Page 1

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Pahing, 13 April 2012/21 Jumadil Awal 1433 H

No: 23833 Tahun Ke-66

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,-

5 Meninggal Akibat Serangan Jantung Pangdam I/BB: Tak Ada Korban Jiwa Di Sumut


PASCA GEMPA ACEH: Foto udara Kabupaten Simeulue, Kamis (12/4). Pihak Badan Penanggulangan Bencana Daerah (BPBD) Kabupaten Simeulue menyatakan, pasca gempa yang mengguncang Aceh pada Rabu 11 April 2012, belum ada laporan tentang kerusakan parah yang terjadi di kabupaten tersebut.

BANDAACEH (Waspada) : Badan Penanggulangan Bencana Aceh (BPBA) , Kamis (12/4) melaporkan dampak gempa 8,5 SR yang melanda Aceh, Rabu (11/4), lima warga meninggal dunia, sementara delapan warga lainnya mengalami luka ringan. Kepala Pelaksana BPBA, Asmadi Syam merincikan korban meninggal dunia tersebut, masing-masing Nurkhadijah, 70, warga Gampong Pisang, Kecamatan Seutia, Aceh Barat Daya dan seorang laki-laki di Kota Lhokseumawe karena serangan jantung. Berikutnya yang juga korban gempa, yakni Yasin Kulam, 70, warga Gampong Lingke, Kecamatan Syiahkuala, Banda Aceh, Fauziah, 60, dan M Yusuf, keduanya warga Kecamatan Darul Imarah, Aceh Besar, yang juga diduga karena serangan jantung. Sedangkan korban luka ringan, Sefa Alfa, 9, Deni Alfa, 7, dan Kiki Alfa, 1, warga Gampong Madumpang, Kecamatan Suro, Aceh Singkil, Ferdiansyah, 21, Lastri, 18, Diana, 36 dan Melawati warga Kecamatan Simeulue Barat dan Simeulue Timur, Simeulue serta Ummi Kalsum,65, warga Gampong Air Sialang, Kecamatan Kluet Selatan, Aceh Selatan. Korban mengalami patah kaki ketika lari menyelamatkan diri. Asmadi juga menyebutkan, pagar Lapas Kelas III Kota Banda Aceh dan Rumah Sakit Umum Singkil, kantor RAPI di Meunasah Manyang, tembok penjara dan dua rumah di Kota Cot Gle rusak berat serta satu rumah di Kahju, Aceh Besar rusak ringan. Asmadi melaporkan, Pemerintah Aceh melalui BPBA telah melaksanakan penanganan kedaruratan bencana dengan baik, yakni memberikan pertolongan penyelamatan dan evakuasi termasuk pemenuhan dasar pengungsi. Lanjut ke hal A2 kol. 3

Ilmuan Terkejut Tak Ada Tsunami WASHINGTON (Waspada): Dua gempa besar yang terjadi Rabu(11/4) ,hanya berselang beberapa jam membuat para ilmuwan dan ahli gempa terkejut karena tidak menimbulkan tsunami. Menurut seismolog USGS, Susan Hough, “ini kejadian yang aneh.” Sebab, jarang terjadi ada

gempa sesar geser yang berkekuatan sebesar ini. Demikian juga pendapat

Waspada/Armin Nasution

GUS IRAWAN (kiri) dan Tuan Guru Babussalam (kanan) saat berdialog berbagai hal. Selain itu Gus Irawan juga memohon doa restu dari Tuan Guru untuk maju dalam pemilihan kepala daerah tahun depan.

Gus Irawan Silaturrahmi Ke Tuan Guru Babussalam LANGKAT (Waspada): Di tengah kesibukannya mengomandoi Bank Sumut, Gus Irawan Pasaribu menyempatkan diri bersilaturrahmi ke Tuan Guru Babussalam. Gus Irawan Pasaribu dan rombongan mampir ke tempat itu untuk berdiskusi banyak hal dengan Tuan Guru Babussalam Syech H Hasyim Al Syarwani di Bumi Tareqat Naqsyabandiyah Desa Babussalam, Kecamatan PadangTualang, Kabupaten Langkat, kemarin malam. Dalam suasana penuh keakraban, hadir juga di situ jamaah Majlis Taklim Salafiah As-Syafi’iyah, Pulo Brayan Medan yang dipimpin langsung KH H Najaruddin Lubis. Pada silaturahmi tersebut Gus Irawan juga berkesempatan shalat berjamaah bersama jamaah Tareqat Naqsyabandiyah Desa Babussalam dan jamaah Majlis Taklim Salafiah As-Syafi’iyah.

Lanjut ke hal A2 kol. 1

Kevin Furlong, profesor geosains dari Penn State University.”Seminggu lalu, kita tak pernah menyangka ada gempa sesar geser dengan kekuatan sebesar ini. Ini sangat, sangat besar,” kata dia seperti dimuat, kemarin. Dalam catatan USGS, gem-

pa yang terjadi kemarin adalah yang terbesar kesebelas sejak tahun 1900. Ini mungkin gempa sesar geser terbesar yang pernah diketahui. Sebelumnya, Kepala Pusat Data Informasi Badan Nasional Penanggulanan Bencana (BNPB) Sutopo Purwo Nugroho

Paripurna DPR Sahkan RUU Pemilu Jadi UU

MEDAN (Antara): Universitas Negeri Medan selaku koordinator pengawas ujian nasional di Sumatera Utara menemukan adanya kekurangan naskah ujian yang dikirimkan dari percetakan di Pekanbaru, Riau ke Medan. “Hasil invetarisir panitia, bersama inspektorat tadi malam, ternyata ada beberapa materi soal yang muatannya kurang namun jumlahnya tidak banyak. Ini sudah kita beritahukan ke percetakan untuk segera dikirimkan kekurangannya,” kata Rektor Universitas Negeri Medan (Unimed) Prof Ibnu Hajar, Kamis (12/4), tanpa merinci jumlah total kekurangannya. Kekurangan soal ini, lanjutnya, tidak mempengaruhi pendistribusian naskah UN ke kabupaten/kota di Sumatera Utara, sebab naskah yang kurang itu terdapat untuk daerahdaerah terdekat dengan lokasi penyimpanan soal UN. “Masih ada waktu empat hari lagi, saya rasa cukup untuk mengirimkan sisanya itu. Jarak dari Pekanbaru ke Medan hanya satu malam. Jadi, sebelum pelaksanaan saya rasa sudah selesai,” katanya. Lanjut ke hal A2 kol. 3

JAKARTA (Waspada): Rapat Paripurna DPR RI akhirnya bersepakat Rancangan UndangUndang tentang Pemilihan Umum 2014 disahkan menjadi Undang-Undang setelah dua dari empat hal krusial diputuskan melalui mekanisme voting di Gedung MPR /DPR/ DPD RI, Jakarta, Kamis (12/4). Wakil Ketua DPR RI Pramono Anung yang memimpin Rapat Paripurna DPR RI mengetukkan palu tanda menyetujui RUU itu menjadi UU Pemilu 2014 tanpa ada lagi interupsi dari anggota DPR RI. Setelah itu, Menteri Dalam Negeri yang merupakan perwakilan pemerintah menyampaikan pandangan pemerintah. Sebelumnya, terjadi perdebatan melalui interupsi-interupsi yang disampaikan anggota DPR RI pimpinan rapat paripurna. Dari empat hal krusial pada RUU Pemilu, yang pembahasannya selama beberapa hari terakhir berlangsung alot, dua hal di antaranya harus diputuskan melalui mekanisme voting. Hal pertama yang diputuskan melalui mekanisme voting

GEMPA bumi Aceh 11 April 2012 bersumber dari sumber gempa pada punggu tengah Samudera Sembilan Puluh Timur (ninetyast Ridge) di dasar laut Lautan India. Dijalur gempa ini sejak tahun 1912 terjadi gempa beberapa kali dengan kekuatan lebih besar dari 7 SR. Sejajar dengan Punggungan Sembilan Puluh Timur ini ada Patahan Investigator yang menjorok menjangkau Kepulauan Nias. Proses tektonik dan kegempaan di kawasan Punggungan Sembilan Puluh Timur ini dapat memicu terjadinya perulangan gempa bumi di Nias Selatan (1935, 7.7 SR) dan gempa bumi Karo (1930, 7.2 SR). (Jonathan Tarigan)

PM Inggris Di Universitas Al-Azhar:

Assalamualaikum JAKARTA (Antara): Perdana Menteri Inggris David Cameron ternyata menerapkan pepatah Minang, yang berbunyi “masuk kandang kambing mengembik, masuk kandang kerbau melenguh”, ketika menyampaikan pidatonya di Universitas Al-Azhar Jakarta, Kamis (12/4). Hal tersebut tersirat ketika di awal David Cameron memberikan pidato, dia menguAP capkan “assalamualaikum”, Lanjut ke hal A2 kol. 6 PM Inggris David Cameron

Lanjut ke hal A2 kol. 6

2004, yang menewaskan 230.000 orang dan membuat jutaan orang lainnya kehilangan tempat tinggal. “Gempa kemarin jauh lebih kecil,” kata dia, seperti dimuat situs sains, LiveScience, 11 April 2012. Dia menambahkan, gempa yang terjadi 2004 berkekua-

Oleh Tgk. H. Ameer Hamzah

Waspada/ Rustam Effendi

KORBAN yang disebut- sebut bernama Hendro Priyadi, warga Pulo Brayan Bengkel, tewas.

Bentrokan Di Sei Mati, Satu Tewas Dan Satu Luka

Shalat Jumat Di Mana?

BELAWAN (Waspada): Puluhan pria bersenjata tombak besi dan senjata tajam serta senjata api, menyerang warga Batang Kilat, Lingk. 2 , Kel. Sei Mati , Kec. Medan Labuhan, Kamis (12/4). Akibatnya, satu dari puluhan pria itu disebutsebut bernama Hendro Priyadi, warga Pulo Brayan Bengkel, tewas di lokasi, seorang temannya luka parah.

Lihat hal. C4 Dan C5

Lanjut ke hal A2 kol. 6

MEDAN (Waspada) : Kejaksaan Negeri (Kejari) Medan menahan mantan Wakil Direktur (Wadir) Narkoba Poldasu Ajun Komisaris Besar Polisi (AKBP) Aprianto Basuki Rahmat bersama tiga tersangka lainnya. Hal tersebut menyusul pelimpahan perkara tahap II oleh penyidik Poldasu Kamis (12/4).Penahanan Apriyanto sempat berlangsung alot. Pasalnya, mantan orang nomor dua di Direktorat Reserse Narkoba Poldasu itu menolak menandatangani berita acara penahan dirinya. “Tersangka menolak menandatangani berita acara penahanan tapi kita menahannya karena persamaan hak di mata hukum terhadap ketiga

Lanjut ke hal A2 kol. 1

tan 9,1 skala Richter atau gempa ketiga paling kuat yang pernah dicatat dalam sejarah. Namun, yang paling signifikan dan membedakan, gempa kemarin tidak terjadi pada zona subduksi, di mana lempeng

Lanjut ke hal A2 kol. 3

Waspada/Surya Efendi

REGU khusus TNI AD bersenjata lengkap menyelamatkan Wapres dalam gladi dan simulasi di halaman Masjid Raya Al Mashun Medan, Kamis (12/4).

Hari Ini, Wapres Di Bandara Kualanamu

2.670 Personil TNI Dan Polri Disiagakan MEDAN (Waspada): 2.670 Pasukan pengamanan dari TNI AD, TNI AU, TNI AL dan Poldasu siaga mengamankan kunjungan kerja Wakil Presiden Boediono selama di Medan dan Simalungun, mulai Jumat (13/4) hingga Sabtu (14/4). Rencananya, Boediono mengunjungi Bandara Kualanamu dan mengunjungi Sekolah Unggulan di Simalungun. “Kita baru saja gelar pasukan untuk mengetahui kesiapan dari

masing-masing personel dan materil pengamanan serta sarana pendukung,” kata Pangdam I/BB Mayjen TNI Lodewijk F. Paulus usai Siaga Pengamanan di Lapangan Benteng, Kamis (12/4). Menurutnya, personil pengamanan itu akan ditempatkan di Lanud Medan, Bandar Udara Internasional Kualanamu, Masjid Raya Medan,

Lanjut ke hal A2 kol. 4

Ada-ada Saja

Jaksa Tahan Mantan Wadir Narkoba Poldasu

Kemenangan Sejati

Masjid Raya Medan

ke) jarak dari gempa 10 Januari 2012 yaitu kurang dari 30 km. Sementara, ahli geofisika dari Badan Survei Geologi Amerika Serikat atau U.S. Geological Survey (USGS), Julie Dutton mengatakan, gempa kemarin jauh berbeda dengan gempa yang memicu tsunami

Naskah UN Untuk Sumut Kurang

Al Bayan

KEMENANGAN dalam perjuangan adalah kepuasan dan kekalahan adalah kesedihan. Begitu kata seorang ahli hikmah Abu Laits As-Samarkandi. Memang benar adanya. Umpamanya; Seorang petinju yang dapat mengalahkan lawan, akan melompat kegirangan sambil mengacungkan tinjunya ke udara. Begitu juga seorang pemain bola yang dapat menjaringkan si “kulit bundar” ke gawang lawan. Kemenangan macam itu adalah semu (sementara). Pada kesempatan yang lain, sang juara akan dikalahkan lawan. “Maukah aku tunjukkan padamu kemenangan yang sejati? Kemenangan yang tak terkalahkan lagi?”. Kata seorang guru pada muridnya. “Mau, tunjukkan wahai Syaikhuna,,” pinta muridnya. Lanjut ke hal A2 kol. 3

mengatakan, berdasarkan analisis, gempa yang terjadi kemarin adalah gempa sesar geser, bukan sesar naik. “Bukan megathrust sehingga potensi tsunami tak terlalu besar,” kata dia. Lokasinya yaitu di bagian luar dari daerah pertemuan lempeng (outer rise earthqua-

Uang Gaji Diganti Ayam

Waspada/Micky Maliki

WARGA mengumpulkan es yang turun dari langit untuk lebih mengetahui kebenaran hujan es.

Hujan Es Guyur Kota Kabanjahe KABANJAHE( Waspada): Kota Kabanjahe Kamis (12/4) sore diguyur hujan es sehingga masyarakat yang sedang berada di sepanjang Jl. Veteran harus memarkirkan kendaraan mereka agar terhindar dari tumpahan es. Pantauan Waspada di lokasi Jl. Veteran Kabanjahe beberapa batu es yang menghujani kota tersebut sempat meng-hebohkan masyarakat.Mereka keluar rumah untuk melihat hujan es, karena bagi masyarakat Tanah Karo, hujan es akan berdampak bagi para petani. Lanjut ke hal A7 kol. 1

DEFISIT anggaran membuat negara Uzbekistan mengeluarkan kebijakan untuk mengganti gaji pegawai sipilnya. Para pegawai sipil di negara tersebut diberi ayam sebagai bentuk bayaran uang gaji mereka. Meski pemerintah setempat mengatakan, para pegawai tersebut menerima sukarela gaji unik yang dibayarkan kepada

Lanjut ke hal A2 kol. 2

Serampang - Maunya hujan duit... - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Pahing, 13 April 2012/21 Jumadil Awal 1433 H z zNo: 23833 * Tahun Ke-66

Terbit 28 Halaman (A1-12, B1-8,C1-8) z zHarga Eceran: Rp 2.500,-

30 Kali Gempa Susulan

BANDA ACEH (Antara): Gempa susulan pascagempa berkekuatan 8,5 skala richter (SR) yang terjadi di Samudera Hindia, Rabu (11/4) pukul 15.38 WIB, masih berlangsung hingga Kamis (12/4). “Gempa susulan masih terjadi dengan kekuatan berkisar di bawah 6,5 SR,” kata Kepala Stasiun Geofisika, Badan Meteorologi, Klimatologi, dan Geofisika (BMKG) Banda Aceh Syahnan di Banda Aceh, Kamis. Ia mengatakan, pihaknya mencatat 30 kali gempa susulan sejak Rabu (11/4) pukul 15.38 WIB hingga Kamis (12/4) pukul 07.29 WIB dengan kedalaman bervariasi. Berdasarkan pencatatan dari seismograf, kata dia, gempa Rabu (11/4) siang terjadi dua kali, yakni pukul Lanjut ke hal A2 kol 2

34 Napi Sigli Belum Kembali Waspada/Muhammad H Ishak

PANITIA Kamp Pengungsian sedang mempersiapkan makanan di pengungsian di Masjid Istiqamah Cot Keh, Kecamatan Peureulak, Kab. Aceh Timur Kamis (12/4).

sepi karena siswa dan para guru masih enggan kesekolah karena takut akan gempa susulan. Ketua Koalisi Barisan Guru Bersatu (Kobar GB), Sayuti, Kamis (12/4) mengatakan, murid di sekolah SMP 12 Kampung Jawa dipulangkan karena yang hadir hanya

BANDA ACEH ( Waspada): 34 Napi Rutan Benteng Sigli, Kabupaten Pidie belum kembali, dari 206 Napi yang kabur akibat isu muncul gelombang tsunami setelah terjadi gempa berkekuatan 8,5 SR mengguncang Aceh, Rabu (11/4). Demikian Kepala Divisi Kemasyarakatan Kanwil Kementerian Hukum dan HAM Provinsi Aceh H. Jauhar Fardin, Bc.IP.SH.MH menjawab Waspada, Kamis (12/4). Kata dia, setelah terjadi gempa dan kemudian isu munculnya tsunami, maka bukan hanya napi yang panik, tapi petugas rutan juga panik lari, berbarengan dengan masyarakat yang juga berlarian menyelamatkan diri. “Tapi, alhamdulillah, sebagian napi telah kembali dengan

Lanjut ke hal A2 kol 5

Lanjut ke hal A2 kol 6

Waspada/Gito Rolies

SEORANG petugas berada di dekat tembok Lapas Banda Aceh yang terletak di Gampong Bineh Blang, Pagar Air, Kecamatan Ingin Jaya runtuh sepanjang 100 meter, Kamis (12/4).


Hari Ini Wapres Ke Banda Aceh DPR Sahkan Sistem Pasca Gempa Sejumlah BANDAACEH (Waspada): Badan Penanggulangan Bencana Aceh (BPBA) , Kamis (12/4) melaporkan Penghitungan Suara Kuota Murni dampak gempa 8,5 SR yang melanda Aceh, Rabu Sekolah Lumpuh

JAKARTA (Antara): Rapat Paripurna DPR RI menetapkan bahwa sistem penghitungan suara pada Pemilu 2014 mendatang menggunakan sistem kuota murni. Keputusan lewat voting itu dengan jumlah sistem penghitungan kuota murni (alternatif A) mendapatkan 342 suara dan sistem divisor webster (alternatif B) sebanyak 188

suara. “Ju m l a h s u a ra u n t u k alternatif A sebanyak 342 suara dan alternatif B adalah 188 suara. Dengan demikian alternatif A (kuota murni) dijadikan dasar melakukan penghitungan suara pada Pemilu 2014 mendatang,” kata pimpinan rapat paripurna Lanjut ke hal A2 kol 1

(11/4), lima warga meninggal dunia, sementara delapan warga lainnya mengalami luka ringan.

Kepala Pelaksana BPBA, Asmadi Syam merincikan korban meninggal dunia tersebut, masing-masing Nurkhadijah, 70, warga Gampong Pisang, Kecamatan Seutia, Aceh Barat Daya dan seorang laki-laki di Kota Lhokseumawe karena serangan jantung. Berikutnya yang juga korban gempa, yakni Yasin Kulam, 70, warga Gampong Lingke, Kecamatan Syiahkuala, Banda Aceh, Fauziah, 60, dan M Yusuf, keduanya warga Kecamatan Darul Imarah, Aceh Besar, yang juga diduga karena serangan jantung. Sedangkan korban luka ringan, Sefa Alfa, 9, Deni Alfa, 7, dan Kiki Alfa, 1, warga Gam-

pong Madumpang, Kecamatan Suro, Aceh Singkil, Ferdiansyah, 21, Lastri, 18, Diana, 36 dan Melawati warga Kecamatan Simeulue Barat dan Simeulue Timur, Simeulue serta Ummi Kalsum,65, warga Gampong Air Sialang, Kecamatan Kluet Selatan, Aceh Selatan. Korban mengalami patah kaki ketika lari menyelamatkan diri. Asmadi juga menyebutkan, pagar Lapas Kelas III Kota Banda Aceh dan Rumah Sakit Umum Singkil, kantor RAPI di Meunasah Manyang, tembok penjara dan dua rumah di Kota Cot Gle rusak berat serta satu rumah di Kahju, Aceh Besar

BANDA ACEH (Waspada): Sejumlah sekolah di Kota Banda Aceh pasca bencana gempa bumi, Rabu kemarin, aktivitas belajar mengajar lumpuh total karena murid dan guru tidak hadir akibat masih takut. Amatan Waspada, beberapa sekolah seperti di SDN 2 Banda Aceh dan SMP 12 Kampung Jawa Banda Aceh terlihat

Lanjut ke hal A2 kol 2

Hasil Pilkada Aceh Diumumkan 15 April Gempa Tak Pengaruhi Penghitungan Wapada/Asrirrais

AIR sungai Batangserangan meluap sampai merendam sebagain ruas Jalan Sudirman, Kec. Tanjungpura, Kamis (12/4).

Sungai Batangserangan Meluap Kota Tanjungpura Terendam TANJUNGPURA (Waspada): Intensitas curah hujan yang cukup tinggi dalam beberapa hari terakhir membuat Sungai Batangserangan di Kec. Tanjungpura, Kab. Langkat, Kamis (12/4) siang meluap hingga merendam sebagian ke inti kota Jl. Sudirman. Menurut salah seorang

warga Kel. Pekan Tanjungpura, kemungkinan air sungai akan kembali normal, bila malam ini cuaca cerah dan hujan tidak kembali turun. “Meski luapan air tidak sampai merendam rumah, tapi apabila musim hujan warga di bantaran sungai sangat khawatir mengingat kondisi sungai saat ini sudah semakin

dangkal,” kata warga seraya meminta kepada pemerintah agar melakukan normalisasi sungai. Camat Tanjungpura, Nuriansyah, SSTP, yang dihubungi Waspada, Kamis petang menyatakan, sampai sejauh ini belum ada warga yang mengungsi. Menurut dia, kondisi air mulai surut. (a02/a03)

BANDA ACEH (Waspada): Komisi Independen Pemilihan (KIP) Aceh menyatakan tahapan Pilkada Aceh tetap berjalan meski sempat terganggu akibat gempa berkekuatan 8,5 Skala Richter (SR), Rabu (11/ 4). Saat ini KIP kabupaten/kota masih merekapitulasi suara hasil Pilkada Aceh 9 April. Wakil Ketua Komisi Independen Aceh Ilham Syahputra menyebutkan, gempa tidak memengaruhi proses perhitungan suara. Bahkan, kata dia, proses perhitungan suara di tingkat kecamatan telah selesai kemarin. “Kami masih menunggu hasil rekap suara dari Kabupaten/kota. Sejauh ini tidak ada masalah,” katanya, Kamis (12/4).

Kemenangan Sejati Oleh: H Ameer Hamzah

Lanjut ke hal A2 kol 2

Waspada/Muhammad Hanafiah

11 PASANGAN Cabup-Cawabup Aceh Tamiang yang akan mengikuti Pemilukada Aceh Tamiang periode 2012-2017 pada 9 Juni 2012.Tampak berdiri mulai dari sebelah kanan yaitu pasangan Jamaluddin T.Muku-Suaib Araby US dan H.Hamdan Sati-Iskandar Zulkarnain serta seterusnya berdiri berdasarkan nomor urut masing-masing di Ruang Rapat Utama Gedung DPRK Aceh Tamiang, Rabu (11/4) malam.

Nomor Urut 11 Pasangan Cabup Aceh Tamiang Ditetapkan KUALASIMPANG (Waspada): Komisi Independen Pemilihan (KIP) Kabupaten Aceh Tamiang menetapkan nomor urut 11 pasangan calon bupati (Cabup)–calon wakil bupati (Cawabup) Aceh Tamiang yang akan mengikuti Pemilukada di kabupaten tersebut pada 9 Juni 2012. Penetapan nomor urut

tersebut dilaksanakan dalam rapat pleno terbuka yang berlangsung di Ruang Rapat Utama Gedung DPRK Aceh Tamiang, Rabu (11/4) malam. Rapat dibuka oleh Ketua KIP Aceh Tamiang, Izuddin dan dilanjutkan oleh Komisioner KIP setempat, Zulfahmi yang merupakan Ketua Bagian Pencalonan Bupati-Cawabup


MUHAMAD Prawiro Dijoyo atau Joyo (kanan), yang sebelumnya bernama Siti Maemunah saat bersama ibundanya, Ngatun (55), usai menjalani operasi penyesuaian kelamin di RSUP dr Kariadi Semarang, Jateng, Kamis (12/4).

Siti Akhirnya Jalani Operasi Kelamin JAKARTA (Waspada): Muhammad Prawiro Dirjoyo akhirnya dapat tersenyum lebar hari ini. Sebabnya, dia akan menjalani operasi kelamin seperti yang diimpikannya sejak dulu.

Lanjut ke hal A2 kol 1

MEDAN (Waspada): Kejaksaan Negeri (Kejari) Medan menahan mantan Wakil Direktur (Wadir) Narkoba Poldasu Ajun Komisaris Besar Polisi (AKBP) Aprianto Basuki Rahmat bersama tiga tersangka lainnya. Hal tersebut menyusul pelimpahan perkara tahap II oleh penyidik Poldasu Kamis (12/4).Penahanan Apriyanto sempat berlangsung alot. Pasalnya, mantan orang nomor dua di Direktorat Reserse Narkoba Poldasu itu menolak menandatangani berita acara penahan dirinya. “Tersangka menolak menandatangani berita acara penahanan tapi kita menahannya karena persamaan hak di mata hukum terhadap Lanjut ke hal A2 kol 3

Aceh Tamiang yang menuntun tata tertib acara pencabutan nomor undian dan pencabutan nomor urut. Acara tersebut dihadiri unsur Muspida Plus Aceh Tamiang, 11 pasangan CabupCawabup, kecuali Cabup dari Partai Aceh ( PA), Agussalim Lanjut ke hal A2 kol 1

Ada-ada Saja

Jaksa Tahan Mantan Wadir Narkoba

Al Bayan

KEMENANGAN dalam perjuangan adalah kepuasan, dan kekalahan adalah kesedihan. Begitu kata seorang ahli hikmah Abu Laits As-Samarkandi. Memang benar adanya. Umpamanya; Seorang petinju yang dapat mengalahkan lawan, akan melompat kegirangan sambil mengacungkan tinjunya ke udara. Begitu juga seorang pemain bola yang dapat menjaringkan si “kulit bundar” ke gawang lawan. Kemenangan macam itu adalah semu (sementara). Pada kesempatan yang lain, sang juara akan dikalahkan lawan. “Maukah aku tunjukkan padamu kemenangan

KIP Aceh masih melakukan perhitungan dan rekapitulasi suara secara manual. Rencananya hasil Pilkada Aceh akan diumumkan pada 15 April mendatang. “Jadwalkan tanggal 15 itu sudah selesai perhitungan di tingkat provinsi,” ujarnya. Dua gempa besar yang menguncang Aceh kemarin melumpuhkan aktivitas warga di seluruh wilayah. Setelah 8,5 SR, Aceh kembali digoyang gempa dalam hitungan jam. Warga berlarian menyelamatkan diri ke tempat-tempat yang dianggap aman, karena khawatir terjadi tsunami, seperti yang pernah dirasakan masyarakat Aceh pada tahun 2004 silam. (vvn/m13)

Uang Gaji Diganti Ayam

Waspada/Armin Nasution

GUS IRAWAN (kiri) dan Tuan Guru Babussalam (kanan) saat berdialog berbagai hal. Selain itu Gus Irawan juga memohon doa restu dari Tuan Guru untuk maju dalam pemilihan kepala daerah tahun depan.

DEFISIT anggaran membuat negara Uzbekistan mengeluarkan kebijakan untuk mengganti gaji pegawai sipilnya. Para pegawai sipil di negara tersebut diberi ayam sebagai bentuk bayaran gaji mereka. Meski pemerintah setempat mengatakan, para pegawai tersebut menerima sukarela Lanjut ke hal A2 kol 5

Gus Irawan Silaturrahmi Ke Tuan Guru Babussalam


LANGKAT (Waspada): Di tengah kesibukannya mengomandoi Bank Sumut, Gus Irawan Pasaribu menyempatkan diri bersilaturrahmi ke Tuan Guru Babussalam. Gus Irawan Pasaribu dan rombongan mampir ke tempat itu untuk berdiskusi banyak hal dengan Tuan Guru

- Krue Seumangat - He.... he....he....

Lanjut ke hal A2 kol 4

Berita Utama

A2 Nomor Urut 11....

yang berhalangan hadir, sedangkan Cawabup dari PA Abdussamad tampak hadir. Pendukung 11 pasangan cabupCawabup Aceh Tamiang dan para undangan lainnya juga tampak hadir memenuhi ruangan sidang utama DPRK Aceh Tamiang. Adapun hasil pencabutan nomor urut 11 pasangan CabupCawabup Aceh Tamiang adalah 1.Joni Evita-H.Buyung Arifin 2.Muhammad Nasir-Jabat Sumbadha 3.Abdul Halim-Mahmud 4.Agussalim-Abdussamad 5.HT.Yusni-Ismail 6.Haprizal Roji-Toni Heriadi 7.H.Awaluddin-Syaiful Anwar 8.Lukmanul Hakim-Boeran 9.Zulfendi-H.Abul Hayat 10.H.Hamdan Sati-Iskandar Zulkarnain 11.H.Jamaluddin T.Muku-Suaib Araby US “Nanti akan kami tetapkan jadwal kampanye dan debat kandidat Cabup-Cawabup Aceh Tamiang ,” tegas Ketua KIP Aceh Tamiang seusai acara pencabutan nomor urut pasangan cabup-Cawabup Aceh Tamiang itu kepada Waspada, Rabu (11/4) malam. (b23)

DPR Serahkan ....

DPR RI, Pramono Anung di Gedung DPR RI, Jakarta, Kamis (12/4). Dalam voting tersebut, alternatif A dipilih oleh Fraksi PD (140 suara), Fraksi PKS (54 suara), Fraksi PAN (42 suara), Fraksi PPP (37 suara), Fraksi PKB (28 suara), Fraksi Gerindra (24 suara) dan Fraksi Hanura (17 suara) Sedangkan alternatif B hanya dipilih oleh Fraksi Golkar (97 suara) dan Fraksi PDIP (91 suara). Sekjen PPP, Romahurmuziy menyatakan, tiga opsi lain seperti parliamentary threshold atau ambang batas

Siti Akhirnya .... “Sejak jam 2 saya sudah puasa dan jam 6 saya mulai diinfus, doakan ya,” ujar Joy di atas tempat tidur yang mengantarnya menuju ruang operasi, di Rumah Sakit Dokter Kariadi, Semarang, Kamis (12/4). Joy akan menjalani tiga tahap pemeriksaan yakni operasi saluran kencing atau uretoplasi, selanjutnya operasi penutupan lubang dan terapi. Operasi tahap pertama ini sedang berlangsung hampir empat jam. Ngatun ibunya nampak gelisah menunggu. “Saya berharap semua berjalan lancar,” kata Ngatun pendek.Belum ada keterangan resmi dari dokter yang me-nanganinya namun pihak RS berjanji akan memberikan keterangan langsung melalui dr Ardi yang memimpin operasi . Joy adalah anak keempat dari lima bersaudara. Ia tinggal di Jl Kinoralim, gang Duduko II, Rt 04 RW 04 Kelurahan Sembungharjo, Genuk, Semarang. Namanya sempat terangkat saat ia mengajukan penetapan kelamin di PN Semarang. Penetapan itu ia ajukan karena sejak kecil ia diperlakukan sebagai anak perempuan. Bahkan namanya juga nama perempuan, Siti Maimunah. Namun karena nalurinya merasa ia laki-laki, maka ia mencoba memeriksakan secara medis. Kesimpulannya, Siti Maimunah adalah laki-laki dengan alat kelamin tak sempurna. Majelis hakim di PN Semarang tak ragu menetapkan bahwa Joy adalah laki-laki. Dan ia mengucap selamat tinggal kepada Siti Maimunah untuk berganti menjadi Mohamad Prawiridijoyo.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Re3+. Kd3. 2. GxK+mat.

Jawaban TTS: TTS Topik


Mimbar Jumat




Jawaban Sudoku: 8 7 9 4 3 2 6 5 1

3 6 2 1 5 7 9 4 8

4 5 1 8 6 9 2 7 3

6 9 4 2 1 8 5 3 7

5 1 7 3 9 4 8 6 2

2 8 3 6 7 5 4 1 9

1 2 6 5 8 3 7 9 4

9 4 5 7 2 1 3 8 6

7 3 8 9 4 6 1 2 5

perolehan kursi di parlemen sudah disepakati antar fraksi melalui lobi-lobi pada Rabu malam. “Jadi soal PT sebesar 3,5 persen, jumlah alokasi kursi (3-8 kursi) per daerah pemilihan dan jumlah daerah pemilihan tak perlu divoting lagi,” kata Romahurmuziy. Namun, usai voting terkait sistem penghitungan suara, fraksi Golkar mengusulkan agar masalah PT, jumlah alokasi kursi per dapil dan jumlah dapil harus ditinjau ulang lagi.

30 Kali Gempa ....

15.38.29 WIB, berkekuatan 8,5 SR dan 8,1 SR pukul 15.38.33 WIB. Dua gempa rentetan tersebut dirasakan sekitar lima menit. Sedangkan kekuatan yang dirasakan berkisar 6 hingga 7 Mercalli Modify Intensity (MMI). “Setelah dua rentetan gempa tersebut juga terjadi dua rentetan gempa besar pada pukul 17.43.06 WIB dan 17.43.11 WIB dengan kekuatan yang sama, yakni 8,1 SR,” katanya. Menurut dia, rata-rata pusat gempa dan gempa susulan tersebut terjadi di kedalaman 10 kilometer di bawah permukaan laut. Episentrum atau pusat utama terjadi di 2,31 Lintang Utara, 92,67 Bujur Timur. Episentrum gempa terse-

Gempa Aceh ....

rusak ringan. Saat masa panik pascagempa, sejumlah warga kota mengungsi ke sejumlah titik di pinggiran Banda Aceh, seperti Masjid Unsyiah, Gampong Mireuk Lamreudeup, TVRI Geu Gajah, Blang Bintang, Lhoknya dan Lambadeuk di kawasan Aceh Besar. “Semua warga yang mengungsi tersebut sudah kembali ke rumah,” ungkap Asmadi yang menyebutkan BPBA dalam upaya penanganan dan tindakan yang dilakukan mendirikan tenda darurat di Lambadeuk, Aceh Besar. Asmadi melaporkan, Pemerintah Aceh melalui BPBA telah melaksanakan penanganan kedaruratan bencana dengan baik, yakni memberikan pertolongan penyelamatan dan evakuasi termasuk pemenuhan dasar pengungsi. Selain melakukan rencana tindak lanjut setelah melakukan pemantauan di beberapa lokasi gempa, tim reaksi cepat BPBA juga melakukan pertemuan dengan instansi terkait membahas penanganan bencana tersebut. “Kita minta BPBD kabupaten/kota segera memverifikasi kerusakan dan besarnya kerugian untuk menentukan kategori jumlah bangunan yang hancur, rusak berat dan ringan mengingat bentuk bangunan dan ukuran serta usaha modal yang bervariasi,” katanya. Tinjau TEWS Wakil Presiden Republik Indonesia, Boediono, hari ini, Jumat (13/4) dijadwalkan tiba di Banda Aceh untuk melakukan kunjungan kerja. Selain pertemuan, Wapres juga akan

Al Bayan ....

yang sejati? Kemenangan yang tak terkalahkan lagi?”. Kata seorang guru pada muridnya. “M a u , t u n j u k k a n w a h a i Syaikhuna,,” pinta muridnya. Sang gurupun membaca ayat Allah SWT: Sesungguhnya beruntunglah orang-orang yang beriman, (yaitu) orangorang yang khusyu’ dalam shalatnya, dan orang-orang yang menjauhkan diri dari (perbuatan dan perkataan) yang tiada berguna, dan orang-orang yang menunaikan zakat, dan orang-orang yang menjaga kemaluannya, kecuali terhadap istri-istri mereka atau budak yang mereka miliki. Maka Sesungguhnya mereka dalam hal ini tiada terceIa. (QS.Mukminun ayat: 1-6). Beruntung itu adalah kemenangan. Kemenangan aba-

WASPADA Jumat 13 April 2012

Bendera Bintang Bulan Berkibar Di Aceh Utara LHOKSEUMAWE (Waspada): Tiga lembar bendera bintang bulan, Kamis (12/ 4) pagi, ditemukan berkibar di kawasan sawah Simpang Cot Matahe Kecamatan Syamtalira Bayu, Aceh Utara. Dua lembar diikat di pucuk pohon kapas dan satu lembar diikat di pela-pah rumbiyah. Tiga lembar bendera setelah didapatkan warga kemudian dilaporkan ke Polsek Kecamatan Bayu. Sekitar pukul

10:00, tiga lembar bendera diturunkan anggota Polsek setempat dan diamanakan ke Mapolsek. Juru Bicara Partai AcehWilayah Samudera Pasai Nasrullah Dahlawy mengatakan kepada Waspada, dirinya mendapat informasi adanya tiga lembar bendera yang dinaikan di kawasan itu. Pihaknya meminta supaya polisi mengusut siapa yang menaikan bendera bintang bulan tersebut. “Itu jelas tindakan provo-

kator yang ingin mengacaukan suasana Aceh pasca Pilkada. Kita berharap supaya masyarakat tak terprovokasi dengan ulah segelintir orang, Provinsi Aceh tetap dalam NKRI. Harap saya tak ada lagi yang melakukan hal demikian,” cetusnya. Sementara itu Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kasat Reskrim AKP Galih Indra Giri menyebutkan, bendera tersebut kini sudah diamankan. (cmk/b19)

Jaksa Tahan ....

Aprianto dinyatakan positif menggunakan narkoba berdasarkan surat Laboratoraium dan Forensik (Labfor) Mabes Polri Cabang Medan bernomor Lab: 864/NMF/2012 tertanggal 22 Februari 2012, yang menyebutkan urinenya mengandung jenis flunitrazepam, yang termasuk dalam psikotropika golongan III. Akibat kasusnya tersebut Aprianto dimutasi ke Bidang Propam Polda Sumut. Sekedar mengingatkan, Apriyanto tersandung kasus narkoba setelah petugas Direktorat Narkoba merazia Diskotek Paramount Jl. Putri

Merak Jingga Medan, Sabtu 11 Februari 2012. Polisi menangkap Sri Agustina, Jhonson Jingga, selaku pemilik tempat hiburan itu, serta waitress Ade Hendrawan setelah ditemukan delapan butir pil happy five (H5) dari tanganJhonson. Dalam pemeriksaan diketahui, Ade yang menerima dan memberikan happy five (H5) sesuai pesanan dari AKBP Aprianto. Beberapa hari setelah razia, Aprianto pun dicopot dari jabatannya demi netralitas penanganan kasusnya dan telah diperiksa sebagai saksi di Ruang SubdirektoratNarkoba Polda Sumut, Rabu (22/2). (m38)

Gus Irawan ....

Menurutnya, tidak ada acara formal dalam pertemuan itu. Apalagi begitu datang Gus Irawan langsung shalat berjamaah dengan berbagai kalangan yang hadir di tempat itu dan dilanjutkan dengan makan malam bersama. “Saya minta nasihat, berdiskusi tentang agama, mendengar lebih dekat kondisi Tuan Guru. Semua dikemas biasa. Tidak ada yang istimewa,” jelasnya. Diskusi panjang lebar tentang keislaman, ketuhanan, kepribadian dan berbagai pokok fikiran dari Tuan Guru Babussalam, menurut Gus Irawan, perlu didengarkan. Acara itu kemudian ditutup dengan penyerahan bantuan kepada Bumi Tareqat Naqsyabandiyah Desa Babussalam. “Bantuan ini bukan dilihat dari jumlahnya. Tapi saya sangat bangga bisa berada di hadapan Tuan Guru Babussalam dan jamaah yang ada di sini untuk berdikusi dan bersilaturrahmi,” kata Gus Irawan. (m06)

ketiga tersangka lainnya,” ujar Riki Septa Tarigan, Kasi Pidana Umum Kejari Medan Kamis (12/4). Riki mengatakan pihaknya juga melakukan penahanan terhadap tiga tersangka lainnya yaitu Sri Agustina, Jhonson Jingga dan Ade Hendrawan. Selama ini, penyidik Direktorat Reserse Narkoba Poldasu tidak melakukan penahanan terhadap Apriyanto dengan alasan sakit sehingga dirawat di Rumah Sakit Bunda Thamrin di Jl. Sei Batanghari Medan. Sebelumnya, Aprianto diperiksa di Subdirektorat I Narkoba Poldasu, Rabu 22 Februari 2012 sebagai saksi. Pada Jumat (24/2),dia dinyatakan positif mengonsumsi narkoba jenis psikotropika sesuai hasil tes urine. but berada 382 kilometer barat daya Pulau Simeulue, Provinsi Aceh. Sedangkan pusat gempa susulannya terjadi dengan rentang jarak 237 hingga 705 kilometer barat daya Pulau Simeulue. “Gempa ini sempat memicu tsunami di Simeulue sekitar 80 centimeter, Aceh Barat sekitar 30 centimeter, dan Banda Aceh serta Sabang sekitar 20 centimeter,” katanya. Menurut dia, kendati gempa tersebut berkekuatan besar, namun tidak memicu tsunami besar seperti 26 Desember 2004 karena getaran gempa tektonik Rabu (11/4) tersebut bersifat horizontal. “Biasanya, setelah gempa besar, kekuatan gempa susulannya semakin kecil. Namun, kapan terjadinya gempa dan berapa kekuatannya tidak bisa diprediksi,” kata Syahnan.

Babussalam Syech H Hasyim All Syarwani di Bumi Tareqat Naqsyabandiyah Desa Babussalam, Kecamatan Padang Tualang Kabupaten Langkat, kemarin malam. Dalam suasana penuh keakraban, hadir juga di situ jamaah Majlis Taklim Salafiah As-Syafi’iyah, Pulo Brayan Medan yang dipimpin langsung KH H Najaruddin Lubis. Pada silaturahmi tersebut Gus Irawan juga berkesempatan shalat berjamaah bersama jamaah Tareqat Naqsyabandiyah Desa Babussalam dan jamaah Majlis Taklim Salafiah As-Syafi’iyah. Menurut Gus Irawan, pertemuan itu hanya silaturrahmi biasa. Dia juga mohon doa restu untuk ikut mencalonkan diri menjadi gubernur Sumut pada periode mendatang. “Ini silaturrahmi biasa. Sebagai orang yang sangat memahami Islam saya fikir banyak ilmu dan nasihat yang bisa saya dengar dari beliau,” kata Gus Irawan.

meninjau TEWS (Tsunami Early Warning System) di Ulee Lheu. Informasi yang diperoleh Waspada, Kamis (12/4) Wapres Boediono bersama rombongan yang mendarat di Lanud SIM, Blang Bintang, Aceh Besar, langsung menuju Meuligo Gubernur untuk mengikuti pertemuan dengan Pj. Gubernur Tarmizi A. Karim bersama Muspida Aceh. Usai pertemuan dengan pimpinan Muspida Aceh, Wapres Boediono bersama rombongan akan melakukan peninjauan sebuah lokasi Tsunami Early Warning System (TEWS) di Ulee Lheu, Banda Aceh dan selanjutnya kembali ke Jakarta dengan pesawat khusus. Pesisir Selatan Laporan lain yang diterima Waspada dari Pj Bupati Abdya Azhari Hasan menyebutkan ada ribuan warga yang mengungsi ke sejumlah titik lokasi, umumnya warga tetap bertahan dan memilih tetap bermalam di lokasi pengungsian akibat adanya gempa susulan yang dirasakan hingga beberapa kali, namun sejak Kamis (12/4) pagi para pengungsi dilaporkan sudah mulai kembali ke rumah mereka masingmasing. “Sesuai laporan ketua BPBD Abdya, sampai pukul 24:00 ada warga yang memilih tetap bertahan di sejumlah titik pengungsian, mereka masih takut untuk kembali ke rumah, kita juga sudah berikan bantuan berupa makan dan fasilitas air bersih, sejauh ini tidak ada laporan adanya kerusakan, kita masih akan terus memantau dan melakukan pendataan,” jelas Pj Bupati Azhari Hasan.

Sementara itu Komandan Kodim 0110 Abdya Letkol Arm E.Dwi Karyono AS kepada Waspada juga melaporkan belum adanya temuan kerusakan akibat gempa yang terjadi Rabu (11/4). “Sementara belum ada laporan adanya kerusakan, namun kita masih terus melakukan monitoring ke sejumlah lokasi yang kita nilai rentan bencana, seperti di pesisir pantai dan beberapa titik lainnya, kita bersama beberapa elemen lainnya seperti RAPI (radio antar penduduk indonesia) dan sejumlah satgas terus siaga menghadapi kondisi ini,” sebut Dandim. Dari Aceh Selatan hasil pantauan Waspada sepanjang Kamis kemarin, aktivitas warga di daerah penghasil pala itu kembali normal. “Proses belajar mengajar tetap berjalan, meski hanya beberapa murid saja yang tidak hadir, karena trauma ketika lari menyelamatkan diri ke gunung kemarin,”ucap Samida Laila, 50, guru SMP 2 Tapaktuan. Hal serupa juga diakui para dewan guru di SMU 1,SMU 2, SMU Unggul, SMP 1 dan sejumlah SD lainnya, termasuk SD 9 berlantai 2 di Simpang Empat Kedai Aru Tapaktuan. Kepala Dinas Pendidikan Aceh Selatan H Karman,SE secara terpisah juga mengakui hingga saat ini belum ada ekses dari gempa yang terjadi Rabu kemarin. Meski sebagian murid mengalami trauma, namun proses belajar mengajar hendaknya tidak terganggu, mengingat Ujian Nasional (UN) telah di ambang pintu. Kondisi Aceh Singkil kembali normal pasca gempa, Rabu (11/4) dampak gempa

di yang akan dianugerahkan Allah untuk hamba-hambaNya di dunia dan di akhirat kelak. Maka ketika Muazzin menyerukan “Haiya alashShalah!” (Mari mencari kemenangan!) bersegeralah ke mushalla. Allah SWT. akan memberi kemenangan yang sangat sejati kepada orangorang yang mengutamakan seruan-Nya. Juara-juara di jalan Allah ini tidak akan tetipu dengan “hijau kemilaunya dunia”. Akhirat lebih mereka utamakan, sebab neger i akhirat itu abadi. Di sana cuma ada dua tempat, surga dan neraka. Mereka mempersiapkan diri di dunia untuk meraih surga yang penuh nikmat. Di ujung Surah Ar-Rahman Allah yang Mahaagung menggambarkan pahala yang akan dinikmati oleh peraih piala kemenangan sejati. Para

penghuni surga kekal dan abadi. Dalam surga itu ada piala-piala, bantal bersulam, kasur nan empuk, kamar dan minuman yang khamar, buahbuahan, kurma, delima, pisang, ditemani bidadaribidadari yang baik- baik lagi cantik, yang bermata jelita, putih bersih, dipingit dalam rumah. Mereka tidak pernah disentuh oleh manusia sebelum mereka (penghuni-penghuni surga yang menjadi suami mereka), dan tidak pula oleh jin. Sang kekasih bidadari bertelekan pada bantal-bantal yang hijau dan permadanipermadani yang indah. Maka nikmat Tuhan kamu yang manakah yang kamu dustakan? Maha Agung nama Tuhanmu yang mempunyai kebesaran dan karunia.

8, 5 SR yang sempat menyebabkan ribuan warga lari menyelamatkan diri mencari tempat aman. Ribuan warga yang tinggal di Singkil dan perkampungan lain dipesisir pantai Selatan Aceh itu berupaya melarikan diri karena takut terjadi Tsunami, hal itu dikuatkan peringatan dari BMKG. Warga Singkil disebutkan memanfaatkan jalan mitigasi (jalan pintas) dari Singkil menuju Kampung Sebatang, Tanah Merah dan Rimo, wilay a h k e c a m a t a n Gu n u n g Meriah, Aceh Singkil. Jalan tersebut dibangun pasca gempa Maret 2005 lalu untuk jalan mitigasi karena ruas tersebut membuat jarak dari Singkil menuju Rimo lebih dekat. (b06/cb05/b30/b27)

Ada-ada Saja ....

gaji unik yang dibayarkan kepada mereka. Namun, sejumlah guru di negara bagian Bukhara, mengatakan bahwa mereka mener ima ayam tersebut karena terpaksa. “Kami dipaksa menerima masing-masing 10 ayam,” ujar seorang guru bernama Odil. “Satu ayam (impor dari Serbia) dihargai sekira 5,5 som (Rp27 ribu)… Ayam lokal harganya lebih murah, tapi kami tidak mempunyai pilihan lain.” Pejabat pemerintah setempat membantah bahwa pembayaran gaji dengan ayam tersebut merupakan kebijakan yang sangat sukses, dan menambahkan bahwa mereka akan memperluas kebijakan mereka ke kawasan lain di negara tesebut. Tidak cuma itu, pejabat pusat di Uzbek juga tengah mencari ganti pengeluaran biaya pemerintah dengan bentuk pemberian hewan ternak, seperti dilaporkan Radio Liberty yang dilansir Rianovosti, Kamis (12/4). Laporan tersebut mengatakan, para pegawai sipil di kawasan itu telah menerima 20.000 ekor ayam, dan sisanya sebanyak 40.000 ekor lagi akan diserahkan dalam beberapa bulan mendatang. Para ahli mengatakan, pemerintah Uzbekistan tengah mencari cara untuk memangkas biaya pengeluaran akibat mengalami defisit. Gaji ratarata perbulan pegawai sipil di ibukota Tashkent, berkisar hingga US$320 atau sekira Rp2.750.000. Sedangkan di kawasan lainnya gaji tersebut lebih sedikit, yaitu hanya US$100 (Rp900 ribu) perbulan, menurut data resmi pemerintah. (rzl)

Waspada/Surya Efendi

REGU khusus TNI AD bersenjata lengkap menyelamatkan Wapres dalam gladi dan simulasi di halaman Masjid Raya Al Mashun Medan, Kamis (12/4).

1.050 Personel Amankan Kunjungan Wapres Di K. Namu L U B U K P A K A M (Waspada): Sebanyak 1.050 personel terdiri dari polisi, TNI dan Muspida Deliserdang siap mengamankan kunjungan Wakil Presiden RI Boediono di Bandara Kualanamu, Jumat (13/4). Wabup Deliserdang Zainuddin Mars menyebutkan, sebanyak 1050 staf dari Pemkab Deliserdang, terdiri atas jajaran SKPD dan kecamatan. “Kita turunkan jajaran SKPD, Satpol PP dan kecamatan untuk mengamankan Wapres Boediono, serta Polres Deliserdang 650 personel dan Kodim 0204/DS 200 personel,” kata Wabup didampingi Penanggung Jawab Dandim 0204/DS

Letkol Arh Wawik Dwinanto dan Kapolres AKBP.Wawan Munawar kepada wartawan usai menjadi Irup pengamanan Wapres RI di Mapolres Deliserdang Jl. Sudirman Lubukpakam. “Kita harapkan, kunjungan Wapres berjalan aman hingga selesai, karena ini sudah menjadi tugas dan tanggung jawab kita sebagai tuan rumah dari Kab. Deliserdang,” ujarnya. Kapolres Deliserdang AKBP Wawan Munawar melalui Humas AKP Abdul Hamid mengatakan apel ini untuk persiapan pengamanan Wapres Boediono. “Kita melaksanakan apel gabungan

terdiri atas unsur Muspida Plus, Polri, TNI untuk persiapan kedatangan Wapres Boediono ke BandaraKualanamu,” tandas Hamid. Paspampres Dan Sekda Usai apel gabungan siang hingga sore kemarin di areal Bandara Kualanamu, tim Pasukan Pengamanan Presiden (Paspampres) dan Sekda Deliserdang Azwar S melakukan koordinasi persiapan tempat paparan Wapres di dalam terminal Bandara Kualanamu. Kordinasi melibatkan pimpinan Project Implementation Unit (PIU) PT Angkasapura II Ir. Joko Waskito dan Kasi Humas, Hukum dan Umum Wisnu BS. (m16)

Pasca Gempa....

satu tiga orang saja yang datang, setelah itu kami mengizinkan mereka pulang lagi,” katanya. Menurutnya, pasca kejadian gempa kemarin, para orang tua masih takut akan gempa susulan, sehingga masih enggan untuk melepas anaknya ke sekolah. Bahkan bukan saja murid yang tidak datang sebagian guru juga

tidak hadir ke sekolah . Namun, sebagian sekolah di Banda Aceh ada yang tetap melakukan aktivitas belajar mengajar seperti SMA 1 dan SMP 1 Banda Aceh. Bukan saja di sekolahan, namun juga di kantor pemerintahan seperti kantor wali kota Banda Aceh dan dinas setempat terlihat sepi karena para pegawai tidak hadir. (cb01)

34 Napi Sigli ....

kabur karena memang sengaja oleh pihak rutan. Hal itu guna mencegah amuk penghuni rutan saat gempa 8,5 SR, Rabu petang. “Ini sangat situasional karena napi yang naik ke batang asam dalam komplek rutan sudah berteriak air naik. Mereka memantau kea rah laut apalagi ada gempa susulan pukul 17.45,”jelasnya. Menurut Joko, seluruh napi belum kembali sebahagian besar yang tersangkut kasus narkoba disamping kasus pencurian dan pembunuhan. Dikatakan ke 33 orang itu terdiri 18 napi dan 15 tahanan titipan kepolisian, jaksa dan pengadilan Negeri Pidie. “Kita memeinta mereka kembali dengan kesadaran sebelum batas waktu tersebut habis. Kamis eudah berkordinasi dengan pihak terkait,”harap Djoko. Belum diketahui kapan peningkatan status sebagai napi maupun tahanan kabur itu ditetapkan terhadap 33 orang penghuni rutan yang belum kembali. Djoko menyebutkan masih berkordinasi dengan kepolisian. Tembok LP Runtuh Sementara akibat gempa itu juga tembok Lapas Banda

Aceh yang terletak di Gampong Bineh Blang, Pagar Air, Kecamatan Ingin Jaya runtuh sepanjang 100 meter. Menurut Jauhar, walaupun tembok belakang itu runtuh, namun dari 479 napi dan tahanan yang ada di Lapas Klas II A Banda Aceh, itu tidak ada yang kabur. “Sekarang bagian tembok yang runtuh itu dijaga pihak aparat keamanan,” tuturnya. Kata dia, pada saat terjadi gempa para napi itu sedang istirahat di luar sel dan kemudian mereka seluruhnya di tempatkan pada lokasi aman di lapangan bola, di tengahtengah LP. Kecuali itu, Jauhar juga menyebutkan, akibat runtuhnya Lapas Banda Aceh, maka pada bagian kiri tembok lapas, tidak bisa digunakan lagi dan harus terpaksa dirubuhkan. Untuk itu, sebut Jauhar, pihaknya kini sedang menyusun berapa anggaran yang dibutuhkan untuk membangun tembok Lapas Banda Aceh tersebut, yang akan disampaikan ke Menteri Hukum dan HAM RI dan Pemerintah Aceh. “Kami belum tahu berapa kerugiannya,” sebut Jauhar. (b02/cb06)

berjumlah 15 orang. “Sebelum memulangkan siswa, terlebih dulu guru dan pengawas melakukan musyawarah kemudian baru mengizinkan pulang,’ katanya. Sementara salah seorang guru di SD 2 Banda Aceh Irwan menyebutkan, sejak pukul 07:30, para murid tidak banyak yang datang kesekolah, “Ada kesadarannya sendiri dan juga diantar oleh keluarganya. Kini tersisa 34 orang napi lagi yang belum kembali,’’ papar Jauhar. Petugas kepolisain kini sedang mencari keberadaan napi yang kabur tersebut. Dikatakan, para napi setelah terjadi gempa pertama semuanya dipusatkan pada tempat yang aman di dalam rutan. Namun, setelah terjadi gempa kedua itulah membuat napi dan petugas rutan mulai panik dan berhamburan keluar menyelamatkan diri, apalagi ada isu akan muncul gelombang tsunami. Adapun kapasitas rutan benteng Sigli, itu sebanyak 221 napi dan tahanan. Ultimatum Napi Sementara Kepala Rumah Tahanan Klas II B Pidie, Joko Budi Setianto menyatakan, pihaknya memberi waktu 1 x 24 jam kepada para tahanan dan narapidana yang belum kembali. “Protap dari kepolisian satu kali dua empat jam. Meski demikian kita telah berkordinasi dengan pihak terkait untuk mencari,” katanya kepada wartawan, Kamis (12/4). Menurut Joko seluruh ke 33 Napi tidak dapat dikatakan

Berita Utama


Gempa Tak Pengaruhi Penghitungan

Mantan Pj. Wali Kota T.Balai Diperiksa Kejaksaan TANJUNGBALAI (Waspada): Mantan Pj.Wali Kota Tanjungbalai, HSN kembali diperiksa di Kejaksaan Negeri Tanjungbalai, Kamis (12/4), terkait dugaan penyimpangan proyek rehabilitasi dan rekonstruksi pasca bencana alam Di Asahan TA 2009 senilai Rp 8,1 miliar. HSN dipanggil dan dimintai keterangan karena statusnya ketika itu sebagai kuasa pengguna anggaran atau Kadis Pekerjaan Umum Asahan, saat kegiatan tersebut berlangsung. Dia menjalani pemeriksaan sejak pukul 09:00-13:00. Pada pukul 14:30, HSN kembali memasuki ruangan Kasi Pidana Khusus guna melanjutkan pemeriksaan. Kajari Tanjungbalai Edi Winarto melalui Kasi Pidana Khusus Akhmad EP Hasibuan, membenarkan pemeriksaan terhadap HSN “ Ada 35 pertanyaan yang diberikan kepadanya,” kata Hasibuan. Pemanggilan dan pemeriksaan itu, bukan kali pertama. Pada 9 Januari 2011, lanjut Hasibuan, HSN diperiksa dalam kasus yang sama berdasarkan hasil lidik. “ Dan, hari ini, statusnya masih saksi,” jelas Hasibuan dan menambahkan, tim Penyidik Kejaksaan telah memanggil sejumlah pihak terkait, di antaranya PPTK AM, pengawas, bendahara N dan Ketua Panitia Lelang Ap. Disebutkan, berdasarkan hasil penyelidikan sementara, dugaan penyimpangan kegiatan rehabilitasi dan rekonstruksi pasca bencana alam Kab.Asahan APBN TA 2009, menimbulkan kerugian negara sebesar Rp 745.329.943. “ Jumlahnya 25 kegiatan dengan total anggaran Rp 8,1 miliar, tapi baru 4 kegiatan yang diperiksa, itupun sudah ditemukan kerugian negara sebesar Rp 745 juta,” jelas Hasibuan. Informasi dihimpun Waspada, proyek rehabilitasi dan rekonstruksi pasca bencana alam TA 2009 di Kab.Asahan senilai Rp 8,1 miliar, terdiri dari 25 paket pekerjaan yang tersebar di Kec. Simpangempat, Telukdalam dan Pulaurakyat. Sebanyak 25 kegiatan itu antara lain rekonstruksi badan jalan dan pemasangan tembok penahan pada ruas jalan Simpangempat Bondar Jaksa dengan nilai kontrak Rp 780.120.000, dikerjakan CV.Sekar Bhumi. Rekonstruksi badan jalan dari Pasar 1 menuju Seilebah Kec. Seikepayang dikerjakan CV. Dian Wira Putra dengan nilai kontrak Rp 880.311.000. (a14)

Jaksa Tahan Mantan ... tersangka lainnya,” ujar Riki Septa Tarigan, Kasi Pidana Umum Kejari Medan Kamis (12/4). Riki mengatakan pihaknya juga melakukan penahanan terhadap tiga tersangka lainnya yaitu Sri Agustina, Jhonson Jingga dan Ade Hendrawan. Selama ini, penyidik Direktorat Reserse Narkoba Poldasu tidak melakukan penahanan terhadap Apriyanto dengan alasan sakit sehingga dirawat di Rumah Sakit Bunda Thamrin di Jl. Sei Batanghari Medan. Sebelumnya, Aprianto diperiksa di Subdirektorat I Narkoba Poldasu, Rabu 22 Februari 2012 sebagai saksi. Pada Jumat (24/2),dia dinyatakan positif mengonsumsi narkoba jenis psikotropika sesuai hasil tes urine. Aprianto dinyatakan positif menggunakan narkoba berdasarkan surat Laboratoraium dan Forensik (Labfor) Mabes Polri Cabang Medan bernomor Lab: 864/NMF/2012 tertanggal 22

Hujan Es Guyur ... Seorang petani jeruk di Kabanjahe kepada Waspada mengatakan, hujan es dapat mengakibatkan kerusakan pada tanaman dan bakal terjadi gagal penen. Es yang turun bersama air hujan membuat tanaman jenis holtikultura bakal mati .Hujan esjugadapatmerusakbuahjeruk. Kepala Dinas Pertanian

Gus Irawan ... Menurut Gus Irawan, pertemuan itu hanya silaturrahmi biasa. Dia juga mohon doa restu untuk ikut mencalonkan diri menjadi gubernur Sumut pada periode mendatang. “Ini silaturrahmi biasa. Sebagai orang yang sangat memahami Islam saya fikir banyak ilmu dan nasihat yang bisa saya dengar dari beliau,” kata Gus Irawan. Menurutnya, tidak ada acara formal dalam pertemuan itu. Apalagi begitu datang Gus Irawan langsung shalat berjamaah dengan berbagai kalangan yang hadir di tempat itu dan dilanjutkan dengan makan malam

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport.

Februari 2012, yang menyebutkan urinenya mengandung jenis flunitrazepam, yang termasuk dalam psikotropika golongan III. Akibat kasusnya tersebut Aprianto dimutasi ke Bidang Propam Polda Sumut. Apriyanto tersandung kasus narkoba setelah petugas Direktorat Narkoba merazia Diskotek Paramount Jl. Putri Merak Jingga Medan, Sabtu 11 Februari 2012. Polisi menangkap Sri Agustina, Jhonson Jingga, selaku pemilik tempat hiburan itu, serta waitress Ade Hendrawan setelah ditemukan delapan butirpil happy five (H5) dari tangan Jhonson. Dalam pemeriksaan diketahui, Ade yang menerima dan memberikan happy five (H5) sesuai pesanan dari AKBP Aprianto. Beberapa hari setelah razia, Aprianto pun dicopot dari jabatannya demi netralitas penanganan kasusnya dan telah diperiksa sebagai saksi di Ruang SubdirektoratNarkoba Polda Sumut, Rabu (22/2). (m38) Agustoni Tarigan melalui Kabid Produksi Munarta Ginting kepada Waspada mengatakan, tanaman yang terkena hujan es kurang baik pertumbuhannya, sehingga para petani dianjurkan segera melakukan pemupukan. ‘’Kita dari Dinas Pertanian Kab. Karo akan memerintahkan KUPT pertanian kecamatan, PHP dan PPL untuk melakukan pendataan luas areal tanaman yang terkena hujan es. (c10) bersama. “Saya minta nasihat, berdiskusi tentang agama, mendengar lebih dekat kondisi Tuan Guru. Semua dikemas biasa. Tidak ada yang istimewa,” jelasnya. Diskusi panjang lebar tentang keislaman, ketuhanan, kepribadian dan berbagai pokok fikiran dari Tuan Guru Babussalam, menurut Gus Irawan, perlu didengarkan. Acara itu kemudian ditutup dengan penyerahan bantuan kepada Bumi Tareqat Naqsyabandiyah Desa Babussalam. “Bantuan ini bukan dilihat dari jumlahnya. Tapi saya sangat bangga bisa berada di hadapan Tuan Guru Babussalam dan jamaah yang ada di sini untuk berdikusi dan bersilaturrahmi,” kata Gus Irawan. (m06)

Ada-ada Saja ...

mereka. Namun, sejumlah guru di negara bagian Bukhara, mengatakan bahwa mereka menerima ayam tersebut karena terpaksa. “Kami dipaksa mene1. Re3+. Kd3. rima masing-masing 10 ayam,” ujar seorang guru bernama Odil. 2. GxK+mat. “Satu ayam (impor dari Serbia) dihargai sekira 5,5 som (Rp27 ribu)… Ayam lokal hargaJawaban TTS: nya lebih murah, tapi kami tidak TTS Topik Mimbar Jumat mempunyai pilihan lain.” Pejabat pemerintah setemY A R M U K K H A L I D pat membantah bahwa pembaA U H A yaran gaji dengan ayam tersebut merupakan kebijakan yang H E R A C L I U S H A M K A sangat sukses, dan menambahL L A L U kan bahwa mereka akan memD I S N A D H A F S A H perluas kebijakan mereka ke I I K A kawasan lain di negara tesebut. I M A M Tidak cuma itu, pejabat puU K U K U M sat di Uzbek juga tengah menB Y Z A N T I U M S D cari ganti pengeluaran biaya peA U A K A U merintah dengan bentuk pemK H A L I F A H H A M A L berian hewan ternak, seperti dilaF S L B I porkan Radio Liberty yang dilansir Rianovosti, Kamis (12/4). M U I I A H A L A L Laporan tersebut mengataI K Y A S I N B L kan, para pegawai sipil di kawaU I A san itu telah menerima 20.000 U N T A A ekor ayam, dan sisanya sebaA R A H I M A H U L L A H nyak 40.000 ekor lagi akan diserahkan dalam beberapa bulan Jawaban Sudoku: mendatang. Para ahli mengatakan, pe8 3 4 6 5 2 1 9 7 merintah Uzbekistan tengah 7 6 5 9 1 8 2 4 3 mencari cara untuk memangkas biaya pengeluaran akibat 9 2 1 4 7 3 6 5 8 mengalami defisit. Gaji rata-rata 4 1 8 2 3 6 5 7 9 perbulan pegawai sipil di ibukota Tashkent, berkisar hingga 3 5 6 1 9 7 8 2 4 US$320 atau sekira Rp2.750.000. 2 7 9 8 4 5 3 1 6 Sedangkan di kawasan lainnya 6 9 2 5 8 4 7 3 1 gaji tersebut lebih sedikit, yaitu hanya US$100 (Rp900 ribu) per5 4 7 3 6 1 9 8 2 bulan, menurut data resmi pe1 8 3 7 2 9 4 6 5 merintah. (rzl)

Jawaban Problem Catur:

WASPADA Jumat 13 April 2012

Hasil Pilkada Aceh Diumumkan 15 April


AIR sungai Batangserangan meluap sampai merendam sebagain ruas Jalan Sudirman, Kec. Tanjungpura, Kamis (12/4).

Sungai Batangserangan Meluap, Kota Tanjungpura Terendam TANJUNGPURA (Waspada): Intensitas curah hujan yang cukup tinggi dalam beberapa hari terakhir membuat Sungai Batangserangan di Kec. Tanjungpura, Kab. Langkat, Kamis (12/4) siang meluap hingga merendam sebagian ke inti kota Jl. Sudirman. Menurut salah seorang war-

ga Kel. Pekan Tanjungpura, kemungkinanairsungaiakankembalinormal,bilamalaminicuacacerahdanhujantidakkembaliturun. “Meski luapan air tidak sampai merendam rumah, tapi apabila musim hujan warga di bantaransungaisangatkhawatirmengingat kondisi sungai saat ini sudah semakin dangkal,” kata war-

ga seraya meminta kepada pemerintah agar melakukan normalisasi sungai. Camat Tanjungpura, Nuriansyah, SSTP, yang dihubungi Waspada, Kamis petang menyatakan, sampai sejauh ini belum ada warga yang mengungsi. Menurut dia, kondisi air mulai surut. (a02/a03)

Ilmuwan Terkejut ...

liti Dr. Gegar P, Dr Semeidi dan Dr Widokonko terkait gempa tersebut. “Memang sumber gempa tidak biasa dan karena beradadi luar zona subduksi. Maka diduga tidak mengakibatkan rupture yang besar sehingga tsunami besar tidak terjadi, sekalipun tsunami terdeteksi di dua Tsunami Buoy (DART) yang dikelola NOAA,” ungkap Syamsidik.(Berita lengkap baca hal C-1)

Nias, Simeulue Aceh sudah aman atau tidak ada gempa besar dalam waktu dekat pascagempa di Aceh pada 2004 yang berujung pada tsunami dan Nias di 2005,” kata ahli geologi di Sumut Timbul Raya Manurung di Medan, Rabu. Gempa Simeulue yang cukup kuat hingga terasa di daerah lain Sumatra seperti Sumatera Utara dan Sumatera Barat harus dievaluasi lagi. Para ahli geologi diminta melakukan studi lagi kemungkinan percepatan pergerakan lempeng. Gempa yang kuat itu akan memicu kegiatan vulkanik di Bukit Barisan, kata Timbul yang alumni Fakultas Geologi Universitas Gajah Mada (UGM)Yogyakarta pada 1986 itu. “Harus ada kajian lebih mendalam lagi agar langkahlangkah pengamanan bisa dilakukan dan masyarakat bisa waspada,” katanya. (vvn/b06/ant)

tektonik bertabrakan dan menelusup di bawah lempeng yang lain, gempa Aceh terjadi di tengah lempeng samudera, di mana patahan atau sesar (fault) pada kerak bergerak menyamping, bukan naik turun. Tipe ini disebut gempa sesar geser atau strike-slip. “Gempa sesar geser tidak memiliki potensi bahaya seperti jika terjadi di zona subduksi. Sebab, lempeng bergerak satu sama lain,” kata Dutton, pada situs sains, Our Amazing Planet. Meski terkadang itu memicu longsor di dasar laut, tsunami dahsyat biasanya dipicu oleh gempa di zona subduksi — saat lempeng besar samudera tibatiba anjlok di bawah lempeng lainnya, menciptakan ruang besar di dasar laut. Perpindahan tiba-tiba lempeng itu juga mempengaruhi pergerakan air laut. Makin besar dan dramatis air laut bergerak mengisi ruang kosong itu, makin dahsyat tsunami yang diakibatkan. Hanya beberapa menit setelah gempa terjadi. Pacific Tsunami Warning Center (PTWC) di Hawaii mengeluarkan peringatan tsunami di Samudera Hindia. Di Sabang, daerah paling terdampak saat tsunami 2004, dilaporkan ombak tsunami setinggi kurang dari 1 meter terjadi. PTWC melaporkan, tsunami tertinggi yang ditimbulkan dari gempa kemarin adalah 1 meter. Tidak Biasa Dari Aceh, Dosen Fakultas Teknik Unsyiah Dr Syamsidik Thahir yang diminta tanggapannya menyebutkan gempa yang terjadi Rabu, tidak biasa karena berada di luar zona subduksi, sebagaimana analisa TDMRC Unsyiah dan pene-

5 Meninggal Akibat ... “Kita minta BPBD kabupaten/kota segera memverifikasi kerusakan dan besarnya kerugian untuk menentukan kategori jumlah bangunan yang hancur, rusak berat dan ringan mengingat bentuk bangunan dan ukuran serta usaha modal yang bervariasi,” katanya. Tidak Ada Korban Jiwa Di Sumut Sementara Pangdam I/BB Mayjen TNI Lodewijk F. Paulus mengatakan, gempa 8,5 SR yang berpusat 346 KM Barat Daya Sinabang – Kab. Simeulue Aceh tidak menimbulkan korban jiwa maupun kerusakan bangunan untuk wilayah Sumatera Utara. “Tida ada kerusakan.Ini ha-

Naskah UN ... Ia mengatakan penyebab kekurangan ini karena perhitungan yang kurang tepat pada saat proses pendistribusian naskah, mengingat banyaknya peserta yang mengikuti ujian. Sementara Kepala Dinas Pendidikan Sumatera Utara Syaiful Syafri mengatakan untuk pelaksanaan UN 2012 ini, pihaknya berkomitmen menciptakan UN jujur dan berprestasi. Tidak ada praktik guru membantu siswa

Mempercepat Gempa Besar Mentawai Gempa Simeulue berkekuatan 8,5 Skala Richter (SR) pada Rabu pukul 15:38 WIB diperkirakan memicu dan mempercepat gempa besar di lokasi yang belum ke luar energi besarnya yakni jalur Nias ke selatan atau Mentawai Enggano. “Jadi perlu diwaspadai, apalagi gempa di Simeulue dinilai aneh mengingat ahli geologi sebelumnya menggangap jalur

2.670 Personil TNI ... Pendopo Gubernuran, Hotel JW. Marriot dan sepanjang rute yang dilewati maupun rute cadangan dan rute pengganti. Personil pengamanan itu, katanya, untuk mengantisipasi setiap usaha yang dapat mengganggu kelancaran dan keamanan selama pelaksanaan kunjungan kerja Wapres di wilayah Provinsi Sumatera Utara. Sementara itu, Plt. Gubsu Gatot Pujo Nugroho mengajak warga Sumut untuk menghormati kedatangan Wapres sebagaimana ciri masyarakat Sumut. Terkait kunjungan Boediono ke Bandara Kualanamu, Gatot mengharapkan, kunjungan tersebut memberikan efek terhadap percepatan penyelesaian sil monitor kita pasca gempa di sepanjang Pesisir Selatan dan Kepulauan Mentawai, Nias dan Sibolga serta Padang,” kata Pangdam usai upacara siaga personil pengamanan di Lap. Benteng, Kamis (12/4), terkait kedatangan Wapres Boediono ke Sumatera Utara. Dikatakannya, awalnya ada rasa kekhawatiran tentang efek getaran gempa yang cukup kuat di kawasan pesisir. “Tetapi setelah dilakukan pengecekan, ternyata tidak ada korban jiwa maupun bangunan yang rusak atas kejadian tersebut,” ujar Pangdam I/BB. Pangdam I/BB menyatakan, dari informasi yang diperoleh, korban yang mengalami luka pasca gempa di Simeuleu yang selama ini kerap diisukan dalam pelaksanaannya. Begitu juga informasi adanya naskah UN bocor, ia memastikan bahwa tidak ada naskah asli soal UN yang beredar di tangan siswa, sebab seluruh proses pengawasannya dilakukan dengan ekstra ketat. Tahun ini UN di Sumut untuk tingkat SMA 101.740, MA 19.591, dan SMK 73.671 peserta dan pelaksanaan UN digelar 1619 April 2012 untuk SMA/MA dan SMK 16-18 April 2012.

Al Bayan ... Sang gurupun membaca ayat Allah SWT: Sesungguhnya beruntunglah orang-orang yang beriman, (yaitu) orang-orang yang khusyu’ dalam shalatnya, dan orang-orang yang menjauhkan diri dari (perbuatan dan perkataan) yang tiada berguna, dan orang-orang yang menunaikan zakat, dan orang-orang yang menjaga kemaluannya, kecuali terhadap istri-istri mereka atau budak yang mereka miliki. Maka Sesungguhnya mereka dalam hal ini tiada terceIa. (QS.Mukminun ayat: 1-6). Beruntung itu adalah kemenangan. Kemenangan abadi yang akan dianugerahkan Allah untuk hamba-hamba-Nya di dunia dan di akhirat kelak. Maka ketika Muazzin menyerukan “Haiya alash-Shalah!” (Mari mencari kemenangan!) bersegeralah ke mushalla. Allah SWT. akan memberi kemenangan yang sangat sejati kepada orangorang yang mengutamakan seruan-Nya. Juarajuara di jalan Allah ini tidak akan tetipu dengan “hijau kemilaunya dunia”. Akhirat lebih mere-

Bandara Kuala Namu. “Kita tahu penyelesaian Bandara Kuala Namu ini sudah menjadi mimpi masyarakat Sumut. Pasti kunjungan ini memberikan efek terhadap percepatan penyelesaian Bandara Kualanamu,” katanya. Gatot menambahkan,Wapres Boediono akan melaksanakan Shalat Jumat di Masjid Raya Medan. “Juga ada pertemuan dengan bupati dan walikota di Gubernur,” katanya. Pantauan Waspada, sejumlah aparat TNI dan Polri melakukan simulasi penyelematan Wapres di Masjid Raya Medan jika terjadi hal-hal yang tidak diinginkan. Sejumlah ruas jalan yang akan dilalui juga dijaga ketat dilengkapi dengan persenjataannya. (h02/m32/m16) hanya satu orang. “Sedangkan yang meninggal di Banda Aceh juga bukan karena gempa melainkan sakit jantung. Warga dan Pemda sudah ada prosedur tetap apabila terjadi gempa,” tegasnya. Namun, tambah Pangdam I/BB, pihaknya bersama Lanud tetap siap memberikan bantuan jika terjadi sesuatu di Aceh. Tinjau TEWS Wakil Presiden Boediono, hari ini, Jumat (13/4) dijadwalkan tiba di Banda Aceh untuk melakukan kunjungan kerja. Selain pertemuan, Wapres juga akan meninjau TEWS (Tsunami Early Warning System) di Ulee Lheu. Informasi yang diperoleh Waspada, Kamis (12/4) Wapres Boediono bersama rombongan yang mendarat di Lanud SIM, Blang Bintang, Aceh Besar, langsung menuju Meuligo Gubernur untuk mengikuti pertemuan dengan Pj. Gubernur Tarmizi A. Karim bersama Muspida Aceh. Usai pertemuan dengan pimpinan Muspida Aceh, Wapres Boediono bersama rombongan akan melakukan peninjauan sebuah lokasi Tsunami Early Warning System (TEWS) di Ulee Lheu, Banda Aceh dan selanjutnya kembali ke Jakarta dengan pesawat khusus. (b06/cb05/b30/b27/h02)

ka utamakan, sebab negeri akhirat itu abadi. Di sana cuma ada dua tempat, surga dan neraka. Mereka mempersiapkan diri di dunia untuk meraih surga yang penuh nikmat. Di ujung Surah Ar-Rahman Allah yang Mahaagung menggambarkan pahala yang akan dinikmati oleh peraih piala kemenangan sejati. Para penghuni surga kekal dan abadi. Dalam surga itu ada piala-piala, bantal bersulam, kasur nan empuk, kamar dan minuman yang khamar, buahbuahan, kurma, delima, pisang, ditemani bida-dari-bidadari yang baik- baik lagi cantik, yang bermata jelita, putih bersih, dipingit dalam rumah. Mereka tidak pernah disentuh oleh manusia sebelum mereka (penghuni-penghuni surga yang menjadi suami mereka), dan tidak pula oleh jin. Sang kekasih bidadari bertelekan pada bantal-bantal yang hijau dan permadani-permadani yang indah. Maka nikmat Tuhan kamu yang manakah yang kamu dustakan? Maha Agung nama Tuhanmu yang mempunyai kebesaran dan karunia.

BANDA ACEH (Waspada): Komisi Independen Pemilihan (KIP) Aceh menyatakan tahapan Pilkada Aceh tetap berjalan meski sempat terganggu akibat gempa berkekuatan 8,5 skala Richter (SR), Rabu (11/4). Saat ini KIP kabupaten/kota masih merekapitulasi suara hasil Pilkada Aceh 9 April. Wakil Ketua Komisi Independen Aceh Ilham Syahputra menyebutkan,gempatidakmempengaruhi proses perhitungan suara. Bahkan, kata dia, proses perhitungan suara di tingkat kecamatan telah selesai kemarin. “Kami masih menunggu hasil rekap suara dari Kabupaten/

kota. Sejauh ini tidak ada masalah,” katanya, Kamis (12/4). KIP Aceh masih melakukan perhitungan dan rekapitulasi suara secara manual. Rencananya hasil Pilkada Aceh akan diumumkan pada 15 April mendatang. “Jadwalkan tanggal 15 itu sudah selesai perhitungan di tingkat provinsi,” ujarnya. Dua gempa besar yang menguncang Aceh kemarin melumpuhkan aktivitas warga di seluruh wilayah. Setelah 8,5 SR, Aceh kembali digoyang gempa dalam hitungan jam. Warga berlarian menyelamatkan diri ke tempat-tempat yang dianggap aman, karena

Paripurna DPR ...

dari tiga fraksi yang kalah masih mengajukan interupsi terutama mengenai pasal pasal 208 dan 209 mengenai besaran “parliamentary threshold” yang kemudian diputuskan lagi melalui mekanisme voting. Pada voting mengenai besaran “parliamentary threshold” memilih dua opsi, yakni opsi A yakni memberlakukan “parliamentary threshold” 3,5 persen merata secara nasional. Kemudian, opsi B yakni memberlakukan“parliamentary threshold” secara berjenjang secara nasional, yakni 3,5 persen untuk DPR RI serta lima persen untuk DPRD provinsi dan DPRD kabupaten/kota. Dari hasil voting mengenai besaran “parliamentary threshold” opsi A didukung oleh 343 anggota DPR RI dari FPD, FPG, FPPP, FPKB, Fgerindra dan FHanura. Kemudian, opsi B didukung 197 anggota DPR RI dari FPDIP, FPKS dan FPAN. (ant/aya)

BANDA ACEH(Waspada): 34 Napi Rutan Benteng Sigli, Kab. Pidie belum kembali, dari 206 Napi yang kabur akibat isu muncul gelombang tsunami setelah terjadi gempa berkekuatan 8,5 SR mengguncang Aceh, Rabu (11/4). Demikian Kepala Divisi Kemasyarakatan Kanwil Kementerian Hukum dan HAM Prov. Aceh H. Jauhar Fardin, Bc.IP. SH. MH menjawab Waspada, Kamis (12/4). Kata dia, setelah terjadi gempa dan kemudian isu munculnya tsunami, maka bukan hanya napi yang panik, tapi petugas rutanjugapaniklari,berbarengan dengan masyarakat yang juga berlarian menyelamatkan diri. ‘’Tapi, alhamdulillah, sebagian napi telah kembali dengan kesadarannya sendiri dan juga diantar oleh keluarganya. Kini tersisa 34 orang napi lagi yang belum kembali,’’ papar Jauhar. Petugas kepolisain kini sedang mencari keberadaan napi yang kabur tersebut. Dikatakan, para napi setelah terjadi gempa pertama semuanya dipusatkan pada tempat yang aman di dalam rutan. Namun, setelahterjadigempakeduaitulah membuatnapidanpetugasrutan mulai panik dan berhamburan keluar menyelamatkan diri, apalagi ada isu akan muncul gelombang tsunami. (b02/cb06)

“Saya salut dengan anda,” kata Cameron. Tidak berhenti di situ saja, politikus dari Partai Konservatif tersebut mengucapkan kalimat bernada optimisme dalam pidatonya, “Indonesia mampu memimpin dunia”. Kalimat itu diucapkan PM Cameron hingga enam kali selama berpidato. Tentu saja ucapan PM Cameron tersebut disambut oleh riuh rendah tepuk tangan para tamu undangan, termasuk di antaranya Menteri Pendidikan dan Kebudayaan Muhammad Nuh, mantan Menteri Keuangan Fuad Bawazier dan mantan Menteri Pemuda dan Olahraga Adhyaksa Dault.

Kalimat tersebut dikatakan PM Cameron untuk menanggapi proses demokrasi di tanah air, yang menurut dia akan mencapai kesuksesannya jika Pemerintah Indonesia dapat mengatasi segala bentuk ancaman, seperti kekuasaan, korupsi dan konflik antarsuku. Indonesia ternyata menjadi rekan negara yang menarik bagi Inggris. Bukan hanya untuk berinvestasi di tanah air, tapi juga bahasa dan tradisi Indonesia memberikankesantersendiribagi Kepala Pemerintahan Britania Rayaitu.PMCamerontahudimana dia berada, sehingga dia berusaha menyesuaikan diri dengan tradisi dan Bahasa Indonesia.

bacok seorang dari dua pria itu hingga tewas di tempat dengan luka belah di perut.Kedua tangan dan kedua bola matanya menghitam karena dipukuli. Seorang pria lainnya kritis dan diselamatkan warga. Belum diketahui identias kedua pria yang menjadi korban tersebut.Sedangkan, jenazahnya dibiarkan warga terletak di jalan setelah semua temannya melarikan diri dengan menggunakan tujuh mobil yang tadinya membawa mereka. Satu lagi dibakar warga. Ketika terjadi penyerangan, tidak satupun polisi berada di lokasi. Padahal, sebelumnya setiap hari ada tiga orang polisi ditempatkan di daerah itu guna mengantisipasi terjadinya bentrok. “Kami heran juga, kenapa hari ini tidak ada satu orang polisi di sini. Padahal sebelumnya selalu ada.Kemarin saja, jumlah polisi yang jaga di sini banyak. Hari ini polisi baru datang setelah ada yang mati,” kata warga yang tidak ingin namanya disebut. Saat bertemu di lokasi, Lurah Kel. Sei Mati Kec Medan Labuhan Khairil Amri membenarkan, kedua korban dalam bentrokan itu bukan warganya dan

merupakan warga dari luar. “Yang mati ini bukan warga kita, dan saya belum tahu berasal dari mana,” katanya. Sedangkan, Kapolsek Medan Labuhan Kompol Sugeng Riyadi dan Kanit AKP Oktavianus yang dikonfirmasi, tidak bersedia memberikan keterangan. “Nanti ya, kami masih rapat,” kata Kapolsek singkat saat dihubungi melalui telefon. Bentrokan antara warga dan kelompok pria diduga suruhan PT MML terjadi Jumat (9/3). Ketika itu, seorang warga bernama Sab dan empat orang pria dari kelompok PT MML yakni Hendra, Heru dan T. Indra Jaya warga Jl. Dwikora mengalami luka pada bagian kepala setelah terkena lemparan batu dan senjata tajam. Bentrokan dipicu perebutan lahan seluas 315 antara PT MML dan warga yang telah belasan tahun menggarap lahan pertambakan udang tersebut. PT MML mengaku telah membeli semualahanitudarikeluargaRaja Inal Siregar, PTTirta dan PT LamhotmayangdbuktiandengansertifikatHakPenguasaanLahan(HPL) terbitantahun2011,dariBadanPertanahan Nasional (BPN). (h03)

adalah opsi cara penghitungan suara menjadi kursi parlemen. Voting ini dengan memilih opsi, yakni opsi A, mendukung sistem kuota murni, serta opsi B, mendukung sistem devisor webster. Voting dilakukan dengan cara masing-masing anggota fraksi yang mendukung opsi A agar berdiri dan kemudian dihitung suaranya. Demikian juga masing-masing anggota fraksi yang mendukung opsi B agar berdiri dan dihitung suaranya. Dari penghitungan suara opsi ini, pendukung opsi A sebanyak 342 anggota dari enam fraksi yakni FPD, FPAN, FPPP, FPKB, FGerindra dan Fraksi Hanura. Sedangkan opsi B, pendukungnya sebanyak 188 orang dari tiga fraksi yakni FPG, FPDIP, dan FPKS. Setelah voting mengenai cara penghitungan suara anggota

“Assalamualaikum” ... salam dari Bahasa Arab yang biasa digunakan oleh umat Muslim ketika bertemu orang lain. Dia mengucapkan kata salam tersebut sebanyak dua kali, termasuk ketika mengakhiri pidatonya. Ucapan salam PM Cameron pun disambut jawaban “waalaikumsalam” oleh para tamu undangan di kampus Universitas Islam ternama di Jakarta itu. Selain itu, PM David Cameron juga menyampaikan kekagumannya dalam Bahasa Indonesia ketika menanggapi proses demokrasi yang terjadi di tanah air.

Bentrokan Di Sei Mati, ... Informasi Waspada peroleh di lapangan, puluhan pria itu diduga merupakan suruhan PT Mandiri Makmur Lestari (MML) dalam upaya mengambil lahan pertambakan udang dan ikan seluas 315 hektare yang selama ini dikuasai warga. Semua pria yang belum diketahui asalnya itu datang ke lokasi menggunakan lima mobil angkutan kota (angkot) dan tiga mobil pribadi. Setelah di lokasi, seorang dari puluhan pria itu mengejar sambil menembaki warga. Untungnya, semua tembakan meleset. Sementara puluhan pria lainnya melakukan pengrusakan dan membakar pondok jaga tambak milik Wagiran dan Sulastri. Mendapat penyerangan itu, warga histeris dan berkumpul, kemudian melakukan serangan balasan. Warga menutup beberapa akses jalan keluar dari lokasi, sehingga puluhan pria itu terkepung sambil berusaha lari menyelamatkan diri. Dua dari puluhan pria itu terperangkap warga, kemudian keduanya dipukuli hingga babak belur. Tidak puas, warga mem-

khawatir terjadi tsunami, seperti yang pernah dirasakan masyarakat Aceh pada tahun 2004 silam. (vvn/m13)

34 Napi Sigli Yang Kabur Belum Kembali

WASPADA Jumat 13 April 2012

Medan Metropolitan


Jelang Dies Natalis Ke-25 Sekolah Tinggi Ilmu Komunikasi “Pembangunan”

Antusias Para Penderita Katarak MEDAN (Waspada): Bakti sosial berupa operasi katarak gratis, penyerahan kaki palsu dan alat bantu jalan yang akan digelar panitia Dies Natalis ke2 5 S e k o l a h Ti n g g i I l m u Komunikasi “Pembangunan” (STIK-P) bekerjasama dengan RSU Sari Mutiara, mendapat respon positif dari masyarakat. Hingga saat ini, ada sekitar 27 orang yang telah mendaftar ke sekretariat panitia di kampus STIK-P Jln. Sisingamangaraja No. 84 Medan. Mereka terdiri dari 26 penderita katarak dan satu orang penderita cacat yang membutuhkan bantuan kaki palsu. “Para penderita katarak ini tidak hanya datang dari Kota Medan, tetapi ada juga dari dae-

RSU SARI MUTIARA rah di sekitarnya seperti Binjai, Tanjungmorawa dan Lubukpakam,” kata Ketua STIK-P Hj. Ida Tumengkol, B.Comm, M. Hum diwakili Pembantu Ketua

II Suprapti Indah Putri, SP kepada Waspada, Rabu (11/4). Menurut Putri, para penderita katarak terlihat senang dan begitu antusias saat mendaftar-

Waspada/Arianda Tanjung

SEORANG penderia katarak mendaftarkan diri sekretariat panitia di kampus STIK-P.

kan diri ke kampus STIK-P. “Setelah mendaftarkan diri, mereka akan menjalani pemeriksaan dan diseleksi pada Kamis (19/ 4) hingga Sabtu (21/4) di kampus STIK-P. Bagi peserta yang memenuhi syarat untuk menjalani operasi, maka akan dirujuk ke RSU Sari Mutiara,” jelasnya. Putri juga mengimbau, kepada masyarakat yang ingin menjalani operasi katarak gratis, membutuhkan kaki palsu dan alat bantu jalan brisk walking agar secepatnya mendaftarkan diri ke STIK-P Medan Jln. Sisingamangaraja No. 84 Medan. Sementara itu, seorang penderita katarak asal Tanjungmorawa, Syampir Wijaya, 61, mengaku senang dengan adanya bakti sosial yang digelar STIK-P dan RSU Sari Mutiara ini. “Saya sangat terbantu dengan adanya operasi katarak gratis ini. Saya berharap bisa menjalani operasi katarak. Sebab, penyakit ini sangat menggangu saya dalam menjalankan aktivitas sehari-hari,” kata pensinan karyawan swasta ini. *Arianda Tanjung

PARFI Sumut Lakukan Persiapan MEDAN (Waspada): Persatuan Artis Film Indonesia (PARFI) Sumut telah melakukan berbagai persiapan menjelang pelaksanaan Festival Band dan Pemilihan Top Model dalam rangka Dies Natalis ke-25 Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P). Dukungan yang diberikan PARFI Sumut terhadap perhelatan akbar ini, memang tidak tanggung-tanggung. PARFI Sumut telah melobi bintang sinetron Elma Theana agar bersedia menjadi salah satu juri dalam Pemilihan Top Model. PARFI Sumut juga menjalin kerjasama dengan berbagai mitra guna menyemarakkan Festival Band tersebut. “PARFI Sumut telah ditunjuk oleh panitia Dies Natalis ke25 STIK-P sebagai mitra dan event organizer (EO) dalam Festival Band dan Pemilihan Top Model. Saat ini, kami terus berupaya melakukan berbagai persiapan guna memeriahkan acara tersebut, termasuk mempromosikan lomba ke berbagai daerah,” kata Ketua PARFI Sumut Erwin Norman Siregar (foto) kepada Waspada, Senin (9/4) malam. Kegiatan yang digelar panitia Dies Natalis ke-25 STIK-P ini, menurut Erwin, merupakan salah satu upaya membangkitkan talenta muda berbakat yang ada di Indonesia, khususnya Sumatera Utara. Sebagaimana diketahui, para remaja di daerah ini umumnya memiliki bakat yang luar biasa. Sayangnya, wadah untuk mengembangkan kreativitas tersebut masih sangat terbatas sehingga menjadi penghambat perkembangan mereka terutama di dunia model. Erwin menyatakan optimis bahwa Pemilihan Top Model yang akan digelar pada 26 - 27 Mei mendatang diikuti 200 peserta. Sebab, berdasarkan pengalaman PARFI Sumut yang telah menggelar berbagai even pemilihan model di Medan, peserta yang mendaftar mencapai 300 orang. Hal ini menunjukkan antusias remaja Medan untuk terjun ke dunia modeling, memang cukup tinggi. Guna menyukseskan cara tersebut, Erwin membutuhkan dukungan melalui publikasi di media massa. Dalam hal ini, PARFI Sumut berharap Harian Waspada mempublikasikan Festival Band dan Pemilihan Top Model ini secara besar-besaran sehingga menjadi perhatian berbagai kalangan. “Kita berharap Harian Waspada menerbitkan formulir pendaftaran Festival Band dan Pemilihan Top Model. Hal ini bertujuan agar peserta yang berasal dari luar kota mendapatkan kemudahan untuk mengakses pendaftarannya,” ujar Erwin. Selama ini, lanjut Erwin, yang menjadi kendala dalam penyelenggaraan Pemilihan Top Model tersebut, banyak peserta mendaftarkan diri saat pelaksanaan lomba akan dimulai. Hal ini membuat panitia kewalahan saat melakukan pendataan. Karena itu, publikasi sangat dibutuhkan dalam kegiatan ini. Sementara itu, Ketua Panitia Pelaksana Lomba Jonny Chandra didampingi Koordinator Lomba Modeling Hilman Suhadi mengatakan, dunia model tidak pernah mati sampai kapanpun karena selalu mengikuti perkembangan mode. Banyak kawula muda sukses karena menekuni dunia ini, sehingga tidak ada

Warga Medan Wajib Bayar PBB Kenaikan 100 Persen Telah Disetujui DPRD MEDAN (Waspada): Meski Pajak Bumi dan Bangunan (PBB) mengalami kenaikan hingga 100 persen, maka seluruh warga Kota Medan wajib membayarnya. Sebab, peraturan daerah (Perda) tentang kenaikan PBB tersebut telah disetujui dan disahkan oleh DPRD Kota Medan. “Mana bisa warga Medan tidak membayar PBB. Apapun ceritanya masyarakat harus membayar PBB. Peraturan itu

telah ditetapkan oleh DPRD Medan, jadi membayar PBB wajib dilaksanakan,” tegas Kepala Dinas Pendapatan Kota Medan Sahrul Harahap kepada Waspada, Kamis (12/4). Sebelum Perda tersebut direvisi, seluruh warga Kota Medan wajib membayar PBB. Jika tidak membayar PBB, berarti sama saja tidak mendukung pembangunan Kota Medan. Karena itu, diminta kepada seluruh masyarakat segera membayar PBB guna mewujudkan pembangunan di daerah ini. Mengenai pernyataan anggota DPRD Medan bahwa warga berhak tidak membayar PBB, Sahrul menilai, pernyataan

tersebut tidak benar. Perda PBB itu telah dibahas Panitia Khusus (Pansus) dan ditetapkan oleh DPRD. Anehnya, kenapa ada anggota DPRD yang menyatakan warga berhak tidak membayar PBB. “Yang menetapkan Perda itu kan dewan, jadi kenapa mereka bicara seperti itu. Kita harapkan dewan jangan mengeluarkan imbauan yang tidak membangun. Jangan diimbau seperti itu, sebelum ada revisi atas Perda tersebut,” ucapnya. Sebelumnya, tiga fraksi di DPRD Medan mengajukan rekomendasi revisi Perda No. 3 tahun 2011 tentang PBB Pedesaan dan Perkotaan kepada

Kejatisu Panggil Enam Pejabat RSPM MEDAN (Waspada): Kejaksaan Tinggi Sumatera Utara (Kejatisu) meningkatkan status penyelidikan menjadi penyidikan kasus dugaan korupsi sebesar Rp7,7 miliar di RSU Dr Pirngadi Medan dengan memanggil enam pejabat di RS milik Pemko Medan itu. “Adapun indikasi tindak pidana korupsi di RSU Pirngadi Medan tentang pengadaan SIR (Sistem Informasi Rumah Sakit). Dimana alat ini digunakan sebagai pemantau instalasi peralatan di rumah sakit,” ujar Plh Kasi Penkum Ronald Bakara di Medan, Rabu (11/4). Menurut dia, dugaan korupsi tersebut berupa imbalan jasa sebesar 7 persen terhadap

pihak ketiga dalam hal ini PT Buana dari pemakaian jasa SIR yang diperkirakan alat tersebut berfungsi sejak tahun 2010. “Namun alat tersebut tidak berfungsi hingga sekarang. Akan tetapi biaya proses sebesar 7 persen dari imbal jasa tersebut telah dibayarkan oleh RS Pirngadi ke pihak ketiga dengan jumlah sebesar Rp7,7 miliar,” ujar Bakara. Untuk itu, lanjutnya, pihak Kejatisu melakukan pemeriksaan ataupun penyelidikan terhadap kasus tersebut mulai 5 April 2012. “Hari ini penyelidikan tersebut kita tingkatkan menjadi penyidikan dengan memanggil enam pejabat RS Pirngadi yang bertanggungja-

wab terhadap kasus tersebut,” sebut Bakara. Kata dia, ke enam pejabat tersebut diantaranya Wakil Direktur RSU Pirngadi Medan, Koordinator Sistem Informasi Rumah Sakit (SIR), Bendahara RSU Pirngadi Medan, Ketua Panitia Lelang Pengadaan alat SIR, dan dua pejabat lainnya. Sedangkan untuk menetapkan nama-nama tersangka itu, menurut Bakara, setelah hasil pemeriksaan terhadap enam pejabat RSU Pirngadi tersebut. “Diperkirakan dalam waktu dekat kita akan menetapkan nama-nama tersangka tindak pidana korupsi sebesar Rp7,7 miliar dalam perkara pengadaan SIR tersebut,” tuturnya. (m38)

pimpinan dewan. Ketiga fraksi tersebut yakni fraksi Partai Keadilan Sejahtera (F-PKS), fraksi Partai Demokrat (F-PD) dan fraksi Partai Golkar (F-PG). H. Salman Alfarisi, Lc MA dari F-PKS mengatakan, sembari menunggu revisi tersebut, pihaknya meminta pimpinan dewan mengeluarkan rekomendasi penundaan pelaksanaan Perda PBB. Menurut Salman, warga Kota Medan berhak tidak membayar PBB sebagai bentuk protes atas kenaikkan PBB hingga 100 persen yang tertuang dalam Perda tersebut. Untuk mengeluarkan rekomendasi itu, Salman yang juga anggota Komisi B DPRD Medan mengatakan, pimpinan dewan dapat mengundang para ketua fraksi guna mengambil kata setuju, sehingga rekomendasi yang dikeluarkan secara kelembagaan mempunyai legalitas formal. Dalam hal ini, F-PKS melayangkan surat secara resmi kepada pimpinan dewan agar mempercepat pengeluaran rekomendasi penundaan pemberlakukan Perda No. 3 tahun 2011 itu. Sementara itu, F-PD DPRD Medan juga mengirimkan surat rekomendasi permintaan revisi Perda No 3 tahun 2011 tentang PBB kepada pimpinan dewan dengan nomor 099/FD/DPRDKM/IV/2012. Rekomendasi revisi tersebut berdasarkan pengaduan keberatan masyarakat yang disampaikan langsung ke F-PD.

Ketua F-PD Herry Zulkarnain didampingi Sekretaris Srijati Pohan dan Bendahara FPD A Hie mengatakan, revisi Perda tersebut harus segera dilaksanakan demi asas keadilan bagi masyarakat serta melihat kemampuan mereka membayar PBB. “Dengan biaya hidup yang tinggi seperti saat ini, tidak perlu ada biaya tambahan lagi dari PBB. Surat pengusulan revisi tersebut telah disampaikan FPD dan diharapkan pimpinan dewan bisa segera menindaklanjutinya,” kata Herry. Selain itu, F-PG juga mengajukan permintaan revisi Perda melalui surat No. 038/FPG/ DPRD-M/IV/2012 tertanggal 9 April 2012. Dalam surat tersebut, F-PG mendesak pimpinan DPRD Kota Medan segera mempersiapkan perangkat yang dibutuhkan sebagaimana diatur dalam Tatib. Ketua F-PG CP Nainggolan mengatakan, pemberlakukan Perda No. 3 tahun 2011 itu telah menimbulkan gejolak keberatan di tengah-tengah masyarakat dan telah disikapi DPRD melalui fraksi dan pimpinan melalui rapat konsultasi pada 4 April 2012. (m50)

Sambut Wapres, Gepeng Ditertibkan MEDAN (Waspada): Rencana kunjungan kerjaWapres Boediono di Medan dan Deliserdang, Jumat (13/4), membuat Pemko Medan berbenah diri. Agar kota ini terlihat bersih dan tertata rapi, petugas Sat Pol PP dikerahkan untuk merazia anak jalanan, gelandangan dan pengemis (gepeng) serta menertibkan pedagang kaki lima. Pantauan Waspada, Kamis (12/4), petugas Sat Pol PP merazia gepeng dan anak jalanan di kawasan persimpangan Jln. Juanda – Jln. Brigjen Katamso, persimpangan Jln. Sisingamangaraja – Jln. Juanda – Jln. Halat dan sejumlah ruas jalan yang akan dilalui wapres dan rombongan. Sejumlah anak jalanan yang tertangkap diangkut ke dalam truk dan dititipkan di rumah singgah untuk dilakukan pembinaan. Namun, banyak anak jalanan dan gepeng yang melarikan diri setelah melihat kedatangan petugas Sat Pol PP. Kasat Pol PP Medan Kriswan mengatakan kepada Waspada, razia ini memang rutin dilakukan. Kali ini, razia dilakukan terkait kunjungan Wapres Boediono. “Dijadwalkan, Wapres beserta rombongan akan menunaikan shalat Jumat di Masjid Raya Al Mashun,” ujarnya. (m46/m50)

salahnya untuk mencoba karier di dunia model. Dalam Pemilihan Top Model kali ini, lanjut Hilman, salah seorang jurinya yakni bintang sinetron Elma Theana. Standar penilaian lomba model yakni peserta harus bisa menentukan tema busana yang diminta panitia, make up, gaya rambut dan lainnya. Sedangkan untuk Festival Band, Ilham selaku koordinator lomba mengatakan, sampai saat ini sudah ada 25 band yang mendaftar. Nantinya, para peserta yang mengikuti lomba akan membawakan dua lagu, satu diantaranya merupakan lagu wajib yang sudah ditentukan panitia. “Musik merupakan salah satu jenis hiburan yang disukai semua kalangan, terutama kawula muda. Musik dapat menjadi sarana untuk menuangkan kreativitas untuk berkarya dan berprestasi,” ujarnya.(cdu)


Medan Metropolitan

WASPADA Jumat 13 April 2012

Wali Kota Didesak Realisasikan Janjinya Bangun Masjid Al Ikhlas MEDAN (Waspada): Dewan Dakwah Islamiyah Indonesia (DDII) Sumatera Utara, DPW PBB, dan DPW JBMI Sumut mendesak Wali Kota Medan H Rahudman Harahap dan Plt Gubsu H Gatot Pujo Nugroho untuk segera merealisasikan janjinya membangun kembali Masjid Al Ikhlas yang telah dirubuhkan. Hal itu disampaikan Wakil Ketua DDII Sumut/Ketua DPW Partai Bulan Bintang (PBB) Sumut Dr Ir H Masri Sitanggang MP, didampingi Ketua DPW Jam’iyah Batak Muslim Indonesia (JBMI) Sumut H Aidan Nazwir Panggabean kepada Waspada, Selasa (10/4). Kata Sitanggang, Masjid Al Ikhlas yang dirubuhkan di Jln. Timor harus segera dibangun kembali sesuai dengan apa yang telah dijanjikan Pemprovsu dan Pemko Medan. Karena jika terus berlarut-larut dikhawatirkan akan menim-

Dua Perampok Dihajar Massa MEDAN (Waspada): Dua perampok yang beraksi di Jln. Brigjen Katamso simpang Jln. Suprapto, diamuk massa hingga babakbelur saat berupaya melarikan tas sandang korbannya. Keduanya ditangkap massa karena sepedamotor matic yang mereka gunakan mogok. Kapolsek Medan Kota Kompol Sandy Sinurat didampingi Waka Polsek AKP P Sihombing kepada wartawan, Rabu (11/4) mengatakan, kedua tersangka sempat dibawa ke RS Bhayangkara untuk perawatan karena luka diderita cukup serius. “Setelah lukanya mulai membaik keduanya kembali dimasukkan dalam sel tahanan Mapolsek,” kata Sandy. Menurut dia, kedua tersangka bisa saja tewas jika polisi tidak segera mengamankannya. Keduanya IL, 23, penduduk Pasar 10 Marelan dan MR, 22, penduduk Jln. Karya Karang Berombak. “Mereka itu merupakan perampok jalanan dan telah berulangkali melakukan aksinya, di antaranya di kawasan Jalan Setia Budi dan Jalan Gatot Subroto. Target keduanya wanita yang mengendarai sepedamotor,” sebutnya. Saat melakukan perampokan itu, keduanya telah mengincar Fitri, 23, penduduk Jln. Air Bersih bersama seorang temannya yang mendorong sepedamotor mereka dikarenakan bocor ban. Kedua tersangka kemudian mendekati dan menarik tas yang disandang Fitri. Ketika hendak kabur, mesin sepedamotor pelaku tiba-tiba mati sehingga pengguna jalan lain dan masyarakat sekitar yang mengetahui perampokan itu langsung menangkap keduanya. Pukulan, terjangan dan hantaman benda tumpul mendarat di tubuh kedua pelaku. Polisi mengetahui kejadian itu segera melakukan pengamanan dan membawa tersangka ke rumah sakit. “Barang bukti yang diamankan, sepedamotor, tas korban, dompet dan uang Rp7 ribu,” ujar Sandy.(m27)

MTs, MA PAB Helvetia Sambut UN Dengan Zikir MEDAN (Waspada): Menghadapi ujian akhir nasional (UN) TA 2011-2012, madrasah tsanawiyah (MTs) PAB 1 dan Madrasah Aliyah (MA) PAB 2 Helvetia melakukan malam sentuhan qalbu dengan zikir dan doa, di halaman Perguruan PAB Wilayah IV Helvetia, Sabtu (7/4). Acara yang dirangkai dengan tausiyah dan shalawat tersebut dipandu oleh guru-guru madrasah, di antaranya H Sarwo Edi Harahap SAg, Drs Zakaria Batubara, dan Fazuli Idris BA. Dalam tausiyah yang dilakukan secara estafet tersebut para guru mengatakan, jika para santri ingin sukses menghadapi ujian akhir nasional tahun ini, disamping belajar sungguh-sungguh jangan lupa mohon hidayah dan pertolongan Allah SWT. Selain itu juga, memohon doa restu dari kedua orangtua dan guru masing-masing. Untuk itu bertobatlah dengan dosa-dosa yang pernah dilakukan, sebab dengan dosa dan maksiat yang dilakukan akan bisa menghambat rahmat dan pertolongan Allah SWT. Kepala MTs PAB 1 dan MA PAB 2 Helvetia Drs HM Fauzi MA mengatakan, jauh sebelum kegiatan tersebut dilaksanakan, berbagai langkah dan usaha telah dilakukan dengan harapan target kelulusan tahun ini bisa tercapai semaksimal mungkin. Langkah dan usaha tersebut diantaranya dengan mengadakan penambahan jam pelajaran, les bidang studi, serta melaksanakan beberapa kali try out. Namun, tambahnya, apapun langkah yang ditempuh tak akan membuahkan hasil tanpa pertolongan dan rahmat dari Allah SWT. Dalam kesempatan itu beberapa pembantu kepala madrasah di antaranya Satria Wiraprana Spd, Erlinda A Harahap SSi, dan H Sarwo Edi Harahap SAg menjelaskan, tsanawiyah dan aliyah sudah banyak meraih pretasi yang membanggakan seperti salah seorang siswi MTs PAB 1 berhasil meraih juara pertama MTQ tingkat anak-anak Kota Medan 2012. Juara pertama festival nasyid tingkat SLTA se Kota Medan tahun 2012 dan tiga kali berturut-turut sebagai juara umum pada ulang tahun PAB se Sumatera Utara. Selain itu juga ditambahkan, tsanawiyah dan aliyah sudah memiliki fasilitas yang mendukung antara lain laboratorium IPA, komputer, perpustakaan dan sarana olah raga yang cukup memadai.(m40)

bulkan ekses yang tak diinginkan dan dapat merugikan semua pihak. Perubuhan Masjid Al Ikhlas bisa mengandung potensi konflik yang sangat besar karena masjid tersebut merupakan simbol dan eksistensi umat Islam yang keberadaannya wajib dijaga dan dibela oleh seluruh umat Islam. Dalam hal ini umat Islam memang punya keyakinan bertanggungjawab dan ikut rasa memiliki (sense of belonging) dimanapun umat Islam itu berada. Pemahaman umum dikalangan umat Islam, bahwa yang namanya setiap masjid adalah milik umat Islam dan oleh karenanya wakaf. Logikanya tidak ada orang membangun masjid untuk kepentingan individu (pribadi). Perlu diketahui, angka statistik di Kota Medan mengenai pertumbuhan masjid dari tahun 2006-2009/2010 cuma 17,84 persen, sementara rumah ibadah lain seperti gereja pertumbuhannya

dalam kurun waktu yang sama mencapai 52,01 persen. Maka persentase masjid menjadi lebih kecil karena banyaknya masjid yang dirubuhkan demi kepentingan kelompok tertentu (pengembang-red). Perubuhan Masjid Al Ikhlas sesungguhnya tidak sesuai dengan nota kesepakatan yang ditandatangani di Markas Kodam I/BB yang lalu. Jika pun terjadi perubuhan dilakukan dihadapan MUI dan Ormas Islam. Dalil aqidah “Kita berharapWali Kota Medan segera menyelesaikan masalah ini dengan cepat membangun Masjid Al Ikhlas. Alasan lain adalah Rahudman Harahap saat kampanye didukung umat Islam untuk menjadiWali Kota Medan. Secara pribadi khususnya saat kampanye menghadapi Sofyan Tan, ulama-ulama menyerukan umat Islam untuk memilih Rahudman Harahap dengan dali-dalil aqidah yang

Soal Pengangkatan Honorer

BKD Medan Diduga Manipulasi Data MEDAN (Waspada): Badan Kepegawaian Daerah (BKD) Kota Medan diduga memanipulasi data sejumlah tenaga honorer yang diangkat menjadi calon pegawai negeri sipil (CPNS). Pasalnya, dari 251 honorer yang diangkat, di antaranya ditemukan honorer tahun 2008. Padahal, sesuai peraturan honorer yang diangkat harus tahun 2005 per 1 Januari. Hal itu diketahui di Dinas Pertamanan Kota Medan. Dimana pada, Kamis (12/4), Kepala Dinas Pertamanan Kota Medan Erwin Lubis mengatakan, pihaknya segera meminta klarifikasi ke BKD terkait pengangkatan honorer menjadi CPNS. “Saya sudah suruh Sekretaris dan Kasubag Kepegawaian meminta klarifikasi ke BKD soal pengangkatan honorer tersebut. Hal ini sesuai dengan arahan Wali Kota Medan, jika ada warga keberatan bisa membuat pengaduan. Makanya, kita akan melaporkan keWali Kota Medan melalui BKD supaya pengangkatan itu disesuaikan dengan database,” sebut Erwin. Kata Erwin, dirinya tidak ingin pengangkatan honorer

ada permainan dan harus sesuai dengan aturan. Dimana honorer yang diangkat harus tahun 2005 per 1 Januari, namun kenapa salah seorang honorer di Dinas Pertamanan tahun 2008 tapi lolos verifikasi. “Yang tahun 2005 ada yang tak lolos verifikasi, tapi kenapa tahun 2008 kok lolos. Ada apa ini?,” katanya. Menurut dia, pengaduan itu dilakukan pihaknya agar jika ada pengangkatan tenaga honorer yang tidak sesuai supaya bisa dibatalkan dan diangkatlah tenaga honorer yang sesuai dengan syarat. “Maksud tujuan kita melaporkannya ke BKD agar BKD Medan bisa menyeleksi dan mengecek kembali karena sesuai dengan peraturan pemerintah itu, pengangkatan tenaga honorer harus yang terakhir pengangkatannya pada Januari 2005. Ini justeru dari pengumuman yang kemarin, ada tenaga honorer tahun 2005 tidak diangkat, malah yang di atas tahun 2005 diangkat,” ucapnya. Oleh karena itu, tambahnya, BKD Medan diminta supaya bisa mengecek ulang lagi daftar honorer yang telah diajukan. Pengangkatan honorer itu harus sesuai dengan ketentuan dan aturan. Ketika ditanya siapa

tenaga honorer tahun 2008 yang diangkat menjadi CPNS tersebut, Erwin mengaku lupa namanya. “Kalau namanya saya lupa, namun kita akan laporkan ke BKD Medan. Di sini saya tidak bilang ada permainan, tapi kami minta agar BKD Medan bisa mengecek kembali,” tuturnya. Erwin menyatakan, kalau tenaga honorer yang tidak lolos di Dinas Pertamanan Kota Medan sebanyak 101 orang. Padahal, tenaga honorer yang diajukan itu sudah sesuai dengan persyaratan yakni pengangkatan terakhir sebelum Januari 2005. “Itulah yang akan kita pertanyakan ke BKD, apa masalahnya, kenapa tenaga honorer yang sudah memenuhi persyaratan justeru tidak diloloskan. Malah yang tidak memenuhi persyaratan bisa lolos,” katanya. Kepala BKD Kota Medan Parluhutan Hasibuan ketika dikonfirmasi wartawan terkait adanya dugaan manipulasi data tersebut tidak bersedia menjawab. Dia kelihatan gugup dan langsung meninggalkan wartawan. “Untuk apa ditanya itu, silahkan saja dibuat besar-besar, saya bertanggung jawab dan saya siap dilakukan uji kelayakan terhadap hasil verifikasi tersebut,” katanya.(m50)

Waspada/Ismanto Ismail

PERSONEL Arhanudse 11/BS Letkol (Arh) sedang membersihkan halaman Masjid Raya Al Mashun Medan, Kamis (12/4).

Karya Bakti Yon Arhanudse 11/BS Di Masjid Raya


Para guru dan santri madrasah MTs dan MA PAB Helvetia saat zikir pada malam sentuhan qalbu menghadapi ujian akhir nasional (UAN) TA 2011-2012.

bersumber dari Alquran,” kata Sitanggang dan Panggabean. Kesimpulannyha, janganlah sampai pemimpin yang didukung dengan ayat-ayat Alquran justru tidak memberi perhatian terhadap adanya masjid yang dirubuhkan. Sebab hal ini akan menimbulkan krisis kepercayaan umat terhadap Rahudman sebagai pemimpin umat dan kepercayaan terhadap ulama yang menyerukan memenangkan Rahudman begitu juga Gator Pujo Nugroho. Termasuk Partai Bulan Bintang (PBB) adalah salah satu partai pengurus pertama pasangan Syampurno. Maka andaikata Pemprovsu-Pemko Medan belum punya dana untuk merealisasikan memulai pembangunan Masjid Al Ikhlas Jln. Timor, setidaknya mereka memiliki iktikad yang baik dengan cara mengizinkan jamaah Masjid Al Ikhlas melaksanakan shalat Jumat dilokasi bekas reruntuhan Masjid Al Ikhlas. (m24)

M E D A N ( Wa s p a d a ) : Batalyon Arhanudse 11/BS melakukan karya bakti membersihkan halaman dan lingkungan Masjid Raya Al Mashun Medan, Kamis (12/4). Pantauan Waspada di lapangan, seratusan personel dari Arhanudse 11/BS yang melakukan karya bakti itu dipimpin Danyon Arhanudse 11/BS Letkol (Arh) Syaepul Mukti Ginanjar, SIP dibantu Danrai-P Yon Arhanudse 11/BS Kapten (Arh) Doman Hendro Pramono, Pasi Intel Kapten (Arh) Rimba Anwar, Danki II

Lettu (Arh) Febri Adrianto serta Dan Raima Lettu (Arh) Marno. Selain halaman masjid, personel Yon Arhanudse 11/BS juga membersihkan kuburan dan bagian dalam masjid tersebut. Sedangkan petugas dari Ke c a m a t a n Me d a n Ko t a membersihkan kuburan dan halaman luar masjid tersebut. Danyon Arhanudse 11/BB Letkol (Arh) Syaepul Mukti Ginanjar, SIP, mengatakan, karya bakti ini merupakan salah satu upaya memelihara kebersihan lingkungan Masjid Raya

Al-Mashun Medan. Selain itu, Yon Arhanudse 11/BS juga mengerahkan personel sebanyak 3 SSK guna melakukan pengamanan kunjungan Wakil Presiden ke Medan. Dijadwalkan,Wapres akan melaksanakan Shalat Jumat di Masjid Raya Al Mashun. Karya bakti ini merupakan instruksi Pangdam I/BB Mayjen TNI Modewijk F. Paulus yang langsung dilaksankan Batalyon Arhanudse 11/BS. “Alhamdullilah, karya bakti ini mendapat sambutan baik dari masyarakat,” ungkapnya.(m36)

Waspada/Amir Syarifuddin

PLT Gubsu Gatot Pujo Nugroho menerima audiensi anggota KPI dan Komisi A DPRD Sumut berkaitan akan dilantiknya anggota KPID Sumut, di Gubernuran Medan, Rabu (11/4).

KPI Minta Plt Gubsu Segera Lantik KPID Sumut MEDAN ( Waspada): Demi mencegah terbengkalainya pengelolaan sistem penyiaran di Sumut, Komisi Penyiaran Indonesia (KPI) meminta Plt Gubsu H Gatot Pujo Nugroho, ST segera menerbitkan SK dan melantik anggota KPI Daerah Sumatera Utara. Meskipun sempat meminta penundaan pelantikan KPID Sumut terpilih, namun akhirnya KPI menilai proses pemilihan anggota KPID sudah sesuai dengan ketentuan. Hal itu diungkapkan anggota KPI Iswandi Syahputra didampingi Azimah Subagijo saat bertemu Plt Gubsu H Gatot Pujo Nugroho, ST di Gubernuran Jalan Sudirman Medan, Rabu (11/4). Hadir juga dalam kesempatan itu Ketua Komisi A DPRD Sumut Isma Fadli dan anggota Syafrida Fitrie serta Ahmad Taufik. Kehadiran anggota KPI dan Komisi A DPRD Sumut yang membidangi seleksi pemilihan KPID Sumut ini, dalam rangka mempercepat proses pelantikan anggota KPID Sumut terpilih dan menjelaskan kepada Pt Gubsu sikap dan rekomendasi KPI terhadap polemik yang sempat mewarnai pemilihannya. Kepada Plt Gubsu, Iswandi yang merupakan koordinator pembinaan Sumut ini mengungkapkan, pihaknya memang sempat meminta penundaan penetapan dan pelantikan anggota KPID Sumut, untuk memverivikasi adanya tuduhan penyalahan ketentuan dalam proses pemilihannya. Menurut dia, pihaknya sudah meneliti berbagai tuduhan yang disampaikan para incumbent yang tidak terpilih kembali tersebut, namun ternyata memang tidak ada pasal yang dilanggar. ”Apa yang telah menjadi sikap kami diawal, jika melanggar peraturan memang harus dianulir. Tapi setelah kami koreksi bersama, memang tidak ada pasal yang dilanggar. Ketiga hal yang diberatkan incumbant yang tidak terpilih ternyata itu batal semua,” kata Iswandi.

Ada tiga tuduhan yang disampaikan yaitu adanya anggota KPID terpilih merupakan anggota partai politik, proses pemilihan yang tertutup dan indikasi main uang. Namun kesemua tudingan yang disampaikan tidak terbukti. Namun, tambah Iswandi, bukan berarti mereka dihalangi untuk sampaikan pendapat. Dia mempersilahkan pihak yang berkeberatan untuk menyampaikan sesuai mekanisme yang berlaku di Indonesia. Untuk menghindari berlarut-larutnya proses tersebut sehingga merugikan kepentingan masyarakat luas, maka KPI meminta Plt Gubsu dapat segera melantik anggota KPID terpilih. “Kami siap beri kesaksian bila hal ini sampai ke ranah hukum. Kami bangga komunikasi yang harmoni antara DPRD Sumut dan Plt Gubsu, karena apabila tidak ada pola koordinasi yang baik antara kedua pihak ini mungkin masalahnya bisa berlarut-larut,” sebut dia. Sementara itu Azimah mengungkapkan, penundaan pelantikan KPID yang sudah melewati mekanisme yang ada sangat merugikan. Terlebih lagi berdasarkan standar rekrutmen yang ditetapkan KPI bahwa penetapan SK dan pelantikan paling lambat dilakukan 30 hari setelah DPRD menyampaikan nama kepada gubernur. Menanggapi hal tersebut, Plt Gubsu Gatot Pujo Nugroho menyatakan akan segera menetapkan SK penetapan KPID Sumut dan dalam waktu dekat akan melantik para personel komisioner hasil pemilihan. “Penjelasan KPI ini semakin memotivasi kami untuk segera melantik KPID Sumut terpilih. Kalau memang mereka yang berkeberatan melanjutkan keberatan ke proses hukum, mohon bantuan KPI,” ujar Gatot. Dia menyebutkan, berbagai keberatan yang ada merupakan bagian dari proses demokratisasi, di mana semua pihak ingin aspirasinya terpenuhi. Gatot juga meminta kepada KPI untuk dapat ikut mengkampanyekan keterlibatan masyarakat dalam proses pembangunan.(m28)

Alumni SMA Methodist Hang Tuah Gelar Jalan Santai MEDAN (Waspada): Alumni SMA Methodist I Hang Tuah Medan angkatan 74-76 merencanakan kegiatan Jalan Santai pada, Sabtu 28 April 2012 mendatang. Acara akan dilaksanakan di Armaya Wisata Alam, Desa Sukatendel Pancur Batu. “Kegiatan ini berasal dari ide penasehat alumni Djohan Japutra, dalam rangka mempererat silaturahim sesama alumni, dan merupakan acara khusus atau special event sebab selama ini alumni juga telah melakukan pertemuan rutin bulanan yang diisi dengan acara arisan,” kata Ketua Ikatan Alumni SMA Methodist 7476 Meinarty Bangun, Kamis (12/4). Untuk terlaksananya kegiatan tersebut, telah dibentuk panitia yang terdiri dari Penasehat Djohan Japutra, Kol (CBA) Sabar Ginting, dan Meinarty Bangun. Ketua Panitia Herly Pranata, Sekretaris Bisara L. Tobing, Bendahara Fatimah Lubis, serta Amir Simorangkir dan kawan-kawan sebagai pengelola acara.

Sedangkan Herly Pranata menambahkan, selain gerak jalan santai, kegiatan ini akan diisi acara hiburan keyboard, street magic, berbagai games kelompok, tukar menukar kado, dan lomba menyanyi alumni Idol. Kata dia, meskipun acara tersebut dilaksanakan oleh Alumni 74-76, namun kegiatan itu terbuka untuk umum alumni SMP Methodist 71, dan juga alumni SMA Methodist angkatan sebelum dan sesudahnya. “Tujuan acara ini adalah untuk meningkatkan tali persaudaraan diantara sesama alumni, karenanya keikutsertaan alumni angkatan sebelumdansesudahnyasangatdiharapkan,”ujarnya. Untuk informasi lebih lanjut, angkatan 74 dapat menghubungi Kompol Cirman TS (08136200200 80), Yunita Agnes Sianipar (08126391229), angkatan 75 dapat menghubungi Fatimah Lubis (081361133 222), dan Amir Simorangkir (081361677534), sedangkan bagi angkatan 76 dapat menghubungi Herly Pranata (08126021257) dan Bisara L Tobing (081263027038). (cwan)

WASPADA Jumat 13 April 2012

Medan Metropolitan


Ria Hutagaol Duta Sumut Di Finalis Miss Indonesia 2012 Gatot Titip Pesan Promosikan Daerah MEDAN (Waspada): Duta Sumatera Utara di ajang Miss Indonesia tahun 2012 Kastria Soldiana Elizabeth Hutagaol atau akrab disapa Ria Hutagaol memohon doa restu dari Plt Gubsu dan seluruh warga provinsi ini sehingga nantinya dia bisa memberikan yang terbaik bagi daerah, bangsa dan negara. Harapan Ria itu diutarakannya saat bertemu Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, di Gubernuran Medan, Rabu (11/4). Di pertemuan itu Ria didampingi ibundanya Tiurmaida Manalu, anggota Komisi E DPRD Sumut Richard Eddy M Lingga, dan staf Sekwan DPRD Sumut Evelyn Sitanggang. ”Melalui Plt Gubsu, saya sangat berharap seluruh masyarakat di sini bisa mendoakan untuk sukses mencapai grand final Miss Indonesia tahun 2012 pada 28 April nanti. Karena tanpa dukungan dan doa seluruh warga, saya tidak ada artinya,” kata Ria dalam pertemuan dengan Gatot. Ria menuturkan, dirinya bisa tampil sebagai duta Sumut di ajang itu setelah berhasil mengungguli 600 kontestan lainnya. Ria yang merupakan anak pertama dari empat bersaudara itu mengaku, kesuksesan yang ada di depan matanya, sangat bergantung dari doa dan dukungan banyak pihak khususnya dari warga Sumut. Sementara itu Plt Gubsu dalam pertemuan tersebut menitipkan pesan kepada Ria untuk bisa memanfaatkan momentum tersebut sebagai ajang mempromosikan berbagai

potensi daerah ini di tingkat nasional. ”Terus terang, kami di provinsi saat ini terus aktif mempromosikan berbagai potensi yang dimiliki Sumut tidak hanya ke tingkat nasional, tapi juga ke tingkat internasional. Karena, kami berkeinginan Sumut lebih dikenal tidak hanya sebagai miniaturnya Indonesia, tetapi juga sebagai Trully-nya Asia, mengingat di daerah ini juga menetap berbagai etnis suku bangsa di Asia,” kata Gatot. Untuk mendukung promosi Sumut itu, Gatot mengintruksikan Dinas Pariwisata dan Kebudayaan Sumut memberikan background info yang dibutuhkan kepada Ria guna menjadi bekal dan bahan pembelajarannya menghadapi ajang Miss Indonesia 2012. ”Melalui promosi intansi terkait di provinsi dan dengan bantuan dari Ria, harapan kami nama Sumut bisa bangkit kembali di kancah dunia pariwisata regional, nasional, dan internasional akan cepat bisa terwujud,” ungkap Gatot.(m28)

Waspada/Amir Syarifuddin

GATOT Pujo Nugroho memberikan buku Sumut Dalam Angka 2011 kepada Ria Hutagaol Duta Sumut di ajang Miss Indonesia 2012.

Dua Tersangka Korupsi Dana Bansos Ditangkap Al Washliyah Maimun Gelar Muscam Dan Silaturrahmi Kader MEDAN (Waspada): Pimpinan Cabang Al Jami’iatul Washliyah (PC Al Washliyah) Kec. Medan Maimun, menggelar Musyawarah Kecamatan (Muscam) yang dirangkaikan dengan kegiatan silaturahmi kader, bertempat di Madrsah Al Washliyah Kel. Sei Mati, Sabtu (7/4). Muscam juga dibarengi dengan Muscam empat organ bahagian lainnya yakni Ikatan Pelajar Al Washliyah (IPA), Gerakan Pemuda Al Washliyah (GPA), Angkatan Puteri Al Washliyah (APA) serta Muscam Ikatan Guru dan Dosen Al Washliyah (IGDA). Koordinator Kecamatan Medan Maimun PD Al Washliyah Kota Medan Muaz Tanjung didampingi Ketua Panitia Pelaksana Ishaq Harahap, Senin (9/4) mengatakan, kegiatan tersebut digelar dalam rangka meningkatkan konsolidasi organisasi mengingat Medan Maimun merupakan salah satu basis warga Al Washliyah di Kota Medan. “Kehadiran ratusan kader dan warga AlWashliyah pada kegiatan tersebut menunjukkan eksistensinya Al Washliyah di Kecamatan Medan Maimun, karena memang di daerah ini banyak ulama Al Washliyah yang dilahirkan maupun dikebumikan di kecamatan ini,” ujarnya. Sementara itu, Ketua Panitia Pelaksana Ishaq Harahap mengatakan, selain menghimpun kembali potensi kader kegiatan, kali ini bertujuan untuk merumuskan program kerja Al Wasliyah demi kemaslahatan umat di Kec. Medan Maimun, sebagaimana tema yang diusung ‘Membangkitkan semangat juang organisasi dengan visi dan misi yang berkualitas. “Pendidikan, dakwah dan sosial sebagai bahagian Panca Amal Al Washliyah akan kita prioritaskan di kecamatan ini,” kata Ishaq. Muscam kali ini menghasilkan komposisi kepengurusan PC Al Washliyah Medan Maimun antaralain Ketua Juhar Matondang, Sekretaris Salamuddin, Bendahara Ishaq Harahap. Untuk organ bahagian antaralain PC IPA Ketua M Alfan Hadi, Sekretaris M Ridwan, Bendahara Putri Indah Sari, PC GPA Ketua Asfuadi Lubis, Sekretaris Junaidi Nasution, Bendahara Azhar Matondang, PC APA Ketua Nilawaty, Sekretaris Zahara Lubis, Bendahara Khairani, PC IGDA Ketua Fuahrurozi, Sekretaris Hasanul Fadli, Bendahara Hidayana Utari.(m37)

Kids Fun Fair Di Wiyata Dharma MEDAN (Waspada): Guna meningkatkan kreativitas siswa Taman Kanak-Kanak (TK) dan Sekolah Dasar (SD) di bidang seni, perguruan Wiyata Dharma menggelar Wiyata Dharma Open House 2012 bertajuk Kids Fun Fair, Minggu (7/4). “Kegiatan ini merupakan langkah yang harus diambil dalam menumbuhkan keberanian para siswa sejak dini,” kata Ketua Panitia Christian, S.Kom didampingi Humas Perguruan Wiyata Dharma Drs. J Lumban Batu. Christian menambahkan, tujuan kegiatan ini untuk meningkatkan kreativitas para siswa TK dan SD serta menjalin silaturahmi antara masyarakat, staf pengajar dan para siswa. “Kegiatan ini merupakan keduakalinya digelar dan diharapkan para siswa dapat terpacu untuk berkompetisi dengan siswa lainnya. Kegiatan ini juga diikuti peserta yang berasal dari sekolah lain,” tambahnya. Wiyata Dharma Open House 2012 ini diisi dengan berbagai kegiatan antara lain bazaar, games dan art exhibition. Kemudian, siswa-siswi Perguruan Wiyata Dharma juga berkesempatan memamerkan hasil kerajinan tangan mereka kepada pengunjung.(m42)

Mahasiswa STT Harapan Gelar Donor Darah MEDAN (Waspada): Sekolah Tinggi Teknik Harapan (STTH) bekerjasama dengan Palang Merah Indonesia (PMI) Medan menyelenggarakan kegiatan donor darah di kampus III Jalan HM Joni Medan, Kamis (12/4). Kegiatan yang disambut antusias oleh mahasiswa dan dosen di kampus tersebut, berhasil mengumpulkan 62 kantong darah. “Sebenarnya masih banyak mahasiswa yang belum sempat mendonorkan darahnya, karena keterbatasan waktu,” kata salah seorang dosen STT Harapan Budi Santri. Ketua STT Harapan Muhammad Zulfin menyambut baik kegiatan acara donor darah itu. Menurutnya, acara itu sebagai salah satu bentuk pengabdian kepada masyarakat dan berharap dapat dilaksanakan secara berkesinambungan. “Apalagi seperti yang kita ketahui bersama saat ini stok darah sangat sedikit. Sehingga terkadang PMI kesulitan menyediakan darah jika ada masyarakat yang membutuhkan,” sebutnya. Selain donor darah, kata Zulfin, selama ini sekitar 4000 mahasiswa di kampus yang sudah berdiri sejak tahun 80-an itu, juga sering melakukan kegiatan-kegiatan sosial. Seperti memberikan pelatihan ketrampilan komputer kepada guru-guru di Medan.(m48)

MEDAN (Waspada): Setelah menjalani pemeriksaan lebih dari enam jam di Kejaksaan Tinggi Sumatera Utara (Kejatisu), dua dari tiga tersangka dugaan korupsi bantuan sosial di Biro Bina Sosial Pemerintah Provinsi Sumatera Utara (Pemprovsu) tahun anggaran 2011, akhirnya ditangkap.

Kedua tersangka yakni AF selaku bendahara pada Biro Binsos Provsu dan Su selaku Bendahara pada Biro Umum

Provsu, dibawa langsung dari kantor Kejatisu Jln. AH Nasution, Medan, pada Kamis (12/ 4) sore, pukul 17:00. Sementara itu, Kejatisu belum bisa melakukan penangkapan terhadap tersangka UA selaku bendara pada Biro Perekonomian Provsu, karena adanya surat keterangan dokter yang menyatakan dirinya sakit dan harus dirawat. “UA tidak ditangkap karena ada surat keterangan dokter yang menyatakan sakit atau hamil empat bulan,” kata Plh. Kasi Penkum Kejatisu, Ronald Bakara. Kendati demikian, lanjutnya, pihaknya akan melakukan pengawasan terhadap UA agar tidak pergi ke luar negeri. Dalam hal ini, jaksa dari Kejatisu akan

dibantu oleh dokter lokal. “Sampai saat ini sudah lebih 130 saksi yang dimintai keterangan,” ujarnya. Berdasarkan pantauan wartawan di lapangan, setiap hari lebih dari tiga saksi yang dimintai keterangan oleh pihak Kejaksaan Tinggi Sumatera Utara (Kejatisu). Sebagaimana diketahui, kasus dugaan korupsi tersebut mencuat terkait realisasi penggunaan anggaran bantuan sosial. Pada tahun 2011, anggaran bantuan sosial senilai Rp477. 885.800.000 dengan realisasi sebesar Rp351.693.000.000. Tahun 2009 senilai Rp293.745. 501.407 terealisasi Rp284.199. 897.500 dan 2010 senilai Rp424. 388.575.000 terealisasi Rp348. 105.050.000.(m38)

Kasus Perubuhan Masjid

Pengembang Tidak Penuhi Panggilan MEDAN (Waspada): Pihak pengembang Jati Mas tidak memenuhi panggilan penyidik Reskrim Unit Resum Polresta Medan untuk diperiksa sebagai saksi dalam kasus perubuhan masjid Al-Khairiyah. “Penyidik sudah melayangkan surat panggilan kepada pihak pengembang untuk diperiksa sebagai saksi, Rabu (11/ 4). Tapi, pihak pengembang yang diwakili Darmo tidak datang,” jelas Kasat Reskrim Polresta Medan Kompol Yoris Marzuki, Kamis (12/4). Yoris menegaskan, pihaknya tetap memproses kasus ini dan akan melayangkan surat panggilan lagi terhadap pihak pengembang. “Nanti kita layangkan kembali surat panggilan sebagai saksi terhadap pihak pengembang,” katanya. Dalam kasus ini, lanjutnya,

polisi sudah melakukan pemeriksaan terhadap lima saksi yakni saksi pelapor H. Pimpin Sitepu, terlapor H. Kasmo, lurah, kepling dan Ka KUA. “Mereka sudah dimintai keterangan di Reskrim Unit Resum Polresta Medan,” katanya. Sebelumnya, Kapolresta Medan Kombes Monang Situmorang, SH, MSi menjelaskan, pihaknya terus mengumpulkan bukti-bukti dalam kasus perubuhan masjid ini. “Bukti ini kita kumpulkan dan nantinya kita tanyakan kepada saksi yang sudah diperiksa,” ujarnya. Dia menjelaskan, Polresta Medan tetap memproses kasus yang dilaporkan H.Pimpin Sitepu dengan LP/1655/VI/2004/ Ops/Tabes, tanggal 8 Juni 2004 tentang tindak pidana secara bersama-sama melakukan kekerasan terhadap barang (peng-

rusakan) sebagaimana dimaksud dalam pasal 170 Jo pasal 406 KUHPidana. Sementara itu, dalam surat pemberitahuan perkembangan hasil penyidikan (SP2HP) yang ditandatangani Waka Sat Reskrim AKP Hendra Eko Triyulianto, SIK, SH tanggal 5 Maret 2012 yang ditujukan kepada pelapor H. Pimpin Sitepu disebutkan, polisi sudah melakukan pemeriksaan terhadap empat saksi. Keempat saksi yang sudah diperiksa penyidik yakni H. Pimpin Sitepu, Drs. H. Busro Ali Umar Harahap, Zainuddin Haharap, BA dan H. Kasmo. Rencana selanjutnya, penyidik akan melakukan pemeriksaan lanjutan terhadap H. Pimpin Sitepu dan H. Kasmo. Juga pemanggilan terhadap saksi lain yang ada hubungan dengan perkara ini. (m39)

Gaji Kecil Jangan Jadi Alasan Hakim Terima Suap MEDAN (Waspada): Tidak dapat dibenarkan apapun alasannya hakim melakukan korupsi atau menerima suap. Bahkan dalam agama Islam ada hadist berbunyi: “Pemberi suap dan penerima suap tempatnya di neraka”. Demikian ditegaskan Direktur Lembaga Bantuan Hukum (LBH) Medan dan praktisi hukum Sumut yang dihubungi Waspada secara terpisah, Rabu (11/4), terkait kasus aksi demo hakim dalam menuntut kesejahteraan atau kenaikan gaji. “Gaji kecil jangan dijadikan alat pembenar atau melegalkan para hakim untuk melakukan korupsi,” kata Direktur Lembaga Bantuan Hukum (LBH) Medan Nuriyono. Menurut dia, jika mereka merasa tidak sejahtera menjadi hakim, keluar saja. “Ini kan pilihan hidup mereka, konsisten dengan janji dan sumpah saat menjadi hakim,” sebutnya. Untuk itu, kata dia, tidak ada alasan bagi hakim melakukan korupsi, menerima suap, dan semua tindakan tercela lainnya. Bahkan, ia menyakini meskipun gaji sudah dinaikkan, budaya suap atau korupsi dipastikan masih akan ada. “Kenaikan gaji atau remunerasi di Mahkamah Agung para hakim dinilai juga belum efektif karena diyakini korupsi masih ada, kenaikan sehingga gaji atau remunerasi bukanlah senjata ampuh memberantas korupsi di lingkungan peradilan,” sebutnya. Kata dia, pekerjaan menegakkan hukum

dan keadilan itu tidak segampang dan sejelas seperti dikatakan undang-undang tetapi sarat dengan berbagai intervensi baik itu sosial, ekonomi maupun politik. Hal senada disampaikan praktisi hukum Marasamin Ritonga. Katanya, apapun alasannya tidak dapat dibenarkan melakukan korupsi. Bahkan gaji yang kecil dan kesejahteraan yang minim pun tidak dapat dijadikan alasan pembenar untuk melegalkan penyimpangan. “Jangan sampai kesejahteraan dijadikan alasan hakim terlibat praktik mafia peradilan. Memang lumrah dan wajar kalau para hakim menuntut kenaikan gaji, tapi jangan sampai mereka melakukan penyimpangan karena alasan itu,” ujarnya. Marasamin juga menyakini budaya supa tidak tuntas diberantas secara untuh hanya dengan menaikkan gaji hakim.Tapi, lebih efektif jika dilakukan secara total dan dibutuhkan strategi komprehensif dan menyeluruh memberantas budaya suap itu. Kata dia, hakim perlu diberikan gaji yang cukup agar tidak terbebani “urusan duniawi” sehingga dapat banyak membaca, menimbang, dan merenungkan dengan seksama persoalan yang dihadapi guna menjatuhkan putusan dan memberikan keadilan yang berkualitas. “Jika gaji mereka dipenuhi, maka harus diikuti sanksi tegas bagi hakim yang terlibat korupsi atau suap. Jangan lagi ada toleransi bagi hakim yang nanti terlibat mafia peradilan,” tuturnya. (m49)

Dugaan Korupsi Pengadaan Barang Pada Polmed Medan

Majelis Hakim Tolak Eksepsi Dewi Komariah MEDAN (Waspada) : Eksepsi atau keberatan yang diajukan terdakwa Direktur CV Karya Medika Dewi Komariah atas dakwaan Jaksa Penuntut Umum (JPU), dalam perkara dugaan tindak pidana korupsi pengadaan alat pendidikan laboratorium dan bengkel jurusan teknik elektro Politeknik Negeri Medan sebesar Rp2,1 miliar, ditolak hakim Pengadilan Negeri (PN) Medan. Dalam putusan selanya, majelis hakim menyatakan, seluruh dakwaan Jaksa Penuntut Umum (JPU) sudah tepat sesuai perundangundangan yang berlaku. Sedangkanalasankuasahukumterdakwayang menyebutkan dakwaan jaksa lemah dan kurangnya bukti, menurut majelis hakim, hal itu sudah masuk dalam ranah materi pokok, sehingga harus dibuktikan nantinya dalam persidangan. “Eksepsi terdakwa tidak dapat diterima dan meminta JPU menghadirkan saksi dalam perkara itu pada persidangan berikutnya pekan depan,” tegas Ketua Majelis Hakim Sugiyanto. Pada persidangan lanjutan dengan agenda mendengarkan keterangan saksi-saki, JPU Netty Silaen dan Adelina menghadirkan Ekmon Sitompul selaku sekertaris panitia lelang, Sutan Pardede selaku anggota panitia. Dalam keterangan di persidangan, kedua saksi menyebutkan, dalam pelelangan peng

adaan alat pendidikan laboratorium dan bengkel elektro di Polmed, dengan pagu anggaran senilai Rp4,9 miliar, ada tiga perusahaan diantaranya CV Medika Karya, PT Atraman dan CV Mars Indo Jaya. Pada proses verifikasi yang mengacu pada persyaratan mengikuti lelang tender, kualifikasi SIUP perusahaan besar. Dari tiga perusahan tersebut, akhirnya panitia memenangkan CV Medika Karya. “Selaku pemenang tender pada saat itu, CV Medika karya dinilai telah memenuhi kriteria yang ditentukan,” terang Ekmon. Namun Sutan menyebutkan, keterlibatan dari Herman Taher selaku Direktur PT Antasri Cantika dalam penyedia barang merupakan kebijakan dari Direktur CV Medika Karya, Dewi Komariah, selaku pemenang tender. “Seluruh kegiatan penyedia barang ditentukan oleh terdakwa,” serunya. Tentang barang Microwave Network Analyzer dan Asesoris yang ditolak oleh Polmed selaku user dalam kegiatan, Sutan menyebutkan, penolakan barang oleh Kepala Laboratorium Polmed Morlan Pardede karena barang tersebut sudah rekondisi (bekas), tidak sesuai dengan spesifikasi yang diminta. “Pada saat itu barang diantar oleh Herman Taher atas perintah dari terdakwa,” tegasnya. Usai mendengarkan keterangan saksi-saksi, majelis hakim menunda sidang hingga pekan depan, guna mendengarkan keterangan saksi lainnya. (m38)

Rekonstruksi Kasus Pembakaran Di Kutalimbaru MEDAN (Waspada): Orangtua korban pembakaran di Kutalimbaru, nekad melakukan penusukan menggunakan ujung payung terhadap tersangka SS saat dilakukan rekonstruksi di halaman Polresta Medan, Kamis (12/4). Perbuatan tersebut dilakukan Rosmelia br Silaban orangtua dari Ricardo Jeferson Sitorus karena merasa kesal dengan tersangka yang nekad melakukan pembakaran terhadap anaknya saat menyaksikan rekonstruksi yang dipimpin Kanit Ranmor AKP Ronald F. Sipayung. Namun aksi tersebut berhasil dicegah petugas polisi yang mengawal jalannya rekonstruksi. Kepada wartawan, Rosmelia mengatakan, kecewa dengan kinerja penyidik Polresta Medan karena saksi Koptu Edi Suroso tidak dihadirkan dalam rekonstruksi tersebut. “Kalau oknum TNI itu ikut rekonstruksi, saya mau menanyakan langsung kepada yang bersangkutan bagaimana cerita sebenarnya sehingga terjadi peristiwa seperti ini,” sebutnya. Ditanya wartawan hukuman apa yang cocok kepada ketiga tersangka, Rosmelia menyatakan harapannya dihukum seadiladilnya sesuai perbuatannya kalau bisa pun hukuman mati. Sementara itu dalam rekonstruksi yang dimulai pukul 11:00 dan berakhir pukul 13:30 dihadiri pihak kejaksaan dari Kejari Lubuk Pakam dan penasehat hukum tersangka yakni Ermansyah. Tersangka ET, SS, dan ESG diperankan langsung, sedangkan korban Ricardo Jeferson Sitorus dan Marco Siregar diperankan PHL Polresta Medan. Hadir juga tiga teman korban yakni Bambang Irawan, Briptu Albertus Alam Permana Zebua, dan Moses Purba. Sedangkan tersangka lainnya yang masih diburon diperankan anggota polisi. Rekonstri dengan 24 adegan itu dimulai ketika Ricardo J Sitorus dihubungai melalui handphone oleh Edi Suroso sementara korban Marco Siregar, saksi Bambang Irwanto, Albertus Zebua, dan Moses Purba sudah berada di dalam mobil Kijang BK 1020 HK. Mereka berlima kemudian pergi menuju warung belut di Desa Glugur Rimbun Pancur Batu dan bertemu dengan Suroso. Kemudian Bambang dibonceng Suroso menggunakan sepedamotor mensurvei target operasi Kelana. Setelah berada di kolam Samsul, Suroso menghubungi ke empat korban yang kemudian menggunakan mobil

menyusul ke lokasi. Kemudian Suroso memberi saran kepada Bambang Irwanto untuk menghubungi Kelana dengan mengaku sebagai Iwan Sembling meminta tolong membelikan minyak bensin dengan alasan sepedamotornya habis minyak. Suroso kemudian bersembunyi dibawah pohon pisang dan empat rekannya bersembunyi dibalik mobil. Kelana kemudian ke lokasi dan dipanggil Bambang Irwanto. Begitu Kelana berhenti, datang Marco Siregar langsung merangkul Kelana yang kemudian meronta dan melakukan perlawanan. Albertus Zebua kemudian mengatakan saya polisi dari Polda, mana handphone kamu. Kelana langsung membuang handphonenya dan berteriak maling sambil berlari ke arah kolam pancing. Sedangkan para korban kemudian pergi dari lokasi dan melaju ke Jalan Kampung Merdeka. Berkisar 30 meter masyarakat sekitar sudah banyak yang berdiri di pinggir jalan dan berteriak maling dan mengejar mereka. Sedangkan tersangka SS begitu menerima kabar dari temannya menyampaikan berita tersebut kepada teman-temannya di warung Kaltu. Mereka kemudian menuju ke simpang Jalan Laubekeri dan melihat warga sudah merintangi jalan dengan sepedamotor. Begitu mobil yang ditumpangi korban melintas langsung dihalau massa. Korban Ricardo Sitorus kemudian keluar dari mobil dan berteriak saya polisi sambil mengacungkan senjata softgun. Kemudian Albertus Zebua juga turun dari mobil dan berteriak kami dari Polda dengan mengeluarkan kartu anggota dan dirampas masyarakat. Massa kemudian meminta semua yang ada di dalam mobil turun. Setelah itu mereka melakukan penganiayaan terhadap kedua korban hingga kritis sampai datang petugas Polsek Kutalimbaru. Sedangkan ketiga temannya berhasil melarikan diri. Anggota Polsek Kutalimbaru kemudian mencoba menyelamatkan kedua korban dan memasukkan ke dalam mobil anggota Polsek Kutalimbaru. Namun massa yang sudah emosi kemudian menariknya keluar dan kembali melakukan penganiayaan. Dalam keadaan tidak berdaya, kedua korban ditumpukkan di bawah mobil Innova BK 1020 HK setelah itu dengan menggunakan kertas salah seorang pelaku yang masih diburon membakar kedua korban. (m39)

Waspada/Rudi Arman

SEORANG tersangka (masih buron) yang diperankan anggota Polresta Medan terlihat membakar kertas sebelum membakar kedua korban saat dilakukan rekonstruksi kasus pembakaran di Kutalimbaru di Polresta Medan, Kamis (12/4).


Medan Metropolitan Polresta Tangkap Penganiaya PRT Asal Indramayu

WASPADA Jumat 13 April 2012

Jurtul Togel, Pencuri Kabel Diringkus

MEDAN (Waspada): Polsek Percut Seituan berhasil meringkus seorang penulis toto gelap (togel) KJ, 30, warga Jln. Pancing Gang Waras, Kec. Medan Tembung, dari warung kopi tidak jauh dari rumahnya, Senin (9/4) sekira pukul 10:00 Informasi yang diperoleh di kepolisian, Selasa (10/4), dari tersangka KJ disita barang bukti satu unit handphone yang berisikan angka-angka togel, buku tafsir mimpi, buku tulis, pulpen warna hitam, dan uang sebesara Rp59 ribu. Pada hari yang sama, petugas membekuk pencuri kabel tower berinisial HS, 16, warga Jln. Mesjid Taufik, Kec. Medan Perjuangan, dan BT, 25, warga Jln. Tuamang, Kec. Medan Tembung. Kedua tersangka mencuri kabel tower yang berada di Jln. Tuasan. Aksi kedua tersangka dipergoki oleh karyawan tower Dwi Arpos Syahputra, 26, dan melaporkannya kepada polisi. Akhirnya kedua tersangka ditangkap. Dari tersangka disita barang bukti 30 meter kabel tower, satu tang, dan sebilah pisau. Kapolsek Percut Seituan Kompol Maringan Simanjuntak melalui Kanit Reskrim AKP Faidir Chan mengatakan, tersangka jurtul togel KJ dan dua pencuri kabel tower masih dalam pemeriksaan dan sudah dijebloskan ke sel tahanan. (h04)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari



GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 08.40 12.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Bandung Surabaya

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7986 QZ-7610

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 05.45 08.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Bandung QZ-7487 12 Surabaya QZ-7611 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.30 19.05

Kuala Lumpur MH-860 08.50 Kuala Lumpur MH-864 18.40

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA




U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

MEDAN (Waspada): Petugas Sat Reskrim Polresta Medan menangkap majikan yang melakukan penganiayaan terhadap Pembantu Rumah Tangga (PRT) asal Indramayu Jawa Barat Khu, 16, dan Mu, 17, Kamis (12/4) sore. Ketiga tersangka yang ditangkap dari Swiss Belhotel Medan itu yakni Benny Candra dan istrinya Lili Wikimiyati serta seorang anaknya KeniWijaya. Mereka langsung diboyong ke Unit Perlindungan Perempuan dan

Anak Polresta Medan. Informasi yang diperoleh Waspada, ketika dua PRT tersebut berhasil melarikan diri, Rabu (28/3), ketiga tersangka langsung meninggalkan rumahnya di Jln. Graha Sunggal Blok H No. 9, Kecamatan Medan Sunggal dan menginap di hotel tersebut. Kasat Reksrim KompolYoris Marzuki kepada wartawan, Kamis (12/4) sore membenarkan penangkapan terhadap tiga tersangka penganiaya PRT.“Saat ini, kami sedang melakukan rekonstruksi di rumah pelaku, untuk mengetahui bagaimana tersangka melakukan penganiayaan terhadap pembantunya,” kata Yoris.

Sementara itu, orangtua Mu, Tarzana mengapresiasi kinerja Polresta Medan yang berhasil menangkap ketiga pelaku penganiayaan tersebut.“Alhamdulillah. Saya acungkan jempol kepada Polresta Medan yang begitu cepat menangkap majikan anak saya ini,” kata Tarzana. Dia berharap, pelaku penganiayaan dihukum seberatberatnya. “Saya juga minta agar mereka mau bertanggungjawab atas perbuatannya. Karena perbuatan mereka, sendi bagian bahu kiri anak saya terlepas. Sekarang dia terlihat kurus dan mengalami trauma. Kalau tenaganya sudah tidak dibutuhkan lagi, sebaiknya dipulangkan.

KPKPos - Polri Watch Gelar Seminar MEDAN (Waspada): Unsur Pimpinan Komisi Pemberantasan Korupsi (KPK) dijadwalkan tampil menjadi pembicara dalam Seminar Nasional Pencegahan Tindak Pidana Korupsi AparaturNegara,diBalaiCitraHotel Tiara, Medan , Sabtu (14/4). Seminar yang diselenggarakan Surat Kabar Mingguan KPKPos dan PolriWatch ini juga akan menghadirkan pembicara lainnya dari Markas Besar Kepolisian Republik Indonesia (Mabes Polri), Indonesia Corruption Watch (ICW), dan Dr Eggi Sudjana, SH, Msi dari unsur advokat dengan moderator Dr Hinca Panjaitan. Ketua Panitia Seminar Khomaidi Hambali didampingi Sekretaris Arie Nurwanto mengatakan, Plt Gubernur Sumatera Utara bersama Kapoldasu dan Kajatisu diharapkan hadir guna memberikan kata sam-

butan. Seminar ini mengundang ratusan peserta dari unsur pemerintahan dan lembaga negara, pimpinan perguruan tinggi, partai politik, LSM, mahasiswa dan insan pers. “Sekitar 300-an undangan sudah kita sebar, termasuk undangan kepada para bupati/ wali kota, Kapolres dan Kajari di Sumatera Utara,” kata Khomaidi kepada wartawan, Selasa (10/4). Sementara itu, Pimpinan Umum KPKPos Iskandar, ST didampingi Ketua Lembaga Pemantau Kinerja Polri PolriWatch Ikhwaluddin Simatupang menjelaskan, dasar pemikiran diadakannya seminar ini karena korupsi merupakan sebuah kejahatan yang memiliki dampak luar biasa terhadap segala tatanan kehidupan baik berbangsa dan bernegara.

“Tingkat korupsi di Indonesia masih sangat tinggi. Bahkan sampai detik ini, bangsa Indonesia belum mampu keluar dari lingkaran setan kejahatan korupsi. Budaya korupsi begitu menggurita di semua sendi kehidupan masyarakat terlebih di dalam pemerintahan,” bebernya. Pemberantasan korupsi terkesan berjalan sangat lamban. Tidak ada perubahan signifikan terhadap penurunan angka korupsi, justru yang terjadi angka korupsi semakin bertambah. “Melalui seminar nasional ini, diharapkan dapat menemukan metode pencegahan tindak pidana korupsi di tingkat aparatur negara dengan meningkatkan pengawasan masyarakat terhadap kebijakan pengelolaan keuangan negara atau daerah,” jelas Iskandar yang juga Pemimpin Umum Star Media Group.(m25)

MEDAN (Waspada): Instruksi Plt Gubernur Sumatera Utara Gatot Pujo Nugroho untuk memperbaiki serapan Anggaran Pendapatan Belanja Daerah (APBD) 2012 ternyata hanya pepesankosong.Terbuktiditriwulan pertama ternyata tidak lebih baik dari 2011 alias masih rendah. Kepala Biro Keuangan Pemprov Sumut Mahmud Sagala mengatakan serapan anggaran hingga 5 April 2012 masih sekitar 9,22% dari Rp7,33 triliun. Itupun umumnya untuk belanja tidak langsung seperti gaji dan honor pegawai. Disinggung mengenai rencana Pemprov Sumut yang akan melakukan evaluasi setiap tiga bulan terkait serapan anggaran sejak awal tahun seperti yang dikemukakan Gatot di akhir tahun lalu, Mahmud mengaku belum bisa dilaksanakan. Sebab tidak ada yang bisa dievaluasi

mengingat serapannya masih untuk kepentingan belanja tidak langsung. “Belum bisa evaluasi,” ujar Mahmud menjawab wartawan di Kantor Gubernur Sumut Jalan Pangeran Diponegoro, Medan, Selasa (10/4). KepalaBagianPerbendaharaan Biro Keuangan Pemprov Sumut Ilyas menambahkan, serapan 9,22% tersebut ternyata tidak lebihbaikdaritahunsebelumnya. Pada tanggal yang sama pada 2011sudahmencapai11,08%dari total APBD Rp 5,355 triliun. Dari realisasi serapan anggaran yang 9,22% tersebut di antaranya Rp109 miliar untuk belanja langsung dan Rp725 miliar untuk pembayaran gaji. Kondisi tersebut terjadi karena ada keterlambatan pencairan uang persediaan dan gaji yang biasanya sudah bisa dikeluarkan Januari, namun 2012 ini baru bisa dilakukan pada Maret.

Secara persis Ilyas tidak mengetahui penyebabnya hanya saja ada kemungkinan beberapa satuan kerja perangkat daerah (SKPD) disibukkan dengan penyusunan laporan pertanggungjawaban di awal tahun. Berdasarkan catatan, Plt Gubsu Gatot Pujo Nugroho jelang akhir tahun lalu sempat berulangkali mengutarakan kekesalannya, terkait serapan anggaran yang tidak stabil dari awal hingga akhir tahun sehingga membuat pekerjaan menumpuk menjelang tutup pembukuan. Saat itu Gatot meminta agar serapan anggaran sudah bisa dimulai sejak awal tahun. Hal yang sama juga diungkapkan Sekretariat Daerah Pemprov (Sekdaprov) Sumut Nurdin Lubis bahwa paling lama Februari setiap SKPD sudah mulai bekerja agar serapan anggaran lebih maksimal.(m28)

Jangan disiksa,” katanya. Saat menjadi PRT di rumah majikannya, Mu dan Khu kerap mendapat siksaan. Parahnya lagi, saat mulai lelah, mereka tidak diperbolehkan istirahat. Bahkan, keduanya dihadiahi air seni sang majikan. “Dua sampai tiga bulan

kami di situ, mereka masih baik sama kami. Setelah itu, kami sering dipukuli, dilempar dan selalu disiksa jika membuat kesalahan. Kami juga tidak pernah digaji. Kami juga dikasih air seni, saat mulai merasa lelah,” cerita Mu, Sabtu (7/4). Akibat sering mengalami

siksaan, Rabu (28/3), kedua PRT ini melarikan diri dari rumah majikannya. Saat itu, sang majikan tidak berada di rumah. Usai melarikan diri dengan cara melompat dari lantai II, Khu dan Mu ditolong pedagang warung nasi di sekitar Universitas Pancabudi Medan. (m39/h02)

Rektor USU Ajukan Pengganti Purek III Ke MWA MEDAN (Waspada): Rektor Universitas Sumatera Utara (USU) mengajukan satu calon untuk jabatan pembantu rektor (Purek) III ke MajelisWali Amanat (MWA), pasca pengunduran Prof Eddy Marlianto selaku pejabat lama. “Kita upayakan akhir bulan ini (April) sudah ada pejabat yang baru,” kata Prof Dr Syahril Pasaribu kepada Waspada di kampus USU, Senin (9/4). Dia mengakui, Purek III USU yang lama mengundurkan diri dari jabatannya. Syahril tidak menyebutkan alasan pengunduran diri yang bersangkutan, namun dia menganggap publik telah mengetahuinya. Untuk saat ini, kata dia, Purek I Prof Dr Zulkifli Nasution merangkap jabatan sebagai Purek III. “Sampai dipilihnya Purek III USU yang baru, sementara ini Purek I yang bertanggung jawab,” sebutnya. Menurut dia, penetapan pejabat Purek III definitif perlu dilakukan secepatnya. Alasannya, posisi ini memiliki wewenang dan tugas yang besar, sehingga akan cukup merepotkan bila dirangkap dalam waktu cukup lama oleh purek lainnya. “Banyak unit kegiatan mahasiswa (UKM) dan kegiatan-kegiatan ekstra kurikuler yang membutuhkan peran dan keberadaan Purek III USU yang membidangi kemahasiswaan,” ujarnya. Di sisi lain, diakui rektor, tugas yang saat ini tengah dijalankan oleh Purek I Zulkifli Nasution juga cukup berat, di antaranya adalah terkait penerimaan mahasiswa baru untuk Tahun Akademik (TA) 2012/2013. Ditanya tentang nama-nama calon yang akan diajukannya kepada MWA untuk mengisi jabatan itu, Syahril Pasaribu masih merahasiakannya.

“Hanya saya yang tahu nama calon pejabat bersangkutan,” tuturnya. Untuk sebagian kalangan masyarakat, khususnya sivitas akademika USU, pengunduran diri pejabat Purek III USU saat ini sudah diperkirakan seiring mencuatnya persoalan pribadi yang bersangkutan ke ranah publik. Uang insentif Prof Syahril Pasaribu juga menegaskan, penghentian pemberian honorarium atau uang insentif bagi unsur pimpinan di lingkungan USU adalah untuk efisiensi anggaran. Hasil efisiensi itu sendiri nantinya akan dimanfaatkan universitas untuk kebutuhan lainnya, seperti pembangunan laboratorium, pengadaan fasilitas, dan sebagainya. Sementara akibat penghentian uang insentif itu, muncul keresahan dari kalangan unsur pimpinan di lingkungan USU. Kata rektor, pencabutan honorarium itu sendiri karena selama ini ada dua sumber insentif bagi pimpinan, yaitu dari fakultas dan universitas. Karena dinilai tidak efisien, akhirnya pemberian honorarium dari universitas dihentikan. Selain untuk pengadaan fasilitas di lingkungan USU, dana hasil efisiensi itu juga bisa dimanfaatkan untuk kebutuhan lainnya. Sebagai contoh membantu Fakultas Ilmu Kebudayaan (FIB) yang selama ini masih cukup kekurangan. Meski dicabut, rektor menegaskan, pihak fakultas sebenarnya masih bisa memanfaatkan dana tersebut. Caranya adalah dengan memasukannya ke dalam Rencana Kerja Anggaran Tahunan (RKAT) 2012. Anggaran itu masih bisa dimasukkan ke dalam RKAT 2012. Setelah diperbaiki dan dimasukkan, maka akan diberikan. (m49)

Serapan APBD Sumut Masih Rendah Biaya Besar Kandidat Gubsu

Mhd Akbar Dan Siti Alifa Juara Umum Try Out MEDAN (Waspada): Mhd. Akbar (SMAN 1 Medan) dan Siti Alifa (SMKN 8), berhasil meraih predikat Juara Umum pada try out Ujian Nasional gratis untuk SMA sederajat yang diselenggarakan DPW (Dewan Pimpinan Wilayah) Partai Amanat Nasional (PAN) Sumut di TD Pardede Hall Medan, baru-baru ini. “Mereka berhak menerima hadiah laptop, trofi dan voucher serta piagam penghargaan,” kata Pimpinan BT/BS BIMA Indonesia dr. Robert Valentino Tarigan, SPd kepada wartawan di Medan, Kamis (12/4). Menurut Valentino, Mhd. Akbar merupakan juara umum SMA dan Siti Alifa juara umum SMK. Juara-juara lainnya pada try out tersebut antara lain, kelompok IPS 1, 2 dan 3: Amar Ma’ruf (SMAN 3), Sarah Nur (MAN 2) dan Nurlita Sari (SMAN 20).KelompokIPA1,2,dan3:Mhd Akbar (SMAN 1), M Reza (SMAN 1) dan Desta Senori (SMAN 15).

Kelompok SMK Non-Teknik 1, 2, dan 3: Siti Alifa (SMKN 8), Ainil Mu r n i ( S M K N 7 ) d a n Halimatusakdiah(SMKN6).SMK Teknik 1, 2, dan 3: Freddy Septei (SMKN 3), Heri Setiawan (SMKN 3), Fauziah Syaf (SMKN 3). Kegiatan try out ini diselenggarakan DPW PAN Sumatera Utara bekerjasama dengan Dewan Pimpinan Pusat (DPP) Penegak Amanat Reformasi Rakyat (PARRA) dan BT/BS BIMA. “Kegiatan bertema ‘Ajang Kompetisi Siswa SMA se-Kota Medan’ ini merupakan sumbangsih DPW PAN Sumut terhadap dunia pendidikan di Sumut,” ujar Ketua DPW PAN Sumut H Syah Afandin, SH. Sementara, Ketua DPP PAKKARRusliHalimmenyambutbaik kegiatan yang digelar DPW PAN ini.“Dengan mengikuti try out ini, para siswa sudah mengetahui bagaimanamenghadapiUNyang sesungguhnyasehingganantinya tidak bingung lagi,” ujarnya.

SedangkanValentino selaku Pimpinan BT/BS BIMA Indonesia menyambut baik kepedulian DPW PAN Sumut dalam bidang pendidikan. “Kita berharap partai-partai lain dan para tokohnya peduli pada dunia pendidikan.“Tidak ada bangsa yang bisa maju jika mengabaikan pendidikan,” terangnya. Ketua Panitia Try Out Surkani menjelaskan, kegiatan ini diikuti sekitar lima ribu peserta. Juara umum try out memperoleh hadiah laptop dari Ketua DPW PAN Sumut Syah Afandin, trofi, piagam penghargaan dan voucher untuk mengikuti bimbingan di BT/BS BIMA. Sedangkan pemenang lainnya, memperoleh trofi dan voucher mengikuti bimbingan di BT/BS BIMA serta piagam penghargaan yang ditandatangani Menteri Koordinator Perekonomian Ir M Hatta Rajasa dan Ketua DPW PAN H Syah Afandin, SH.(m25)


MHD Akbar (dua dari kanan) dan Siti Alifa (tengah) berfoto bersama dr. Robert Valentino Tarigan, SPd (kanan), Rusli Halim (tiga dari kanan) dan Surkani (tiga dari kiri).

Membodohi Masyarakat MEDAN (Waspada): Komentar mantan Wakil Wali Kota Medan H Ramli Lubis dan Wakil Ketua DPRD Sumut H Chaidir Ritonga tentang biaya seorang kandidat Gubsu yang begitu besar mencapai Rp100 miliar, tidak mendidik dan membodohi masyarakat. “Kalau memang seorang kandidat Gubsu mengeluarkan biaya sebesar itu, ke depan diragukan dapat memimpin Sumatera Utara dengan baik,” kata Ketua DPW PKB Sumatera Utara Ance Selian, di Istana Maimon Medan, Selasa (10/4). Kenapa, kata Ance, gubernur yang diharapkan masyarakat ke depan yaitu gubernur yang bisa menggali sumber daya alam dan mampu membangun sumber daya manusia (SDM) handal. Menurut dia, kalau kandidat Gubernur Sumut mengeluarkan dana Rp100 miliar, ke depan mereka akan memikirkan bagaimana uang itu harus kembali. Jadi, setidaknya setiap tahun harus mengumpulkan dana Rp20 miliar dan sebulan minimal Rp1,8 miliar, sementara gaji gubernur tidak sebesar itu. Apakah mengembalikan dana nantinya dengan cara-cara tidak halal, itulah yang perlu diwaspadai sejak awal dari kandidat-kandidat Gubsu tersebut. Dia menilai komentar mantanWakilWali Kota

(Wawa) Medan Ramli Lubis dan Wakil Ketua DPRD Sumut Chaidir Ritonga adalah sikap membodohi masyarakat Sumut, karena komentar itu dari anggota dewan biasanya seperti keputusan undang-undang, masyarakat seakan-akan lebih percaya. Padahal, tingkat penyerapan informasi seperti itu minimal warga Sumut berpendidikan sarjana lebih kurang 65 persen, ternyata yang ada saat ini dibawah 10 persen. Ance Selian yang pernah 7 tahun belajar di Pesantren Al Muchtariah Tapsel menyatakan tidak sependapat dengan komentar itu. Kenapa, katanya, masyarakat Sumut tidak semata-mata mengharapkan Sembako dari kandidat Gubsu, namun mereka menginginkan visi dan misi yang jelas serta integritas tinggi membangun Sumatera Utara. Besarnya biaya yang dikeluarkan tidak selamanya menjadi patron atau patokan bagi masyarakat. Pemimpin Sumut ke depan harus mampu membangun Sumatera Utara menjadi masyarakat adil makmur. Prinsip PKB, sebut Ance, kandidat Gubernur boleh siapa saja, namun sikap integritas membangun Sumut harus tinggi serta orang yang dikenal secara luas. “Kalau mengeluarkan uang banyak dikhawatirkan ke depan tidak maksimal membangun Sumut,” ujarnya. (m32)

Ratusan Warga Robohkan Pagar Perumahan PT ACR BELAWAN (Waspada): Tidak terima lahan seluas 74 hektar diserobot, ratusan warga yang tergabung dalam kelompok penggarap merobohkan pagar proyek pembangunan perumahan milik PT Agung Cemara Realty (ACR) di Pasar IV Desa Hevetia, Kec. Labuhan Deli, Selasa (10/4). Sekitar pukul 12:00 siang, seratusan massa membawa kayu dan benda tumpul lain secara bersama-sama memasuki areal lahan yang mereka perebutkan dan menuntut agar PT ACR selaku pengembang menghentikan pembangunan perumahan itu karena dianggap lahan masih bersengketa dan dalam proses persidangan. Sampai di lokasi, warga yang sudah lama kesal dengan sikap PT ACR merusak barak para pekerja dan memukul seorang pengawas ketika berusaha mengambil gambar warga. Massa semakin brutal, sehingga sejumlah petugas Polsek Medan Labuhan yang turun ke lokasi tidak mampu menghalau gerakan massa. Belasan buruh yang sedang bekerja di lokasi perumahan itu lari menyelamatkan diri dari amukan massa. “Tanah ini masih dalam proses persidangan, jadi siapapun tidak boleh melakukan aktivitas di sini. Kami minta pengembang secepatnya keluar, kalau tidak kami akan kembali beraksi dengan massa yang lebih besar,” kata pimpinan aksi B Simanjuntak. Warga yang umumnya petani itu, juga menuntut keadilan terhadap mereka ditegakkan. Warga menuding pemerintah dan kepolisian setempat bertindak pilih kasih dan membiarkan pengembang beraktivitas di lahan sengketa, sementara warga dilarang dan sering mendapat tindakan intimidasi dari preman yang diduga dibayar PT ACR. “Selama ini polisi diam saat kami melapor dan jadi korban tindakan kekerasan preman bayaran itu. Kami menduga ada oknum yang terlibat dalam masalah ini,” ujar Simajuntak.

Walau telah beberapa jam melakukan aksi, tidak satupun pekerja atau perwakilan PT ACR yang bersedia menemui warga. Akibatnya warga mendirikan tenda posko di lahan tersebut. “Kita akan bertahan di sini sampai pemerintah atau pengembang mau menemui kami,” sebutnya. Sementara itu, Camat Medan Deli Dedi Maswardi mengatakan, awalnya perebutan lahan terjadi antara kelompok Titin Kirniawati Cs, PTPN II, dan Al Washliyah. Berdasarkan putusan pengadilan, Titin Kurniawati dinyatakan sebagai pemilik lahan. Belakangan Al Washliyah melakukan perlawan, sehingga eksekusi terhadap semua lahan terhalang. “Lahan sekarang diributi warga setelah di eksekusi pengadilan sekitar bulan Februari 2011. Padahal lahan itu telah menjadi milik Titin Kurniawati Cs dan berkekuatan hukum tetap,” katanya, Rabu (11/4). Hal yang sama dikatakan Sekcam Labuhan Deli Gongma Harahap. Menurutnya warga yang datang ke lahan itu umumnya bukan warga Labuhan Deli, melainkan warga dari sejumlah kecamatan lain dan diduga tidak tahu tentang masalah tersebut.“Kita bingung entah dari mana dan siapa yangmembawawargadatangkelahanitu,”ujarnya. Pantauan Waspada, puluhan orang yang diduga berasal dari kelompok pengembang perumahan masih berjaga-jaga di dekat arel yang diperebutkan itu. Mereka berkumpul di sekitar halaman Puskesmas Labuhan Deli yang bersebelahan dengan gedung SMA Negeri I Labuhan Deli. Selain itu, belasan petugas Polres Pelabuhan Belawan juga masih berjaga-jaga di lokasi. “Kita hanya menjaga agar tidak terjadi bentrok fisik antara warga dan pengembang. Sedangkan masalah kepemilikan lahan, kita serahkan ke BPN,” kata Kabag Ops Polres Pelabuhan Belawan Kompol Dayan di lokasi. (h03)


A7 2.580.446 Siswa SMA Siap Ikuti UN

WASPADA Jumat 13 April 2012

JAK ARTA ( Waspada): 2.580.446 Siswa SMA/ SMALB/MA/SMK seluruh Indonesia siap mengikuti Ujian Nasional (UN) 16-19 April. Sementara di Sumut tercatat ada 751 ribu siswa yang mengikuti UN 2012. Menteri Pendidikan dan Kebudayaan, Muhammad Nuh dalam jumpa pers di Jakarta, Kamis (12/4) mengatakan, kecurangan dalam pelaksanaan UN tahun ini sulit terjadi. Selain percetakan yang bersifat regional dan aman, soal UN juga dibedakan menjadi 5 tipe untuk Antara

ANGGOTA KPU: (Searah jarum jam) Anggota Komisi Pemilihan Umum (KPU) yang baru, Ida Budianti, Sigit Pamungkas, Arif Budiman, Feri Kunia, Hadar Nafis Gumay , Husni Kamil Malik dan Juri Ardiantoro saat pelantikan anggota KPU dan Bawaslu di Istana Negara, Jakarta, Kamis (12/4). Presiden Susilo Bambang Yudhoyono melantik tujuh anggota KPU dan lima anggota Badan Pengawas Pemilu (Bawaslu).

Presiden Lantik Anggota KPU Dan Bawaslu JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono melantik dan mengambil sumpah tujuh anggota Komisi Pemilihan Umum dan lima anggota Badan Pengawas Pemilu (Bawaslu) di Istana Negara, Jakarta, Kamis (12/4) siang. Pelantikan anggota KPU periode 2012-2017 dilaksanakan berdasarkan Keppres nomor 34 P 2012 dan Bawaslu sesuai Keppres nomor 35 P 2012. Keppres tersebut ditandatangani pada 5 April 2012 dan berlaku sejak ditandatangani oleh Presiden. Ketujuh anggota KPU yang dilantik adalah

Sigit Pamungkas, Ida Budiati, Arief Budiman, Husni Kamil Malik, Ferry Kurnia, Hadar Nafis Gumay, dan Juri Ardiantoro. Sementara kelima anggota Bawaslu yang dilantik yakni Muhammad, Nasrullah, Endang Wihdatiningtyas, Daniel Zuchron dan Nelson Simanjuntak. Hadir dalam pelantikan itu Wakil Presiden Boediono, Ibu Negara Ani Yudhoyono dan Herawati Boediono. Hadir pula para menteri kabinet Indonesia Bersatu II dan juga ketua KPU periode sebelumnya Abdul Hafiz Anshary.

MK Tolak Permohonan Abu Bakar Ba’asyir JAKARTA (Antara): Mahkamah Konstitusi menolak permohonan Abu Bakar Ba‘asyir yang menguji Pasal 21 ayat (1) Undang-Undang Nomor 8 Tahun 1981 tentang Hukum Acara Pidana (KUHAP). “Permohonan Pemohon untuk Pasal 21 ayat (1) Undang-Undang Nomor 8 Tahun 1981 tentang Hukum Acara Pidana tidak dapat diterima,” kata Ketua Majelis Hakim Mahfud MD, saat membacakan putusan di Jakarta, Rabu (11/4). Menurut Mahfud yang didampingi tujuh hakim konstitusi, dalil pemohon untuk sebagian “ne bis in idem” (sebuah perkara dengan obyek sama, para pihak sama dan materi pokok perkara yang sama, yang diputus oleh pengadilan yang telah berkekuatan hukum tetap yang mengabulkan atau menolak, tidak dapat diperiksa kembali untuk kedua kalinya). Dalam pertimbangannya, mahkamah mengatakan bahwa Pasal 21 ayat (1) KUHAP, sudah pernah diputus oleh Mahkamah dalam permohonan Nomor 018/PUU-IV/2006, tanggal 20 Desember 2006 dan permohonan Nomor 41/PUU-VIII/2010, 10 Maret 2011. Dalam Putusan Nomor 018/PUU-IV/2006, bertanggal 20 Desember 2006 tersebut, Mahkamah menyatakan pasal tersebut tidak bertentangan dengan UUD 1945, sehingga permohonan tersebut ditolak. “Menimbang bahwa karena norma yang diuji sama, dan pasal yang dijadikan pengujian

yakni Pasal 28D ayat (1) UUD 1945 maka dalam permohonan a quo pengujian atas pasal tersebut adalah ne bis in idem, sehingga pertimbangan hukum dan amar putusan dalam perkara Nomor 018/PUU-IV/2006, tanggal 20 Desember 2006, mutatis mutandis berlaku untuk permo-honan a quo,” kata Hakim Konstitusi Hamdan Zoelva, saat membacakan pertimbangan mahkamah. Abu Bakar menguji pasal 21 ayat (1) KUHAP yang berisi perintah penahanan lanjutan bagi tersangka berdasarkan bukti yang cukup karena kekhawatiran dapat melarikan diri, merusak atau menghilangkan barang bukti tidak berdasar KUHAP. Menurut Abu Bakar dalam pasal tersebut juga disebutkan penahanan lanjutan dilakukan karena adanya kekhawatiran bagi tersangka akan melarikan diri dinilai terlalu subyektif. Pemohon juga menilai implementasi dari pasal tersebut tidak konsisten, sehingga pihak penyidik “seenaknya” saja apakah terdakwa tersebut ditahan atau tidak. Pasal 21 ayat (1) berbunyi: “Perintah penahanan atau penahanan lanjutan dilakukan terhadap seorang tersangka atau terdakwa yang diduga keras melakukan tindak pidana berdasarkan bukti yang cukup, dalam hal adanya keadaan yang menimbulkan kekhawatiran bahwa tersangka atau terdakwa akan melarikan diri, merusak atau menghilangkan barang bukti dan atau mengulangi tindak pidana”.

masing-masing kelas. “Masing-masing tipe lembaran soal itu bukan sekadar diacak nomornya saja, tapi memang berbeda-beda soalnya. Jadi pasti sulit dibocorkan,” tegas mendikbud. Selain itu, pengawasan juga diperketat. Dari 148.352 ruang kelas yang digunakan, jumlah pengawas dari perguruan tinggi mencapai 296.704 orang. Untuk Sumut, ada 4.154 ruang kelas dengan 838 pengawas. Dikatakan Nuh, pihaknya bersama Badan Standar Nasional Pendidikan (BSNP) dan Ba-

V DPR Muliadi mendesak pemerintah agar segera membangun rusun di daerah-daerah pusat perkotaan, dalam rangka tata ruang kota serta mengurangi pemukiman kumuh dan kemacetan. “Banyak orang yang kerja di kota besar seperti Jakarta tapi rumahnya di Bekasi, Tangerang maupun Depok, namun dari sektor transportasi umum tidak memadai dan akhirnya mereka pakai kendaraan pribadi seperti motor. Oleh karena itu rusun jangan dibuat di pinggiran, harusnya daerah perkotaan seperti segitiga emas, Kuningan, Sudirman dan Thamrin,” ujar Muliadi. Muliadi mengatakan, pembangunan rumah susun di perkotaan akan mengurangi tingkat kemacetan yang cukup tinggi di Jakarta sekaligus mendukung pengaturan tata letak kota. “Me-mang tanahnya agak mahal, tapi itu lebih efisien. Apalagi rumah susun ini juga di subsidi,” tuturnya. Akan tetapi Deputi Perumahan Formal Kementerian Perumahan Rakyat (Kemenpera) Pangihutan Marpaung mengakui, pembangunan rumah susun 1.000 tower yang digagas oleh mantan Wakil Presiden RI 2004-2009 Jusuf Kalla saat ini baru tercapai 10% atau 138 tower. Hal ini disebabkan tiga kendala yakni, persoalan lahan, infrastrktur dan distribusi. “Masalah utamanya adalah lokasi yang tidak terstruktur dari barat ke timur, sehingga investasinya menjadi besar,” ungkap Pangihutan. (j03)

Pemerintah Berharap Pembahasan BPIH Cepat Selesai JAKARTA (Waspada): Pemerintah diwakili KomisiVIII DPR RI bersama Kementerian Agama berharap pembahasan Biaya Penyelenggaraan Ibadah Haji (BPIH) tahun 1433 hijriah/2012 dapat selesai secepatnya. Sehingga calon jamaah haji Indonesia yang akan melaksanakan rukun Islam kelima tersebut, sudah dapat mengetahui berapa besar BPIH yang dikeluarkan. Sekretaris Ditjen Penyelenggaraan Haji dan Umrah Kemenag Cepi Supriatna kepada wartawan di kantor Kemenag Jakarta, pekan lalu menyebutkan, pembahasan dengan Komisi VIII DPR RI, hingga kini masih berlanjut selama sepekan ini. Untuk musim haji 2012 ini, jemaah haji Indonesia membutuhkan 194 ribu pemondokan. Tim perumahan yang kini masih bertugas di Arab Saudi dan sudah mendapatkan 60 ribu pemondokan. Hal ini jelas masih jauh dari kebutuhan. Kendati penyelenggaraan ibadah haji masih jauh, tim perumahan harus bergerak cepat karena dikhawatirkan pemondokan terdekat diambil jemaah dari negara lain. Menurut Cepi, persoalan pemondokan pada

musim haji 2012 akan jauh lebih berat untuk mendapatkan di areal paling dekat dengan Masjidil Haram, Mekkah. Pasalnya, pada 2012 ini sudah 1700 bangunan dirobohkan sebagai dampak dari perluasan kawasan kompleks Masjidil Haram. Dengan demikian, untuk mendapatkan bangunan terdekat tentu tidak semudah seperti tahun lalu. Perlu diketahui harga sewa pemondokan pada musim haji 2011 sebesar 3700 Riyal, yang ditanggung tiap jamaah sebesar 3150 Riyal. Sementara pemerintah memberikan subsidi 550 Riyal yang diambil dari dana optimalisasi haji. “Soal besaran biaya ini kini menjadi pembahasan serius di Komisi VIII DPR RI,” ujar Cepi Supriatna. Naiknya harga bahan bakar (avtur) pesawat, diperkirakan membuat ongkos naik haji tahun 2012 terancam naik. Komisi VIII DPR tengah mengupayakan menekan kenaikan ongkos naik haji. Alasan kenaikan ongkos naik haji juga menyangkut kenaikan harga bahan bakar pesawat,” kata anggota Komisi VIII DPR dari Partai Demokrat, Muhammad Baghowi. (j06)

laporan dari dinas pendidikan setempat, kata Kepala BSNP Aman Wirakarta Kusuma, berdasarkan laporan Dinas Pendidikan Aceh. Tidak ada gangguan berarti pascagempa yang mengguncang Aceh dan sebagian wilayah Sumatera pada Rabu (11/4) sore. “Saya sudah cek ke dinas pendidikan Aceh. Walau kemarin sempat panik, alhamdulilah hari ini sudah normal. Persiapan UN berjalan normal, tidak ada daerah dilaporkan mengalami kerusa-kan fisik, dan UN berjalan sesuai jadwal,” katanya.

Seperti diberitakan, peristiwa gempa berkekuatan 8,5 skala Richter yang mengguncang Aceh dan wilayah lainnya di Sumatera berdeka-tan dengan pelaksanaan UN, khususnya UN untuk jenjang pendidikan menengah (SMA/SMK/MA) yang akan digelar Senin (16/4) mendatang. Sebelumnya, pelaksanaan UN di lokasi bencana Aceh sempat akan ditunda, menyusul adanya potensi korban jiwa dari para siswa, kerusakan gedung sekolah, dan kerusakan naskah soal UN. (dianw)

FPDIP Minta Laporan DPD PDIP Soal Gempa JAKARTA (Waspada): Ketua Fraksi PDI Perjuangan DPR RI Puan Maharani mengatakan, FPDI Perjuangan sangat berempati terhadap bencana gempa yang melanda Aceh, Sumatera Utara, Sumatera Barat, Bengkulu dan Lampung. Untuk itu, usai fokus pada rapat paripurna yang panjang dan alot atas Rancangan Undang-Undang Pemilihan Umum (RUU Pemilu), atas UU Nomor 10 Tahun 2008 tentang Pemilihan Umum, FPDI Perjuangan akan fokus mengikuti perkembangan daerah-daerah yang terkena gempa. “Kita akan minta laporan-laporan mengenai gempa itu dari DPD PDI Perjuangan,” ujar Puan Maharani dalam konferensi persnya di Gedung DPR RI Jakarta, Kamis (12/4). Puan juga mengharapkan agar masyarakat yang terkena gempa jangan panik dan tetap waspada. ”Kita semua berharap agar masyarakat selamat dan sehat, “ ujarnya. (aya)

Gubernur Riau Ke Jakarta Usai Dicekal PEKANBARU (Antara): Gubernur Riau HM Rusli Zaenal dikabarkan langsung ke Jakarta usai Komisi Pemberantasan Korupsi (KPK) mengeluarkan pencekalan terhadap dirinya ke luar negeri. Hal itu disampaikan Kepala Biro Humas Setdaprov Riau, Chairul Rizky, ketika dihubungi wartawan di Pekanbaru, Kamis (12/4). “Iya saya sudah tahu pencekalan Pak Gubernur, sekarang beliau di Jakarta,” ujar Rizky. Pencekalan Rusli Zainal oleh KPK diungkapkan oleh Wakil Menteri Hukum dan HAM Denny Indrayana. Menurut Denny, pencekalan orang nomor satu di Provinsi Riau itu diminta oleh KPK tertanggal 10 April 2012. Alasannya untuk membantu KPK dalam kelancaran proses penyidikan dugaan tindak pidana korupsi dalam pembangunan venue PON XVIII di Provinsi Riau. Hingga kini KPK masih melakukan pemeriksaan terhadap anggota DPRD Riau, termasuk Ketua DPRD Riau Johar Firdaus terkait kasus PON Riau. Sebelumnya, KPK juga telah menetapkan empat orang tersangka, dua diantaranya adalah anggota Komisi D DPRD Riau. Sedangkan, dua lainnya adalah pegawai Dinas Pemuda dan Olahraga (Dispora) Provinsi Riau dan pegawai kontraktor dari PT Pembangunan Perumahan (PP).


PAWAI TA’ARUF MTQ BANTEN: Pawai ta’ruf memeriahkan rangkaian acara pelaksanaan MTQ tingkat Provinsi Banten ke-9 di tigaraksa, Tangerang, Banten, Kamis (12/4). Ribuan peserta ikut serta memeriahkan pelaksanaa acara tahunan Musabaqah Tilawatil Quran (MTQ) yang diikuti 8 kota dan kabupaten se-Banten dengan 20.000 peserta.

Aburizal Bakrie: 2014, Indonesia Menguning JAKARTA (Waspada): Ketua Umum Partai Golkar Aburizal Bakrie optimistis partai akan memenangi Pemilihan Umum (Pemilu) 2014. Menurutnya, organisasi partai sudah bekerja sepanjang tahun sejak kepemimpinannya. Sehingga partai akan menuai hasilnya dengan meraih perolehan suara terbanyak secara nasional pada 2014 nanti. Saat melakukan panen raya padi dan berdialog dengan petani di Subang, Kamis (12/ 4), Aburizal mengatakan, langit memang masih biru.Tapi seperti kita lihat ini, padi sudah menguning, 2014 kita akan panen besar,

Indonesia kuning semua.” Dalam dialog itu, para petani yang merupakan gabungan kelompok tani se-Kabupaten Subang, menyatakan siap mendukung Aburizal sebagai calon presiden. “Kami mendukung Pak Ical (sapaan akrab Aburizal Bakrie) menjadi presiden, tapi kalau Bapak jadi presiden, jangan impor beras,” ujar kepala kelompok tani. Menanggapi hal itu, Aburizal menyatakan siap. Tetapi, produksi beras nasional tentu harus ditingkatkan, sehingga tidak ada alasan bagi pemerintah untuk impor.

Pemerintah, kata mantan Menteri Koordinator Kesejahteraan Rakyat itu, juga harus segera membenahi infrastruktur pedesaan dan pertanian. Atas alasan itu pulalah, Partai Golkar berkomitmen untuk mengalokasikan lebih banyak anggaran negara untuk pembangunan infrastruktur, terutama di pedesaan. Seperti yang terjadi di Subang dan Indramayu, menurut seorang ketua kelompok tani, hampir 70 persen sarana irigasi di daerah tersebut rusak. Akibatnya, produksi pertanian tidak maksimal karena kebutuhan air tidak tercukupi. (vvn)

Kinerja Legislasi DPR Memprihatinkan

Pemerintah Segera Tetapkan Zonasi Dan Lokasi Pembangunan Terkait RTRW JAKARTA (Waspada): Pemerintah akan segera menetapan zonasi dan lokasi pembangunan, terkait penyelesaikan Rencana Tata Ruang Wilayah (RTRW) di akhir tahun ini. Sehingga penetapan zona ini akan membuat program pembangunan lebih efisien “Dengan adanya arahan zonasi ini, merupakan juga salah satu aspek perencanaan pembangunan untuk rumah susun,” kata Wakil Menteri Pekerjaan Umum Hermanto Dardak dalam seminar Sosialisasi Undang-Undang Nomor 20 Tahun 2011 Tentang Rumah Susun, di Jakarta, Kamis (12/4). Menurutnya, pembagian zona ini juga akan terkait dengan pembagian zona kepemilikan rumah susun. “Jadi nanti transportasi masyarakat berpenghasilan rendah seperti penghuni rumah susun untuk ke tempat kerjanya juga akan efisien,” ujar Hermanto. Peraturan zonasi dibuat berdasarkan Undang-Undang Nomor 26 Tahun 2007 tentang Penataan Ruang. Arahan zonasi terdiri dari sistem perkotaan nasional, sistem jaringan transportasi nasional, sistem jaringan energi nasional, sistem jaringan telekomunikasi nasional, sistem jaringan sumber daya air, kawasan lindung nasional, serta kawasan budi daya. Mendesak Sementara itu, pembicara seminar lainnya, Ketua Panja RUU Rumah susun (Rusun) Komisi

dan Penelitian dan Pengembangan Kemdikbud juga sudah mendirikan posko pengaduan. Masyarakat yang menemukan kecurangan UN dapat menghubungi telepon bebas pulsa di 177 atau 082260080500 atau email ke pengaduan@kemdikbud.go.I’d. Badan Standardisasi Nasional Pendidikan atau BSNP Kementerian Pendidikan dan Kebudayaan menjamin pelaksanaan ujian nasional di Aceh tidak akan diundur. Hal itu diungkapkan Ketua BSNP Aman Wirakartakusumah setelah dirinya menerima


PETUGAS menunjukkan sampel sabu untuk dimusnahkan saat rilis pemusnahan barang bukti shabu di Kantor BNN, Jakarta, Kamis (12/4). Sebanyak 2.761,87 gram sabu berhasil dimusnahkan petugas dari pengungkapan dua kasus yang berbeda salah satunya di Lapas Pekanbaru, Riau, dengan barang bukti sabu seberat 881,40 gram yang dikemas dalam 8 bungkus plastik bening.

BNN Musnahkan 2,7 Kg Shabu JAKARTA (Antara): Badan Narkotika Nasional (BNN) memusnahkan 2.761,87 gram narkotika golongan I jenis shabu di halaman gedung BNN Jakarta, Kamis (12/4). “BNN kembali melakukan kegiatan pemusnahan barang bukti shabu. Total seluruhnya yang disita petugas 2.832,35 gram shabu kristal,” kata Kepala Bagian Hubungan Masyarakat (Kabag Humas) BNN, Kombes Pol Sumirat Dwiyanto, di Jakarta, Kamis. BNN menyisihkan 50,48 gram barang bukti untuk pembuktian perkara dan 20 gram untuk keperluan pendidikan dan pelatihan, sehingga total barang bukti yang dimusnahkan sebesar 2.761,87 gram. Seluruh barang bukti tersebut merupakan hasil dari pengungkapan dua kasus yang berbeda, ujarnya.

Penduduk Bertambah, Pengangguran Tinggi JAKARTA (Waspada): Ketidakseimbangan jumlah penduduk dengan ketersediaan lapangan pekerjaan membuat Tingkat Pengangguran Terbuka (TPT) usia muda di Indonesia tinggi. Data yang dilansir Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) mencatat, pada 2011 ada 7,7 juta orang menganggur di Indonesia. Dari jumlah itu, 5,3 juta jiwa diantaranya adalah pengangguran terbuka usia muda. Deputi Bidang Pengendalian Penduduk BKKBN Wendy Hartanto mengatakan, selain didominasi tingkat pendidikan yang rendah, pengangguran di Indonesia juga disebabkan terbatasnya lapangan pekerjaan. Ketersediaan lapangan pekerjaan berbanding terbalik dengan pertumbuhan penduduk. Dengan Laju Pertumbuhan Penduduk (LPP) 1,49 persen per tahun, menyebabkan Indonesia mengalami 4 juta kelahiran baru setiap tahunnya. “Tingginya pertumbuhan populasi penduduk di Indonesia itu tidak diikuti dengan ketersediaan lapangan pekerjaan. Akibatnya, angka pengangguran sulit ditekan,” kata Wendy dalam diskusi kependudukan di kantor BKKBN, Jakarta, Rabu (11/4). MenurutWendy, kekhawatiran terbesar dari ketidakterserapan angkatan kerja muda ini adalah semakin tingginya angka kemiskinan. Sedangkan kemiskinan, menyebabkan penurunan kualitas manusia akibat tidak terpenuhinya kebutuhan gizi dan pendidikan. Untuk itu, ditegaskan Wendy, BKKBN tengah menggalakkan perilaku berwawasan kependudukan. Salah satunya dengan mendorong terwujudnya referensi kebijakan-kebijakan pro kependudukan kepada instansi pemerintah pusat dan daerah. Salah satu yang utama adalah persoalan produktivitas penduduk di era bonus demografi pada satu dekade ke depan. (dianw)

JAKARTA (Waspada): Kinerja DPR RI pada masa persidangan III untuk menyelesaikan Rancangan Undang-Undang (RUU), yang sudah menjadi Program Legislasi Nasional (Prolegnas), sangat memprihatinkan. Dari beberapa RUU yang ditargetkan dapat diselesaikan, kenyataannya DPR hanya mampu menyelesaikan dua RUU Prioritas, yakni RUU tentang Penanganan Konflik Sosial dan RUU Pemilu Anggota DPR, DPD, dan DPRD (RUU Pemilu), ditambah empat RUU Kumulatif terbuka terdiri dari tiga RUU konvensi dan satu RUU tentang Perubahan APBN Tahun 2012. Tiga RUU Konvensi tersebut yaitu RUU tentang Pengesahan Konvensi ASEAN tentang Pemberantasan Terorisme, RUU tentang Pengesahan

Persetujuan antara Pemerintah RI dengan Pemerintah Daerah Administrasi Khusus Hongkong RRC tentang Bantuan Hukum Timbal Balik dalam Masalah Pidana, dan RUU tentang Pengesahan Konvensi Internasional mengenai Perlindungan Hak-Hak Seluruh Pekerja Migran dan Anggota Keluarganya. “Kita cukup prihatin melihat jumlah RUU yang dihasilkan dalam Masa Sidang III ini,” kata Ketua DPR RI, Marzuki Alie saat menyampaikan pidato penutupan Masa Sidang III Tahun Sidang 2011-2012, pada Rapat Paripurna DPR, Kamis (12/4). Terkait minimnya capaian kinerja DPR di bidang legislasi, menurut Marzuki Alie karena banyaknya kendala yang ditemui dalam pembahasan, terutama terhadap pasal-pasal yang sulit menemukan kesepakatan bersama antara DPR

dan pemerintah. Kendala ini semata-mata tidak datang dari DPR, tetapi juga dari pemerintah, terutama apabila sampai kepada usulan pembentukan struktur dan lembaga baru. “Belum mantapnya konsolidasi di kalangan pemerintah juga menjadi kendala utama, di samping ada perdebatan di antara fraksi-fraksi DPR,” kata Marzuki Alie. Dia mengungkapkan, kendala lain adalah terdapat beratus Daftar Inventarisasi Masalah (DIM) yang harus dikaji, memerlukan waktu panjang dalam pembahasan. Pimpinan DPR, menurut Marzuki, sangat paham bahwa komisi-komisi dan Badan Legislasi telah bekerja sangat efektif untuk menyiapkan RUU yang akan menjadi inisiatif DPR sebagaimana perintah UU. (aya)

Nurdin Tampubolon Dinilai Mampu Pimpin Sumut JAKARTA (Waspada): Figur anggota Dewan Perwakilan Rakyat Republik Indonesia (DPR RI) Ir Nurdin Tampubolon dinilai sebagai seorang figur pemimpin yang mampu memimpin Sumut. Kualitas profesionalisme wakil rakyat dari daerah pemilihan Sumut 1 meliputi, Kota Medan, Deli Serdang, Serdang Bedagai, dan Tebing Tinggi ini, disokong tingkat pendidikan, kecerdasan, keterampilan, dan kemampuan yang mumpuni sebagai seorang pemimpin. Nurdin juga sosok tokoh yang berdiri di atas semua golongan sosial, ekonomi, maupun politik. “Jika bang Nurdin Tampubolon masih mau maju sebagai salah satu calon Gubernur Sumatera Utara (Cagubsu) pada Pilgubsu 2013, saya yakin rakyat Sumut akan memberikan dukungan yang besar,” ujar praktisi komunikasi Andy kepada wartawan di Jakarta, Selasa (10/4). Sosok Nurdin Tampubolon, katanya, sudah memperlihatkan tipe kepemimpinan yang mampu menampung semua keragaman, mulai dari suku bangsa, agama, lapisan ekonomi, hingga lapisan sosial politik.

Nurdin juga sosok pemimpin yang tidak akan mengumbar janji, sebab Ketua DPP Partai Hanura ini dinilai tipe pemimpin yang lebih mengutamakan karya daripada kata. Diyakini, jika maju dan terpilih sebagai Gubernur, dipastikan visi dan misi membangun daerah Sumut mengalami kemajuan yang lebih nyata. Bagaimana desainnya, sudah tentu akan memperhatikan geostragegis dan geopolitik Sumatera Utara. Misalnya, bagaimana caranya supaya daerah Sumut memiliki energi listrik yang berlebih. Padahal Sumut disamping memiliki PLTA Asahan, sumber alam masih banyak yang belum diberdayakan. Karena itu, Nurdin menjadi orang pertama di DPR yang menyuarakan kepada pemerintah untuk menasionalisasikan PT Inalum. Bahkan, Nurdin menyuarakan agar daerah ikut sebagai pemegang saham. Nurdin menyadari ketersediaan energi listrik sudah tentu merupakan infrastruktur yang penting untuk pembangunan ekonomi di daerah itu disamping pembangunan jalan. Jika Nurdin memimpin, dia akan menjadikan Sumut bisa mengekspor energi

listrik ke daerah lain. Saat memimpin rapat membicarakan nasionalisasi Inalum menjadi milik nasional di Komisi VI DPR RI, Nurdin meyakinkan pemerintah dan DPR bahwa bangsa dan negara akan memperoleh keuntungan besar saat 100 persen mengelola Inalum. Nurdin juga sangat komit menjaga kelestarian Danau Toba, sehingga suplai air Danau Toba sebagai sumber air bagi Inalum bisa terjamin, aliran Sungai Asahan bisa terpelihara, serta masyarakat di sekitarnya juga menjadi lebih sejahtera. Namun sayang, kata Andy, walaupun Nurdin sudah memenuhi kriteria yang dibutuhkan Sumut sebagai pemimpin masa depan, hingga saat ini masih belum melihat tandatanda anggota Komisi XI DPR RI itu akan maju sebagai salah satu Cagubsu. Nurdin Tampubolon yang diminta komentarnya terkait Cagubsu, mengakui belum memikirkan untuk maju dan masih fokus menjalankan tugas sebagai wakil rakyat untuk menyuarakan aspirasi dan kepentingan daerah Sumut. (j07)



WASPADA Jumat 13 April 2012

25 Juta Al Quran Dibagikan Gratis Di Jerman PIHAK Keamanan Jerman saat ini tengah memantau kampanye kelompok Islam Salafi yang tengah menggelar aksi pembagian 25 juta Al-Quran di negara itu. Warga Jerman yang bukan muslim bisa mendapatkan cetakan Al-Quran dengan terjemahannya lewat aksi ini.

Petugas keamanan sedang mengkaji apakah aksi ini bisa dikategorikan sebagai pelanggaran undang-undang kebebasan beragama di negara itu. Kementerian Dalam Negeri Jerman menjelaskan kampanye seperti itu merupakan bentuk

dari dakwah yang agresif. Salah satu anggota kelompok Islam Salafi, Ibrahim Abou Nagie yang tinggal di Cologne mengatakan dia ingin menyelamatkan warga non-Muslim dari ancaman neraka lewat aksi tersebut. Sejauh ini sudah 300 ribu Al-

Quran yang telah dibagikan kelompok itu. Kelompok Islam Salafi sendiri merupakan kelompok yang berupaya meniru dan menjalankan ajaran para pengikut awal Nabi Muhammad. Sementara itu, Kantor Perlindungan Konstitusi di North Rhine-Westphalia dilaporkan terus mengawasi organisasi yang digerakan oleh Ibrahim Abou Nagie. Langkah yang dilakukan oleh Abou Nagie dan kelompoknya ini mendapat kritikan dari partai politik di Jerman. “Kapanpun kalau memungkinkan, langkah agresif seperti ini harus dihentikan,” kata Guenter Krings dari partai pendukung pemerintah, Serikat Demokrasi Kristen, CDU

seperti ditulis oleh the Rheinische Post. Menurutnya yang mereka persoalkan bukan pembagian Al-Quran-nya semata namun karena kelompok Salafi kerap melakukan hal radikal maka aksi ini menjadi mengganggu. Selain dari CDU kritikan dan keprihatinan juga datang dari Partai tengah kiri, Sosial Demokrat dan Partai Hijau. Kelompok Salafi dalam aksinya ini membagikan Al-Quran dengan terjemahan bahasa Jerman di sejumlah trotoar kota-kota di Jerman termasuk di Cologne. Sejumlah cetakan kitab ini juga rencananya akan didistribusikan ke Austria dan Swis. Setahun lalu Kepala Kantor Perlindungan Konstitusi, Heinz Fromm sempat memberikan pendapatnya tentang kelompok Islam Salafi. “Tidak semua anggota kelompok Salafi itu teroris.” “Namun memang hampir semua terduga teroris yang kita tangkap mempunyai kontak dengan kelompok ini atau jika tidak mereka sendiri juga menganut ajaran Salafi.” Sejumlah laporan menyebutkan aksi pembagian Al-Quran di Jerman oleh kelompok Islam Salafi ini didanai oleh seorang donor kaya yang berada di Bahrain. (bbc/rzl)

Al Quran dengan terjemahan bahasa Jerman.

Bangkai Titanic Habis AP

iPad 3. Sejumlah konsumen sedang mencoba iPad 3 pada penjualan di hari pertamanya di Paris, pertengahan bulan lalu (16 Maret 2012). iPad versi ketiga dari Apple ini telah beredar di Amerika Serikat dan sejumlah negara Eropa.

Apple, Perusahaan Termahal Di Dunia RAKSASA teknologi Apple melampaui angka US$600 miliar atau Rp 5.500 triliun untuk pertama kalinya dalam sejarah dan mengokohkan posisinya sebagai perusahaan paling bernilai di seluruh dunia. Nilai saham Apple mencapai titik tertingginya US$644 sekitar Rp6 juta pada Selasa (10/04), padahal pada Februari lalu baru saja melampaui harga US$500. Saham Apple sudah melonjak nilainya hampir 60% sejak awal tahun ini. Ini merupakan tonggak pencapaian penting bagi pabrikan iPhone ini, padahal sahamnya baru dihargai US$3,19 Rp30 ribu pada tahun 1997 saat perusahaan yang antara lain didirikan almarhum Steve Jobs itu terancam bangkrut. Pesaing terdekat Apple

adalah Microsoft yang bernilai US$260 miliar atau Rp 2.380 triliun sementara pada tahun 1999, di puncak booming era dotcom, nilainya pernah mencapai US$619 miliar atau kurang lebih Rp5.677 triliun dalam bentuk kapitalisasi pasar. Spekulasi menyebut booming era teknologi baru akan segera muncul, diikuti dengan kelesuan setelahnya. Pada hari Senin, raksasa jejaring sosial Facebook baru saja mengumumkan belanja fantastis senilai US$1 miliar atau Rp9 triliun untuk penyedia aplikasi berbagi foto Instagram, perusahaan mungil yang hanya mempekerjakan 13 pegawai dan baru didirikan pada bulan Oktober 2010. Kebangkitan Apple Kebangkitan Apple di bawah kemudi Steve Jobs,

yang meninggal dunia tahun lalu akibat kanker, muncul berkat terobosan dalam produk komputer dan kemudian pemutar musik iPod, diikuti iPhone dan iPad. Jobs turut membidani lahirnya Apple di lembah Silicon pada 1980an, namun kemudian dipecat pada akhir dekade itu. Jobs lalu diminta bergabung kembali tahun 1997, menerapkan perubahan pada lini produksi Apple, berpuncak pada kesuksesan iPhone serta tablet-nya, iPad. Pada Januari lalu Apple melaporkan angka keuntungan terbesarnya dalam tiga bulan 2011. Pada akhir tahun yang sama, perusahaan ini melaporkan memiliki simpanan uang tunai 97,6 miliar atau Rp893 triliun. (bbc/rzl)

Wanita Uzbekistan Dipaksa Steril SEBUAH investigasi memperlihatkan bahwa program sterilisasi rahasia di kalangan para wanita Uzbekistan saat ini tengah berlangsung. Wartawan BBC untuk Asia Tengah, Natalia Antelava, berbicara dengan sejumlah wanita yang mengalami sterilisasi tanpa persetujuan atau bahkan sepengetahuan mereka. Adolat, salah seorang korban sterilisasi rahasia, mengatakan dirinya mengetahui tidak bisa lagi mempunyai anak, setelah seorang dokter ahli mengungkapkan kondisi dirinya. “Saya mencoba hamil

setelah anak kedua saya lahir. Namun upaya saya selalu gagal. Belakangan saya tahu, saya diam-diam disterilisasi,” kata Adolat. Adolat mengatakan kondisi ini menyedihkan dan memalukan dirinya karena di Uzbekistan tolok ukur keberhasilan satu keluarga, antara lain, ditentukan dengan jumlah anak. Kini Adolat harus puas hanya dengan dua anak perempuan. Adolat tidak sendirian. Ada banyak wanita yang diam-diam disterilisasi. Penuhi Target Sebagian tuba fallopi mereka disumbat,

sementara rahim sejumlah wanita diangkat setelah melahirkan anak kedua atau ketiga. BBC mengatakan program rahasia ini tampaknya ditujukan untuk mengontrol angka kelahiran di Uzbekistan. Beberapa dokter mengatakan Kementerian Kesehatan memerintahkan mereka memenuhi target sterilisasi per bulan. Di perkotaan jumlahnya empat wanita per bulan dan di pedesaan dokter harus melakukan sterilisasi terhadap 32 wanita setiap bulan. Salah satu LSM mengatakan pada 2010 saja 80.000 wanita mengakui disterilisasi. Namun angka ini dibantah pemerintah Uzbekistan yang mengatakan mereka tidak menerapkan kebijakan tersebut. Wanita-wanita yang diwawancarai wartawan mengatakan, mereka diceraikan suami setelah mengetahui mereka tidak bisa lagi memiliki anak. Dampak lain dari program ini adalah banyak wanita Uzbekistan yang khawatir melahirkan di negara tersebut. Mereka takut mereka langsung disterilisasi setelah melahirkan. (rzl)

DALAM waktu kurang dari 30 tahun, mungkin tidak akan ada yang tersisa dari kapal Titanic kecuali “rusticle,” formasi karat yang mirip stalaktit, kata penelilti Henrietta Mann, yang menghabiskan empat tahun untuk mempelajari bakteri yang menggerogoti kapal karam tersebut. Ekspedisi penelitian pada 1991 ke bangkai kapal yang terletak sekitar 12.400 kaki (3.780 meter) di dasar laut itu mengungkapkan formasi gugusan karat yang serupa dengan es atau stalaktit menggatung di kapal besar tersebut. Mereka biasanya terjadi di bawah air ketika besi tempa teroksidasi. Mann, seorang pakar biologi dan geologi dari Universitas Dalhouseie di Halifax, memperoleh sempel dari Institut Oceanografi Bedford dan menelitinya dengan mikroskop elektronik. Dia menemukan fakta kalau bakteri itu, bukan karena proses kimia, menjadi alasan terbentuknya formasi yang terjadi di perairan dalam tesebut. Peneliti Kanada itu mengidentifikasi puluhan bakteri, termasuk satu yang tidak pernah terlihat sebelumnya, yang ia juluki sebagai Halomonas titanicae, telah “mengunyah” lambung baja kapal tersebut dan mengubahnya, atom per atom, menjadi “rusticle,” beberapa bahkan setinggi pria dewasa. Tak terlihat dengan mata telanjang, berukuran hanya 1,6 mikrometer panjangnya, bakteri ini berkembang biak menjadi miliaran selama bertahun-tahun. “Titanic terdiri dari 50.000


BANGKAI haluan kapal Tintanic. Seratus tahun telah berlalu sejak RMS Titanic tenggelam pada tahun 1912. ton baja,” kata Mann kepada AFP. “Jadi, ada banyak makanan untuk bakteri saya.” Bakteri itu juga memakan jendela, tangga, dan gerbang – semuanya yang terbuat dari besi kasar - serta tungku besi. “Mereka makan itu juga,” kata Mann. Hanya kuningan yang tidak disentuh. “Saya tidak tahu kecepatan mereka memakan besi,” tapi membandingkan foto-foto

awal dari bangkai itu dengan foto yang terbaru, jelas terlihat perubahan yang cepat telah terjadi. “Mungkin dalam 20 atau 30 tahun dari sekarang bangkai kapal ini akan runtuh (menjadi) tumpukan karat,” katanya. Mann mancatat 27 bakteri yang hidup di rusticle, beberapa memiliki tentakel, serta cacing tabung dan makhluk kecil lainnya, bergerak dalam “koloni yang bersimbiosis.”

Bakteri pertama mungkin diciptakan oleh diatom (ganggang uniseluler) dalam “salju laut” - kotoran dari permukaan. Salah satu bakteri kemudian menghasilkan bakteri lain dan bersama-sama mereka membentuk rantai dan kemudian jaring, lebih banyak bakteri tumbuh pada jaring dan mengisi lubang-lubang dan akhirnya mengeras menjadi struktur rusticle dengan di dalam sirkulasi

air. “Struktur bakteri ini seperti spons,” jelas Mann. Kehancuran Titanic sudah pasti akan menjadi kerugian besar warisan dunia, kata Mann. Tapi pada saat yang sama penemuannya menawarkan harapan: semua kapal tua, rig minyak dan kargo yang jatuh ke dasar laut tidak akan menumpuk seperti sampah. Bakteri akhirnya akan menghancurkan semuanya. (ant/rzl)

Jembatan Tertinggi Di Dunia SETELAH memiliki jembatan terpanjang di dunia Danyang Kunshan Grand Bridge, China kini juga punya jembatangantungtertinggididunia Aizhai Bridge. Pekan lalu, Presiden Hu Jintao meresmikan jembatan tertinggi di dunia sepanjang 1.146 meter yang membentang sekitar 350 meter di atas Dehang Canyon. Tak hanya megah, jembatan tersebut juga memiliki keunikan karena menghubungkan dua terowongan. Sebenarnya jembatan yang dibangun pada Oktober 2007 itu sudah rampung pada Desember 2011.Tetapi, pemerintah setempat merasa perlu melakukan uji kelayakan sebelum meresmikannya. Sejak akhir Maret lalu pengendara motor dan mobil sudah mulai lalu-lalang di jembatan itu. ”Berkat jembatan ini, perjalanan dari Jishou menuju Chadong yang biasanya makan waktu empat jam menjadi hanya kurang dari sejam,” kata Chen Mingxian, pimpinan proyek jembatan yang terletak di kawasan Jishou, Provinsi Hunan, selatan tengah China tersebut. Menurut situs, pemerintah China

mendapat bantuan 208 juta dolar AS (sekitar Rp 1,9 triliun) dari Asian Development Bank (ADB) untuk membangun jembatan tertinggi tersebut. Chen mengatakan bahwa jembatan itu punya empat keistimewaan. Pertama, lokasinya berada di lembah dan bahkan

mengangkangi sebuah desa. Keistimewaan kedua konstruksinya yang sengaja memisahkan tiang penyangga dan balok penampangnya. ”Jembatan ini juga menggunakan batu sebagai tumpuan suspensi dan fiber karbon,” tuturnya. Lalu, digunakan kereta gan-

tung sebagai salah satu teknik untuk menancapkan tiang penyangga ketika membangun. Menurut Chen, pembangunan jembatan ini membuahkan hasil maksimal. Pemakai jalan serta pejalan kaki juga bisa berjalan di jembatan yang menyala pada malam hari dengan 1888 lampu


WARGA menyaksikan pembukaan jembatan sepanjang 1.146 meter yang membentang sekitar 350 meter di atas Dehang Canyon.

menggunakan jalur khusus. Sebelumpembukaanjembatan, beberapa orang berani menantang maut demi membuat konstruksi raksasa itu tampak benar-benar megah. Pekerja itu tidak menggunakan tali pengaman dan berjalan di atas konstruksi besi, membawa sapu lidi untuk bersih-bersih. Beberapa sibuk mengecat sana. Agar seluruh rangka besinya berwarna merah. Kini pengguna jalan sudah bisa menikmati infrastruktur dibuat untuk meringankan beban lalu lintas wilayah Jishou itu. Jembatan dengan empat lajur tersebut merupakan yang keempat di dunia dibangun menyeberangi lembah yang jauh, sehingga tampak menghubungkanduapuncakgunung. Meski panjang, jembatan ini hanyalah bagian kecil dari rute 64 kilometer Jishou-Chadong Expressway yang setengah rutenya berupa 18 terowongan.Tepat di bawah jembatan itu, terdapat bagian khusus untuk pejalan kaki. China saat ini memegang rekor sebagai negara yang memiliki jembatan terpanjang dunia, yakni DanyangKunshanGrandBridge mencapai 160 kilometer. (net/rzl)

Luar Negeri

WASPADA Jumat 13 April 2012


Persiapan Akhir Peluncuran Roket Pembawa Satelit Korut BEIJING (Antara): Direktur Jenderal Pusat Kontrol dan Pengendalian Pelucuran Satelit Korea Utara (Korut) Paek Chung-hou mengatakan segala persiapan akhir peluncuran satelit Kwangmyonsong-3 terus dilakukan. Laporan sejumlah media China yang diundang ke Pyongyang, Kamis (12/4), mengatakan Rabu telah dilakukan pengisian bahan bakar dan diperkirakan memakan waktu sembilan hingga 10 jam. Tentang waktu peluncuran, Paek Chung-hou mengatakan masih menunggu kepastian dari supervisi. “Tentang kepastian tanggal peluncuran akan diputuskan supervisi,” kata Paek Chung-hou. Namun, beberapa ahli menyatakan setelah pengisian bahan bakar yang diperkirakan memakan waktu sembilan hingga 10 jam Rabu, maka kemungkinan satelit akan diluncurkan Kamis atau tidak lebih dari Senin (16/4). Paek mengatakan meski pihaknya sibuk menyiapkan segala hal terkait peluncuran satelit seberat 100 kg itu, pemimpin Korut Kim Jong-un memintanya untuk terus mengabarkan tentang segala persiapan itu kepada media dan dunia. “Ini menunjukkan transparansi kami, dan sangat penting bagi kami untuk berbagi tentang peluncuran satelit ini kepada negara lain,” kataPaekChung-hou.Diamenambahkan,”Kaliandapatmenyaksikan sendiribahwainiadalahsatelitbukanmisilsepertiyangdikhawatirkan”. Chung-hou mengatakan hal itu kepada sejumlah pihak termasuk media asing dari China yang diundang ke pusat peluncuran satelit Sohae di Cholsan County sebelah utara Pyongyang. Sejak sebulan silam Korut telah mengumumkan akan meluncurkan satelit Kwangmyongsong-3 untuk memperingati Kim II-sung. Rencana itu mendapat reaksi keras dari tetangganya Korea Selatan, Jepang, Amerika Serikat dan lainnya. Sedangkan China meminta agar semua pihak tenang dan mengendalikan diri untuk tidak memperkeruh situasi di semenanjung Korea. Jadi pemimpin tertinggi militer Sementara itu, perkembanga lainnya terjadi Korut, pemimpin baru Kim Jong-un dipilih sebagai pejabat militer tertinggi oleh partai yang berkuasa, kata media pemerintah Kamis pagi, menjelang rencana peluncuran roket yang telah memicu peringatan internasional itu. Jong-un terpilih sebagai ‘Ketua’ Komisi Militer Pusat - yang mengendalikan 1,1 juta personil militer - di satu konferensi partai tersebut pada Rabu, kata Kantor Berita Korea Utara (KCNA). Pengumuman tersebut dikeluarkan setelah Partai Buruh Korea (WPK), Rabu menyatakan Jong-Un‘sekretaris pertamanya,’ mendapatkan gelar baru. Ayahnya, Kim Jong-il, yang meninggal Desember lalu, dinyatakan menjadi sekretaris jenderal partai “abadi”, pos yang dia jabat di masa hidupnya.

Turki Lakukan Penangkapan Baru Atas Beberapa Mantan Pati ANKARA (AP): Para jaksa Turki Kamis (12/4) memerintahkan penangkapan atas lebih dari selusin mantanperwiramiliter, termasuk empat jenderal purnawirawan, sehubungan dengan peran mereka dalam penggulingan PM Islamis. Penyelidikan terakhir itu dilakukan pada saat pemerintah Turki yang berakar Islam berusaha untuk menepikan pengaruh militer dalam kehidupan politik di negeri itu. Polisi melakukan penggerebekan sejumlah rumah dari selusin tersangka Kamis (12/4), termasuk Cevik Bir dan tiga mantan jenderal lainnya, sehubungan dengan peran mereka memaksa pengunduran diri seorang PM Islamis Necmettin Erbakan pada tahun 1997. Bir, seorang mantan deputi kepala staf panglima misi pemelihara perdamaian PBB di Somalia tahun 1993, telah memanfaatkan popularitasnya sebagai pimpinan militer untuk mengeritik penguasa Islam radikal saat itu. Militer Turki menganggap dirinya sebagai benteng pemerintahan sekuler Turki. Para perwira itu dituduh menekan Erbakan agar mengundurkan dirisehubungandengandugaanberusahameningkatkanperanIslam di negara yang mayoritas penganut Islam itu, yang peme-rintahannya menganut sistem sekular, demikian kata kantor kejaksaan di Ankara. Partai Islam Sejahtera Erbakan telah memenangkan pemilihan 1995, yang membuka jalan bagi peran Islam yang makin besar dalam kancah politik, sosial dan budaya Turki. Menlu Ahmet Davu-toglu mengatakanpenyelidikanitumerupakansatuusahauntukmenjamin bahwa tidak akan ada lagi kudeta di masa mendatang di Turki. (m10)

Gempa Kuat Guncang Mexico MEXICO CITY (AP): Satu gempa kuat melanda lepas pantai Mexico Kamis (12/4), membangunkan warga yang tertidur lelap di dekat Teluk California. Gempa itu terjadi hanya beberapa jam setelah satu getaran gempa mengayun-ayunkan gedung-gedung pencakarlangitdiMexicoCity,sehinggabanyakwargayangmengungsi. Pihak berwenang mengatakan tidak satupun dari gempa bumi itu yang menimbulkan korban dan kerusakan. Survei Geologi AS (USGS) melaporkan kekuatan gempa 6,9 skala Richter melanda perairan antara Semenanjung Baja dan negara bagian utara Sonora pada pukul 12:15 dinihari waktu setempat. ParapendudukdikotaHermosilloterbangunketikamerasatempat tidur mereka berayun dan kipas angin di dek bergetar. Luis Enrique Cordova, direktur dinas darurat di Sonora, mengatakan warga yang kebingungansegeramembanjirijaringantelefonkantorperlindungan sipil di Hermosillo, kota terbesar dan ibukota negara bagian itu, yang berpenduduk kira-kira 700.000 jiwa. Namun Cordova mengatakan tidak ada kerusakan berarti yang terdeteksi di kawasan itu. Walikota Mexico City Marcelo Ebrard mengatakan di akun twitter-nya bahwa tidak ada tanda-tanda awal kerusakan serius dan pada layanan-layanan penting di ibu kota, termasuk sistem kereta bawah tanah dan di bandara internasional, semua berfungsi. Survei Geologi Amerika Serikat mengatakan gempa berkekuatan 7,0 skala Richter melanda di negara bagian barat Michoacan pada kedalaman 40,8 mil (65,6 kilometer). Ini adalah gempa besar ketiga yang pernah memukul Mexico dalam waktu kurang dari sebulan. Sebuah gempa berkekuatan 7,4 skala Richter melanda negara itu pada20Maretlaludan merusakratusanbangunandibaratdaya.(m10)

Seputar ASEAN Kamboja Segera Bergabung Misi Perdamaian Di Sudan Selatan PHNOM PENH (Antara/Xinhua-OANA): Polisi militer Kamboja dan petugas medis militer akan meninggalkan Kamboja pada 16 April dalam misi penjaga perdamaian di Sudan Selatan, demikian siaran pers Program Pembangunan Kamboja PBB. Mereka adalah di antara 153 anggota pasukan penjaga perdamaian Kamboja yang akan dikirim ke Sudan Selatan tahun ini. Sampai saat ini, 839 tentara Kamboja telah menyelesaikan misi penjaga perdamaian, dan 222 prajurit saat ini sedang menjalankan misi itu, kata siaran pers Ra bu (11/4). Berbicara pada upacara tersebut, Koordinator Residen PBB DouglasBroderickmengucapkanterimakasihkepadapasukanpenjaga perdamaiandanmemujiTimPenjagaPerdamaianAngkatanBersenjata KerajaanKambojakarena melanjutkanwarisanKambojamemberikan kontribusi bagi upaya pemeliharaan perdamaian global. Broderick mendesak pasukan penjaga perdamaian untuk terus menjalankan tugas tanggung jawab yang dipikulkan kepada mereka karena mereka memberikan dukungan kepada negara baru Selatan Sudan yang masih muda.


PARA prajurit Korea Selatan ambil bagian dalam satu latihan militer dekat zona demiliterisasi yang memisahkan kedua Korea

di Paju, kira-kira 45 km di utara Seoul, Korea Selatan, Kamis (12/4). Korea Selatan — yang secara teknis masih berada dalam keadaan perang dengan Korea Utara setelah konflik mereka tahun 1950-1953 berakhir dengan satu gencatan senjata bukan satu perjanjian damai — memperingatkan Korea Utara bahwa memperburuk pengucilannya jika meneruskan maksudnya meluncurkan roket.

Syria Tenang Penuhi Seruan Gencatan Senjata Dari Utusan PBB BEIRUT (AP): Satu gencatan senjata rapuh yang ditengahi oleh PBB berlaku di Syria Kamis (13/4) ketika pasukan rezim tampaknya menghentikan serangan luas atas oposisi, namun masih — belum memenuhi tuntutan yang diajukan oleh utusan khusus internasional Kofi Annan agar menarik pasukan ke baraknya masing-masing. Jika gencatan senjata itu bertahan, maka itu merupakan pertama kalinya rezim berkuasa menaati satu gencatan senjata yang ditengahi secara internasional sejak rezim Bashar Assad melancarkan satu penumpasan brutal aksi protes massa selama 13 bulan yang menyerukan penggulingannya. Oposisi menyerukan protes damai Jumat (14/4) untuk menguji komitmen pemerintah pada persetujuan itu. Perasaan skeptis yang dalam bahwa rezim itu mau menghentikan serangannya selama mungkin, sebagaimana Assad selalu melanggar janjinya. Juga, rezim itu mengatakan Rabu, pada malam sebelum gencatan senjata, bahwa pihaknya berhak untuk merespon setiap agresi, yang ber-

potensi untuk melanggar gencatan senjata. RencanaAnnanmenyerukan pengerahan peninjau internasional dan perundingan transisi politik begitu gencatan senjata berlaku. Inisiatif itu telah mendapat dukunganinternasional,termasuk dari sekutu Assad, Rusia, China dan Iran, dan secara luas terlihat sebagai peluang terakhir bagi penyelesaiandiplomatikgunamengakhiri pemberontakan bersenjata di sana. Barat dan para sekutunya meragukan ketulusan janji rezim Assad untuk memenuhi rencana gencatan senjata, yang menyerukan pemerintah Syria agar mengizinkan protes damai. Satu gencatan senjata sebenarnya dapat mengancam rezim dengan

mendorong sejumlah besar pemrotes untuk membanjiri jalanan, sebagaimana mereka lakukan pada awal revolusi terhadap kekuasaan selama empat dasawarsa klan Assad. Pemerintah menghadapi para pemrotes denganpenumpasanyangkerasdan sejak itu lebih dari 9.000 orang tewas, demikian menurut PBB. BurhanGhalioun,kepalaoposisi Dewan Nasional Syria (SNC), mendesak warga Syria agar ikut berunjukrasa damai Jumat. Protes biasanya dilakukan Jumat setelah kerumunan umat Islam keluar dari masjid setelah menunaikan shalat Jumat. Batas waktu terlewati Batas waktu gencatan senjata yang didukung PBB dengan tujuan menghentikan kekerasan yang berlangsung lebih dari setahun di Syria terlewati Kamis dan tak segera ada laporan-laporan mengenaipertempuran,katapara aktivis. Observatorium Syria untuk Hak Asasi Manusia melaporkan adanya suara ledakan-ledakan di kota Zabadani, dekat perbatasan dengan Lebanon, tak lama

setelah pukul 06:00 waktu setempat batas waktu berakhir tetapi mengatakan tidak jelas apa yang menyebabkan ledakanledakan tersebut. Seorang warga kota mengatakan telah terjadi serbuan meriam di kota itu semalam tetapi dia tak mendengar apa-apa setelah batas waktu gencatan senjata. Para pegiat lain di kota-kota Hama, Homs dan Damaskus mengatakan situasi telah tenang. Kementerian Pertahanan SyriaRabumengatakanpihaknya akan menghentikan operasi pada Kamis pagi tetapi tidak menyebutkan tentara mundur dari kotakota dan sebaliknya mengatakan akan menghadapi “setiap serangan” yang dilakukan kelompokkelompok bersenjata. Serangan-serangan terhadap permukiman oposisi selama pekan terakhir telah memicu keraguan-keraguan akan dipatuhinyagencatansenjata.Taksatu pun dari aktivis mengatakan mereka telah melihat tanda-tanda penarikan kembali tank-tank dari pusat perkotaan, salah satu butir yang Suriah sepakati berdasarkan gencatan senjata. (m10)

Filipina Dan Jepang Siaga TOKYO (Antara/AFP): PM JepangYoshihikoNodaKamis(12/ 4) mengatakan bahwa negaranya dalam siaga penuh atas rencana peluncuran roket Korea Utara (Korut), yang diperkirakan pada waktu beberapa hari mendatang. “Kamiinginberusahamereka menahan diri sampai menit terakhir,” kata Noda kepada wartawan saat ia tiba untuk melakukan pembicaraandengangugustugas khusus yang dibentuk untuk menangani tanggapan Jepang atas rencana peluncuran. Sementara itu pemerintah Filipina telah memerintahkan untukmengalihkanpenerbangan guna menghindari daerah-daerah di mana puing-puing roket itu mungkin jatuh, kata kepala kontrol lalu lintas udara. Korut yang bersenjata nuklir telah menyatakan rencananya untuk meluncurkan satelit antara

Kamis-Seninuntukmenandaiseratus tahun kelahiran pendiri negara Presiden Kim Il-sung. Kritikus Barat melihat peluncuran itu sebagaiujicobarudalterselubung yang dilarang oleh Resolusi Dewan Keamanan PBB. Tokyo telah menempatkan sistem pertahanan rudal untuk mencegat dan menghancurkan roket jika terlihat ditetapkan jatuh di wilayah Jepang, banyak seperti yang terjadi pada tahun 2009 ketika Pyongyang meluncurkan roket jarak jauhnya. Kamis, majelis rendah parlemen Jepang dengan suara bulat menerima resolusi yang menuntutPyongyangmenghentikanpeluncuran roket yang direncanakan. “Peluncuran tidak pernah bisa diperbolehkan karena merupakan tindakan menghancurkan perdamaian dan stabilitas tidak hanya di Jepang tetapi juga

di Asia timurlaut,” katanya. Pemerintah Manila memerintahkan agar penerbangan mengalihkan arahnya guna menghindari wilayah-wilayah yang mungkin terkena puing-puing roket itu yang jatuh. Dari 12-16 April, sekitar 20 penerbangan sehari akan terpengaruh oleh perintah itu, kata Michael Mapanao, kepala bagian kontrol lalu lintas otoritas penerbangan. Kepala pertahanan sipil Filipina Benito Ramos juga telah memerintahkan pelayaran untuk menghindari daerah-daerah di mana puing-puing roket itu diperkirakanakanjatuhdandengan polisi serta para penjaga penjaga dan angkatan laut semua menegakkan larangan tersebut. Di Pulau Ishigaki Jepang di selatankepulauanOkinawa,yang terletak tepat di bawah lintasan pengumumanroket,pejabatkota

melanjutkan siaga pada pukul 06:00 waktu setempat Kamis, satu jam sebelum lima hari jendela peluncuran dibuka. Penduduk telah diperintahkan untuk berlindung di gedunggedung secepat roket itu diluncurkan, dan tidak untuk mendekatisemuadebuyangtampaknya telah jatuh dari roket karena biasanya sangat beracun, kata para pejabat.

Partai Konservatif Kuasai Parlemen Korea Selatan SEOUL (Waspada): Partai konservatif yang saat ini memimpin pemerintahan Korea Selatan (Korsel) berhasil memenangkan pemilu parlemen. Warga Korsel juga mempersiapkan diri untuk pemilu Presiden Korsel pada Desember mendatang. HasilpemiluParlemenKorseldiumumkanhariinidanmenunjukkan kemenangan bagi New Frontier Party (NFP). Partai Presiden Lee Myung-bak itu meraih 152 kursi dari 300 kursi di Majelis Nasional ParlemenKorsel.SisakursidiParlemenKorseldiamankanDemocratic United Party Party (DUP) atau yang sering disebut partai kiri tengah. Sebelumnya, DUP diprediksikan menang lewat poling, namun mereka akhirnya mengkritisi NFP yang menandatangani perjanjian perdagangan bebas Korsel dan Amerika Serikat (AS) dan pembangunan pangkalan laut AS. “Korsel melakukan voting untuk kestabilan, para kelompok konservatif mendukung NFP dengan kuat, sementara itu DUP tidakdapatmemunculkansatutokohyangkompeten,”ujarpengamat politik Hahm Sung-deuk, seperti dikutip AFP, Kamis (12/4). Presiden Lee juga menyambut kemenangan dari partainya dalam pemilu Parlemen Korsel. Dirinya mengatakan, Pemerintah Korsel akan melakukan yan terbaik dalam mengurus warganya.

China Kirim Kapal Lagi Hadapi Kebuntuan Dengan Filipina MANILA (AP): China mengirimkan kapal ketiga Kamis (12/ 4) ke kawasan perairan yang dipertikaikan di Laut China Selatan di mana terjadi pertikaian dengan kapal-kapal Filipina, yang mengundang ribut Manila. Para diplomat China dan Filipina berusaha segera menyelesaikan pertikaian yang berbahaya di lepas Scarborough Shoal di lepas pantai baratlaut Filipina yang sempat menimbulkan kehebohan di Manila Selasa lalu. Satu kapal perang Filipina berusaha untuk menahan sejumlah nelayan China yang dituduh memasuki negeri itu dan menangkap ikannya secara ilegal. Namun terhalang oleh kedatangan dua kapal pengintai China. SalahsatudarikapalChinaitumenghalangikapalFilipinamemasuki Beting Scarborough itu di mana sekurang-kurangnya delapan kapal pukatChinaberlabuhdisana.Kapal-kapalChinajugamemerintahkan kapal perang Filipina meninggalkan beting Scarborough, dengan menyatakan bahwa kawasan itu berada di bawah kedaulatan China. Namunkapalperangitutetaptinggaldiperairantersebutkarenaalasannya kawasan itu wilayah perairan Filipina. KSAL Filipina Deputi Laksamana Alexander Pama mengatakan kapal perang BRP Gregorio del Pilar telah ditarik dari Scarborough Kamis untuk mengisi bahan bakar dan digantikan oleh satu kapal penjaga pantai Filipina. Tindakan itu bukan mundur atau memberi semacam konsesi kepada China, katanya. “Kami bukan mundur dari wilayah perairan kami sendiri,” kata Pama. (m10)

Penengah Timteng Berusaha Hidupkan Perundingan Damai WASHINGTON (Antara/Reuters):Penengah perdamaian Timur Tengah (Timteng) mengecam pembangunan permukiman Israel dan menyeru para donor untuk memenuhi janji bantuan buat Palestinasaatmerekaberusahamenghidupkankembalipembicaraan yang hampir mati tersebut. Apa yang disebut Kuartet —Uni Eropa, Rusia, PBB dan Amerika Serikat— menyatakan mereka mendukung seruan 23 September 2011 agar semua pihak mencapai kesepakatan perdamaian paling lambat akhir 2012, sasaran yang tampaknya kian jauh dari jangkauan. Meskipun menyambut rencana agar PM Israel Benyamin Netanyahu dan Pemerintah Otonomi Palestina bertemu akhir April, kelompok itu juga mengangkat ‘kerapuhan yang meningkat dalamperkembangandilapangan’danmencaciIsraelkarenakegiatan permukiman yang berlangsung terus. Pemimpin Israel dan Palestina berencana bertemu akhir April tapi pembicaraan yang langka itu mungkin hanya mempertajam perbedaan yang telah membuat perundingan perdamaian jadi macet.

Pasukan Israel Temani Warga Israel Terobos Masjid Al-Aqsa


FESTIVAL SONGKRAN DI BANGKOK. Seorang warga Thai menggunakan satu senjata air ketika dia ikut ambil bagian dalam satu perang air dengan wisatawan dalam Festival Songkran di Khaosan Road di Bangkok, Thailand, Kamis (12/4). Festival Songkran, juga dikenal sebagai festival air, menandai dimulainya Tahun Baru Thailand yang diyakini akan membersihkan nasib buruk.

JERUSALEM (Waspada): PeziarahIsraelmemasukiwilayah kompleks Masjidil Aqsa. Mereka ditemani oleh pasukan Israel saat memasuki tempat ibadah bersejarah itu. “Pihak penjaga berhasil mencegah peziarah Israel itu, untuk menjalankan ritual keagamaannya. Sempat terjadi perdebatan antara kedua belah pihak, tetapi tidak berlangsung lama,” pernyataanYayasanMasjidil Aqsa seperti dikutip Ma’an, Kamis (12/ 4/2012). Menurut pihak yayasan, Direktur Kantor Sumbangan Islam Syekh Azzam al-Khateeb tiba ke lokasi itu usai mendapatkan laporan. Syekh Al-Khateeb pun langsungmemerintahkanpengusiran terhadap warga Israel. Kompleks Al-Aqsa yang terdiri dari masjid yang disertai kubah,adalahlokasisuciketigaumat Islam. Warga Israel meyakini di

lokasi ini pula dibangun Kuil Yahudi kedua berada. Beberapa tokoh garis keras Israel mengusulkan agar Israel membangun kuilYahudiditempatsuciitu.Usulan ini tentunya mengundang kecaman dari pihak Palestina. LokasiKompleksAl-Aqsasaat inimasihdibawahkendaliKantor Sumbangan Islam. Kunjungan dari warga Israel selama ini dikecam oleh Palestina dan tentunya dilarang. Curi emas Palestina Sementara itu, pihak militer Israel menyelidiki tuduhan seorang warga Palestina yang mengklaim pasukan Israel mencuri emas yang dimiliki. Insiden itu terjadi, saat prajurit Israel melakukan penggerebekan di rumahnya pekan lalu. “Sekira 50 prajurit Israel yang ditemani anjing pelacak, mendobrak masuk rumah saya. Ber-

sama dengan istri, kami ditahan di kamar ketika mereka menggeledah isi rumah,” ujar Atta Sabri Shtiwi seperti dikutip Al Arabiya, Kamis. Tidak jelas mengapa rumahnya yang berada di Desa Kafr Qaddum menjadi target operasi dari pasukan Israel. Sementara putra dari Shtiwi juga dikabarkan ditangkap oleh militer Negara Yahudiitu.“Uangkamimasihada, tetapiemasyangdisimpandalam kain sudah hilang. Pihak militer menolak untuk mendengarkan saya dan pergi begitu saja,” lanjut Shtiwi. Berdasarkan keterangan Shtiwiemasyanghilangitunilainya mencapai 8.600 euro atau sekira Rp103,6 juta (Rp12.054 per euro). Ternyataemas-emasitubukanlah miliki Shtiwi, melainkan milik warga lain yang menitipkan kepada pedagang berusia 44 tahun itu. (ok)


REGU pemadam kebakaran menggunakan pasir untuk menimbun minyak yang berserakan di jalanan di depan satu bus yang rusak parah yang diangkat setelah terjadi satu kecelakaan jalanan di Xiaoxian, provinsi Anhui, China, Kamis (12/4). Sekurang-kurangnya 23 orang tewas dalam satu tabrakan adu kambing antara bus dan satu truk pengangkut pasir di Xiaoxian itu, demikian menurut sejumlah pejabat.

Laga Kambing Bus Dan Truk Di Anhui, 23 Orang Tewas BEIJING (AP): Kantor berita pemerintah China mengatakan sekurang-kurangnya 23 orang tewas ketika satu bus bertabrakan ‘laga kambing’ dengan satutrukditimurChinadalamsalahsatukecelakaan terakhir yang paling serius di jalanan yang kacau di China. Kantor berita Xinhua mengatakan kecelakaan itu terjadi Kamis (12/4) pagi di Suzhou di provinsi Anhui.Truktersebutmengangkutpasirketikaterjadi kecelakaan.

Xinhuamengatakanpolisibelummemberikan keterangan mengenai sebab terjadinya kecelakaan tersebut. Jumlah penumpang di bus itu juga belum diketahui. Keselamatan jalanan merupakan satu problem serius di China. Menurut Xinhua, perawatan jalan yang buruk serta perilaku mengemudi kendaraan yang buruk juga menjadi penyebab kematian kira-kira 70.000 orang dan 300.000 lainnya cedera dalam setahunnya. (m10)



WASPADA Jumat 13 April 2012

Hasil Kamis (12/4) Granada vs Ath Bilbao Sp Gijon vs Levante Valencia vs Rayo Vallecano Atl Madrid vs Real Madrid

2-2 3-2 4-1 1-4



BINTANG Real Madrid, Cristiano Ronaldo (2 kiri), mencetak hatrik ke gawang Atletico Madrid dalam laga derbi pada lanjutan La Liga Primera di Vicente Calderon Stadium, Kamis (12/4).

Real Madrid 32 26 4 2 104-28 82 Barcelona 32 24 6 2 94-23 78 Valencia 32 14 10 8 50-38 52 Malaga 31 15 5 11 47-43 50 Levante 32 14 6 12 46-44 48 Osasuna 32 11 13 8 37-52 46 Sevilla 31 11 9 11 36-33 42 Ath Bilbao 32 10 12 10 47-44 42 Atl Madrid 32 11 9 12 43-41 42 Espanyol 32 11 9 12 39-43 42 Getafe 32 11 9 12 33-43 42 Vallecano 32 12 4 16 49-57 40 Real Betis 32 11 6 15 39-45 39 Sociedad 32 10 8 14 39-48 38 Mallorca 31 9 10 12 32-40 37 Granada 32 10 6 16 30-48 36 Villarreal 31 7 11 13 31-45 32 Zaragoza 31 7 7 17 28-56 28 Sp Gijon 32 7 7 18 32-60 28 Santander 31 4 13 14 23-48 25

CR7 Jadi Pembeda Kenyamanan MU Terganggu


KIPER Manchester United, David de Gea (kanan), meninju bola saat gawangnya diserbu pemain Wigan Athletic dalam lanjutan Liga Premier di The DW Stadium, Kamis (12/4).

MADRID (Waspada): Mega bintang Real Madrid, Cristiano Ronaldo (CR7), kembali menjadi kunci kemenangan timnya dalam laga Derbi Madrid edisi ke-178 La Liga di Vicente Calderon, Kamis (12/4). CR7 mendulang hatrik untuk membantu Real melindas Atlético 4-1. Gelandang senior Real, Xabi Alonso, menyadari jasa rekannya tersebut. Selain karena Los

Merengues bermain dengan karakter dan intensitas yang tinggi, duel sesama klub ibukota Spa-

nyol itu juga menyajikan perbedaan bagi timnya, berkat jasa legiun asal Portugal itu. Madrid, sempat unggul 1-0 berkat gol pembuka CR7, diimbangi oleh gol sundulan Radamel Falcao di 10 menit pertama babak kedua.Tapi, Ronaldo punya sihir tersendiri untuk kembali menjadi faktor pembeda kedua tim dengan mencetak dua gol tambahan sebelum pesta Real ditutup aksi Jose Callejon.

“Kami sadar, mengambil tiga poin dari mereka, akan amat krusial bagi kami, dan kami bermain dengan intensitas yang tinggi untuk mengecap kemenangan. Kemenangan ini tetap memelihara kepercayaan diri kami,” tutur Xabi. “Cristiano (Ronaldo) adalah pemain yang krusial bagi kami dan selalu menjadi pembeda di banyak pertandingan dengan gol-golnya. Gol kedua dan ketiganya memberi kami semangat dan kepercayaan diri. Golgolnya itu juga menentukan,” lanjut mantan punggawa Liverpool tersebut. Kendati menjaga keunggulan menjadi empat poin dari Barcelona, Madrid harus tetap menatap laga-laga sisa bagaikan final. Pasalnya, Barca belum lelah untuk terus menguntit di posisi kedua. Di jornada ke-33 akhir pekan nanti, Los Blancos sudah dinanti Sporting Gijón. “Kuncinya, kami tak boleh kehilangan angka dan harus fokus pada satu pertandingan ke pertandingan lainnya. Kami senang bisa mengalahkan tim hebat seperti Atletico dan men-

MASKOT Juventus, Alessandro Del Piero (kanan), merayakan laga ke-700 bersama Si Nyonya Tua dengan gol kemenangan atas Lazio, Kamis (12/4). -AP-

Tuah Magis Del Piero TURIN, Italia (Waspada): Alessandro Del Piero melengkapi milestone mengesankannya dengan tampil sebagai pahlawan Juventus. Di laga ke-700, Del Piero mencetak gol penentu I Bianconeri atas Lazio 2-1. Sebelum duel kontra Lazio di Juventus Stadium, Kamis (12/ 4), Del Piero diketahui telah mencatatkan 699 laga sejak bergabung dengan Juve pada 1993 silam. Momen bersejarah yang ditunggu-tunggu Del Piero dan fans Juve pun akhirnya menjadi kenyataan kala Antonio Conte memasukkan sang bintang pada menit 73 menggantikan Mirko Vucinic. Saat Del Piero memasuki la-

pangan, Juve masih dalam posisi imbang 1-1 menyusul gol akrobatik Simone Pepe dibalas sundulan Stefano Mauri di penghujung babak pertama. Del Piero pun langsung menunjukkan magisnya seperti yang pernah ditunjukkan saat mencetak gol penting ke gawang AC Milan (Coppa Italia) dan Inter Milan (Serie A). Menjadi eksekutori tendangan bebas yang biasa diambil Andrea Pirlo, Del Piero sukses menjebol gawang Federico Marchetti dengan tendangan melengkung nan indah yang bersarang di pojok gawang Lazio. Seisi publik Juventus Sta-

dium pun bersorak menyambut gol sang ikon klub, karena Juve sukses memetik kemenangan plus merebut puncak klasemen dari tangan AC Milan dengan keunggulan satu poin. Del Piero sendiri mengaku senang bisa menjadi penentu kemenangan timnya. Lewat akun twitternya, @delpieroale, Del Piero mengatakan “Senang bisa mencetak gol dengan tendangan bebas…Kami masih di depan, malam yang indah!” Sayang, di balik euforia yang diberikan Del Piero kepada Juventini di seluruh dunia, sang pemain tengah harap-harap cemas menanti masa depannya yang masih suram, menyusul

Hasil Kamis (12/4) Catania vs Lecce Fiorentina vs Palermo Genoa vs Cesena Inter Milan vs Siena Juventus vs Lazio Napoli vs Atalanta Parma vs Novara

1-2 0-0 1-1 2-1 2-1 1-3 2-0

komentar Andrea Agnelli. Pasalnya, Presiden Juve itu mengatakan ini akan menjadi musim terakhir Del Piero bersama Si Nyonya Tua. Sementara itu, AS Roma mengalahkan Udinese 3-1 sehingga posisinya terpaut empat poin di bawah Lazio dan Napoli kalah 1-3 di kandang dari Atalanta.Saatbersamaan,InterMilan bangkituntukmengungguliSiena 2-1 hasil dua gol Diego Milito di San Siro. (m33/ant/rtr/ini)

Bayaran Mahal Kegagalan Robben DORTMUND, Jerman (Waspada): Direktur Olahraga Bayern Munich, Christian Nerlinger, mengakui kegagalan Arjen Robben mengeksekusi tendangan penalti pada bigmatch Bundesliga melawan Borussia Dortmund, Kamis (12/ 4), dibayar mahal dengan gagalnya menempel Dortmund di puncak klasemen. Kekalahan 1-0 itu membuat Munich tertinggal enam poin dari Dortmund yang berada di puncak klasemen. Alhasil, juara bertahan Bundesliga itu kembali difavoritkan untuk mempertahankan gelar. Robert Lewandowski memberikan keunggulan 1-0 pada menit 77. Tak lama berselang, Munich memiliki kesempatan untuk menyamakan kedudukan lewat tendangan penalti. Sialnya, Robben yang mengeksekusi tendangan tersebut gagal karena RomanWeidenfeller berhasil membaca arah bola dengan tepat. “Itu adalah pertandingan yang sangat dramatis. Selama 90 menit, Dortmund memiliki peluang lebih baik, sehingga mereka pantas meraih kemenangan. Di menit akhir pertandingan yang dramatis, (penalti Robben) seharusnya itu dapat membuat kami mendapatkan poin,” keluh Nerlinger. Meskipun demikian, Nerlinger telah berjanji Munich akan berjuang sampai akhir. Dikatakan, fokus Hollywood FC sekarang adalah terus berjuang hingga sisa musim karena Ner-

Hasil Kamis (12/4) Dortmund vs B Munich Hanover 96 vs Wolfsburg Nuremberg vs Schalke 04 Hamburg vs Hoffenheim Leverkusen vs Kaiserlautern

1-0 2-0 4-1 0-4 3-1

linger berasumsi segalaya masih memungkinkan secara matematis. Sebaliknya, kemenangan ini tidak menjadikan Dortmund sesumbar telah memastikan gelar. Pelatih Jurgen Klopp menegaskan timnya belum memenangi apapun, meski unggul enam poin di puncak klasemen. “Kami masih memimpin, namun kami tidak akan merayakan apa-apa saat ini,” tegas Klopp. Pada empat partai tersisa di liga, Dortmund akan meng-


EKSEKUSI penalti Arjen Robben (11) berhasil diselamatkan kiper Dortmund, RomanWeidenfeller, dalam bigmatch Bundesliga, Kamis (12/4). hadapi Schalke, Borussia Moenchengladbach, Kaiserslautern, dan Freiburg. Di lain pihak, Mu-

nich akan menghadapi Mainz, Werder Bremen, Stuttgart, dan Cologne. (m33/ant/rtr)

Kemenangan Historis Quevilly PARIS (Antara/Reuters): Anthony Laup menggebrak pada menit akhir ketika tim Divisi III, Quevilly, membuat kejutan besar saat mengalahkan tim Ligue 1 Stade Rennes 2-1 dan maju ke final Piala Prancis, Kamis (12/4). Laup menjebloskan bola melewati Benoit Costil pada akhir permainan lewat serangan balik tajam tiga menit menjelang akhir. Sebelumnya, Karim Herouat menyamakan kedudukan menjadi imbang sejak Julien

Feret mencetak gol pada babak pertama untuk Rennes. Quevilly mengawali permainan dengan lamban, tetapi meningkat permainannya setelah turun minum. Feret membuat tim tamu memimpin pada menit kedelapan lewat tendangan keras mendatar. Quevilly mengawali babak kedua dengan bagus dan mendapatkan hasilnya pada menit 64 berkat tembakan jarak jauh Herouat dari jarak 16 meter. Rennes mencoba melakukan tekanan, tetapi Jonathan Pitroipa kehilangan bola. Que-

villy pun melancarkan serangan balik yang akhirnya dimaksimalkan oleh Laup. Mampu membuka ruang, Laup menembak dari sudut sempit melewati kiper Rennes yang kemudian terduduk di gawangnya selama beberapa menit sesaat pluit panjang berbunyi. Quevilly, mengalahkan Olympique Marseille pada putaran sebelumnya, akan bertemu dengan Olympique Lyon pada 28 April mendatang. Di semifinal lainnya, tim juara Prancis tujuh kali itu mengalahkan tim Divisi III, Gazelec Ajaccio 4-0.

curi tiga poin penting dalam laga derbi,” sambungnya seperti disadur laman resmi klub. Real, akan bertandang ke markas Barca di Nou Camp pada 21 April mendatang, kini mengantongi 82 poin dari 32 pertandingan dan Barca mengoleksi 78 poin. Semifinalis Liga Europa, Atletico, menempati urutan sembilan dengan 42 poin dan terancam gagal tampil di pentas Eropa musim mendatang. Di pertandingan lainnya, Valencia merebut posisi Malaga di urutan ketiga klasemen, setelah Jonas membuat gol ganda untuk kemenangan timnya atas Rayo Vallecano. Jordi Alba dan Pablo Hernandez juga menyumbang gol bagi El Che yang menang 4-1. Levante hilang kesempatan untuk berada di urutan keempat setelah kalah 2-3 atas tim yang terancam degradasi, Sporting Gijon. Sementara itu, Athletic Bilbao yang juga menjadi semifinalis Liga Europa hanya bermain imbang 2-2 dengan Granada. (m33/ant/rtr/goal)

WIGAN, Inggris (Waspada): Kekecewaan terpancar dari wajah Sir Alex Ferguson seusai Manchester United tunduk 0-1 dalam lanjutan Liga Premier di markas Wigan Athletic, DW Stadium, Kamis (12/4). Namun, pelatih asal Skotlandia itu lapang dada mengakui kemenangan tim besutan Roberto Martinez tersebut. Setelah kedua tim bermain imbang tanpa gol di sepanjang 45 menit pertama, gawang David De Gea kemasukan gol Shaun Maloney di menit 50. Hingga laga berakhir, gol tunggal penyerang Skotlandia kelahiran Malaysia itu tak terbalaskan dan keunggulan Setan Merah terpangkas menjadi lima angka. “Malam yang mengecewakan bagi kami. Di sepanjang babak pertama, Wigan benarbenar mendominasi. Malam mengerikan yang kadang tidak bisa Anda hindari dalam sepakbola,” ujar Ferguson. Pria yang menangani Setan Merah sejak 1986 silam itu lantas mengakui performa gemilang punggawa The Latics. Menurut-

nya, Maloney cs berhak atas kemenangan pertama sepanjang sejarah pertemuan kedua tim. “Wigan memang tampil lebih baik dan layak menang. Meski kerap diremehkan, permainan mereka luar biasa,. Tanpa melihat posisi mereka di papan bawah klasemen, kemenangan ini merupakan kredit tersendiri bagi pelatih,” tutur pelatih berusia 70 tahun itu sportif. Dengan kekalahan tersebut, MU memang belum tergusur dari puncak klasemen dengan raihan 79 poin. Namun, armada Old Trafford saat ini hanya terpaut lima poin dari pesaing terdekat, Manchester City. Di saat bersamaan, tim besutan Roberto Mancini sukses menggulung West Bromwich Albion 4-0. City hanya butuh waktu enam menit untuk membuka keunggulan lewat sepakan keras Sergio Aguero. Menit 54, keagresifan City membuahkan hasil kedua lagilagi berkat Aguero. Berselang tujuh menit kemudian, giliran Carlos Tevez menggetarkan gawang West Brom sebelum dilengkapi aksi David Silva. Arsenal menundukkanWolverhamptonWanderers 3-0. Gol

Hasil Kamis (12/4) Man City vs West Brom Wigan vs Man United Wolves vs Arsenal QPR vs Swansea

4-0 1-0 0-3 3-0

Klasemen Man Utd 33 25 4 4 Man City 33 23 5 5 Arsenal 33 20 4 9 Tottenham 33 17 8 8 Newcastle 33 17 8 8 Chelsea 33 16 9 8 Everton 33 13 8 12 Liverpool 33 12 10 11 Fulham 33 11 10 12 Norwich 33 11 10 12 Sunderland 33 11 9 13 Stoke 33 11 9 13 West Brom 33 11 6 16 Swansea 33 10 9 14 Aston Villa 32 7 14 11 QPR 33 8 7 18 Wigan 33 7 10 16 Bolton 32 9 2 21 Blackburn 33 7 7 19 Wolves 33 5 7 21

78-28 79-26 66-41 57-38 50-42 56-38 38-34 40-36 43-43 46-52 42-41 32-45 39-47 35-44 35-44 38-56 31-57 36-65 45-70 34-73

79 74 64 59 59 57 47 46 43 43 42 42 39 39 35 31 31 29 28 22

Robin van Persie, Theo Walcott, dan Yossi Benayoun membawa Arsenal duduk di tempat ketiga dan menjauh dari kejaran Tottenham Hotspur (59). (m33/ant/rtr/sky)


WASPADA Jumat 13 April 2012

SMA Angkasa, SMPN 42 Kampiun LPI Tingkat Kota Medan MEDAN (Waspada): SMA Angkasa 1 menjadi juara kategori SLTA setelah menaklukkan SMK Raksana 5-0 pada final sepakbola Liga Pendidikan Indonesia (LPI) tingkat Kota Medan di Stadion Unimed, Kamis (12/4). Pertandingan baru berjalan 11 menit, SMA Angkasa sudah unggul lewat sepakan Novri Ardiansyah. Tampil di bawah tekanan, SMK Raksana harus susah payah menahan gempuran lawan. Hingga turun minum, kedudukan 1-0 tetap bertahan. Memasuki babak kedua, Angkasa langsung menekan. Menerapkan permainan bolabola pendek, Novri cs mampu mendikte permainan anak-anak Raksana untuk menambah em-

pat gol masing-masing dari Novri Ardiansyah (2), Josua Pailalah, dan M Juanda. Untuk kategori SLTP, gelar juara direbut SMPN 42 yang sukses mengandaskan SMPN 38 dengan skor 1-0. SMPN 42 mencetak gol di menit 18 melalui aksi Wahyu Wibowo. Sebagai juara, SMA Angkasa dan SMPN 42 berhak mewakili Kota Medan di LPI Tingkat Provinsi Sumut. (m18)

Waspada/Setia Budi Siregar

WAKIL dari Diknas Medan, Sugerno (kiri), dan Asrul Batubara (PSSI Medan) menyerahkan trofi kepada juara SLTP dan SLTA LPI Kota Medan di Stadion Unimed, Kamis (12/4).

Persati Lengkapi 8 Besar Taufan Gama Simatupang Cup IV PULAURAKYAT, Asahan (Waspada): Persati Air Batu merebut tiket terakhir ke babak 8 Besar setelah menahan PS PTPN III Kebun Bandar Selamat 0-0 dalam lanjutan turnamen sepakbola Taufan Gama Simatupang Cup IV Grup D di Stadion Pulu Raja, Pondok Batu, Pulau Rakyat, Asahan, Kamis (12/4). Tambahan satu angka membuat Persati total mengemas 12 poin untuk tampil di posisi kedua klasemen, sekaligus

melengkapi jatah 8 Besar. Meski gagal mengemas poin penuh, PS PTPN III tetap kokoh di puncak klasemen Grup D. Duel kedua tim yang dipimpin wasit Feryanto, berlangsung monoton. Kedua tim terkesan bermain aman, mengingat hasil imbang cukup untuk memastikan kedua tim melaju ke babak 8 Besar, khususnya bagi Persati. Sebelumnya, enam tim telah lebih dulu memastikan tiket 8 Besar. Keenam tim itu adalah

Bintang Timur, Bintang Kedjora (Grup A), Gunung Melayu, Padang Pulau (Grup B), PS Alba Aek Ledong, dan Padasa Enam Utama (Grup C). Sementara itu, pada pertandingan yang sudah tidak menentukan lagi, Neo Star Club menang tipis 1-0 atas PS Puja. Panitia Turnamen, Atan Zuhri Sinambela, mengatakan pertandingan babak 8 Besar akan mulai digelar pada Minggu (15/4) nanti. (a31)

Sumut Rebut Dua Medali Kejurnas JAKARTA (Waspada): Tim atletik Sumut berhasil mencatatkan nama di papan skor perolehan medali sementara pada hari pertama Kejurnas Atletik Remaja dan Junior 2012 di Stadion Madya Gelora Bung Karno Senayan Jakarta, Kamis (12/4). Itu setelah dua dari lima atlet Sumut yang tampil, yakni Welman Pasaribu meraih medali perak dari nomor lari 5000 meter putra, dan Abdul Hafiz merebut medali perunggu dari nomor lempar lembing putra. Peluang menambah medali sempat diperoleh Putri Aulia yang mampu menembus final nomor lari 200 meter. Sayang, Putri hanya finish kelima. “Senang juga dapat medali, apalagi yang pertama untuk Sumut di ajang ini, meski sebetulnya kurang puas karena catatan waktu saya kurang baik,” kata Welman. “Saya memang harus banyak berlatih lagi untuk bisa meraih yang terbaik. Karena, saya masih bisa meningkatkan kecepatan di garis finish. Tapi sudahlah, masih ada satu nomor lagi

yang akan saya ikuti. Mudahmudahan saya bisa memperbaiki penampilan,” kata siswa kelas 3 SMKN 1 Siborong-borong, Tapanuli Utara. Catat waktuWelman 16:24.77 memang hanya terpaut sedikit dari Khamid Soim (Jateng) yang merebut medali emas dengan waktu 16:24.26. Menurut pelatih kepala tim atletik Sumut, Mardi Lestari, Welman hanya kurang berani melakukan sprint jelang finish. Padahal anak pasangan Abdul Pasaribu dan Merry Sihombing ini tampak belum kelelahan. “Agnes (Sandiova) yang tampil di nomor 400 dan 1000

Jawaban di halaman A2







1 D

GELANDANG PSMS Medan, Riki Ardiansyah (34), diganjal pemain PSPS Pekanbaru dalam lanjutan Grup D ISL U-21 di Stadion Teladan Medan, Kamis (12/4). -Waspada/Hamdani-

PSMS,” kata Pelatih PSPS, Agus Rianto, mengaku pola kick and rush bukanlah sepakbola negatif. Sebelumnya, PSAP tampil mengejutkan saat menghentikan auman Macan Kemayoran 1-0. Torehan tiga angka pertama itu membuat PSAP berada di posisi ketiga setelah PSMS dan Persija Jakarta. Persija tampil menyulitkan anak-anak PSAP di babak pertama. Bahkan skuad asuhan Francis Wewengkang menguasai jalannya pertandingan, tetapi gagal dalam penyelesaian akhir. Sebaliknya, PSAP mengandalkan serangan balik melalui duet Irfandani dan Fauzon. Menit 56, Irfandani me-

Jadwal Sabtu (14/4) 15.30 WIB PSAP vs PSPS 19.00 WIB PSMS vs Persija

Klasemen Grup D PSMS Persija PSAP PSPS

2 2 2 2

1 1 1 -

1 1

1 1 1

3-0 2-1 1-3 0-2

4 3 3 1

manfaatkan kemelut di depan gawang Persija dengan menceploskan bola ke tiang jauh yang sulit diantisipasi penjaga gawang Persija, Adixi Lenzivio. Gol itu sekaligus mengejutkan kubu Persija yang akhirnya gagal merebut poin. (m18)

Maraton 5-K KONI Rantau Utara

200 Pebulutangkis Bersaing Di T Tinggi

RANTAUPRAPAT (Waspada): KONI Kecamatan Rantau Utara, Kabupaten Labuhanbatu, akan menggelar lomba maraton 10K, Minggu (15/4) nanti. Kegiatan itu sebagai rangkaian acara memeriahkan pelantikan pengurus baru. Untuk mendapat dukungan Ketua KONI Kecamatan Rantau Utara, Andi Pati Dana Siagian, beserta pengurus beraudiensi kepada Ketua Persatuan Atletik Seluruh Indonesia (PASI) Kabupaten Labuhanbatu, Amirin Harahap, Kamis (12/4). “Persiapan menggelar kegiatan dimaksud sudah maksimal. Lomba ini akan diikuti pelajar tingkat SLTP (putra) se-Kecamatan Rantau Utara. Untuk itu, kita mengharapkan dukungan dari PASI Labuhanbatu,” ucap Andi didampingi Muchlis (Wakil Ketua), Joko Gunawan (Sekretaris) dan Ketua KONI Labuhanbatu, Zainul Arifin Hasibuan. (a18)

TEBINGTINGGI (Waspada): Sekira 200 pebulutangkis mulai dari kelompok pemula hingga veteran mengikuti kejuaraan tingkat usia di GOR Marah Halim Kota Tebingtinggi, 1116 April 2012. Kejuaraan yang diikuti 55 klub itu sekaligus penjaringan atlet oleh PBSI Tebingtinggi. Ketua KONI Tebingtinggi, HM Daniel Sulthan SE, mengatakan kejuaraan itu diharapkan bisa melahirkan bibit pebulu-

tangkis andal dari Tebingtinggi. “Sudah saatnya pebulutangkis mengharumkan kembali nama kota kita ini,” harap Daniel, Kamis (12/4). Sekretaris Umum PBSI Sumut, Arwansyah, mengungkapkan adanya sejumlah atlet bulutangkis asal Kota Tebingtinggi yang mengharumkan Sumut dalam SEA Games 2011, yakni Anneke Feinya Agustin (ganda putri) yang meraih emas. Selain itu, Julis Josephine Santoso yang

meraih medali perunggu di PON. Plt SekdakoTebingtinggi, Drs Hadi Winarno MM, mengatakan kini Tebingtinggi merindukan prestasi atlet berbagai cabang dalam rangka mengharumkan nama kota di daerah lain. Sejak lama, Tebingtinggi dikenal sebagai gudangnya atlet berbagai cabang, misalnya angkat besi, sepakbola, bola voli, pencak silat, karate maupun bulutangkis. (a09)


meter putri bahkan baru pertama kali turun di Kejurnas. Tapi masih ada Agustina Manik (100 meter putri). Jadi kesempatan menambah medali memang masih terbuka,” tegas Mardi. Pembina atletik Sumut, Chairul Azmi Hutasuhut, meminta kelima atlet Sumut bisa mengeluarkan kemampuan terbaiknya. “Terus berjuang dan pantang menyerah. Kuatkan tekad kalian saat berada di lintasan lomba bahwa sesungguhnya kalian itu bisa. Kibarkan panjipanji kebesaran atletik Sumut di pentas nasional,” tegas Chairul. (yuslan)




MEDAN (Waspada): Permainan kick and rush yang diperagakan PSPS Pekanbaru menyulitkan PSMS Medan dalam mengembangkan permainan hingga kedua tim harus puas bermain imbang tanpa gol dalam lanjutan Grup D Indonesian Super League (ISL) U-21 di Stadion Teladan Medan, Kamis (12/4) malam. “Anak-anak terkejut dengan permainan kick and rush PSPS. Mereka tampil sapu bersih dengan bola-bola lambung disertai pressing ketat,” ujar Asisten Pelatih PSMS, Zefrizal, yang mengaku timnya tidak tampil dengan performa terbaik setelah Juanda Priyatna cedera engkel. Disaksikan 2.000-an penonton, PSMS yang kental dengan format 4-4-2 mengandalkan dua striker, Sutrisno dan Hendra Nasution. Namun keduanya sulit menembus pertahanan PSPS yang dikoordinir Khairil. PSPS sendiri hanya mengandalkan Mardiono sebagai ujung tombak. Tambahan satu angka ini tak mengubah posisi Ayam Kinantan untuk tetap memuncaki klasemen Grup D dengan nilai empat, setelah sebelumnya menggasak PSAP Sigli 3-0. Sebaliknya, PSPS masih di posisi juru kunci dengan satu poin. “Kita bersyukur dapat mencuri poin atas tuan rumah

Waspada/Yuslan Kisra

Problem Catur


MEDAN (Waspada): Ketua DPRD Medan, Drs H Amiruddin, memberi apresiasi kepada kepengurusan baru Pertina Kota Medan yang dinilai bergerak cepat dalam upaya meningkatkan pembinaan dan prestasi tinju. “Kita berharap di bawah pengurus Pertina baru, olahraga tinju Medan yang berjaya di era tahun 1980-an dapat bangkit dan meraih kembali kejayaan itu,” ucap Amiruddin saat menerima audiensi pengurus baru Pertina Kota Medan, Kamis (12/4). Dikatakan, kondisi sekarang sudah berbeda di mana pengusaha kurang berminat mengurus dan membantu pembinaan tinju. Begitupun, atlet dan pelatih diminta tidak putus asa, tapi sebaliknya terus berjuang menunjukkan prestasi terbaik. Ketua Pengkot Pertina Medan, Kapt CPM Binson Simbolon SH, mengatakan pihaknya bertekad menggelar kejuaraan pada 26-28 April nanti sebagai rangkaian pelantikan pengurus baru Pertina Kota Medan periode 2012-2015. (m42)

PSMS Kelabakan Gaya PSPS

TIM atletik Sumut foto bersama dengan Chairul Azmi Hutasuhut di Stadion Madya Senayan Jakarta, Kamis (12/4).

Putih melangkah, dalam posisi sekak mematikan lawannya dua langkah.


Ketua DPRD Apresiasi Pertina Medan







1. Nama pertempuran antara pasukan muslim versus pasukan Romawi Timur tahun 636. 3. ____ bin Walid, panglima pasukan muslim dalam pertempuran diatas, dikenal sebagai saifullah (pedang Allah). 5. Nama kaisar Roma pada pertempuran diatas, kepada siapa Rasulullah pernah mengirim surat untuk memintanya agar masuk Islam. 6. Buya _____, ulama besar, pernah menjadi Ketua MUI Pusat. 8. Deretan; Rangkaian nama-nama mereka yang terpercaya meriwayatkan hadis. 9. Nama istri Nabi Muhammad, menyimpan naskah kumpulan Al Quran asli Panitia Zaid. 10. Pemimpin. 12. Zat tanduk tipis pada ujung jari kaki dan tangan, disunatkan dipotong hari Jumat. 13. Nama populer Romawi Timur dalam sejarah perang diatas (No. 1 Mendatar) beribukota Constantinople. 17. Wakil (pengganti Nabi Muhammad setelah wafat). 18. Perbuatan baik yang mendatangkan pahala. 19. Singkatan Majelis Ulama Indonesia.

20. Tidak haram. 21. Surat Al Quran yang dibaca pada saat kemalangan. 23. Binatang yang disebut dalam surat Al Ghasiyah ayat 17. 24. Semoga Allah mengasihinya, mengampuninya.


1. Kaum yang berondok dan diberitahukan oleh batu yang berbicara menjelang kiamat. 2. Guru agama; Ahli agama. 3. Buah larangan yang dimakan Adam dan Hawa. 4. Kota pusat kekhalifan Umayyah. 7. Ucapan syukur kepada Allah. 9. Kebijaksanaan (dari Allah). 11. Ja’iz; Tidak berdosa dan tidak pula berpahala bila dilakukan. 14. Pedang Nabi Muhammad yang dirampasnya dari tangan musuh dalam perang Badar. 15. Sifat khusus untuk menunjukkan adanya Allah dan hanya ada pada Allah; Mentalitas. 16. Tulus hati; Al-_____ surat al Quran dimulai dengan kata qul. 18. Sejenis burung yang menyerang pasukan Abrahah. 19. Tempat bermalam, melempar jumrah dan menyembelih kurban. 22. Nabi yang anaknya bernama Sam.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

3 4

1 8 2 4 7 2 7 9 6 8 5 2 7 7 8 1 4 7 3 6 4 6 9





MF Pitra Terbaik Ketiga Brunei Campomanes Memorial Open MEDAN (Waspada): Pecatur Sumut, MF Pitra Andika, memperoleh hasil gemilang dengan menduduki posisi ketiga pada turnamen catur internasional bertajuk Brunei Campomanes Memorial Grand Master Open di Bandar Seri Begawan, Kamis (12/4). Pitra menempati posisi ketiga setelah mengemas 6,5 Match Point (MP). Posisi pertama dan kedua ditempati duo Uzbekistan, GM Dzhumaev Marat dan MI Vakhidov Jakhongir, yang juga memperoleh nilai sama, tetapi Pitra kalah solkof. Turnamen yang diikuti 40 pecatur dari Uzbekistan, Malaysia, India, Filipina, Vietnam, Srilangka, dan tuan rumah Brunei itu berlangsung selama enam hari sejak 7 April lalu dengan menggunakan sistem Swiss 9 babak. “Ini hasil menggembirakan dari Pitra Andika dalam upaya memperoleh norma Master Internasional,” ujar Sekum Percasi Sumut, Perry Iskandar, didampingi Ketua Umum Percasi Medan, Sonny Firdaus SH, Kamis (12/4). Percasi Sumut pimpinan Parlindungan Purba SH MM terus melakukan pembinaan di daerah dan terbukti Pitra Andika yang berasal dari Kota Medan sudah menoreh tinta emas pada Brunei Campomanes Memorial Grand Master Open. Keberhasilan Pitra ini diharapkan menjadi motivasi untuk memperoleh prestasi lebih baik lagi ke depan. Bahkan, menurut Perry, Pitra sempat memimpin sendirian pada babak ketujuh dengan nilai 6,5 MP. Namun pada babak sembilan, Pitra mengalami kekalahan atas GM Dzhumaev Marat. Pecatur Uzbekistan lainnya yang sampai babak delapan meraih 5,5 MP, MI Vakhidov Jakhongir, menang atas MI Sharma Dinesh (India) di babak kesembilan. Di babak delapan, Pitra memetik kemenangan atas MF Turqueza Mari Joseph (Filipina). (m18)


Hamilton Kena Penalti SHANGHAI, China (Waspada): Pukulan yang terbilang berat mendera Lewis Hamilton (foto), menjelang seri GP China. FIA memvonis Hamilton penalti lima grid saat start, Minggu (15/4) nanti. Otoritas tertinggi Formula One menjatuhkan sanksi tersebut, lantaran Hamilton mengganti gearbox di mobilnya. Gearbox McLaren MP4-27 miliknya memang diakui bermasalah, tapi baru dua hari belakangan diketahui penyebabnya. Tentunya, hukuman ini akan membuat berat perjuangan Hamilton untuk mengklaim podium puncak perdana musim ini sekaligus gelar GP China ketiga sepanjang kariernya. Hamilton sendiri mengaku dirinya sial, karena baru sadar gearbox usak, tak lama sebelum sesi latihan. “Keberuntungan belum berpihak pada saya, tapi saya yakin hal itu akan kembali, cepat atau lambat,” papar Hamilton, Kamis (12/4). Namun, hukuman itu belum menggugurkan gairahnya untuk tetap berjuang hingga garis finish sekaligus mendulang poin sempurna di seri ketiga. Modalnya pun dirasa cukup, terlebih performa Hamilton terbilang gemilang di dua seri perdana, yakni podium ketiga. “Masa sulit di musim lalu memberi saya pelajaran berharga tentang konsistensi. Tak ada gunanya mengejar hasil bagus jika tak didukung performa menawan di pekan-pekan sebelumnya,” pungkas juara dunia 2008 itu. (m33/auto)

Pasang Iklan Telp. 4528431 HP. 081370328259


WASPADA Jumat, 13 April 2012

Sumatera Utara

WASPADA Jumat 13 April 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:28 12:41 12:29 12:36 12:36 12:32 12:29 12:25 12:31 12:31

‘Ashar 15:37 15:48 15:38 15:43 15:43 15:44 15:38 15:34 15:40 15:39

Magrib 18:34 18:49 18:35 18:43 18:42 18:37 18:35 18:30 18:37 18:38



Shubuh Syuruq


19:43 19:58 19:44 19:52 19:51 19:46 19:44 19:39 19:46 19:47

04:55 05:06 04:55 05:01 04:01 05:00 04:56 04:51 04:58 04:57

05:05 05:16 05:05 05:11 05:11 05:10 05:06 05:01 05:08 05:07

L.Seumawe 12:34 L. Pakam 12:27 Sei Rampah12:27 Meulaboh 12:38 P.Sidimpuan12:26 P. Siantar 12:27 Balige 12:27 R. Prapat 12:23 Sabang 12:41 Pandan 12:28

06:20 06:32 06:20 06:27 06:26 06:25 06:21 06:16 06:23 06:22

Zhuhur ‘Ashar 15:41 15:36 15:35 15:46 15:37 15:36 15:37 15:34 15:47 15:39





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:41 18:34 18:33 18:45 18:31 18:32 18:32 18:29 18:49 18:33

19:51 19:42 19:42 19:54 19:39 19:41 19:41 19:38 19:58 19:42

04:59 04:54 04:53 05:04 04:54 04:53 04:54 04:51 05:06 04:55

05:09 05:04 05:03 05:14 05:04 05:03 05:04 05:01 05:16 05:05

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:28 12:29 12:39 12:32 12:29 12:35 12:24 12:34 12:27 12:26

18:33 18:35 18:46 18:37 18:35 18:42 18:30 18:40 18:32 18:32

19:42 19:44 19:55 19:46 19:44 19:51 19:38 19:49 19:41 19:41

04:55 04:56 05:04 04:59 04:55 05:01 04:51 05:01 04:55 04:53

05:05 05:06 05:14 05:09 05:05 05:11 05:01 05:11 05:05 05:03

Panyabungan 12:25 Teluk Dalam12:32 Salak 12:29 Limapuluh 12:25 Parapat 12:27 GunungTua 12:24 Sibuhuan 12:24 Lhoksukon 12:34 D.Sanggul 12:28 Kotapinang 12:22 AekKanopan 12:24

06:25 06:19 06:18 06:29 06:19 06:19 06:19 06:16 06:32 06:20

15:39 15:39 15:45 15:42 15:37 15:43 15:34 15:43 15:38 15:36

06:20 06:21 06:29 06:24 06:20 06:26 06:16 06:26 06:20 06:18

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:37 15:44 15:40 15:34 15:37 15:36 15:36 15:41 15:38 15:33 15:34




Shubuh Syuruq

18:29 18:36 18:35 18:31 18:33 18:29 18:29 18:41 18:33 18:28 18:30

19:38 19:45 19:44 19:40 19:42 19:38 19:37 19:50 19:42 19:36 19:39

04:53 05:00 04:57 04:52 04:54 04:52 04:52 04:59 04:55 04:50 04:51

05:03 05:10 05:07 05:02 05:04 05:02 05:02 05:09 05:05 05:00 05:01

06:18 06:25 06:22 06:17 06:19 06:17 06:17 06:24 06:20 06:15 06:16

Napi Kasus Korupsi Meninggal Mendadak BINJAI (Waspada): Napi kasus korupsi di Dinas PU Binjai, Ir. Zainal Arifin, 57, penduduk Jalan Gining Semeru Kelurahan Binjai Estate Kecamatan Binjai Selatan, Kamis (12/4) sekitar pukul 13:15 meninggal mendadak di Rumah Sakit Umum Bidadari Binjai, setelah mendapat perawatan medis. Pihak Lembaga Pemasyarakatan (LP) Binjai yang mengantar korban ke rumah sakit dan setelah mengetahui korban meninggal dunia, kemudian menyerahkan jenazahnya kepada keluarga untuk dikebumikan. Keterangandiperoleh,setelah

korban sholat dzuhur di masjid LP Binjai, korban pamit kepada teman-temannya sambil mengatakan dia lelah dan mau istirahat. Sementara teman-teman korban di LP tidak menaruh curiga sedikitpun. Namun ketika teman sekamarnya masuk, dia

melihat korban kejang-kejang. Teman korban langsung memberitahu pegawai LP. PihakLPlangsungmembawa korban ke RS Bidadari Binjai, di kawasan Binjai Utara. Setelah sempat mendapat perawatan, korban akhirnya menghembuskan nafas terakhir. Sementara itu keterangan lainnya menyebutkan, sebelumnya korban sudah sering ke luar masuk rumah sakit karena menderita penyakit jantung. Seharusnyakorbansudahbebasbersyarat karenasudahmenjalanihukuman 1tahun,dantinggalduabulanlagi hukuman yang harus dijalani.

Begitu juga adik Zainal Arifin, yaitu mantan Lurah Binjai Estate yang kini juga sedang menjalami hukuman dalam kasus penyelewengan dana bantuan Raskin, seharusnya sudah bebas bersarat. Namun permohonannya ditolak. Kalapas LP Binjai Surung Pasaribu, BCiP, SG, M.Hum ketika dikonfirmasi di ruang kerjanya, membenarkansalahseorangNapi meninggalmendadak.Diakuinya, semasa menjalani hukuman Ir. ZainalArifinsangattaatsholatlima waktu. Dia juga membenarkan, masahukumanZainalArifintinggal dua bulan lagi.(a05) Waspada/Ist

Bupati Langkat Bantu Speedboat Untuk Pelayanan Kesehatan STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH menyerahkan speedboat kepada Kadis Kesehatan Langkat, HermanSadeck, ditandai dengan penyerahankuncisecarasimbolis pada pelantikan kepengurusan PersatuanPerawatNasionalIndonesia (PPNI) Kab. Langkat, di Serambi Jentramalay rumah dinas bupati di Stabat, Rabu (11/4). “Manfaatkan sarana ini sebaik-baiknya guna memberi pelayanankesehatanbagimasyarakat pesisir pantai,” kata Bupati H. Ngogesa mengawali arahannya. Menurut Bupati, sektor kesehatan faktor penting dalam penguatansumberdayamanusia, karenanyaPemkabLangkatmencanangkan layanan kesehatan 24 jam di seluruh Puskesmas. Pada bagian lain Bupati berpesan agar keberadaan perawat mampumemberidampakpositif bagi peningkatan kualitas kesehatan masyarakat. “Perawat harus mampu mengembangkan ilmu pengetahuan sesuai kebutuhan masyarakat,” ujar Bupati seraya mengajak seluruh tenaga kesehatan yang telah diberi amanah kedudukan dan fasilitas dari negara, mengedepankan sisi kemanusiaan dalam memberi pelayanankesehatanmasyarakat. Sementara Ketua PPNI Sumut Evi Karota Bukit menyampaikankeberadaanperhimpunan

perawat wujud tanggungjawab dalammemberipelayananterbaik bagi pasien sesuai standar, kewenangan dan kompetensi perawat.SebelumnyaKetuaPPNI Kab. Langkat yang baru dilantik, H.M. Ansyari mengajak anggotanya untuk membulatkan tekaddansemangatberbuatyang terbaik bagi kemajuan dan

pengembangan dunia keperawatan, di Kabupaten Langkat khususnya. “Kebijakan yang dilakukan Bupati H. Ngogesa, peluang bagi perawat untuk lebih mampu berbuat ikhlas di masyarakat dan sepatutnya kita mendukung pemimpin yang peduli akan kesehatan warganya,” sebut

PLT Gubernur Sumatera Utara, H. Gatot Pujo Nugroho, ST bersama Bupati Sergai Ir. H.T. Erry Nuradi, M.Si didampingi Sekdakab Sergai selaku Ketua Panitia Pelaksana MTQ XXXIII tingkat Provinsi Sumatera Utara tahun 2012, Drs. H. Haris Fadillah, M.Si dan jajaran panitia pelaksana lainnya usai menerima audiensi di Gubernuran Medan.

Ansyari disambut ratusan perawat yang hadir, sembari menambahkan, sosok H. Ngogesa jauh sebelummenjabatsebagaibupati telah menunjukkan kepedulian akan peran penting kesehatan dengan membangun Rumah Sakit Delia di kampungnya, yang cukup banyak membantu masyarakat.(a01)

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH secara simbolis menyerahkan kunci speedboat kepada Kadis Kesehatan Langkat Herman Sadeck, di Serambi Jentramalay rumah dinas bupati di Stabat.

Perpisahan SMAN 1 L. Pakam LUBUKPAKAM (Waspada): Ratusan siswa SMA Negeri 1 Lubukpakam melaksanakan acara perpisahan dengan para pendidik (gurured), di Gedung Olah Raga (GOR) Lubukpakam, Rabu (11/4). Acara dirangkai dalam kegiatan Pentas Seni (Pensi) menampilkan grup band, tari tradisional, puisi, vokal solo, vokal group, dance dan kegiatan lainnya berlangsung meriah. Hadir Kepala Dinas Pendidikan, Pemuda dan Olahraga (Kadis Dikpora) Kabupaten Deliserdang Hj. Sa’adah Lubis, SPd, MAP, Kasek SMAN 1 Lubukpakam Badaruddin Tarigan, S.Pd, para guru, serta siswa SMAN 1 Lubukpakam. Kadisdikpora Deliserdang Hj. Sa’adah Lubis mengatakan, Pensi dapat dijadikan sebagai sarana mengembangkan bakat, talenta, kreativitas siswa khusus di bidang musik, tari dan sastra. Terlebih lagi kegiatan Pensi sesuai kebijakan Kementerian Pendidikan dan Kebudayaan, dimana Juni 2012 akan diadakan Festival dan Lomba Seni Siswa Nasional (FLS2N) di Mataram, Nusa Tenggara Barat, jelas Hj. Sa’adah. 17.551 Peserta UN Kadisdikpora juga menjelaskanTahun Pelajaran 2011-2012 jumlah siswa SMA, MA dan SMK di Deliserdang 67.551 orang, Dari jumlah itu 17.551 siswa kelas XII tercatat sebagai peserta Ujian Nasional (UN).UntukdapatlulusUNdenganprestasiterbaik,jujurdanterhormat, haruslah tekun belajar diiringi semangat. Sementara Kepala SMAN 1 Lubukpakam, Badaruddin Tarigan, S.Pd mengaku bangga melihat kreasi siswa yang setiap tahun terus melakukan inovasi dengan dukungan komite sekolah. Karenanya kepada seluruh siswa diingatkan untuk terus meningkatkan semangat belajar sehingga seluruh siswa kelas XII lulus UN.(a06)

212 Kilometer Badan Jalan Di Sergai Rusak Berat SEIRAMPAH (Waspada): Berdasarkan hasil musyawarah rencana pembangunan (Musrenbang) Kab. Serdang Bedagai dengan tema pemberdayaan ekonomi masyarakat dan kreativitas lokal, dalam upaya penanggulangan kemiskinan dengan memanfaatkan Sumber Daya Alam (SDA) berwawasan lingkungan, usulan terbesar dari masyarakat adalah peningkatan jalan. “Berdasarkan hal itu untuk tahun 2012 di bidang fisik, Pemkab Sergai memprioritaskan peningkatan (pembangunan) jalan,” kata Kepala Badan Perencanaan Pembangunan Daerah (Bappeda) Kab. Sergai, Ir. HM. Taufik Batubara kepada Waspada, Rabu (11/4), di ruang kerjanya di Sei Rampah. Dijelaskan Taufik, usulan masyarakat cukup berdasar, karena dari 1.463,95 Km panjang jalan di Sergai, 212,480 Km di antaranya kini rusak berat dan 344,276 Km rusak ringan. Menurutnya, salah satu penyebab, kerusakan jalan adalah kendaraan yang melebihi tonase, sehingga diharapkan pihak perkebunan dan pengusaha mematuhi peraturan terkait kelebihan tonase. “Pemkab Sergai berterimakasih kepada Pemprovsu yang telah meningkatkan status jalan yaitu jalan Sipispis batas Tebingtinggi sepanjang 29,02 Km menjadi jalan provinsi dan tahun ini mendapat peningkatan jalan sepanjang 5 Km,” terang Taufik Batubara. Pada paska Musrenbang Pemprovsu, lanjutnya, Pemkab Sergai akan memprioritaskan beberapa usulan krusial di antaranya pengusulan jalan lintas Matapao, Sei Rampah dan Sei Bamban (Marhaban), Jalan Susur lintas Timur Sergai, serta Ruang Terbuka Hijau (RTH) di sepanjang sepadan Sei Ular dan pembuatan bronjong di Sei Rampah.(c03)

Sukseskan MTQ XXXIII Di Sergai, Bupati Dan Panitia Temui Plt Gubsu SEI RAMPAH (Waspada): Mendekati waktu penyelenggaraan Musabaqah Tilawatil Quran (MTQ) XXXIII tingkat Provinsi Sumut tahun 2012, 28 April - 5 Mei 2012 di Kelurahan Melati Kebun Kec. Pegajahan Jalinsum Medan-TebingtinggiKab.Serdang Bedagai, Bupati Ir. H.T. Erry Nuradi, M.Si didampingi Ketua panitia pelaksana Drs. H. Haris Fadillah,M.Siberaudiensidengan Plt. Gubsu H. Gatot Pudjo Nugroho, ST di Gubernuran Medan, Rabu (11/4) sore. Bupati Erry Nuradi selaku ketua umum acara ini melaporkan persiapan pelaksanaan MTQ yang sudah hampir rampung pengerjaannya. Selain itu disebutkan, pembukaan even keagamaan akbar ini akan dihadiriMenteriAgamaRISuryadharma Ali, Menteri Koordinator Bidang Kesejahteraan Rakyat RI (Menkokesra) Agung Laksono, para pengurus Asosiasi Pemerintah Kabupaten Seluruh Indonesia (APKASI), unsur Forum Komunikasi Pimpinan Daerah (FKPD)ProvinsiSumutdansekitar 3000 kafilah ditambah penggembira serta official dari 33 kabupaten/kota se Sumut, yang diperkirakan jumlahnya 15000an orang.

Hari Ini, HUL Ke-88 Tuan Guru Babussalam MEDAN (Waspada): HUL ke-88 wafatnya Allah Yarham Syekh Abdul Wahab Rokan Al Kholidi Naqsyabandi,Tuan Guru Babussalam Langkat, diperingati Jumat (13/4) bertepatan dengan 21 Jumadil Awal 1433 H di Des Babussalam,Kec.Padangtualang, Kab. Langkat. Kepada Waspada, Kamis (12/ 4), Ketua DPD Persatuan PengamalThariqatIslam(PPTI)Provinsi Sumatera Utara Sutan Djalaluddin Siregar, SH, menjelaskan, makam Tuan Guru di sebuah bangunan berbentuk masjid setiap hari dikunjungi peziarah “Sedangkan para murid dari jamaah beliau memperingati hari wafatnya dengan berbagai kegiatan sebelum acara HUL ke-88 diadakan, antara lain suluk 40 hari diawali pembacaan Alquran dan hatam Alquran, zikir ratif syajaliah dan Maulid Nabi Muhammad SAW serta qasidah di sisi pusara

almarhum tiga malam berturutturut,” ujar Sutan Jalaluddin Siregar seusai melihat persiapan HULke-88TanGuruBabussalam. Dijelaskannya, acara puncak berlangsung siangnya di madrasah besar dengan pertemuan akbar, semacam reuni bagi seluruh jamaah dan murid Tuan Guru, yang sebagian berasal dari negara tetangga seperti Malaysia, Singapura,Brunai,Thailand.Tidak hanya dari Sumut seperti dari Medan,Labuhanbatu,TapanuliSelatan, Asahan,Tanjungbalai, Deliserdang, juga dari Provinsi Aceh, Riau, Pekanbaru dan lain-lain. “Acara HUL biasanya dihadiri sejumlah pimpinan eksekutif, legislatif, Muspida dan Muspika, serta tokoh masyarakat lainnya,” ujar Sutan Djalaluddin Siregar. Diungkapkannya, warga trariqat adalah insane yang beriman dan bertakwa; tidak hanyaberzikir,tetapijugaberpikir,

berkarya nyata serta memiliki tanggungjawab moral terhadap pembangunannasional. “PeringatanHULdapatdijadikanmomentummempertegassikaptersebut,” ujar Sutan Djalaluddin Siregar. Thariqat Naqsyabandiah sebagai unsur PPTI, lanjut dia, tidak mengajarkan warganya bersikap apatis dan berpangku tangan, tetapi tanggap dan dinamissebagaimanadicontohkan Tuan Guru Babussalam yang bertama Syekh Abdul Wahab Rokan Al Kholidi Naqsyabandi. “Bersamamuriddanjamaahnya, beliau menyingsingkan lenganbajudanmemanggulpacul mengolah tanah mencetak pertanian, pertambakan dan kebun, dibuat berpetak-petak sesuai jenis tanaman dengan pengairan yang teratur. Begitu jugausahapeternakandikerjakan denganteknologimaju,”ujarSutan Djalaluddin Siregar.(ihn)

Warga Tolak Rumah Ibadah Ilegal TEBINGTINGGI (Waspada): RatusanwargadiKel.Durian,Kec. Bajenis dan Kel. Mandailing, Kec. TebingtinggiKota,menolakkeberadaanrumahibadahilegaldikomplek perumahan Deli Nusa Indah. Penolakan itu disampaikan melalui surat diserahkan kepada Wali Kota Tebingtinggi dan instansi terkait. Delegasiwargayangbertemu Plt. Sekdako Tebingtinggi Drs. H. HadiWinarno,Selasa(10/4),yakni pengurus BKM Masjid Al Hidayah Aswad Asmara, Ketua DPW FrontPembelaIslamSyafriJambak, Edwin Dhani dan Kepala Lk.01, Kel. Durian, Rohman, menyampaikan surat penolakan mereka. Dalamsurattertanggal11April 2012 kepadaWali Kota Ir. H. Umar Zunaidi Hasibuan, MM warga menyatakankeberatandanprotes atasaktivitasibadahdankeberadaan rumahibadahunitAhmadYaniyang

menempati rumah toko. Selain lokasinya berada di pemukiman umat Islam, warga yakin keberadaannya menyalahi Peraturan Bersama Menteri Agama dan Menteri Dalam Negeri No.8dan9Tahun2006,khususnya pasal18ayat1.Suratituditembuskan ke Kapolres, DPRD, FKUB Camat Bajenis, Lurah Durian dan Mandailing. Pasal itu berbunyi; Pemanfaatanbangunangedungbukanrumah ibadah sebagai rumah ibadah sementara harus mendapat surat keterangan pemberian izin dari bupati/wali kota, dengan memenuhi persyaratan. Dalam surat itu, diterangkan juga, pada 2011 lalu, keberatan GBI Unit AhmadYani, secara lisan dan tertulis keberatan warga sudah disampaikan kepada aparat pemerintah. Namun, pengaduan itu tidak ditanggapi serius,

sehingga aktivitasnya berlanjut hingga kini. “Kondisi itu terkesan melecehkan warga sekitar.” Sementara Edwin Dhani minta PemkoTebingtinggi tegas, jangan sampai kasus rumah ibadah Jalan Sutoyo yang saat ini bangunannya sudah permanen terulang kembali. HalsenadadisampaikanKetua DPW FPI Tebingtinggi Syafri Jambak.“Dulukitadiamkankarena mereka janji takkan melanjutkan aktivitasibadah,karenasewaruko hampirhabis.Tapisekarangmereka lanjutkan,malahkianramai,”kata Syafri Jambak. DalampertemuandenganPlt. SekdakoTebingtinggi,utusanwarga minta Pemko Tebingtinggi menutup rumah ibadah ilegal itu secepatnya. “Jika dalam tempo 10 haritakadarealisasi,jangansalahkan wargamelakukanaksisendiri,”tegas utusan warga.(a09)

Pihak panitia telah berkoordinasi dengan jajaran Kepolisian DaerahSumateraUtara(Poldasu) untuk mengamankan lokasi acara serta mengatur lalulintas dengan mengalihkan jalur lalin ke beberapa jalur alternative, sehingga tidak terjadi kemacetan lalulintas saat acara pembukaan. Selain itu sedikitnya ada 20 Duta Besar negara sahabat, menurut Erry Nuradi akan hadir. Untuk itu diminta kepada jajaran

Pemprovsu agar memfasilitasi penyambutan para Dubes dan Menteri setibanya di Medan, hingga menuju lokasi acara. Menanggapi laporan Bupati Erry Nuradi, Plt. Gubsu Gatot Pudjo Nugroho menyambut dengan antusias pelaksanaan MTQ XXXIII, sekaligus mengucapkan terimakasih atas kesediaan Pemkab Sergai menjadi tuan rumah. “Semoga segala persiapan yang dilakukan dapat

mendukung terselenggaranya acara ini dengan sukses dan mencapai sasaran, sebagaimana yang diharapkan,” kata Gatot. Plt. Gubsu mengimbau semua pihak terkait bekerja maksimal untuk mensukseskan seluruh rangkaian acara mulai dari awal persiapan hingga akhir penyelenggaraan. “Pemprovsu siap memfasilitasi para tamu dari kedutaan dan menteri menuju ke lokasi.”(a08)

Camat Sirapit Dicopot Dari Jabatannya STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu, SH mengambil langkah tegas dengan mencopot aparatnya yang melaksanakan tugas melampaui batas kewenangan. Proses penon-aktifan Camat Sirapit SG Manik segera dilakukan dan sebagai pelaksana tugas sementara waktu dihunjuk Asisten Pemerintahan, kata Sekda Langkat H. Surya Djahisa menjelaskan kepada sejumlah karyawan PT Langkat Nusantara Kepong (LNK) yang menyampaikan aspirasinya ke kantor bupati di Stabat, Selasa (10/4). Lebih lanjut Surya Djahisa didampingi Asisten PemerintahanAbdulKarim,KabanKesbangpolinmas Sulistianto,KakanSatpol-PPIrhamSukridanKabag Humas Syahrizal mengemukakan, pihaknya telah memanggilCamatSirapitatasperintahbupatiguna memintapenjelasantentangsuratyangdikeluarkan Camat bernomor 593.7-87/SRP/2012 tertanggal 26 Maret 2012 ditujukan kepada Manajer PT. LNK KebunTanjungKelilingperihalagartidakmemasuki

lahan areal HGU PTPN II/PT. LNK. Sementara itu, Sujono selaku jurubicara karyawan mengemukakan akibat surat camat itu, karyawan PT. LNK Kebun Tanjung Keliling yang berada di wilayah Kec. Sirapit tidak bisa bekerja dan merasa resah. Kami tidak ingin diadu domba karena kami bekerja untuk menafkahi keluarga kami, kata Sujono seraya meminta ketegasan Pemkab Langkat. Sebelumnya Bupati Langkat H. Ngogesa yang menerimatembusansuratdaricamattersebutmerasa kaget dan langsung memerintahkan Sekda, Asisten Pemerintahan, Kabag Tapem dan Kabag Hukum guna meminta pertanggungjawaban camat. Setelah diketahui isi surat melampaui batas kewenangan seorang camat dan berpotensi menimbulkan polemik antar masyarakat dan karyawan, akhirnya Sekda H. Surya Djahisa merekomendasi kepada bupati untuk mencopot oknum camat yang bersangkutan.(a01/a03)

Waspada/ Riswan Rika

WALI Kota Binjai HM Idaham didampingi Ketua TP PKK Ny. Lisa Andriani bersama pendukung acara seni di PRSU ke 41 Medan.

Binjai Tampil Dengan Dongeng Silancang Dan Barongsai Di PRSU BINJAI (Waspada): Binjai tampil beda di Open Stage PRSU ke 41 di Medan, Selasa (10/4) malam, dengan dongeng si lancang oleg siswa SD sampai Barongsai yang meraih prestasi internasional. Pergelaran Barongsai ketika menyambutWali Kota Binjai HM Idaham dan Ny. Lisa Andriani saat memasuki lokasi open stage mendapat perhatian ratusan pengunjung, walau situasinya hujan. Suasana open stage PRSU di Medan disi

PemkoBinjai.Berbagaiatraksidihadirkan.Ternyata Binjai tampil dengan kelompok prestasi. Seperti Sanggar Rumput Hijau SMA Negeri 2 Binjai yang meraih gelar juara nasional musikalisasi puisi 2011. Pendongeng cilik M. Hafiz siswa SD 027950 Binjai dengan dongeng si Lancang, ternyata mendapat perhatian pengunjung. M. Hafiz merupakanjuaramendongengProvinsiSumateraUtara, bercerita diiringi lakonnya yang mengundang kagum dan humoris.(a04)

Wali Kota Dumai Berkunjung Ke IPQAH Binjai BINJAI(Waspada):WaliKotaDumaiH.Khairul Azhar, SH didampingi Sekda dan penjabat eselon II, Kamis (12/4) mengunjungi Kantor IPQAH Binjai di Jalan Gatot Subroto Kelurahan Limau Mungkur, Kec. Binjai Barat. Wali Kota Dumai H. Khairul dan Ketua IPQAH (Ikatan Persaudaraan Qari/Qariah) Binjai H.Yusuf, SH, M.Hum terlibat pembicaraan program peningkatan pengajian Alquran serta program Magrib Mengaji. HM. Yusuf menjelaskan, pembinaan qari dan qariah tidak bisa dalam waktu singkat.

IPQAH Binjai mengumpulkan qari dan qariah se Kota Binjai untuk dibina qari internasional. “Jika diperlukan kami mengundang qari bertaraf internasional lain untuk mengajar,” ujar Yusuf. Wali Kota Dumai H. Khairul Azhar, SH tertarik dengan pola pembinaan IPQAH Kota Binjai, dan minta IPQAH berkunjung ke Dumai, sehingga pertukaran ilmu bisa lebih banyak. Khairul Azhar mengundang IPQAH Binjai ke Dumai dan melakukan kerjasama dalam pengembangan Magrib Mengaji.(a04)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana

Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David

Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

KOTAPINANG (Waspada): Paripurna penyampaian nota Laporan Keterangan Pertanggung Jawaban (LKPJ) Bupati Labusel 2011 di gedung DPRD, Kamis (12/4) diwarnai unjukrasa yang dilakukan sekelompok pemuda yang tergabung dalam Lembaga Independen Pemuda Indonesia (LIPI). Dalam orasinya pengunjukrasa meminta DPRD Labusel menolak LKPJ Bupati karena didugalaporanyangdisampaikan tidak benar. Koordinator Aksi Samsuten Ritonga mengatakan, sepanjang tahun 2011 kinerja bupati tidak berjalan maksimal. Hal ini dilihat dari banyaknya proyek yang tidak selesai dan berbagai kebijakan lain yang tidak tepat sasaran. Meskiaksiinihanyadilakukan oleh enam orang, namun pengawalan yang dilakukan petugas Satpol PP-Linmas cukup ketat.

Ratusan petugas terlihat berjaga didepanpintugedungmencegah pendemo masuk ke arena paripurna.“Apayangdilakukanbupati belum sesuai dengan visi-misinya,” kata Erwin. Sementara pada paripurna yangdipimpinKetuaDPRD,Ferry Andhika Dalimunthe itu, Bupati Labusel Wildan Aswan Tanjung saat membacakan nota pengantar LKPJ-nya menyebutkan, kondisi ekonomi makro Labusel pada 2011 berdasarkan PDRB berdasarkan harga konstan yang mencapai Rp2,83 triliun maka

pertumbuhan ekonomi Labusel baru mencapai 5,61 persen atau lebih rendah dari Sumut yang mencapai 6,58 persen. Dengan jumlah penduduk 2011sebanyak285.437jiwa,maka PDRB perkapita Labusel mencapai Rp22,6 juta yang berpengaruh pada menurunnya tingkat pengangguran terbuka sebanyak 3,92 persen dari tahun sebelumnya. Namun jumlah penduduk miskin2011mencapai40.600jiwa atau 14,22 persen. Paripurna diskors hingga 30 April, dan untuk pembahasan LKPJ Bupati Labusel 2011 dilakukan melalui mekanisme panitia khusus (Pansus) yang diwakili utusan masing-masing fraksi di DPRD Labusel. Pansus diketuai Hasraruddin Daulay (Fraksi Golkar), Hari Maryono (Fraksi Demokrat), dan Hari Muktasar (Fraksi Pembaharuan). (c18)

Korsleting Listrik, Restoran Sari Laut Terbakar TANJUNGBALAI (Waspada): Restoran Sari Laut di Jalan SudirmanKotaTanjungbalailudes terbakar, Kamis (12/4) sekira pukul 03:00. Kebakaran diduga akibat korsleting listrik. Tidak ada korban jiwa dalam peristiwa itu, namun kerugian ditaksir puluhan juta rupiah. Petugas dari PolsekTanjungbalai Selatan juga telah memasang garis polisi (police line) untuk keperluan penyelidikan. Informasi dihimpun Waspada, seperti biasa penjaga malam, Buyung, 50, berkeliling ke sekitar restoran untuk memeriksa keamanan dilengkapi lampu penerang senter. Saat Buyung meronda itulah, terdengar suara gemericik api mirip dua kabel listrik beradu. Karena terkejut, lelaki itu mencari tahu asal suara. Saat tiba di bagian ruangantengahdiamelihatbunga api berasal dari kabel listrik dekat kipas angin.

Seketika Buyung berusaha mematikan seluruh aliran listrik di restoran yang kerap dijadikan tempat berbagai acara termasuk pernikahanitu.TapiusahaBuyung gagal, percikan api tetap tak mau mati sehingga Buyung berlari ke jalan raya dan memukul-mukul tiang telepon sambil berteriak, berharap masyarakat terbangun. Tak cukup sampai di situ, Buyungmengambilinisiatifmenghubungi pemadam kebakaran dengan minta bantuan security salah satu bank.Tak berapa lama dua unit mobil pemadam tiba di lokasi memadamkan api yang telah membesar dan merambat ke seluruh sisi bangunan. Saat air habis, ternyata api belum juga dapat dikuasai sehingga empat truk pemadam lainnnya dikerahkan. Beruntung, si jago merah dapat dijinakkan tanpa merenggut korban jiwa. Pemilik Restoran A Ciu alias Suheridilokasikejadian,mengata-

kanrestoransudahtidakberfungsi sejak beberapa minggu lalu. Namun terdapat sejumlah pedagang yang memanfaatkan bangunandanlistrikdibagianpaling depan, tepatnya di pinggir Jalan Sudirman depan SMP Negeri 1 T. Balai. Kepala Badan Nasional Penanggulangan Bencana Daerah (BNPB) KotaTanjungbalai, Mahdin Siregar didampingi Sofyan, ST yang turun ke lokasi, mengatakan api berhasil dikuasai dalam waktu kurang dari 30 menit. Dia mengimbau warga senantiasa waspada karena musibah kebakaran dapat muncul kapan saja. Kapolres Tanjungbalai AKBP EP Sirait melalui Kapolsek Tanjungbalai Selatan Kompol B Siallagan, didampingi Kasubbag Humas AKPY Sinulingga mengatakantidakadakorbanjiwa.Dugaan sementara kebakaran diakibatkan terjadinya hubungan arus pendek (korsleting listrik).(a32)

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT

� Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Hakim Minta Hadirkan Barang Bukti SS 3 Kg KISARAN (Waspada): Sabu-sabu (SS) seberat tiga kilogram bisa merusak satu provinsi, dan majelis hakim PN Kisaran minta menghadirkan barang bukti di depan sidang. Hal itu diungkapkan Ketua Majelis Hakim PN Kisaran Zulfida Hanum, SH saat memimpin sidang mendengarkan keterangan saksi dari personil Polres Asahan terhadap kasus membawa SS tiga kilogram dengan terdakwa ZN, 41, warga Kampung Baru, Kota Tanjungbalai, Selasa (10/4). Menurutnya, SS tersebut telah dimusnahkan, namun barang bukti berbentuk mobil, tas, dan telepon genggam harus dihadirkan agar dapat diperlihatkan kepada terdakwa. “SS seberat tiga kilogram ini bisa merusak masyarakat satu provinsi. Oleh sebab itu barang bukti lainnya harus dihadirkan untuk kelancaran sidang sidang,” ujar Zulfida. Keterangan saksi dari Polres Asahan menjelaskan, tertangkapnya terdakwa, saat di dalam mobil Avanza warna hitam BK 1419 HA yang melintas di Jalinsum, tepatnya depan Makam Pahlawan saat akan menuju Medan, 21 November 201 malam. Sehingga terdakwa diamankan bersama barang bukti lainnya untuk proses penyidikan. “Dia tertangkap saat razia rutin yang ditingkatkan bersama tiga orang temannya (dua wanita dan satu pria). Namun hasil penyelidikan, rekannya tidak mengetahui bahwa terdakwa membawa barang haram itu,” ujar Saksi. SedangkanuntukjasakarenamembawaSSdariTanjungbalai-Medan, kata saksi, mendapat bayaran sebesar Rp10 juta, namun uang yang baru diterimanya sebanyak Rp1,5 juta untuk biaya perjalanan. Sementara, JPU Hendri Edison Sipahutar, SH, MH mengakui barang bukti tersebut dan akan menghadirkannya dalam persidangan berikutnya. “Barang bukti mobil, tas dan telepon genggam itu ada danmasihtersimpan,danakankamihadirkanpadasidangberikutnya,” ujar Hendri. (a15)


PENYAMBUTAN Plt Gubsu Gatot Pujonugroho bersama Ketua Umum DPW Generasi Muda Puja Kesuma H Suratman dan MPO GM Puja Kusuma Sumut H Faisal SP saat meresmikan pendopo serbaguna Batubara.

Plt Gubsu Tutup Festival Kuda Kepang LIMAPULUH (Waspada): Plt Gubsu H Gatot Pujonugroho, ST, Senin malam (9/4) secara resmi menutup Festival Kuda Kepang se Kab. Batubara yang telah berlangsung sejak 5 April di Lapangan BolaDesaMangkei,Kec.Limapuluh,Kab.Batubara yangdiselenggarakanGenerasiMudaPujakesuma. Selainmenutupfestivalkudakepang,PltGubsu Gatot Pujonugroho yang disambut ribuan masyarakat dari etnis Jawa, Simalungun, Karo, Batak, KBPPP Polri dan tokoh masyarakat dari ulama, juga meresmikan Pendopo Serba Guna yang berlokasi di Desa 4 Negeri, Kec. Limapuluh. Dalam kesempatan ini, Plt Gubsu didampingi KetuaUmumDPPPujakesumaHSuratmanSP,MajelisPertimbanganOrganisasiPujakesumaAKBP(Purn) Rusbandi, Ketua Dewan Pakar Pujakesuma Prof Dr Sri Sulistiawati disambut MPO GM Pujakesuma Sumut Ir Zahir MAP, Faisal SP dan Sekretaris GM Pujakesuma SumutWarsim dan Zulkarnain. PltGubsumengatakan,pengalamanhidupnya

sebagai puncak prestasi yang dikenangnya adalah, ketika acara perpisahan di Sekolah Dasar (SD) yang menarikan kuda lumping bersama temannya yang tak terlupakan. “Jadi saya sudah merasakan, prosesnya adalah panjang jadi sebenarnya orang Jawa semua gerak, tembang dan tari itu punya filosopi yang tinggi,” katanya. Ketua GM Pujakesuma Batubara Mahendra Sudrajat dalam laporannya menjelaskan bahwa festival kuda kepang ini diikuti 11 peserta memperebutkan piala bergilir GM Pujakesuma Sumut dan hadiah uang tunai, bingkisan dan piagam penghargaan. Sementara Ir Zahir, MAP selaku MPO GM Pujakesuma mengatakan, masyarakat Batubara rindu terhadap kunjungan Plt Gubsu Gatot Pujongrohoyangganteng.Karenanya,kedatangan Plt Gubsu di Desa 4 Negeri Kec. Limapuluh, Kabupaten Batubara ini disambut meriah ribuan masyarakat. (m14)

Dua Maling Dihajar Massa AEKKANOPAN (Waspada): Dua orang maling nyaris tewas dihajar massa karena keduanya tertangkap basah sedang menyatroni rumah milik warga Tanjung Sari II Desa Tanjung Pasir, Kec. Kualuhselatan, Kab. Labuhanbatu Utara (Labura) Rabu (11/4) malam. Kedua pelaku itu DK, 21, warga Dusun Kampungbanjar,DesaTanjungpasir,Kec.Kualuhselatan danDS,22,wargaDusunAekronggas,DesaHasang, Kec. Kualuhselatan. Informasi dihimpun menyebutkan, kejadian itu bermula saat kedua pelaku sedang menyatroni rumah Darmawan, warga Tanjungsari II Desa Tanjung Kec. Kualuhselatan, keduanya masuk melalui jendela rumah korban dengan cara

mencongkelnya, kemudian pelaku mengambil mesin genset milik korban. Saat keduanya sedang melakukan aksinya, pemilik rumah memergoki perbuatan mereka, dan secara spontan berteriak minta tolong, yang mengundangperhatianwargayanglain.Kemudian warga datang berbondong bondong dan langsung menghakimi kedua pelaku. Kapolsek Kualuhhulu AKP Arifin Marpaung didampingi Kanit Reskrim Iptu Sunarto membenarkan kejadian tersebut. Dikatakannya petugaslangsungterjunkeTKPuntukmengamankan pelaku. “Kita telah mengamankan kedua pelaku dankeduanyatelahkitabawakeRSUDLaburauntuk mendapatkan perawatan,” kata Kapolsek. (c08)

Ganti Rugi Tanah Masjid An’nur Dipertanyakan

Hubungi kami


Jumat 13 April 2012

Paripurna LKPJ Bupati Diwarnai Unjukrasa

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi:


Waspada/Rasudin Sihotang

PETUGAS pemadam kebakaran dari BNPB berusaha menjinakkan api yang membakar restoran Sari Laut, Kota Tanjungbalai.

Tikam, Bacok Biasa Di Baganasahan TANJUNGBALAI (Waspada): Aksi tikam-menikam dan pembacokan merupakan sesuatu hal yang biasa di kawasan Baganasahan, Kec. Tanjungbalai, Kab. Asahan. “Kalau saya amati, bacokbacokan adalah hal biasa bagi masyarakat sini, padahal telah kami imbauan dan arahan agar warga tetap senantiasa menjaga keamanan,” kata Kapos Polisi Baganasahan Aiptu R Sirait melalui Petugas Aiptu E Manurung ditemui Waspada di ruang kerjanya, Selasa (10/4). Menurut Manurung, alasan dia mengatakan hal itu, karena

seringnya terjadi penganiayaan menggunakansenjatatajamantar sesama warga terutama di kalangan pemuda. Aksi seperti itu, kata Manurung, telah berlangsung lama dan dia mengaku belum mengetahui motif pembacokan meski korban telah banyak berjatuhan. Selain itu, Manurung juga mengakusalahsatufaktorkendala dalam menangani kasus di wilayah kerjanya itu akibat minimnya petugas Pos Baganasahan yang hanya berjumlah enam personel. Padahal, wilayah hukum yang ditanganinya cukup luas mencakup 9 desa dengan jumlah pen-

duduk sekitar 30 ribu jiwa. Di tempat terpisah, seorang warga Hermansyah Siregar alias Sangkot menegaskan, saat ini BaganasahanmembutuhkanKepolisian Sektor demi penegakan hukum di Baganasahan. Selama ini, kata Sangkot, banyak kasus yang tak jelas proses hukumnya, diduga akibat minim personel Pos Polisi setempat. Untukitu,diamewakiliwarga Baganasahan berharap agar Kapoldasu Irjen PolWisjnu Amat Sastromempertimbangkanuntuk menambah personelnya dengan mendirikan Kepolisian Sektor di muara Sungai Asahan itu. (a32)

Truk Tangki Terguling Di Jalinsum LIMAPULUH (Waspada): Truk tangki BK 9912 BH bermuatan Crude Palm Oil (CPO) yang datang dari arah Kisaran menuju Medan terbalik di Jalinsum Desa Karang Baru, Kec.Talawi, Kab. Batubara, Selasa (10/4).

Menurut keterangan Rohadi, pemilik warung tempat di mana truk terguling, menyebutkan, saat terguling mengeluarkan suara cukup keras. “Waktu itu saya sedang berada di dalam rumah. Tiba - tiba

di luar terdengar suara, dan ketika saya keluar sudah ada truk yang terguling,” kata Rohadi. Warga yang ada di sekitar langsung memanfaatkan peristiwa itu dengan mengambil CPO yang tertumpah. (c05)

BAGANDALAM, Batubara (Waspada): Pengurus BKM Masjid An’nur Desa Bagandalam, Tanjungtiram, Batubara merasa dipermainkan tentang ganti rugi tanah masjid terkena proyek jalan Kemenpera. “Sampai hari ini, kami belum menerima uang ganti rugi tanah masjid kena pembangunan jalan proyek Kemenpera dijanjikan,” kata Zainuri Sekretaris BKM An’nur Bagandalam, Selasa (10/4). Cerita Zainuri didampingi Ketua BKM An’nur Ustadz H. Husairi Lc, S.Ag, berawal dilaksanakan pekerjaan pembangunan jalan beton asal proyek Kemenpera berdana Rp3,9 miliar Januari 2012 lalu. Karena terkena tanah masjid, pihak BKM, Kades, Konsultan, Kontraktor sepakat mengganti rugi tanah masjid termasuk tanah Alwashliyah, tanah milik Dt Zainuddin. Untuk tanah masjid semula diganti dengan

tanah timbun 20 motor, tetapi BKM minta senilai harga tanah timbun waktu itu Rp5.200.000. Setelah ditunggu sekian bulan uang ganti rugi disepakati tak kunjung dibayar, tanpa jelas siapa yang bertanggungjawab Tanah Alwashliyah dan tanah Dt Zainuddin sudah dibayar. Sumber menyebutkan, yang bertanggungjawab membayar ganti rugi tanah masjid sudah dilimpahkan kontraktor kepada Kades Bagandalam Am.Tak jelas apakah benar atau tidak Kades Am yang bertanggungjawab, karena sampai, Selasa (10/4) BKM An’nur belum menerima ganti rugi tersebut. “Kami tak tahu jawaban bila jamaah masjid mempertanyakan ganti rugi tanah masjid. Setahu kami yang bertanggungjawab sejak awal adalah pihak kontraktor proyek Kemenpera,” ujar Zainuri. (a12)

Pengaruh Narkoba, Adik Pukuli Kakak TANJUNGBALAI (Waspada): Diduga akibat pengaruh pemakaian narkoba, seorang adik tega menganiaya kakaknya, Selasa (10/4). Informasi dihimpun Waspada, kejadian berawal saat korban Ina, 36, warga DusunV, Desa Baganasahan, Kec. Tanjungbalai, Kab. Asahan sedang makan siang bersama kedua anaknya di rumah. Tiba-tiba, adiknya berinisial Ra, 30, datang marah-marah meminta uang diduga untuk membeli narkoba. Karena korban tidak bersedia memberikan, Ra naik pitam dan menganiayanya menggunakan pemukul bulu tangkis (raket). Tidak sampai di situ, duda yang diduga telah terpengaruh narkoba itu,lantasmengambilsatuunitsepedayangterparkir di dekatnya dan menghempaskannya ke tubuh korban. Lebih parah lagi, Ra bergegas mengambil alat pemotong rumput (celurit/sabit) ke dapur dan mengancam akan membunuh korban. Tak tahan dengan perbuatan adiknya yang telah lama tinggal satu rumah itu, Ina berlari ke Pos Polisi yang tak jauh dari lokasi kejadian untuk meminta perlindungan. “Kami tak tahan lagi pak, sudah sering kali dipukuli. Dulu dia tidak begini, tapi sejak memakai

sabu-sabu dan ngelem, dia jadi beringas. Kami takut pak, katanya kami akan dibunuh,” ungkap Ina sambil terisak sedu saat membuat laporan di Pos Polisi Baganasahan. Kapolres Asahan AKBPYustan Alpiani melalui Kapos Baganasahan Aiptu R Sirait didampingi staf Aiptu E Manurung membenarkan pihaknya menerima laporan itu. Dikatakan Manurung, dirinya akan meneruskan pengaduan itu ke Polsek Airjoman untuk dilakukan penyelidikan. Sementara, seorang ibu rumah tangga M Boru Siregar,41,menjelaskanbahwaperedarannarkoba di Baganasahan kondisinya sudah sangat memprihatinkan. Dikatakan, para pengedar menjual narkoba secara terang-terangan di tengah masyarakat bahkan dengan harga yang sangat terjangkau. “Mendapatkan narkoba di sini sama mudahnya dengan membeli permen di warung. Harganya pun cukup terjangkau. Bayangkan saja, sabu-sabu tersedia dalam paket Rp50.000,” kata Boru Siregar. Untuk itu dia berharap agar Kapoldasu Irjen Pol Wisjnu Amat Sastro memberikan perhatian khusus kepada Baganasahan, karena saat ini kawasan itu dinilai sangat jauh dari penegakan hukum. (a32)

Penjual Jamu Larikan Mobil Rental

Waspada/Agusdiansyah Hasibuan

WARGA memperhatikan truk CPO yang terguling di Jalinsum, Kec. Talawi, Kab. Batubara.

KISARAN (Waspada): Mantan penjual jamu melarikan mobil rental, namun aksi itu dapat diamankan dan kini masih dalam pemeriksaan Polres Asahan, Selasa (10/4) malam. Informasi dihimpun Waspada, tersangka MD,32 warga Jln Cempaka, Kota Binjai, menyewa mobil jenis Daihatsu Xenia BK 1501 RI menuju Kisaran dengan bayaran Rp 300 ribu guna menjemput keluarga. Namun pemilik mobil memberikan mengirimkan sopirnya Hendriko Pane. Mereka berangkat sejak, Rabu (3/4) sekitar pukul 23:00, dan pagi harinya sampai di Kisaran. Kamis (4/4) saat sarapan, tersangka melarikan mobil tersebut, dan meninggalkan sopirnya, sehingga berujung dengan laporan ke pihak yang berwajib. “Sebenarnyasayatidakadaniatuntukmencuri,

namun untuk bergaya mencari teman sewaktu sama-sama menjual jamu,” ujar tersangka, sambil mengatakan bahwa dirinya mantan penjual jamu di Kisaran, dan berasal dari Solo, namun menetap di Binjai. Kapolres Asahan AKBP Yustan Alpiani, dikonfirmasi Waspada, melalui Kasat Reskrim AKP Fahrizal, membenarkan penangkapan itu. Menurutnya tersangka diamankan karena berdasarkan laporan korban yang mobilnya di curi.Sehinggadilakukanpenyidikandanmengukui jejak tersangka dan akhirnya dapat diamankan di kedai kopi wilayah Tanjungbalai. “Hinggasaatinikitamasihmelakukanpemeriksaan,sehinggamotifyangdilakukantersangkaterkuak. Keberhasilan menangkap tersangka berdasarkan informasi masyarakat,” ujar Fahrizal. (a15)

Sumatera Utara

WASPADA Jumat 13 April 2012


Meski Sudah Dipecat Mendagri Bupati Palas Lantik Pejabat SIBUHUAN (Waspada): Meski sudah dipecat Mendagri Gamawan Fauzi, Bupati Padanglawas (Palas) Basyrah Lubis tetap melakukan pelantikan terhadap sejumlah pejabat eselon III dan IV serta Kepala Sekolah (Kepsek) di jajaran Pemkab Palas. Pelantikan dilaksanakan dalam dua gelombang di aula Kantor Bupati setempat, Rabu (11/4), dihadiri Sekda Gusnar Hasibuan, Kapolsek Barumun AKP H. Bosar Ependi Harahap, Kacabjari Sibuhuan H. Ramlan

Harahap, SH dan sejumlah Kadis serta Kaban. Pejabat yang dilantik 197 orang, terdiri dari 6 camat, 4 sekretaris dinas, 3 Sekcam, 6 Kabid, 2 Kabag dan seorang inspektur wilayah serta 37 kepala

Kegiatan PT. Palmaris Stanvas PANYABUNGAN (Waspada): Kegiatan PT. Palmaris Raya, sebuah perusahaan perkebunan kelapa sawit di Kec. Batahan, distanvaskan (dihentikan sementara) oleh Bupati Mandailing Natal (Madina). Lahan yang distanvaskan meliputi lahan perkebunan bermasalah di lokasi Batahan 1, Batahan II, dan Batahan. Penstanvasan lahan tersebut berdasarkan surat bupati nomor: 180/855/HKOR/2012, tanggal 10 April 2012, sebagai tindaklanjut dari surat pimpinan DPRD Madina nomor: 170/087/2012, tanggal 10 April 2012. perihal rekomendasi hasil audensi masyarakat Batahan dengan pihak legislatif dan eksekutif . Demikian disampaikan Bupati Madina melalui Kabag Humas dan Protokol, Haposan, S.Sos kepada Waspada, Rabu (11/4) di ruang kerjanya. Dijelaskan, saat ini Pemkab Madina dalam tahap pengumpulan data-data terkait lahan yang bermasalah antara warga Batahan dengan PT. Palmaris. Ketua Komisi B DPRD Madina, Sofyan Edi Saputra mengungkapkan, sikap tegas Pemkab Madina akan sangat membantu kinerja panitia kerja (Panja) DPRD Madina di lapangan untuk menyelesaikan permasalahan lahan di wilayah Pantai Barat. (c14)

HMI Cabang P. Sidimpuan Gelar Basic Training PADANGSIDIMPUAN (Waspada): Pengurus Himpunan Mahasiswa Islam (HMI) cabang Padangsidimpuan menggelar latihan kader I (basic training) di aula Gedung Bina Insani, Jalan Imam Bonjol Kota P.Sidimpuan, baru-baru ini. Acara pelatihan yang dipanitiai Komisariat Sekolah Tinggi Agama Islam Negeri (STAIN) P.Sidimpuan itu dibuka Pejabat (Pj) Ketua Umum HMI Cabang P.Sidimpuan Nasrul Iskandar P. Siregar. Dalam sambutannya Nasrul Iskandar mengatakan, HMI merupakan organisasi kader dan organisasi perjuangan sebagaimana yang tertuang dalam AD/ART HMI. “Pengkaderan merupakan jantungnya organisasi yang harus terusmenerusdilaksanakansecaraberkesinambunganagarregenerasi di tubuh HMI tidak pernah putus,” ujar Nasrul yang menjabat sebagai Pj Ketum HMI sesuai SK PB HMI No: 219/KPTS/A/04/1433 H. Ketua Bidang Pembinaan anggota HMI Cabang P.Sidimpuan Marakali Harahap mengatakan, LK I ini diikuti 40 peserta yang sebelumnya dinyatakan lulus dalam screening test. “Sebenarnya screening test itu diikuti 46 orang namun yang dinyatakan lulus dan berhak mengikuti tahap LK I hanya 40 orang,” terangnya. (a26)

Maling Bongkar Mobil Bendahara Dishub Batubara LIMAPULUH(Waspada): Mobil bendahara Dishub Pemkab Batubara, Dedy Muchlis,38, yang diparkir di samping kantor Bupati Batubara, Rabu (11/4) sekira pukul 11.00 dibongkar maling, dan uang yang baru diambil dari bank nyaris raib. KapolsekLimapuluhAKP.BambangRubianto,SHkepadaWaspada mengatakan, peristiwa itu bermula saat pelapor berada di kantor Bank Sumut untuk mengambil uang rapel gaji CPNS menjadi PNS Dinas Perhubungan Pemkab Batubara sebanyak Rp15.000.000. Setelah pelapor menerima uang dan memasukkan ke dalam tas ransel warna hitam, usai dari bank dengan mengendarai mobil Suzuki Katana warna putih BK 1167 BE, kemudia menuju kantor Bupati Batubara dan mobil diparkir keadaan terkunci. Ditempat itu pintu mobil dirusak dan pelaku masuk ke dalam mobil korban. Tak lama Dedy datang, lalu pelaku langsung kabur tanpa sempat membawa hasil dengan mobil Terios warna hitam BK1371 NG. “Kemudian saya dan anggota Polsek Limapuluh melakukan pengejaran, namun tidak berhasil ditemukan. Tetapi kasus ini masih tetap kami selidiki,” kata Bambang, sembari menyebut, atas kejadian tersebut korban tidak mengalami kerugian. (c05)

Jembatan PNPM Di P.Rambe Sudah Retak PEMATANGRAMBE, Batubara (Waspada): Bangunan jembatan ukuran 12 x 3 meter di Dusun II Desa Pematang Rambe Kec.Tanjungtiram Batubara yang baru selesai dikerjakan sudah retak-retak. WargaPematangRambe,Rabu(11/4)mengatakan,pembangunan jembatan bersumber dari dana PNPM-2011 Rp173 juta, yang siap dikerjakan 26 Maret 2012 ternyata baru 10 hari, dinding kiri kanan opritnya retak-retak. Kalau sudah retak dikhawatirkan bangunan oprit akan amblas bila dilintasi prah roda empat. “Kami minta pihak TPK,konsultan,PJOKbertanggungjawabuntukmemperbaikisebelum rusak tambah parah,” usul warga. Selain jembatan warga juga menyesalkan bangunan sumur bor dana APBD Batubara 2011 Rp50 juta sejak siap tidak berfungsi airnya tak keluar. Warga mengharapkan sumur bor, beserta jembatan di Dusun II yang rusak agar mendapat perbaikan. (a12)

Ditodong Senpi, Sepedamotor Lenyap STABAT (Waspada): Dua pria warga Desa Air Hitam Kec. Gebang Kab. Langkat menjadi korban perampokan di kawasan Tangkahan Pinang Gebang setelah ditodong senjata api, Senin (9/4) dinihari. Keterangan dihimpun, korban Jansen Hutahaen, 17, bersama rekannya Roni mengendarai sepedamotor Suzuki Satria FU BK 4945 PAI menuju kediamannya usai jalan-jalan dari arahTanjungpura. Dalam perjalanan dua pria berboncengan mengendarai sepedamotor Satria FU, minta korban berhenti karena mengaku polisi. “Kami panik dan terjatuh,” kata Roni, pengendara sepedamotor saat ditemui di RSU Tanjungpura, Selasa (10/4). Kemudian salah seorang pelaku mengeluarkan senjata api jenis pistol dan minta jangan bergerak. Saat itu seorang pelaku lain langsung merampas sepedamotor dan kabur bersamaan ke arah P. Brandan. “Kami tidak tahu apakah itu pistol mainan atau asli,” tambahnya. Kejadian telah dilaporkan ke Mapolsek Gebang.(a03)

seksi. Kemudian, 123 Kepsek dan 15 pengawas sekolah. Sejumlah Kepsek yang dilantik di antaranya merupakan pelantikan pengukuhan karena SK pengangkatannya sebagai kepala sekolah masih dari Kab. Tapanuli Selatan atau sebelum Palas dimekarkan. Dalam sambutannya, Bupati mengatakan pergantian pejabat merupakan hal yang lumrah dan salah satu upaya penyegaran dalam organisasi. Pelantikan tersebut berdasarkan keputusan

Baperjakan Pemkab Palas. Kemudian, bupati menegaskan, pelantikan tersebut sah dan dapat dipertanggungjawabkan secara hukum, karena dirinya hinggasaatinimasihtetapsebagai bupatiyangsahdalammemimpin Kab. Padanglawas. “Meski berbagai pemberitaan mengatakan saya sudah diberhentikan sebagai bupati, namun hingga saatinibelumadapemberitahuan yang saya terima, dengan demikian saya masih tetap sebagai bupati Padanglawas,” tegas Basyrah.

Kepada pejabat yang dilantik dia mengatakan agar melaksanakan tugas masing-masing sesuai tupoksi yang diemban. Sebagai PNS yang mempunyai tugas utama melayani masyarakat dilarang untuk ikut berpolitik. Kepadawartawanusaipelantikan, Basyrah kembali menegaskanagarwargaPadanglawastetap tenang dan jangan terprovokasi olehisuyangberkembang,karena pemekaran Kab. Padanglawas adalah murni hasil perjuangan bersama. (a34/a27)

Antisipasi Kecurangan UN Madina 14.565 Peserta Ikuti UN SMA Dan SMP PANYABUNGAN(Waspada): Berbagai upaya dilakukan untuk mengamankan jalannya Ujian NasionaldiMandailingNatal(Madina), termasuk upaya mengantisipasi kecurangan yang dilakukan oknum tertentu. “Berbagai persiapan sudah dilaksanakan, termasuk berbagai upayamengantisipasikecurangan yang akan dilakukan oknumoknumtidakbertanggungjawab,” kata Kepala Dinas Pendidikan MadinamelaluiSekretarisKhairul Bahri Batubara di Panyabungan, Kamis (12/4). Dijelaskannya, pelaksanaan Ujian Nasional (UN) tingkat SMA danSMPsederajatdiKab.Madina akan diikuti 14.565 peserta dari sekolah negeri dan swasta yang dilakukan secara serentak 16-26 April 2012. Khairul Bahri merinci, pesertaUNdiMadinatersebutmasingmasing terdiri dari siswa SMA dan MA negeri/swasta 4.399 orang

dilaksanakan di 49 sekolah dan SMK negeri/swasta 1.827 orang akan dilaksanakan di 14 sekolah, sementara jumlah siswa tingkat SMPdanMTsnegeri/swasta8.339 orang berasal dari 113 sekolah. “Jadwal ujian utama UN tingkat SMA/MA dilaksanakan 16-19 April 2012 dan susulan 2326 April 2012 dan SMK ujian utama 16-18 April 2012 dan susulan 23-25 April 2012. Sementara ujian utamatingkatSMP/MTspada2326 April 2012 dan susulan 30 April sampai 4 Mei 2012, sedangkan ujian utama SD/MI yaitu 7-9 Mei 2012dansusulan14-16Mei2012,” ujarnya. Ia berharap agar para siswa peserta UN harus tetap semangat dan meningkatkan kepercayaan diri akan kemampuan, sehingga dapatdenganbaikmenyelesaikan soal-soal yang akan diujikan. Peserta juga harus teliti dalam menjawab setiap soal, artinya pikiran harus konsentrasi karena

itu kunci untuk mempermudah menjawab setiap soal ujian. “Kita memberikan semangat dan motivasi agar para siswa peserta UN tidak takut dalam mengerjakan soal. Jika sebelumnya belajar tekun, maka dipastikan seluruh soal akan dapat dikerjakan dengan baik dan benar,” jelasnya. Ketika disinggung soal target yang ditetapkan pihaknya dalam UN tahun ini, Sekretaris Dinas Pendidikan Madina itu mengatakan, pihaknya tidak bisa menargetkan kelulusan siswa tahunini,namundenganharapan target kelulusan harus lebih baik dari tahun lalu. “Kami tidak bisa targetkan tingkatkelulusananak-anakpada tahun ini. Tetapi kita harapkan meningkatkan dari tahun lalu. Setidaknya prestasi kelulusan secaranasionaltelahdicapaitahun lalu dan diharapkan ini dapat dipertahankan,”ungkapnya. (a28)

Mahasiswa Desak Kejatisu Tangkap Ketua YMBR MEDAN (Waspada) : Aliansi Oposisi Mahasiswa Tapanuli Tengah mendesak Kejaksaan Tinggi Sumatera Utara (Kejatisu) segeramenangkapKetuaYayasan Museum Barus Raya (YMBR), H.ST, SE. Hal ini terkait dengan penyalahgunaan anggaran terhadap pembangunan museum Barus Raya di Kec. Barus, Tapanuli Tengah sebesar Rp1,15 miliar. “Fakta yang kita terima dan akan diserahkan ke Kejatisu tentangpenerimaandanamelalui rekening Rp750 juta dalam dua tahap.Yang pertama pada 10 Juli 2007 senilai Rp500 juta dan

kemudianRp250jutasetelahnya,” ujar Koordinator aksi Khairunnas Panggabean didampingi Melfan di Kejatisu, Kamis (12/4). Kemudian, lanjutnya, pada September 2007 YMBR juga menerima hibah dari Pemkab Tapteng Rp75 juta, lalu ditambah lagi hibah dari Pemprovsu Rp75 jutapada12Novemper2007.“Dan danahibahdariAPBDSumut2010, YMBRjugamenerimaRp250juta. DengandemikiantotalRp1,15miliar diterima yayasan,” lanjutnya. Padahal, lanjutnya, pembangunan museum tersebut bertujuan menjaga warisan situs budayaTapanuliTengah.Dimana

dengan terjaganya aset tersebut tentunya memiliki peran besar untuk membangun dan mengangkat harkat martabat masyarakat Tapanuli Tengah. “Aksi kali ini yang keempat dengan memberikan sejumlah buktikepadaKejatisubahwaKetua YayasanMuseumBarusRayatelah menerima dana tersebut melalui rekeningnya,” ujarnya seraya berharap hal ini ditanggapi secara serius oleh Kejatisu. SementaraKoordinatorSatgas Kejatisu Edward yang menerima paramahasiswatergabungdalam koalisiTapanuliTengahsiapmenerima aspirasi mahasiswa. (m38)

OK Arya Jadikan Desa Strategi Pembangunan LIMAPULUH (Waspada): Pemkab Batubara jadikan desa sebagai strategi pembangunan, sejalan memberdayakan masyarakat sebagaimana peraturan berlaku. Bupati H. OK Arya Zulkarnain,SH,MMmengatakan hal itu ketika menerima audiensi siswa SMU Negeri I Kec. Air Putih. Audiensi berlangsung seusai diskusidenganDirjenPengembangan Fasilitas Industri Wilayah I Kementerian Perindustrian RI, IgustiPutuhSuryaIrawandiruang pertemuan Ketua DPRD Kab Batubara, Selasa (10/4). Dirinya mengaku adanya

kendala dihadapi dalam perjalanansebagaibupati,namunsemangat tetap bergelora di tangan masyarakat atau istilah ondak copat membangun. ‘’Ini memicu semangat saya membangun Batubara bersama,’’ ujarnya didampingi Ketua DPRD Batubara Selamat Arifin, SE, MSi dan anggota, Suharto, BA. Setiap rencana pembangunandiusulkandesa,ditindaklanjuti dengan memasukan kedalam Musrenbang guna dianggarkan dan dibahas bersama dengan legislatif.Begitujugadisisiekonomi, sosial dan pendidikan setidaknya

nanti dapat membangun politeknik setingkat universitas. Sampai upayapengembanganpelabuhan danindustridanmenjadikanKualaTanjung pelabuhan internasional membuka peluang kemajuan ekonomi . Salahseorangsiswamengaku optimis visi dan misi Batubara sejahteradanberjayadapatterwujud dengan apa yang dirasakan dan programpembangunankedepan. ‘’Ini sesuai paparan bupati yang berkesempatan menerima kunjungan audiensi kami,’’ tukas Desi Pratiwi Mukhti didampingi rekan-rekannya. (a13)

HNSI Batubara Tolak Permen KP No.2/2011 BATUBARA ( Waspada): Rumusan sosialisasi Kepmen KP.No.06/2010 dan Kepmen KP.No.02/2011 hasil diskusi serta arahan Ka. diskanla Provsu H. Zulkarnain, SH, M.Si bersama Lantamal I-Belawan Saiful, Ditpolair Belawan-Ir. Revolkhair, SH, Diskanla Sergai Ir. M. Ramlan Matondang, M.Sc, Diskanla Tanjungbalai Ir. Nefri Siregar, Diskanla Deliserdang Ir. Zulkifli Nasution, BPPP Belawan Mathius Tiku, ANPPATI Darwin, SE, AP2GB RB. Sihombing di Medan5April2012tidakberpihak kepada nelayan kecil.

“Hasil rumusan tanggal 5 April 2012 tidak melibatkan organisasi nelayan melahirkan rumusan tidak berpihak kepada nelayan kecil. Seakan berpihak kepada pengusaha kuat,” tegas Ketua HNSI Batubara Eddy Alwi di Tanjungtiram, Kamis (12/4). Menurut Eddy Alwi didampingiSekretarisHNSIBatubaraM. Rajab, dalam rumusan perta-ma tertulisperlunyasosialisasilangsung kepadanelayantradisionaltentang Permen KP No.2/2011 di mana telah terjadi pengurangan ukuran jalur 1 dari 6 mil menjadi 4 mil. Sudah tentu Permen itu

merugikan nelayan kecil yang selama ini jarak tangkap 6 mil seperti pukat Apung nyosor ke lahan nelayan kecil sekitar 2-3 mil, apalagi diaminkan dikurangi jadi 4 mil entah apa yang bakal terjadi nanti. “Kami HNSI Batubara menolak Kepmen KP.No.2/2011 jelas merugikan/tidak berpihak kepada nelayan kecil dan Men KP perlu mengkaji ulang keputusan tersebut,” tegas Eddy. “Banyak hal perlu didiskusikan dan kami siap melakukan dialog kapan saja untuk melindungi hak-hak nelayan kecil,” ujarnya. (a12)

Pemakai Sabu Diciduk TANJUNGBALAI (Waspada): Seorang tersangka juru tulis judi jenis KIM merangkap pemakai sabu, diciduk polisi di Kec.Teluknibung, Kota Tanjungbalai Selasa (10/4) malam. Tersangka MAPS alias Adi, warga Jalan Julius Usman Ujung Link I, Kel Pantai Burung, Kec. Tanjungbalai Selatan, ditangkap bersama barang bukti ponsel, uang tunai dan sabu seberat 0,33 gram. Dari informasi dihimpun Waspada, penangkapan terjadi ketika polisi mendapat informasi warga tentang aktivitas tersangka sebagai juru tulis judi KIM. Berbekal informasi berharga itu, polisi lantas menyelidiki dan mengintai gerak-gerik tersangka. Tersangka ditangkap beserta barang bukti ponsel dan uang tunai Rp 65 ribu. Kemudian saat digeledah ditemukan narkoba jenis sabu dari saku celana seberat 0,33 gram dalam 1 bungkus plastik transparan. Kapolres Tanjungbalai AKBP EP Sirait melalui Kasubbag Humas AKPYani Sinulingga membenarkan penangkapan itu. Kata Sinulingga, pihaknya masih menyelidiki dan berupaya mengembangkan kasus tersebut. (a14)

Waspada/Helmy Has

NELAYAN kecil dengan kesederhanaannya tergusur alat tangkap modal besar butuh perlindungan hukum.

Waspada/Ahmad Cerem Meha

GROUP Kombur Malotup di studio Radio Kiis 106.6 FM Padangsidimpuan ketika menyampaikan hiburan kepada pendengar setia melalui siaran udara, Rabu (11/4) malam.

Pelestarian Bahasa Angkola Melalui Kombur Malotup P. SIDIMPUAN (Waspada):Nilai-nilai luhur yang diwariskan nenek moyang kita khususnya di Padangsidimpuan sebagai wilayah ulayat etnis Angkola, dilestarikan antara lain melalui acara kombur malotup bahasa Angkola. Hal itu diutarakan Grup Kombur Malotup Radio Kasyfi Inti Indah Suara (Kiis) FM, yang dinakhodai H Darwis Sitompul (Bung Bob), anggota pemain Bung Borkat Siregar, Bung Darwan Situmorang, Muhammad Asroy (Ustad) dan M Abduh Siregar usai mengudara di studio radio itu, Gang Harahap, Pangkaldolok, Kota Padangsidimpuan Rabu (11/4), pukul 22:00. ‘’Melalui kombur malotup suatu acara humor berbahasa Angkola bertujuan untuk mempertahankannilai-nilaibahasadaerahyangmulaipudar kita lihat saat ini akibat globalisasi. Selain mempertahankan bahasa Angkola, nilai-nilai budaya dalihan na tolu (suatu nilai dasar peradatandiTapanuli)tetapkitasampaikankepada pendengar,’’ ujar mereka. Dalam program itu, selain membudayakan bahasa Angkola, biasanya materi disampaikan sudah ditentukan oleh tim kombur yang disampikan dari studio ke pendengar melalui

jangkauan siaran hingga ke wilayah Riau, Sumbar dan kawasan Tapanuli Bagian Selatan, Tapanuli TengahdanNias,jugadapatdiaksesmelaluistreaming radio di internet dengan chanel radio kiis 106.6 fm Padangsidimpuan. Materi disajikan di antaranya masalah dan isu yang sedang berkembang di tengah-tengah masyarakat Tapanuli, termasuk masalah isu ekonomi kerakyatan yang semakin menjamur, sehingga apabila ada pesta rakyat untuk pemilihan kepala daerah, warga miskin diduga keras menjadi sasaran empuk para tim sukses (TS) calon kepala daerahituuntukmembagi-bagikanuang,sembako dan lainnya. Selain masalah sosial kerakyatan lainnya di acara itu, dengan menyuarakan parodi seorang calon kepala daerah yang akan maju memimpin di suatu daerah tertentu, dengan mencontohkan salah satu calon kepala daerah ketika kampanye menjanjikan pembangunan irigasi di salah satu desa, demikian perbaikan jalan akan disegerakan. Namun setelah terpilih, si calon kepala daerah lupa akanjanjinyakepadarakyat,sehinggarakyatkecewa, rakyat ngedumel, ‘’Bahatan kecet do pamarenta i ‘’ (hanya janji palsu pemerintah itu). (c13)

Tanjungbalai Rawan Gizi Buruk Satu Balita Dirawat Intensif TANJUNGBALAI(Waspada): KotaTanjungba- sumsi makanan. Oleh sebab itu, lanjut Rusman, lai rawan terjadi gizi buruk. Pasalnya, selama 2012 akhirnya Maysaroh dibawa ke RSUDTanjungbalai ini, sedikitnya tercatat lima pasien gizi buruk yang dengan status pasien umum. “Baru hari ini kami ditangani intensif di RSUD Kota Tanjungbalai, masukkan kartu Jamkesmas,” kata Rusman yang dan satu di antaranya masih menjalani perawatan sehari-harinya bekerja serabutan. di ruangan anak Rabu (11/4). Hasil diagnosa dokter, lanjut Rusman, ternyata Para penderita gizi buruk yang pernah dirawat bungsu dari lima bersaudara itu positif menderita intensif itu, Muhammad Hafiz, 1,2 tahun, warga gizi buruk atau mall nutrisi. “Memang kondisinya Kel. Pematangpasir, Kec. Teluknibung, Rahmi, sudah mulai membaik sejak dirawat di sini,” kata 1,4 tahun, Safira Putri, 56 hari, warga Link.II, Kel. Rusman. Seiraja, Kec. Seitualang Raso, Reni Lumban Batu, Salah satunya, sebut Rusman, saat dibawa 1,4tahun,wargaJalanTentena,Kel.KeramatKubah, ke RSUD, berat badan Maysaroh hanya 6,4 kiloKec. Seitualang Raso. gram, dan kini sudah naik menjadi 7,2 kilogram. Sementara, penderita gizi buruk yang Direktur RSUDTanjungbalai dr. Hj. Diah Retno menjalani perawatan intensif, Maysaroh, 1,8 melalui spesialis anak dr. Nangsang, SpA, memtahun, warga Jalan Makros, Kel. Kapias Pulau benarkanMaysarohterjangkitgiziburuk.“Kondisinya Buaya, Kec. Teluknibung. sudahmulaimembaik,bahkanberatbadannyajuga Putri dari pasangan Rusman Munazir dan naik.Memangidealnyauntukanakseusianya,berat Rinawati itu, berat badannya hanya 7,2 kilogram, badan harus 11 kilogram,” kata Nangsang. (a14) sedangkan untuk anak seusianya, berat badan ideal harus 11 kilogram. Selain berat tubuh yang tidak seperti anak seusianya, Maysaroh dinyatakan mengidap gizi buruk dengan ciri-ciri perut membesar, fisik lemas, kulit terkelupas, rambut pirang, wajah seperti orang tua dan kedua kelopak mata mencekung. “Kalau tidak salah, enam bulan lalu anakku kena diare, karena dianggap biasa makanya cuma dibawa ke Puskesmasdandukunkampong.Tapi penyakitnya tak kunjung sembuh,malahsemakinparah,” kata Rusman Munazir di ruangananakRSUDTanjungbalai. Waspada/Rahmad F Siregar Ironisnya, menurut RusPASIEN gizi buruk, Maysaroh, menjalani perawatan intensif man, kulit Maysaroh mulai terkelupas dan sulit mengon- di RSUD Tanjungbalai.

Jalan Muarasipongi Pakantan Kupak-kapik PANYABUNGAN (Waspada): Selain menjadi langganan banjir pada saat musim penghujan, ruas jalan kabupaten yang menghubungkan Kec. Muarasipongi – Kec. Pakantan Kab. Mandailing Natal (Madina) sekira 12 km, kondisinya sudah sangat memprihatinkan karenanya perlu perhatian pemerintah daerah. Hasan Lubis, salah seorang warga Pakantan menjelaskan, badan jalan yang kupak-kapik mulai dari Simpang Koto Beringin dan itu sudah berlangsung hampir dua tahun, namun sampai sekarang a belum mendapatkan perhatian dari pemerintah untuk memperbaikinya. “Kerusakan jalan ini sudah hampir dua tahun. Memang badan jalan pernah diaspal sekitar tiga tahun lalu, namun sudah kembali rusak, ditambah lagi saat perluasan badan jalan sekitar dua tahun lalu, membuat parit tertimbun tanah longsor ,” katanya, Kamis (12/4). Menurutnya, rusaknya jalan menuju kawasan penghasil kopi itu, sangat mempengaruhi perkembangan perekonomian masyarakat. Artinya, harga kebutuhan pokok terus naik, sementara warga yang ingin membawa hasil buminya ke Pasar Muarasipongi terganggu karena harus mengeluarkan ongkos besar. “Bukan itu saja, bagi anak sekolah dan warga yang harus setiap hari keluar daerah Pakantan, sangat terganggu karena kondisi jalan yang banyak lubang ,” terangnya. Hal senada disampaikan Iken. Dijelaskan,

kondisi jalan Muarasipongi-Pakantan rusak parah. Selain sering tertimbun tanah longsor, parit jalan tidak terurus sehingga jika musim penghujan tiba air mengalir ke badan jalan mengakibatkan lubang besar. “ Jika musim penghujan kondisi jalan sangat licin, akibatnya warga tidak berani melewatinya dan kalau badan jalan tertimbun longsor, warga Pakantan sering terisolir terkadang 2 hingga 3 hari, akibatnya aktivitas masyarakat terganggu dan terkadang anak sekolah harus libur karena tidak bisa di lokasi yang longsor ,” ungkapnya. Menurut pengamatan, kerusakan jalan itu sangat parah karena sepanjang jalan nyaris mengalami kehancuran, aspalnya terkelupas yang tinggal hanya kerikil-kerikil dan batu-batu kecil di tengah badan jalan, akibatnya cukup menyulitkan bagi pengguna jalan. Selain jalan yang hancur, badan jalan menghubungkan dua kecamatan itu sering tertimpa tanah longsor di musim penghujan. Ini terjadi akibat tanah terdapat di atas badan jalan tidak ada lagi penahannya seperti tumbuhan. Kalau ini terjadi, bisa dua hingga tiga hari material tumpukan tanah berhasil dibersihkan dari badan jalan. Jika musim penghujan, jalan itu sama sekali tidak bisa dilewati kendaraan, sehingga membuat warga terpaksa jalan kaki atau naik ojek yang ongkosnya mencapai Rp20.000 hingga Rp25.000 per orang. (a28)


Sumatera Utara

WASPADA Jumat 13 April 2012

Pasar Rakyat Rp17 M Di Pangururan Mendag: Ini Pasar Keenam Dari 10 Pasar Percontohan SAMOSIR (Waspada) : Menteri Perdagangan (Mendag) RI Gita Irawan Wirjawan meresmikan pembangunan Pasar Rakyat Percontohan di Pangururan yang bersumber dari APBN dan APBN-P tahun 2011 melalui Tugas Perbantuan Kemendag RI senilai Rp17 miliar lebih, Kamis (12/4), di Pangururan.

Usut Pembiayaan PJU Pakpak Bharat PAKPAK BHARAT (Waspada): Dugaan adanya pembiayaan Penerangan Jalan Umum (PJU) yang tumpang tindih di Pakpak Bharat diminta diselidiki pihak penegak hukum. Hal itu disampaikan Nuel Boangmanalu Pimpinan LSM PIPARA (Pemantau Independen Pengelolaan Aset Negara) kepada wartawan, Kamis (12/4). “Kita minta penegak hukum segera melakukan penyeledikan lebih jauh terkait dugaan tumpang tindih pembiayaan PJU Pakpak Bharat” ungkapnya. Bukan hanya itu, sesuai dengan pantauan pihaknya hingga saat ini terdapat sejumlah PJU sudah mengalami kerusakan sehingga tingkat penggunaan arus listrik juga mengalami penurunan per KWH. “Sebagian besar lampu jalan umum sudah mengalami kerusakan sejak lama. Ini kan seharusnya tidak lagi harus dibiayai bebannya,” tegas Nuel. Sekaitan itu dikatakan Nuel secara lebih proaktif apa yang sudah disampaikan media atas pengakuan pimpinan PLN Pakpak Bharat terkait adanya dua sumber pembiayaan PJU di Pakpak Bharat dapat ditindaklanjuti oleh pihak penegak hukum. Di lain pihak, pelayanan PLN Salak dinilai semakin memburuk. Seperti diungkapkan salah seorang warga Kota Salak, ibukota Pakpak Bharat, Seddi Boangmanalu, seringnya mati lampu tanpa pemberitahuan telah mengakibatkan kerugian besar bagi masyarakat. Selain telah merusak barang-barang elektronik, seringnya mati lampu juga sangat mengganggu kenyamanan masyarakat pengguna listrik PLN. Warga berharap pihak PLN Cabang dapat segera mengevaluasi kinerja PLN Salak khususnya dalam memberikan pelayanan bagi pelanggan. (csb)

Mendag mengatakan, peresmian pasar rakyat percontohan Pangururaninimerupakanperesmian ke enam dari 10 pasar percontohan seluruh Indonesia. Dia mengaku sangat mempertimbangkanpembangunanpasarhasil bumi untuk Kab. Samosir. Acara peresmian ditandai dengan penandatangan prasasti oleh Mendag Gira Irawan Wirjawan disaksikan unsur Muspida

Kab Samosir, DPRD Samosir, Bupati Humbahas Maddin Sihombing,Wakil Bupati Pakpak Barat dan mantan Bupati Dairi Master Tumanggor. Terlihat juga Kadis Perindag Drs Jasmin Limbong, Sekretaris Koperindag Samosir Ir. Walson Sagala, Kabid Perdagangan Hut IsasarSimbolon,STdantokohadat, tokoh masyarakat dan mewakili pedagang.

Dilakukan penyerahan seperangkat pakaian adat yang diberikantokohadatSamosirdan diiringi dengan gondang dan tortor Batak dan diakhiri acara penanaman pohom palem ekor tupai di arealTaman Pasar Rakyat Percontohan Pangururan. Usai acara peresmian, Mendag RI Gita IrawanWirjawan dijamu di rumah Dinas Bupati Samosir, di Pangururan. (c11)

Banjir Di Samosir, Bukit Longsor SAMOSIR (Waspada): Banjir yang terjadi di Desa Janji Maria Kec Sitio-tio Kab. Samosir diakibatkan oleh curah hujan yang cukuptinggisehinggamenimbulkan longsoran tanah perbukitan setinggi 250 meter dari pemukiman penduduk. “Akibat tanah longsor ini juga menimbulkan aliran sungai kecil baru di lokasi bencana,” ujar Kapala Badan Penanggulangan Bencana Daerah Kab. Samosir

Drs. Purnamawan Malau, MM kepada Waspada, Rabu (11/4) di kantornya. Dikatakannya, peristiwa terjadi, Senin (9/4) sekira pukul 08:00, kemudian pihaknya bersama masyarakat melakukan peninjauan dampak dari longsor tersebutdanmenyarankanwarga sekitar waspada dan bila perlu mengungsi ke tempat aman. Kerugian diperkirakan mencapai Rp200 juta akibat

rusaknya tali air dan perladangan kopi seluas hampir 1 ha milik marga Manik dan marga Tamba. Wargayangtinggaldisekitarlokasi 70 KK. Dampak lain yang terjadi, tambak atau kolam ikan mengalamikekeringanakibatirigasiyang hancur. Rencananya, PemkabSamosirakanmemberikanbantuan berupa beras sipir ni tondi dan membuat saluran darurat dari pipa paralon 25 meter. (c11)

Ormas Dan LSM Harus Daftar Ulang PEMATANGSIANTAR (Waspada): Organisasi kemasyarakatan (Ormas) dan Lembaga Swadaya Masyarakat (LSM) harus mendaftar ulang minimal satu kali dalam satu tahun. “Bila tidak mendaftar ulang, berarti Ormas dan LSM itu tidak terdaftar lagi di Kesbangpol dan Linmas,” tegas Kepala Badan Kesbangpol dan Linmas Pemko Pematangsiantar Drs. Gunawan Purba di ruang kerjanya, Rabu (11/4). Purba menyebutkan Kesbangpol dan Linmas Pematangsiantar memberi kesempatan kepada Ormas dan LSM yang berada di wilayah kerjanya agar melakukan pendaftaran ulang Ormas dan LSM masingmasing mulai 1 Mei-29 Juni 2012. Menurut Purba, pendaftaran ulang itu sekaligus validasi data base Ormas dan LSM secara nasional sesuai dengan maksud UU RI nomor 8 tahun 1985 dan PP nomor 18 tahun 1986 serta SE Mendagri nomor 220/1980.DIII tanggal 27 November 2007. Mengenai validasi data itu, Purba menyebutkan pihaknya saat ini sedang mengumumkannya kepada seluruh Ormas dan LSM ruang lingkup Pematangsiantar serta diharapkan Ormas dan LSM itu segera melaporkan ulang keberadaan Ormas dan LSM masingmasing ke Kesbangpol dan Linmas. (a30)

Sepedamotor Raib Dari Areal Parkir Ramayana PEMATANGSIANTAR (Waspada): Sepedamotor korban Hendra Wijaya,29,wiraswasta,wargaJalanTanahJawa,GangApollo,Kelurahan Melayu, Kec. Siantar Utara, Kota Pematangsiantar hilang saat diparkir di areal parkir pusat perbelanjaan Ramayana Pematangsiantar. Sepedamotor Yamaha Jupiter MX BK 4708 ON milik korban diduga hilang dari areal parkir lantai dua perbelanjaan Ramayana di Jalan Sutomo, Kelurahan Pahlawan, Kec. Siantar Timur, Pematangsiantar, Senin (9/4) pukul 21:00, dengan mengenderai sepedamotornya serta memarkirkannya di areal parkir di lantai dua. Sesudah mengunci stang serta membayar uang parkir dan menerima tanda pembayaran uang parkir, korban masuk ke dalam perbelanjaan Ramayana. Saat korban hendak pulang dan menuju ke lokasi parkir, korban terkejut ketika tidak melihat lagi sepedamotornya di lokasi parkir. Ketika diminta pertanggungjawaban kepada petugas parker, mereka mengaku hanya bertugas mengutip uang parkir dan tidak bertanggungjawab atas kehilangan sepedamotor. Kapolres Pematangsiantar AKBP AlberdTB Sianipar, S.Ik, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin, SH, Selasa (10/4) menyebutkan pengaduan korban sudah diterima dan masih dalam penyelidikan. (a30)

Waspada/Saut Boangmanalu

KETUA Komisi D DPRD Sumut H. Yan Syarin, SE dan Sekretaris Drs. Biller Pasaribu, Maratua Halim Siregar dan Ajib Shah (tengah berambut putih) bersama rombongan dan jajaran Pemkab Pakpak Bharat foto bersama di sela-sela kunjungan kerja di Jalan Pakpak Bharat menuju Humbahas.

Komisi D DPRD Sumut Tinjau Jalan Pakpak Bharat-Humbahas PAKPAK BHARAT (Waspada): Komisi D DPRD Sumatera Utara bersama Dinas Bina Marga Provinsi dan Balai Besar Pelaksanaan Jalan Nasional Wilayah I Medan meninjau jalan yang menghubungkan Kabupaten PakpakBharatmenujuHumbang Hasundutan (Humbahas) melalui Delleng Simpoon Salak, Kab. Pakpak Bharat. Kegiatan tersebut berlangsung Rabu, (11/4) yang dimulai dari Jalan Propinsi dari Sukarame Kec. Kerajaan hingga Puncang Delleng Simpoon, perbatasan Pakpak Bharat dengan Humbahas. Tampak antara lain Ketua Komisi D DPRD Sumut H. Yan Syarin, SE, Sekretaris Drs. Biller

Pasaribu, Maratua Halim Siregar dan Ajib Shah dan rombongan. Kepada para anggota Komisi D DPRD Sumut, Bupati Pakpak Bharat diwakili Asisten Pemerintahan Tekki Angkat menyampaikan, ruas jalan ini sangat urgen karena menjadi urat nadi perekonomian antar kedua kabupaten tersebut khususnya barang dan jasa. Selainitujuga,dijelaskan,ruas jalan ini sangat potensial karena sedang dikembangkan di sekitar lokasi persawahan sekira 200 hektar dan perkebunan gambir sekira 300 hektar. “Ini sudah sangat mendesak untuk segera dilakukan peningkatan kualitas jalan karena sudah pasti akan

mensejahterakan masyarakat banyak,” ujar Tekki Angkat. Seusai peninjauan lapangan, rombongan Komisi D DPRDSU diterima oleh Bupati Pakpak Bharat Remigo Yolando Berutu, MBA dengan didampingi Wakil Bupati Ir. H. Maju Ilyas Padang beserta Ketua DPRD Pakpak Bharat Ir. Agustinus Manik di Salak. Dalam acara ramah tamah Bupati Remigo mengapresiasi kunjungan kerja Komisi D DPRD Sumut beserta rombongan ke Kabupaten Pakpak Bharat. Bupati berharap dari kunjungan kerja ini dapat segera direalisasikan pembangunan sarana jalan yang menghubungkan kedua kabupaten tersebut. (csb)

Proyek Jalan Medan, Kabanjahe Rp37,67 M KABANJAHE (Waspada): Pelaksanaan paket proyek peningkatan struktur jalan nasional Medan – Kabanjahe yang dilaksanakan secara bertahap sejak 2011, terus berlanjut menelan biaya Rp37.670.216.197 bersumber dari APBN TA 2012. Menurut data plank proyek yangdipasangdilapangan,proyek tersebutdibagimenjadiduapaket yakni paket batas Medan – batas Kabupaten Karo sepanjang 6 km dengan biaya Rp17. 675.875.070 dan paket batas Kab. Deliserdang – batas Kota Kabanjahe 7,33 km menelan biaya Rp19.994.341.127. Sesuai dengan data yang ada pada plank proyek yang dipasang di kilometer 31 -32 Desa Rambung Baru Kecamatan Sibolangit Kabupaten Deliserdang, untuk paket proyek batas Medan – batas Kab. Karo, kontrak tanggal 15 Maret 2012, dengan masa pelaksanaan 25 Maret hingga 14 November 2012 yang dikerjakan kontraktor PT Karya Murni Perkasa. Sedangkan data pada plank proyek untuk paket batas Deliser-

dang – batas Kota Kabanjahe yang dipasang di kilometer 53 – 54 di Penatapan Desa Daulu dan di dekat tugu Perjuangan Berastagi, dengan kontrak nomor: 04/ KTR – APBN/DK/PPK 18/2012, tanggal 15 Maret, waktu pelaksanaan 19 Maret sampai dengan 29 November 2012, masa pemeliharaan 730 hari kalender, dengan kontraktor PT Sabarita Perkasa Abadi. Proyek jalan nasional Medan – Kabanjahe tersebut di bawah penanganan Balai Besar Pelaksanaan Jalan Nasional Satker : Pelaksanaan Jalan Nasional MetropolitanMedanBagianpelaksanaan : PPK -18 (Metropolitan Medan Selatan,Cs) Kementerian Pekerjaan Umum Direktorat Jendral Bina Marga. Pengamatan Waspada di lapangan,Selasa(10/4)sore,pihak kontraktor melakukan kegiatan pelapisan badan jalan dengan aspal hot mix untuk paket batas kota Medan – batas Kab. Karo di kilometer 31 -32 Desa Rambung Baru.

Namun sangat disayangkan, walaupun tengah turun hujan pihak kontraktor tetap saja melakukan pekerjaan pelapisan badan jalan yang basah. Warga setempat memperkirakan hasil pekerjaan tersebut akan cepat rusak karena melakukan pelapisan badan jalan yang dalam keadaan basah sebagaimana tahun – tahun sebelumnya, sehingga kemudian tahun ini harus dilapis kembali. Untuk paket proyek batas Kab. Deliserdang – batas Kota Kabanjahe, sejauh ini belum ada terlihat melakukan kegiatan pekerjaanfisik,kecualimelakukan pengukuran dan penandaan tempat-tempat yang akan dilakukan pekerjaan fisik. Selain kegiatan proyek peningkatanstrukturjalan,sejumlah pekerjaan lainnya juga sedang berlangsung di sejumlah titik tertentu di jalan nasional Medan – Kabanjahe, seperti pembuatan parit beton, pembersihan bahu jalan dan kegiatan pemeliharaan rutin lainnya. (c09)

Bishop GKPPD Hadiri Pembinaan Guru Sekolah Minggu PAKPAK BHARAT (Waspada): Pimpinan tertinggi Gereja Kristen Protestan Pakpak Dairi (GKPPD) Bishop Pdt. E. J. Solin menghadiri kegiatan pembinaan guru sekolah minggu se-Kabupaten Pakpak Bharat yang diselenggarakan oleh Kementerian Agama (Kemenag) Kab. Pakpak Bharat di GKPPD Lae Trondi Salak, Rabu (11/4). “Tidak ada satu bangsa atau suku pun yang boleh menganggap dirinya lebih tinggi dari yang lain, karena asalnya dari penciptaan Tuhan,” ungkap Bishop Pdt. E. J. Solin. Lebih jauh disampaikannya, semua ras dan bangsa sama asalnya, di mana setiap manusia merupakan ciptaan Allah. Ketua Panitia Kegiatan Daulat Padang, S.PAK pada kesempatan tersebut menyampaikan, pada kegiatan tersebut menghadirkan para pendeta dan dosen sebagai narasumber seperti Bishop GKPPD Pdt. E. J. Solin dan Dosen SekolahTinggi Teologi Oikumene Indonesia (STTOI) Delima Banjarnahor. Sementara dari Kemenag Kabupaten Pakpak Bharat pada kesempatan tersebut dihadiri oleh Kasubag Drs. H. Dungar Angkat mewakili Kepala Kemenag Pakpak Bharat, dengan menghadirkan 30 peserta dari utusan semua Gereja di Pakpak Bharat. (csb)

Malam Pesona Budaya Simalungun Memukau Pengunjung PRSU SIMALUNGUN (Waspada): Malam pesona pagelaran kesenian dan budaya Simalungun berhasil mendapat perhatian dan memukau pengunjung di arena Pekan Raya Sumatera Utara (PRSU) Jalan Jenderal Gatot Subroto Medan, barubaru ini. Meski diguyur hujan, namun tak mengurangi antusias tokoh masyarakat baik yang berasal dari Kab. Simalungun maupun Kota Medan menyaksikan kebolehan putra-putri dari tano habonaron do bona tersebut. Pagelarandiawalidenganpenampilanparaartisartis Simalungun dengan membawakan lagu-lagu daerah, disusul penampilan Horsi dan Imas USU dengan pragmen tradisional ‘Pajabu Parsahapan’. Bupati Simalungun JR Saragih mengharapkan masyarakat Simalungun jangan hanya menjadi penonton atau penggemar kesenian dan budaya daerahnya, namun harus peduli untuk terlibat

Bodhicita-RSU dr Hadrianus Kerjasama Bidang Kesehatan PANGURURAN(Waspada):Yayasan Bodhicita Mandala Indonesia yangberalamatdiJalanSelamMedanakanmelakukankerjasamadengan RSU dr Hadrianus Sinaga Pangururan di bidang kesehatan. Kehadiran pihak yayasan yang diwakili Bhiksu Nyanapratama disambut Direktur Dr. Nimpan Karo-karo di ruang kerjanya, Rabu (11/4). Dr.Nimpanmengatakan,kerjasamayangperludilakukandiSamosir di bidang penyakit katarak, hernia dan TBC.Tahun 2012, penanganan penyakitherniatidakmasalahkarenasudahadadokterbedah,sedangkan untukpenyakitkataraksudahdijalinmelaluiPerdamikarenaRSUHadrianus belum memiliki dokter spesialis mata. Untuk TBC, menurutnya, penanganan selama ini dilakukan di Puskesmas oleh Tim TBC. Menurut dia, penanganan penyakit TBC itu perlu dilakukan sampai ke tingkat klinis dan farmakologi sehingga infeksi TBC dan infeksi sekunder harus disembuhkan. Bhiksu menyebutkan, yayasannya sudah melakukan kerja sama dengan Rotary, Lions, RS Elisabeth Medan, Pemkab Humbahas dan Pemkab Tapsel. Dr. Nimpan juga mengharapkan adanya kerja sama untuk penanganan luka bakar pasien di Samosir seperti di leher yang dapat mengakibatkan kepala menjadi tertarik dan luka bakar di tangan yang jadi menyatu ke ketiak. Sedangkan untuk HIV/AIDS, Bhiksu mengatakan di Sukaramai Medan ada lima kasus tapi terkendala karena ada penolakan dari masyarkat karena malu. (c11)

Waspada/Edison Samosir

MENTERI Perdagangan RI Gita Irawan Wirjawan melakukan penyiraman setelah menanam pohon palem ekor tupai di areal taman Pasar Rakyat Percontohan Pangururan.

Waspada/Basita Bukit

PROYEK peningkatan struktur jalan nasional Medan – Kabanjahe terus berlanjut pada TA 2012. Foto diambil ketika dilakukan pelapisan badan jalan di kilometer 31-32 Desa Rambung Baru, Kec. Sibolangit.

melestarikan dan mencintainya. JR mengaku miris jika selama ini upaya pelestarian kesenian dan budaya Simalungun justru banyak dilakukan oleh orang yang bukan etnis Simalungun, bahkan lebih tinggi kepeduliannya dibandingkan masyarakat Simalungun sendiri. Kepala Dinas Pariwisata dan Kebudayaan Simalungun, Jarinsen Saragih mengatakan pelaksanaan pagelaran kesenian dan budaya Simalungun di arena PRSU merupakan salah satu upaya melestarikan kesenian dan budaya sekaligus promosi seni dan budaya Simalungun Ketua DPRD Simalungun, Binton Tindaon mengatakan, kesenian dan budaya Simalungun harus menjadi tuan di negerinya sendiri, sehingga harus tetap dilestarikan supaya tidak tersisih dengan budaya atau kesenian asing yang banyak digemari generasi muda saat ini. (a29)

Pembukaan MTQN Ke-41 Simalungun Meriah SIMALUNGUN ( Waspada): Bupati Simalungun, JR Saragih, Kamis (12/4), membuka secara resmi pelaksanaan MTQN (Musabaqah Tilawatil Quran Nasional) ke- 41 Tingkat Kab. Simalungun, di lapangan eks kantor bupati di Pamatang Raya, Kab. Simalungun. Acara pembukaan berlangsung meriah dan berjalan lancar diawali defile marching band dan para kontingen dari 31 kecamatan se- Kab. Simalungun. Selain bupati, hadir pada acara pembukaan tersebut Ketua DPRD Simalungun, Binton Tindaon, unsur Muspida, Ketua MUI Simalungun, H A Halim Lubis, Ketua LPTQ, Jadiaman Purba, Ketua panitia Ir Amran Sinaga, pimpinan SKPD, camat, official dan peserta MTQ dan ribuan masyarakat. Kegiatan MTQN ke-41 Kab. Simalungun berlangsung 12-14 April 2012. Bupati Simalungun dalam arahannya mengatakan, MTQ setiap tahun dilaksanakan sebagai arena perlombaan seni membaca Alquran dan pembinaan mental bagi generasi muda Islam. Semua bisa tampil dengan baik untuk bertanding, namun sasaran yang dicapai tidak semata-mata menjadi pemenang, tetapi lebih jauh lagi adalah untuk mencapai peningkatan ketakwaan kepada

Tuhan Yang Maha Esa. Ditambahkan bupati, MTQ merupakan salah satuupayamengingatkandanmendekatkaniman kepada pencipta, sekaligus menjalin silaturahmi antar sesama dengan orang lain. “Qari dan qariah yang tampil baik dan menjadi juara akan menjadi utusan ke MTQN di tingkat provinsi,” tegas JR. Ketua DPRD Simalungun, Binton Tindaon, mengatakan pelaksanaan MTQ tidak hanya meningkatkanprestasi,namunlebihjauhlagiuntuk meningkatkan keimanan dalam rangka melaksanakan nilai-nilai Alquran. Untuk itu dia mengharapkan kepada Pemkab Simalungun agar para juara MTQN ke-41 Simalungun ini diberikan perhatian khusus, sehingga para generasi muda IslamtetapbersemangatmeningkatkanSDM-nya terutama dalam bidang seni membaca Alquran. Ketua Panitia Pelaksana MTQN ke-41 Simalungun, Ir Amran Sinaga, menjelaskan, perlombaan diikuti 690 peserta qari/qariah dan official dengan enam cabang perlombaan yakni cabang Mujawwad, Fahmil Quran, Sharhil Quran, Khattil Quran, Tartil Quran dan Tahfidz Quran. Sedangkan kegiatan MTQ tersebut digelar hingga 14 April 26 2012. (a29)

Waspada/Hasuna Damanik

BUPATI Simalungun JR Saragih didampingi ketua panitia MTQN-ke-41 tingkat Kab.Simalungun, Amran Sinaga, memberi ucapan selamat kepada ketua dewan juri usai dilantik.

21 Mesin Jekpot Diamankan, Enam Pemain Ditangkap KABANJAHE (Waspada): 21 Unit mesin jekpot serta enam orang diduga sebagai pemain diamankan polisi di beberapa titik Kota Kabanjahe saat polisi melakukan kegiatan rutin dalam memerangi perjudian di wilayah hukum Polres Tanah Karo, Rabu (11/4) sekitar pukul 19.00. DalampenggerebekandipimpinKasatsabhara AKP SP Anak Ampun di beberapa lokasi yang ada di Kabanjahe dinilai masih ada beberapa lokasi yang belum sempat ringkus polisi namun kegiatan guna memerangi tidak perjudian yang kini terus dilaksanakan sebagai atensi Kapoldasu Irjen Pol Wijsnu Amat Sastro. Ke-21 unit mesin jekpot diamankan polisi dari berbagai lokasi seperti di Plaza Kabanjahe diamankanduaunit,JalanSamuratigaunit,wilayah simpang 6 dimankan dua unit, di Jalan Pasar Baru enam unit, di Jalan Kotacane tiga unit dan di Jalan Lau Cimbah lima unit. Darikeseluruhanmesinyangdiamankanpolisi terlihat di dinding mesin jekpot telah ditandai yang diduga sebagai kode sang pemilik jekpot

yang berada di setiap warung kopi di Kabanjahe, kode tersebut di antaranya KBN, SBN dan C8. Keenam orang yang diamankan polisi diduga sebagai pemain dan pemilik warung di antaranya SM, 35, warga Samura diduga sebagai pemilik warungkopi,ATN,wargaKabanjahedidugasebgai pemilik warung kopi , DT, 32, warga Pasar Baru diduga sebagai pemilik warung kopi, RS, 43 warga Kabanjahedidugasebagaipemain,NLRS,33warga Kabanjahe diduga sebagai pemain dan PS, 29, warga Jalan Lingkar yang diduga sebagai pemain. Kapolres Tanah Karo AKBP Marcelino Sampouw, SH, MT melalui Kasatreskrim AKP Harry Azhar didampingi Kasatsabhara AKP SP Anak Ampun, Kasubag Humas AKP Sayuti Malik, SH kepada Waspada membenarkan pihaknya telah mengamankan 21 mesin jekpot serta enam orang diduga pemain, pemilik warung dan uang Rp1.035.000 yang diamankan dari tangan masingmasing pemain dan pemilk warung kopi. “Mereka kini telah kita amankan ke Mapolres Tanah Karo guna pengusutan lebih lanjut,” ujarnya. (c10)


WASPADA Jumat 13 April 2012

Persoalan Kita Mental


Introspeksi Pasca Gempa


‘’lhamdulillah, tidak terjadi apa-apa dengan keluarga saya di Aceh.’’ Ucapan seorang warga Medan itu mewakili kita semua yang terkejut dan kalut saat dilanda guncangan gempa kemarin. Suara azan dan zikir pun berkumandang. Kita memang wajib bersyukur kepada Sang Pencipta Alam Jagat Raya (Allah SWT). Kalau melihat besarnya kekuatan gempa dan getarannya terasa begitu menakutkan di sejumlah kota di Pulau Sumatera hingga ke Malaysia, Singapura, Thailand, bahkan sepanjang Samudara Hindia, sepertinya gempa kemarin tidak kalah dahsyatnya dibandingkan gempa serupa tahun 2004 akhir lalu. Pusat gempa samasama di Aceh. Yang membedakan, kekuatan gempa di Aceh tahun 2004 itu awalnya 8,9 skala richter (SR), tapi kemudian meningkat menjadi , bahkan disebutkan pula mencapai 9,1 SR. Artinya, polanya cenderung menaik. Sebaliknya, gempa kemarin, tepatnya pukul 15.38 kecenderungannya menurun. Badan Meteorologi, Klimatologi, dan Geofisika (BMKG) awalnya mengumumkan, berkekuatan 8,9 skala richter, lalu dimutakhirkan menjadi 8,5 SR, terakhir 8,3 SR. Gempa ke dua pun terjadi beberapa jam berikutnya sekira pukul 17.43 WIB, dengan kekuatan 8,1 SR. Bumi yang begitu kokoh bergetar selama beberapa menit. Allahuakbar! Bedanya lagi, gempa tahun 2004 diikuti gelombang tsunami besar sehingga korbannya luar biasa banyak (ratusan ribu jiwa), kerugiannya tidak terhitung berupa kerusakan jalan, jembatan, listrik, bangunan-bangunan vital, persawahan, ternak dll. Gempa kemarin hanya membuat masyarakat, khususnya di Aceh dan wilayah lain yang juga dilanda tsunami delapan tahun lalu ketakutan, mereka berlarian ke luar rumah dan mencari lokasi daratan tinggi untuk mencari perlindungan yang dirasakan aman bagi diri dan keluarga. Terlihat sekali kalau masyarakat Aceh masih trauma. Sama juga masyarakat di Thailand, khususnya di kawasan pantai (Phuket), Malaysia dll. Hemat kita, gempa yang terjadi kemarin maupun sebelum-sebelumnya merupakan siklus tahunan akibat pergeseran lempeng bumi. Itu menurut kajian ilmiahnya. Tapi, kajian ilmiah itu bisa saja salah. Misalnya, sejumlah pengamat atau pakar gempa mengatakan gempa plus tsunami 2004 hanya mungkin terjadi (terulang) seratus tahun sekali. Siklus itu menggembirakan banyak pihak. Intisari Artinya, kejadian di Aceh takkan mungkin dialami generasi sekarang ini. Paling generasi dan cicit yang merasakannya. Tapi mudahKekuatan gempa 2004 cucu mudahan kita sama berdoa semoga jangan terulang lagi. hampir sama gempa 2012 sampai Terkait gempa dahsyat yang terulang di dengan kekuasaan Allah Aceh kemarin, Allah SWT berkehendak lain prediksi pakar gempa. Sehingga manusia tak banyak korban jiwa dari hanya bisa melakukan kajian ilmiah, berusaha mencari tahu sepanjang kemampuan akal dan pikirannya. Tapi, ketentuan yang hakiki tetap di tangan Allah SWT. Kalau Allah berkehendak, bisa saja gempa terjadi berulangulang dalam kurun waktu tertentu. Dan itulah yang terlihat di Aceh dengan pusat gempa di Simeuleu. Gempa pertama sangat besar, gempa kedua juga sangat besar di atas 8 SR, baru gempa-gempa berikutnya (susulan) skala richternya lebih rendah dan menurut kajian ilmiahnya bumi kembali menyesuaikan diri setelah melepaskan ‘’mega trust’’. Justru itu, marilah kita melakukan introspeksi diri. Jangan berandai-andai dan berdalih. Bersyukur karena jumlah korban dan kerusakannya sangat kecil. Walaupun kekuatan gempa mencapai 8,5 SR, namun guncangannya tak menimbulkan kerusakan parah. Gelombang tsunami tak terjadi. Itu pertanda Allah SWT masih sayang pada hambanya, di Aceh, Sumut, dan negara-negara tetangga lainnya. Selain itu, pastilah Allah SWT ingin mengingatkan kita semua untuk selalu ingat dan menyembah-Nya. Mungkin selama ini kita semakin lupa diri, merasa paling pintar, paling kuat, paling kaya, kurang bersedekah, abai dalam membayar zakat, atau hanya mengejar duniawi semata. Saat gempa kita baru ingat pada Sang Pencipta, timbul rasa takut mati. Padahal, gempa dengan kekuatan seperti kemarin sangat kecil dibandingkan saat hari kiamat tiba nanti. Bukan hanya guncangan yang dirasakan makhluk hidup, tapi gunung-gunung dan seluruh isi alam luluh-lantak, hancur, bagaikan kapas berterbangan saat tiupan sangkakala dibunyikan. Adalah Malaikat Israfil yang bertugas meniup terompet pada hari itu (tak seorang pun tahu kapan waktunya tiba). Dan tak seorang pun bisa luput dari maut di hari kiamat yang pasti itu. Tak pelak lagi, gempa besar kemarin merupakan peringatan dari Yang Maha Kuasa pada semua hamba-Nya. Lihat saja banyaknya negara dan badan pencatat gempa menyebutkan gempa ini berpotensi tsunami. Namun ketakutan itu tak terjadi. Kalaupun terjadi kenaikan permukaan air laut tapi ketinggiannya tak sampai satu meter sehingga dampak kerusakannya nyaris tak terlihat di daerah gempa (Sumut dan Aceh) apalagi di negara-negara tetangga. Artinya, sekalipun kekuatan gempa demikian dahsyat, nyaris sama dengan peristiwa 2004, kali ini tidak sampai meratakan bangunan dan mematikan berkat kekuatan doa.+


Faks 061 4510025

Facebook Smswaspada

+628126329716 Redaksi WASPADA yth,Perpanjangan waktu pengumuman Polling di tulis hari jumat tgl 7/4 tapi di kalender hari jumat tgl 6/4,bukan tgl 7/4 mana yg benar ?!? Dari pelanggan Waspada di Aceh. +6281260856563 Kpd. Yth..dir Pam Tirtanadi... Kmi Masyarakat Husus Nya Medan..begitu Susa Mau Masukan Air Pam/ Pasang Baru..sampai Menungu Ber Bulan Bula...gmana Cara Kerja Pam Tirtanadi? Buat Masyarakan Medan? Kok Harus Menungu Ber Bulan Bulan? +6285763196160 Pantun buat dunsan sanak nan di kampung .baparak ka parak urang .induk boleh batanam tebu .nan anjalai nyo cabut juo. .bamamak ka mamak urang .induk bulih tampet mang adu. Nan salasai nyo pakusut pulo. Ambo banamo lb katorong. Urang par tamo mandarek di bulan. Mambao pisawek merek apolo.induk lah salah kaki tadorong .mangko kampung ambo ting gakan. Ulah dek bansait nangko juo .mudik kareta ka si cincin. Singgah sa banta di kampung ben dang. Baranti tan tang ujung gunung. Cadik bana awak ko miskin .lidah ndak masin didanga urang.elok ka rantow ting gakan kampung . dari elbe katorong di pondok nan langang tmbung +6281370980427 Saya heran membaca berita waspada rabu 4 april dgn judul besar alias headline utama “ mendagri....,sementara didalam berita sk blm diteken,cemana ni redaktur koq jd spt koran tak berbobot ya ? +6285361424120 GURU GURU AGAMA ISLAM DI KABUPATEN KARO jadi sapi perahan oknum Kementrian Agama kab.karo. karena guru 2 di patok membayar untk menerima Sertifikat pendidik sebesar rp 250.ribu/guru dgn alasan untk biaya leges demikian juga saat mempersiapkan berkas pengusulan 1. dikenakan biaya rp 200.rb./guru. Sadis... +6285262957864 Tindakan Wamenkumham secara preman dgn menampar petugas sipir tdk bisa dibenarkan.ini baru menjadi wamen,bagaimana kalau mentri.hal ini harus dituntut secara hukum.termasuk ajudan yg bertindak secara arogan. +6281361371593 Pak Presiden,jangan terburu nafsu mendepak PKS. Jangan ada kata dr rakyat, Presiden menzolimi PKS(Rakyat. Masih ingat SBY dulu pernah bilang dizolimi penguasa,lalu jadi lah Presiden...! Hebaaat....! Buat PKS jangan takut, rakyat mendukung (Namialus Medan). +6285362309533 85% penduduk NKRI adalah umat ISLAM, Alangkah eloknya setiap masuk waktu shalat semua stasiun televisi mengumandangkan adzan tanda waktu masuk shalat wajib yang lima waktu tsb. Dan saya usulkan/mohon pada Saudaraku HAJI KARNI ILYAS pemimpin TV ONE agar acara RADIO SHOW dari jam 23.00-02.00 pagi dihapuskan saja, karena sangat2 tidak sesuai dengan budaya bangsa Indonesia, ganti saja dengan acara yang bernuansa agama, etika, pencerahan dsbnya. INSYA ALLAH !!! +6285763327286 Halo Pak Walikota/ Kepala Pajak Pbb Medan, Rakyat Mau Makan Aja Susah, Apalagi Disuruh Bayar Pbb Yg Naik Lebih Dari 100 Persen. Kemudian Kalian Suruh Rakyat Mengajukan Keberatan, Nanti Dikurangi 50 Persen. Emangnya Kami Ini Pns (Pengangguran Terselubung). Kami Buruh Yg Kalo Tdk Kerja Gaji Tdk Dibayar. Buat Aturan Yang Benar Lah +62811655150 Pak Walikota, Jl.Dazam Raya yg lebarnya hanya 4 mtr setahu kami adalah daerah pemukiman/perumahan.Tetapi pd saat ini rumah dijalan tsb umumnya tlh berubah menjadi gudang/showroom mobil.Kami masyarakat yg tinggal disekitar jalan tsb merasa keberatan dan terganggu karena mobil2 kerap diparkir sepanjang jalan tsb yg membuat Jalan menjadi sempit.Kami hrp dpt ditertibkan dan jangan dirubah tata ruang/peruntukan dr PERUMAHAN/PEMUKIMAN kpd peruntukan lain.


Oleh M Ridwan Lubis Mereka adalah orang yang sangat berkecukupan namun terus menerus menumpuk kekayaan.


esuai dengan dasar dan filsafat bangsa Indonesia, maka hal yang menjadi prioritas dalam pembangunan adalah melakukan penataan kembali terhadap mental bangsa. Bagaimana bisa, suatu bangsa yang dikenal sejak lama memiliki etos kerja yang tinggi sesuai dengan kondisi sulitnya geografis Indonesia yang terdiri dari ribuan pulau yang dipisahkan satu sama lain dengan lautan tetapi mereka bisa hidup melalui tuntunan agama maupun budaya yang teraktualisasi melalui petuah orangtua. Tuntunan agama dan budaya membentuk sejumlah gugusan tata aturan (code of conduct) sehingga setiap orang mengetahui dengan sadar akan hak dan kewajibannya. Kekuatan mental nelayan yang mampu mengarungi lautan siang dan malam guna menangkap ikan tentulah bukan pekerjaan ringan andaikata keberangkatan mereka ke laut tidak dibekali dengan sejumlah tata aturan yang bersumber dari Zat Yang Mahagaib. Tetapi di tengah kepolosan masyarakat nelayan di lautan serta petani di lahan pertanian dan perkebunan yang bernaung di bawah payung keseimbangan alam semesta—di sisi lain kita dihadapkan dengan perilaku sebagian kelompok masyarakat yang memadakan sumber penghidupannya dengan menadahkan tangan di perempatan jalan— menggendong bayi ataupun memanfaatkan kekurangan anggota badannya. Pemandangan yang lebih memilukan apabila kelompok di atas menadahkan tangan dengan meminta-minta disebabkan kondisi kehidupan yang miskin dan papa. Kalaupun diperoleh belas kasihan orang maka hal itu hanya untuk menutupi hajat hidup untuk dimakan pada hari itu juga. Coba kita renungkan saudara-saudara kita yang terpandang telah telah tercerahkan melalui proses pendidikan sehingga mereka tergolong kelompok masyarakat profesional dan menduduki posisi strategis yang menampilkan diri sebagai pemimpin— tetapi dengan sadar melakukan berbagai penyimpangan dari aturan dan sistem yang ada guna mempertahankan sebuah prestise dan jabatan. Lalu

persoalannya, apakah orang yang melakukan penyimpangan itu hanya karena didorong oleh kehidupan yang miskin secara materi. Mereka adalah orang yang sangat berkecukupan namun terus menerus menumpuk kekayaan. Kehausan materi terus menerus mendera orang yang mengalami sakit mental. Benar sabda Rasul yang menyatakan adanya tiga hal yang mengakibatkan kecelakaan hidup: memperturutkan hawa nafsu (hawan muttaba’), taat kepada sifat kikir (syuhhun mutha’) dan bangga terhadap diri sendiri (i’jab al mar’i bi nafsihi). Berbagai lembaga pemeriksa, mulai dari inspektorat, auditor, meningkat kepada jaksa, hakim, polisi, pengacara dan sebagainya dibentuk akan tetapi kenyataannya semakin dibuka sebuah kasus akan semakin terang benderang pula rentetan terkuaknya kasus lain yang lain. Dari sudut pendekatan antropologi budaya, bangsa Indonesia telah sejak lama dikenal orang luar sebagai bangsa yang sangat kuat dengan tradisi keberagamaannya. Berbagai upacara dan perayaan hari besar keagamaan telah melekat dalam diri seluruh kelompok agama di Indonesia. Rumah-rumah ibadat khususnya pada waktu-waktu tertentu melimpah pengunjungnya. Fasilitas publik baik perkantoran, hotel, pusat perbelanjaan sudah menjadi kelaziman untuk memiliki tempat ibadah guna menampung keperluan dari pengunjungnya. Lalu pertanyaan yang mengusik perhatian kita adalah dimana letaknya mata rantai yang terputus (missing link) antara kesemarakan upacara keagamaan dengan semakin meningkatnya intensitas penyimpangan mental. Untuk memahami keadaan tersebut maka marilah kita melihat bahwa kunci utama hakikat kemanusiaan terletak pada potensi yang terdalam dalam dirinya yang berfungsi selain untuk membedakan antara benar dan salah tetapi juga untuk membedakan antara yang baik dan buruk. Secara legal formal, kemungkinan sebuah penghasilan yang fiktif adalah memenuhi aturan karena ada bukti tertulis sebagai pendukung akan tetapi secara substan-

ºsial, perolehan komisi, insentif apalagi korupsi, penyalahgunaan jaba-tan atau apapun namanya adalah ber-tentangan dengan nilai dasar kema-nusiaan. Dari paparan tersebut, maka inti persoalannya adalah terletak pada persoalan mental bangsa yang memerlukan penataan kembali—diarahkan kepada peneguhan nilai-nilai kebenaran agar setiap warga masyarakat memiliki rasa bangga apabila mereka berhasil berjalan di atas sistem dan disiplin terhadap nilai kebenaran. Persoalannya, siapa di antara pemimpin ataupun aparat yang istiqomah berdiri di atas prinsip ini. Sayangnya, dampak dari program pemerintah terhadap peneguhan komitmen mental ini belum kelihatan secara signifikan. Program pengawasan yang dimulai dengan Pakta Integritas, Diklatpim,

Pentaloka dan lain sebagainya hanya ibarat nyanyian sunyi tidak berdaya menghadapi penyimpangan perilaku itu. Demikian juga, lembaga keagamaan belum memberikan perhatian yang sungguh-sungguh untuk mempromosikan kehidupan yang jujur, disiplin, optimis dan teladan. Sementara sebagian masyarakat masih lebih banyak menempatkan agama sekedar sebagai simbol sosial belum menjadi jalan (syari’at) menuju Tuhan. Dapat dibayangkan betapa mahalnya ongkos yang harus dibayar bangsa ini apabila pembangunan mental belum menjadi prioritas dari seluruh rangkaian program pembangunan. Penulis adalah Dosen UIN Syarif Hidayatullah Jakarta.

Giliran ‘Diplomat & Sayap Militer’ Pimpin BL-1 Oleh Sofyan Harahap Maraknya operasi militer mengharuskannya ke luar negeri guna membangun diplomasi internasional selaku diplomat,mengampanyekan perjuangan rakyat Aceh yang tertindas di masa Orde Baru.


asil hitung cepat pasca Pilkada Gubernur Aceh 9 April lalu memastikan sang incumbent Irwandi Yusuf kalah telak dan harus ikhlas menyerahkan tongkat estafet kepemimpinan orang nomor satu di Aceh (BL-1) kepada seniornya di Partai Aceh (d/a GAM = Gerakan Aceh Merdeka), dr ZainiAbdullah yang berpasangan dengan Muzakir Manaf (Wagub) disingkat Zikir. Prediksi hasil Pilkada Aceh yang berlangsung serentak memang mengejutkan banyak pihak. Sebab, kemenangan besar yang diraih PA luar biasa, di luar dugaan para pengamat politik dan sosial lokal maupun nasional. Soal dugaan terjadi kecurangan dalam proses tahapannya, apakah masalah daftar nama calon pemilih, surat suara/panggilan, intimidasi, sampai permainan politik uang dll, menurut hemat kita bukan berita baru. Hampir di semua Pilkada kabupaten-kota hal seperti itu selalu terjadi. Sehingga desakan Pilkada ulang menggema di beberapa daerah. Ujung-ujungnya nanti ya terpulang putusan Mahkamah Konstitusi (MK). Mahfud MD dkk biasanya berpihak pada bukti-bukti dan keterangan saksi. Dualisme Perpecahan Meski posisi Irwandi di Partai Aceh (PA) sepertinya dipinggirkan, bahkan dianggap seperti musuh. Namun andil perjuangannya selama bersama-sama tokoh seperjuangan dalam membesarkan GAM di masa lalu, rasanya mustahil hilang begitu saja. Sejarah akan mencatat, sehingga berita yang menyebut Irwandi sudah didepak dari PA patut dipertanyakan. Menurut hemat kita, berita Irwandi diberhentikan atau tidak lagi terdaftar di dalam struktur kepengurusan PA bisa benar. Tapi, bisa jadi pula hanya rumor terkait kepentingan politik pihak tertentu. Seiring dengan perjalanan waktu bisa saja situasi panas jadi cair. Sama halnya ketika Golkar memecat Syamsul Arifin saat Pilgubsu lalu karena masuk lewat parpol lain, kemudian namanya direhabilitir dan malah diangkat menjadi ketua Golkar Sumut mengganti Ali Umri. Irwandi bisa jadi masih kalah senior dalam perjuangan GAM di masa sulit. Dia baru dikenal masyarakat luas ketika mewakili GAM dalam berbagai perundingan dengan pemerintah RI. Sebelumnya, dosen kelahiran Bireuen pada 2 Agustus 1960 ini lulusan Fakultas Kedokteran Unsyiah dan sempat mengenyam pendidikan di College of Veterinary Medicine Oregon State Uni-

versity. Sekalipun jabatannya di GAM kemudian melonjak, sebagai Staf Khusus Komando Pusat Tentara (19982001), tetap saja Irwandi belum bisa disamakan dengan seniornya, seperti Malik Mahmud (mantan PM), Zaini Abdullah (mantan Menlu) dll. Saat berjuang Zaini bersama para pejuang GAM lainnya terus diburu TNI sehingga bergerilya di tengah hutan, nyawanya terancam, dan memilih hijrah ke luar negeri tahun 1980an. Maraknya operasi militer mengharuskannya ke luar negeri guna membangun diplomasi internasional selaku diplomat, mengampanyekan perjuangan rakyat Aceh yang tertindas di masa Orde Baru. Oleh karena itu, hal biasa jika terjadi like and dislike terkait kepemimpinan dan keinginan Irwandi maju untuk kedua kalinya dalam Pilkada Aceh lalu. Gerbong Irwandi mungkin ngotot karena tak ingin tersingkirkan begitu saja. Sedangkan PA sudah punya calon sendiri: Zaini Abdullah dan Muzakir Manaf. Artinya apa?, PA ingin perubahan dan hakkul yakin masyarakat Aceh berpihak pada jagonya walaupun mereka sempat terancam tidak ikut Pilkada. Untung saja lobi politik PA di pusat demikian kuat sehingga mulai dari presiden, menteri, sampai MK sepertinya berpihak pada aspirasi PA. Jadwal Pilkada Aceh pun berulang kali ditunda. Jelas penundaan itu merugikan para incumbent, termasuk mengancam peluang Irwandi, Nazar dll. Tak pelak lagi, jabatan di pemerintahanlah yang menyebabkan tokohtokoh mantan pejuang GAM terpecah, terjadi dualisme, demi mengejar kekuasaan pasca perdamaian. Kalau saja Irwandi mengikuti instruksi PA dengan tidak lagi mencalonkan diri dalam Pilkada Gubernur Aceh lalu, besar kemungkinan tokoh-tokoh mantan GAM, Panglima Wilayah GAM, kombatan, dan elite politik dalam PA tidak terpecah. Namun begitu kita tidak bisa menyalahkan Irwandi, Nazar maupun Zaini- Muzakir dll. Sebab, semuanya punya hak untuk mencalonkan diri sesuai perundangan. Di sini terlihat sikap tegas PA. Irwandi juga tegas melakukan perlawanan. Melihat besarnya dukungan dan keberadaan PA kian solid dan banyaknya intrik yang timbul sekaitan dengan pencalonan Irwandi dalam Pilkada lalu, tidak tertutup kemungkinan tokohtokoh eks GAM akan membentuk dua sampai tiga partai lokal baru pasca Pilkada, dan kita melihatnya positif. Balal ada yang mengontrol Zikir menjadi oposisi dan konstitusi pun mem-

bolehkan. Apalagi melihat dukungan buat Irwandi dalam Pilkada lalu cukup besar. Ia dan wakilnya, Muh-yan Yunan menduduki peringkat dua, perolehan suaranya hampir 30 persen. Ini modal kuat buat kubu Irwandi untuk memproklamirkan partai lokal baru yang berarti pecahan dari PA karena merasa aspirasi politiknya tidak tertampung lagi di PA. Patah Tumbuh Pepatah atau slogan TNI ‘’Patah Tumbuh Hilang Berganti’’ berlaku di mana saja, termasuk dalam suksesi kepemimpinan di Aceh saat ini. Seperti kita ketahui, cukup banyak tokoh GAM, anggota TNA yang tewas di masa lalu dalam pertempuran, baku tembak dengan aparat keamanan, atau disergap di tempat persembunyiannya di tengah hutan belantara oleh pasukan ABRI/ TNI. Kita sebut saja Panglima Gerakan Aceh Merdeka (GAM) Teungku Abdullah Syafi’ie. Dia mati syahid di Desa Blang Sukon, Cubo, Kecamatan Bandar Baru, Pidie Jaya pada 22 Januari 2002. Perjuangannya bergerilya di dalam hutan belantara mengagumkan. Terlebih lagi perjuangan Pimpinan Tertinggi/ Deklarator/Wali GAM Teungku Muhammad Hasan Di Tiro sangat dihormati rakyat Aceh. Kalau Abdullah Syafi’ie,50, tewas dalam pertempuran 30 menit, Hasan Tiro wafat karena faktor usia lanjut,85, di RSU Zainal Abidin, Banda Aceh dua tahun lalu. Beliau wafat sehari setelah resmi kembali lagi menjadi warga negara Indonesia (WNI) dan mewasiatkan kepada pengikutnya/masyarakat Aceh untuk menjaga perdamaian. Hasan Tiro adalah putra Aceh sempat berpindah menjadi warga negara Swedia karena persoalan politik. Kala itu, Hasan Tiro menjadi tokoh utama bercita-citaAceh merdeka dan memisahkan diri dari Indonesia untuk meningkatkan kesejahteraan rakyatnya. Beruntung, polemik tersebut berakhir damai di Helsinki, Finlandia, 15Agustus 2005. Sejak itu gerakan ini beralih ke panggung politik karena seluruh persenjataan organik yang dimiliki GAM harus dimusnahkan oleh pengawas perdamaian asing. Meskipun banyak tokoh GAM di masa lalu telah tiada namun gerakan ini masih tetap eksis, membumi, di tengah masyarakat. Abdullah Syafi’ie digantikan Muzakir Manaf sebagai panglima sayap militer sehingga menyulitkan aparat keamanan mengalahkan pasukan GAM. Penutup Bila dibandingkan ketokohan mantan Menlu GAM Zaini Abdullah yang melakukan perlawanan bersama sang tokoh legendaris GAM dr Hasan Tiro di luar negeri (bermarkas di Swedia) ketokohan Irwandi tentu saja masih kalah jauh di mata rakyat Aceh. Keduanya sama-sama intelektual dan terpe-

lajar. Zaini lebih senior dan lebih banyak makan asam garam. Sedangkan Muzakir Manaf —digelar Mualem— memiliki pengeta-huan tinggi tentang ilmu kemiliteran, lama berlatih di Libya, disegani oleh para mantan kombatan dan berbagai elemen masyarakat Aceh. Apalagi posisinya sebagai Ketua PA membuat-nya lebih dipercaya ketimbang tokoh-tokoh yang lebih senior. Sekalipun Muzakir lebih junior tapi kerja kerasnya memanggul senjata di hutan dan sukses menjadi Panglima GAM menjadi cata-tan tinta emas dalam ingatan rakyat Aceh. Hasil Pilkada 2012 menunjukkan rakyat Aceh cinta dan menginginkan tokoh utamanya yang ‘’asli’’ dan ‘’berdarah-darah’’ memimpin GAM menjadi pemimpin lima tahun ke depan. Zaini, 72, sukses berjuang untuk berdiplomasi di luar negeri, sementara Muzakir , 48, sukses memanggul senjata sebagai Panglima GAM. Perpaduan tokoh diplomat dan sayap militer menjadi duet memimpin Aceh (BL-1) masa depan dan Zikir berkewajiban memenuhi janji-janjinya mengubah Aceh harus lebih baik dalam segala bidang: birokrasi, ekonomi, hukum, sosial dan keagamaan dalam bingkai NKRI.** Penulis adalah wartawan Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Warga Medan berhak tidak bayar PBB - Paten juga kalau bisa begitu * Partai Demokrat buka pendaftaran Cagubsu - Siapa pendaftar pertama, he...he...he * Impor kentang dan jagung rugikan petani Sumut - Iyalah, Kentang di Brastagi menggunung


D Wak

B6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CHEVROLET Trooper ‘90 Dijual. Abu tua met, mobil mulus, body lempang, interior rapi, AC dingin, Mobil siap pakai. Harga 50Jt Nego. Hub. 0821 6188 3111 DAIHATSU Xenia Over Kredit, mulus, PW, PS, Ban Baru, jok kulit, VR, Thn. 04/ 10, Bayar 27x Sisa 21x, angs. 3,7 tanpa bunga. Balik DP 57 Nego. HP. 06166477734, 085246166601 Maaf TP

5 CM 6 CM

Rp. 65.000 Rp. 78.000


Carry Pick Up, Ertiga, APV Arena Cash/Credit DP Rendah, Angsuran Ringan. Hub. 0852 7084 7017

TOYOTA Kijang Super Dijual Thn. 91. W. Hijau metalik 6 Speed long. H. 41Jt. Nego/Suzuki Carry 1000cc. Thn. 95 pintu belakang H. 31Jt. Nego. Hub. HP. 0813 7031 0953



PURBA : 0813 9789 4633

DAIHATSU Xenia Li Thn. 2006 VVT-i Type Sporty BK Medan, W. Hitam met, Velg 14, Harga damai / Bisa Bantu Kredit. Peminat Hub. HP. 0811 642077

Ready Stock Yaris Terbaru 2012, Avanza G Innova, All Tipe. Fortuner, Putih, Hitam, Rush, Hilux, Bisa Tukar Tambah. Semua Mobil. Hub. 0813 6120 1719 / 68783325

DAIHATSU Taruna CSX Th. 1999. Merah silver, BK Medan, pajak panjang lengkap. Siap pakai. Hrg. 77 Juta/damai. HP. 0812 5451 974 DAIHATSU 100% BARU

All New Xenia Angs 2.071.000 Terios Angs. 2.747.000 Pick Up Angs. 2.385.000 Hub. ADEK - ASTRA 081 263 400 55, PIN: 274CA61C

PROMO DAIHATSU Xenia, Luxio, Terios, barang ready Hub. DAUD HSB. 0812 6362 4634 DAIHATSU ESPASS 1.6 1997 Supervan AC, Tape, VR, WR, Biru mulus. BK Mdn asli. Hrg. 39Jt/Nego. Hub. 0811 650 674 DAIHATSU 100% BARU Ready Stock: Xenia Terios, Grand Max PU/MB. Luxio, Sirion. Data dijemput. Proses Cepat. Hub. 0812 6305 0708 PROMO DAIHATSU SLIPER PROMO Terios DP 21 Jt-an Angs. 4 Jt-an Xenia DP 18 Jt-an Angs. 3 Jt-an Pick Up DP 7 Jt-an Angs. 2 Jt-an Luxio DP Nego. Dapatkan Juga Paket Kredit Impian & Mini for Max. Hub: IRNANDA 0813 7580 2895 / 0821 6761 2659

DAIHATSU Taruna CSR EFI Thn. 2001/2000. Hitam met (over Kredit) Plat BM - Lengkap, mulus & terawat. Sound System - Balik DP: 38Jt (nego). Angs: 2,5Jt x 24 bln (sdh byr 12 bln). Hub. 0852 9775 0771 - 777 56757

FORD Ranger 2002 Double Cabin 4x4 Diesel 2,5 Biru, Velg Racing, mulus, terawat, siap pakai (BU). 105Jt Nego. 0821 6463 7090 BIG PROMO!!! FREED HONDA * HADIAH & CASH BACK !! All New, CRV, CITY, CIVIC, BRIO JAZZ ** Pesan Terima Tukar Tambah Semua Merk !! CRV 081.260.7777.55 / 061.777.141.55

NISSAN READY STOCK Dapatkan Nissan Xtrail, DP Murah 50 Jt-an atau Angsuran 7 Jt-an + Kredit s/d 5 thn. Hub. 0821 6323 5812 / 0831 9933 4067

NISSAN XTrail XT A/T ‘04. Rp. 152Jt. Nissan Livina XR M/T ‘08. Rp. 132Jt Hub. 91327433


TOYOTA Great Corolla 1.6 SEG ‘94 Hitam Met. Hub. 0812 643 4643 (no sms) TOYOTA PROMO New Avanza, Innova, Rush, Fortuner, dll. Hub. 0853 1098 8164 TOYOTA Innova V Matic Bensin Thn. 2005. Hitam, BK Mdn, pajak STNK Baru Rp. 155Jt. Hub. 0853 7089 9893 TOYOTA Kijang LX 1.8 Bensin Thn. 2004. AC, VR, PS, CL, jok kulit, Silver, Plat, BM Rp. 105Jt. Hub. 0812 6594 2789


SUZUKI X ‘Over ‘07. Matic, Silver, Built Up Japan Audio Power - Sub Woofer. Tangan pertama, Peminat serius Hub. 061-77300808 / 0819 628808, Tanpa Perantara.

BUTUH DANA Jaminan BPKB mobil, Pick-Up, truck, intercooler, data lengkap. Proses cepat. Hub. 0853 597 11000




VEGA R 2008 awal

dijual. 1 (satu) tangan. 0821 6030 7939





SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000




Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602




TV 42” LCD P - P. Sonic= 4Jt. LCD 32” Samsung - P. Sonic @ 2,8Jt. 34” Sony= 2Jt, , 29” Flat Baru LG=2Jt, 29” Bekas 900rb - 17Jt. 14-21=300rb - 650rb. LCD Monitor 22”= 800rb. PS1=300rb, PS2=800rb. PS GO=1,3Jt, DVD 200rb, Vortabel=700rb, Ampli Cina=400rb, Technics H. Kardon Spk- Tehnic - EQ - TV Mobil, dll. LAPTOP, HANDICAM, CAMERA, PROJECTOR Handicam Sony HI-8=1 Jt Mini DV=1,5Jt-DVD=2Jt Canon Legria=1,5Jt, Camera 5 Mp=12 Mp 500rb - 1,2Jt Fax, P.Jector Benq = 2,8Jt.

SPLIT BEKAS MODEL BARU DIJUAL MURAH 1 Pk=1,2Jt - 1 1/2= 1,8Jt - 2 pk=2Jt, Air Coler=800Rb



Kulkas 1 Pt - 2 Pt - 600rb - 1,2Jt, 2 Pt. Super Jumbo= 1,9Jt. F LG 5 Rak =1,2Jt. M. Cuci 1 Tb-2 Tb = 600rb - 1,2Jt

M. Cuci baru = 1,2Jt (2 Tb 9 Kg) Genset 3000 w= 2Jt, 8000w =4.5Jt. Pompa Air, Sanyo - P. Cliner





0812 631 6631




Hub. 061-77913537 / 0813 7553 3375



Cuci AC, Servis/Perbaikan Pasang dan Bongkar Pasang AC Hub. MADINA SERVICE 061 50 36 14 15 0853 7234 0844

Ada Garansi


845.8996 0812.631.6631

Pasang Iklan Mini

“WASPADA” Telp: 061 - 4576602



Surat Tanah SK Camat Luas tanah +/- 1 ha. a/n. Sri Hartati. alamat Tanah Desa Lau Timah Kec. Pancur Batu Deli Serdang. Hilang disekitar Jl. Sei Mencirim Diski pada tgl. 30/ 3-12. Bagi yang menemukan harap menghubungi sdr. Toni. HP. 0813 7636 0455. Tidak akan dituntut dan akan diberikan hadiah sepantasnya.

FAX.4561347 Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


UMROH MULTAZAM 1. 2. 3. 4. 5. 6.


Umroh Reguler 9hr tgl. 23 April, 7 Mei, 18 Mei Umroh Reguler 12/ 13 hari Tgl. 25 April, 10 mei Umroh Plus Turkey - Akhir Juni Umroh Plus Mesir - Bulan Mei Umroh Plus Jordan Aqsha - Akhir Juni Umroh Ramadhan awal - tengah - akhir 1 bln 2 minggu - 9 hari (Hotel - Apt)

Manasik Haji Multazam: Setiap hr Sabtu Pkl. 14.00-16.00Wib hr Minggu Pkl. 09.00-11.00 Wib Tempat manasik Mesjid Agung Medan Jl. P. Diponegoro DAFTARKAN SEGERA KE:


Jl. Titi Papan/ Pertahanan No. 10 Sei Sikambing Medan Telp. (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6495.8456


1.Surat Akte Perolehan Pengoperan dan Penyerahan Hak No. 79. Tgl. 20 Des. 1988. dibuat oleh Amran Nst. pada waktu itu Notaris Pengganti sementara Aniswar Yanis di Medan A/n. Abdul Hakim Saleh Bashel 2. Akte Perolehan Jual Beli No. 15 Tgl. 3 Feb. 1977 dibuat oleh Notaris Roesli Medan. A/n. Sri Dhanarty. Rumah dan Tanah Jl. Biawak No. 27 Kelurahan Pandau Hulu II. Kecamatan Medan. Luas Tanah ± 140M2 Bekas Grat C 2692 HILANG / TERCECER

Bukti Kwitansi pembayaran Ganti Rugi sebidang tanah dari PTP-N IX untuk DPD Partai Golkar Sumatera Utara yang terletak di Jl. Pancing / Selamat Ketaran Kab. Deli Serdang. Bagi yang menemukan Hub. 0819 862337 Kantor DPD Golkar Sumut (061) 4156444


Telah tercecer Surat Tanah SK Bupati Kepala Daerah Kabupaten Deli Serdang No. 28821/A/III/ 3. Tgl. 22 Desember 1973. An. Badaruddin Lubis

Perguruan As-Syafi’iyah Internasional membutuhkan TU, Satpam, Guru SD, SMP dan SMA Bidang Studi : - Geografi, Matematika, Bhs. Inggris, Bhs. Indonesia, Pend. Ekonomi, Penjas, Fisika, Kimia, Biologi, PKn, TIK, Seni Budaya, Agama Islam ( PAI ) dan Guru Kelas SD. Persyaratan sbb : 1. S1/AIV 2. Pengalaman min 2 tahun 3. Mampu mengoperasikan MS. Power Point 4. Mampu berbahasa Inggris ( minimal passif ) 5. Mampu membaca Al-Qur’an dengan lancar 6. Memiliki Laptop sendiri 7. Bersedia test micro teaching. 8. TU, D3/S1 Akuntansi 9. Satpam ( Berpengalaman ) Lamaran ditulis tangan dan diantar langsung ke :

Perguruan As-Syafi’iyah Internasional, Jl. Karya Wisata II No. I Medan Johor - Medan. Paling lambat tanggal : 16 April 2012.

HILANG SKT an. SYARIFUDDIN Luas 5.400M2. Lokasi tanah di Kel. Baru Ladang Bambu Kec. Medan Tuntungan Kota Medan HILANG

1. Surat Keputusan Kepala Inspeksi Agraria Riau No. 1A1/PHGB/65, tertanggal 1003-1965 seluas 63.041 M2 2.Gambar Kasar sementara sebagai lampiran Surat Keputusan Penegasan Hak Milik/Guna Bangunan No. 1A1/ PHGB/65, tertanggal 22-03-1965 3. Surat Keputusan Kepala Inspeksi Agraria Riau No. 1A.649/9/65, tertanggal 22-03-1965 seluas 63.041 M2. 4.Surat Keputusan Walikota Kepala Daerah Kotamadya Pekanbaru No.40/ZI/DPUK/ 66 /tanggal 15-02-1966 (lima belas Pebruari seribu sembilan ratus enam puluh enam), tentang pemberian izin mendirikan bangunan. Surat-surat tersebut A/n. SULAIMAN ISMAIL, HANAFIAH, TENGKU MUHAMMAD ALI. Hilang disekitar Jl. Gatot Subroto.




Yang Butuh Bibit Gaharu dan Bibit yang lain. Seperti: Damar Laut, Meranti, Kayu Kapur dan lain-lain. Hub. Bapak Jamal. Di Limau Manis Tanjung Morawa dan Siap melayani pesanan dalam partai besar. HP. 0813 7091 2113






HOTEL MADINAH : AL-HARAM / DALLAH TAIBAH HOTEL MAKKAH : SARAYA AJYAD / MAKARIM HOTEL JEDDAH : AL AZHAR Penerbangan Via Singapore *Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis DAFTAR SEGERA

Kantor: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4/18 Medan

Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488 Website: Ikuti: THE REAL TRAINING FOR HUMAN CHARACTER BUILDING





IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat


Hub. 4517509 - 0821 6322 4343 (JUAL BELI) Jl. Ayahanda No. 10

11 CM Rp. 165.000 12 CM Rp. 180.000

HA TI-HA TI terhadap penipuan yang HATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab

Bagi yang berminat Hubungi: 0853.7288.8832

Bergaransi/ Setia Luhur 160 F

Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

9 CM Rp. 126.000 10 CM Rp. 140.000

1 (Satu) Set Alat-alat Gilingan Padi Siap pakai: A. Polish Beras 2 unit N.L 25 B. Ayaan beras 90 lubang 1 unit C. Mesin nissan diesel RD 8 D. Kupas kulit 1 unit 10 inchi E. Dan peralatan lainnya


NISSAN READY STOCK Dapatkan Grand Livina DP Murah 30 Jt-an atau Angsuran 3 Jt-an + Kredit s/d 5 tahun. 0813 7524 2240 - 061.77389245 Mulus, orisinil lengkap cantik. W. biru mica. H. Balik DP 35Jt. Udah bayar 23xsisa 13x 1.146.000. Hub. 0853 6010 8884

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

SEPEDA MOTOR KAWASAKI Ninja S Thn. 2010 Dijual. Warna hitam. Kondisi 99%. Sangat terawat dan jarang pakai. Harga 25,5/Nego. Peminat serius Hub. 0811 6603 357

Rp. 91.000 Rp. 104.000


TOYOTA Innova 2006 / 2007 Hitam. Seri G Manual lengkap. Hub. 061.77820001

DAIHATSU Xenia XI 2010 Type Sporty 1300cc (terlengkap). W. Silver met, jok masih bungkus spt baru. BK Medan, blm ada sisip (original) Hub: 0852 6143 1262 TP.

DAIHATSU Espass 1.3 Thn. 1997 Bln 12, Ungu, Rp. 33Jt Nego. Ban Baru, AC, Tape, Hub. 0813 7645 8528, 77135528

7 CM 8 CM

SUZUKI Katana GX Thn. 1994. Hitam, Medan, lengkap. 0852 9618 4745

Jumat, 13 April 2012




Tempat: The Sulthan Darussalam Hotel Sabtu - Minggu: 26 - 27 Mei 2012, Jam 08.00-18.00 WIB Tempat pendaftaran: Sekretariat SCSU................................... (0812.8131.8288) Ir. H. Hasrul Hasan MM........................ (0811.642.616) Ustadz. Drs. H. Anwar AA................... (0812.635.9750) Drg. AKBP. Hj. Ettylamurty.................. (0812.6006.719) Hj. Iru Pratiwi......................................... (0811.605.144) Hj. Hazanenny...................................... (0812.7730.0044) Hj. Rita Dulong...................................... (0812.635.9059) H. Suriono - Mesjid Agung................. (0812.6030.4600) Toko Buku Sembilan Wali.................. (061) 452.7285 The Sultan Darussalam Hotel............ (0812.6374.6867) Madinah Syariah Millenium Plaza....(7779.8910) Ustadz. M. Arifin - Binjai...................... (0813.7008.0117) Ir. Hapson Siregar - Kisaran............... (0821.6867.0060) Dr. H. Charles Srg - Aekkanopan..... (0812.609.5287) H. Ahmad Suaib - Banda Aceh......... (0813.7555.4373)

DIJUAL CEPAT 7 unit Gerobag Dawet/ Cendol, Kondisi bagus, Bisa lgs dipakai, Harga 5,5 Jt/nego, Komisi 500.000. Bagi yg menjualkan Hub. 0852.6225.0761, Cepat Buruan

DICARI Min. Lulusan SMU utk jadi Guru TK dan Siap ditempatkan Jl. Karya Wisata No. 23A Telp. (061) 786.2156


DIBUTUHKAN Yg bisa masak utk Resto/ PEnginapan di Pantai Danau Toba Desa SIlalahi Kab. Dairi Boleh Suami/ Istri pondokan tersedia (Taji bersih) Hub HP. 0821.6844.7333

Hanya 65 Rb, Daftar Jadi Member Gratis: Katalog, Buku panduan, Ukuran baju/ Sepatu, dll Dapatkan Discount & Bonus Yang Banyak Hub: Rina 0853.6000.8740 - 0857.6084.8346 (061) 9132.8942




1. Pemasangan Depot Air Minum Sistem Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0852 6168 0200 - 0812 600 5410


Lowongan kerja, Dibutuhkan wanita tamatan SD, SMP, SMA, Akper, Akbid utk dididik diperkajakan sbb: Baby Sitter, P. Jompo, K. Asuh, Honor 900 Rb s/d 1,6 Jt. Hub: Yayasan Sinar Bunda, Jl. Ngumban Surbakti No. 23 Simp. Pos Pd. Bulan Medan HP. 0821.6064.4428

DICARI SEGERA Lls SLTA/ sdrj Unk dididik & Lsg dislrkan mjd Guru PG/ TK Hub Jl. KH. Wahidin Hasyim 92 Medan Telp: 456.9269


Sebuah Lembaga Pendidikan membutuhkan beberapa orang karyawan untuk bagian STAF ADMINISTRASI Persyaratan: 1. Wanita max 25 tahun 2. Pendidikan min. SMK/ D3 3. Pengalaman min. 1 tahun 4. Mampu menggunakan komputer Lamaran lengkap diantar ke: GRAND EDUCATION CENTRE Jl. Kapten Muslim No. 227B Helvetia Medan Telp. 845.2872




- Paket Full channel andalan 1 bulan - Paket Basic channel andalan 1 bulan Tetap BISA Nonton TANPA isi voucher Hanya dengan membeli receiver High Definition

DIJUAL 2nd, Power Sound Standard CA-18. M7200, M3600, L4.8, L2.8 Sub 18 Vega. BMB 55, 1, 2, 11, J7, Ransa 8W, Yamaha 1000 W. Crown. Terima Visa 0% Jl. Indragiri 25. 061-7345487


Hubungi: PT. DKI (061) 457.1617


LOWONGAN DIBUTUHKAN: Gadis/ Janda Muslim Jaga anak, Gaji 700 Rb/ bln Bersih Hub. 0812.6553.5559


Pengalaman 3 tahun, CV, kirim, Langsung Jl. Karyawisata No. 23A Telp. (061) 786.2156


Wanita (17 - 45 thn) sbg Perawat anak, Gaji 900 Rb/ bln Hub: “Bpk. Ridho” Jl. Ayahanda 73C Medan 0852.7552.3457 - (061) 453.1124



WASPADA Jumat 13 April 2012

06.30 Go Spoy 07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Kabar KAbari 15.30 Tom & Jerry 16.00 Silet 17.00 Seputar Indonesia 17.30 Jodohku 18.00 Mega Sinetron : Yusra Dan Yumna 21.00 Indonesian Idol 2012 22.30 Box Office Movies :


07.00 SCTV FTV Pagi 09:00 Liputan 6 Terkini 09:03 Hot Shot 10:00 SCTV FTV Pagi 11.00 Liputan 6 Terkini 11.03 SCTV FTV 12:00 Liputan 6 Siang 12:30 SCTV FTV 15.00 Uya Emang Kuya 15.30 Film Layar Lebar 16.00 Liputan 6 Terkini 16.03 Jebakan Betmen 17.00 Liputan 6 Petang 17.30 FTV Istimewa 19.30 SCTV Sinetron : Putih Abu Abu 20.00 Liputan 6 Terkini 20.30 Cinta Salsabilla 22.00 SCTV Musk Spesial Musik Spesial Karnaval 00.00 Liputan 6 Malam

07.00 Filler New Oscar’s Oasis 08.00 Cerita Pagi 09.00 Cerita Pagi-1 10.30 Kribo 11.00 Sidik 11.30 Lintas Siang 12.00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15.30 Lintas Petang 16.00 Animasi Spesial 18.00 Animasi Spesial Shaun The Sheep 19.00 Fathiyah 20.00 Tendangan Si Madun 21.00SiMiskin&SIKaya 22.00 Tarung Dangdut 01.00 Premier Preview

07:30 Fenomania 08:00 Friends (Live) 09:00 Fresh & Fun 09:30 Gowes 10:00 Boys Before Flowers 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Tom & Jerry 13:30 Tom & Jerry 14:00 Woody Wood Pecker 14:30 Woody Wood Pecker 15:00 Indonesia Super League 2011-2012 17:30 Topik Petang (Live) 18:00 Pesbukers (Live) 19:00 Siapa Takut 20:00 Petualangan 3 Macan 21:00RealitiSelebritiKel.Sungkar 22:00 Sinema Spesial : Susuk Pocong 0:00 Telisik

07:00 - KISS Pagi 07:30 - FTV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia Dong Yi, Jewel In The Crown 13:30 - Drama Asia Pink Lipstick 15:00 - KISS Sore 16:00 - Fokus 16:30 - Drama Asia Sungkyunkwan ScandalPemanah Rajawali 18:00 - Drama Asia (Mandarin): 19:00 - Sinetron Unggulan 20:00 - Tutur Tinular 22:00 - Buaya Show 23:00 - Mega Asia:

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.00 Headline News 10.05 Eleven Show 11.05 The Spring & Latern Festival 12.05 Metro Siang 13.05 Oasis 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Suara Anda 19.05 Suara Anda 19.30 The Beauty Of Harmony 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 The Destroyed In Seconds


07:30 Ranking 1 08:30 Bioskop Indonesia 10:30 IBU 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Show Imah 14:30 86 15:00 Keluarga Minus 15:30 Sketsa 16:00 Happy Family 16:30 Sepenggal Sejarah 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 The Hits 21:00 Bioskop TransTV 23:00 Kakek-Kakek Narsis 00:00 Bioskop TransTV 02:00 Reportase Malam

06.30 Apa Kabar Indonesia 09:30 Live New Kabar Pasar Pagi 10:00 Coffee Break 11:30 Mutumanikam 12:00 Live News Kabar Siang 13:30 Tokoh 14:30 Keliling Indonesia 15:00 Tahukah Anda 15:30 Imperium 16:30 Sport File 17:00 Live News Kabar Petang 19:30 Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22.00 Live News Kabar Arena 23:00 Radio Show

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:00 Spongebob Squarepants 08:00 Penguin Of Madagascar 08:30 Pat & Stan 09:00 Super Hero Kocak 10:00 Obsesi 11:00 Top Banget 11:30 Hot Spot 12:00 Awas Ada Sule 2 13:00 Sketsa Tawa 13:30 Main Kata 14:30 Tamu Gokil 15:00 Petualangan Panji 15:30 Berita Global 16:00 Top Banget 16:30 Fokus Selebriti 17:00 Tom and Jerry Kids Show 17:30 Spongebob Squarepants 19:00 Sketsa Tawa 19:30 Gara-gara Wendy 20:00 Big Movies

07.30 Selebrita Pagi 08:00 Ups Salah 08:30 Karaoke Keliling 09:00 Pelangi 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-Citaku 14:00 Dunia Binatang 14:30 Koki Cilik 15:00 Kuas Ajaib 15:30 Asal Usul Cari Tahu. 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Petualang 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata **m31/G

Reuni American Pie, Lebih Tua, Lebih Vulgar Tidak disangka, 13 tahun berlalu sejak komedi hit remaja American Pie, mengusung sepak terjang sekelompok remaja sekolah menengah atas melepas keperawanan mereka, menghangatkan industri hiburan laiknya seloyang pai hangat.

The Eagles/

The Eagles Terima Penghargaan Rock and Roll Hall of Fame SELAMA 41 tahun, Berklee College of Music memberikan penghargaan gelar doktor dalam bidang musik bagi tokoh-tokoh berpengaruh dalam industri musik. Tahun 2012 ini penghargaan Rock and Roll Hall of Fame diberikan kepada kelompok musik The Eagles. Para musisi ini menerima penghargaan diumumkan 12 Mei mendatang di Arena Agganis, universitas Boston. Menurut kebiasaannya, pada malam sebelum perayaan, mahasiswa Berklee menggelar konser di Agganis menonjolkan musik yang biasa diusung figur musik berpengaruh bakalan diberi penghargaan, tapi pertunjukan dan pengumuman tidak dibuka untuk umum. The Eagles, akan bergabung dengan group-group elit termasuk Duke Ellington yang menerima penghargaan Berklee pertama tahun 1971, Quincy Jones, penerima penghargaan doktor tahun 1983, David Bowie meraih penghargaan Berklee tahun 1999, Steven Tyler mendapatpenghargaaninitahun2003dan ArethaFranklinmencomot Rock and Roll Hall of Fame tahun 2006 . Sementara di tahun 2012 ini tiga musisi kesohor sekaligus direncanakan menerima gelar ini. Nur/thr



Informasi Pembaca Bursa Property

Jl.STMNo.44/41LokasiStrategis,Uk.panjang27m, Lebar 18m Hub. 0852.7651.1941 RUMAH Dijual Permanen, Bertingkat 2 Jl. Denai Ujung , KT 4, KM 2, RT 2, Luas 11x18m, PAM, PLN, SHM Hub. 0813.9642.3289 RUMAH DIJUAL, 2 Tk, 4 KT, 4 KM, Strategis daerah Gaperta Ujung (sebelah Mesjid) Hub. 0853.6443.2447 RUMAH Dijual dan Isi dalam L. 11mtr, P. 22 mtr, Perabotan, Lemari hias/ pakaian, Dapur/ Bupet, Kursi Jepara, M. Makan dan Lain² Hub. 0853.6010.8884 - 0852.9776.2009 RUMAH Dijual Jl. Puyuh 7 No. 138 Perumnas II Uk. Tanah 14x15: 210m, KM 3, KT 3, RT 1, RM 1, R. Sholat, PLN, Telp, PDAM, Grasi, SHM, Harga 275 Jt/nego 0812.6394.9109 - 734.2900


American Pie/



Ukuran: 4,5x18m² (SK Camat) Lokasi: Pasar 7 Tembung Jl. Sukamaju Gg. Sidomulyo HUBUNGI: HP: 0813.6244.7000 - 0853.6181.8000

Model Apa Saja, Kursi Anda yang rusak, Kami dapat merenovasi menjadi Baru, Melayani kantor, Hotel, Rumah sakit, dll Hub Telp. 734.2493 HP. 0815.7015.2844


G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik


Sekarang kelompok itu kembali -sedikit lebih tua, walaupun tidak berarti lebih bijak- dalam sekuel keempat American Reunion, sekali lagi akan bermain-main dengan komedi vulgar, menampilkan banyak adegan di luar batas. Tanpa mereka sadari, kelompok yang kembali berkumpul untuk reuni SMA itu, terjebak dalam suatu akhir pekan


KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106






Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

Rumah ukuran 9,5x28m, Di Jalan Raya Menteng samping Gg. Benteng lokasi Pinggir jalan No. 01A Medan (Khusus Muslim) Telp. (061) 734.8760


1 unit Rmh Fasilitas lengkap di Perumahan Tanjung Permai IX No. 151 (samping Mesjid) Sukadono Hub. 0813.7066.0656 0812.6497.0066,TP


- Rumah gandeng ± 5x10mtr, Fas. Listrik, Air PAM (SHM), Hanya 61 Jt Di Jl. Seksama Ujung - Laptop Dell Dual Core/ Coreduo: 2,3 Jt - Laptop Acer Core i3, Grasi 7 bln: 3,2 Jt Hub. 0853.7077.7707



Dengan Luas Tanah 800m² (L. 20m, P. 40m) Jl. Selamat No. 105 Hub. 0812.607.3123 (TP) RUMAH DIJUAL

- Luas Tanah ±4100m, Ada bangunan, Listrik, Air, Lokasi 70mtr dr Tugu Timbangan Lubuk Pakam, SHM, Jl. Galang, Hrg net 3,8 Milyar - L. Tnh 7x14, L. Bg. 7x6m², List 900 Watt, Air PAM, 2 KT, 1 KM, Keramik, SHM, Jerjak/ Pingu besi, Genteng, Perum. Pesona Nabila, Hrg net 115 Jt, Kp. Lalang, Ada Hub. 0852.7738.1831



Untuk usaha didaerah Deli Serdang dan Kuala Namo (3000 meter - 6 Ha) Syarat: - Pinggir jalan utama, Sertifikat Pemilik langsung (TP) & Bebas sengketa Hub. 0812.8114.3333

Harian WASPADA Media yang Tepat untuk Iklan Anda



PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188






JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333




33 Tahun pengobatan ini berkiprah kini buka Praktek Menetap di Kota Medan, Bebas pantangan tidak ada efek samping untuk semua RAS dan Agama Khusus Pria: Khusus Wanita: - Tambah Ukuran - Ingin punya keturunan - Panjang 13, 14, 15, 17, 18, 20, 21 cm - Perbesar payudara - Besar 3, 4, 5, 6 cm - Vagina seperti perawan kembali - Tahan lama, mani encer hasil bisa di cek ke dokter - Lemah syahwat, impotensi - Mati Rasa, infeksi rahim, senggugut Konsultasi Umum: Menghadirkan pewaris, ilmu sapu masalah, R. tangga, Jodoh, karir bisnis, pelaris, PIL/ WIL, susuk jual tanah, buka aura Alamat Praktek: JL. SM. RAJA MESJID RAYA MEDAN, MASUK JL. AMALIUN 500 METER NO. 125 KOMAT II Izin Kejaksaan: B.18/DPS.5/01/2008,izin Dinkes: 448/347 HP: 0812.6370.0234




Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.1222

liar gara-gara ulah si raja pesta Stifler (Sean William Scott), tak terke-cuali Jim (Jason Biggs) dan Michelle (Alyson Hannigan) yang telah menikah dan me-miliki seorang anak. Eddie Kaye Thomas (Finch), yang saat ini berusia 33 tahun, dalam wawancara terbarunya menyebut film itu sebagai penghormatan untuk American Pie. “Film pertama membahas suatu periode besar dalam kehidupan setiap orang yaitu ketakutan untuk tidak cukup keren sehingga harus lulus SMA tanpa berhasil melepas status perawan — dan itu paling buruk! Namun dalam film kali ini, yang dibahas adalah fakta bahwa, `sekarang saya berusia 30 tahun dan ternyata tidak seperti yang saya harapkan,” kata Thomas. Berkat kesuksesan American Pie pada 1999 maka saat ini film-film komedi berbondongbondong menampilkan sejum-

lah adegan vulgar, cenderung mengumbar sensualitas dan aksi-aksi di luar batas. Salah satu contoh penerus generasi American Pie adalah waralaba Bridesmaids dan The Hangover. “Komedi kami akan selalu total, kami berdua menyukai komedi jenis ini, dan Hayden Schlossberg bersama dengan Jon Hurwitz menulis skenario untuk American Reunion. Kedua tokoh itu juga sosok dibalik waralaba komedi vulgar Harold & Kumar. Schlossberg mengaku menulis naskah film itu adalah suatu tantangan yang menyenangkan untuk mengetahui lelucon pop terbaru, atau bagaimana menampilkan ketelanjangan yang akan membuat orang tidak nyaman. Kedua penulis naskah menekankan bahwa sebagai bagian dari kisah asli American Pie ditulis Adam Herz, maka tujuan

utama mereka adalah mempertahankan ciri khas komedi dan karakter film 1999 itu. “Yang paling kita cintai dari film aslinya adalah karakterkarakternya,” kata Hurwitz. Semua pemain, antara lain Tara Reid sebagai Vicky, Mena Suvari (Heather), Chris Klein yang memerankan Oz —yang kini adalah pembawa acara olahraga sukses—, Thomas Ian Nicholas (Kevin), Eugene Levy sebagai ayah Jim dan Jennifer Coolidge pemeran ibu Stifler, mengatakan mereka sangat ingin untuk kembali. Klein mengatakan keabadian film waralaba itu terletak pada temanya yang tak lekang dimakan zaman. “Hubungan antar tokoh - siapa yang tahu apa akan terjadi 10 tahun kemudian? Dan kita menertawakan hal itu...kita menemukan diri kita terjebak dalam situasi yang sibuk.”(ant)

Album Madonna Rangking Satu Tangga Lagu Hit Inggris Album gress MDNA Madonna menempati rangking satu tangga lagu hit Inggris. Itu artinya ratu pop berusia 53 tahun ini telah mengambil alih posisi penyanyi kesohor dunia Elvis Presley sebagai artis solo paling banyak debutnya meraih peringkat pertama tangga album top Inggris. Pada album MNDA, Madonna bekerjasama dengan William Orbit dan LMFAO juga menyertakan singel lawas Gilrs Gone Wild. MNDA adalah album kedua dengan penjualan paling laris di minggu pertama perilisannya. Di peta singel top Inggris, penyanyi Chris Brown mencapai posisi pertama dengan track Turn Up The Music. Tembang hit sebelumnya adalah Run it! mencomot posisi nomor dua pada tahun 2006. Track itu menimbulkan kontroversi setelah remix yang menonjolkan mantan kekasih Chris yaitu Rihanna sebelum pasangan ini berpisah. Debut Sean Paul bertajuk She Doesn’t Mind menduduki rangking kedua, Nicky Minaj naik di peringkat ketiga dengan album Starship. Rilisan Katty Perry berjudul Part Of Me dan singel mantan anggota group musik Gotye Somebody I Used To Know pada minggu-minggu sebelumnya mendapatkan posisi terhormat, kini menduduki tempat kelima. Nur/


Sorcerer And The White Snake, Memburu Siluman Ular Putih Celestial Movies mempersembahkan kisah cinta si siluman ular putih dalam film unggulan Sorcerer and theWhite Snake, Sabtu, (14/4) pukul 09:00. Sorcerer and the White Snake adalah sebuah film adap-tasi, legenda klasik China ten-tang siluman ular putih berusia 1000 tahun bernama Susu (Eva Huang, Kung Fu Hustle). Suatu ketika ia menemukan cinta sejatinya pada diri seorang herbalis muda yang lugu, Xu Xian Yi (Raymond Lam, Master of Tai Chi). Karena begitu besar cintanya pada Xu, ia tidak menggubris nasihat saudaranya, si ular hijau Qingqing (Charlene Choi, Triple Tap), bahwa tindakannya itu berbahaya buat dirinya juga Xu. Susu pun rela diperistri Xu dan hidup menjadi manusia. Adalah Biksu Fa Hai (Jet Li, Fist of Legend) dan Neng Ren (Wen Zhang, Ocean Haven), sebagai demon hunter atau pemburu siluman handal kemudian hadir untuk memisahkan cinta terlarang antara manusia dan siluman ular itu untuk selamanya. Dengan kekuatan yang tangguh dari para siluman, mampukah Fahai menangkap Susu dan mengurungnya dalam pagoda Lei Feng? Film fantasi yang penuh dengan spesial efek Computer Generated Imaging (CGI) spektakuler ini digarap sutradara, koreografer laga, produser terkenal Tony Siu-tung Ching

(An Empress and the Warriors) yang sudah malang melintang di perfilman Hong Kong, China hingga Bollywood. Peraih Hong Kong Film Awards kategori Best Action Choreography dalam Hero ini mengaku bahwa ide awal pembuatan film ini adalah untuk menyatukan tradisi China yaitu beladiri dan teknologi barat. Didukung teknik spesial efek yang fantastis serta deretan pemain handal, Sorcerer and the White Snake mampu memberi tontonan yang menghibur. Bahkan film ini mendapat kehormatan untuk tampil dalam Venice Film Festival. Film dirilis

akhir September 2011 ini berhasil menduduki peringkat pertama dalam daftar box office internasional mengalahkan The Smurfs dan Abduction, serta mengantongi keuntungan 15,9 juta dollar di seluruh dunia kecuali untuk wilayah Amerika Utara. Jet Li mengaku cukup kelelahan selama proses syuting berlangsung. “Saya bertarung dengan ular putih, setelah itu dengan ular hijau, lalu dengan siluman lain dan seterusnya. Bener-bener melelahkan karena sangat menguras energi. Setiap adegan selesai, saya langsung lega,” ungkapnya.

Sementara Eva bangga terlibat dalam film ini. “This is the best action movie i’ve ever had. Penuh aksi melelahkan. Saya harus terbang, harus berkelahi dengan Jet Li. Karakter saya juga menggunakan pedang putih untuk menunjukkan karakter perempuan lebih kuat dibanding versi sebelumnya,” ungkap pemeran gadis bisu penjual es dalam Kung Fu Hustle ini. Paras ayu dan dedikasinya yang luar biasa dalam membawakan karakternya memberikan warna tersendiri ditengah gempuran momen aksi yang intens .(m19)

B8 Ekonomi & Bisnis Pemerintah Kaji Larangan Mobil 1500 CC Pakai Premium JAKARTA (Waspada): Pemerintah tengah mengkaji pembatasan subsidi energi melalui larangan mengkonsumsi premium bagi kendaraan pribadi. Premium merupakan bensin beroktan 88 yang sampai saat ini masih disubsidi pemerintah. Langkah ini mencuat setelah pemerintah batal menaikkan harga bahan bakar minyak bersubsidi, karena terganjal dengan demonstrasi besarbesaran dan membuat Dewan Perwakilan Rakyat tak menyetujui langkah pemerintah 1 April lalu. “Ini salah satu opsi yang kami kaji untuk menekan subsidi bahan bakar,” kata Direktur Jenderal Minyak dan Gas Kementerian Energi Evita

Herawati Legowo dalam pesan singkat, Kamis (12/4). Mengenai batasan mobil, Evita enggan mengatakan berapa kapasitas mesin yang bakal dilarang menggunakan Premium. Apakah di atas 1.500 cc atau 1.300 cc. “Semua masih dikaji,” katanya. Namun, sebelumnya Wakil Menteri Energi dan Sumber Daya Mineral Widjajono Partowidagdo mengungkapkan perlunya membatasi premium hanya untuk mobil tak lebih dari 1.500 cc. Wajar saja, mobil pribadi merupakan peminum BBM bersubsidi terbesar, men-

capai 53 persen dari total kuota yang diberikan pemerintah. Bila jadi, mobil-mobil terlaris di Indonesia, AvanzaXenia, masih bisa minum bensin jatah orang miskin. Toyota Avanza memiliki kapasitas mesin 1.300-1.500 cc, dan Daihatsu Xenia 1.000-1.300 cc. Mobil lain di bawah 1.500 cc adalah Suzuki Splash, Kia Picanto, Nissan March, dan masih banyak lagi mobil-mobil laris lain. Sebelumnya langkah pemerintah mengurangi subsidi dengan menaikkan harga bahan bakar, kandas di parlemen. Ini setelah banyaknya demonstrasi menolak kenaikan dan memicu dewan mengganjal program dengan mempertahankan pasal 7 ayat 6 yang melarang pemerintah menaikkan harga bahan bakar.

Namun, pemerintah diberi kebebasan dengan pasal tambahan yang membolehkan pemerintah menaikkan harga BBM bila rata-rata harga minyak mentah Indonesia (ICP) dalam 6 bulan telah melampaui 15 persen dari target APBN sebesar 105 dolar AS per barel. Pemerintah pun kalang kabut. Mereka harus menekan dari segala lini agar anggaran subsidi bahan bakar tak lebih dari Rp137 triliun, seperti dalam APBN Perubahan 2012. Jauh di bawah hitungan pemerintah yang bila harga Premium tetap dipertahankan Rp4.500 per liter, subsidi BBM tanpa ampun akan membengkak menjadi Rp178 triliun. “Sudah segede kaki gajah yang bengkak,” demikian Menteri Negara BUMN Dahlan Iskan menggambarkan. (vvn)

BI Tahan Suku Bunga 5,75 Persen JAKARTA (Waspada): Bank Indonesia kembali mempertahankan suku bunga acuan (BI rate) di level 5,75 persen karena laju inflasi masih konsisten dan dari sisi fundamental. “Kebijakan ini karena dinilai masih konsisten dari sisi tekanan inflasi dan fundamental yang juga masih terkendali,” kata Gubernur BI, Darmin Nasution tentang hasil Rapat Dewan Gubernur BI, Kamis (12/4). Namun, pihaknya akan BI melihat dari sisi risiko ke depan pada tekanan inflasi apakah meningkat, terutama kemungkinan kebijakan bahan bakar minyak (BBM) bersubsidi dari pemerintah. “Bila diperlukan kami mengambil kebijakan mengantisipasi dampak inflasi tersebut,” jelasnya. BI akan melakukan penguatan operasi moneter dan makro sesuai ekonomi ke depan. Diharapakan langkah tersebut akan meredam gejolak moneter, bila pemerintah mewujudkan pembatasan BBB bersubsidi, kata dia. Sementara untuk pertumbuhan, Darmin memperkirakan masih akan relatif tinggi di

tengah risiko perlambatan ekonomi dunia dan kemungkinan kenaikan harga BBM subsidi yang ditempuh pemerintah. Pada triwulan II 2012 pertumbuhan ekonomi diperkirakan mencapai 6,4 persen, sedikit lebih rendah dibandingkan dengan prakiraan pertumbuhan untuk triwulan I 2012 sebesar 6,5 persen. Namun perkiraan pertumbuhan masih dapat mencapai 6,3-6,7 persen pada 2012 dan meningkat menjadi sekitar 6,46,8 persen pada 2013. “Pertumbuhan ekonomi yang tinggi, di tengah perlambatan ekonomi global tersebut, terutama ditopang kuatnya permintaan domestik dengan konsumsi yang masih kuat dan peran investasi yang semakin meningkat,” jelas Darmin. Penimbangan risiko (balance of risks) untuk 2012 menunjukkan pertumbuhan cenderung bias ke bawah baik karena dampak perlambatan perekonomian global maupun kemungkinan adanya kebijakan terkait BBM oleh pemerintah, apabila tidak ditempuh langkah-langkah stimulus khusus-

nya dari kebijakan fiskal. Secara sektoral, seluruh sektor ekonomi masih tumbuh cukup tinggi, dengan pertumbuhan tertinggi pada sektor transportasi dan komunikasi, sektor perdagangan, hotel dan restoran; dan sektor bangunan. Cadangan Sedangkan cadangan devisa sampai akhir Maret 2012 mencapai 110,5 miliar dolar AS atau setara dengan 6,1 bulan impor dan pembayaran utang luar negeri pemerintah. “Kinerja Neraca Pembayaran Indonesia (NPI) pada tahun 2012 diprakirakan akan mencatat surplus yang lebih kecil dibandingkan tahun sebelumnya,” ungkap Darmin. Penurunan surplus neraca pembayaran, lanjutnya, terutama disebabkan oleh defisit transaksi berjalan yang lebih besar. Dikarenakan melambatnya ekspor sejalan dengan perlambatan permintaan dunia di tengah impor yang terus mengalami peningkatan. “Hal ini seiring kuatnya permintaan domestik dan tingginya konsumsi BBM. Tapi dari sisi lain, transaksi modal

WASPADA Jumat 13 April 2012

dan keuangan diprakirakan masih mengalami surplus yang cukup besar ditopang oleh aliran investasi langsung dan portofolio,” tutur Darmin. (j03)


Waspada/Hamdani Sejumlah pekerja memikul beberapa goni gula Kristal di salah satu tokoh Jalan Sukaramai Medan, Kamis (12/4). Seluruh petani tebu menolak dengan rencana pemerintah yang akan mengimpor gula mentah sebanyak 240.000 ton ke Indonesia, karena disamping harganya lebih murah produksi gula lokal juga akan tersingkir dan dapat merugikan petani. Harga jual gula impor dipasar mencapai Rp 8.000 hingga Rp 11.000 perkilogram sementara gula lokal Rp 11.000 hingga Rp.12.500 perkilogramnya.

Pasca Gempa, Distribusi BBM Normal BANDA ACEH (Waspada) : Gempa yang mengguncang Sumatera Rabu (11/4) siang tidak berdampak pada distribusi bahan bakar minyak ke SPBU yang ada di Aceh. Menurut Sonny Mirath, Assistant Customer Relation FRM 1 Sumbagut penyaluran berlangsung seperti biasa. “Situasi antrian sudah berkurang, dan penjualan BBM di SPBU hari ini berlangsung dengan normal,” kata Sonny kepada Waspada Kamis (12/4) siang. Sonny juga menyebut tidak terdapat gangguan di lima terminal BBM Pertamina di Aceh, seperti di Meulaboh, Kabupaten Aceh Barat, dan Terminal Pertamina di Krueng Raya, Aceh Besar. “Infrastruktur SPBU dan jalan menuju SPBU di Aceh cukup bagus sehingga distribusi dapat berjalan dengan lancar.” Sebutnya. Meski terjadi banyak antrian di berbagai SPBU di Banda Aceh dan Aceh Besar namun Sonny menyebut stok BBM masih cukup banyak sehingga warga di Banda Aceh tidak perlu panik dan khawatir BBM habis. Saat ini stok BMM jenis premium sekitar 11.000 kiloliter (kl), dan solar sekitar 14.000 kl. Jumlah itu menurut Sonny cukup untuk memenuhi kebutuhan masyarakat Aceh sekitar selama 7-9 hari mendatang. Sementara itu setengah jam pasca gempa atau sekitar pk.16.00 Rabu (11/4) hingga pk.22.00 SPBU yang ada di Lheungbata, Batoh dan Lampeunerut Banda Aceh disesaki kendaraan yang membutuhkan minyak. Meski beberapa saat operasional SPBU beberapa kali sempat terhenti karena listrik padam.(b08)

Harga Sayuran Di Banda Aceh Stabil BANDA ACEH (Waspada) : Harga sayur-sayuran di pasarpasar tradisional di seputaran Kota Banda Aceh dan Aceh Besar, stabil dua pekan terakhir. Termasuk saat isu harga BBM akan naik 1 April lalu, harga sayuran tetap stabil. Pantauan Waspada dan keterangan pedagang, Kamis (12/4), harga yang terjadi hingga kemarin sudah bertahan sebulan lebih, seperti bawang merah Rp15.000 per kg, bawang putih Rp11.000, tomat Rp7.000, kentang Rp5.000, cabai merah Rp20.000, cabai kering Rp28.000, wortel Rp5.000, cabai rawit Rp26.000, kol Rp4.000, dan bunga kol bersih Rp10.000 per kg. Namun sebaliknya, harga cabai hijau malah turun dari Rp25.000 menjadi Rp15.000 per kg beberapa pekan terakhir.

Ayam potong Sementara beberapa usaha ayam potong di kawasan Aceh Besar, sekarang terancam gulung tikar. Pasalnya, modal usaha kian menipis. “Padahal, usaha yang dirintis sejak 2007 sempat berkembang. Sehingga di antara mereka sempat memperluas areal tempat usahanya,”

kata Marwan, pengusaha ayam pedaging. Namun, sayangnya dalam beberapa bulan terakhir, kondisinya megap-megap. Bila usaha mereka tidak ada yang membantu, maka yang dikhawatirkan akan menjadi kenyataan. “Memasuki 2011 usaha kami mulai mengalami kendala, diantaranya masalah pakan yang harus didatangkan dari Medan, karena tidak diproduksi di daerah sehingga membutuhkan biaya agak lumayan besar,” ungkap Marwan. Selain itu, sambungnya, harga jual ayam sering kurang sesuai atau tidak sesuai dengan modal yang dikeluarkan. “Kami berharap usaha kami yang sedang morat-marit ini ada kepedulian dari pemerintah daerah,” pintanya. (b09)

sudah miliki 5 agen rekrutmen dan terus berkembang hingga beberapa timwork terbentuk,” jelas Agent Director AXA Financial Medan ini. Baginya, membentuk tim asuransi lebih menguntungkan dari pada menjual produk asuransi sendirian. Kini Ruby telah menikmati hasilnya dengan beberapa kali meraih penghargaan serta menjelajah negara Asia dan Eropa. “Kalau saya tidak di AXA, mana mungkin saya bisa jalanjalan ke berbagai daerah di Indonesia atau ke luar negeri. Meskipun saya bepergian tapi ingkam tetap mengalir, bahkan lebih besar dari penghsilan saat di toko elektronik,” ungkapnya. Kedepan, Ruby berkeinginan memiliki kantor sendiri di Medan sebagai upaya pengembangan usaha, seiring peta perkembangan pangsa pasar asuransi di Sumatera Utara. “Karena bisnis ini akan terus berkembang seiring bertambahnya jumlah penduduk. Dan saya merasa sudah sehati dan sejiwa dengan bisnis asuransi ini,” tambahnya. Sementara Yovita Hamdani mengatakan profesi agen asuransi bisa memahami kondisi yang diperlukan nasabah. “ Tanggungjawab kita mengelola uang nasabah dan kita harus bantu jika sewaktuwaktu nasabah itu membutuhkan layanan keuangannya, meskipun tanpa diminta,” kata peraih Top Producer dari Best

Team No.1 PT AXA Financial Indonesia versi Asosiasi Asuransi Jiwa Indonesia. Bergabung di industri asuransi, semula Yovita ingin kebebasan waktu bekerja dan kebebasan mengatur uang sendiri. “Jadi agen asuransi itu kita bisa mengatur waktu untuk bekerja, meskipun tetap harus punya tanggungjawab,” jelas lulusan Maastricht School of Management Netherland. Dari komitmen bekerja di asuransi ini, lanjut Yovita, tentu ada kesempatan untuk jalanjalan ke berbagai tempat atau ke luar negeri. “Tapi untuk meraih kesempatan tersebut, kita harus komit dulu dengan pekerjaan ini. Dari jerih payah kita ini, barulah perusahaan memberi kesempatan untuk belajar ke luar negeri,” ungkap ibu dua anak ini. Ba g i Yov i t a , a s u ra n s i memberi kepastian. Memang ini menjadi slogan utama dalam menjual produk investasi dan jaminan risiko yang tak terduga bagi manusia. Tidak hanya manusia yang dijamin, tapi juga benda tak bernyawa. Dari benda sangat berharga seperti perhiasan sampai ke benda berharga namun tak lazim. Benda-benda menjadi berharga tinggi ketika diasuransikan. Sedangkan manusia yang terasuransi akan berdampak positif bagi keluarga serta kerabat, ketika mendapatkan musibah sakit atau meninggal dunia. (j03)

“Untuk pasokan kebutuhan pasar, kami menerima kiriman dari Berastagi, Sumut dan Takengen, Aceh Tengah serta Bener Meriah. Khusus harga wortel lebih murah seribu dari Takengen ketimbang Berastagi, tapi kualitas bagus dari Berastagi. Buktinya sayuran Berastagi bisa tahan hingga empat hari disimpan,” ungkap Syukri di Pasar Kartini Peunayong, Kamis (12/4).

“Panggilan Jiwa, Seorang Bankir Jadi Agen Asuransi”

Waspada/Armin Nasution

CEO BNI Kanwil Medan Ahmad Sentosa Miad (dua dari kiri) dan Dirut PD Pasar Kota Medan Benny Sihotang (tiga dari kiri) menyaksikan penandatanganan akad kredit BNI Wirausaha (BWU) yang dilakukan debitur Maruli Panggabean di Medan, Kamis (12/4). Bank tersebut menargetkan penyaluran kredit sebesar Rp407 miliar pada tahun ini untuk wilayah Medan.

Kredit BNI Wirausaha Ditargetkan Rp407 M MEDAN (Waspada): Bank Negara Indonesia Kantor Wilayah (BNI Kanwil) Medan menargetkan penyaluran kredit BNI Wirausaha (BWU) Rp407 miliar tahun ini, meningkat dibandingkan realisasi 2011 sebesar Rp311 miliar. CEO BNI Kanwil Medan Ahmad Sentosa Miad mengatakan target tersebut meningkat Rp96 miliar dibandingkan 2011. Sedangkan secara nasional, bank BUMN menargetkan dapat menyalurkan kredit BWU sebesar Rp5 triliun. “Kenaikan secara nasional mencapai Rp3 triliun dari posisi 2011 yang masih Rp2 triliun. Ini dikhususkan untuk segmen usaha kecil dan menengah (UKM) dengan plafon antara Rp50 juta sampai Rp1 miliar dengan jangka waktu pengembalian lima tahun,” jelasnya saat relaunching BNI Wirausaha di Pasar Petisah, Kamis (12/4). Kegiatan ini berlangsung hingga 14 April 2012. Ahmad Sentosa Miad

mengatakan BWU merupakan jenis kredit produktif baik dalam bentuk kredit investasi (KI) maupun kredit modal kerja (KMK). Melalui BWU, pihaknya berharap dapat membantu pelaku UKM, termasuk pedagang, meningkatkan produktivitas dan usahanya. Dirut PD Pasar Kota Medan Benny H Sihotang menegaskan kalangan perbankan diajak berpartisipasi membantu meningkatkan usaha pedagang UKM, termasuk pengusaha informal. “Kami senang bekerjasama dengan perbankan, termasuk BNI. Namun kami meminta kerjasama tersebut berjalan transparan dan jujur, sehingga saling menguntungkan. Saya juga mengajak pedagang di Pasar Petisah dapat menjalin kerjasama dengan BNI,” jelasnya. Benny mengatakan, kalangan perbankan juga diharapkan dapat memperhatikan keberadaan pedagang informal.

Seperti di Pasar Petisah, dimana cukup banyak pedagang informal yang berjualan di luar gedung pasar tersebut. Benny yang baru dilantik menjadi Dirut PD Pasar Medan Januari 2012 mengatakan, pihaknya akan memperbaiki kondisi lantai dua Pasar Petisah, agar dapat ditempati pedagang informal itu. Selama enam bulan pertama, para pedagang ini akan dibebaskan dari biaya. “Namun untuk memperbaiki lantai dua ini, kami memerlukan kerjasama dengan perbankan. Saya berharap BNI dapat membantu merealisasikan kerjasamanya,” ujar dia. Menanggapi permintaan itu, Ahmad Sentosa Miad menyatakan siap membantu merealisasikan rencana pengaktifan lantai dua bagi pedagang informal ini. “Sejalan dengan program good corporate governance atau GCG, kami juga siap bekerjasama dengan transparan dan saling menguntungkan,” ungkapnya.(m06)

KARENA panggilan jiwa, seorang bankir yang telah bekerja 12 tahun rela melepas profesinya dan beralih menjadi agen asuransi. Dia rela melepas tunjangan bulanan dan fasiltas lainnya dari bank swasta nasional demi mengajak masyarakat mempersiapkan diri untuk perlindungan kemudian hari. Adalah Afif Masduki yang telah bekerja sekitar 12 tahun di bank swasta nasional kini beralih profesi menjadi agen asuransi.“Ya, saya sudah bekerja di tiga bank swasta. Tapi kemudian saya tinggalkan, beralih jadi agen asuransi di tahun 2005,” katanya saat bincang-bincang dengan Waspada, kemarin. Latar belakang mengundurkan diri dari seorang bankir menjadi sales asuransi, menurut Afif, karena ingin membantu orang lain yang tertimpa musibah, sekaligus merencanakan dana orang lain untuk persiapan hari tua. “Karena bagi saya membantu orang lain adalah amal dan perbuatan terpuji, karena tugas kita merencanakan dana seseorang untuk persiapan hari tua atau untuk perlindungan kesehatan,” ujar peraih Champion Club Level Ambassador ini. Berdasarkan survei Bank Dunia, dari jumlah penduduk Indonesia yang mencapai 230 juta jiwa, ternyata untuk keperluan medis (kesehatan) 70 persen penduduk Indonesia menanggung biaya sendiri (tidak dilindungi asuransi kesehatan-red), meskipun biaya kesehatan meningkat 20 persen

setiap tahunnya. Dari data tersebut, menggambarkan banyak orang Indonesia yang tidak terlindungi (terproteksi) oleh asuransi dalam hal kesehatan, pendidikan atau kematian. Padahal, biaya kebutuhan setiap tahunnya selalu meningkat. “Bayangkan, kalau ada seorang ayah tiba-tiba terkena musibah atau kecelakaan di jalan, sementara dia tidak diproteksi asuransi. Padahal ayah ini tulangpunggung keluarga dengan anak yang masih kecil dan istri hanya ibu rumah tangga,” jelas Afif mengilustrasikan kejadian. Afif yang pernah mengenyam pendidikan di Madrasah Tsanawiyah Negeri dan Madrasah Ibtidaiyah Banyuwangi, Jawa Timur, menegaskan, seseorang sedini mungkin harus mempersiapkan diri sebelum musibah itu datang. “Inilah tugas agen asuransi menjelaskan apa yang diperlukan kemudian hari. Bagi saya ini tugas mulia, membantu dan merencanakan finansial orang lain untuk persiapan di hari kemudian,” katanya. Namun Afif mengingatkan, bagi pemula agen asuransi untuk tetap bertanggungjawab terhadap nasabah yang ditanganinya. Terutama bila nasabah tersebut mengalami musibah atau sekadar menanyakan kondisi keuangannya. “Karena apa yang kita peroleh dan kita nikmati sebagai agen asuransi, hal itu tidak terlepas dari kepercayaan nasabah yang menempatkan uangnya untuk kita kelola,” tekan Afif. Dia sangat berterimahkasih kepada AXA Financial Insurance yang telah memberikan kesempatan berkarier di dunia asuransi, hingga menduduki posisi sebagai Agency Director Team Topaz dan meraih beberapa penghargaan lainnya.

Semua ini bisa dia raih berkat pendidikan (training) yang diperolehnya selama bergabung di AXA dan tentunya karena panggilan jiwa. “Dari pengalaman jadi agen asuransi ini, saya bersyukur sudah bisa berang-katkan orang tua dan mertua saya naik haji. Selain itu, saya juga berkesempatan keliling dunia. Ada yang sekadar vacancy atau memang untuk belajar di cabang-cabang AXA insurance di sejumlah negara,” tuturnya. Sementara kejenuhan terhadap suatu pekerjaan sering menimbulkan kebosanan. Perasaan seperti itu yang dirasakan Ruby (foto), mantan pengusaha toko elektronik yang beralih menjadi seorang agen asuransi. “Setiap hari hampir tidak ada waktu bersantai saat saya masih menggeluti bisnis elektronik. Sampai di rumah pun saya masih harus melayani permintaan pelanggan atau memikirkan pesanan pelanggan,” ujarnya. Suatu saat, Ruby melihat aktivitas familinya yang lebih dulu menjadi agen asuransi AXA Financial. “Saya lihat profesi famili saya ini banyak ruang santai, bandingkan saya yang setiap hari harus berada di toko melayani pelanggan. Bahkan saat dia jalan-jalan ke luar negeri pun, masih ada ingkam yang terus masuk. Pokoknya, pemasukannya terus bertambah,” terangnya. Dari aktivitas familinya, di 2005 Ruby mencoba peruntungan di AXA Financial dan mengikuti beberapa bulan training. Kemudian ilmu yang didapat, mulai dia terapkan ke salah satu pelanggan tokonya, sekaligus menjadi agen. “Setelah saya ikuti beberapa training gratis di AXA ini sambil jual produksi asuransi, ternyata dalam waktu enam bulan saya


WASPADA Jumat 13 April 2012

Dituduh Memilih Independen, Timses PA Aniaya Dua Pemuda

Khawatir Tsunami

Ribuan Jiwa Warga Pesisir Mengungsi

LHOKSEUMAWE (Waspada) : Karena menyangka orang lain memilih calon independen, anggota timses Partai Aceh di Desa Babah Lung, Kec. Makmur, Aceh Utara menganiaya dua pemuda. Korban penganiayaan, Zakaria Nurdin, 27, dan Ridwan, 31, asal Desa Babah Lung, Selasa (10/4) didampingi keluarga mengadukan kasus penganiayaan ke Mapolres Lhokseumawe. Kasat Reskrim AKP Galih Indra Giri membenarkan pihaknya telah menerima pengaduan resmi dua warga yang menjadi korban penganiayaan di Desa Babah Lung. Pasca kejadian itu,Yusra yang tidak terima suaminya dianiaya timses PA langsung membuat laporan ke Polsek Makmur. Kemudian kedua korban diminta untuk langsung melaporkan kasus tersebut ke Polres Lhokseumawe. (b16)

Sarjani-M.Iriawan Menang Telak SIGLI (Waspada) : Hasil terakhir rekapitulasi perolehan suara pemilihan Bupati dan Wakil Bupati Pidie yang dilakukan Posko Tim Koordinasi Pemkab Pidie, Rabu (11/4) menempatkan posisi pasangan Sarjani Abdullah-M.Iriawan menang telak. Pasangan Sajani Abdullah-M. Iriawan unggul dengan jumlah suara 129.478 atau 60 persen. Pasangan Salman Ishak – Saifuddin Harun mengantongi suara 26.595 atau 12 persen. Pasangan Ghazali Abbas Adan- Zulkifli HM Juned mengantongi suara sebanyak 21.368 atau 10 persen. Selanjutnya pasangan T Khairul Basyar-Muhammad. MTA memperoleh suara sebanyak 13.202 atau enam persen. Pasangan DR Gunawan Adnan-Adami sebanyak 8.077 suara atau empat persen, lalu pasangan Saiful Anwar-Sofyan Alibasyah mengantongi suara sebanyak 7.627 atau empat persen. Pasangan Tgk H Yusri Ahcmad-Helmi 6.775 suara atau tiga persen dan terakhir pasangan Masri-Zainal mengantongi suara sebanyak 1.399 atau satu persen. “Ini data perolehan suara paling terakhir dari 23 kecamatan” kata Ketua Posko Koordinasi Pilkada 2012 Pemkab Pidie, Rabu (11/4). Sementara Cagub/Cawagub Aceh dr Zaini Abdullah-Muzakir Manaf juga dilaporkan menang telah dari empat rivalnya dengan t orehan angka yang dikumpulkan 157.497 suara atau 75 persen. (b10)

Cabup/Cawabup Bireuen Ikuti Uji Baca Alquran BIREUEN (Waspada) : Ketua KIP Bireuen Alibasayah SP membuka uji mampu membaca Alquran bagi Cabup/Cawabup Bireuen 2012 di Masjid Agung Bireuen, Rabu (11/4). Uji mampu baca Alquran sebagai salah satu syarat ikut mencalonkan diri. Ketua Panitia Nurdin dalam laporannya menyampaikan, sebagai tim penguji diketuai Ketua MPU Bireuen Tgk H Hanafiah BA bersama LPTQ setempat. Pengamatan Waspada, kesepuluh pasangan Cabup/Cawabup Bireuen saat mengikuti uji mampu baca Alquran berjalan lancar. (b12)

Pilkada Aceh Penuh Pelanggaran SIGLI (Waspada) : Proses Pilkada Aceh belum berjalan sesuai prinsip-prinsip demokrasi. Pelaksanaannya penuh kecurangan, intimidasi dan kekerasan. Partai politik selaku pihak yang bertanggungjawab dinilai penting memberikan pendidikan politik kepada masyarakat dan tidak hanya mendatangi konstituennya saat pemilu berlangsung. Demikian poin penting yang terungkap dalam acara Konsultasi Pasca Rekapitulasi Hasil Pilkada 2012 yang diselenggarakan PB HAM Pidie, Rabu, (11/4). Direktur PB HAM Pidie, Heri Saputra mengatakan, pilkada merupakan momen dari oleh dan untuk rakyat untuk memilih pemimpin di mana rentan dengan gesekan kepentingan. Kecurangan pilkada di antarannya, kata dia, adanya saksi dari calon pasangan tertentu yang ditolak Panitia Pemungutan Suara (PPS). Pemilih yang mencoblos hingga berulangkali dan kotak suara yang tidak disegel saat dibawa dari TPS ke PPK. (cb06)

Pilkada Sabang Putaran Kedua Bulan Juni SABANG (Waspada) : Hasil perolehan suara sementara melalui penghitungan cepat Quick Count telah kelihatan tidak ada satu pasangan calon Wali Kota dan Wakil Walikota Sabang yang meraih suara 30 persen. Untuk menentukan secara pasti hasil perolehan suara sesuai dengan tahapan pelaksanaan Pilkada Aceh, maka KIP Sabang akan menunggu rekapitulasi hasil pemungutan suara di Panitia Pemilihan Kecamatan (PPK). Ketua KIP Sabang, Seniwati mengatakan, Rabu (11/4), rekapitulasi hasil penghitungan suara dari PPK akan direkap kembali di kantor KIP Sabang pada Sabtu (14/4). Jika nanti terbutki tidak ada satu pasangan calon yang mencapai perolehan suara sebanyak 30 persen, maka dipastikan pilkada untuk memilih calonWali Kota danWakilWali Kota Sabang akan dilaksanakan putaran kedua dan diperkiran dalam bulan Juni akan datang. (b31)

Pasangan Husaini –Islamuddin Minta Pilkada Diulang SABANG (Waspsda) : Tim Sukses Pemenangan Calon Wali Kota dan Wakil Wali Kota Sabang Husaini-Islamuddin minta KIP Sabang supaya melakukan Pilkada ulang karena salah satu TPS di Gampong Cot Ba’u, Kec. Sukajaya Sabang dinilai curang. Dalam surat itu disebutkan, sehubungan dengan ditemukan kesalahan dalam menggunakan kertas suara calon walikota dan wakil walikota Sabang, di TPSV, Gampong Cot Ba’u, Kecamatan Sukajaya Kota Sabang yang digunakan secara double (ganda) oleh pemilih. Ketua KIP Sabang, Seniwati mengatakan, dia telah menerima surat keberatan dari tim sukses calon Wali Kota Sabang dan calon Wakil Wali Kota Sabang Husaini dan Islamudidin. (b31)

Kemenangan Zikir Di Bireuen Kemenangan Untuk Rakyat BIREUEN (Waspada): Sekretaris Partai Aceh Bireuen mengatakan, kemenangan pasangan Zikir (Zaini-Muzakir) dalam Pilkada Aceh merupakan kemenangan rakyat Bireuen dan Aceh pada umumnya. Karena keduanya adalah putra Aceh yang telah dipercayakan rakyat untuk jadi pemimpim gubernur-wakilnya untuk priode mendatang. “Jadi kemenangan pasangan Zikir bukan kemenangan PA, KPA saja, melainkan kemenangan semua elemen atau kelompok masyarakat Aceh,” kata Muzakir, Rabu (11/4). Kepada masyarakat Muzakir, berterimakasih atas dukungan yang diberikan dan mengajak semua komponen masyarakat untuk merapat barisan untuk membangun Bireuen dan Aceh umumnya ke depan. (cb02)

4.108 Warga Simpangulim Golput SIMPANGULIM (Waspada): 4.108 Atau sekitar 30 persen dari total 13.707 calon pemilih di Kec. Simpang Ulim, Aceh Timur, golput alias tidak menggunakan hak pilihnya pada Pilkada Aceh, 9 April. Ketua Panitia Pemilihan Kecamatan (PPK) Simpang Ulim, Iskandar Basyah, menyebutkan, banyak penyebab warga tidak hadir ke TPS. Antara lain, tidak ada di tempat pada hari pencoblosan, sakit dan sebagian lagi memang tidak berminat menggunakan hak pilih. Iskandar juga menyebutkan, hasil rapat pleno Selasa (10/ 4) sore, kandidat Bupati Aceh Timur dari Partai Aceh Hasballah yang punya nama panggilan sama seperti petinju dalam film Amerika— Rocky, menang di Kec. Simpang Ulim. (b19)


Waspada/Jaka Rasyid

KARYAWAN Sinar Mas Grup di kawasan Peunayong Banda Aceh terlihat panik sebagian menangis saat gempa 8.5 SR menguncang Aceh Rabu (11/4) siang.

Gempa 11 April Beda Dengan 26 Desember 2004 BANDA ACEH (Waspada): Gempa bumi 8,5 SR yang melanda daratan Aceh dan kawasan pulau Sumatera, 11 April 2011, posisinya bukan pada pertemuan lempeng (bidang kontak) antara lempeng Indo-Australia dan lempeng Eurasia. Tapi terjadi di luar bidang kontak (outer rise), tepatnya di bagian lempeng IndoAustralia. “Berbeda dengan gempa 26 Desember 2004 lalu, terjadi pada bidang kontak kedua lempeng itu atau dikenal dengan zona subduksi memiliki mekanisme sesar naik,” sebut Zulfakriza Zulhan (foto), staf Badan Penanggulangan Bencana Aceh (BPBA) yang sedang tugas belajar S-3 di ITB Bandung, menjawab Waspada, Kamis (12/4). Dikatakan, zona subduksi yang memiliki mekanisme thursting (sesar naik) dapat memicu tsunami besar, jika kekukatan gempanya besar seperti yang terjadi di Aceh tahun 2004 dan Jepang tahun 2011 lalu. “Berbeda dengan gempa yang terjadi kemarin di Aceh, mekanismenya Strike Slip (sesar geser) dan gaya yang dihasilkan tidak memicu tsunami yang besar akan tetapi penjalaran gelombang gempanya yang luas karena sumbernya relatif dangkal,” tutur Zulfakriza yang mengupdate magnitude gempa kemarin 8,5 BMKG dan 8,6 USGS. Katanya, gempa 11 April erat kaitannya dengan gempa 10 Ja-

memperngaruhi regangan tektonik di daratan Aceh sehingga akan berdampak pada sesar aktif di Aceh,” tutupnya.

nuari 2012 (7,1 SR) yang lokasinya berjarak 30 kilometer antara gempa 11 April dengan gempa 10 Januari 2012 lalu. Selain itu, katanya, mekanisme gempanya sama-sama strike slip (sesar geser) dan mekanisme strike slip dengan kekuatan lebih dari 8 SR baru kali ini terjadi di Aceh. “Kalau ada pertanyaan, apakah akan ada gempa susulan yang lebih besar dari magnitude 8.9 SR, secara pengetahuan kegempaan yang saya tahu kecil kemungkinan. Tapi perlu kita ingat bahwa dinamika bumi sangat kompleks sehingga setiap kemungkinan itu pasti ada,” tutur Zulfakriza. Pada sisi lain, kandidat doktor geologi ini menyebutkan fenomena gempa 11 April berbeda dengan gempa Mentawai, Sumatera Barat. Karena gempa Mentawai terjadi pada bidang kontak lempeng (zona subduksi) dan mekanisme sesar naik dan dangkal sehingga memicu tsunami. “Fenomena kejadian gempa Mentawai di kenal dengan Tsunamigenic Earthquake, artinya gempa yang dangkal, goncangan relatif rendah tapi menghasilkantsunami,”ungkapnya. Terkait dengan sesar aktif yang ada di daratan Aceh, tambah Zulfakriza, ini menjadi ancaman tersendiri. Aceh memiliki tiga segmen utama sesar aktif yang merupakan bagian dari sistem sesar Sumatera. “Tentunya ada energi yang terkumpul pada tiga segmen sesar itu sehingga suatu saat energi tersebut akan terlepas, yang kita kenal dengan gempa. Gempa kuat yang terjadi kemarin akan

Tidak Biasa Sementara itu, Dosen Fakultas Teknik Unsyiah, Dr Syamsidik Thahir yang diminta tanggapannya menyebutkan gempa yang terjadi 11 April tidak biasa karena berada di luar zona subduksi, sebagaimana analisa TDMRC Unsyiah dan peneliti Dr. Gegar P, Dr Semeidi dan Dr Widokonko terkait gempa 11 April 2012 di Aceh. “Memang sumber gempa tidak biasa dan karena berada di luar zona subduksi. Maka di duga tidak mengakibatkan rupture yang besar sehingga tsunami besar tidak terjadi, sekalipun tsunami terdeteksi di dua Tsunami Buoy (DART) yang dikelola NOAA,” ungkap Syamsidik yang juga Dosen Fakultas Teknik Unsyiah ini. Diduga arah sumber deformasi diagonal arah sumbu Timur Laut-Barat Daya sebelah barat dari Pulau Simeulue dengan panjang deformasi sekitar 600 kilometer. Sekalipun tsunami kecil di temukan di Meulaboh, Calang, dan sekitarnya, ada indikasi tsunami yang lebih dari lokasi-lokasi itu terjadi di pulau-pulau kecil antara pulau Nias-Siberut. “Tapi sekali lagi, kami tidak punya data di pulau-pulau itu. Mudah-mudahan ada kesempatan memvalidasi analisa itu. Pada 19 April 2012 nanti, kami ada ekspos di Meulaboh bersama BPBD Aceh Barat,” cetusnya. (b06)

BMKG Catat 159 Gempa Susulan BANDA ACEH (Waspada): Pascagempa di Aceh, Rabu (11/ 4), Stasiun Geofisika Mata Ie, Aceh Besar mencatat sebanyak 159 gempa susulan dengan magnitude terus menurun antara 3-5 pada Scala Richter (SR). “Biasanya pascagempa besar, gempa susulannya cenderung menurun kekuatan-

nurun. Dari pukul 07:00 sampai pukul 14:00, kembali tercatat 42 gempa susulan. “Gempa susulan itu magnitudenya selalu bervariasi, ratarata gempa susulan itu antara 3-5 Scala Richter,” ungkap Eridawati. Lokasi gempa susulan itu masih berada di pusat gempa 8,3 SR yang melanda Aceh. (b06)

nya,” tutur Eridawati, petugas Stasiun Geofisika Badan Meteorologi, Klimatologi dan Geofisika, Mata Ie, Aceh Besar, Kamis (12/4) di Banda Aceh. Dikatakannya, sampai pukul 07:00, Kamis (12/4), gempa susulan tercatat sebanyak 117 kali dengan kekuatan atau magnitudenya yang sudah me-

PEUREULAK (Waspada): Pasca gempa ber- masuk ke desa untuk menjarah isi rumah, hal kekuatan 8,5 SR yang menguncang Aceh Rabu itu sebagaimana pengalaman gempa setelah (11/4) sekira pukul 15:38, seluruh warga pesisir tsunami tahun 2004. Oleh karenanya, PA berharap agar kaum Selat Malaka, khususnya di Aceh Timur, naik ke gunung mencari perlindungan menghindari lelaki tetap berada di desa demi keamanan. tsunami sebagaimana yang terjadi 2004 silam. “Kita sudah menyalurkan bantuan logistik ke Meski BMKG sudah mencabut peringatan pengungsi, tapi kita harap jika kondisi sudah tsunami beberapa jam setelah gempa susulan, aman maka dipersilakan untuk pulang ke runamun hingga kini di Kabupaten Aceh Timur mah masing-masing, karena keamanan gammasih terlihat dua titik pengungsi yakni di pong juga keamanan yang harus dijaga bersaMasjid Istiqamah Desa Cot Keh, Kecamatan ma,” kata Syahrul yang juga Cawabup Aceh Peureulak Kota. Sementara titik pengungsi lain- Timur berpasangan dengan Hasballah (Rocky). Di Idi Cut Dan Idi Rayeuk nya juga tampak di Maunasah Gampong SeuSementara itu, ratusan kepala keluarga (KK) neubok Baroh, Kecamatan Darul Alam (Idi Cut). Warga mengaku terpaksa mengungsi karena di Desa Kuala Idi Cut dan sebagian warga Desa khawatir terjadi tsunami, ditambah lagi kebera- Seuneubok Baroh Idi Cut, Kecamatan Darul Aman ikut mengungsi ke surau. Mereka berdaan pengungsi dari desa-desa di pesisir. Geuchik Gampong Kuala Bugak, Ibrahim bondong-bondong lari meninggalkan rumah Harun kepada Waspada Kamis (12/3) menye- menuju dataran tinggi, guna menghindari tsubutkan, pengungsi di Cot Keh masing-masing nami. Hal yang sama juga terjadi di Idi Rayeuk, 650 jiwa dari Desa Kuala Bugak dan 300 jiwa dimana masyarakat di Pusong dan Desa Keudari Desa Matang Muda Itam. Kedua desa seca- tapang Mameh ikut mengungsi ke Gampong ra geografis terletak persis di pesisir Peureulak Baro dan ke perbukitan di Desa Buket Pala. Kota. “Warga mengungsi saat terjadi gempa Berbeda dengan di Kecamatan Idi Rayeuk, dan hingga sekarang masih belum berani pu- warga yang sempat panik saat terjadi gempa lang ke rumahnya karena khawatir terjadi tsu- namun langsung kembali ke rumahnya masingnami,” katanya. masing menjelang pukul 23:00.“Rata-rata warga Amatan Waspada, seribuan jiwa pengungsi mengaku panik, karena khawatir terjadi tsudisana tampak memadati halaman Masjid Istinami. Tapi sebagian warga seperti di Idi rayeuk qamah Cot Keh yang berada sekitar 5 kilometer ke arah selatan pesisir pantai Kuala Bugak. Selain sudah ada yang pulang, tapi di Cot Keh (Peumenumpang di balai (surau—red) yang tersedia reulak) masih mengungsi,” kata Pj Bupati Aceh di dalam pekarangan masjid, pengungsi juga Timur Ir Nasrullah Muhammad didampingi memanfaatkan lokasi parkir. Rata-rata, di dalam Sekda Aceh Timur Syaifannur, SH.MM kepada kamp pengungsian itu hanya dimanfaatkan Waspada Kamis (12/4) di Idi. Nasrullah Muhammad mengaku, pihaknya anak-anak dan orang lanjut usia beristirahat, sementara kaum muda-mudi tampak mondar telah menyalurkan bantuan logistik masa panik untuk warga di pengungsian melalui Badan mandir di luar kamp. Sedangkan aktifitas lain yang terlihat di Penanggulangan Bencana Daerah (BPBD) Aceh sana adalah anak-anak berangkat ke sekolah Timur dan Bagian Kesra Setdakab Aceh Timur. dari posko pengungsian. Meski sehari sebelum- “Kita harapkan, jika kondisi sudah aman, apalagi nya Peureulak ikut diguncang gempa bumi yang BMKG sudah mengeluarkan pernyataan berpotensi tsunami, tetapi aktifitas pembela- dicabut peringatan tsunami, maka warga kita jaran lancar sebagaimana biasanya. Pulang harap kembali ke rumah masing-masing,” sekolah, khususnya pelajar SMP sederajat dan tandas Nasrullah Muhammad. (b24) murid SD sederajat langsung ke kamp pengung-sian dan menyantap makanan apa adanya yang ada di kamp pengungsian. Bantuan PA Mengalir Ketua DPW Partai Aceh (PA) AcehTimur Syahrul Syamaun secara terpisah mengaku pihaknya telah menyalurkan bantuan berupa logistik untuk dua titik pengungsian di Aceh Timur yakni di Cot Keh (Peureulak) dan Seuneubok Baroh (Idi Cut). Pihak PA dan KPA meminta masyarakat tidak terprovokasi dan panik dengan isu tsunami, karena Waspada/Muhammad H Ishak setelah warga me-ninggalkan rumah dan desanya da- BANTUAN Partai Aceh (PA) mengalir ketika warga pesisir lam kondisi kosong dikha- mengungsi ke Masjid Istiqamah Cot Keh, Kecamatan Peureulak, watirkan ada pihak lain yang Aceh Timur.

Hasil Pilkada Keputusan Rakyat SIMPANGULIM (Waspada): Pj Bupati Aceh Timur, Ir Nasrullah Muhammad M.Si MT, menyatakan, siapapun calon bupati yang menang dalam Pilkada 2012 adalah pilihan dan keputusan rakyat. Semua elemen masyarakat diminta mendukung calon terpilih demi kemajuan pembangunan. “Jangan lagi ada dakwa-dakwi. Ibarat sepakbola, laga sudah usai. Sekarang masanya salamsalaman. Siapapun pemimpin 5 tahun kedepan harus kita dukung bersama,” ajak Nasrullah dalam pertemuan dengan Muspika dan tokoh tiga kecamatan wilayah barat Aceh Timur, di kantor Camat Simpangulim, Kamis (12/4). Didampingi Sekda Syaifannur, SH.MM, Nasrullah atas nama seluruh unsur Muspida juga menyampaikan terimakasih kepada seluruh rakyat Aceh Timur atas dukungan dan partisipasinya, sehingga pilkada di daerah ini

berjalan lancar, tertib, aman, damai dan demokratis. “Banyak pihak, termasuk Pak Gubernur sendiri, mengkhawatirkan situasi keamanan Aceh Timur ketika pilkada berlangsung. Itu sebabnya, sebelum hari H, kami Muspida rajin turun ke lapangan demi memantau situasi. Dan Alhamdulillah, berkat dukungan kita semua, pilkada di daerah kita berjalan sangat baik,”imbuh Paknas, panggilan akrab Nasrullah. Amatan Waspada, selain Camat tuan rumah, Lukman SP, tampak hadir Camat Pante Bidari, Burhanuddin SH, Camat Madat, Russamin SE dan sejumlah keuchik serta Imum Mukim dari ketiga kecamatan tersebut. Dari legislatif, hadir Syafrizal M Thaeb, politisi Partai Demokrat asal Simpangulim. Sementara dari unsur LSM, diwakili Ketua GeMPAR Auzir Fahlevi SH, juga putra asli Simpangulim.(b19)

PLN, Telkom Dan Pertamina Diminta Tetap Layani Masyarakat LHOKSEUMAWE (Waspada) : Pasca gempa 8,5 SR mengguncang Aceh, dikabarkan jaringan Telkom, PLN dan Pertamina terganggu akibat guncangan hebat. Begitupun, Muhammad Azhari, anggota Komisi VI DPR-RI meminta ketiga perusahaan BUMN tersebut tetap memberikan pelayanan maksimal kepada masyarakat. “Kami meminta PLN, Telkom dan Pertamina, apabila ada

kerusakan jaringan pasca gempa segera memperbaiki semua jaringan yang rusak agar pelayanan kepada masyarakat tidak terhenti,” papar Muhammad Azhari. Said Muharam, Humas PLN Aceh ketika dikonfirmasi, Kamis (12/4) mengatakan, pada saat gempa mengguncang Aceh, Rabu (11/4), listrik padam di tiga titik, yakni Banda Aceh, Sinabang dan Meulaboh.

Khusus untuk Kota Banda Aceh. listrik padam total, sedangkan untuk Sinabang dan Meulaboh padam sebagian. Begitupun sejak kemarin malam listrik kembali normal di tiga titik itu, bahkan untuk Sinabang dan Meulaboh lampu padam hanya 45 menit, hanya Banda Aceh yang sedikit lama, karena lampu normal kembali pada pukul 22: 15. (b18)

Ratusan KK Tinggalkan Tempat Pengungsian BIREUEN ( Waspada): Ratusan KK warga kawasan pinggiran dari sejumlah kecamatan di Bireuen yang sempat mengungsi pasca terjadi gempa Rabu (11/4) petang, telah kembali ke desanya. Mereka yang telah kembali setelah sempat mengungsi semalam antara lain, warga Desa Pante Rheng, Sangso dan warga dari Desa Lancang (Samalanga), warga Desa Rheum Baroe (Simpang Mamplam). Kemudian, warga Desa Kubu, dan warga Desa Meunasah Baroe (Peudada), warga Desa Batee Timoh, Kuala Jeumpa, warga Desa Kuala Raja dan

Ujong Blang Masjid (Kuala). Selanjutnya, warga Desa Jangka Alue Bie, warga Desa Alue Nuya Pasie, Alue Buaya Gampong, Linggong dan warga Desa Tanoeh Anoe, Kuala Ceurape, Alue Pineung, Alue Kuta, Pante Ranup, Pante Paku. Pante Sukon dan Meunasah Dua, (Jangka). Warga Desa Ie Rhob, Lingkakuta, dan warga Desa Lapang Barat (Gandapura). Warga saat itu menerima bantuan dari anggota KPA berupa beras, mi instan, air mineral, telur dan barang kebutuhan lainnya. “Kami mengungsi karena khawatir akan naik air laut,”

kata sejumlah warga Kecamatan Jangka beberapa saat setelah tiba di komplek masjid Desa Cot Ijue. Pantauan terakhir kemarin pagi warga kecamatan Jangka tersebut telah kembali ke desa masing-masing. Ketua KPA-PA Daerah III Wilayah Batee Iliek, Sufri alias Boing didampinggi Rusidi kepada wartawan Rabu (11/4) malam mengatakan, sebagai wujud kepedulian terhadap para pengungsi pihaknya bekerjasama dengan masyarakat malam itu menyalurkan bantuan kepada pengungusi dari Kecamatan Jangka di beberapa titik. (cb02)


PJ BUPATI Aceh Timur, Ir Nasrullah Muhammad, MSi.MT, menyampaikan arahan pada pertemuan dengan muspika dan tokoh masyarakat tiga kecamatan, wilayah barat Aceh Timur, di kantor Camat Simpangulim, Kamis (12/4) siang.

Di Aceh Besar, Kegiatan Masyarakat Kembali Normal KOTA JANTHO (Waspada): Kegiatan masyarakat di Aceh Besar kembali normal setelah sempat dipanikkan oleh gempa berkekuatan 8,8 pada Schala Righter yang terjadi Rabu (12/ 4) siang. Begitupun, perasaan was-was akan terjadi gempa susulan masih menghiasi wajah masyarakat di daerah itu. Sementara itu, aktivitas pasar dan kegiatan belajar-mengajar juga berjalan seperti biasa. Pantauan Waspada di Pasar Induk Lambaro, Sibreh, Seulimum, Kota Jantho dan Lhoknga, sepanjang Kamis (12/4) kemarin, dipadati warga yang hendak berbelanja kebutuhan sehari-hari. “Saya ke pasar untuk belanja kebutuhan sehari-hari karena persediaan di rumah sudah habis. Menurut saya, aktivitas di pasar ini masih seperti biasa, kecuali ada satu-dua tempat jualan yang tutup. Harganya juga sama seperti kemarin (Rabu-red) sebelum gempa, tidak ada yang

naik,” kata Andawiyah, seorang ibu rumah tangga yang Waspada temui di Pasar Lambaro, Kecamatan Ingin Jaya, Aceh Besar. Hal yang sama juga diungkapkan Agus, seorang pedagang makanan sarapan pagi di Pasar Kota Jantho. Dia mengatakan, meski kemarin (Kamisred) dirinya tidak berjualan karena masih takut gempa, namun dirinya tetap pergi ke pasar untuk belanja sejumlah kebutuhan, untuk persiapan jualan besok (hari in-red). “Hari ini (Kamis) saya tidak jualan karena masih takut datang gempa susulan. Apalagi sejak Rabu sore hingga malam aliran listrik ke Kota Jantho padam. Baru tengah malam listrik nyala. Saya lihat tidak ada ada masalah dengan persediaan barang di pasar ini. Semua tersedia cukup dan harga-harganya juga tidak ada kenaikan,” kata Agus. (b05)



Seunuddon Butuh Perpustakaan SEUNUDDON (Waspada) : Warga Seunuddon, Aceh Utara sangat membutuhkan perpustakaan. Sarana itu untuk menunjang sarana belajar, baik di kalangan pelajar ataupun masyarakat umum. “Mengingat tak ada satu pun fasilitas penunjang, terutama kebutuhan pada buku-buku selain di sekolah, maka masyarakat umum, termasuk mahasiswa dan santri, tidak bisa mendapatkan ilmu pengetahuan lebih yang bisa menunjang pelajaran mereka,” ungkap Ketua Kesatuan Mahasiswa dan Santri (KeMS) Seunuddon, Mukhlis Azmi di Seunuddon, Kamis (12/4). Untuk meningkatkan berbagai pengetahuan itu, kehadiran perpustakaan di kecamatan itu memang sudah sangat mendesak. Dia berharap Pemkab Aceh Utara segera mendirikan sebuah perpustakaan yang nantinya dimanfaatkan semaksimal mungkin oleh pelajar dan masyarakat umum. Banyak generasi penerus di Seunuddon yang berbakat, kata Mukhlis, tidak didukung dengan sarana memadai. Sehingga sulit untuk mengembangkan diri melalui ilmu pengetahuan bila tidak ada perpustakaan yang menyediakan buku dan kitab. “Keberadaan perpustakaan ini nantinya bisa memotivasi mereka untuk tidak hanya belajar di sekolah dan di balai pengajian saja,” ujarnya. Menurutnya, dengan adanya perpustakaan, para pelajar bisa lebih leluasa menambah ilmu pengetahuan seiring perkembangan zaman yang semakin maju pesat. Dengan demikian, Seunuddon yang letaknya di pesisir ini tidak menjadi daerah yang ketinggalan, penduduknya bisa berpikir lebih maju dan setara dengan sebagian besar penduduk di kota. Selain itu Mukhlis juga mengajak semua elemen masyarakat Seunuddon untuk lebih memperhatikan pendidikan generasi penerus, baik pendidikan duniawi maupun ukhrawi, agar mereka menjadi orang-orang yang beriman, berakhlak, dan mampu memberikan yang terbaik untuk daerahnya. (b14)

Pemkab Aceh Timur Terima 422 Mahasiswa KPM LANGSA (Waspada):Pemerintah Kabupaten Aceh Timur terima 422 orang mahasiswa Sekolah Tinggi Agama Islam Negeri (STAIN) Zawiyah Cot Kala Langsa yang akan melakukan Kuliah Pengabdian Masyarakat (KPM) angkatan XXIII di kabupaten dimaksud, Kamis (12/4). Penyerahan ratusan insan akademis dilakukan secara simbolis kepada pemerintah Aceh Timur di aula kampus STAIN Zawiyah Cot Kala Langsa yang diterima Asisten II Bidang Pembangunan, Ekonomi dan Keistimewaan Aceh, Ir. M. Yasin. Dalam sambutannya pada pembekalan dan penyerahan mahasiswa KPM dimaksud, M.Yasin mengatakan, pemerintah Aceh Timur menyambut baik dan mendukung kehadiran para mahasiswa STAIN Langsa di Aceh Timur untuk melaksanakan Kuliah Pengabdian Masyarakat. Ketua Pelaksana Kegiatan Pembekalan KPM STAIN Zawiyah Cot Kala, Junaidi, A.Ma dalam laporannya mengatakan, jumlah peserta KPM yang akan diturunkan ke masyarakat dalam angkatan XXIII ini sebanyak 422 orang dari seluruh jurusan. “Mahasiswa KPM ini akan dibagi dalam dua gelombang, dan mereka akan ditempatkan di dua kecamatan, yaitu Kecamatan Peureulak Barat 15 desa dan Kecamatan Rantau Peureulak, 23 desa. Untuk tiap-tiap desa ditempatkan 11 orang mahasiswa/ i,” sebut Junaidi seraya menambahkan dalam menjalankan KPM mahasiswa akan diterapkan kedisiplinan dan keterampilan. (b20/b22)

Waspada/Maimun Asnawi

SALAH seorang warga Gampong Meunasah Geudong, Kecamatan Samudera, Aceh Utara, Kamis (12/4) menunjukkan tanggul sungai yang telah mengalami abrasi. Tanggul berada pas di depan pintu rumahnya.

Penyelundupan Sabu Dari Malaysia Ke Aceh Digagalkan BANDA ACEH (Waspada): Petugas Bandara Internasional Sultan Iskandar Muda, Blang Bintang, Aceh Besar, menggagalkan penyelundupan 229,21 gram narkotika jenis sabu atau senilai Rp458.500 juta dari Malaysia. Kepala Kantor Pengawasan dan Pelayanan Bea Cukai Banda Aceh Beni Novri, Kamis (12/4) mengatakan, penyelundupan narkotika merupakan yang kelima kalinya dibawa penumpang pesawat AirAsia AK-1305 dari Kuala Lumpur berinisial NB,38, asal Aceh yang mendarat, Rabu

(11/4) pukul 13:00. “Modus penyelundupan dilakukan dengan jalan menyembunyikan sabu-sabu ke dalam dubur, yang telah dikemas ke dalam kondom berbentuk sebuah telur sebanyak enam butir,” katanya. Setelah dilakukan pemeriksaan atas barang bawaan pribadi NB, petugas tidak menemukan barang larangan. Karena menunjukkan sikap mencurigakan selama dilakukan pemeriksaan awal, maka dilakukan rontgen dan pada hasil foto menunjukkan ada benda aneh

dalam perut penumpang tersebut. Kemudian petugas membawanya ke Rumah Sakit Meuraxa untuk mengeluarkan benda itu. Benda yang dikeluarkan itu berupa benda yang berbentuk kapsul yang berisi bubuk kristal putih. “Benda tersebut lalu diperiksa ke Balai Pengujian dan Identifikasi Barang DJBC Medan. Hasil pemeriksaan diketahui kristasl putih itu positif narkotika jenis sabu,” terang Beni. (cb01)

Pengumuman CPNS Abdya Dinilai Sarat Masalah BLANGPIDIE (Waspada) : Pengumuman calon pegawai negeri sipil (CPNS) dari jalur honorer di kabupaten Aceh Barat Daya (Abdya) dinilai sarat masalah dan penuh intrik. Hal itu terindikasi dari sejumlah info yang menyebutkan banyak tenaga honorer yang terdaftar secara resmi dan telah bekerja selama belasan tahun namun dinyatakan tidak lulus. Tetapi sebaliknya ada CPNS yang dinyatakan lulus walaupun selama ini diketahui tidak pernah terdaftar sebagai tenaga honorer. Persoalan terungkap setelah pengumuman resmi hasil CPNS dari jalur honorer diterima sejumlah tenaga honorer di Abdya sejak Kamis (12/4). Salah seorang tenaga honorer kepada Was-pada menye-

butkan adanya indikasi kecurangan dan intrik pemalsuan keterangan honorer dari salah satu dinas dalam upaya meluluskan calon tertentu. Akibat intrik tersebut sejumlah tenaga honorer mengaku telah dizalimi Pemkab Abdya dan meminta adanya pengusutan lebih lanjut atas tindakan oknum pejabat di Pemkab Abdya. Sementara itu praktisi dan pengamat pendidikan di Abdya Drs H Ridwan Adami,MM kepada Waspada juga mengaku telah menerima informasi dan keluhan sejumlah tenaga honorer Abdya terkait hasil pengumuman CPNS dari jalur database honorer. Dirinya juga menya-yangkan jika intrik dan kecurangan tersebut di lakukan oleh oknum pejabat tertentu untuk melulus-

kan kroni ataupun keluarganya, hal ini menurutnya akan menciderai azas keadilan dan profesionalitas sehingga akan membentuk karakteristik pegawai yang tidak baik kedepannya. “Kita sudah menerima informasi tersebut, ini tentu harus di usut tuntas oleh pihak berwajib jika memang ada kecurangan seperti itu,” ung-kap Ridwan Adami yang juga Ketua Perguruan Tinggi Muhammadiyah STKIP Abdya. Terkait persoalan itu, Kepala Badan Kepe-gawaian, Pendidikan dan Pelatihan (BKPP) Abdya drh Cut Hasnah yang dihubungi Waspada mengelak memberikan tanggapan. Telpon selularnya yang sudah terhubung saat dikonfirmasi juga tidak di angkat-angkat. (cb05)

Cabup Aceh Timur Dari PA Ingin Dekat Rakyat LANGSA (Waspada): Calon Bupati Aceh Timur dari Partai Aceh, Hasballah M Thayeb alias Rocky mengatakan, bila Allah mengizinkan dia bersama wakilnya Syahrul bin Syamaun alias Linud dilantik sebagai Bupati Aceh Timur dan Wakil Bupati Aceh Timur, keduanya tetap berdomisili di ibukota Aceh Timur di Idi, dan berusaha dekat dengan rakyat. Berkenaan dengan itu, Hasballah juga mengucapkan terima kasih kepada pihak yang telah mendukung perjuangan Partai Aceh serta juga terimakasih kepada jajaran Polri/TNI/ KNPI dan juga pers atas kemenangan tersebut. “Kami tetap memperjuangkan amanah MoU Helsinki serta UUPA,” katanya. (b20)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


LHOKSEUMAWE (Waspada): Sebanyak 7.602 orang siswa Sekolah Menengah Atas/ Madrasah Aliyah dan Sekolah Menengah Kejuruan secara serentak akan mengikuti Ujian Nasional (UN) mulai tanggal 16-26 April untuk SMA dan MA, sedangkan siswa SMK mulai dari tanggal 16-25 April. UN diawasi 866 orang pengawas. Ujian Nasional kali ini dilaksanakan dengan sistem silang murni sama dengan tahun sebelumnya. Para siswa akan dinyatakan lulus apabila berhasil meraih nilai rata-rata minimal 5,5, dengan ketentuan tidak boleh ada satupun nilai mata pelajaran yang di bawah 4. UN dilaksanakan di sekolah masing-masing. Selain diawasi oleh para guru, peserta ujian juga diawasi oleh aparat kepolisian dari Mapolsek kecamatan masing-masing. Meskipun sistem pengawasan terbilang ketat, Dinas Pendidikan, Pemuda dan Olah Raga tetap memasang target kelulusan di atas 90 persen. “Kami berani memasang target itu karena jauh hari sebelumnya kita telah membekali para peserta UN dengan berbagai persiapan, di anta-

ranya telah melaksanakan try out, remedial dan berbagai les dan jam belajar tambahan. Mudahmudahan target kita tercapai,” harap Razali, SPd, Kadis Pendidikan, Pemuda dan Olah Raga Aceh Utara yang diamini Drs Wahyuni, MPd, Ketua UN dan A Rahman TB, Sekretaris. Mereka menjamin pelaksanaan UN kali ini akan berlansung dengan tertib dan lancar dan tentunya dengan cara-cara yang benar. Pihak sekolah dan pengawas diingatkan untuk tidak membocorkan soal ujian, dan jika terjadi akan dikenakan sanksi sesuai aturan yang berlaku. A. Rahman mengatakan, tidak ada celah untuk melakukan kecurangan, karena soal-soal UN diantar ke lokasi ujian dengan pengawalan ketat dari aparat Kepolisian Mapolres Aceh Utara dan Kota Lhokseumawe. A. Rahman TB, juga mengatakan, jumlah peserta UN SMP/MTS sebanyak 9.703 orang, dengan jumlah pengawas 1.094 orang. Mereka akan mengikuti ujian di 547 ruang. UN untuk SMP dan MTS akan dilaksanakan pada 23 April hingga 4 Mei tahun 2012. (b18)

Disdik Pidie Ingatkan Siswa Fokus Belajar SIGLI (Waspada): Dinas Pendidikan (Disdik) Pidie kembali mengingatkan para siswa peserta Ujian Nasional (UN) tetap fokus belajar dan mengulang pelajaran yang pernah diajarkan para guru. Khususnya mata pelajaran yang masuk dalam UN. “ Misalnya untuk siswa SMA/MA jurusan IPA yang dites dalam UN. Antara lain mata pelajaran, Bahasa Indonesia, Bahasa Inggris, Fisika, Matematika, Kimia dan Biologi. Jurusan IPS, Bahasa Indonesia, Bahasa Inggris Ekonomi, Matematika, Sosiologi dan Giografi. Sedangkan untuk siswa SMK. Bahasa Inggris, Bahasa Indonesia dan Matematika,” kata Kepala Dinas Pendidikan Pidie Drs. H. Bukhari Taheir kepada Waspada, Kamis (12/4).

Selain mengingatkan para siswa peserta UN, Bukhari juga mengingatkan para orang tua siswa untuk selalu memantau kegiatan anak-anaknya di rumah maupun di luar rumah. Ia berharap para orang tua murid bisa mengingatkan anak-anaknya untuk tetap fokus belajar, jangan lalai dengan aktifiats yang dianggap tidak perlu. Apalagi bagi siswa SMA/MA/pelaksanaan UN, Senin 16 sampai Kamis 19 April 2012. Sedangkan SMK Senin 16 sampai Rabu 18 April 2012. Artinya waktu untuk belajar dan mengulang pelajaran sangat singkat. “ Karena itu kami mengimbau kepada para siswa untuk fokus belajar” tegasnya. (b10)

Persiapan UN Kota Langsa Hampir Rampung Siswa SMA/MA/SMK/SMALB Siap Hadapi UN LANGSA (Waspada): Kepelaksanaan try out yang pala Dinas Pendidikan Kota dilakukan masing-masing Langsa Drs Mustafa, MPd sekolah,” pungkas Mustafa lagi. menegaskan, sebanyak Sementara itu, Wakil Sek2.276 siswa dari 15 SMA/ retaris Panitia UN Sudarto, SPd MA/SMALB dan 819 siswa menambahkan, untuk penSMK dari 8 sekolah negeri/ distribusian materi UN yang swasta siap mengikuti ujian pertama sekali kita terima adanasional (UN) yang akan lah persiapan alat-alat tulisnya dilaksana-kan, Senin (16/4) dan telah didistribusikan ke depan. sekolah-sekolah. Kemudian Hal itu naskah soal dan lembar jawadikemukakan Mustafa ketika ban komputer (LJK) yang di ditemui, Ka-mis (12/4). cetak di Kudus, Jawa Tengah diDrs Mustafa, MPd distribusikan ke provinsi Aceh, “Untuk persiapan sudah Kepala Dinas lalu paling lambat besok pagi hampir rampung, kita Pendidikan Kota Langsa tinggal hanya menunggu sudah sampai ke Kota Langsa. pendistribusuan naskah soal “Selanjutnya naskah soal itu dan LJK dari provinsi. Menu-rut informasi, dimasukan ke dalam gudang sampai Kamis (14/4) ini naskah itu diberangkatkan dari pelaksanaan hari H pelaksanaan UN, yang di provinsi dan Insya Allah malam nanti atau paling sana sudah kita siapkan penjagaan dari aparat terlambat besok, Jumat (14/4) naskah itu akan kepolisian untuk menjaga 24 jam penuh sampai kita terima,” terangnya. berakhirnya ujian nasional,” sebutnya. Disinggung mengenai persiapan, Mustafa Untuk pendistribusian soal ke sekolahmenambahkan, untuk menyukseskan UN ini sekolah, lanjut Sudarto, naskah soal dan LJK berbagai upaya telah kita lakukan, termasuk diambil oleh kepala sekolah melalui pengawamelakukan sosialisasi kepada kepala sekolah, pengisian data siswa harus jelas, sehingga tidak lan pihak kepolisian hingga sampai ke sekolah. ada anak yang dirugikan. Begitu juga halnya Di sana tentunya sudah ada para pengawas dengan pengawas telah kita beri arahan, karena setempat dari guru-guru dan pengawas dari pengawasan yang kita terapkan dengan sistem perguruan tinggi yang bertanggung jawab pesilang. Sehingga pelaksanaan UN nantinya nuh terhadap kerahasian naskah soal itu, sebagai orang yang memantau pelaksanaan UN. benar-benar matang. “Untuk pengambilan soal mulai pukul 06:00 Di samping itu juga memberikan support kepada siswa agar terlatih mentalnya, sehingga hingga 07:00, sebelum jam itu kita sudah stand nantinya pada hari H tidak down menghadapi by di gudang sampai semua para kepala sekolah ujian nasional. “Hal itu bisa menjadi momok selesai mengambil naskah soal. Begitu juga terbesar bagi siswa, di samping kesiapan aka- halnya nanti bila usai pelaksanaan UN, soal demik seperti membahas soal-soal UN sesuai dimasukan ke dalam gudang dan selanjutnya kurikulum di standar kelulusan siswa (SKL) dan kita kirim ke provinsi,” demikian Sudarto. (m43)

Turbin Bekas PT Arun Mampu Suplai 600 Megawatt Listrik Untuk Masyarakat

Partai SRI Siap Ikut Verifikasi LANGSA (Waspada) : Partai Serikat Rakyat Independen (SRI) siap untuk diverifikasi oleh Komisi Pemilihan Umum (KPU) guna menghadapi Pemilu Legislatif pada 2014 mendatang. Bahkan di Provinsi Aceh, partai pimpinan mantan Menteri Keuangan RI Sri Mulyani ini, telah membentuk kepengurusan hampir di seuruh kabupaten/kota di Aceh. Ketua DPW Partai SRI Provinsi Aceh Abdul Manaf didamping Ketua DPC Partai SRI Kota Langsa Jamaliah serta Ketua DPC Partai SRI Aceh Tamiang M Yusuf, Rabu (11/4) mengatakan Partai SRI telah resmi berbadan hukum sesuai SK Menteri Hukum dan HAM No : M.HH-09.AH.11.01 tanggal 27 Maret 2012.(b20)

Jumat 13 April 2012

SMA/MA Dan SMK Gelar UN 16-26 April

Krueng Pase Abrasi, 13 Gampong Terancam Terisolir SAMUDERA (Waspada): Sepanjang 800 meter tanggul sungai Krueng Pase di Gampong Meunasah Geudong, Kecamatan Samudera, Aceh Utara telah mengalami abrasi. Kondisi ini telah berlasung selama lima bulan terakhir. Jika tidak segera diantisipasi, dikawatirkan warga di 13 gampong akan terisolir. Muhammad Hasbi, Geusyik Gampong Meunasah Geudong kepada Waspada mengatakan, titik paling rawan terdapat pada tanggul yang berhadapan dengan Meunasah (surau) Geudong. Kalau tidak segera diperbaiki, maka diprediksikan tanggul sungai itu akan putus. “Kalau tanggul ini putus, maka warga yang tinggal 13 gampong lainnya akan terisolir,” katanya. Akibat abrasi, dua tiang listrik yang terdapat dipinggir sungai hampir rubuh, kondisi ini membahayakan jiwa masyarakat dan dapat mengganggu suplai listrik kepada warga di sana. Kondisi ini telah dilaporkan ke Kantor Kecamatan Samudera, namun hingga saat ini belum ada respon dari pihak terkait. Bahkan, M. Hasbi mengaku telah melaporkan kembali persoalan itu pada Musrembang tahun 2013. Harusnya, kata Hasbi pemerintah dapat mendalukan anggaran untuk kebutuhan perbaikan tanggul sungai itu, karena dinilai sangat darurat. Jumlah penduduk yang tinggal di Gampong Meunasah Geudong mencapai 1.260 jiwa atau 311 KK. (b18)


Waspada/Mustafa Kamal

M YUSUF bersama kawannya memikul karungan ikan yang disangkut pada sebatang kayu. Ikan tesebut hendak dijual dengan cara memajangnya di pinggir jalan raya. Foto direkam, Rabu (11/ 4).

Tak Punya Boat, Jual Ikan Pun Jadi Tak semua keinginan dalam kehidupan ini terpenuhi, apapun itu. Namun dalam berusaha tak boleh patah semangat. Itu semboyan yang membuat semangat M Yusuf, 45, warga asal Cot Trueng, Kecamatan Muara Batu, Aceh Utara saat menjual ikan di pinggir jalan. Pria lajang hidup bersama ibu tua renta itu sudah 15 tahun menekuni profesi sebagai penjual ikan di pinggir jalan raya. Usai shalat Subuh ia hanya dapat berharap kepada orang lain, ikan hasil tangkapan di laut dijual kepadanya, barulah dia memajangkan jualan di pinggir jalan. Bahkan dalam seminggu, dia tak setiap hari dapat menjual ikan tersebut di lokasi yang sudah dikenal banyak orang persisnya depan toko orang di Desa Cot Trueng. Kadang-kadang,

kata Yusuf, ikan yang didapat dengan cara dikail di laut itu tidak membuahkan hasil, terpaksa dia ‘gigit jari’. Sedangkan sang ibu yang tak lagi bekerja karena pikun, hanya menunggu yang dibawa pulang anaknya pada siang dan sore hari, inilah kisah kehidupan ibu dan anak ini. Sementara ‘ladang’ usaha lain mereka tak punya. Mereka bergantung hanya pada hasil laut. Jangankan bicara sawah dan kebun, tambak pun tak punya. Kalaupun dalam seminggu tidak menentu. Hari itu ia dapatkan 400 ekor ikan tongkol dari temannya. Kemudian dia kemas berbentuk karangan, satu karangan diikat 10 ekor ikan, dijual Rp24 ribu. “10 ekor atau satu karangan saya jual Rp24 ribu, harga itu tidak jauh beda

dengan modal, sangat tipis sekali untungnya,” kata Yusuf. Pun demikian, kata Yusuf, jualannya itu laku tiap harinya. “400 ekor saya jual atau sekitar 800 kg, InsyaAllah laku setiap hari, biasanya sore hari sudah habis. Tapi yang membuat saya ‘gigit jari’ tidak setiap hari ikan ada, itulah masalahnya,” pungkas anak Ummi Kalsum itu. “Biarpun telah lama saya berprofesi seperti ini, dan rasanya ingin mengalih ke bidang lain. Bernelayan layaknya teman-teman, merupakan dambaan saya saat ini, tapi apa boleh buat modal tidak ada. Untuk itu, saya mengharapkan pemerintah memberikan bantuan boat,” ucap korban tsunami yang tinggal di rumah tak layak huni itu. Mustafa Kamal

LHOKSEUMAWE (Waspada): Sebanyak 32 unit turbin milik PT Arun di Lhokseumawe mampu menghasilkan 600 megawatt listrik. Seiring dengan revitalisasi kilang Arun, pembangkit listrik milik BUMN tersebut dapat digunakan untuk memenuhi kebutuhan listrik masyarakat Aceh yang selama ini masih bergantung dengan listrik dari Sumatera Utara. Seiring dengan revitalisasi kilang Arun, sejumlah fasilitas perusahaan pengolahan gas alam ini juga dapat bermanfaatkan untuk masyarakat. Diantaranya, turbin yang mampu menghasilkan listrik sekurangnya 600 megawatt. Vice President PT Arun, Ir H Fuad Buchari, MT mengakui, proses revitalisasi harus selesai akhir tahun 2013. Selain pembangunan receiving terminal di bekas Gampong Blang Lancang, Pertamina juga akan membangun pipa dari terminal gas ke Sumatera Utara. “Akhir tahun 2013 harus selesai,” tegas Fuad Buchari di sela-sela penyerahan beasiswa kepa-

da 100 siswa SMA dan MA di Gedung Serba Guna PT Arun, Kamis (12/4). Bantuan dari Osaka Gas Foundation International and Cultural Exchange (OGFICE) itu diserahkan kepada para siswa berprestasi. Selama ini PLN masih mensuplai listrik dari Sumatera Utara untuk Aceh. Sehingga ketika terjadi kerusakan jaringan akibat bencana alam dan perbuatan pihak tak bertanggungjawab, masyarakat sepanjang pantai Timur Provinsi Aceh mengalami krisis listrik. Namun dengan memanfaatkan turbin berkapasitas sampai 600 megawatt, masalah listrik di Aceh dapat diatasi. Fuad Buchari juga menjelaskan, tahun ini PT.Arun menargetkan hanya mampu menghasilkan gas 23 kapal. 17 kapal di antaranya diekspor ke Korea, sedangkan sisanya untuk kebutuhan industri pupuk dalam negeri. “Sampai saat ini kita telah mengekspor 6 kapal ke Korea,” jelasnya. (b15)

Waspada/Zainal Abidin

PARA SISWA dari Lhokseumawe sedang menerima beasiswa Osaka Gas Foundation International and Cultural Exchange (OGFICE) yang diserahkan Vice President PT Arun, Ir H Fuad Buchari, MT, Kamis (12/4).


WASPADA Jumat 13 April 2012

Tangki Meledak, SPBU Di Bebesen, Aceh Tengah Terbakar

Penyaluran Terbuka Dan Tidak Berpihak NAGAN RAYA (Waspada) : Mengenai penyaluran permohonan masyarakat untuk cetak sawah baru di Kabupaten Nagan Raya, Dinas Pertanian dan Peternakan telah mengeluarkan surat keputusan yang ditandangani Kapala Dinas Ali Basyah, SP sebanyak 22 kelompok tani. Dengan sasaran penerima manfaat batuan sosial kegiatan perluasan cetak sawah. Dari data diterima Waspada, Kamis (12/4) dari 22 kelompok tani luas lahan yang akan menerima bantuan mencapai 859.62 hektare dari anggaran 1.600 Ha, dengan anggaran dana Rp 8.495.100.000 miliar, yang bersumber dari APBN. Ali sendiri mengaku, nantinya penyaluran akan diberikan sesuai permohonan kelompok tani yang masuk dan tentunya layak setelah dilakukan pemantauan langsung. “Saya berharap penyalurannya terbuka dan tidak berpihak pada Kecamatan tertentu,” ucap Anto warga Kecamatan Kuala pada Waspada.( cda)

BEBESEN (Waspada) : SPBU penyalur BBM di Kampung Tan Saril, Bebesen, Aceh Tengah terbakar, Kamis (12/4) pagi. Tak ada korban jiwa maupun luka-luka dalam kejadian naas itu. Namun sebuah mobil Datsun BL 8403 G memiliki dua tangki rakitan yang diduga ingin menimbun BBM hangus dan sumber api berasal dari kendaraan. Kerugian ditaksir mencapai ratusan juta rupiah. Kapolres Aceh Tengah, AKBP Dicky Sandoni, Kamis (12/4) di TKP menyebutkan, kronologis kejadian bermula dari kendaraan yang mengisi bensin berlebihan di SPBU itu. “Menurut Marwan, petugas SPBU, awalnya dia memperingatkan pemilik mobil, bensin yang telah diisi bocor. Namun pemilik mobil tak mengindahkan teguran petugas, dan ketika kendaraan itu dinyalakan, percikan api kemu-

Anggaran Dinas Kehutanan Minim NAGAN RAYA (Waspada) : Melalui Dinas Kehutanan dan Perkebunan Kabupaten Nagan Raya lakukan program penanaman pohon sebanyak 13.0150 batang bagi seluruh wilayah dalam lingkup Kabupaten. Kabid Kehutanan Harianti Nova, S.Hut.MSi kepada Waspada Kamis (12/4) mengatakan, hingga saat ini sudah 7,000 batang pohon tertanam, dengan sasaran penanaman Ujung Fatihah Kecamatan Kuala- Kecamatan Darul Makmur, yakni jalan nasional. Dikatakannya juga, penenaman nantinya akan terus menyebar hingga lingkungan sekolah maupun perkantoran. “Jenis pohon yang ditanam trenbesi mahoni dan ketapang, yang cukup dikenal tinggi Co2, dengan usia bibit satu tahun,” kata Harianti diruang kerjanya. Dengan dilakukannya program penanaman pohon yang diperogram pemerintah pusat itu, kiranya menjadi harapan besar untuk mencegah terjadinya pemanasan global yang sangat dikhawatirkan. Mengenai anggaran Harianti mengatakan bersumber dari dana Otonomi Kusus (Otsus). Pihaknya hanya menyelenggarakan dan menjalankan program itu saja, dengan pola kerja sewakelola di bawah pantauan Rehabilitasi Hutan dan Lahan (RHL). Dimana seluruhnya dibawah kordinasi Provinsi. (cda)

Waspada/Khairul Boangmanalu

INSIDEN DI TRAFFIC LIGHT: Insiden pelanggaran masih tinggi di seputaran traffic light di Jalan T Umar Subulussalam. Pada foto, pengendara sepedamotor yang terjatuh persis di antara traffic light sedang dibantu warga, Kamis (12/4).

Warga Penanggalan Desak Qanun Pemekaran Desa SUBULUSSALAM (Waspada): Sejumlah komponen warga Desa Penanggalan, Kec. Penanggalan, Subulussalam mendesak DPRK Subulussalam menerbitkan qanun pemekaran desa menyusul pengesahan anggaran terkait melalui paripurna DPRK, Desember 2011 lalu. Salah seorang warga, Darmin Tinambunan, Kamis (12/4) di Penanggalan mengatakan, permohonan pemekaran Desa Penanggalan malah telah digaungkan warga setempat sejak 2002 silam, saat daerah ini masih berada dalam wilayah Kabupaten Aceh Singkil. “Waktu itu, Ketua Panitianya Bapak Syarifuddin Padang, Ketua Komisi A DPRK Subulussalam sekarang,” tutur Darmin sembil berharap, Ketua Komisi A bisa mensiasati agar qanun pemekaran secepatnya dibuat. Secara terpisah, Syarifuddin Padang mengakui kalau pasca pengesahan anggaran terkait, pihaknya menerima proposal usulan 11 pemekaran desa. Namun diakui, usulan pemekaran desa pada 2012 se-Kota Subulussalam hanya tujuh desa, yakni tiga di Kec. Penang-galan dan masing-masing dua desa di Kec. Simpang Kiri dan Sultan Daulat. “Kita akan melakukan evaluasi layak atau tidaknya desa yang minta dimekarkan,” terang Syarifuddin. (b28)

Kuasai 600 Ha Tanah Tanpa IUP, Pemerintah Diminta Ambil Sikap SUBULUSSALAM (Waspada): Disinyalir sekira 600 hektare tanah di Kec. Longkib, Subulussalam, dikuasai tanpa Izin Usaha Perkebunan (IUP), pemerintah setempat diminta jeli dan segera mengambil sikap. Syahril Tinambunan, Ketua LSM Berkah Subulussalam, Kamis (12/4) di Penanggalan mengatakan, penguasaan lahan di sana sangat merugikan masyarakat dan terkesan mengabaikan peraturan pemerintah maupun UU. Dikatakan, dari mediasi yang dilakukan unsur Muspika Longkib dihadiri Camat Mawardi, Kapolsek Adriamus, mantan camat Topan Bakti, LSM Berkah, Tompel (Kelompok Tani Madina) dan Ruli Tarigan (pemilik lahan tanpa IUP), Selasa (10/4), kepemilikan tanah oleh Ruli Tarigan disinyalir hanya berdasarkan surat izin garap dari masyarakat.(b28)

PNS Di Agara Pertanyakan Rapel Kenaikan Gaji KUTACANE (Waspada) : Ribuan Pegawai Negeri Sipil (PNS) di Aceh Tenggara mulai cemas dan mempertanyakan pembayaran rapel kenaikan gaji tahun 2012. Pasalnya sampai memasuki medio April ini ,realisasi pembayarannya belum jelas. Awalnya, ujar beberapa PNS , pembayaran rapel kenaikan gaji itu dibayarkan beberapa hari setelah pembayaran gaji seluruh pns, namun anehnya sampai sekarang belum ada kejelasan kapan rapel kenaikan gaji PNS itu dibayarkan. Padahal, kata sumber Waspada, pembayaran rapel gaji terkait kenaikan gaji PNS sebesar 10 persen sesuai isi PP Nomor 11 Tahun 2011. Pembayaran rapel kenaikan gaji itu merupakan hak PNS yang harus dibayarkan Pemkab yang bersangkutan. Informasi sebelumnya, rapel kenaikan gaji disebut-sebut bakal dibayar dua hari setelah tanggal 2 April, akhirnya mundur lag menjadi tanggal 8 dan kemudian mundur lagi menjadi tanggal 10 April 2012, tapi tak ada satupun angin segar jadi kenyataan. Menurut beberapa sumber di kantor bupati dan dinas terkait di Agara, molor dan belum pastinya jadwal pembayaran rapel kenaikan gaji PNS di Agara terhitung dari Januari hingga Maret 2011 itu, akibat Suhailuddin Kadis DPKKD tak berada di tempat dan sedang tugas keluar daerah, sebab itu proses pencairan belum bisa dilakukan. Kadis Pengelolaan Keuangan dan Kekayaan Daerah (DPKKD), Suhailuddin hingga berita ini dikirimkam Kamis (12/4) belum berhasil dikonfirmasi. (b26)


Waspada/Irwandi MN

SPBU di Tan Saril, Aceh Tengah yang hangus dilalap api, Kamis (12/4) pagi. Kerugian akibat musibah tersebut mencapai ratusan juta rupiah.

Kapolres Gayo Lues Tindak Pendemo Anarkis BLANGKEJEREN (Waspada) : Pascaaksi demo massa kandidat cabup/cawabup Irmawan – Yudi yang berlangsung selama dua hari, terlihat aktivitas kantor, dinas, badan di lingku-ngan Pemerintah Kabupaten Gayo Lues lumpuh. Pasalnya, para PNS takut dan was-was dari aksi massa pendemo yang anarkis, pusat kota Blangkejeren juga terlihat sepi tidak seperti bia-sanya, begitu juga dengan pusat pasar belanja, masyarakat hati-hati keluar rumah, takut aksi demo terulang lagi. Sementara, di depan Pendopo Bupati Gayo Lues, tepatnya jalan besar protokol itu terlihat penjagaan yang ekstra ketat dari pasukan TNI, Brimob dan Tim Gegana. Selain itu, gedung kantor DPKD, Setdakab, Pertambangan, dan gedung lainnya di jaga ketat pasukan keamanan. Pantauan Waspada, Kamis (12/ 4), saat ini tidak tampak satupun pendemo dari kubu Irmawan – Yudi yang beraksi. Menurut informasi yang dihimpun, massa dari kubu Irmawan – Yudi sudah membubarkan diri dan hanya terlihat petugas keamanan yang ber-

jaga-jaga di seluruh persimpangan jalan kota Blangkejeren. Kapolres Gayo Lues AKBP Sofyan Tanjung mengatakan, sebagian kotak surat suara sudah diamankan di Polres Gayo Lues sesuai surat permintaan dari KIP Gayo Lues. “Demi keama-nan kita tempatkan di Mapolres Gayo Lues untuk menjaga dari amukan massa,” ujar Kapolres. Pascademo, Sofyan Tanjung mengatakan, telah ada penam-

bahan pasukan keamanan satu pleton dari Brimob Aceh Tengah, Aceh Tenggara, Lhokseumawe, tiga tim Gegana dan tiga SSK Brimob dari Polda Aceh, satu SSK ber-jumlah 120 orang. “Semua pasukan sudah siap siaga di MapolresGayoLues,” jelasSofyan Tanjung. Kapolres menegaskan, akan menindak pelaku anarkis yang membakar fasilitas negara seperti beberapa kantor camat dan kantor KIP. (cjs)

Waspada/Jasvira Sautisa

KONDISI Kota Blangkejeren masih terlihat sepi pasca demo anarkis pendukung Irmawan-Yudi. Seperti terlihat di truk pasukan dari Brimob dan Gegana parkir di depan Bank BPD Aceh, Kamis (12/ 4).

Tahapan Pilkada Aceh Tengah Bakal Tertunda TAKENGEN (Waspada): Panwas Aceh Tengah sudah mengeluarkan surat rekomendasi penghentian sementara tahapan Pilkada. Yunadi HR, Ketua Panwas dalam surat resminya meminta KIP untuk mempertimbangkannya. Sementara itu, seluruh kotak suara yang seharusnya diamankan di KIP Aceh Tengah,

beralih ke Mapolres. Kapolres Aceh Tengah AKBP Dicky Sandoni memberikan jaminan bahwa kotak suara akan aman di kantornya. “ Bukan, bukan saya yang menjadi KIP Aceh Tengah. Namun masa yang melakukan demo ke kantor KIP, mempercayakan polisi untuk mengamankan kotak suara,” papar Kapolres

Aceh Tengah, Kamis (12/4). Dalam aksi demo di kantor KIP, Rabu (11/4) masa pendukung 10 kandidat bukan hanya meminta keterangan KIP tentang penyelenggaran Pilkada yang melanggar aturan, namun mereka meminta Kapolres Aceh Tengah untuk menjamin keamanan pilkada di Aceh Tengah. (b32)

Ibnu Menatap Rumahnya Terbakar NASIB tragis menimpa Ibnu Abas, 42, Kaur Desa Kampong Blang, Dusun Meunasah Teungoh, Kec.Simpang Tiga, Kabupaten Pidie. Ia hanya bisa menatap rumahnya terbakar pada saat seluruh warga desa tempatnya berdomisili itu, sedang merayakan kenduri Maulid Nabi besar Muhammad SAW, Kamis (12/4). Beruntung saat kejadian, api cepat dipadamkan oleh warga yang kebetulan sedang ramai berkumpul di meunasah sehingga rumah tradisional adat Aceh yang terbuat dari kayu dan beratapkan seng hanya seba-

gian terbakar. Kendati begitu kerugian ditaksir Rp50 juta. Ibnu Abasv mengatakan, saat peristiwa itu terjadi dirinya sedang berada di meunasah. Sedangkan di rumah, istri dan anak-anaknya sibuk mempersiapkan makanan kenduri untuk tamu undangan. Namun tiba-tiba keluar percikan api dari wayer listrik dan langsung menyambar ke dinding dan menyambar atap. Mengetahui api mulai membakar sebagian rumah, lalu anak-anaknya melaporkan peristiwa itu kepada warga. Dalam waktu sekejab warga

yang sedang berkumpul di meunasah langsung memberi pertolongan memadamkan api, sehingga rumah tersebut hanya sebagian yang terbakar. Ekses dari peristiwa tersebut, lemari dan tempat tidur beserta isiisinya ludes terbakar. Sementara kebakaran diduga akibat arus pendek listrik. Camat Simpang Tiga Iskandar Abas didampingi Kepala Desa Kampong Blang mengatakan, pihaknya telah melaporkan kebakaran rumah Ibnu Abas kepada Dinas Sosial, Kab. Pidie. Dalam waktu singkat, bantuan masa panik untuk 10 jiwa penghuni rumah itu disalurkan. (b10)

Waspada/Muhammad Riza.

WARGA Desa Kampong Blang, Kec.Simpang Tiga, Pidie, Kamis (12/4) membersihkan puing-puing rumah milik Ibnu Abas yang terbakar diduga akibat arus pendek.

dian menyambar mobil dan SPBU ini,” papar Dicky, mengutip keterangan Marwan, yang dijadikan polisi sebagai saksi atas peristiwa itu. Melihat konstruksi mobil yang memiliki tangki rakitan, lanjutnya, ada upaya penimbunan BBM ingin dilakukan pemilik mobil. “Kami sedang mencari pemilik Datsun ini. Sementara telah dilakukan pengamanan di TKP. Selanjutnya kami melakukan pengembangan terkait kejadian ini,” katanya. Pemilik SPBU, Imaduddin mengatakan, akibat musibah itu pihaknya mengalami kerugian Rp400 juta. “Yang jelas pompa SPBU sudah tidak layak pakai lagi. Namun untuk bensin yang telah musnah saya tidak bisa pastikan berapa jumlah kerugian karena dipasok sore kemarin,” papar Imaduddin. (cb09/b32)

Tagore Laporkan Kecurangan KIP Ke MK REDELONG (Waspada) : Karena merasa dicurangi oleh Komisi Independen Pemilihan (KIP) Bener Meriah, pasangan Calon Bupati Tagore AB dan CalonWakil Bupati Bener Meriah Aldar AB akan melakukan tuntutan ke Mahkamah Konstitusi (MK). Hal ini seperti yang dikatakan Tagore, Kamis (12/4) usai dirinya menerima sejumlah laporan dugaan kecurangan yang dilakukan oleh KIP. “Saya menerima pesan singkat bahwa KIP menerima sejumlah uang dari salah satu pasangan lain untuk memenangkannya dalam Pilkada ini,” ungkap mantan Bupati Bener Meriah ini. Anggota KIP diduga telah menerima sejumlah uang di Hotel Renggali, Aceh Tengah pada 2 April. Selain itu, indikasi kecurangan itu mulai dari penggelembungan jumlah suara di sejumlah TPS, pihak KPPS juga menghalang-halangi warga tidak datang ke TPS untuk memilih dan memberikannya sejumlah uang, agar surat suara tersebut dapat dimanipulasi. Di salah satu TPS di Kampung Gunung Tunyang, Kec.Timang Gajah. Terdaftar dalam DPT yang memilih 285 orang, tetapi surat suara yang dicoblos 304 suara. Ahmadi, Ketua KIP Bener Meriah memban-

tah tuduhan itu. Dia bersumpah tidak melakukan kecurangan apapun dalam Pilkada ini. “Saya siap digantung jika terbukti melakukan kecurangan memenangkan salah satu kandidat. Saya akan tuntut balik karena mereka telah memfitnah dan melakukan pencemaran nama baik ,” tutur Ketua KIP. Namun dia mengakui ada bertemu dengan Nasir AK dan Sarkati di Hotel Asean Medan berbicara tentang memenangkan Tagore. “Memang kami ada bertemu. Nasir menanyakan bagaimana cara memenangkan Tagore. Ya saya jelaskan caranya, karena mereka bertanya,” aku Ahmadi. Ahmadi juga menyangkal menerima sejumlah uang dari salah satu kandidat peserta pilkada di Hotel Renggali, Takengen. “Saya bertemu Firmandes, anggota DPRA dan pertemuan sesama teman, saat beliau mengikuti kampanye pasangan Zikir di Aceh Tengah,” papar Ahmadi. Pihak Tagore telah melaporkan semua kecurangan yang diduga dilakukan KIP kepada Bawaslu RI, Panwaslu Aceh dan Panwaslu Bener Meriah agar diusut. (b33)

KIP Banda Aceh Bisa Digugat Hilangkan Hak Pilih Warga BANDA ACEH (Waspada): Komisi Independen Pemilihan (KIP) Kota Banda Aceh bisa digugat bila benar hampir separuh warga Banda Aceh dihilangkan hak pilihnya akibat unsur kesengajaan oleh penyelenggara Pilkada. “Tidak mungkin begitu banyak penduduk tidak mencoblos pada 9 April 2012 lalu kalau bukan karena ada skenario yang dibikin penyelenggara pemilihan itu untuk kepentingan kandidat tertentu,” ungkap pengacara senior di Aceh, Saifuddin Gani, SH di Banda Aceh, Kamis (12/4) petang. Sebelumnya Gerak Indonesia yang dipimpin Akhiruddin Mahyiddin menyebutkan banyaknya warga Banda Aceh, tidak memilih bukan mau golput tetapi mereka tidak mendapat surat undangan dari petugas penyelenggara Pilkada. Tercatat 153.000 orang warga kota yang masuk Daftar Pemilih Tetap (DPT), hanya 91.000 yang menggunakan hak pilihnya. Dari jumlah itu, 89.000 suara sah dan sekitar 2500 suara rusak. Sedangkan 61.500 orang tidak ikut Pilkada. Artinya, ada sekitar 40 persen lebih suara tidak memilih. Menurut Acun, lawyer ini akrab disapa, sangat ironis jika benar ada separuh penduduk kota tidak mendapatkan hak pilihnya. Karena jika KIP bekerja profesional hal ini tidak mungkin terjadi. Sebaliknya kalau lembaga itu bekerja untuk memenangkan kandidat tertentu bisa saja hal semacam itu terjadi, terutama dalam mendata pemilih atas dasar kepentingan untuk kandidat tertentu. Jika dugaan ini benar, lanjut Acun, maka sangat berbaya bagi proses demokrasi di Indonesia dan Banda Aceh khususnya dan lembaga itu bisa digugat oleh kandidat yang merasa pendukungnya dihilangkan haknya atau warga Banda Aceh yang merasa haknya telah dihilangkan oleh KIP setempat. Dugaan ada skenario dari kandidat tententu yang bermain dengan rapi, bisa saja terjadi kalau mengacu dari laporan Gerak Indonesia yang merilis separuh warga Banda Aceh tidak diberikan hak mencoblos pada hari pemungutan suara. Penelusuran GeRAK Indonesia

Caranya? Sebut Akhiruddin, surat undangan tidak dibagikan. Begitu warga datang ke TPS, ternyata, namanya juga tidak tercantum, sehingga dalam Pilkada 2012 ini mereka kehilangan hak pilihnya. Padahal, lanjut Akhiruddin, warga yang namanya tidak tercantum dalam DPT, adalah warga asli Kota Banda Aceh. Nama mereka tercantum dalam KK baik KK yang lama maupun yang baru, juga KTP baru. Ironisnya, dalam satu rumah, misalnya ada empat orang yang pempunyai hak pilih, tapi hanya satu orang yang mendapat kartu undangan. Seperti warga di Aspol Kuta Alam. Untuk Kecamatan Kuta Alam, dilaporkan sedikitnya ada 15.000 warga yang kehilangan hak pilih. Kemudian di kawasan Lampase Kota, ada sekitar 8.000 warga yang tidak datang ke TPS. Begitu juga di kawasan Uleekareng, lebih 5.000 warga tidak datang ke TPS. Umumnya, warga yang tidak mendapat surat undangan itu berada di basis atau kantong-kantong salah satu pasangan calon Wali Kota Banda Aceh yang merupakan saingan berat calon incumbent, Mawardy Nurdin-Illiza Sa’aduddin Djamal. (b01)

Intimidasi Warnai Pilkada Aceh BANDAACEH (Waspada): Pemantau Pilkada Aceh yang berkantor di Bangkok, Thailand, ANFREL merilis sejumlah kejadian pada 9 April saat pencoblosan. Hasil pemantauan lembaga ANFREL dipaparkan kepada wartawan, Rabu (11/4) di Hotel Oasis Banda Aceh. Ketua ANFRELl Asia, Damaso Magbual menjelaskan, pada hari pencoblosan, ANFREL mengamati beberapa masalah yakni staf TPS memasuki bilik suara meskipun tidak diminta, petugas itu mengarahkan pemilih untuk memilih calon tertentu. Intervensi lain sering datang dari pendu-kung partai yang hadir di banyakTPS, mereka mondarmandir di sekitar tempat pemungutan suara. Tim pemantau Komnas HAM juga mencatat sejumlah kasus intimidasi saat melakukan pemantauan di sejumlah daerah di Aceh. “Kasus yang ditemukan itu merupakan tugas polisi untuk menindaklanjutinya hingga ke pengadilan,” kata Ketua Komnas HAM Ifdhal Kasim di Banda Aceh. (cb01)

Illiza : Kemenangan Seluruh Warga Banda Aceh BANDAACEH (Waspada) : Calon Wakil Wali Kota Banda Aceh Illiza Saaduddin Djamal mengaku kemenangan pasangan MawardiIlliza pada Pilkada 2012 ini adalah kemenangan bagi seluruh warga Banda Aceh. “Pesta ini milik masyarakat, bukan milik Mawardi-Illiza. Untuk itu, kami harus membuktikan kemenangan itu dengan menjalankan visi dan misi kami bisa terwujud lima ke depan,” papar Illiza dalam percakapan khusus dengan Waspada di Banda Aceh, Rabu (11/4). Kenapa warga kembali memilih pasangan Mawardi-Illiza? menurut Ketua PPP Kota Banda Aceh itu, karena salah satu pertimbangan warga memilih yaitu telah menyaksikan dan melihat prestasi pasangan incumbent ini dalam lima tahun lalu. “Kita telah memberikan fakta bukan janji,” ujar Illiza. Selain itu, hubungan yang harmonis pasangan ini dengan semua stakeholder berjalan dengan baik. Kata dia, faktor keteladanan pasangan Mawardi-Illiza membuat warga begitu tertarik memilih kembali, di samping hubungan yang dibangun pemerintah kota dengan semua pihak, seperti para ulama, tokoh masyarakat, pemuda dan komponen lainnya.

Begitu juga, kata dia, hubungannya dengan kapasitas perempuan di Banda Aceh sangat baik dan ini terbukti ketika kampanye Mawardi-Illiza, ribuan kaum hawa hadir dengan bagitu semangat walaupun saat itu dalam keadaan hujan. “Jadi, saya pikir kaum perempuan cukup banyak memilih pasangan nomor urut 4 ini,” tuturnya. Ketika ditanya program apa saja yang diprioritaskan untuk tahun pertama? menurut Illiza, pihaknya akan segera melakukan konsolidasi dengan berbagai pihak, terutama dengan ulama. Menyinggung tentang banyaknya warga yang tidak memilih alias golput berkisar sampai 40 persen, menurut Illiza, itu karena bertepatan hari libur panjang sehingga banyak warga mamanfaatkan hari libur dengan keluarga keluar daerah. Bahkan, ada juga warga tidak memilih karena tidak mendapat undangan. Karenanya, di akhir pembicaraan Illiza mendengar adanya selentingan pihak yang merasa tidak puas dengan hasil Pilkada ini dengan ingin mengajukan gugatan ke Mahkamah Konstitusi. Menurutnya, hal itu tidak perlu dilakukan, karena semua itu bisa diselesaikan dengan cara yang baik. Apalagi, sebelumnya telah mengikrarkan pilkada damai. (b02)


Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Ar-Ridho Jl. A.R. Hakim Gg. Sepakat No. 6 Al-Chairat Jl. A.R Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Makmur Jl. A.R. Hakim Gg. Langgar/Bahagia No. 25 Al-Manar Jl. Laksana No. 47 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Al-Utaminiyah Jl. Utama Gg. H. Syukur No. 1 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jami’ Darul Ikhlas Jl. Batu No. 13 Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. B-A T.S. III Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Dr. Sun Yat Sen No. 71 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Nurul Huda Jl.Denai Gg. Pinang No. 12 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Rahmat Jl. Denai Gang I No. 2 Silaturrahim Jl. Emas No. 10 Silaturrahim Jl. Bromo Gg. Silaturrahim No. 11 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Jl. Puri Komplek Masjid Taqwa No. 183 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Drs. Alwi Batubara Muchlis Muaz, S.HI H. Arif Muhammad Erde, Lc Syahril Bashrah, S.HI, S.Pd.I Tagor Muda Lubis Drs. H. Usman Batubara Drs. Ade Mustahdi Ali Dahriun Harahap, S.Ag H. Zuhri Nasution, Lc Prof. DR. Lahmuddin Lubis, M.Ed Drs. H.M. Salim H. Jamaluddin, Lc H.M. Fajar Hasan, MA Safwan Drs. H. Darwansyah Simanjuntak M. Tuah Sirait, MA H. Yazid Syamsuddin, Lc Drs. H. Mashudi Hajar Mustafa Lubis, S.Q. H. Muhammad Yahya Musdar Bustamam H. Rumalis Drs. H. Yahya Indra Syafruddin Sinaga, S.Pd.I Drs. H. Lukman Hakim, M.Pd H. Bahauddin Nasution, Lc H. Mhd. Yusri Indra, Lc Drs. Usman Abdillah H. Ismail Malik Drs. Sunaryo K.H. Munawar Chalil Mex Zainis Chaniago Drs. H. Agus Thahir Nasution Bahril Datuk, SE, MM Jamaluddin Al Bathani

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Kel. Harjosari II Al-HidayahMapolda Sumut Jl.S.M. Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I Kel. Harjosari II Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Ikhlashiyah Jl. Garu-I No. 69 Kel. Harjosari-I Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ridho Shobirin Jl. Garu IV Harjosari I Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VI Kel. Harjosari I Shilaturrahim Jl. Garu III No. II-G Kel. Harjosari-I Salman Jl. STM Kel. Sitirejo II Raya Taqwa Jl. S.M. Raja Km. 5,5 No. 1 Kel. Harjosari-I Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1-B Tarbiyah Lingk. I Kel. Siti Rejo II

Muntaqo Drs. H. Sutan Syahrir Dalimunthe H. Nazhar Daulay, Lc, S.Pd.I H. Fauzi Lubis, MA Heri Siswan, S.HI Drs. H. Akhdar Bunayya H. Burhanuddin Nur, Lc M. Hasby Almawardhi Lbs. S.Ag Drs. M. Tholib Harahap H. Hanafi Ismed, Lc, MA Imam Yazid, MA Drs. Maimuddin Cibero Drs. M. Nuh, SH, MH Drs. H. Yahya Tambunan Abd. Rahman, S.Pd.I Rusli Effendi, S.Pd.I Arifin, S.Ag Drs. M. Idris Hasibuan Drs. H.M. Nasir, MA Drs. Mustaman Batubara, MA M. Arifin, M.Ag Muhammad Rojai, S.HI, S.Pd.I

MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Amanah Jl. Diponegoro No.30-A Kom.Gd.Keuangan Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Bulan Jl. Letjend. Jamin Ginting Gg. Masjid No. 1 Iklab Jl. Letjend. Jamin Ginting Km. 1,27 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede 42 Nurul Huda Jl. K.H.Wahid Hasyim Asrama Brimob

Drs. H. Abdul Rahman DR. H. Ahd. Zuhri, Lc, MA H. Surianda Lubis, MA Asmu’i Lubis, S.HI Abror Parinduri, S.Pd.I Drs. H. Qamaruddin, S. Drs. Rajuddin Harahap, S.Ag H.M. Rusli Yusuf Drs. M. Sholihul Amri Drs. H.T. Baharudin, S.

MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 15 At-Taqwa Jl. Putri Hijau No. 14 Asy-Syafiah Jl. Karya Dalam (Depan kantor Lurah) Al-Furqan Jl. Karya 2 Lingk. XI Kel. Berombak Al-Jihad Jl. K.M. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Massawa (Arab) Jl. Temenggung No. 2-4-6 Al-Wiraji Jl. Karya Gg. Sosro Lingk. XVI Kel. Karang B. Baitus Syifa Jl. Putri Hijau Rumah Sakit Tembakau Deli Jami’ Jl. Merdeka No. 3 Pulau Brayan Kota Muslimin Jl. Karya Lingk.XVII No.41 Karang Berombak Nurul Islam Jl. Karya Lingk.VIII No.203 Kel.K.Berombak Nurul Haq Jl. Listrik No. 12 Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Syuhada Komplek Trikora Jl. Danau Toba No. 2 Taqwa Jl. Karya Gg. Madrasah No. 24

Achyar, S.Pd.I Drs. Azwani Lubis, M.Ag H.M. Nasir Drs. H. Mahyuddin Nst., M.Ag Drs. Zulkarnaein Hasibuan Drs. H. Sa’dullah Ahmad Drs. H. Azhar Sitompul, MA Drs. Saukani Muda, MA Drs. Hisyam Dalimunthe Munawir Prof. Dr. Asmuni, MA Drs. Gazali Umar H.M. Nasir DR. H. Raihan Nasution, MA Drs. Manaon Batubara Drs. H. Hasanuddin Harun Syafruddin Syam, MA Drs. H. Burhanuddin, MA

MEDAN BELAWAN Jami’ Belawan Jl. Selebes Belawan

H.T. Ahmad Bakri

MEDAN DELI Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Ridha Komplek TNI-AL Barakuda Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Iklas Jl. Alumunium II Lingk. XII Tg. Mulia Al-Jihad Jl. Mangaan I/Jl. Bahagia Raya Lingk. VI Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Jam’iyyatush Shoolihin Kel. Tg. Mulia Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Nurul Iman Jl. Sidomulyo Ujung Kel. Tg. Mulia

As-Syarifah Jl. Pembangunan Kompl. Pondok Surya H. Fahmi Mahyar Al-Falah Jl. Palem Raya Perumnas Helvetia Drs. M. Idris Ginting Al-Huda Jl. Balai Desa/Beringin V No. 116 Kel. Helvetia H. Sudirman, Lc Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Drs. Mahyuddin Daulay Al-Hasanah Jl. Setia No. 41 Tg. Gusta Jauhari Marpaung, S.Ag Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Drs. M. Yusuf Tanjung Al-Ikhas Jl. Teratai II Blok 18 Perumnas Helvetia Khairul Adenan Al-Ikhlas Jl. Jongkong Komplek Dolok Sumut Parlindungan Batubara Al-Ikhlas Jl. Setia Luhur No. 180 Lingk. XI Dwikora Drs. Irham Hasibuan Al-Mustaqim Jl. Kapten Muslim No. 226 Tamrin Butar-butar, S.Ag, S.Pd.I Al-Mukhlisin Jl. Bakti Utara No. 21 Lingk. VI Kel. T.Gusta H. Ponidi Sabari Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Zuany, S.Ag Al-Masturah Jl. Binjai Km. 7,8/Jl.Sekolah No. 29 Drs. H. Marasonang Siregar Darussalam Jl. Asrama No. 11 Drs. Tarmizi Dalimunte, S.Pd.I Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Drs. Lily Suheri Istiqomah Jl. Amal Luhur No. 86 Kel. Dwikora Drs. H. Mahmuddin Sirait Tjut Nyak Dhien Jl. Gatot Subroto/Jl. Rasmi No. 28 Zainun, MA Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah Drs. Satiman Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadomo Asrizal Tanjung, S.Sy. Taqwa Jl. Kapten Sumarsono Gg. Safar Erwandy, S.Ag Taqwa Jl. Kamboja Raya No. 319 Blok 4 Perum Helvetia Umar Sidiq, N.K. Taqwa Jl. Setia No. 30 Tg. Gustaq Drs. Budiman Taqwa Jl. Asrama No. 14-P Sei Sikambing V-II Ramli, S.Sos.I MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Annazhirin Jl. Karyawisata Kel. Gedung Johor Ar-Raudhah Komplek Risva I Blok V Kel. Gedung Johor Al-Amin Jl. Eka Surya Gg. Eka Kencana Gedung Johor Al-Badaar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. Karya Tani Lingk. VIII Pangk. Masyhur Al-Ikhlas Jl. Karya Kasih Baru Lingk. X Kel. P. Masyhur Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor Al-Muslimin Jl. Suka Luhur Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlisin Jl. Karya Sehati No. 14 Kel. P. Masyhur Al-Muhajirin Komplek Medan Permai Al-Mustafa Jl. Karya Jaya Gg. Karya XII-XIV Baitul Iman Jl. Karya Jaya Asrama Arhanudse II/BS Baiturrahmah Jl. Karya Jaya No. 101 Pangk. Masyhur Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. Pangk. Masyhur Sholihin Jl. Karya Jaya No. 160-G Gedung Johor

Prof. Dr. Ir. H. Basyaruddin, MS Drs. H. Ali Husin Siregar Drs. Fakhruddin Rokan Drs. H. Syamsuddin Hasan Drs. Ali Muddin Siregr, MA Sofwan Harahap, S.Ag Drs. Kasron Hasan Nst., MA Ahmad Faisal Nasution, MA Drs. H. Khairuddin Siregar H. Samsuddin Nasution, S.Ag H. Sugianto, Lc, M.Ag Drs. Fahrozi Drs. H. Syarifuddin Nasution M. Yaser Arafat, S.Sos Drs. Mahyudin Azro Drs. H. Syamsul Basri Tamar Drs. Rusli Tanjung Badri, S.Ag Defrizal Lubis, S.Pd.I Drs. Jafar Drs. H. Nazaruddin Hasibuan Drs. H. Saffaruddin Daulay Drs. H.A. Syaukani DR. H. Zamahsyari, MA Arif, SH, MH. Zulkifli Harahap, S.Pd.I Ir. H.MMB. Damanik, MSc Prof.Dr.H.M. HasballahThaib, MA Dr. H. Khaidir Tanjung Drs. Wahid Hasan Drs. H. Syamsuddin Hasan Abdulah Baihaqi, S.Fil.I

MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Huda Jl. Kemiri III No. 28 Simpang Limun Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Mashun Jl. Sisingamangaraja Al-Muttaqin Jl. Amaliun/Panduan Tenaga Gg. Tengah Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Hikmah Hongkong Plaza Jl. Cerebon Islamiyah Jl. Jati III No. 85 Kel. Teladan Timur Muslimin Jl. Air Bersih Lingk. VII Sudirejo I Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Ridho Bakti Jl. Air Bersih Lingk. IX, Kel. Sudirejo-I Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7 Yayasan Zending Islam Indonesia Jl. SM. Raja No. 11-A

Dr. H. Hasan Mansur Nst., Hsb. Drs. Ahmad Wazir Drs. H. Rusli Tanjung Drs. Son Haji Harahap Tenerman, S.Sos H. Zulfikar Hajar, Lc Misnan Al Jawie, SH, M.Hum Drs. H. Usman Batubara Drs. Waldemar Gazali Deliman Siregar, S.Ag H. Mara Jaksa Harahap, S.Ag Prof. DR. H. Asan Asari, MA Drs. H. Hafidz Ismail Prof. DR. H. Amiur Nuruddin, MA Drs. H. Dahrul, MA Drs. H. Abdul Razak Drs. H. Kasman, MA Husni Mubarak H. Jasmi Assuyuthi, Lc Thoib Hasan Lubis, S.Pd.I

MEDAN LABUHAN Al-Amal Jl. Banten Gg. Amal No. 170 Dusun IX-A Sofyan, BA Al-Husain Jl. Jala Raya Griya Martubung Drs. Sugiman Al-Mukarramah Kampung Besar Darat Kel. Martubung Drs. Adlansyah Baitul Ikhwan Jl. T. Lestari 12/9198 Blok V Gr. Martubung H. Hasan Basri Jamlus Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal H. Zainul Arifin Harahap Raya Al-Osmani Labuhan - Deli Drs. A. Nizar, S.Pd.I MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Ar-Rahman Jl. Brigjen Katamso Gg. Perbatasan Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Jl. Brigjen Katamso Gg. Mesjid No.53 Nurul Muslimin Jl. Juanda (bundaran) Kel. Jati

Junaidi Arsyad, MA M. Jamil, S.Pd.I Drs. Umar Rifai Hasibuan, S.Pd.I H. Darwin Zainuddin, MA Drs. Agus Salim Drs. Alamsyah Ahmad H. Hasanuddin Hasibuan, Lc

MEDAN MARELAN Drs. H.M. Fauzi Sunara Sofyan M.S. Drs. Mahyuddin Masykur Syamsul Bahri Sarwan Nasution, S.Pd.I H. Musyohur Siregar, S.Ag M. Nursyam Ashmarqandi, S.Ag. K.H. Mhd. Abd. Syukur Drs. Fahrul Rizal, M.SI Ahmad Husen, S.Pd Helmi Fahmi Dalimunthe, M.Ag

MEDAN DENAI Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Sudirman Ar-Ridha Jl. Camar 18 Blok II Perumnas Mandala Drs. Jontar Donggoran Al-Amanah Jl. A.R. Hakim Gg. Aman No. 90 Kel. TSM. Drs. Pantis Simamora Al-Ansor Jl. Raya Medan Tenggara Gg. Anshor No. 11 Hasan Basri, STh.I Al-Hidayah Jl. Menteng Indah VI Kel. Medan Tenggara H.M. Rajab, Lc, MA Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Drs. H. Muhiddin Gurning Al-Hasanah Perumnas Mandala Drs. H. Agus Salim Pardede Al-Muslimin Jl. Kenari XII Lingk. VII-VIII Per. Mandala Drs. Nadran Jamal Nasution Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Drs. H. Muri Damri Al-Mukhlishin Jl.Enggang I Perumnas Mandala Drs. Hasbullah Jakfar, MA Al-Quba Jl. Rawa Kel. Tegalsari Mandala II Drs. Razali Abdul Kahar Al-Ridha Jl. Jermal VII Drs. H. Nurman Almi Drs. H. Abu Bakar Adnan Srg., MA Baiturrahman Jl. Medan Tenggara VII No. 42 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Asroruddin Saidi Hijraturridha Jl. Selamat Ujung Gg. Subrak Sp. Limun Drs. Haitami Lubis Nurul Islam Jl. M. Nawi Harahap Badu Amin Nasution, S.Ag Nurul Iman Jl. Rawa I Lorong Sedar Drs. H. Ade Filham Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Drs. H. Muniruddin, M.Ag Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Khairul Zaman, S.FI Taqwa Jl. Jermal III No. 10 Drs. Syaifuddin Daulay Taqwa Jl. Pancasila Gg. Masjid No. 1 Kel.T.S.Mandala III Drs. Zulkarnaen Lubis, MA MEDAN HELVETIA Amaliyah Jl. Sakura I Lingk. II Blok-19 Perum. Helvetia Drs. H. Ponu Siregar An-Nur Jl. Budi Luhur No. 75-A Usman Matondang Ar-Raudhah Jl. Persatuan No. 22-AR Helvetia Timur Amirwan, S.Ag

Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Marelan

M. Rusli Nasution, S.Ag Drs. Muhammad Rais M.Pd.,MSc H. Jamaluddin, S.Ag T. Muslim Harun Suprapto

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Mahyuddin Tambunan, S.Ag Ar-Rahman Jl. Prof. H.M. Yamin SH No. 363 Drs. H. Ali Imran, Dj. Ar-Rahim Jl. M. Yacub Gg. Langgar Batu No. 24 Andi, S.Pd.I Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Drs. H. Taklaq Mahmud Ar-Ramlah Jl. Sejati No. 16 Drs. Bahari Ahmad Al-Amin Jl. Prof. H.M. Yamin SH, 482 Drs. H.M. Makmur Situmorang Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Darwis, S.Ag Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 33 Drs. H. Khairul Zilazan Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Zulfahmi Hutasuhut, MA Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Drs. Ibrahim Arbi, S.Pd.I Al-Hurriyah Jl. M. Yakub No. 17 Muhammad Saleh, S.HI, MA Al-Huda Jl. Malaka No. 117 Drs. H. Musa Yahya Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Fathul Hadi, S.Pd.I Al-Muslimin Jl. Gerilya No. 1 Drs. Mahmuddin Batubara Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Drs. Hasrat E.Samosir, M.Ag Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Drs. Husyairi Ikhwaniyah Jl. M. Yacub No. 3 Drs. H. Askolan Lubis, MA Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Amrar Mahfuzh Faza, S.HI Ikhlashiyah Jl.Sei Kera No. 314 Kel. Sei Kera Hulu Drs. A. Raja Pasaribu Istiqomah Jl. Bambu Runcing/Pahlawan Drs. Mahmuddin, M.Ag Jamik Al-Ikhwan Jl. H.O.S. Cokroaminoto Kel. S.K.Hulu Drs. M. Nurdin Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Drs. H. Muslim Wahid Siregar Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Drs. Rijal Harahap Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Drs. Safaruddin, MA Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan H. Julkarnain M., SH, CN Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Drs. Abdul Majid Syam Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat Ramadhan Damanik, S.Ag Taqwa Jl. Karantina Ujung Asrama TNI-AD Glugur Hong Syaripuddin Umar Lubis MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. Sei Putih Timur II Annas Kompleks Diskes Jl. Ibus Raya/Jl. Rotan

Drs. M. Sukri Asda, Nasution Damri Tambunan, S.HI, S.Pd.I

Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Ikhwan Jl. Mesjid No. 142 Kel. Sei Putih Tengah Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Setia Al-Mukarram Jl. Sikambin Gg. Patimura No. 9 Ubudiyah Jl. Kebun Bunga Kel. Petisah Tengah

WASPADA Jumat 13 April 2012 Drs. H. Syarifuddin Al Hayat Drs. Zainal Abidin H. Nazaruddin Idris, Lc Zulfahmi Drs. Ahmad Supriyadi Drs. Syahrul Nasution, M.Ag Drs. H. Zulham, ZA Ahmad Jais, M.Ag Syaiful Asro, M.Ag Drs. Syafruddin Syam, M.Ag Hasanuddin, S.Pd.I Drs. H. Ramlan Yusuf Rai

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Assakinah Jl. Polonia (Starban) Komp. Perum TNI-AU Al-Hidayah Jl. Komodor Udara Adi Sucipto Polonia Al-Hidayah Jl. Starban Kel. Sari Rejo Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Bakti Jl. Mongonsidi I Baru No 11 Baitut Tahmid KPPBC Tipe A2 Jl. Suwondo No. 1 Dirgantara Lanud Jl. Imam Bonjol No. 52 Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Hanudnas III Polonia Komp. Kantor Hanudnas TNI-AU Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

Ahmad Zaini, S.Ag Drs. M. Tholib Harahap, MA Drs. Imron Rokan Drs. H.M. Syafrudin Ramli Kardi Drs. H. Harianto Effendi H. Abdul Rahim, Lc, SA, S.Pd.I M. Nasir Anshori, S.HI Drs. H. Syarifuddin Sindha H. Al-Ahyu, MA M. Adlan Thoib Hasan, S.Pd.I

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. H. Solihin Dalimunthe Al-Amri Jl. Nusa Indah Asam Kumbang Ridwan Abbas, SH Al-Furqon Jl. Setiabudi Pasar I Tanjung Sari Azhar Arifin, SH Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Ramli Kardi Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Abdul Fatah Nur, S.Pd.I Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. H. Suparmin Sareh Al-Ikhlas Pasar 7, Padang Bulan Sofyan Sirait, S.Ag Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Drs. Zulkifli,S.Pd.I Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Muhyiddin Al-Muhtadun Jl. Karya Sembada No.179 Komp.KosernaDrs. Usmar Chan Al-Munawwarah Jl. L.Putra No. 19-A Komp. Kejaksaan Drs. Affan Su’aidi, S.Ag Baitul Mukmin Jl. Bunga Terompet V No. 6 Kel. P.B.S. Drs. H. Zulkarnain Jami’ Jl. Pasar I Lingk. VIII Kel. Tg. Sari Drs. H. Humala Harahap Muslimin Jl. Setia Budi Kel. Tg. Sari Drs. Affan Suaidi, MA Nurul Iman Kompl. Perhub. Jl. Penerbangan No. 77 Habibullah, MA Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan M. Arifin Nasution, S.Pd.I Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan H. Daud Yakub Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Azizon, SH, M.Hum Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. Abdul Khalik, SH Salamiyah Jl. Bunga Kesuma No. 50-D Kel. P.B.S. II Sugeng Raharjo, S.Ag Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 Dedi, S.Ag Prof. Dr. H. Ramli Abd.Wahid, MA Taqwa Kampus II UMA Jl. Setia Budi No. 79-B MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridho Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei.S. Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Basyir Jl. Garuda No. 78-B Sei Sikambing-B Al-Badar Jl. Binjai Km. 6,8 Medan Al-Falah Jl. Murni No. 27 Kel. Tanjung Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Istiqomah Dusun I Desa Pujimulio Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Jihad Jl. Sunggal No. 129 Al-Mukhlisin Jl. Darussalam/ Sei Rokan No. 2 Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Muhajirin Jl. Perwira No.18-A Kompl. Pondok Karya Al-Muhajirin Komp.BBLK Industri Jl. Gatot Subroto 7,8 Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Dermawan Jl. Rajawali No. 19 Sei Sekambing-B Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Muh. Jayak Jl.Jend.G.Subroto Km. 5,5 No.184A Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Hikmah PT. Perkebunan Nusantara-III Kandir Nurul Ikhsan Jl. Kelambir V No. 53-B Kel. Lalang Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Raudotussuffah Jl. Pinang Baris Kel. Lalang Riyadhussholihin Jl. Sunggal No.198 K.S.Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan Km. 13,7 Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Taqwa Sugeng Rejo Cabang Sei Sikambing-B

Syarifuddin Pasaribu, S.Ag Drs. Abd. Majid Sufriandy, S.Ag Drs. Tohiruddin Pohan Drs. H. Syahron Sulaiman H. Nazrul Fahri Drs. Lukman Hakim Hsb., M.Ag M. Khumaini Hamyar, S.Ag Ahmad Muttaqin Nasution Susanto, STHI Ali Imran H. Raden Taufiq H. Misto, AR H. Syarifuddin, Lc Drs. H. Soedarno Drs. Luqmanul Hakim Drs. H. Ahmad Suhemi Drs. Khairuman. ARS Hasanul Arifin, S.Ag Drs. Ruhiyat Prof. H. Nawir Yuslem, MA Maulana Ibrahim, S.Ag Drs. Idrus Uteh Drs. Asman Ali Nur Harahap Drs. H. Nazaruddin Hasibuan Drs. H. Suten Hasibuan Maulana Ismail, S.Ag Drs. H. Asnan Ritonga Drs. H. Abidin Azhar Lubis H. Sarwo Edi Harahap, S.Ag Drs. H. Mahmudin Sirait K. Tanjung Syafrizal Harahap, S.Ag Armat Nasution, BA Prof. Dr. H. HasballahThaib, MA Drs. H. Syahrinal Lubis Anang Anas Azhar, MA DR. H.M. Yakub Amin, MA Drs. Rahmad Pohan

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Ar-Ridho Kel. Sidorame Timur As-Sholah Jl. Pendidikan No. 39 Glugur Darat I Al-A’la Jl. Pembangunan No. 46 Kel. Glugur Darat II Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ikhlas Jl. Madiosantoso No. 197 Lingk. 14 P.B. Darat Al-Ihsan Jl. Jemadi No. 34 Pulau Brayan Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Qudus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Kel. Gaharu Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Jamik Jl. Kapten Muchtar Basri, BA Gg. Masjid No. 40 Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Rabithatul Muslim Lingk. 14 Glugur Kota Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Pulo Brayan Bengkel Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Ubudiyah Jl. Bambu III Kel. Durian Tabligh Tarjih Jl. Mustafa No. 1 G. Darat 1 Kp. Dadap

K.H. Nazaruddin Lubis H. Marhamin Tanjung, S.Ag H. Musohur Siregar, S.Ag Hariyono, S.Ag Drs. Juliardi Drs. Yose Rizal Lubis Edy Susanto, S.Ag Drs. Zainuri Suparman, S.Ag H. Mhd. David Sagita Putra, M.Ag Drs. Muhammad Drs. M. Yunan Silalahi Abdul Kadi Hasibuan, S.Pd.I M. Husni Ritonga, MA H. Amir Shalih, S.Ag Drs. H. Thohiruddin Nasution Drs. H. Usman Suher Drs. Yahya, M.Ag Drs. Hasbih Dasopang Drs. H. Zakaria Drs. H. Effendi Batubara Drs. M. Zuhri Pulungan H. Musdar Tambusai, Lc Habibi Sembiring, Lc Drs. H. Milhan Yusuf, MA Drs. H. Azwardin Nasution H. Zulkarnain Drs. H. Aspan Sianipar H. Rushkan Nawawi, BA Drs. H. Tukiman Drs. Mashul Drs. Zulkarnaen Lubis, MA Drs. H. Kasman, MA DR. Sudirman, MA

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan At-Tawwabin Jl. Pimpinan No. 1 Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih

Indra Suheri H. Naharman, S.Ag Drs. M. Yusuf Siregar Drs. Ahmad Dairobi Drs. Ahmad Syamsuri (Bersambung ke hal C5)

Mimbar Jumat

WASPADA Jumat 13 April 2012


Agar Tak Cemas Hadapi UAN


Gatot: Rajin Belajar Dan Banyak Berdoa Ujian Akhir Nasional (UAN) di depan mata. Kecemasan tentu membayangi di benak para pelajar yang akan menghadapi penentuan kelulusan mereka. Bayangan ketakutan tidak lulus UAN kerap mengantui para apelajar, sehingga justeru mengganggu ketenangan dalam menjawab soal-soal yang disajiakan. Agama Islam mengajarkan pada umatnya agar tidak mengalami kecemasan dalam menghadapi apapun, termasuk Ujian Nasional. Plt Gubernur Sumatera Utara, H Gatot Pujo Nugroho menghimbau segenap pelajar yang akan menghadapi UAN agar memperbanyak berdoa, melakukan usaha optimal yaitu belajar dan kemudian berserah diri kepada Al-

lah. “Hanya dengan demikian kalian dapat menghadapi Ujian Akhir Nasional dengan hati yang tentram, tanpa kecemasan,” ujar Gatot dalam kunjungannya di sekolah TK, SD dan SMP Islam TerpaduAl-IhyaTanjung Gading, Batubara, Selasa (10/4) lalu. Di hadapan ratusan pelajar yang hadir, Gatot memberikan motivasi agar anak-anak tidak lupa bersyukur kepada Allah SWT dan selalu rajin belajar dan tak lupa juga diiringi berdoa. ”Rajin-rajinlah belajar dan banyak berdoa, terutama bagi yang akan menghadapi Ujian Akhir Nasional,” ujar Gatot. Disadari bahwa para siswa yang menjadi peserta Ujian Akhir Nasinal pada umumnya mengalami kecemasan. Mereka takut jika tidak

mampu mengerjakan soal-soal dengan baik maka akan mengalami kegagalan, yang pada akhirnya mereka akan memikul beban moral yaitu perasaan malu, minder, bahkan kehilangan kepercayaan diri. Karena itu berdoa sangat penting dan menentukan, sebagaimana Firman Allah dalam Q.S Ar r’d: 28 yang artinya: ”(yaitu) orang-orang yang beriman dan hati mereka manjadi tenteram dengan mengingat Allah. Ingatlah, hanya dengan mengingati Allah-lah hati menjadi tenteram.” Ayat tersebut mengingatkan agar kita selalu berzikir atau mengingat Allah SWT agar memperoleh ketenangan, bebas dari kecemasan dan ketakutan serta ke-

khawatiran. Begitu juga bagi pelajar yang akan menghadapi ujian nasional yang pada umumnya mengalami kecemasan yang berlebihan, maka ayat di atas juga menguatkan kepercayaan bahwa dengan melaksanakan apa yang diperintahkan oleh agama akan membawa ketenangan batin. Selain berdoa dan berzikir mengingat Allah, Gatot juga berpesan agar para pelajar jangan mudah berputus asa dan menyerah. Karena menurutnya siapa yang memiliki cita-cita dan sungguh-sungguh berusaha mencapai cita-cita dengan bekerja keras dan tak pantang menyerah, maka dia akan berhasil kemudian. “Bukan hal yang tidak mungkin kalau 20 tahun ke depan kalian reuni

bersama teman-teman di tempat yang diinginkan, seperti di Me-kah, atau di Inggris dan lainnya. Nah, kalian harus bisa mengejar mimpi itu agar menjadi kenyataan,” katanya memberi semangat. Gatot mengatakan agar pelajar rajin dan selalu bersyukurlah kepada Allah SWT, serta jangan mudah menyerah. “Karena menyerah adalah perbuatan yang kurang disenangi Allah. Kuatkan hati mantapkan semangat agar cita-cita yang di angan-angankan tercapai. Tanpa semangat dan kekuatan hati, maka akan malas belajar, dan malas berdoa, padahal, semuanya adalah kunci keberhasilan menuju kesuksesan,” tandasnya.(m28)


BERIKAN SEMANGAT : Plt.Gubsu, H Gatot Pujo Nugroho ST mengangkat tangannya untuk memberikan semangat kepada siswasiswi ketika mengunjungi SD dan SMP Islam Terpadu Al-Ihya yang akan menyambut Ujian Nasional di Tanjung Gading Batubara, Selasa (10/4). Waspada/Ist.

BERDOA BERSAMA : Pl.Gubsu, H Gatot Pujo Nugroho ST berdoa bersama Siswa-siswi SD dan SMP Islam Terpadu Al-Ihya Tanjung Gading Batubara, Untuk Kesiapan Ujian Nasional, Selasa (10/4). Waspada/Ist.

FOTO BERSAMA: Plt.Gubsu, H Gatot Pujo Nugroho ST Merangkul dan Berfoto bersama sebelum meninggalkan Sekolah SD dan SMP Islam Terpadu AlIhya Tanjung Gading Batubara, Selasa (10/4).


SALAMI SISWA-SISWI : Plt.Gubsu, H Gatot Pujo Nugroho ST Menyalami Siswa-siswi sebelum meninggalkan Sekolah Dasar dan SMP Islam Terpadu Al-Ihya yang akan menyambut Ujian Nasional di Tanjung Gading Batubara, Selasa (10/4). Al-Bayan Jl. Kasuari I/Gurilla No. 10 Kel. Sidorejo Al-Falah Jl. Pukat Banting IV No. 10 Al-Huda Jl. Tuasan Gg. Aman Kel. Sidorejo Hilir Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hilal Jl. Belat No. 76-B Al-Ikhlas Lingk. II Kel. Bandar Selamat Al-Ikhlas Jl. Ambai Ujung No. 15-B Kel. Sidoarjo Hilir Al-Ishlah Jl. Pukat V Kel. Bantan Timur Al-Ikhlash Jl. Pasar V Gg. Al-Ikhlash Dusun XIII Durian Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Baiturrahman Kampus UNIMED Jl. Williem Iskandar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Ikhlashiyah Jl. Suluh/Jl. Tempuling No. 20 Kel.Sidorejo Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Jamik Al-Jihad Jl. Besar Tembung Desa Tembung Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Raya Muslimin Jl. Pukat I No. 1 d\h Jl. Mandailing No.1 Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Taqwa Kampus I UMA Jl. Kolam No. 1 Medan Estate Taqwa Jl. Letda Sudjono No. 15 Ubudiyah Jl. Taduan No. 109 Kel. Sidorejo

Drs. Syahrin Pane Drs. H. Yusdarli Amar Drs. Khairul Siregar Drs. H. Mulkan Daulay Drs. Faizal Lubis H. Amir Saleh Nasution, S.Ag M. Halim Harahap, S.Ag Drs. Ngadimin, K.R. H. Ruslan Efendi, Lc Drs. H.M. Fahmi El-Fuad Drs. Asmanuddin Damanik Drs. Joko Santoso Zulkifli Nasution, S.Pd.I H. Fajrul Hak, Lc, MA Shufriadi Drs. Irwansyah Sitorus Drs. Sulaiman Barus H. Sutan Syahrir Dlm., S.Ag M. Yusuf, S.Pd.I Drs. H. Bahron Nasution Drs. H. Ali Imron Hasibuan M. Yunus Daulay, S.Ag Drs. H. Kemal Fauzi Drs. Lisman Lubis Mardiansyah

MEDAN TUNTUNGAN Ar-Rahman Griya Nusa 3 Tanjung Selamat Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hikmah Kompleks R.S. Jiwa Propsu Jl. Tali Air Lk. IV Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami II Perumnas Simalingkar Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Taqwa Jl. Sawit Raya, Perumnas Simalingkar

BKM Drs. M. Yusuf Asyhadi Haidir Lubis, S.Pd.I H. Solihin Adin, S.Ag Drs. Amrin Yus Zuhirsan, Lc, MA Drs. M. Ridwan Syarifuddin Sinaga, S.Ag Drs. Agus Suhedi Drs. H. Hamdan Hamidi Hrp. H. Muchsi Habibi Sembiring, Lc Drs. H. Sartoni

DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Drs. M. Rozi Ainul Yaqin Jl. Pembangunan IV No. 30 Desa Mulrorejo Drs. Ranto Marpaung At-Taubah Dusun XX Lr. Pertanian Blok Gading Fajar Wahyudin, S.Ag Al-Firdaus Jl. Medan Batang Kuis Ds. XI Empl. Km 10 Mukhtarudin, MA Al-Furqan Perumahan Bumi Tuntungan Sejahtera DSC H. Umar Siregar, Lc Al-Hafiz Hamparan Perak Kec. Hamparan Perak Abdul Latif, S.Pd.I Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur H. Irfan Batubara Al-Ikhlas Komp. Kantor Bupati Deliserdang L.Pakam Drs. H. Kholiluddin Harahap Al-Ikhlash Lingk. VI Gg. Sidorejo Kel. Deli Tua Sudarno, S.Ag Al-Issyah Hakim Jl. Karya Jaya Kel. Deli Tua Drs. Mauddin Nasution Al-Jihad Jl. Pembangunan No. 26 Zulfadli Simanjuntak, S.Ag Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Herman, S.Ag Al-Mukhlisin Komplkek Namori Village Ali Murtadho, S.HI Jami’ Al Muhajir Jl. Rel Pasar X No. 06 Bandar Khalifah Drs. M. Royanta, M.Pd As-Salam Jl.Raya Medan Namorambe Komp.Pisu No.1 Syofwan Harahap, S.Ag Baiturrahman Jl. Merica Raya Blok F Peru. Simalingkar Drs. A. Ghazaly Rangkuty Baitussalam Dagang Kerawan Tanjung Morawa Drs. H. Arifin Marpaung H.M. Asjro Effendi Jl. Haji Misbah No. 22 H.A. Muin Akmal Lubis, MA Jami’ Jl. T. Imam Bonjol No. 17 Lubuk Pakam Drs. H. Lukmanul Hakim Srg. Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Zaidil Jami’ Asysyakirin Jl. Besar Km. 11,5 Deli Tua H. Ahmad Fuad Sinaga Jami’ Jl. Irian No. 79 Kel. Pekan Tanjung Morawa Parlaungan Nasution, M.Ag Jami’ Al-Ihsan Jl. Imam Abdul Ds.Selemak Kec.H.Perak H. Mursal Harahap

Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Khairul Fatihin Dusun II Kec. Tg. Morawa Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Nurul Burhanuddin Jl. Cempaka Dusun V Ds K.Durian Raya Jl. T. Raja Muda No. 26 Lubuk Pakam Syuhada Kec. Galang Taqwa Lubuk Pakam Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

Drs. H. Pandi FilhamLubis Drs. H. Syarifuddin Drs. Harun Nasib, S.Pd.I Drs. H.M. Arifin Umar Saifuddin Nur, S.Pd.I M. Rusli Ismail, S.Ag A. Abrar Rangkuti, S.Pd.I Drs. H. Lukman Hakim, M.Pd Edi Sundowo, MA

BINJAI Agung Kota Binjai Amal Jl. H. Agus Salim No. 14 Kel. Jatinegara Amal Jl. T. Imam Bonjol Gg. Cempaka An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahmah Turiam Jl. Kakap No. 1 Kel. Tanah Tinggi Al-Hidayah Jl. Talam No. 28 Kel. Nangka Al-Hilal Jl. Ikan Irwana No. 17 Kel. Dataran Tinggi Al-Huda Kel. Pahlawan Kota Binjai Al-Mushlihin Kel. Satria Kota Binjai Al-Qadar Kel. Payaroba Griya Payaroba Indah Darussalam Jl. Cut Nyak Din No. 2 Kel. Tanah Tinggi Istiqomah Jl. T.A. Hamzah Kel. Jati Negara Jami’ Athohirin Kota Binjai Nurul Falah Jl. S.M. Raja No. 60 Nurul Yaqin Jl. S.M. Raja No. 94 Kel. Tanah Tinggi

Drs. H. Sudarno Drs. H. Ahmad Saleh Hrp., S.Pd.I Drs. Elfizar Koto Abu Harun Drs. H. Jannah Siregar Muhammad Arif, S.Ag H. Farhan Rawi, S.Pd.I H. Fahmi Barus, BA Drs. H. Pandapotan Harahap Drs. H. Khairuddin Pulungan H. MuhammadYusufTanjung Drs. Misli Tanjung Wagirin, S.Pd.I Asmuri Hafiz, S.Pd.I Drs. H. Ahmad Nasir

ST A B AT Ar-Raudhah Dusun VII Desa Kebun Balok Al-Furqan Lingk. I Musyawarah Kel. Kwala Bingai

M. Sapri Nasution, S.HI, S.Pd.I Ardiansyah Al Hafiz

TEBING TINGGI Amal Muslim Kp. Rao Amaliyah Jl. K.F. Tandean No.344 Lingk. V Kel. B.Sakti An-Namirah Jl. Gunung Papandayan Lingk. II At-Taqwa Jl. Dr. Kumpulan Pane No. 58 Al-Abidin Jl. Kom. Yos Sudarso Kel. Lalang Al-Hidayah Kel. Tanjung Maru Hilir Kampung Keling Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Al-Hasanah Jl. Kartini No. 16 Tebing Tinggi Al-Hasanah Jl. Merbau Perumnas Bagelen Teb. Tinggi Al-Haq Kel. Deblob Sundoro Padang Hilir Al-Qomar Jl. Kutilang Lingk. 05 Kel. Bulian Al-Khairani Jl. Baja Lingk. VI Kel. T. Tinggi Al-Ikhlas Lingk. 03 Kel. Tanjung Marulak Al-Ihsan Simp. Dolok Kel. Sri Padang Kec. Rambutan Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Mukhlis Kel. Pasar Baru Al-Muthmainnah Lingk. I Kel. D.Sundoro Darul Jihad Jl. Ahmad Yani Komp. Detasemen B Farida Jl. H. Ahmad Bilal Lingk. V Kel. Damar Sari Hikmah Jl. Lengkuas Lingk. II Kel. Bandar Sakti Istikmal K.F. Tandean Lingk. III Bandar Sakti Jami’ Jl. Batu Bara Kel. Satria Jami’ Jl. Soekarno-Hatta Kel. Tambangan Hulu Nurul Amal Kompl. Kodim Lingk. 04 Kel. Lalang Nurul Huda Jl. Bukit Bundar Lingk. 03 Kel. Lalang Nur Islam Jl. P. Irian Lingk. 94 Kel. Persiakan Nurul Ikhwan Rumah Sakit Sri Pamela Raya Nur Addin Jl. R. Suprapto No. 126 Syuhada Jl. Iskandar Muda No. 79-A Taqwa Jl. Bakti Kel. Satria Kota Tebing Tinggi Ubudiah Jl. Pulau Samosir Kel. Bandar Sono

Suratman Yusnul Adhary, SE Drs. Jakfaroni, SH Zulkarnain, S.Ag Abd. Wahab Romadhansyah, Lubis H.M. Thahir, SH Zulkifli M. Nuh H.M. Yusuf Rekso Zuhril Lubis Drs. Ali Akbar Nasution Almaya Andika Rudi Kurniawan, S.Pd.I M. Taher Nasution, S.HI Drs. H.M. Ghazali Saragih Drs. H.P. Daposang H. Abdurrahman Drs. Aminullah H. Ardhu Billi Drs. H. Agushul Khair H. Asdi Akmal Nasution Drs. Safarullah Edi Purba, MA Drs. H. Hamdani H.B. Saragih, S.Pd.I Drs. Usman Amir Tagor Mulia, S.Sos.I H. Wijaya Damanik Muhammad Ridwan Syam T. Azmi, S.Sos.I Drs. Daulat Sibarani Yusnan Harahap H.M. Syamsi

H.M. Hafez, Lc

Amanah Mendidik Anak Banyak anak banyak rezeki. Ungkapan ini sangat populer di kalangan masyarakat, terlepas dari spirit yang mendompleng di balik ungkapan tersebut. Hanya saja dalam pandangan Islam anak adalah amanah Allah SWT yang dititipkan kepada orang tua untuk dididik, dibimbing, diajarkan agar menjadi sosok manusia yang beriman mengenal agama dan Khaliknya, beramal dan berjuang untuk meninggikan panji-panji agamanya. Tujuan akhir dari amanah Allah SWT terhadap anak yang dititipNya kepada kita adalah menghantarkan mereka menjadi penghuni surga dan membentengi mereka dari neraka jahannam. Hal ini ditegaskan Allah SWT dalam surah at-Tahrim ayat 6 : ”Wahai orang-orang yang beriman peliharalah dirimu dan keluargamu dari api neraka...” Sekarang pertanyaan besar yang harus kita jawab dengan ikhlas dan penuh kesadaran adalah: Apakah setiap kita selaku orang tua sudah berupaya menjalankan amanah Allah SWT tersebut? Mendidik dan membimbing anak menjadi sosok yang beriman, mengenal agama, bisa membaca Alquran, berakhlak mulia, menutup aurat, menjauhi Narkoba, tempat-tempat praktek prostitusi dan tempat maksiat lainnya. Atau tanpa kita sadari justru kita terjebak berkontribusi menjerumuskan mereka ke jalan yang dimurkai Allah SWT. Karena kenyataannya sampai sekarang kasus kenakalan remaja dengan beragam bentuk dan dinamikanya terus menjadi problem besar bangsa kita. Bahkan tidak sedik orang tua yang tidak berdaya menghadapi tingkah laku anaknya. Seolah tanda akhir zaman yang pernah diungkapkan Nabi Muhammad SAW dalam sebuah hadis yaitu “akan datang masanya nanti seorang budak memimpin majikannya” sedang kita alami. Makna hadis tersebut sebagai ilustrasi dari kepemimpinan dan wibawa seorang majikan atau orang tua telah ambruk di mata budak atau anaknya. Untuk mengantisipasi fenomena di atas dan mengembalikan wibawa orang tua di mata anaknya perlu kerja keras dan mengikuti panduan dan rambu-rambu agama. Karena agama sejak awal telah menentukan jalanjalan yang memberikan garansi kepada manusia untuk menjamin kesuksesan dunia dan akhirat. Ulama sepakat bahwa proses yang dapat ditempuh orang tua untuk mendidik anaknya agar dapat memahami dan mengamalkan ajaran agama sesuai tuntunan Islam dimulai sejak janin di kandungan. Misanya dengan memperdengarkan bacaan Alquran yang dibacakan seorang ibu, mengajarkan keimanan, kejujuran, keikhlasan dan berbagai budi pekerti lainnya. Untuk terselenggaranya itu semua, seorang ibu harus menerapkannya terlebih dulu dalam dirinya mulai dari belajar membaca Alquran sampai berupaya keras mengamalkan budi pekerti. Menghindarkan sebisa mungkin berfikiran negatif terhadap Allah SWT dan agama, menjauhi perilaku melanggar syariat dan mencegah tutur kata tidak sopan. Setelah anak lahir ke dunia, orang tua dapat menanamkan nilai-nilai agama dalam sepanjang kehidupan anak. Jangan pernah ada pemikiran bahwa mengajarkan nilai agama kepada anak akan menjadikan sosok anak yang kolot dan ketinggalan zaman. Justru dengan penanaman nilainilai agama sejak usia dini akan membentengi anak dari dekadensi moral di usia remaja dan dewasanya. Mungkin kita ingat dengan sederetan tokoh sahabat seperti Ali bin Abi Thalib, Ibnu Umar, Ibnu Abbas, kita juga mengenal tokohtokoh Tabi’in, tabi’ tabi’in baik para ahli fikih, ahli tafsir, ahli hadis, ahli sejarah, ahli fisika, ahli kimia, para pemimpin besar dan politikus muslim lainnya. Semua mereka adalah orang-orang yang sejak kecilnya telah mendapat pendidikan dan pembinaan agama secara intensif dari orang tua dan para murabbi (pengajar) yang fokus membimbing meningkatkan kapasitas dan potensi sehingga mereka menjadi tokoh umat yang dicatat sejarah. Semoga anak yang sedang Allah SWT titip kepada kita saat ini dapat kita pelihara sehingga menjadi alternatif tokoh umat yang beriman dan berilmu yang akan dicatat sejarah bangsa kita nantinya— manakala kita memulai menjalankan proses yang telah diajarkan oleh agama untuk mendidik mereka sesuai dengan rambu-rambu agama.

INDRAPURA Jami’ Indrapura

Burhanuddin Lubis

KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Hidayah Jl. Cokroaminoto Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer Ikhwaniyah Jl. Merpati No. 44 Kel. Gambir Baru Jami’ Baiturrahim Kel. Kisaran Naga Nurul Yaqin Jl. Agus Salim Kel. Teladan Nurul Yaqin Kantor Direksi - PB. BSP Kisaran Nurul Huda Jl. Malik Ibrahim No. 37 Nuur-Assyiam Kel. Lestari Siti Zubaidah Jl. Budi Utomo No. 285

Drs. H. Syafi’i, MA H. Ahmad Bin Yasir H. Nono Astono H. Aswiluddin Rambe H. Salman Tanjung, MA H. Rahmad Hidayat, Lc Drs. H. Nummad Adham, SH, Nst. H. Imran Mahdin, MA H. Ismail Qodri, Lc Sulaiman, S.SI Drs. H. Zulhaidir H. Ahmad Julhanuddin, Lc, MA Dahmul Daulay, S.Ag, MA Drs. H. Abd. Rasyid Drs. Zulkifli Simbolon M. Sani H.M. Kosim Marpaung, S.Ag

LABUHAN BATU Attaqwa Labuhan Batu Selatan Besar Tanjung Medan Labuhan Batu Selatan Besar Kota Pinang Labuhan Batu Selatan Jami’ Kota Pinang Labuhan Batu Selatan

Mahrizal Hasibuan Jamaluddin Pasaribu, BA Rahmad Irfan Nasution, S.Ag Sofyan Almi, S.Pd.I

BATUBARA Ar-Rahman Dusun II Desa Pasar Lapan Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

Sunaryo, K.S. S.M. Ruslan Sueb Hasyim Rusli H. Muslim Ismail

A S AHA N Arif-Al Azhim Polres Asahan

Drs. H. Nurul Ikhsan Sitorus, MA

TANJUNG BALAI Al-Istiqomah Jl. Anggur Kel. Pantai Johor

H.M. Yusuf Zailani, Lc

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba

Agus P. Nasution, S.Pd.I

SIDIKALANG Agung Kota Sidikalang Al-Muhajirin Jl. Bambu Kuning Blok A No. 59 Telaga Zam-zam Jl. Ahmad Yani Batang Beruh

Anwar Efendi Piliang Abdul Yajid Lingga, S.Ag Drs. H. Mawardi Lingga, MA

BIREUEN Masjid Agung Bireuen Masjid Taqwa Kec. Gandapura Masjid Besar Kec. Makmur Masjid Besar Kec. Kuta Blang Masjid Besar Kec. Peusangan Masjid Besar Kec. Peusangan Siblah Krueng Masjid Besar Kec. Peusangan Selatan Masjid Besar Al-Furqan Kec. Kota Juang Masjid Ridha Kec. Jeumpa Masjid Baitunnur Peudada Masjid Baiturrahim Jeunieb Masjid Besar Kec. Kuala Masjid Besar Baitul Huda Kec. Juli Masjid Besar Kec. Peulimbang Masjid Besar Kec. Simpang Mamplam Masjid Besar Kec. Samalanga

Tgk Musliadi Peudada Drs Tgk Hasan Basri Ahmad Tgk Abubakar Zakaria Tgk Abdullah Tgk. H M Nur Hasballah Tgk M Jamil Tgk M Jafar Banta Drs Tgk H Jamaluddin Idris Tgk Azhari Nurdin Tgk Busyairi Tgk Zulkarnain Tgk Sudirman Tgk Kahiruman Tgk M Yusuf Ahmad Tgk. Azhari Tgk M Nur Dhiauddin

Mimbar Jumat


Mentalitas Dan Tauhid Seorang Pekerja Oleh H.M. Nasir, Lc., MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Alwashliyah.


llah SWT berfirman: Dan katakanlah wahai Muhammad, bekerjalah kamu, Allah dan Rasul dan orangorang mukmin akan melihat pekerjaanmu. (QS. At-Taubah: 105). Ayat di atas memerintahkan kepada umat Islam melalui lisan Rasulnya Muhammad SAW untuk beramal, bekerja aktif dalam menjalankan kehidupan sesuai dengan bakat dan kemampuan masing-masing sebagaimana diperjelas di dalam surat Al-Isra’ ayat 84: Katakanlah ya Muhammad tiap-tiap kamu beramal, bekerja sesuai dengan bakatnya/kemampuannya, dan Tuhanmu lebih mengetahui siapakah yang lebih mendapat petunjuk/bimbingan dalam pekerjaanya. Pekerjaan di dalam Islam dapat diartikan dalam arti umum dan khusus. Secara umum, mengerjakan segala apa yang diperintahkan Allah Swt atau memperbuat laranganNya, dalam Islam mengerjakan perintah dipandang sebagai amal shaleh sedangkan mengerjakan yang dilarang-Nya disebut sebagai amal maksiat, baik dikerjakan oleh fisik atau non-fisik. Dengan demikian pekerjaan dapat dikategorikan kepada dua kelompok, pertama pekerjaan yang bersifat fisik, dan pekerjaan yang membutuhkan akal fikiran/mental. Pekerjaan yang dikategorikan dalam kelompok fisik seperti pertanian, perkebunan, dan lain-lain, dan yang bersifat non-fisik seperti pendidikan dan lain-lain. Lebih dari itu, pekerjaan tidak hanya sekedar untuk memenuhi kebutuhan dan tuntutan hidup, akan tetapi bekerja merupakan suatu kewajiban karena perintah bekerja diterima langsung oleh Nabi Muhammad SAW melalui wahyu sebagaimana dijelaskan di dalam ayat bekerja di atas. Oleh sebab itu, pekerjaan pada prinsipnya selama dalam koridor perintah Allah SWT. tidak ada yang hina dan rendah di mata Allah SWT. katakanlah seorang petugas kebersihan yang bergelimang dengan sampah dan kotoran, membersihkan jalan raya, kuli kasar memikul beban berat dan mandi keringat, pendayung becak mengantarkan penumpang ke tempat tujuannya, semuanya dapat dikelompokkan pada pekerjaan yang mulia dan

halal, bahkan pekerjaan tersebut dikelompokkan kepada jihad. Nabi Saw bersabda: Thalabul halal jihad (mencari yang halal adalah jihad) (alhadis). Dan di dalam hadis yang shahih dijelaskan bahwa pekerjaan yang paling baik adalah usaha seseorang dengan tangannya. Nabi Saw bersabda: Tidak ada makanan seseorang yang lebih baik dari segala hasil usahanya selain dari usaha tangannya sendiri (HR. Al-Bukhari). Hanya saja, membuat pekerjaan tersebut bisa menjadi hina dan

punyai cakupan yang amat luas, selama dalam koridor syari’at dan diperintahkan Allah SWT. untuk mengerjakan dan dilarang untuk mengerjakannya dapat dikelompokkan kepada amal shaleh. Diakui memang, bahwa pekerjaan mempunyai tingkatan dan martabat tertentu, sesuai dengan skill dan kemampuan seseorang. Allah SWT. berfirman: Apakah mereka yang membagi-bagi rahmat Tuhanmu? Kamilah yang menentukan penghidupan mere-

Jangan semata-mata memandang kepada objek pekerjaan, akan tetapi di balik pekerjaan tersebut ada suatu nilai yang teramat berharga . rendah, mulia dan terhormat, tergantung kepada mental pekerjanya. Misalnya seseorang yang bermental pejabat yang terbiasa menggunakan “telunjuk”nya dalam bekerja sehari-hari, mentalnya akan jatuh dan terhina dan direndahkan jika di suatu saat menjadi bawahan, karena mentalnya tidak siap untuk diperintah, apalagi jika dimutasikan atau dipecat dari pekerjaan dia akan merasa terhimpit dengan beban yang amat berat karena mentalnya memang bukan mental seorang pekerja. Berbeda dengan mental seorang pekerja, penggagas, perintis, peneliti, dia tidak melihat dari objek pekerjaannya, dia melihat dari nilai suatu pekerjaan itu. Jika pekerjaan dipandang sebagai ibadah dapat dipastikan seseorang tidak akan merasa terhina dan direndahkan dengan pekerjaan yang ditekuni. Bukankah suatu hari Nabi Muhammad SAW pernah mencium tangan seseorang kuli kasar yang tangannyapun amat kasar sembari mengatakan “ini tangan ahli surga”. Oleh sebab itu kata ‘amal’ di dalam Alquran sering berdam-pingan dengan kata ‘shaleh’ sehingga menjadi akronim ‘amal shaleh’ yang mana penggunaannya dalam semantik kita sehari-hari, hanya berkonotasi kepada ibadah-ibadah yang bersifat mahdhah (murni ibadah). Padahal ‘amal shaleh’ mem-

ka dalam kehidupan dunia, dan kami telah meninggikan sebagian derajat mereka atas sebagian yang lain beberapa derajat, agar sebagian mereka dapat mengambil manfaat atas sebagian yang lain, dan rahmat Tuhanmu lebih baik dari apa yang mereka kumpulkan (QS. Az-Zukhruf: 32). Ayat yang memerintahkan bekerja dan ayat yang menjelaskan tentang martabat pekerjaan di atas, pada dasarnya adalah menekankan kepada mentalitas dan tauhid seorang pekerja itu sendiri, agar jangan semata-mata memandang kepada objek pekerjaan, akan tetapi di balik pekerjaan tersebut ada suatu nilai yang teramat berharga yaitu keikhlasan yang dapat meninggikan derajat pekerjaan itu sendiri, dan nilai yang tersirat itu tidak banyak diketahui oleh orang dan tidak semua orang dapat melihatnya, maka ayat perintah bekerja di atas diperkuat dengan pantauan Allah dan Rasul serta orang-orang beriman terhadap hasil pekerjaannya. Penglihatan Allah terhadap pekerjaan manusia akan memberi pahala yang berlipat ganda di akhirat, penglihatan Rasul terhadap pekerjaan mereka menjadi saksi bahwa etos kerja, keikhlasan bekerja telah dicontohkan oleh Nabi SAW, sedangkan penglihatan orang-orang beriman terhadap pekerjaan orang-orang yang ikhlas adalah manfaat yang

berkesinambungan, tidak putusputusnya hingga dunia dikiamatkan, Nabi Saw bersabda: Seandainya anda tahu besok hari kiamat, sempatkanlah menanam kayu pada hari ini (HR. Al-Bukhari). Maka di dalam Islam, tidak ada tempat untuk menganggur membuang-buang waktu tanpa manfaat karena pengangguran seperti yang dikatakan oleh Dr. ‘Aid Alqarni bagaikan “rumah kosong tempat tinggal setan dan ladang senda gurau dan maksiat” (Hadaiq Zatabahzah, 2006). Ketika seorang laki-laki datang kepada Rasul SAW untuk meminta pekerjaan, Nabi SAW lebih dahulu membina mentalnya, dari mental peminta-minta menjadi mental seorang pekerja, karena sebagian orang beranggapan bahwa memintaminta itu adalah suatu objek pekerjaan. Nabi bertanya kepada seorang fakir miskin peminta-mita dan mencari pekerjaan: Adakah anda memiliki sesuatu? Tidak, kata laki-laki itu, saya hanya memiliki sehelai tikar hamparan yang separuhnya digunakan untuk duduk dan separuh lagi untuk selimut, dan 1 mangkok untuk tempat minum. Nabi berkata: bawa dua-duanya kemari. Lalu laki-laki itu datang kepada Nabi SAW membawa kedua-dua benda itu, dan Nabi SAW melelangnya di hadapan para sahabt, lalu Nabi menjualnya kepada sahabat yang mau membayar seharga dua dirham, dan Nabi SAW menyerahkan uang tersebut kepada laki-laki tadi dan berkata: 1 dirham belikan makanan untuk keluargamu dan 1 dirham lagi belikan sebuah kampak untuk mencari kayu dan jangan datang kemari kecuali setelah 15 hari. Setelah 15 hari laki-laki itu datang kembali membawa uang 10 dirham, lalu berkata: wahai Rasulullah Allah telah memberkahi saya dan pekerjaan saya. Dan Nabi SAW bersabda: pekerjaan anda lebih daripada anda datang di hari kiamat dengan ada tanda di muka anda sebagai peminta-minta (alhadis). Akhirnya, pekerjaan yang halal tidak ada yang hina di sisi Allah, hanya mental manusia yang membuat pekerja itu merasa terhina dan yang berperan dalam menentukan pekerjaan tersebut berhasil atau tidak tergantung mentalitasnya dan tauhid pekerjanya. Wallahua’lam bil ash-shawab.

Esensi Keadilan Perspektif Islam Oleh Drs. H. As’ad Marlan M.Ag Penulis adalah Guru MAL Dan Dosen Fakultas Tarbiyah IAIN SU Medan


enurut salah satu riwayat pernah diceritakan dari hadits shahih yang bersumber dari Siti Aisyah Ra, sesungguhnya orang Quraisy merasa cemas disebabkan ada seorang perempuan Al-Makhzumiyah mencuri perhiasan. Mereka berkata: Siapa yang akan membicarakan masalah ini kepada Rasulullah SAW ? dan tak ada yang berani kecuali Usamah kesayangan Rasulullah SAW, maka Usamah pun membicarakannya kepada Rasulullah SAW (untuk meringankan hukuman perempuan tersebut). Rasulullah SAW berkata kepada Usamah: “Apakah engkau berusaha membela orang yang dikenai hukuman Allah ?”. Setelah itu Rasulullah SAW berkhutbah dan berkata: “Hai Manusia, sesungguhnya yang telah membinasakan umat sebelum kamu dulu adalah kalau seorang bangswan

mencuri, mereka biarkan, tetapi apabila orang lemah mencuri mereka melaksanakan hukum. Demi Allah seandainya Fatimah binti Muhammad mencuri pasti aku potong tangannya”. (HR. Bukhari Muslim). Berdasarkan hadits diatas bahwa manusia takut dihukum, baik pribadi atau kelompok yang takut dan tidak bersedia dihukum dengan hukuman yang telah ditetapkan Allah, seperti hukuman mati bagi si pembunuh (qishas) dan potong tangan bagi pencuri, dll. Mereka berusaha dengan segala kemampuan yang mereka miliki agar bisa diberi keringanan atau bebas sama sekali dari hukuman Allah. Mereka tidak pernah sadar bahwa Allah menetapkan hukum-hukumnya itu adalah untuk kemaslahatan manusia itu sendiri. Hanya orang yang beriman secara Kaafah (sempurna) yang mau menerima

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Ustad yang saya hormati, apa hukumnya kita membaca Alqur’an dengan tidak menggunakan hukum tajwid? Dan apa pula hukumnya bila tidak fasih disebabkan karena tidak pernah mau belajar? Dari M. Yusuf di Simalungun. Terima Kasih. Jawab : Terimakasih atas pertanyaanya. Menurut yang kami ketahui hukum membaca Alqur’an tanpa tajwid adalah Haram. Dasar hukumnya, Allah menyuruh membaca Al-qur’an dengan perkataan: “Dan bacalah Alqur’an dengan tartil” (Muzammil:4). Arti tartil menurut Ali bin Abi Thalib adalah membaguskan huruf-hurufnya dan mengetahui tempat waqafnya. Ilmu yang membaguskan bacaan dan mengetahui tempat waqaf membaca Alqur’an hanyalah ilmu tajwid, jadi makna dari firman Allah itu “ Dan bacalah Alqur’an dengan tartil (memakai ilmu tajwid). Imam Ibnu Jaziri menyatakan: “ Membaca Alqur’an dengan tajwid hukumnya wajib, barang siapa yang membaca nya tanpa tajwid maka ia berdosa, karena dengan tajwid Allah menurunkan Alqur’an sampai kepada kita”. Selanjutnya, menjawab pertanyaan kedua, Hadis dari Abdullah bin Amr ia berkata: “ Rasulullah bersabda: “Belajarlah Alqur’an kalian kepada empat orang yakni Abdullah bin Mas’ud, Salim Maula Abi Huzaifah, Ubay bin Ka’ab, Muaz bin Jabal” (HR Bukhari). Para sahabat Rasul adalah orang arab asli yang dalam pengucapan lahjah arabnya sudah demikian bagus, begitupun tetap Rasul menyuruh mereka untuk belajar Alqur’an kepada empat sahabat utama tersebut, Artinya membaca Alqur’an tidak sembarangan-wajib belajar. Jika ada orang yang membaca Alqur’an tanpa belajar, maka dipastikan ia salah dalam melafalkan dan membacanya, atau kalaupun ia benar membacanya, maka bacaan tersebut dibaca tanpa ilmu, ia berdosa. Tetapi jika ada orang yang belajar dengan sungguh-sungguh dan berkesinambungan, tetap juga belum mampu dengan sempurna atau masih ada salah, maka yang demikian itu dimaafkan. Kunci dari membaca Alqur’an wajib belajar. (Lihat, Buku Su’ad Ibu Abdul Hamid, Taisir Ar-Rahman, Dar Taqwa. Abduh Abbas Al-Wahidi, Majmu’ Mufid fi ilmi tajwid, Mesir. Ahmad An-Nuri, Pedoman Tahsin Tilawah Al-qur’an dan Ilmu Tajwid. Pustaka Kautsar) Walluhu A’lam. Al-Ustadz H. Ismail Hasyim, MA

Menegakkan keadilan adalah syarat untuk tegaknya masyarakat, bangsa dan Negara. Tanpa keadilan masyarakat, bangsa dan Negara akan hancur. dengan ikhlas hukum Allah tersebut. Sejak dari masa ke masa sampai saat ini bahkan mungkin sampai hari kiamat ada orang-orang bangsawan, jutawan, pejabat-pejabat tinggi, polisi atau militer, tokoh-tokoh masyarakat dan orang-orang yang berkuasa tidak bersedia dihukum walaupun jelas sudah divonis bersalah. Untuk itu sering ia gunakan pangkat, jabatan, relasi, pengaruh dan uang agar diberi keringanan hukum atau bahkan dibebaskan. Seperti yang usaha yang dilakukan Usamah untuk mempengaruhi Rasulullah dan gagal total, bahkan menurut riwayat Rasulullah sangat marah kepada sahabatnya itu, karena dia berusaha membela perempuan bangsawan Quraisy agar terlepas dari hukum Allah, yaitu potong tangan bagi pencuri. Dengan demikian menegakkan keadilan adalah syarat untuk tegaknya masyarakat, bangsa dan Negara. Tanpa keadilan masyarakat, bangsa dan Negara akan hancur. Allah SWT berfirman:”Dan jika Kami hendak membinasakan suatu negeri, maka Kami perintahkan kepada orang-orang yang hidup mewah di negeri itu (supaya mentaati Allah) tetapi mereka melakukan kedurhakaan dalam negeri ini, maka sudah sepan-tasnya berlaku terhadapnya perkataan (ketentuan Kami), kemudian kami hancurkan negeri itu sehancurhancurnya.” QS. Al-Isra’: 16). Ketika rasa senasib-sepenanggungan sudah longgar dan pudar, dimana-mana menyuarakan kata persaudaraan, kesetiakawanan terus didengungkan sebagai penghias bibir saja (lipstick) sementara dalam kenyataan masing-masing mencari keselamatan diri sendiri, tidak lagi peduli dengan yang lain, bersikap masa bodoh, maka saat itu sebenarnya kita telah berada pada ambang kehancuran. Realita di masyarakat, seringkali keadilan hanya dimiliki oleh penguasa atau mantan penguasa, konglomerat, orang-orang kaya. Apabila mereka sedang berperkara, maka para pembela sudah antri berebut untuk dapat menjadi pengacaranya, walaupun mereka harus berhadapan dengan publik, masyarakat, tetapi apabila terjadi kepada orang-orang miskin seperti pencuri sebuah semangka beberapa waktu yang lalu,

dan lainnya, walaupun mereka berteriak seakan keadilan enggan menghampirinya, para pembela pun diam masa bodoh. Oleh karena itu seseorang yang kebetulan mendapat amanat kedudukan kuat hendaklah tidak menganiaya yang lemah, yang kaya tidak menindas yang miskin, yang pandai tidak menipu yang bodoh. Sebaliknya hendaklah mereka yang kuat membantu yang lemah, yang kaya membantu yang miskin, dan yang pandai membimbing yang bodoh. Ada beberapa pembelajaran dari hadist yang penulis sebutkan di awal tulisan ini diantaranya: Pertama, adanya larangan Rasulullah SAW melakukan pembelaan terhadap setiap orang yang melakukan kesalahan tidak pidana seperti mencuri, merampok dan lain sebagainya. Adapun Koruptor dikategorikan sebagai pencuri, penguasa atau penegak hukum wajib menjalankan hukum para koruptor itu tanpa pilih kasih demi tegaknya suatu keadilan. Kedua, tidak dibenarkan ada perasaan sayang, kasihan, takut, ragu-ragu untuk menjatuhkan hukuman terhadap seseorang, sekalipun anak kandung sendiri, kaum kerabat, pejabat tinggi, apalagi hanya sekedar mantan pejabat. Dalam hal ini Allah SWT menyuruh berlaku adil dengan firmannya: “Sesungguhnya Allah menyuruh kamu berlaku adil dan berbuat kebajikan.” (QS. An. Nahl: 90). Ketiga dimata hukum perempuan sama dengan laki-laki. Apakah dia perempuan bangsawan atau rakyat biasa. Keempat, dari masa ke masa kekacauan, kerusuhan dan kerusakan akan menimpa umat manusia selama mereka tidak menegakkan hukum-hukum Allah atau mereka tebang pilih dalam menjalankan hukum. Kelima, dianjurkan kepada para pejabat untuk bersikap adil kepada rakyatnya, supaya dapat mewujudkan kasih sayang diantara diantara mereka. Hadist tersebut diatas perlu menjadi renungan oleh pihakpihak yang berwenang, terutama dari para penegak hukum agar terwujud keadilan ditengah-tengah masyarakat. AminYa Rabbal Alamin. Wallahu A’lam Bisshawab.

WASPADA Jumat 13 April 2012

Beramal Dapat 2 Pahala Para ulama selalu mengingatkan jamaahnya untuk menjadi Muslim (umat Islam) yang kaya harta dan kaya pula dalam mendermakan hartanya di jalan Allah SWT. Yang tercela adalah mencari kemasyhuran, tahta dan kedudukan, serta sangat bercita-cita mendapatkannya dengan menghalalkan segala cara. Misalnya menghabisi hak orang, tindakan represif, agar bisa menjadi pemimpin. Memang sebaiknya jika kita ingin membantu atau bersedekah, berinfak, berzakat sebaiknya jangan sampai riya (ingin dipujidilihat orang lain). Bisa-bisa tidak ikhlas. Tapi, jika niatnya positif. Seseorang mendermakan hartanya, memperlihatkan kedermawaan atau pemberian sedekah kepada publik boleh-boleh saja dengan niat agar orang lain melakukan hal yang sama, berlomba-lomba berbuat baik.Ya, semua tergantung niatnya. Kalau semata demi Allah SWT apa yang dilakukannya sah saja dan insya Allah memperoleh pahala dari Sang Pencipta Allah Azza Wazallah. Tapi, kalau tujuan dan niatnya karena ingin dipuji, pamer atau riya, jelas tidak memperoleh pahala alias sia-sia di mata Allah SWT. Dalam sebuah kajian disebutkan bahwa kemasyhuran itu sendiri bukanlah suatu yang tercela. Tiada yang lebih masyhur dari para Anbia’, Al-Khulafa’ Ar-Rasyidin, dan imam-imam mujtahidin. Tetapi yang tercela adalah mencari kemasyhuran, tahta dan kedudukan, serta sangat bercita-cita mendapatkannya dengan menghalalkan segala cara untuk kepentingan pribadi. Jadi, kemasyhuran tetap menjadi ujian bagi orang-orang yang lemah, seperti yang dikatakan oleh Imam al-Ghazali. Dalam hadits Rasulullah SAW disebutkan, Baginda pernah ditanya tentang seorang lelaki yang melakukan suatu amal kebajikan kerena Allah SWT, lalu orang ramai menyanjungnya. Maka Baginda menjawab, “Itu karunia yang didahulukan, sekaligus kabar gembira bagi orang Mu’min.” (HR Imam Muslim, Ibn Majah dan Ahmad). Begitu pula hadits yang ditakhrij Imam At-Tirmidzi dan Ibn Majah, dari hadits Abu Hurairah, bahwa ada seorang lelaki berkata, “Wahai Rasulullah, ada seorang melakukan suatu amal dan dia pun senang melakukannya. Setiap kali dia melakukannya kembali, maka dia pun berasa takjub kepadanya.”Baginda bersabda, “Dia mempunyai dua pahala, pahala karena merahasiakannya dan pahala memperlihatkan.” (Sumber kumpulan buku hadist dan online).

Orang-orang Yang Lupa Oleh Fachrurrozy Pulungan Ketua Majelis Zikir Qalbun Salim dan Sekretaris Majelis Dakwah Al Washliyah


aka apabila manusia ditimpa bahaya ia menyeru Kami, kemudian apabila Kami berikan kepadanya nikmat dari Kami, ia berkata; ‘ Sesungguhnya aku diberi nikmat itu hanyalah kepintaranku’. Sebenarnya itu adalah ujian, tetapi kebanyakan mereka tidak mengetahui “. QS al Zumar ayat 49. Dalam kesibukan menghadapi hari-hari kerja dan beraktifitas yang kompetitif tentu saja kita penuh dengan kelelahan dan berpeluh keringat, sehingga seringkali tak ada lagi waktu tersisa untuk merenungkan hidup dan untuk mencari makna kehidupan, dan seringkali juga kita tidak dapat ber-sosialisasi dengan masyarakat lingkungan ditempat kita tinggal. Hal ini menjadi ciri kehidupan manusia moderen yang tidak hanya tinggal di kota-kota besar yang menjadi pusat kehidupan yang penuh sesak, tetapi juga sudah merambat kepelosok-pelosok desa. Berikut ini bisa dilihat dari beberapa kasus kehidupan masyarakat moderen yang sibuk itu. Kita mulai dari kasus yang sederhana: Tiap orang yang sudah berkeluarga apabila ditawarkan suatu tugas-tugas sosial (semisal gotong royong) seringkali jawabannya tidak ada waktu, karena pekerjaan sosial tersebut di luar rencana kegiatan keluarga dan pekerjaan ekstra. Kalau seseorang tidak mampu secara fisik dan tidak well educated, ya apa bolehbuat-bisa diterima. Tetapi jika ia mampu, amal (pekerjaan) tersebut kalau ditelusuri akan berdampak positif terhadap diri dan keluarganya dalam rangka hablum minannas, sebab sebagaimana kita ketahui bahwa keluarga adalah anggota masyarakat, tetapi penolakan seperti itu sudah kaprah (biasa) untuk mereka yang super sibuk. Kasus kedua terjadi pada satu keluarga muda, baik suami maupun istri, keduanya bekerja, sibuk. Suami seorang profesional, istri wanita karir , mereka pun punya anak. Karena sibuknya, shalat pun hampir tak sempat, kalau pun ada, bolong-bolong. Dzuhur shalat, Asar tidak. Magrib shalat, Isya tidak, termasuk Subuh pasti tinggal, karena kecapekan dan kesiangan. Apalagi dzikir, kata ini sudah lama hilang dalam kamus pribadi mereka, karena pola pikir mereka sudah berubah. Mereka lupa bahwa dikiri dan kanan nya selalu diawasi malaikat pencatat (Qur’an surah Qaf ayat. 18). Mereka pun tak sadar kalau pada saat tertentu Allah mengutus malaikat Nya untuk menghentikan seluruh aktifitas kehidupannya (surah al Sajadah ayat 11). Dan sudah berapa kali kita mendengar bahwa orang yang kita kagumi maupun orang yang kita benci meninggal tiba-tiba (mati mendadak), bahkan mereka lebih muda dari kita-tetangga kita, atau mungkin juga kawan kita, tapi tetap saja kita lupa. Kasus berikutnya, masih berkaitan dengan kasus di atas. Seorang imam shalat jamaah di masjid sudah tidak lagi mendzikirkan ayat-ayat al Qur’an, tahmid, tasbih, takbir maupun asmaul husna. Mengapa terjadi erosi seperti itu ? Karena ulah makmumnya. Pelanpelan tapi pasti mereka diam-diam beringsut dari shaf depan kebelakang dan terus kabur saat imam sedang berdzikir. Padahal kalau disadari, dihayati, dan diucapkan berulang-ulang dengan khidmat, kalimat tahmid, tasbih dan takbir ditambah suratul fatihah dan ayatul kursi dengan menghayati maknanya, hidup ini akan selalu optimis, terang, dan jauh dari penyakit stres dan depresi. Singkatnya akan selamat dunia akhirat. Kalau ditanya mengapa mereka (jama’ah) kabur pelan-pelan. Alasannya pasti banyak. Misalnya, karena masih banyak pekerjaan, sudah ada janji, karena mau beli mobil bekas melalui iklan WASPADA, karena kalau terlambat bisa keduluan orang lain, dan sebagainya. Kalau shalat jama’ah subuh lain lagi alasannya mengapa mereka buru-buru keluar. Karena mau senam pagi, karena mau antar anaknya sekolah, karena kurang tidur akibat semalaman begadang nonton bola di TV. Padahal Nabi SAW pernah mengeraskan suaranya dalam berdzikir selesai shalat fardhu berjamaah sebagaimana diriwayatkan oleh imam Bukhari dari Ibnu Abbas. Diceritakan oleh Ibnu Abbas ra, “Sesungguhnya berdzikir dengan mengeraskan suara setelah shalat fardu, ada dilakukan dimasa Nabi SAW”. Kata Ibnu Abbas meneruskan,“Aku tahu hal itu dilakukan orang-

orang demikian selepas shalat, aku dengar begitu”. (Shahih Bukhari juz 1, Fathul Bari juz 2 hal 591 dan al Adzkar, Imam Nawawi hal. 58). Ternyata semakin meningkat status sosial seseorang (keluarga), semakin meningkat saja tuntutan ekonomisnya. Orang ingin terus sehat, ingin terus kaya, tetapi dengan jalan segampang mungkin, sesuka hatinya. Betapa sebenarnya mereka lupa, bahwa ia bukan dengan sendirinya ada (exist). Dan orang yang suka lupa termasuk penyakit phisikis, sedang sengaja melupakan terkategori penganut paham sekularisme. Padahal pekerjaan, urusan politik, senam pagi, urusan keluarga, hiburan, maupun bisnis mobil dapat diatur sedemikian rupa-sebaik-baiknya. Kok bisanya umat Islam kebanyakan sekarang menjadi berpaham sekularisme ? Mereka menempatkan urusan dunia menjadi prioritas utama, memisahkan antara urusan dunia dan akhirat. Bukankah muamalah itu tak dapat dipisahkan dengan syariah? Dunia dan akhirat adalah terpadu /integrated, seperti pepatah minang mengatakan, ‘adat bersendi syara, syara bersendikan kitabullah’. Karenanya gak usah banyak berdalih dan berargumentasi, udkhulu fissilmi kaffah-menjadi umat Islam itu harus menyeluruh, tidak parsialis, memilah milih mana yang kita suka-suka. Kasus lainnya adalah setiap manusia memiliki sifat sedih apabila ditimpa musibah, senang bila mendapatkan sesuatu yang diinginkan, kecewa, kagum, takut, benci dan lainnya. Semua sifat tersebut dapat dianalisis secara psikologis. Tetapi seringkali ilmu dan akal tidak mampu menganalisis dan mencarikan jalan keluar. Demikian juga yang terjadi di dunia kedokteran. Sebagai jalan terakhir dari diagnosa penyakit yang tak dapat disembuhkan, para dokter pun melemparkannya kepada Tuhan, karena logika sudah tidak mampu lagi menerima kenyataan. Pertanyaannya, mengapa Tuhan menjadi alternatif terakhir ? Kenapa tidak dari semula dihindarkan perbuatan keji dan mungkar. Manusia seringkali melupakan Allah yang menganugerahkan nikmat kepada dirinya, ketika ia dalam kondisi lapang. Bahkan terkadang ia merasa bahwa keberhasilan yang dicapainya sebagai hasil dari kekuatan dan kemampuan dan kepintaran dirinya. Namun sebaliknya, ketika ia meresa kecewa, sedih, takut, atau setelah kena batunya, baru ingat Allah !. Mengapa Allah seringkali diperlakukan habis manis sepah dibuang? Hal ini pun berulang-ulang diperingatkan al Qur’an seperti ayat pembuka di atas, dan dalam surah Yunus ayat 12 surah al Isra’ ayat 68, serta surah az Zumar ayat 8. Ketika ditimpa bencana, rumah kebakaran, kebanjiran, kehilangan pekerjaan, atau kehilangan jabatan, ditinggal suami atau istri, perusahaan bangkrut, bisnis ditipu, maka bibir pun terus basah memintaminta belas kasihan Allah. Tetapi ketika Allah telah menghilangkan segala yang merisaukannya. Ia pun lupa, bahwa ia pernah mengemis. Allah Maha Tahu keinginan hati dan niat seseorang, apalagi perbuatan yang jahat maupun iktikad dan perbuatan yang ma’ruf, baik yang terselubung maupun yang terang-terangan. Tapi kenapa selalu saja banyak orang yang melupakan Allah ? Mengapa kadang-kadang orang menjauhkan diri dari Allah ? Padahal Allah selalu mendekati kita, bahkan sedekat urat nadi dileher kita. Seandainya ada orang yang kenal dengan anda dan anda selalu berbuat baik kepadanya, tetapi ia tak mau dekat dengan anda, apakah anda akan senang dengan orang itu? Muslim dan muslimat yang tidak dekat dengan Allah, itu tandanya shalat mereka bolong-bolong, boleh jadi mereka tak shalat, kikir kedekut bin pelit. Kalau pun ia memberi, bersedekah atau berinfaq pasti ada imbalannya. Orang pelit sama dengan orang yang tak mau dekat (taqarrub) kepada Allah, yaitu tak mau shalat, enggan membayar zakat dan tidak mau berdzikir. Maunya cuma berdo’a (minta-minta saja) Mungkin ia menerapkan prinsip ekonomi dalam beribadah, meskipun dalam rangka hablum minallah. Orang pelit itu baru mau berdzikir kalau ada maunya alias dzikir vested interest. Akhirnya, shalat, zakat, dan berdzikir orang-orang yang lupa masih lebih baik dari pada orang yang melupakan shalat, membayar zakat, dan berdzikir. Wallahu a’lam.

Manusia seringkali melupakan Allah yang menganugerahkan nikmat kepada dirinya, ketika ia dalam kondisi lapang.

Mimbar Jumat

WASPADA Jumat 13 April 2012


Gaji Hakim Dalam Tinjauan Hukum Islam Azhari Akmal Tarigan

Pria Pakai Cincin Emas, Buanglah…(5) Allah membenci ummat Islam yang hidup mewah. Banyak orang-orang kafir yang masuk neraka karena hidup mewah. Pola hidup orang mewah adalah pamer/ria akan hartanya. Lebih menumpuk harta ketimbang membantu orang-orang miskin atau mujahid yang berjuang di jalan Allah. Karena merasa besar/kibir akan kemewahan yang mereka pamerkan, mereka cenderung menganggap dirinya paling hebat dan paling benar serta menolak kebenaran. Mungkin ada yang berpendapat Nabi dan para Sahabat seperti Abu Bakar, Umar, dan Usman itu kaya. Mereka memang memiliki banyak rezeki atau uang, tapi mereka lebih senang mensedekahkannya untuk jalan Allah dan Fakir Miskin. Nabi hidupnya sangat sederhana dan tidur di atas pelepah kurma. Abu Bakar ra menyumbangkan seluruh hartanya untuk jihad di jalan Allah. Umar menyumbang separuh, sedang Usman menyumbang sepertiga dari hartanya. Adakah para orangorang kaya Muslim sekarang seperti mereka? Sangat langka. Bahkan para ustad pun berlombalomba hidup kaya berlebih-lebihan.Dari Abu Musa Al Asy’ary ra bahwa Nabi Muhammad SAW bersabda, “Memakai kain sutera dan emas itu haram bagi umatku yang laki-laki; dan halal bagi umatku yang perempuan.” (HR. At Turmudzy) Dari Umar bin Khattab ra berkata, Nabi Muhammad SAW bersabda: “Janganlah kamu sekalian memakai kain sutera, karena sesungguhnya orang yang telah memakainya di dunia maka nanti di akhirat tidak akan memakainya lagi.” (HR. Bukhari Muslim) Dari Anas ra juga berkata, Nabi Muhammad SAW bersabda: “Barangsiapa yang memakai kain sutera di dunia maka ia tidak akan memakainya nanti di akhirat.” (HR. Bukhari Muslim) Perintah Nabi di atas sangat jelas. Mendurhakai perintah Nabi SAW akan mengundang azab Allah yang keras. Firman Allah SWT: “Dan berapalah banyaknya penduduk negeri yang mendurhakai perintah Tuhan mereka dan Rasul-rasul-Nya, maka Kami hisab penduduk negeri itu dengan hisab yang keras, dan Kami azab mereka dengan azab yang mengerikan” [Ath Thalaaq). (Sumber hadis shahih, penjelasan Ustadz Ammi Nur Baits, syariahonline, media Islam).

Dakwah Seorang Cendikiawan (Bang ‘Imad 21 April 1931 - 2 Agustus 2008: In Memoriam) Oleh Budi Juliandi, MA Dosen STAIN Langsa


agi kita yang pernah menyaksikan setiap Kamis subuh/pagi acara “Hikmah Fajar” di RCTI beberapa tahun lalu, pasti mengenal sosok penceramahnya yang tidak lain adalah “Dr Ir Muhammad Imaduddin Abdulrahim, MSc” atau lebih akrab disapa dengan Bang ‘Imad, Putra Tanjungpura, Langkat kelahiran 21 April 1931. Ayahnya, Haji Abdulrahim, adalah seorang ulama di Langkat. Sedangkan ibunya, Syaifiatul Akmal, seorang wanita yang merupakan cucu dari sekretaris Sultan Langkat. Tantangan dakwah Tidak ada sebuah kesuksesan yang instan atau datang begitu saja tanpa perjuangan panjang. Jauh sebelum menjadi pence-ramah di Hikmah Fajar RC TI, beliau adalah dai kampus yang terbiasa dengan tan-tangan dakwah. Bang ‘Imad muncul sebagai dai saat situasi yang amat sulit untuk “sekedar” menjadi se-orang Muslim, apalagi menjadi seorang dai dalam dan luar kampus. Tantangan dakwah waktu itu sangat berat. Saat itu umat Islam tengah menghadapi de-Islamisasi, baik di bidang ideologi, politik, maupun budaya. Pemerintah waktu itu selalu mencurigai Bang ‘Imad dan kawan-kawan. Atmosfir politik saat itu tidak bersahabat bagi siapa pun yang akan mendakwahkan Islam apalagi di lingkungan kampus. Kalau kita mau jujur, terjadinya proses “santrinisasi” di kalangan kelas menengah Muslim sekarang, khususnya mereka yang berasal dari ITB, dan kemudian menular ke beberapa perguruan tinggi lainnya, tidak bisa dilepaskan dari peran Bang ‘Imad. Itu pula mungkin yang menjadikan dirinya berhasil membukakan mata hati banyak ilmuan Muslim di Indonesia. Beliau adalah “pendekar” yang mendorong dan memelopori proses Islamisasi ke dan di dalam kampus. Pilihannya di bidang dakwah karena beliau sejak awal sudah terdidik dalam bidang agama, sejak dari Tanjungpura, Langkat. Pendidikan agamanya bukan diperolehnya dari pendidikan formal. Akan tetapi, dia mampu mengembangkan pengetahuan agamanya itu dan dikaitkan dengan bidang pengetahuannya di ITB. Di situ, beliau berhasil menggabungkan kemampuannya di bidang sains dan kegiatan dakwah. Pada tahun 1962, beliau pula orang pertama bersama aktivis masjid kampus ITB (Salman) lainnya yang melakukan salat Jumat di masjid tersebut. Inilah salat Jumat pertama di masjid-masjid kampus di seluruh Indonesia. Kiranya tidaklah berlebihan jika kita katakan bahwa fenomena berdirinya masjid kampus di berbagai perguruan tinggi umum di Indonesia dan maraknya kegiatan keislaman di kampus umum seperti ITB, UI, UGM, Unibraw pada masa sekarang merupakan buah dari gerakan dakwah yang dilakukan Bang ‘Imad. Model pendekatan dakwah Menurut Prof Dr Yusuf Amir Feisal, sebenarnya ide kegiatan dakwah kampus bukanlah murni dari Bang ‘Imad, tapi merupakan ide Pak Muhammad Natsir. Tapi kemudian ide itu dikembangkan oleh Bang ‘Imad dengan metode dakwah yang khas, di mana Bang ‘Imad mengembangkan dakwahnya sesuai dengan kepribadian ilmunya. Rasanya sulit mencari tandingan Bang ‘Imad dalam berdakwah, terutama karena kemampuan beliau dalam meyakinkan jamaahnya. Ini karena pendekatan dakwah yang ia gunakan, yaitu dalil-dalil (argumen) yang bernuansa teknologis dan saintis yang jarang dimiliki pendakwah lain. Barangkali pula karena latar belakang keluarga beliau dan didukung oleh basic agama yang kuat, pembacaan atas ayat-

ayat Alquran yang fasih, meski beliau jarang “bergumul” dengan kitab-kitab kuning. Baginya kebenaran agama akan lebih mudah diterima dan dijelaskan dengan logika-logika ilmu pengetahuan modern. Kebiasaan beliau dalam berdakwah adalah tanpa tedeng aling-aling; ia mengemukakan apa adanya. Konsep-konsep dakwahnya lebih menekankan pada tauhid. Hal ini didasarkan pada sebuah pemikiran bahwa dasar dari setiap perkembangan dan kegiatan adalah tauhid. Singa podium Bang ‘Imad tak ubahnya seorang “singa podium” saat berceramah. Ceramahnya memukau, hingga ruangan masjid tak muat lagi menampung para mahasiswa yang ingin mendengar isi ceramahnya. Mungkin karena alasan ini, Pengurus Besar HMI memintanya untuk menjadi Pimpinan Pusat Lembaga Dakwah Mahasiswa Islam. Yang jelas, ceramah Bang ‘Imad begitu memikat karena ia memberikan penafsiran-penafsiran baru terhadap kandungan Alqur’an yang ia kombinasikan dengan sains modern. Bang ‘Imad mengajak jamaahnya untuk melakukan refleksi ulang terhadap ajaran-ajaran Islam. Kiprah Bang ‘Imad dalam dakwah bukan hanya terbatas di dalam negeri tetapi juga sampai ke manca negara. Ketika ia dikirim belajar (S2) di Amerika tahun 1963 ia telah menunjukkan wataknya sebagai agen dakwah di manapun ia berada. Sebagaimana yang ia lakukan di ITB, Bang ‘Imad mempelopori diadakannya salat Jumat untuk para mahasiswa Muslim di kampus Iowa. Ia bukan hanya mengajak mahasiswa asal Indonesia tetapi juga mahasiswa dari negara Muslim lainnya seperti Mesir dan Pakistan. Tahun 1970 Bang ‘Imad diminta untuk mengembangkan Technical College, satu-satunya perguruan tinggi di Malaysia yang hanya dapat menyelenggarakan pendidikan setingkat D3. Rencananya perguruan tinggi ini akan ditingkatkan menjadi institut yang diberi nama Institut Teknologi Kebangsaan. Selama di Malaysia Bang Imad tidak bisa meninggalkan kebiasaannya berdakwah. Ketika merancang kurikulum institut, ia sengaja memasukkan pelajaran agama sebagai mata kuliah wajib agar mahasiswa yang dibentuk di sana bukan hanya menguasai sains modern tetapi juga memahami agama dengan baik. Bang Imad meyakinkan bahwa agama Islam tidak bertentangan dengan sains dan teknologi yang selama ini dipersepsikan oleh kebanyakan orang Melayu. Ceramah ini ditanggapi positif dan menginspirasi banyak orang Malaysia. Penutup Bang ‘Imad tidak pernah di lahirkan dari rahim sekolah Islam dan perguruan tinggi Islam. Beliau bukan alumni pesantren atau IAIN. Namun pengetahuan agama dan pengamalan Islamnya tidak bisa dipandang sebelah mata. Beliau adalah seorang dai yang lahir dari rahim sekolah umum dan perguruan tinggi umum. Namun gerakan dakwah beliau terbukti mampu mengislamisasikan kampus-kampus umum yang dianggap sekuler. Bang ‘Imad telah berpulang ke rahmatullah di Jakarta, 2 Agustus 2008 pada umur 77 tahun. Beliau adalah salah satu penggagas ICMI, penggagas Bank Muamalat Indonesia, dan pendiri Masjid Salman ITB. Sebagai orang Sumatera Utara, sejatinya kita berbangga memiliki putra terbaik yang lahir dan besar di provinsi ini. Tanggal 21 April ini, adalah hari kelahiran beliau. Kita patut mengenang sepak terjang dakwah beliau. Paling tidak beliau adalah pahlawan bagi kebangkitan Islam di perguruanperguruan tinggi umum.

Beliau adalah seorang dai yang lahir dari rahim sekolah umum dan perguruan tinggi umum. Namun gerakan dakwah beliau terbukti mampu mengislamisasikan kampus-kampus umum yang dianggap sekuler.

Dosen Fakultas Syari’ah IAIN.SU


akim perjuangkan kesejahteraannya”. “Surat Keputusan itu sudah tergadai”. Kalimat-kalimat di atas adalah beberapa judul berita di media massa yang sedang menyoroti “demonstrasi hakim di Jakarta” beberapa hari yang lalu. Puluhan hakim dari Aceh sampai Sulawesi menyampaikan aspirasinya ke Komisi Yudisial (KY), DPR dan lembaga terkait lainnya. Sebagai pejabat Negara, mereka menuntut peningkatan kesejahteraan. Apa yang mereka terima selama ini, gaji atau remunerasi belum dipandang layak. Jauh dari cukup. Tentu saja sikap hakim yang “berunjuk rasa” menimbulkan kontroversi baru di masyarakat. Sebagian orang menyebutnya sebagai hal yang wajar. Bahkan sampai-sampai ada yang memandang “sebagai hal wajar” dan “dapat memaklumi” jika selama ini banyak terjadi jual beli perkara. Soalnya gaji hakimnya kecil. Akibatnya mereka mencari pemenuhan kehidupannya dengan cara yang lain. Tentu gaji kecil tak bisa dijadikan alasan untuk melegalkan jual beli perkara. Ada pula yang menilai perilaku hakim tidak wajar. Hakim gagal memberi contoh yang baik kepada masyarakat. Jika hakimnya saja demikian, yang selalu merasa kurang, dan tidak bisa hidup sederhana, bagaimana pula dengan masyarakatnya. Bahkan ada yang lebih sinis dari itu lagi. Bagi masyarakat, sejatinya hakim harus terlebih dahulu memperbaiki kinerjanya, memberi rasa adil kepada masyarakat barulah mereka menuntut kenaikan gaji. Artikel ini tidak ingin masuk pada kontroversi tersebut. Tidak juga bermaksud menilai sikap hakim yang “berunjuk rasa” ke Jakarta sebagai sesuatu yang pantas atau tidak. Artikel ini hanya ingin mengajak pembaca untuk bercermin kepada ajaran Islam. Bagaimana sebenarnya gaji atau kesejahteraan hakim dalam sejarah peradilan Islam masa lalu. Dr. Samir Aliyah dalam bukunya “Sistem Pemerintahan Peradilan dan Adat dalam Islam” menuliskan dengan cukup baik sebagai berikut: “ Gaji hakim disesuaikan dengan kondisi ekonomi Negara dan kebutuhan hakim

tersebut. Sebab, Umar bin Al-Khattab menetapkan gaji bagi hakimnya, Syuraih, sebanyak 100 dirham dalam setiap bulan. Tapi gaji hakim ini bertambah pada masa Bani Umayah sampai 10 dinar dalam setiap bulan, kemudian naik menjadi 30 dinar pada masa Abbasiyah. Bahkan pada masa keemasan Dinasti Abbasiyah pada masa Al-Ma’mun, gaji Isa bin Munkadir sebagai hakim di Mesir sebanyak 1000 dinar setiap bulan, sedangkan pada masa Dinasti Fathimiyyah naik menjadi 1200 dinar. (Samir Aliyah:355). Informasi yang diberikan oleh Samir Aliyah menunjukkan betapa Negara bertanggungjawab terhadap gaji hakimnya. Ada dua kata kunci yang menarik dianalisis, ekonomi Negara dan kebutuhan hakim. Mencari titik temu antara kekuatan ekonomi Negara dengan kebutuhan hakim merupakan hal yang sulit walaupun tidak berarti mustahil. Justru yang menjadi masalah adalah ketika terjadi paradoks. Satu sisi pemerintah menyatakan keuangannya sedang sulit APBN-nya hampir jebol- sehingga tidak bisa menaikkan gaji pegawai, namun pada sisi lain eksekutif dan legislatifnya mempertontonkan kemewahan. Pejabatpejabatnya jauh dari sikap hidup sederhana. Uang Negara dihamburkan untuk perjalanan dinas dan studi banding yang tidak jelas hasilnya. Pembangunan gedung atau renovasi yang menelan biaya mahal, yang sebenarnya belum perlu, membuat masyarakat sulit percaya bahwa keuangan Negara sedang kritis. Bercermin pada Umar dan khalifah-khalifah sesudahnya, konsistensi kenaikan gaji hakim menunjukkan kepedulian yang tinggi dari pemerintah terhadap hakimnya. Di samping itu, kenaikan bertahap tersebut menunjukkan kesadaran akan pergeseran kebutuhan hakim seiring dengan perubahan zaman. Sampai di sini, menurut penulis, jika ada hakim yang kesejahteraannya terabaikan oleh pemerintah, sementara itu hakim tersebut telah bekerja secara benar, adil dan penuh integritas, maka Negara sesungguhnya telah melakukan kezaliman yang luar biasa kepada pejabatnya. Namun kita juga tidak boleh menutup mata terhadap integritas dan kesederhanaan hakim

Gaji yang layak bagi hakim adalah keniscayaan. Di samping itu kita harus merubah paradigma kesejahteraan. Gaji bukan sekedar untuk makan, sandang pangan dan papan. yang pernah lahir dalam rahim sejarah. Masih menurut Samir, dalam sejarah Islam, terdapat sebagian hakim yang malah tidak mengambil gaji dalam tugas peradilannya. Adakalanya dikarenakan dorongan keagamaan, menjaga diri dari hal-hal yang syubhat, atau menganggap cukup dengan apa yang dimilikinya. Ada pula sebagian hakim yang tidak mau mengambil gaji ketika masa liburnya. Ada riwayat dari Abu Khuzaimah Ibrahim bin Zaid, hakim Mesir bahwa dia tidak mengambil gaji untuk hari Jum’at dengan mengatakan, “Sesungguhnya saya adalah pegawai bagi kaum muslimin. Jika saya tidak bekerja untuk mereka, maka saya tidak boleh mengambil harta mereka. Dia pun mengembalikan 15 dirham ke bait al-mal untuk hari yang dia tidak melaksanakan tugas kehakiman. Demikian juga dengan Hakim Abu Khuzaimah Ar-Ru’aian yang jika mencuci bajunya, melayat jenazah atau sibuk dengan urusan pribadinya, maka dia mengambil dari gajinya sesuai dengan jumlah hari yang dia tersibukkan dengan pekerjaannya sendiri lalu mengembalikannya ke bait al-mal. (Samir Aliyah: 356). Memang ada ulama seperti Asy-Syarkhasi yang menganjurkan Imam atau pemerintah untuk mengangkat hakim dari kalangan orang kaya. Tujuannya adalah agar mereka tidak silau terhadap harta. Tidak juga menggadaikan putusannya demi harta. Saya ingin mengemukakan pandangan Imam Al-Mawardi di dalam Adab Al-Qadhi yang juga dikutip oleh Samir Aliyah. Menurut ulama yang banyak menulis tentang ketatanegaraan Islam tersebut, “Peradilan merupakan tugas yang boleh mendapatkan gaji dari bait al-mal. Sebab, Allah menjadikannya bagi para pegawai (amil) zakat bagian dari darinya. Juga dikarenakan para khalifah mengambil gaji atas tugas

khilafah, maka para hakim juga sama kondisinya seperti mereka. Adapun gaji hakim ditentukan sesuai dengan kebutuhan tanpa lebih atau kurang. Demikian pula gaji para pembantu hakim, seperti panitera, pengawal, pengganti dan opsir, sehingga tidak seorangpun di antara mereka yang tergesa-gesa dalam memutuskan perkara. ASy-Syafi’I berkata, “ gaji hakim itu juga telah termasuk kebutuhan untuk membeli kertas-kertas yang dibutuhkan dalam menetapkan hujjah dan keputusan. Juga untuk membeli buku-buku dan catatan-catatan yang dimaksudkan untuk kemaslahatan umum. Gaji yang layak bagi hakim adalah keniscayaan. Di samping itu kita harus merubah paradigma kesejahteraan. Gaji bukan sekedar untuk makan, sandang dan papan. Sebagaimana dikatakan Imam Asy-Syafi’i, gaji juga harus dapat memenuhi kebutuhan hakim terhadap buku, jurnal dan media lainnya. Jangan harapkan kualitas hakim kita akan meningkat jika aksesnya terhadap informasi baru sangat rendah. Jika mau jujur, berapa budget hakim setiap bulannya untuk membeli buku atau berlangganan jurnal. Atau di Pengadilan manakah yang perpustakaannya layak dan membanggakan. Sampai di sini, pemerintah sejatinya harus memperhatikan kesejahteraan hakimnya. Pemimpin yang adil dan peduli tidak akan pernah membuat pejabat negaranya bertanya tentang kesejahteraannya. Saatnya pemerintah mengambil keputusan yang cepat untuk memberikan rasa adil kepada hakim. Jika pemerintah telah ber-laku adil terhadap pejabatnya, maka semua itu harus mereka bayar dengan integritas dan putusan yang berkualitas. Wallahu a’lam bi al-shawab.

Menyegarkan Kembali Sistem Penilaian Dalam MTQ Drs. H. Yusdarli Amar Hakim MTQ Tingkat Nasional, Pengurus LPTQ Sumut


usabaqah Tilawatil Quran Nasional (MTQN) Tingkat Provinsi Sumatera Utara tahun 2012 segera digelar 28 April -5 Mei di Serdang Bedagai . Tidak dapat disangkal bahwa salah satu penentu keberhasilan pelaksanaan setiap event MTQ adalah para hakim. Mengapa?, sebab, para hakimlah yang menilai tingkat kebenaran bacaan yang dilantunkan para qari dalam setiap cabang dan tingkatan, sekaligus menetapkan para juara. Meskipun kejuaraan bukanlah tujuan utama dari pelaksanaan MTQ, namun kejuaraan dapat dijadikan tolak ukur perkembangan khazanah ilmu seni baca Alquran. Tidak hanya itu, kejuaraan juga dapat menjadi alat ukur sejauhmana khazanah ilmu seni baca Alquran tersebut dapat diaplikasikan lewat bacaan oleh setiap peserta yang tampil sekaligus menjadi barometer pembinaan Alquran yang dilakukan oleh sebuah daerah. Menakar Standarisasi Perhakiman Sistem penilaian MTQ terus berubah dan berkembang seiring perjalanannya yang telah berusia 44 tahun (1968-2012). Walaupun dalam rentang waktu yang begitu panjang, dalam praktiknya, standarisasi penilaian perhakiman menurut hemat penulis masih membutuhkan penyem-purnaan lebih lanjut. Masih sering hakim yang menilai menurut “selera” dan pemahaman yang beragam, terutama pada level kecamatan maupun kabupaten, bahkan tak jarang pada tingkat provinsi dan nasional sebagaimana pengalaman kami adanya. Kondisi seperti ini seringkali mengakibatkan inkonsistensi dalam penilaian dan tak jarang mengakibatkan terjadinya kerancuan yang berujung pada perdebatan, kecurigaan bahkan keraguan terhadap objektivitas penilaian yang dilakukan oleh seorang hakim. Sebutlah beberapa contoh persoalan penilaian yang sering muncul dalam pelaksanaan MTQ. Dalam bidang tajwid. Persoalan yang muncul biasa terkait dengan perbedaan pemahaman dan penafsiran terhadap pelafalan bacaan yang diperdengarkan oleh qari. Misalnya terkait dengan penyebutan huruf tertentu (terkait dengan sifatul huruf dan ahkamul huruf), penekanan pada penyebutan huruf qalqalah tertentu dan sejumlah perbedaan cara pandang lainnya dalam kasus-

kasus bacaan tertentu. Dalam bidang ghina (lagu). Persoalan muncul biasanya saat menentukan bagaimana irama dan gaya serta variasi yang dikatakan baik?. Dalam bidang fashahah, persoalan yang muncul terkait dengan penguasaan hakim terhadap tata bahasa arab, sebab penilaian fashahah terkait dengan waqf dan ibtida’,

dang bacaan, (sesuai dengan petunjuk permusabaqahan yang dikeluarkan oleh LPTQ Nasional) adalah “model” bacaan Qari Internasional Mahmud Kholil Khusairi, dan tentunya juga qari yang mempunyai standar dan kualitas yang kurang lebih sama atau mendekatinya. Terkait dengan perbedaan penilaian, yang penting dipertegas

Masih sering hakim yang menilai menurut “selera” dan pemahaman yang beragam, terutama pada level kecamatan maupun kabupaten, bahkan tak jarang pada tingkat provinsi dan nasional serta tumpang tindihnya pengurangan nilai dalam mura’atul huruf, saat peserta salah menyebutkan huruf tertentu atau juga salah baca. Dalam bidang suara. Persoalan yang selalu muncul, suara yang bagaimanakah yang ideal? Suara besar atau kecil?, suara yang ‘araby atau ‘ajamy?, suara yang dzauq atau tidak? yang tidak jarang lebih mengedepankan “selera” hakim dari pada standarnya, dan sejumlah persoalan lainnya. Standar Penilaian Tentu penulis tidak bermaksud menggurui dan merasa paling benar dalam membuat tulisan ini, namun ada beberapa masukan yang mungkin dapat dijadikan pandangan menyikapi berbagai persoalan ini. Pertama, secara teoritis. Bahwa ukuran atau standar bacaan yang baik adalah bacaan yang mendekati bacaan yang dilafazkan Rasulullah Saw. sebagai penerima wahyu, yang diikuti sahabat, tabi’in dan dilanjutkan oleh para ulama tajwid. Selanjutnya para ulama tajwid membuat kaidahkaidah dalam ilmu tajwid. Sebutlah beberapa buku rujukan dalam ilmu tajwid yang familiar dipelajari, Hidayah Al-Qari karya Abdul Fattah Sayyid Azmi Al-Marasfi, Syarah AlMuqaddimah Jazariyah Fi Ilmi Tajwîd karya Shofwat Mahmud Salim, Uddah Al-Qari Fi Tajwîd Al-Kalam AlBari karya Syekh Abdurrahim AlTharhuni, Haq at-Tilawah karya Husni Syaikh Usman dan tentu banyak kitab lainnya. Kedua, secara praktis. Bahwa setelah melalui diskusi panjang, telah sepakat para ulama Quran di Indonesia bahwa dalam standar dalam bi-

adalah tugas hakim pada bidang tajwid adalah mendengar dan mengamati secara teliti tajwid yang bersifat ‘amaly bukan bersifat ‘Ilmy (Lihat Mahmud Khalil khushairy, Ahkam Qira‘at al-Qur‘an (Makkah: Dar Al-Basyair Al-Islamiyyah, 1417 H). Hakim dituntut untuk melakukan pengamatan lewat pendengaran sekaligus mengetahui standar pelafalan yang benar dan baik, sehingga hakim mampu menilai mana lafaz yang masuk pada kesalahan besar (khata’ jaly) atau kesalahan kecil (khata’ khafy). Sedangkan hal yang bersifat ilmy biasanya lebih mudah memahaminya, sebab sesuatu yang sudah baku. Dalam bidang fashohah, pemahaman hakim terhadap tata bahasa arab seperti mubtada’, khabar, na’at man’ut, idhafah dan sebagainya tentunya pemahaman terhadap maksud ayat adalah keniscayaan, sebab terkait dengan waqf dan ibtida. Sedangkan mura’atul huruf hanya terfokus terhadap perubahan huruf secara totalitas, bukan kepada “kesempurnaan” sifatul huruf atau ahkamul huruf, sebab hal itu adalah “kapling” dari hakim bidang tajwid sehingga tidak terjadi tumpang tindih. Dalam bidang lagu. Beberapa hal yang penting mendapat perhatian adalah seperti penyelarasan lagu (ghina) kepada kaidah-kaidah bacaan/ tajwid. Seperti halnya saat seorang qari “memainkan” variasi lagu bukan pada bacaan yang panjang (mad), walaupun boleh saja dilakukan asalkan tidak menyalahi kaidah bacaan. Demikian juga tekanan (hentakan) lagu pada bacaan izhar sehingga dikhawatirkan terjadi bacaan seret (tidak utuh). Bukan tidak jarang, qari-

qariah yang tampil lebih mementingkan kemampuan melantunkan lagu yang menyebabkan kaidahkaidah bacaan menjadi tidak utuh bahkan salah (khata”), apalagi memaksakan diri untuk mengikuti gaya atau variasi lagu tertentu yang mungkin lagi trend dibawakan oleh kebanyakan qari. Sungguh tidak salah mengikuti trend qari-qari yang mashhur saat ini seperti Sahat Anwar dan lain sebagainya, namun tidak baik mengikuti gaya/model/variasi menyebabkan keutuhan bacaan menjadi rusak. Hal penting lainnya adalah keselarasan lagu dengan makna ayat yang sedang dibaca, sehingga bacaan, lagu dan makna ayat menjadi selaras adanya. Dalam bidang suara. Salah satu yang penting ditekankan dalam hal suara adalah, selain hal-hal yang sudah disepakati (jumlah lagu, keutuhan, kejernihan dan sebagainya) bagaimana kemampuan qari untuk melantunkan suaranya stressing (penekanan) suara pada huruf dan hukum huruf tertentu ketika membawakan lagu dalam penilaian tajwid. Tidak baik terdengar misalnya ketika seorang qari menekankan sebuah lagu atau variasi pada hukum bacaan izhar dan semisal dengan itu. Demikian juga bobot penilaian suara yang ‘araby tentu lebih pantas mendapatkan nilai “lebih” dari pada suara yang “biasa-biasa” saja. Objektivitas Penilaian Dalam memberikan penilaian, hakim dituntut memberikan penilaian secara objektif sesuai dengan tingkat kebenaran atau kesalahan peserta, tanpa boleh terpaku atau takut dengan perbedaan nilai dengan hakim lain pada bidang yang sama. Kebijakan LPTQ dalam penilaian yang tidak boleh terdapat perbedaan penilaian lebih dari tiga (3) point tidak boleh disalahpahami. Sebab, perbedaan penilaian yang tidak boleh lebih dari tiga poin adalah bentuk dari upaya LPTQ agar hakim benar-benar objektif dan dalam memberi penilaian, tetapi bukan berarti tidak boleh berbeda hingga lebih dari tiga poin. Kesalahan tetaplah kesalahan dan harus dinilai secara benar dan rinci dan dapat dipertanggungjawabkan. Mudah-mudahan Allah memberikan kemudahan kepada kita dalam memberikan penilaian yang mendekati kebenaran. Semoga bermanfaat. Wallahu’alam.

Mimbar Jumat


WASPADA Jumat 13 April 2012

Venesia Tempat Bertemunya Timur Dan Barat Tanpa perdagangan dengan Muslim, Venesia tidak akan pernah ada. Alih-alih jadi republik maritim yang kuat, republik yang didominasi pedagang Mediterania sejak abad 12 sampai abad 16 itu mungkin hanya berbentuk sebuah desa nelayan. KEKAYAAN Venesia terkait erat dengan dunia Islam setidaknya sejak abad kedelapan. Republik Venesia adalah “jalan masuk barang-barang impor mewah ke Eropa seperti karpet dan tekstil, dan membuka pintu Eropa bagi budaya Islam yang menciptakan barangbarang tersebut,” tulis Walter Denny, Dosen seni di Universitas Massachusetts di Amherst, dalam katalog “Venice and the Islamic World.” Untuk melacak pengaruh Islam dan koneksi Muslim di Venesia tidak sulit jika Anda tahu di mana dan bagaimana melihatnya. Salah satunya, jika Anda berdiri di alun-alun di depan Basilika St Markus, tanda-tanda ada di sekitarnya. Dari mulai kubah, lengkungan dan mosaik emas bangunan ini sampai labirin jalan-jalan berliku di sekitarnya, menurut Sejarahwan arsitektur Deborah Howard dari Universitas Cambridge meniru arsitektur dan desain perkotaan Islam. Sebaliknya, hampir di dalam kota-kota Muslim mulai dari Aleksandria, Konstantinopel (kemudian berganti nama menjadi Istanbul), Damaskus, Aleppo, Trebizond dan Tabriz, terdapat kota-kota Venesia kecil, daerah kantong komersial yang diawasi oleh Bailo, atau konsul, lengkap dengan gereja-gereja, pendeta, pedagang, dokter , tukang cukur, tukang roti, tukang masak, penjahit, apoteker dan ahli perak. Tanpa perdagangan dengan Muslim, Venesia tidak akan pernah ada. Alih-alih jadi republik maritim yang kuat, republik yang didominasi

Seorang gubernur Mamluk dan pejabatnya bersiap-siap menyambut konsul Venesia Niccolò Malipiero di Damaskus pada tahun 1511. Kuba Masjid Raya Umayya terlihat di belakangnya. pedagang Mediterania sejak abad 12 sampai abad 16 itu mungkin hanya berbentuk sebuah desa nelayan. Perdagangan Besar Perdagangan besar terjadi antara dua bagian dunia ini. Sutra, rempah-rempah, karpet, keramik, mutiara, kristal Ewers dan logam mulia tiba di Venesia dari Timur (negara-negara Arab), sedangkan garam, kayu, linen, wol, beludru, karang Italia, kain halus dan budak merupakan benda yang diekspor ke Mesir, Anatolia, dan Persia. Akibatnya, banyak kata-kata Arab yang diserap ke dalam bahasa Italia, termasuk istilah perdagangan seperti doana (adat) dan tariffa (tugas) dan namanama barang mewah seperti sofa, dipan dan damasco. 4. Kebudayaan dan pencetakan Sebagai pusat penerbitan utama untuk kawasan Eropa, Venesia juga mencetak banyak terjemahan teks Bahasa Arab

dalam bahasa Latin dan Italia, termasuk Canon, buku referensi standar medis tulisan dokter Persia Ibnu Sina (yang disebut Avicenna di Barat), dan ulasan tentang karya Aristoteles oleh filsuf Kordoba Ibnu Rusyd (dikenal di Barat sebagai Averroes) pada abad ke-12. Bahkan cetakan ayat pertama Alquran diterbitkan di Venesia pada tahun 1537-1538 oleh pencetak buku lokal dengan tujuan menguasai pasar bahasa Arab. Namun, cetakan tersebut penuh dengan kesalahan sehingga gagal total, tetapi justru hal itu yang menginspirasi dibuatnya terjemahan ke dalam bahasa Italia pada tahun 1547, menurut Stefano Carboni, seorang kurator seni. Sejarah Singkat Venesia Suku Gothic dan Lombardic yang kabur dari daratan Italia pada abad kelima, berlindung di pulau-pulau laguna Adriatik yang menjadi cikal bakal Ve-

Gedung yang dibangun di Grand Canal di Venesia pada pertengahan abad 13 ini diperuntukkan bagi para pedagang Turki. Gedung yang jadi akomodasi tempat tinggal ini disebut Fondaco dei Turchi. Sekarang gedung ini jadi museum sejarah alami Venesia. nesia. Dengan menimbun dasar laut, para pengungsi yang tinggal di kawasan ini secara bertahap memperbesar pulau dan membangun jembatan penghubung. Karena tidak memiliki lahan pertanian, Venesia awal mengandalkan perikanan dan perdagangan, mendeklarasikan diri sebagai republik merdeka di tahun 726 dan mendirikan benteng pertama untuk Doge atau adipati, dan pemerintah pada abad kesembilan. Setelah menaklukkan Konstantinopel pada tahun 1204, orang Venesia menghiasi kota mereka dengan jarahan dari ibukota Bizantium itu, mengantarkan sebuah zaman keemasan perdagangan dengan Timur Tengah dan Timur yang berlangsung sekitar empat abad.

Mamluk, yang menguasai hamparan luas wilayah dari Mesir sampai Syria sejak 1250 sampai 1517, mengandalkan angkatan laut Venesia untuk melindungi pantai mereka. Meskipun hubungan diplomatik terlihat hangat, Qansuh Sultan al-Ghuri menempatkan rantai wakil konsul Pietro Zen pada tahun 1511 dan memenjarakannya di Kairo untuk mengadakan pembicaraan rahasia dengan Shah Ismail, penguasa Safawi pertama Persia. Sementara, Venesia mengupayakan aliansi dengan Persia guna menghadang Ottoman memperluas kerajaan, yang memang mengakhiri kekuasaan Mamluk enam tahun kemudian, pada tahun 1517. Venesia memiliki “hubungan cinta-benci” dengan Ottoman, yang, tidak seperti Mamluk, me-

reka berusaha merebut kuasa atas Venesia di Mediterania Timur. Meskipun terjadi beberapa konflik terutama di Corfu pada tahun 1537, Siprus pada tahun 1571, Candia (Kreta) dari 1646 sampai 1669 dan antara 1684 dan Morea 1716)-secara keseluruhan berlangsung perdagangan damai antara keduanya, dan Napoleon lah, bukan Ottoman, yang akhirnya menaklukkan Venesia pada 1797. Seperti kaisar Perancis ambisius, Ottoman Sultan Meh-met II, yang menaklukkan Konstantinopel pada tahun 1453, juga haus akan pengakuan dunia. “Dia ingin diakui seperti kaisar atau raja oleh kekuatan Eropa.” Untuk menyebarkan ketenarannya, Mehmet meminta agar pemerintah Venesia mengirim seorang seniman untuk mengabadikan potretnya dan seorang

pemahat untuk menem-pa medali dengan gambarnya. “Meskipun Venesia terlibat perang dengan Ottoman, namun pedagang Turki tetap menjadi tokoh yang dihormati bagi di wilayah itu”. Namun begitu, Venesia tidak mau mengakui bahwa Dinasti Utsmani memiliki budaya yang berkembang dengan baik dibanding kebudayaan milik mereka. “Hanya setelah Ottoman dikalahkan di Wina tahun 1683 kami mulai mengakui bahwa Turki bukan bangsa barbar dan telah menghasilkan literatur dan karya seni refleksi terbaik yang merupakan wujud dari keahlian terbesar mereka,” kata Walter Denny. “Setelah Ottoman tidak lagi menjadi ancaman militer, kita mulai bisa menganggap mereka sebagai mitra sederajat.” Syafri/MHc

Raja Kisra Dan Masjid Sterilisasi Masjid (Pelajaran Dari Kasus Perubuhan Masjid)

Oleh Achyar Zein

Drs Muhammad Rais MPd., M.Si

Dosen Fak. Tarbiyah IAIN-SU dan Pengurus el-Misyka Circle

(Ketua Umum Ikadi Kota Medan)


etelah perjanjian Hudaibiyah pada akhir jaganya dari kesombongan orang-orang yang tahun keenam Hijriyah, Rasulullah SAW me- sombong, dari kepongahan orang-orang yang nulis surat yang ditujukan kepada beberapa berusaha menghalangi jalan dakwah ini, dari siapa raja, menyeru mereka kepada Islam. Hal ini meru- saja yang merobek-robek jalan dakwah ini. Perobohan Masjid pakan bentuk ekspansi dakwah Rasulullah SAW daMasjid dalam Islam dianggap sebagai salah lam rangka mengembangkan Islam sampai ke luar Jazirah Arabia. Rasulullah SAW menunjuk bebe- satu sendi utama dalam bangunan masyarakat rapa orang sahabat sebagai kurir yang cukup mem- Islam di masa Rasulullah SAW, sakarang dan sampai masa yang akan datang. Tanpa maspunyai pengetahuan dan pengalaman. Dalam Kitab Sirah Nabawiyah diceritakan ada jid bangunan Islam tidak akan berdiri secara besebanyak delapan kerajaan yang dikirimi Rasulul- nar dan utuh di samping juga dakwah Islam tidak lah surat dakwah tersebut, sebagian menerima de- akan berkembang seoptimal mungkin. Tanpa ngan senang hati dan masuk Islam, sebagian yang masjid umat Islam tidak akan tertarbiyah secara lain menolak dengan halus dan sebagian lagi me- Islami dan tidak akan mengenal problematika nolak dengan sangat kasarnya. Yang menolak dak- yang dialami oleh muslim lainnya. Masjid adalah wah Rasulullah SAW dengan sangat kasar tersebut sarana dakwah agama ini. Lihatlah Kisra yang merobek-robek surat Raadalah Kisra Abrawaiz, Raja Negeri Persia. sulullah SAW, yang bermakna ia merobek dakwah Surat Kepada Kisra Beginilah bunyi dakwah Rasulullah SAW kepada ini, kekuasaannya pun akhirnya dirobek-robek Kisra. Dengan menyebut nama Allah yang Maha oleh Allah SWT. Maka siapa saja yang berani unPemurah lagi Maha Penyayang. Dari Muhammad tuk merobohkan masjid dan bersekutu untuk perobohanutusan Allah unnya itu artinya tuk Khosrau, peia sedang menguasa Persia Lihatlah Kisra yang menyobek-nyobek robohkan dakyang Agung. Sawah ini. lam bagi orangsurat Rasulullah SAW, yang bermakna Apresiasi orang yang meTerhadap Pemngikuti petunjuk, ia menyobek dakwah ini, kekuasaannya bangunan beriman kepapun akhirnya disobek-sobek oleh Allah Kembali da Allah dan RaMasjid Al Ikhlas sulNya, dan bagi yang bersaksi Penulis juga bahwa tidak ada Tuhan kecuali Allah, Esa, tidak mendukung pertemuan Muspida Sumatera Utara ada sekutu bagiNya dan bagi yang bersaksi bahwa plus Pemko Medan, MUI Sumut, MUI Medan serta Muhammad itu hambaNya dan utusanNya. Aku Forum Umat Islam yang kemudian menghasilkan mengajakmu kepada panggilan Allah, sesung- kesepakatan tentang akan dibangun kembali Masjid guhnya aku adalah utusan Allah bagi seluruh Al Ikhlash Jl. Timor di tempat semula seperti yang manusia supaya aku memberi peringatan kepada disampaikan Walikota Medan, Bapak H.Rahudman orang-orang yang hidup hatinya dan supaya Harahap. Mengajak kepada seluruh elemen umat Ispastilah ketetapan azab terhadap orang-orang lam agar bahu membahu dan bergandeng tangan kafir. Peluklah agama Islam maka kamu akan sela- untuk mempertahankan dan menjaga asset serta mat. Jika kamu menolak maka kamu akan me- marwah umat Islam dan masjid merupakan salah nanggung dosa orang-orang Majusi. Reaksi Kis-ra satu marwah umat Islam. setelah membaca surat tersebut, ia pun meroPenulis berharap bahwa kasus perobohan Masbeknya sambil berkata, Budak rendahan dari jid Al Ikhlas Jl. Timor merupakan kasus terakhir rakyatku menuliskan namanya mendahuluiku. yang terjadi di kota ini khususnya, dan Sumatera Ketika Rasulullah SAW mendengar reaksi Kisra ter- Utara pada umumnya. Dan ini merupakan pelasebut, maka Rasulullah SAW mengatakan, Semoga jaran berharga bagi umat Islam untuk terus memAllah mencabik-cabik kerajaannya. bangun komunikasi dan menggalang kekuatan Doa tersebut dikabulkan, Persia akhirnya kalah umat serta seluruh elemen umat bersama-sama dalam perang menghadapi Romawi dengan kekalamenjaga marwah Fatwa MUI Sumut khususnya han yang menyakitkan. Kemudian ia pun digulingkan oleh anaknya sendiri yakni Syirawaih, ia dibunuh dan tentang haramnya perobohan masjid. Penulis juga dirampas kekuasaannya. Seterusnya kerajaan itu kian menghimbau kepada para pengembang untuk tercabik-cabik dan hancur sampai akhirnya ditak- menjaga kekondusifan toleransi umat beragama di lukkan oleh pasukan Islam di masa Khalifah Umar daerah ini dengan menghargai dan menghormati keberadaan rumah ibadah. Bin Khaththab hingga tidak bisa lagi berdiri. Selanjutnya mengajak kepada seluruh ele-men Pelajaran Berharga Kisah ini juga menyisakan begitu banyak pe- umat Islam untuk kembali mengikat tali ukhuwah lajaran buat kita. Surat yang dikirim Rasulullah yang sudah mulai terurai dikarenakan adanya pro SAW tersebut adalah merupakan bagian dari dan kontra masalah perobohan masjid, mengdakwah Rasulullah SAW. Siapakah pemilik dak- hentikan caci-maki dan saling hina, semoga Allah wah ini ? Pemilik dakwah ini adalah Allah, dan merahmati, mengampuni dan memberikan pedakwah ini adalah jalan para Rasul. Karena dak- tunjuk kepada kita semua serta kepada para wah ini milik Allah, maka Dia lah yang akan men- pemimpin kita.


an sesungguhnya masjid-masjid adalah milik Allah dan janganlah kamu menyembah seorangpun di dalamnya selain Dia. (Q.S. al-Jin ayat 18). Ketika Alquran menyatakan bahwa semua masjid adalah milik Tuhan berarti fungsi masjid telah diambil alih oleh-Nya. Pengambilalihan ini menunjukkan bahwa fungsi masjid harus mengacu kepada ketetapan yang dibuat-Nya di dalam Alquran yaitu bahwa masjid harus steril dari praktek-praktek syirik. Pentingnya masjid disterilkan dari syirik karena dapat membuat fungsi masjid menjadi statis. Hal ini bertentangan dengan rencana Tuhan yang ingin menjadikan masjid sebagai institusi yang dapat mencerdaskan umat karena umat tidak akan pernah cerdas selama masih menggeluti dunia syirik. Pada tataran idealnya, masjid harus selalu siap memberi pencerahan kepada umat agar cerdas menangkap berbagai fenomena kehidupan. Kecerdasan ini dapat diawali melalui sikap menjadikan masjid sebagai spirit karena di dalamnya telah dilakukan ibadah untuk menumbuhkan energi baru dalam kehidupan. Berlainan dengan perbuatan syirik yang selalu mengarahkan pelakunya kepada kebodohan karena yang menyembah lebih cerdas dan lebih kuat dari yang disembah. Melihat kontrasnya perbuatan syirik ini maka wajar sekali jika syirik harus dimusnahkan karena masjid tidak akan pernah maju selama di dalamnya masih terdapat praktek syirik. Prihal yang seperti inilah menyebabkan munculnya larangan agar kesucian masjid jangan dinodai dengan perbuatan-perbuatan syirik dan bahkan semua orang Mukmin berkewajiban untuk menjaganya. Bila hal ini terjadi maka masjid akan kehilangan fungsi fundamentalnya sehingga para jamaah akan mudah terkontaminasi dengan perbuatan yang bertentangan dengan akal sehat. Pernyataan Alquran di atas menginginkan agar masjid dijadikan sebagai lembaga yang dapat mengarahkan umat kepada satu visi. Visi dimaksud adalah mencari ridha Tuhan dengan melepaskan diri dari segala

macam praktek yang berkaitan dengan syirik. Pengaruh Syirik Terhadap Kemunduran Masjid Hakikat dari setiap ibadah ialah melakukan pengabdian hanya semata-mata kepada Tuhan karena kagum dengan segala sifat kesempurnaan dan kemuliaan-Nya. Pasca pelaksanaan ibadah ini diharapkan agar pelakunya mampu menyerap sebagian sifat-sifat kesempurnaanNya untuk dijadikan sebagai acuan moral. Oleh karena itu, setiap pelaksanaan ibadah tidak boleh ditujukan kepada yang lain kecuali hanya kepada Allah SWT. Menjadikan sesuatu selain Tuhan untuk disembah disebut dengan syirik yang menurut ‘Afif Abd al-Fattah Thabbarah dalam kitab Ruh al-Din al-Islami terdiri dari patung-patung berhala, he-

tilah langit dan bumi akan mengalami benturan. Pelecehan inilah yang membuat Tuhan “tersinggung” karena kesucian-Nya telah dinodai akibat ketololan manusia sendiri. Padahal Tuhan sudah berulang kali menjelaskan bahwa diri-Nya memiliki kekuasaan yang tidak terbatas dan sanggup melakukan apa saja sesuai dengan kehendak-Nya tanpa harus dibantu oleh kekuatan lain. Untuk mengikis kesyirikan ini maka masjid adalah satusatunya institusi yang dapat diharapkan karena di dalamnya dilakukan ibadah untuk merenungi kebesaran dan kemahakuasaan Tuhan. Renungan ini tidak akan pernah berhasil jika dalam ibadah masih dirasuki oleh unsur-unsur syirik dan bahkan ibadah yang

Oleh karena itu, setiap pelaksanaan ibadah tidak boleh ditujukan kepada yang lain kecuali hanya kepada Allah SWT. wan, kuburan, benda-benda langit, kekuatan alam, mentuhankan manusia dan menduga bahwa Tuhan mempunyai anak. Gambaran yang dikemukakan oleh Thabbarah ini masih sebatas gambaran pisik tentang syirik padahal masih terdapat gambaran lain yang sifatnya abstrak seperti niat, pengakuan dan keyakinan. Perbuatan syirik sangat dicela oleh Tuhan karena dapat menodai kesucian zat dan sifat serta perbuatan-Nya sehingga orangorang yang melakukan syirik dianggap tidak pandai membalas jasa-jasa baik yang diberikanNya. Jasa baik dimaksud adalah penciptaan Tuhan terhadap manusia dengan segala fasilitas yang telah diberikan-Nya untuk menunjang kehidupan. Dalam konteks ini hanya satu yang diminta oleh Tuhan yaitu melakukan pengabdian hanya kepada-Nya. Prilaku syirik ini terkesan melecehkan esensi dan eksistensi Tuhan karena menempatkanNya pada posisi yang tidak berdaya sehingga diperlukan adanya tuhan yang lain. Alquran berulang kali menegaskan tentang penciptaan langit dan bumi yang teratur dan jika semua ini dilakukan oleh dua kekuatan pas-

dilakukan tidak memiliki kesan sama sekali. Harapan ini tercermin dari fungsi masjid yang senantiasa mengarahkan jamaahnya untuk melakukan ibadah hanya kepada Tuhan tidak kepada yang lain. Pengakuan melalui ibadah ini menunjukkan bahwa Tuhan adalah Zat Yang serba maha sehingga tidak terpikir sedikitpun adanya kekuatan yang dapat menyaingi sifat Tuhan ini. Alquran secara tegas menyatakan bahwa semua masjid adalah milik Tuhan dan salah satu fungsinya adalah untuk mengikis praktek-praktek syirik. Fungsi ini merupakan skala prioritas untuk mewujudkan fungsi-fungsi yang lain karena tanpa melakukan fungsi ini maka fungsi-fungsi yang lain tidak akan mungkin diwujudkan. Oleh karena itu, sangat tidak layak bila di dalam masjid masih terdapat sesuatu yang berkaitan dengan nuansa syirik. Melihat tingginya harapan ini maka masjid harus ‘steril’ dari syirik baik niat, pengakuan maupun perbuatan sehingga tidak ada dualisme yang disembah di dalam m a s j i d . Pemurnian ibadah yang dila-

kukan di dalam masjid ini memiliki nuansa tersendiri dimana pelakunya dapat menghayati nilai-nilai spritual yang terkandung di dalam ibadah. Implikasi dari pemurnian ibadah ini akan melahirkan semangat hidup yang tinggi sehingga ibadah sudah menjadi kebutuhan hidup. Al-Qurthubi dalam tafsirnya al-Jami’ li Ahkam Alquran mengomentari ayat di atas bahwa Tuhan menyuruh nabi-Nya dan orang-orang Mukmin berdoa secara murni hanya kepada-Nya ketika memasuki masjid manapun. Komentarnya lebih lanjut yaitu jangan menyekutukan Tuhan di dalam masjid dengan membuat berhala dan yang lainlain untuk disembah. Komentar al-Qurthubi ini menunjukkan bahwa mensterilkan masjid dari syirik adalah kewajiban orang-orang Mukmin mengingat bahwa kedudukan masjid tidak dapat dilepaskan dari pola hidup orangorang Mukmin sehar i-har i. Nampaknya isyarat dari komentar al-Qurthubi ini adalah bahwa masjid tidak akan pernah memberikan akses yang terbaik kepada umat jika di dalam masjid masih tedapat praktek-praktek syirik. Kecaman tentang syirik ini didapati berulang kali dalam Alquran dan bahkan ada dua ayat yaitu Q.S. al-Nisa’ ayat 48 dan 116 yang menegaskan bahwa Tuhan tidak membuka peluang untuk mengampuni dosa syirik namun selainnya tetap diampuni. Penegasan ini menunjukkan bahwa Tuhan tidak pernah bertoleransi kepada syirik dan karenanya prilaku ini tidak layak dilakukan terlebih-lebih lagi di dalam masjid. Penutup Masjid sebagaimana yang dipahami adalah sebagai tempat untuk melakukan ibadah dengan ikhlash dan tauhid kepada Tuhan dan karenanya jangan pernah ada perbuatan yang melenceng dari kedua konsep ini. Pelencengan dari kedua konsep ini dianggap telah menodai kesucian masjid dan oleh sebab itu semua pihak berkewajiban untuk mensterilkan masjid dari praktek-praktek syirik, dan hal ini perlu untuk dilakukan guna mewujudkan fungsi-fungsi yang lain.

Waspada, Jumat 13 April 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you