada Alquran dan Sunnah Rasulullah SAW sebagai rujukan ketika menghadapi dan memecahkan berbagai persoalan hidup. Juga untuk melakukan ijtihad ketika berbagai persoalan hidup secara zahir tidak ditemukan jawabannya dalam Alquran maupun Hadis Nabi SAW. Namun, kesepakatan itu berubah menjadi perbedaan ketika masing-masing (ulama) berusaha memahami dan menangkap maksud yang ada di balik teks-teks Alquran maupun Hadis. Meski untuk menepis perbedaan itu para ulama telah membuat rambu-rambu dalam mengatur lalu lintas jalannya penafsiran dengan membedakan ayatayat qath’i dan zhanni. Untuk ayat-ayat qath’i, umat Islam tidak boleh berbeda pemahamannya. Jelasnya, ayat-ayat qath’i itu hanya memiliki kemungkinan pada satu penafsiran, atau istilah ini juga dikenal dalam ilmu ushul sebagai sesuatu yang secara pasti telah diketahui (dipahami)/ ma’lum min al din bi al dharurah, sehingga tidak ada alasan yang dapat dikemukakan dengan mengatakan, ‘saya tidak tahu itu’. Umpamanya, Allah itu Esa, Alquran itu mutlak kebenarannya, tidak ada Nabi setelah Nabi Muhammad SAW, dan lain-lainnya. Sedangkan ayat-ayat zhanni, adalah ayat-ayat yang sangat mentolerir banyaknya kemungkinan (multi) penafsiran. Ayat yang berkaitan dengan rukun wudhu’misalnya, mana saja batas muka yang dibasuh atau memulai dari mana membasuh tangan hingga batas siku (memulainya dari siku atau dari jari-jari), para ulama berbeda pendapat. Dan biasanya ayat-ayat zhanni itu berkaitan erat dengan praktek-praktek ibadah. Itu sebabnya Islam memberikan kelonggaran pada apa yang disebut tana’ul lil ibadah (keragaman cara beribadah), selama dilakukan untuk tujuan yang sama yaitu ibadah kepada Allah SWT, dan tidak menyimpang dari syarat, rukun dan wajibnya. Dalam konteks dan semangat yang sama, Almarhum Munawir Sazali (Menteri Agama di tahun 19921997) pernah dengan lantang mengatakan bahwa ayat Alquran surah an Nisa’ ayat 11 tentang waris sudah tidak relevan lagi. Munawir menganggap pembagian waris bagi anak laki-laki dan perempuan (2:1) tidak adil untuk kondisi masyarakat Indonesia. Ia menafsirkan untuk waris itu harus fair, yaitu satu berbanding satu untuk anak laki-laki dan perempuan. Lalu muncullah istilah reaktualisasi ajaran Islam yang pada tahun 1992-1993 sempat mengguncangkan pemikiran para ulama, sebab menurut para ulama ayat pada surah an Nisa’ itu adalah qath’iyah, yang tidak perlu ditafsirkan ulang dan harus dijalankan sebagaimana bunyi zahir ayat. Sejalan dengan lontaran pemikiran Munawir, Alm Abd. Rahman Wahid (Gusdur), lewat bahasa yang sedikit berbeda, tetapi dalam tujuan yang sama, beliau mengkampanyekan perlunya pribumisasi Islam. Artinya, bagaimana agar ajaran Islam yang rahmatan lil ‘alamin itu benar-benar larut dan membumi dengan kultur dan kepribadian suatu bangsa. Karena kita tinggal di Indonesia, maka upaya ke arah itu diwujudkan dalam sikap yang memiliki wawasan ke Islaman sekaligus ke Indonesiaan. Gusdur bahkan menyatakan bahwa ayat innad dina ‘indallahil Islam (sesungguhnya agama di sisi Allah adalah Islam), adalah tidaklah mutlaq. Kemudian pemikiran Gusdur yang menghebohkan lagi ialah, bahwa rukun Islam yang lima harus ditambah satu lagi yaitu, keadilan sosial, sehingga rukun Islam menjadi enam. Sementara itu Prof. Harun Nasution juga pernah melontarkan pemikiran tentang ‘qadha dan qadhar yang harus dihapus dari ajaran Islam. Karena menurutnya rukun iman yang dianggap baku ini membuat umat Islam statis, tidak bisa bergerak maju. Demikian juga Alm. Nurcholis Madjid (Cak Nur) ikut meramaikan bursa pemikiran Islam (tajdid). Pemikiran Cak Nur yang paling dianggap kontroversial adalah ketika menerjemahkan kalimat lailaha illallah yang umumnya diterjemahkan ‘tiada tuhan melainkan Allah’ menjadi tiada tuhan melainkan tuhan. Dan

dalam ijtihad Cak Nur juga menyatakan, bahwa ‘jilbab’ bukan sesuatu yang wajib. Seperti bola salju, pembaruan pemikiran ke Islaman itu terus bergulir. Mungkin sesuai karakternya, ajaran yang diturunkan melalui Nabi Muhammad SAW ini, bagai tak mau sepi dari perbincangan umatnya. Unik nya, semakin intens freku-ensi perbincangan berlangsung, justru semakin terasa bahwa ajaran Islam itu adalah aktual, konstektual, dan universal. Ijtihad dan Tajdid, adalah masalah yang belum semua umat Islam mengetahuinya, hanya para ulama dan para pakar hukum Islam, para ustadz, serta sebagian kecil umat Islam yang memahaminya. Para ulama Ushul mendefinisikan ijtihad sebagai, ‘ usaha mengerahkan seluruh tenaga dan segenap kemampuannya, baik dalam menetapkan hukum-hukum syara’ maupun untuk mengamalkan dan menerapkannya’. (kitab Ushul Fiqih, Mhd. Abu Zahrah). Dari pengertian ini maka ijtihad mengandung dua faktor yakni; pertama : para ahli (mujtahid) menetapkan suatu hukum dan penjelasannya untuk mengetahui ketentuan hukum-hukum furu’ amaliyah dengan menggunakan dalil-dalil nya secara rinci. Kedua, para mujtahid mencari dan menerapkan illat terhadap berbagai kasus juz’iyah, dengan menerapkan prinsipprinsip yang telah ditetapkan ulama terdahulu, sehingga dengan demikian menjadi jelaslah ketentuan hukum-hukum tentang masalah-masalah yang belum atau tidak dikenal sebelumnya. Sebagian ada juga kelompok yang menganggap perlunya berijtihad terhadap kajian-kajian yang umumnya sudah menjadi kesepakatan ulama baik dalam kajian ibadah maupun aqidah. Akan tetapi perlu diingat bahwa apa yang telah menjadi kesepakatan ulama yang satu, tetapi tidak menjadi kesepakatan pada ulama lainnya yang kita anut, dan mengajak orang lain untuk mengikuti paham kita, bukanlah merupakan ijtihad, tetapi lebih dari usaha memindahkan mazhab ulama ini, kepada mazhab ulama yang lainnya. Seperti misalnya orang yang memahami adanya ‘qunut shubuh’ (pemahaman mazhab Syafi’i) diajak untuk tidak qunut (mazhab Hambali, Hanafi, Maliki). Atau orang yang menolak ‘tawassul, tabarru’, ziarah kubur ke makam para wali, , yang mereka sebut sebagai tahayul, sebenarnya adalah faham (mazhab) Ibnu Taimiyah dan Abdul Wahab (Wahabiyah). Atau orang yang mengerjakan tahlilan pada acara kematian, adzan pada pemberangkatan jamaah haji, tepung tawar haji dan pernikahan, shalat taraweh 20 rakaat ditutup dengan 3 rakaat witir, dan lain-lain dipaksa untuk meyakini pemahaman yang dianutnya, juga bukan merupakan ijtihad, tapi upaya memindahkan mazhab. Perbedaan pemahaman antara satu ulama dengan ulama lainnya seharusnya tidak memaksakan kehendak kita agar orang lain pindah mazhab, sehingga menuduh orang lain yang tidak mengejakan pendapat mazhab yang dipahaminya adalah masuk neraka (bid’ah). Tidak ada satu ulama di antara ulama-ulama yang masyhur itu yang tidak menggunakan Alquran dan Hadis sebagai sumber ketetapan pendapatnya. Tuhan yang mereka sembah juga adalah Allah SWT, tak ada yang lain. Seperti firman Allah SWT pada ayat pembuka di atas, mengaharuskan kita untuk belajar memahami agama secara benar kepada ahlinya. Fas alu ahla dzikri inkuntum la ta’lamun. Berijtihad kepada suatu masalah hukum yang belum ada ketentuannya dalam nash, sangat dimungkinkan dilakukan oleh para ahlinya, tetapi memindahkan mazhab yang sudah diyakini orang lain kepada mazhab yang kita anut, bukan suatu kebijaksanaan. Karena tidak ada satu ulama pun yang memaksakan orang lain untuk melaksanakan apa yang ia pahami. Rasulullah SAW bersabda, “Mudahkanlah, jangan persulit. Gembirankanlah, jangan takut-takuti ”. Hadist dari ‘Aisyah RA. Wallahu a’lam. � Penulis adalah pemerhati ASPENDEK.

Mimbar Jumat

WASPADA Jumat 1 April 2011

Pintu-Pintu Berbuat Baik(4) 19.Mencintai orang-orang Anshor: Nabi SAW bersabda : ‘’Orang-orang Anshor tidak mencintai mereka kecuali orang mukmin, tidak membenci mereka kecuali munafik, maka barang siapa yang mencintai mereka Allah mencintainya, barang siapa yang membenci mereka Allah mem-benci mereka.’’ 20.Memberikan kelonggaran waktu orang yang kesulitan: Nabi SAW bersabda: ‘’Siapa yang memberikan kelonggaran waktu kepada orang yang kesulitan atau membebaskannya Allah memberikan naungan kepadanya pada hari kiamat di bawah anungan-Nya pada hari yang tidak ada naungan kecuali naunganNya.’’ 21.Menutupi aib saudara muslim: Nabi SAW bersabda: ‘’Siapa yang menutupi [aib] seorang muslim Allah menutup [aibnya] hari kiamat.’’ 22.Mendidik anak perempuan: Nabi SAW bersabda: ‘’Siapa yang memiliki tiga anak, sabar dalam mendidik mereka, memberikan makan dan minum mereka dan pakaian mereka dengan hasil usahanya, adalah mereka pada hari kiamat sebagai dinding penghalang untuknya dari api neraka.’’ 23.Membela nama baik saudara muslim: Nabi SAW bersabda: ‘’Siapa yang membela kehormatan saudaranya dalam kondisi tidak bertemu, adalah wajib bagi Allah untuk memerdekakannya dari api neraka.’’ 24.Menahan marah: Nabi SAW bersabda: ‘’Siapa yang menahan marahnya sementara dia mampu untuk melampiaskan Allah akan memanggilnya di hadapan seluruh makhluk pada hari kiamat sehingga di persilahkan memilih bidadari mana yang ia kehendaki.’’ 25.Tawadhu’: Nabi SAW bersabda: ‘’Siapa yang merendahkan diri karena Allah, bertawadhu’ maka Allah akan meninggikan derajatnya.’’ 26.Silaturrahim: Nabi SAW: ‘’Siapa yang menghendaki untuk diluaskan rizekinya dan dipanjangkan umurnya hendaklah menyambung tali silaturrahim, persaudaraannya.’’ 27.Membunuh cecak dengan satu pukulan: Nabi SAW bersabda : ‘’Siapa yang membunuh cecak dalam satu pukulan dicatat buatnya seratus kebaikan, dalam pukulan kedua kurang dari itu, dalam pukulan ketiga kurang dari itu. (Sumber: kumpulan hadis shahih, penyemangat berbuat baik)

Akal-akalan Oleh H. Syarifuddin Elhayat Dulu, ketika masih duduk di bangku Sekolah Dasar, saat akan pulang sekolah, guru kelas sering kali mengantar kita pulang dengan sebuah cerita yang bernada nasehat.Satu kali, Cek Gu ,—panggilan akrab guru sayapun mengingatkan kami agar tidak menggunakan akal untuk akal-akalan.” Satu saat nanti, akan ado sajo (ada saja) orang nengok kamu dengan akal-akalan untuk mengakalakali (mempengaruhi—bahkan menipu) untuk mendapatkan keuntungan dari kamu samuo,”begitu kata guru kami mengawali nasehatnya. Abu Nawas, kata tuan guru ana, pernah berteriak-teriak di tengah pasar sehingga orangpun berkumpul. “Sudara-sudara sekalian, coba kalian dengar dan camkan baik-baik ya, saat ini saya benci dengan yang haq,dan sayapun suka akan fitnah,bahkan saya hari ini dah menjadi orang kaya,lebih kaya dari Allah,” begitu kata Abu Nawas. Mendengar pernyataan Abu Nawas, orangorang sangat resah,karena pernyataannya sa-ngatsangat membingungkan rakyat dan karuan saja diapun ditangkap punggawa negara lalu kemudian dihadapkan kepada Khalifah Harun al Rasyid. Benarkah wahai Abu Nawas,kata baginda Harun, laporan sampai kepadaku bahwa engkau telah membenci sesuatu yang haq, bahkan menyukai fitnah,malah engkaupun mengaku lebih kaya dari pada Allah. “Benar baginda Khalifah,”kata Abu Nawas dengan tenang dan bukan hanya saya, tuan bagindapun menyukai hal itu. Mendengar ucapan itu hadirinpun tersentak bahkan Harun al Rasyid tersinggung besar. “Aku ingatkan kamu wahai Abu Nawas, apa yang engkau nyatakan telah keterlaluan dan telah melampaui kewajaran,” kata Harun al Rasyid sambil meminta klarifikasi dari Abu Nawas. Begini khalifah, kata Abu Nawas, saya sering mendengar ta’lim di halaqah pengajian,bahwa kematian dan neraka adalah sesuatu yang haq, saya nak tanya dulu ,siapa yang suka dengan kematian dan neraka .”Tapi kenapa engkau suka pada fitnah ?,” kata Khalifah. Benar tuan, usahkan saya ,kata Abu Nawas, malah tuan bagindapun suka akan fitnah. “Maksud enta?,” kata Harun al Rasyid. Abu Nawaspun menjawab,”benar tuan saya suka itu, sebab saya pernah membaca dalam alquran bahwa sesungguhnya harta anak adalah fitnah ,Nah… ana mau tanya dulu apakah tuanku baginda Khalifah tidak menyukai anak dan harta?. “Baik!,Jadi bagaimana pengakuanmu yang menyatakan bahwa engkau lebih kaya dari pada Allah, apakah itu bukan pernyataan yang menyimpang dan tidak pantas,” kata Khalifah. “Pernyataan ana itu cukup jelas adanya tuan baginda,”kata Abu Nawas,—Saya hari ini Alhamdulillah dikaruniai punya anak dua,sementara Allah tidak punya anak sama sekali tuan, dah jelas dan nyata kan adanya,”kata Abu Nawas tenang. “Tapi engkau sudah benar-benar keterlaluan dan tidak wajar Abu Nawas terhadap aturan Allah yang haq,” kata Khalifah sembari bertanya,”Lantas, apa maksudmu menyampaikan pernyataan seperti itu. Dengan enteng Abu Nawas menjawab singkat,”Supaya ana bisa dihadapkan dan bertemu dengan tuan, lantas——yaaa, agar diberi perhatian dan imbalan, tentunya juga hadiahlah, katanya. “Kamu memang benar-benar gila Abu Nawas,” kata Khalifah sembari memerintahkan penggawa (pembantunnya) untuk memberikan uang seratus dinar kepada Abu Nawas. Nceek,itulah yang dimaksud oleh guru ana dengan akal-akalan.” Satu saat nanti akan ado sajo (ada saja) orang, macam (seperti) Abu Nawas

yang suka berakal-akal dan akalan-akalan untuk mengakal-akali kamu dan juga mengengkari kebenaran kekuasaan Tuhan dengan akalnya,” begitu kata cek gu . Cerita yang sangat bernash buat ana tuan dan kisah di atas menjadi cermin untuk melihat apa yang terjadi di hadapan dan dibelakang ana hari ini,seakan-akan ada benarnya.Bukankah ada sementara orang yang suka mencaricari celah dan salah untuk kemudian membuat pernyataan dengan akal-akal saja, padahal sesungguhnya diapun mengengkari kata hati dan menafikan sebuah kebenaran. Tidak sedikit kita temui, sohib, di tengah ummat ini, ada orang yang dengan enteng saja memberi pernyataan, memberi tanggapan, berdiri gagah, duduk wibawa di tengah-tengah ‘cameranya’ media menjawab pertanyaan yang kadangkala memutar balikkan makna yang ada. Dia bagaikan ‘duplikat’ Abu Nawas dalam berkata bahkan tidak jarang memutar balikkan fakta, padahal itu akal-akalan saja untuk mengakal-akali. Tujuannya, tidak lebih seperti jawaban akhir Abu Nawaslah Tulaang, bisa dipanggil dan ketemu ‘raja’,ujung-ujungnya ‘pucuk’ ber-angka. Ah.., Nceklah yang tau itu semua. Jujur tuan,meskipun ana,’butik’ alias buta politik,tapi kadang terhenyak juga hati embe lihat sementara media yang menayangkan pergolakan yang terjadi di dalam maupun luar negeri. Ampun tuan, kalau salah,—nyaris layar kaca tak sepi dari pergolakan politik negara luar,—khususnya Timur Tengah, wabil khusus pergolakan Libya. Akhul Qoid Mu’ammar Ghaddafi ‘dihujani’ bahkan bagaikan dihujjat bahwa dia yang nota bene muslim dan musuh bebuyutan Amerika itu, adalah orang yang sangat korup,sangat diktator,sampai-sampai kepada berita dikelilingi gadis-gadis cantik yang jadi pengawal hingga suka bedah pelastik. Cukup-cukuplah menjadi opni publik yang negatif yang dicari-cari agar orang yang tak mengertipun ikut membencinya. Sebagai seorang muslim,terhenyuh juga perasaan ni tuan mendengar tudingan itu. Seakan-akan,pemimpin Libya itu tak pernah berbuat baik untuk dan dalam hidupnya. Padahal, kata orang-orang yang pernah tinggal di negara minyak itu,negaranya termasuk makmur,rakyatnya nyaris tak melarat, bahkan orang-orang yang belajarpun diberi ‘sangon’, hingga,— konon,—pelajar luar yang dah tammatpun masih diperhatikan dengan diberi biaya untuk dakwah di negara masing-masing. Bukankah dia juga yang memberi bantuan besar bagi sebuah Yayasan zikir di Jakarta yang nilainya ratusan miliar rupiah, padahal Amrik,tak pernah terdengar memberi hibah untuk keummatan,bahkan orang-orang yang berkata akal-akal itupun tangannya tak pernah terulur demi kemanusiaan. Lain lagi yang lain,Ahmadiyah sudah difatwakan bukan bagian dari Islam,alih-alih ‘dipertontonkan’ pada mata umat akan orang-orang yang membela mati-matian dengan membuka ‘kitab’ HAM dalam ada upaya menyudutkan ahli agama. Padahal kadang kala ahli yang diminta dalam berkata itu,usahkan ngerti agama,—afwan tuan, sekali lagi afwan,— menyebutkan Ahmadiyah saja dia tak pas.Konon pula nak buat ‘fatwa’.Bukankah itu akal-akalan Nceek.Islam menyebut agama ini adalah agama akal dan tak ada agama bagi orang yang tidak berakal.Tapi ingat, agama dan ajarannya bukan akal-akalan yang bisa diakal-akali untuk mengakalakali. Ampun Tok,ambe hanya ‘menafsirkan’ Abu Nawas saja untuk mau’idzoh buat yang baca.

J

C7

Jamuan Laut Adalah Khurafat Dan Pembodohan

amuan laut tidak sama dengan kenduri laut. Jamuan laut kental dengan nuansa tradisi yang dilakukan secara turun temurun dengan tujuan untuk menjamu makhluk. Makhluk yang dianggap berperan mengawasi dan memantau keadaan laut. Kepercayaan itu dianut oleh sebagian masyarakat Indonesia terutama dari suku Jawa dan Melayu, mereka meyakini adanya dewa, dewi, peri, membang, begu, hantu, lancang kuning dan sebagainya, yang dapat dipanggil atau dipuja untuk meminta dihindarkan dari bala dan musibah. Jika dikaitkan dengan akidah Islam, itulah yang disebut dengan khurafat, yaitu sesuatu yang diyakini bertentangan dengan akal sehat. Berbeda dengan kenduri, kenduri ialah upacara ritual agama Islam dengan menghadirkan sekelompok jamaah, membaca ayat-ayat Alquran, wirid-wirid, munajat, dan berdoa kepada Allah Swt untuk meminta rezeki, bersyukur, meminta dihindarkan dari bala dan musibah. Biasanya dipimpin oleh seorang kiyai, lebai, dan sedikit menghadirkan jamuan-jamuan sebagai sedekah kepada jamaah yang hadir. Akan halnya dengan jamuan laut, meskipun telah dikemas dalam bentuk kenduri dan doa, munajat dan zikir, namun masih dicampur aduk dengan khurafat, yaitu motivasi (niat)nya, meminta kepada selain Allah Swt, untuk terhindar dari bala dan musibah. Hal itu dibuktikan dengan cara menghanyutkan kepala kerbau atau makananmakanan sebagai jamuan kepada penunggu laut yang telah diyakini oleh sebagian mereka yang mempunyai keyakinan seperti yang diterangkan di atas. Praktek seperti inilah yang dikatakan khurafat yang mengarah kepada syirik. Khurafat berasal dari asal kata kharifa yakhrifu - khurafatan, yaitu sesuatu yang diambil, dipetik dari cerita-cerita bohong dan tidak diterima akal sehat. Pada mulanya khurafat hanya dalam bentuk, cerita dongeng yang dapat menarik perhatian orang mendengarnya. Sebagaimana diceritakan di dalam hadis Nabi Saw yang diri-

Oleh H.M. Nasir Lc, MA

wayatkan oleh Imam Ahmad dan Turmuzi, bahwa suatu hari Nabi Saw certia kepada para isterinya. Aisyah ra berkata: Suatu malam Rasul Saw bercerita kepada para isterinya tentang sebuah cerita, kemudian salah seorang dari isteri Rasul Saw berkata: Wahai Rasulullah, cerita itu adalah cerita khurafat. Rasul Saw lantas bertanya : Tahukah kamu (isteriisteriku) apa itu khurafat? Di zaman jahiliyah ada seorang laki-laki dari suku Uzroh memiliki keluarga dari makhluk jin, ia tinggal bersama jin itu beberapa lama, kemudian kelompok jin mengembalikan lakilaki itu kepada masyarakat manusia. Laki-laki itu kemudian bercerita tentang peristiwa dan kejadian-kejadian yang aneh yang menakjubkan yang pernah disaksikan pada masyarakat jin itu. Mendengar itu orang-orang banyak berkata: Ini adalah cerita khurafat bagi masyarakat awam, sebab itu tidak masuk akal, sebab bagi mereka, manusia tidak mungkin hidup bersama tinggal bersama makhluk jin yang berbeda situasi dan alamnya. (Ensiklopedi Hukum Islam). Dari hanya berbentuk sebuah cerita yang tidak masuk akal, khurafat menyusup ke dalam lapangan akidah Islam, disebabkan faktor kurang memahami akidah Islam dengan benar, atau boleh jadi disebabkan karena tradisi-tradisi lama yang masih dianut oleh kaum muslimin, etos berfikir dan mitos yang berkembang di dalam kehidupan bermasyarakat. Tidak dapat dipungkiri, di dalam masyarakat yang berfikir

semakin praktis dan modern sekarang ini, masih ada sekelompok masyarakat yang berkeyakinan dan mempercayai halhal yang khurafat, seperti “kenduri laut” yang dilakukan oleh masyarakat Batubara baru-baru ini (Harian Waspada, 26-29 Maret 2011), dimana para nelayan sudah berbulan-bulan lamanya tidak mendapatkan hasil tangkapan ikan yang memadai untuk menghidupi keluarga mereka. Lalu mereka mengadakan “kenduri laut” dengan menghadirkan “orang pintar” untuk menyembelih seekor kerbau, dan kepalanya dihanyutkan ke laut dan dua hari setelah itu, para nelayan tidak turun ke laut – sebagaimana informasi yang sampai kepada kita – untuk menunggu reaksi dari jamuan yang telah dilakukan. Ironisnya, kenduri laut ini bukan hanya dihadiri oleh orang-orang yang tidak mengerti agama, akan tetapi sebagian orang-orang yang berilmu turut serta menghadirinya, bahkan ikut mensponsori terlaksananya “upacara kelautan” tersebut. Islam memandang jamuan laut adalah perbuatan khurafat dan dapat merusak keyakinan, karena masalah mendatangkan rezeki, menolak bala, nasib, dan lain-lain yang berkaitan dengan hal-hal yang ghaib, tidak ada sama sekali campur tangan hantu laut, dewa laut, maupun jin laut. Memberikan jamuan kepada makhluk-makhluk ghaib yang dianggap dapat mendatangkan mudarat dan manfaat adalah satu bentuk penghinaan terhadap martabat manusia itu sendiri, karena manusia lebih mulia dari pada jin. Di dalam Alquran Allah Swt menjelaskan, bahwa Allah memuliakan anak Adam dan mengangkat tinggi derajat mere-ka baik di darat maupun di laut, dan memberi rezeki dengan yang baikbaik, dan melebihkan anak Adam dari kebanyakan isi alam semesta ini, sebagaimana disebutkan di dalam surat al-Isra’ ayat 70. Ibnu Abbas berkata : Jin Islam sekalipun apabila bertemu dengan orang-orang Islam, dia akan lari karena sangat segan dan hormat kepada manusia.

Kalau melaksanakan shalat justru mereka menjadi makmum di belakang manusia, demikian pula jin-jin kafir sangat segan kepada manusia. (lihat tafsir Al-Azhar Buya Hamka Jilid 10 hal.7684) Oleh sebab itu, amat janggal dan terhina jika manusia meminta perlindungan kepada makhluk jin dan memberi mereka jamuanjamuan berupa kepala kerbau, dengan harapan ikan-ikan di laut supaya bangkit dari persembunyiannya. Hanya orang-orang yang lemah akidahnya dapat menerima praktek-praktek “kenduri laut” yang dipersembahkan untuk memuja-muja jin dan hantuhantu dengan harapan mendatangkan rezeki. Sedangkan orang yang berakidah benar (shahih) men-jalankan agama ini dengan baik, tidak akan mau terbawabawa dengan “pembodohan” yang dilakukan oleh segelintir orang-orang jahil. Bila kenyataannya ikan di laut semakin berkurang, itu disebabkan kemaksiatan dan dosa yang dilakukan oleh para nelayan (baca: manusia) itu sendiri, mereka setiap hari menguras hasil laut, akan tetapi mungkin mereka tidak pernah menundukkan kepada (shalat) menyembah yang mempunyai lautan itu sendiri (Allah Swt). Atau boleh jadi disebabkan oleh keserakahan manusia dengan menggunakan alat penangkap ikan yang dapat menguras semua isi laut, sehingga anak-anak ikanpun tidak ada yang bertahan. Akibat dari semua itu, populasi ikan semakin berkurang dan pada gilirannya akan musnah. Lalu, oleh sebagian orang yang tidak mengerti agama, akan berupaya menghubungkannya dengan agama dan diadakanlah “kenduri laut”, “jamuan laut”, “upacara kelautan”. Bukankah semua itu perbuatan khurafat dan upa-cara pembodohan terhadap masyarakat nelayan? Wallahua’lam bil ash-shawab Penulis adalah: - Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batu Bara - Pembantu Rektor IV Universitas Al Washliyah (UNIVA) Medan

Etika Muslim Dalam Memenuhi Kebutuhan Hidup

E

tika atau yang lazim disebut akhlak, menduduki tempat yang penting dalam ajaran Islam. Bahkan etika dapat dikatakan merupakan ajaran Islam yang paling essensial. Nabi Muhammad Saw bersabda dalam sebuah hadis yang diriwayatkan Bukhari Muslim: “Hanya saja aku diutus ke permukaan bumi untuk memperbaiki akhlak manusia.” Akhlak adalah perikeadaan jiwa manusia yang mampu melahirkan perbuatan-perbuatan lahiriah secara spontan. Akhlak yang baik akan melahirkan perbuatan yang baik. Dalam dimensi vertikal maupun horizontal, akhlak diatur dalam Alquran dan Hadis RasulullahSaw. Selanjutnya akhlak ini yang diharapkan dapat lebih diutamakan oleh seorang Muslim dalam menggapai segala kebutuhan hidupnya. Pada dasarnya Islam mengajarkan umatnya untuk bersikap optimis dalam menjalani kehidupan. Tapi optimisme tersebut harus didasari kemampuan kerja dan ikhtiar yang memadai. Karena tidak adanya kerja keras yang dilakukan oleh manusia itu sendiri, maka Tuhan tidak akan memberikan pertolongan-Nya. Etika Muslim Dalam Memenuhi Kebutuhan Hidup Dalam kondisi negara kita yang multi krisis saat ini, kecenderungan untuk memperoleh rejeki dengan cara tidak halal dalam menempuh dan menggapai hidup adalah sangat rentan, apabila tidak memiliki basic dan konsistensi iman yang kuat. Sehingga “mencari rejeki yang haram saja sulit, apalagi yang halal” sudah merupakan yang tidak asing lagi kita dengarkan. Terutama bagi mereka yang merasa bahwa tidak ada lagi jalan lain yang harus ditempuh untuk mendapatkan rejeki yang halal. Makna etika muslim dalam menggapai kebutuhan hidup di sini, menyangkut cara seorang muslim dalam memenuhi hidupnya, baik kebutuhan material maupun spiritual. Alam dan seluruh isinya disediakan Allah untuk kebutuhan hidup manusia, maka bekerja merupakan

Oleh H Ahmad Sabban Rajagukguk MA salah satu upaya yang dilakukan untuk memenuhi kebutuhan hidup tersebut. Manusia yang menghuni planet bumi ini tidak hidup mandiri, melainkan hidup dalam sosialitas. Manusia adalah makhlum monopluralis, makhluk individu sekaligus makhluk sosial. Manusia individu dalam kehidupan sosial saling bergantung yang satu sama yang lainnya. Sehingga semangat kebersamaan harus senantiasa mutlak diwujudkan dalam kehidupan sosial. Dalam konteks menggapai kebutuhan hidup kita, ada beberapa hal etika yang harus kita pelihara. Antara lain adalah sebagai berikut : a. Semua kegiatan bermotivasi ibadah Alquran surat Az Zariyat ayat 56 menjelaskan bahwa jin dan manusia diciptakan untuk menyembah kepada Allah. Hal itu menunjukkan bahwa hidup setiap muslim harus mengabdikan hidupnya hanya untuk Allah SWT. Artinya, setiap manusia harus taat dan patuh atas dasar cinta kepada Allah. Petunjuk-petunjukNya harus dipatuhi dan larangan-laranganNya dijauhi. Hidup beribadah kepada Allah dalam artinya yang luar merupakan induk akhlak religious. b. Bekerja adalah wajib dan mulia Ayat-ayat Alquran yang menyebutkan iman lazimnya diikuti dengan amal saleh. Amal tidak lain adalah kerja nyata yang merupakan manifestasi dari iman. Bekerja mencari nafkah adalah kewajiban setiap manusia, maka menjadi kewajiban jugalah bagi penguasa untuk menciptakan lapangan kerja. Bagi penguasa yang mampu menciptakan lapangan kerja, luar biasa pahalanya dan sangat mulia di sisi Allah SWT. c.Kasih sayang kepada sesama manusia Umat manusia merupakan keluarga besar dari manusia itu sendiri. Kasih sayang merupakan syarat mutlak untuk meles-

tarikan nilai-nilai kekeluargaan di kalangan manusia. Hal ini ditegaskan Nabi Muhammad SAW dalam salah satu hadis yang diriwayatkan Thabrani dan Hakim dari Ibnu Mas’ud yang berbunyi: “Berkasihsayanglah kamu dengan sesama yang ada di bumi, niscaya kamu akan disayangi oleh yang ada di langit.” d. Suka menolong dan memberi jasa Islam mengajarkan agar manusia lebih banyak memberikan jasa untuk memenuhi kepentingan orang lain. Saling tolongmenolong dalam kebaikan merupakan perbuatan mulia, terutama menolong orang yang berada dalam kesusahan, yaitu dengan menolong orang yang belum mendapat kebutuhan hidup yang layak. e. Mesujudkan maslahat dan menghindari mudharat Tujuan utama ajaran Islam adalah terwujudnya kebaikan (maslahat) dalam hidup manusia, baik secara perorangan, maupun sosial, jasmani maupun rohani, dunia maupun akhirat. Oleh karena itu, semua kegiatan manusia untuk memenuhi kebutuhan hidupnya harus didasarkan atas nilai menarik manfaat dan menghindari mudharat. Dikerjakan yang maslahat dan dihindari yang merusak. f. Mencari yang halal dan menjauhi yang haram Syariat Islam mengatur kehidupan manusia menuju terwujudnya kepentingan hidup yang membawa kepada kebaikan. Oleh karenanya, yang ha-lal dibolehkan dan yang haram dihindarkan. Semua yang haram pasti merugikan kehidupan manusia. Menjauhkan yang haram akan membawa keuntungan bagi manusia dan melanggar yang haram akan mendatangkan malapetaka bagi manusia. g. Menegakkan keadilan Islam mengajarkan agar nilai-nilai keadilan dan ihsan selalu ditegakkan dalam kehidu-

pan bermasyarakat. Adil dapat diberikan pengertiannya secara umum dengan memberikan kepada orang lain sesuatu haknya. Secara negative, jangan merampas hak orang lain secara semena-mena. Sedangkan ihsan dalam hubungannya dengan keadilan adalah kebajikan mengatasi keadilan. h. Hak milik adalah amanah Islam mengajarkan bahwa alam semesta adalah ciptaan Allah. Sebagai pencipta, Allah adalah pemilik hakiki segala sesuatu yang ada di alam ini. Meskipun demikian, Allah menciptakan manusia dengan naluriah-naluriah yang akan mendorong kegiatan hidupnya, terutama adalah naluriah berketurunan dan pemilikan. Dalam kaitan itu Islam mengajarkan bahwa hak milik manusia diakui adanya dan dilindungi keselamatannya. Menyadari bahwa harta yang diperoleh menusia berasal dari rejeki Allah, disertai dengan ke-sadaran tentang fungsi hidup manusia untuk beribadah kepada Allah, akan mendorong manusia untuk berusaha memperoleh harta secara halal dan membelanjakannya sesuai petunjuk-petunjuk Allah dan Rasul-Nya, hingga akan selamatlah kelak dalam mempertanggungjawabkannya kepada Allah. Kesimpulan Etika Islam dalam memenuhi kebutuhan hidup memberikan patron dan batasan agar tidak terjerembab kepada kondisi yang diharamkan oleh Allah SWT. Hal ini, Islam menegaskan bahwa dalam menggapai kebutuhan hidup, Islam telah memberikan petunjuk-petunjuk yang sangat kongkrit. Sebab itu, menjadi kewajiban seorang muslimah untuk mengikuti petunjuk tersebut agar hidupnya selamat dunia dan akhirat. � Penulis adalah Mahasiswa Program Doktor IAIN-Sumatera Utara Medan, Kepala Cabang Petisah Medan dan Mursyid Persulukan Babut Taubah Serambi Babussalam Hatonduhan Simalungun.

C8 MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Al-Istiqomah Jl. Seto No. 33 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Ikhanul Wathan Jl. AR. Hakim Gg. Langgar No. 53 Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Muhajirin Kel. Sei Rengas Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Makmur Jl. A.R. Hakim Gg. Langgar/Bahagia No. 25 Al-Utaminiyah Jl. Utama Kota Matsum II Gg. Syukur Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Darul Ikhlas Jl. Batu No. 13 Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. 8-A Khairiyah Jl. Rahmadsyah Gg. Subur 192 Muslimin Jl. Dr. Sun Yat Sen No. 71 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl. Denai Gg. Pinang No. 12 Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gang I No. 2 Shilaturrahim Jl. Emas No. 10 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Jl. Puri Komplek Masjid Taqwa No. 183 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Daftar Khatib Shalat Jumat Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadono Drs. Khalidin Musa Drs. Agus Taher Nasution H. Muhammadin Angkasah, Lc Drs. H. Jalaluddin Hasibuan Drs. Husairi Drs. H. Abdul Halim Siregar Drs. Zuhari Lubis Ahmad Khawari Kamad, BA Ahmad Haidir Saragih Drs. H. Syamsuddin Panarik Drs. H. Fauzi Usman, SH H. Imami Najib Hasibuan Drs. H. Yusdarli Amar Drs. Yahya Tambunan H. Suhaidi, Lc Drs. H.M. Hayat Harahap Drs. Syaefuddin Daulay Drs. H. Ibnu Hajar Harahap Muchlis Muaz, S.HI Drs. H. Yahya Indra Drs. H.M. Hafizd Ismail Drs. H. Efnedi Arief, MA Drs. Arman Aziri Drs. H. Amhar Nasution, MA Ibrahim Yunan, S.Pd.I Zailani, S.Pd.I Drs. Ibnu Hajar Harahap Drs. Jamaluddin, MA Drs. H. Ali Rajab Chaniago Drs. Askolan Lubis, MA Fachruddin AR, MA

MEDAN AMPLAS Al-Hidayah Mapolda SU Jl. S.M.Raja Km.10,5 No. 60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I Kel. Harjosari II Al-Jihad Jl. Garu II Villa Harjosari Indah No. 106 Baiturrahman Jl. Bajak III Kel. Harjosari II Ikhlashiyah Jl. Garu-I No. 69 Kel. Harjosari-I Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Miftahul Jannah Jl. Pertahanan No. 70-A Timbang Deli Nurul Barkah Jl. Selambo IV No. 29 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Raya Taqwa Jl. S.M. Raja Km. 5,5 Kel. Harjo Sari I Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VI Kel. Harjosari I Shilaturrahim Jl. Garu III Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II Sepakat Jl. Turi Gg. Sepakat No. 5 Tarbiyah Medan Amplas Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1 B

Parlaungan Nasution, S.HI H. Fakhruddin, BA Drs. H.M. Basyir Yahya Drs. Sofyan Daulay Drs. Ali Asri Drs. Pangeran Harahap, MA Al Munir Abdul Wahab Drs. Ali, MA Muhyidin Nasution Badrin Rizaldi, S.Ag Ardhi Nasution, S.Hut Drs. Sangkot Nasution Drs. M. Alwi Batubara Chairul Effendi Drs. Ramli, AT Drs. H. Masran DR. H. Ramlan Yusuf Rkt., MA Khairul Shaleh, S.Sos.I Mhd. Rahim, MA Maulana Siregar, MA

MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30-A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Muslimin Jl. Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede No. 42 Nurul Huda Jl. K.H. Wahid Hasyim Asrama Brimob

Drs. H. Ahmad Suhaimi DR. H. Muzakkir, MA Drs. Suhendri HS, MA Drs. Sobirin Lubis Drs. Zulkarnain Lubis, MA Drs. H. Azwardin Nasution Drs. H. Zainuddin Sinaga Drs. H. Darwis Nasution Drs. Ardiansyah

MEDAN BARAT At-Taqwa Jl. Putri Hijau No. 14 Al-Furqan Jl. Karya II Kompl. Ex Kowilhan Al-Hasanan Inna Dharma Deli Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Massawa (Arab) Jl. Temenggung No. 2-4-6 Al-Istiqomah Jl. Putri Hijau No. 01 Komp. Deli Plaza Baitus Syifa RS. Tembakau Deli PTP Nusantara-II Haji Maraset Jl. Sei Deli No. 139 Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Nurul Hidayah Jl. Tinta 63-B Kel. Sei Putih Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6 Nurul Islam Jl. Karya Lk. VIII No. 203 Kel. K.Berombak Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Rumkit Jl. Putri Hijau Tk. II Putri Hijau Kesdam I/BB Syuhada Jl. Danau Toba No. 2 Kel. Seil Agul Taqwa Jl. Karya Gg. Madrasah No. 24

Drs. M. Labib Maulana, S.Pd.I M. Ya’qub Drs. Syamsuddin Hasan H. Khairuddin, Lc Drs. Muhammad Nasution T. Nazaruddin, S.Ag Drs. Amrin Siregar Syahnim Siregar Syahruddin, S.Pd.I H. Heri Adlin, Lc Usman Abdillah Drs. Budiman Sobar Lubis, S.Pd.I Drs. Khairul Akmal Rangkuti Drs. H. Azhar Anwar Drs. Azwani Lubis, M.Ag Drs. H. Jannah Siregar Drs. Matseh MG, S.Pd.I

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan Taqwa Jl. Veteran Belawan

Ilham Maulana M. Yusuf

MEDAN DELI Amalyatul Huda Jl. Nusa Indah No. 22-A Lingk. 26 Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Ikhlas Jl. Alumunium III Kel. Tj. Mulia Al-Jihad Lingk. VI Kel. Mabar Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Jami’iyyatush Shoolihiin Jl. Alumunium I Lingk. XIII Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia MEDAN DENAI Arafah Jl. Pertiwi No. 22 Kel. Binjai Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Ar-Ridha Jl. Camar 18 Perumnas Mandala Al-Anshor Jl. Raya Medan Tenggara Gg. Anshor Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Al-Hidayah Jl. Menteng Indah VI H.Kel.Medan Tenggara Al-Hasanah Jl. Merpati I No. 1 Kel. Kenangan Baru Al-Muslimin Jl. Menteng II Gg. Pembangunan Lingk.XI Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Mukhlishin Bromo Ujung Jl. Selamat Kel. Binjai Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Makmur Jl. Bersama Ujung K.Perum.Griya Al-Bania Al-Ridha Jl. Jermal VII Lingk. IX Kel. Denai Baiturrahman Jl. Medan Tenggara II Kel. Denai Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahmin Jl. Pelajar Timur Gg. Darmo No. 5 Darul Ilmi Murni Lingk. I Kel. Tegal Sari Mandala II Hijraturridha Jl. Selamat Ujung Gg. Subrah/Ketua Muslimin Jl. Selam II No. 47 Tegal Sari Mandala-I Nur Islam Jl. M. Nawi Harahap Kel. Binjai Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Nurul Iman Jl. Rawa Lr. Sedar Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Raya Miftahul Iman Jl. Panglima Denai Jermal 7 Taqwa Jl. Jermal III No. 10 Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Pancasila Gg.Masjid No.1 Kel.T.S.Mandala III

Drs. Usman Batubara Muchsin Harahap, S.Pd.I Maulana Sinaga, S.HI Abdul Halim, S.Ag Drs. H. Abusamah Pulungan Drs. Akhiruddin Muhid H. Hasan Basri Lubis, Lc Drs. Ahmad Raja Pasaribu Alimuddin Syah Drs. Sulaiman Barus Mahyuddin, S.Ag Drs. H. Sakhira Zandi, MA Drs. H. Nurman Almi Mahmuddin, MA Drs. H.M. Irfan El Fuadi Lubis Drs. Muhidin Masykur Drs. H. Syahminan Hasibuan H. Burhanuddin Nur, Lc Drs. H. Mar’ie Batubara Drs. H. Dariansyah Emde Harun Ar Rasyid Drs. Sarbaini Drs. Juntar Dongoran H. Parlin Bancin, Lc Samidi, S.Ag, M.Pd Drs. Faizal Lubis Drs. H. Ali Rajab Chan

MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia An-Nur Jl. Budi Luhur No. 75-A At-Taubah Jl. Prona No. 12 Lingk. VII Cintai Damai Ar-Raudhah Jl. Persatuan No. 22-AR As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Al-Bashir Rusmi Jl. Kapten Muslim Gg. Solo Tengah Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Al-Ikhlas Jl. Bakti Lubur No. 113 Kel. Dwikora Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Al-Ikhas Jl. Jongkong Komplek Dolok Sumut Al-Ishlah Jl. Kapten Muslim No. 54-A Al-Kautsar Jl. Gaperta Ujung K. Perum. Tata Alam Asri Al-Mukhlisin Jl. Bakhti Utara No.21 Link. VI Kel.T.Gusta Al-Mustaqim Jl. Kapten Muslim No. 226 Al-Masturah Jl. Binjai Km. 7,8/Jl.Sekolah No. 29 Darussalam Jl. Asrama No. 11 Istiqomah Jl. Amal Luhur No. 86 Ikhlasiyah Jl. Amal Luhur No. 29 Kel. II Dwikora Raya Al- Falah Jl. Cendana Blok 17 Perumnas Helvetia Taqwa Jl. Kapten Muslim Gg. Jawa Taqwa Jl. Kamboja Raya No. 319 Blok IV P.Helvetia Taqwa Jl. Kapten Sumarsono Gg. Safar Taqwa Jl. Setia No. 30 Cabang Helvetia

Drs. H. Nazamuddin Lubis Drs. Parlaungan Hasibuan Ali Nur, Lc Zainuddin, S.Pd.I Drs. Hasrat Effendi, S. Tamrin Butar-butar, S.Ag M. Hasbi Nasution, S.Sos.I Suwarno, S.Pd.I Drs. Suparmin Sareh Drs. M. Yamin Drs. H. Ade Fifan Mhd. Yusuf, AR, MA Drs. H. Nasrun Zakaria Bukhari, S.Ag Ahmad Fauzan Lubis Ridwan, S.Ag Drs. H.M. Ridwan Drs. H. Samiun Mas Drs. H. Adhlan Rifa’i Sirait Drs. Abdul Majid Drs. Zainuddin Hamidi Irwansyah, S.Pd.I Legino, S.Ag Drs. Sjaipul Bahri

Ahmad Sayuti Sairin, S.Ag Drs. Nurtuah Tanjung DR. H. Amnas S., SH Drs. Syahrin, A.W. Parenta Lubis, S.Ag Masdar Tambusey, S.Ag Ibnu Saud Nilzam Zuber Zulfikar, S.Pd.I Yudillah Amin, S.Pd.I

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Gedung Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Amaliyah Perumahan Citra Wisata Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Assyafi’iyah Jl. STM Suka Tari No. 9 Ar-Raudhah Komplek Risva I Blok V Kel.Gedung Johor Annazhirin Jl. Karyawisata Kel. Gedung Johor Al-Amin Jl. Eka Surya Gg. Eka Kencana Ged. Johor Al-Badar Jl. Karya Dharma No. 19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Al-Ikhlas Jl.Eka Suka Lingk. XIII Kel. Gedung Johor Al-Issyah Hakim Jl. Karya Jaya Kel. Gedung Johor Al-Muslimin Jl. Suka Luhur Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mustafa Jl. Karya Jaya, Gg. Karya XII-XIV7 Al-Qisth Kejaksaan Tinggi Jl. Abd. Haris Nst. P.Mashur Baiturrahman Perumahan Johor Indah Permai 1 Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Baitul Iman Jl. Karya Jaya Asrama Arhanud P. Masyhur Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Istiqomah Jl. Abdul Hamid No. 70 Muslim Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pkl. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Nurul Ikhwan Jl. Karya Kasih Sunnah Al-Muhsinin Jl. Abdul Haris Nasution No. 11 Sunnah Rabithah Jl. Karya Darma Pangk. Masyhur MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Da’wah Jl. Sakti Lubis Gg. Amal 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Jami’ Teladan Jl. Teladan/Gembira No. 2 Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Mua’llimin Jl. S.M. Raja Kp. Keluarga No. 33 Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Setia Amal Jl. Sakti Lubis Gg. Pegawai Kel. Sitirejo Silaturrahim Jl. Pelajar No. 58 Drs. H. Hayat Harahap Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7 Yayasan Zending Islam Indonesia Jl. SM Raja No. 11-A MEDAN LABUHAN Al-Amal Jl. Banten Gg.Amal No.170 Dusun IX-A Helvet Al-Husin Jl. Raya Blok IX-Griya Martubung Al-Istiqomah Blok IV Griya Martubung Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Nurul Ikhwan Jl. Helvetia By Pass Gg. Masjid No. 234 Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Al-Muhajirin PTPN-IV Jl. Letjend. Suprapto No. 2 Al-Mujtahidin Jl. Brigjen Katamso Gg. Lori Kp. Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ ‘Aur Jl. Brigjen Katamso/Kampung Aur Kel. Aur Jami’ Al Fajar Jl. Brigjen Katamso Gg. Alfajar No. 15 Jami’ Jl. Brigjen Katamso Gg. Masjid No. 53 Kp. Baru Muslimin Jl. Juanda (bundaran) Kel. Jati Muslimin Jl. Brigjen Katamso Lingk. II Gg. P.Burung Thoyyibah Jl. Multatuli Lingk. V No. 64 MEDAN MARELAN Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Ar-Ridha Jl. Jala IX Lingk. IV Paya Pasir Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Al-Amin Jl. Prof. H.M. Yamin SH, 482 Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Al-Falaah Jl. Ibrahim Umar Gg. Sato No. 03 Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Al-Huda Jl. Malaka No. 117 Al-Hurriyah Jl. M. Yakub No. 17 Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Al-Muslimin Jl. Gerilya No. 1 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Amana No. 5 Istiqomah Jl. Bambu Runcing/Pahlawan Ikhwaniyah Jl. M. Yacub No. 3 Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Taufiq Jl. Mesjid Taufiq No. 120 Kel. Tegal Rejo Taqwa Jl. Karantina Asrama Glugur Hong MEDAN PETISAH

Drs. H. Ansari Parinduri, M.Ag H. Irfan Said Batubara Drs. H. Darwansyah Muslih Sinaga, S.HI Drs. Usman Batubara Hasbi Al Mawardi Lubis, S.Ag Drs. H.M. Arifin Umar Drs. Ali Muddin Siregar Drs. Abdul Hadi Hasibuan Drs. H. Ahmad Taufiq M. Nasir Ansori S.HI, S.Pd.I Drs. Ngadimin Drs. Safwan Harahap Drs. H. Bachrum Saleh Hsb., MA Rustam Harahap, S.Pd.I H. Akhyar H. Ahmad Iqbal, Lc Drs. H.M. Ilyas Purba Ahmad Suhardi Lubis, S.Pd.I Ahmad Suhardi Lubis, S.Pd.I Dr. H. Muzakir, MA Malik Faisal, S.HI Drs. H. Sempurna Silalahi H.M. Bambang Irawan, S.Ag H. Alfan H. Rakif Mas Aswan Effendi, S.Ag Drs. H. Zahiruddin Nasution M. Nasir Anshori, S.HI Drs. Watni Marpaung, MA M. Rifi Harahap, S.Ag H. Mustado, S.Pd.I H. Al-Ahyu, MA Drs. A. Syaukani Husnel A.M, M.Ag Zainal Abidin, S.Pd Drs. Muhammad Natar Hsb. Drs. Bukhari Muslim Lubis Abdul Aziz, S.Ag Mex Zainis Tjaniago Prof. DR. H.M. Hatta H.M. Syukur Abrazain, BA Drs. H. Umar Khatib H. Fajar Hasan Mursid, Lc, MA Drs. Ismail Panjaitan Drs. H. Indra Harahap Drs. H. Masyaluddin Berutu DR. H. Ahmad Zuhri, MA Drs. H.M. Nurdin Amin, Lc Prof. Dr. H. Asmuni, MA Bahrumsyah, S.Ag Drs. Mas’ud Panjaitan, S.Pd Drs. Tenerman Drs. M. Ridwan Dahrin Harahap, S.Pd.I Drs. H. Ahmad Bangun Nst., MA M. Nur Jambak H. Herman Yusuf Drs. M. Nizar Rangkuti Ahmad Soim Zulham Effendi, S.Pd.I Drs. Najib Kamal Simbolon Junaidi Arsyad, MA DR. H. Ahmad Zuhri, Lc, MA Drs. Dahrul Drs. Umar Rifai Hasibuan, S.Pd.I Drs. Ade Mustahdi Ali H. Sarifudin Siagian Drs. Ahmad Bardan Drs. H. Hamdan Yazid H. Salman Alfarizi, Lc, MA M. Nur Fahmi, K.H. S.HI H. Surisno Gatot, Lc Suhaimi, S.HI Syamsir Karim Baringin Siregar, S.Ag Drs. Syamsuri Drs. Amri Sutanto Abdul Muthalib, M.Ag Asmanuddin Damanik, S.HI Drs. H. Bahron Nasution Syafriadi, SHI Drs. H. A. Rahman Syamsuddin, Lc H.M. Ali azmi Nst., Lc, MA Drs. H. Fauzi Usman Drs. Ahmad Azizi AM, S.Pd.I Drs. Tenerman Drs. M. Zuhri Pulungan Drs. Rasmidi Drs. Muhammad Rais, M.Pd., M.SI Drg. H. Aspan Bahri Drs. H. Efendi Rambe Naharman HR, S.Ag Drs. H. Syarbaini Tanjung, MA Drs. H.M. Gurning DR. Sudirman, Lc, MA Drs. H. Amrul Fuad Drs. Zakaria Drs. H. Ramli Asmuni

Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Zainul Amri, S.Pd.I Annas Komplek Diskes Jl. Ibus Raya/Jl. Rotan Drs. K.H. Amiruddin, MS Ar-Ridhwan Jl. Abd. Hamid No. 28 DR. H. Hasan Mansur Nst., MA As-Syahaadah Jl. Sikambing Belakang No. 18 Munawar P., MA Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Drs. H. Ismail Zana Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Mawardi Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Drs. H. Anwar Sayuthi Noor Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Sutan Tua Lubis, S.Pd.I Al-Mukarram Jl. Sikambing Gg. Patimura No. 9 Drs. H. Tamhid Harahap Gaudhiyah Jl. Zainul Arifin No. 200A Ahmad Jais, M.Ag Istiqamah Pasar Petisah Hasnan, S.Ag Jamik Kebun Bunga Jl. Kejaksaan Kebun Bunga H. Sutan Syahril D., S.Ag Nurul Haq Jl. Listrik No. 12 Drs. H. Ali Amran Zakaria, Lc Raya Aceh Sepakat Jl. Mengkara No. 2 Ahmad Muttaqin Nst., S.Pd.I Taqarrub Jl. Darussalam No. 24 H.M. Nasir, Lc Ubudiyah Jl. Kebun Bunga/Jl. Jend. S. Parman H. Murtado MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Drs. Syaifudin Nur Assakinah Jl. Polonia (Starban) Per. Angkatan Udara Mashur Utama Hasibuan, S.Ag Al-Hidayah Jl. Starban Kel. Sari Rejo Drs. H. Legimin Syukri Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo O.K. M. Syafii Asy’ari Baitussalam Kosek Hanudnas III Fahrial, S.Ag Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 Drs. Abdul Majidsyam Bakti Jl. Mongonsidi I Baru No. 11 Drs. Effendy Rambe Dirgantara Lanud Jl. Imam Bonjol No. 52 Drs. H. Abdul Sani Sinaga Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukaramai Aswanto Yus Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Zainuri, S.Ag Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D Drs. H.M. Rusly Yusuf MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. Burhan, H.S. Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Ahmad Bashori, S.Ag Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Sari Guna Rambe, S.Ag Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari A. Hasbullah, S.Ag Al-Ikhlas Pasar VII, Padang Bulan Ahmad Ismail Manurung Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Drs. Ismail Mukhtar Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Deni Syahputra Al-Muttaqien Jl. Setia Budi Gg. Tengah No. 11 H. Ali Imran Nasution, S.Ag Al-Muhtadun Jl. Karya Sembada No.179 Kom.Koserna M. Amri Sembiring, S.HI Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Drs. M. Nazaruddin Hasibuan Jami’ Jl. Pasar I Lingk. VIII Tg. Sari Drs. H. Mhd. Selian Muslimin Jl. Setia Budi Kel. Tg. Sari Drs. Syarifuddin Sinaga Nurul Iman Jl. Penerbangan No.77 Komp.Perhubungan Khairil Marzuq Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Mahluddin

Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Nurussalam Jl. Bunga Cempaka No.53 P.B. Selayang II Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 Taqwa Jl. Abdul Hakim No. 2 Tg. Sari

WASPADA Jumat 1 April 2011 Drs. Usman Hsb., SH, M.Hum H. Abd. Rahman Yakub Dr. Achyar Zein, MA Drs. H. Sulaiman H.M. Yahya Drs. Asrizal Tanjung

MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Jl. Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Komplex BTN Dusun III Sei Semayang Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Basyir Jl. Garuda No. 78-B Sei Sikambing B. Al-Badar Jl. Binjai Km. 6,8 Medan Al-Falah Jl. Murni No. 27 Tanjung Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Hasanah Jl. Stasiun Dusun I Tg.Gusta Kp. Pertamina Al-Hafiz Jl. Pinang Baris No. 142 Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muttaqin Jl. Hanura No. 10 Kel. Tanjung Rejo Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Mukhlisin Jl. Darussamam Jl. Sei Tuan No. 38 Al-Muhajirin Kompl. Pondok Karya Kodam-I/BB Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Mu’awanah Jl. Puskesmas I/Jl. Seroja Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Darul Huda Jl. Kasuari No. 53-56 Sei Sikambing-B Isti’adah Jl. Amal No. 4 Kel. Sunggal Istiqamah Jl. Perwira Kel. Lalang Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Jl. Pinang Baris No. 19 Kel. Lalang Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nur Amaliyah Jl. Jend. Gatot Subroto Km. 9 Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT.Perkebunan Nusantara-III Kandir Mdn Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Riyadhussholihin Jl. Sunggal No. 198 Lingk. XIV Raudotussuffah Jl. Pinang Baris Kel. Lalang Raudhatul Fatimah Jl. Swadaya P. Baris Kel. Lalang Syuhada Jl. Balam Lingkungan XIII Sei Sikambing-B Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Silaturrahim Jl. Perintis Kemerdekaan D.Sei Semayang Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Merpati Gg. Mushollah Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tanjung Rejo

Drs. Dasuki Simangunsong Burhanuddin Harahap, S.Ag Drs. Ngadiman G., S.Pd.I H. Abd. Mun’im, MA H. Raden Taufik Drs. M. Yusuf AR, MA Drs. H. Achyar Zein, MA Nurrahman, SH M. Khumaini Hamyar, S.Ag M. Ridwan, S.Pd.I Suwardi, BA Drs. Parno Kartawi Zainuddin, S.Ag Drs. H. Irham Hasibuan H. Syafria Andy, MA Drs. H.M. Jamil, MA Ahmad Basori, S.Ag Drs. Mhd. Solihul Amri Drs. Tohir Pohan Drs. H.M. Yusuf Tanjung Dr. Zuhri, MA H. Al Huddan, S.Sos Zulfan Effendi, MA Prof.DR.H.HasballahThaib, MA Ikhfan Ahmad Nasution, S.Pd Drs. M. Sholihul Amri Drs. Hakimuddin Bambang Permadi, S.Ag Drs. H. Nazrul Fakhri Hamyar Drs. H. Sailan Nasution Nasrun Drs. H.M. Yazid Mufti Lubis Drs. Zulkarnain Sara Drs. H. Ali Amnar Tambunan Drs. H. Khairuman Arsyad, M.Hum Safrizal, S.Pd.I M. Bahren AR, S.Pd.I Drs. Hasanul Arifin Drs. Hasanul Arifin, S.Ag Drs. A. Wahab Kalimantan Drs. H. Azhari AkmalTarigan, MA Abdul Rahman Drs. Sunaryo Drs. Abd. Khadir, Z. Drs. Hasanuddin

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Ash-Sholah Jl. Pendidikan No. 39 Kel. Glugur Darat I Al-A’la Jl. Pembangunan I No. 46 Kel. Glugur Darat II Al-Barkah Jl. Setia Jadi Kel.Glugur Barat I Al-Furqoan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ikhlas Jl. Umar No. 71 Kel. Glugur Darat I Al-Ikhlas Jl. Madiosantoso No. 197 P. Brayan Darat Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Bustanul Huda Jl. Perwira I Lingk. VIII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Perjuangan 45 Jl. Prof. H.M. Yamin, SH No. 51 Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Sutomo Ujung Gg. A No. 47 Kel. Durian Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Ubudiyah Jl. Bambu III Kel. Durian Taqwa Pulo Brayan Bengkel Taqwa UMSU Jl. Kapten Mukhtar Basri No. 3 Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap Ulul Albab Jl. Sutomo IAIN-Sumatera Utara

Syah Kholid Nasution, MA Drs. Hakim Siregar Ahmad Yani, S.Ag Drs. Bustami, HA Drs. Syamsul Bahri Sianipar Drs. H. Naziruddin Idris, Lc Drs. Sayuti Lubis Drs. Abdul Roni Drs. H. Juanda Sirait Drs. Ahmad Syaukani Drs. Maragading Hakim, S.Ag Drs. H. Saiful Asro Dalimunthe,MA DR. H. Hasanuddin, MA H.A. Perdana Indra, M.Ag DR. H.M. Sofyan, Lc, MA Drs. H. Baharuddin Siregar H. Mohammad Syafiar, Lc, MA H.M. Rajab Asri Maswail, Lc DR. H. Ardiansyah, Lc, MA Drs. H. Effendi Batubara Drs. H. Sokon Saragih, M.Ag Drs. H. Lahmuddin Ritonga Dr. M. Syahnan Nasution H. Achyar Nasution, Lc, MA Drs. H. Nurdin Muhammad Drs. Tuah Sirait, MA Drs. Abdul Kadir Jailani Tanwir Siagian Drs. Khaidir Sulaiman Prof. DR. Lahmuddin Lbs., M.Ed Drs. Sarwo Edi H. Nahar A. Ghani, Lc, MA Drs. Hasanuddin MD., MA Dr. H. Muhammad Sofyan, MA

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metrologi Raya Gg.Karya No. 1 Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Bayan Jl. Gurilla No. 10 Al-Falah Jl. Pukat Banting IV No. 10 Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hilal Jl. Belat No. 76-B Al-Ikhlas Lingk. II Kel. Bandar Selamat Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Al-Muqorrobin Jl. Pukat II No. 52 Bantan Timur Al-Izzah Kampus II Pasar V Medan Estate Baiturrahman Kampus Unimed Jl. Williem Iskandar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Darul Djalal Jl. Taut\Sukaria No. 29 Kel. Sidorejo Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo Ikhwaniah Jl. Tuamang No. 47 Kel. Sidorejo Hilir Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Raya Muslimin Jl. Pukat I No. 1 Kel. Bantan Timur Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Jl. Kolam No. 01 Kampus I Medan Estate Taqwa Jl. Letda Sudjono No. 15 Taqwa Ranting Sidorejo Hilir

Drs. Ngatman Aziz Sarman, S.Ag Drs. H.M. Situmorang Drs. H. Abu Bakar Adnan Srg., MA Drs. Sofyan Sauri, SH Drs. H. Nurman Almi Drs. Satiman Mhd. Yusuf Siregar, S.Ag Drs. Syamsuddin Amin Drs. H. Amiruddin Batubara Syarifuddin Sirait, S.HI, S.Pd.I Drs. Dairobi Butar-butar Drs. Maradingin Nst., M.Ag Jumiran Abdi, S.Ag Drs. Bahron Nasution Dr. Jamil, MA Abdul Lathif, Lc, MA Asri Koto Drs. H.T. Mahmud Drs. Mizwar Rangkuti Drs. H. Romsil Harahap H. Muhammad Taufiq, MA Drs. H. Amir Saleh Nasution Drs. H. A. Halim Fadlan Junaidi, S.Pd.I, M.SI Prof.Dr.H.A.Ya’kub Matondang, MA Drs. Kemal Fauzi Syarif Dongoran

MEDAN TUNTUNGAN Azizi Kel. Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Ikhlash Jl. Nilam 11 No. 1 Perumnas Simalingkar Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Muhajirin Jl. Kopi Raya II Blok A Perum Simalingkar Al-Muhajirin Jl. Seroja Komplek Medan Permai Al-Muhtadin Jl. Kemiri Raya I No.1 Blok-G Simalingkar Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Iklab Jl. Letjend. Jamin Ginting Km. 12,5 No. 100 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Silaturrahim Jl. Kapas 13 No. 49 P. Simalingkar Taqwa Jl. Sawit Raya Perumnas Simalingkar

Drs. H. Sulaiman, Mhd. BA Drs. Indra Budiman Horasman Purba, BA Drs. M. Syafi’i Nasution Drs. Adi Sucipto Ir. H. Hazaraini Anwar Awaliddin Rangkuti Nurrahman, SH Syafruddin Syam, MA Drs. H. Hasbi Yunus Maulana Habibullah Drs. Nazaruddin Sir, S.Ag Bekta Perkasa, MA Bambang Kuswoyo, SE Husin Drs. Abdul Kadir Jailani

DELI SERDANG Amal Islamiyah Jl. Sudirman Kel. Lubuk Pakam Pekan Ainul Yaqin Jl. Pembangunan IV No. 30 Al-Falah Jl. Pasar V No. 73 Dusun XIV Desa Tembung Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC Al-Hafiz Hamparan Perak Kec. Hamparan Perak Al-Hikmah Kompleks RS Jiwa Daerah Propsu Al-Ikhlas Simpang Beringin Hamparan Perak Al-Ikhlas Desa Suka Makmur Kec. Delitua Al-Muttaqien Gg. Kolam Deli Tua Al-Muttaqin Dusun V Desa Bangun Dari Komp.Koserna Al-Mukhlishin Jl. Terusan Bandar Setia Dusun II Al-Salam Jl. Raya Medan-Namorambe Kom. Pisu No.1 Baitussalam Dagang Kerawan-Tg. Morawa Graha Deli Permai Jl. Tani Bersaudara, K. Namorambe Khairul Fatihin Dusun II Kec. Tg. Morawa Jami’ Jl. T. Imam Bonjol No. 17

Drs. M. Yusron Siregar Drs. Muchsin Nasution Khairuzzaman, S.Ag H. Darma Effendi, SH, MA H. Habibuddin, Lc H. Bakhtiar Wahid Khairunnazri Nasution, S.Pd.I H. Ibnu Hajar, BA H.A. Sugianto, Lc Ajma’in Amin Drs. Syamsul Anwar Nasution H.M. Ridwan Hamid Drs. Nazaruddin Nasution H. Turmudi H. Alfan Drs. H. Jamaluddin Drs. H. Ahmad Taufik Lubis


Waspada, Jumat 1 April 2011