Issuu on Google+

Berastagi 20-30 0 C

R. Prapat 25-330C

Parapat 20-30 0C

P. Siantar 17-260C

Sibolga 22-33 0 C Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Medan 24-320C

BMKG Polonia

JUMAT, Wage 12 November 2010/5 Zulhijjah 1431 H

No: 23325 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12 B1-12)

Harga Eceran: Rp2.500,-

Tenda Jamaah Indonesia Belum Siap

Lagi Ratusan Calhaj Terlantar Di Medan

MAKKAH (Antara): Persiapan sejumlah tenda bagi jamaah haji Indonesia di Arafah masih terus dikerjakan dan diharapkan dalam sisa waktu yang tinggal tiga hari ke depan, tenda untuk pelaksanaan wukuf 9 Dzulhijah (15 November) sudah siap pakai. Tenda-tenda jamaah haji Indonesia yang masuk zona jamaah Asia, letaknya di belakang bila dibanding dengan jamaah non Asia lainnya. Tenda Misi Haji Indonesia berdekatan dengan plang batas akhir wilayah Arafah. Lokasinya berada di Maktab 44, Street 908 Road 9. Tak jauh dari tenda milik Malaysia. Lanjut ke hal A2 kol. 2

MEDAN (Waspada): Ratusan calon jamaah haji dari berbagai kota seperti Medan, Tebingtinggi, Sergai, Batam, Riau, Lampung, Makassar, Aceh dan Kalimantan, gagal berangkat ke Tanah Suci Makkah. Ratusan Calhaj tersebut, kini diinapkan di Hotel Sri Deli Medan oleh Biro Perjalanan Haji dan Umroh Azizi Kencana Wisata beralamat di Hotel Sri Deli dan Jalan Sutomo Ujung Medan. Nadia Nuzula salah seorang calhaj asal Bandar Lampung mengungkapkan, mereka sudah 13 hari menginap di hotel tersebut. Tapi sampai saat ini tidak ada kepastian kapan mereka diberangkatkan ke Arab Saudi. Lanjut ke hal A2 kol. 6

Arab Saudi Siaga Serangan Al Qaida

Jamaah Nonkuota Capai 3.000 Orang

RIYADH, Arab Saudi (AP): Arab Saudi siaga dari kemungkinan serangan al-Qaida pekan depan pada pelaksanaan Haji, yang diikut jutaan umat Islam dari berbagai penjuru dunia. Pada saat musim Haji, jutaan jamaah membanjiri Makkah dan Madinah, kata Menteri Dalam Negeri Saudi. Menteri Dalam Negeri Arab Saudi, Rabu (10/11), mengatakan dia tidak akan mengesampingkan upaya al Qaida untuk mengganggu keamanan pada saat Ibadah Haji, tahun ini, yang akan dimulai pekan depan. “Kami tidak dapat mempercayai mereka (al Qaida). Kami tidak akan mengesampingkan setiap upaya untuk mengganggu keamanan Haji,” kata

JEDDAH (Antara): Pada hari terakhir sebelum penutupan (closing date) Terminal Haji Bandara King Abdul Azis pada Rabu (10/11), jumlah nonkuota asal Indonesia yang mendarat di bandara itu lebih dari 3.000 orang atau lebih banyak dibanding tahun lalu. Jamaah nonkuota dengan jumlah besar antara lain diberangkatkan oleh Kelompok Bimbingan Ibadah Haji (KBIH) Al Bayan Jakarta. Jamaah yang diberangkatkan KBIH ini tak hanya dari ibu kota, tapi juga dari berbagai penjuru Tanah Air. Pada hari kedua jelang closing date, juga masih banyak ditemukan jamaah nonkuota yang keleleran. Sembilan jamaah asal Madura telantar di bandara 10 jam lebih lantaran penjemput tak kunjung datang.


PULUHAN ribu jamaah haji melaksanakan tawaf di Masjidil Haram, Kamis (11/11). Ibadah haji tahunan ini diikuti sekitar tiga juta jamaah yang menyebabkan Lanjut ke hal A2 kol. 2 Kota Makkah menjadi sangat padat.

3 Hari Menjelang Mina, Makkah Padat Makkah (Waspada): Tiga hari lagi menjelang keberangkatan ke Mina pada tahapan pertama dari lima tahap pelaksanaan ibadah haji, semua jalan di seluruh Arab Saudi padat. Rabu (10/11) malam, temperatur Makkah tercatat 25 derajat Celsius. Tapi lapangan dan atap yang dilapisi permadani di tingkat-tingkat Masjidil Haram, di mana berada Ka’bah, dipenuhi oleh jamaah bersenang-senang dan bersantai. Menurut pantauan, penerbangan internasional dan domestik yang penuh dengan jamaah laki-laki, perempuan dan anak-anak terus berdatangan

Rektor IAIN Kukuhkan Lima Guru Besar

di Bandara Internasional King Abdulaziz. Lalulintas lancer di jalan expressway dengan empat jalur menuju Makkah dari Jeddah. Satu jawaban bagi kurangnya kemacatan di jalanraya yaitu ketatnya disiplin para penegak hukum dan Departemen Paspor yang punya kebijakan nopermit-no-pilgrimage (tak ada izin tanpa jamaah).

MEDAN (Waspada): Rektor Institut Agama Islam Negeri (IAIN) Sumatera Utara mengukuhkan lima guru besar tetap dari FakultasTarbiyah, Ushuluddin dan Syariah di aula Kampus II IAIN, Jalan Willem Iskandar Medan Estate, Kamis (11/11). Kelima guru besar yang dikukuhkan yakni Prof. Dr. H. Amiur Nuruddin, MA dari Ilmu Ekonomi Islam Fakultas Syariah, Prof. Dr. H. Abd. Mukti, MA dari Sejarah Pendidikan Islam

Lanjut ke hal A2 kol. 1

Gayus Melenggang Di Luar Tahanan

Karutan Mako Brimob Dan 8 Anggota Ditahan JAKARTA (Waspda): Kapolri Jenderal Timur Pradopo mengatakan, Kepala Rutan Markas Komando (Mako) Brimob Polri bersama delapan anggotanya yang diduga turut memberi keleluasan kepada Gayus HP Tambunan hingga keluar tahanan, telah dijebloskan dalam tahanan. “Iya (ditahan), ya ini bagian dari evaluasi. Ikuti semua proses hukumnya,” kata Kapolri ditanya wartawan di Mabes Polri mengenai kebenaran penaha-

nan Kepala Rutan Mako Brimob bersama anggotanya di Jakarta, Kamis (11/11). Kata Kapolri, penyidikan terhadap dugaan bebasnya Gayus di luar Rutan Mako Brimob ditangani Direktorat Tindak Pidana Korupsi (Tipikor) Polri, dan telah menahan sembilan orang polisi. Sementara, Kadiv Humas Polri Irjen Iskandar Hasan mengatakan, Kepala Rutan Mako

Lanjut ke hal A2 kol. 1

BACA DI HALAMAN DALAM Antara Alquran Dan Alhadis

Pendidikan Islam Dalam Perspektif Alquran

Oleh dr Arifin S Siregar

Oleh H.M. Nasir, Lc, MA

Mimbar Jumat-B10

Mimbar Jumat-B11

Waspada/Surya Efendi

WALIKOTA Medan Rahudman Harahap bersama sejumlah pejabat meninjau Pasar Sore Padang Bulan, Kamis (11/11), yang terbakar menghanguskan ratusan kios.

Walikota Hibur Duka Pedagang Pasar Sore PERISTIWA kebakaran yang memusnahkan 196 kios dan stand Pasar Sore Padang Bulan di Jalan Jamin Ginting, Kamis (10/11) dini hari, tak hanya menyisakan puing-puing bekas kebakaran tetapi juga menyisakan duka bagi pemilik kios yang menjadi korban.

Istri Gayus Tambunan Dimutasi Ke Kecamatan JAKARTA (Waspada): Milana Anggraeni (foto), istri Gayus Tambunan, terdakwa kasus mafia pajak, dianggap sudah tidak memenuhi syarat sebagai PNS di lingkungan DPRD DKI Jakarta. Milana yang sering bolos kerja dikenai sanksi administrasi.

Lanjut ke hal A2 kol. 1


Pasar Sore Padang Bulan bukan yang pertama tetapi merupakan korban ketiga yang terbakar sepanjang tahun 2010, setelah Pasar Kuala Bekala dan Pasar Sukaramai.

Lanjut ke hal A2 kol. 3

Rahmat Shah Siap Layani Gugatan Gubsu MEDAN (Waspada): Anggota Dewan Perwakilan Daerah (DPD) RI Rahmat Shah menyatakan siap melayani gugatan Gubsu H Syamsul Arifin terkait lahan eks Gedung Pemuda di Jl. Medan-Binjai Km 6,7. “Semua bukti-bukti kepemilikan atas lahan itu ada pada saya sesuai ketentuan hukum dan Undang-Undang RI serta putusan-putusan hukum yang sudah inckraht (mempunyai kekuatan hukum tetap),” kata Rahmat didampingi kuasa hukumnya Edi Yunara di Galeri Rahmat Jl. S Parman Medan, Kamis (11/11). Menurut Rahmat, Pemprovsu telah kalah di PN Medan,

Lanjut ke hal A2 kol. 3

Fakultas Tarbiyah, Prof. Dr. H. Syafaruddin, MPd dari Ilmu Pendidikan Islam Fakultas Tarbiyah, Prof. Dr. Fachruddin, MA dari Administrasi Pendidikan Islam Fakultas Tarbiyah dan Prof. Dr. Katimin, MAg dari Sejarah Politik Islam Fakultas Ushuluddin. Prof. Fadhil Lubis menyebutkan, dengan dikukuhkannya kelima guru besar tersebut maka

Lanjut ke hal A2 kol. 1

Soeharto Tak Dapat Gelar Pahlawan JAKARTA(Antara): Dewan Gelar, Tanda Kehormatan, dan Tanda Jasa memastikan mantan Presiden Soeharto (alm) tidak mendapat gelar pahlawan nasional. Kepastian itu disampaikan dalam acara penganugerahan gelar pahlawan dan gelar kehormatan di Istana Negara, Jakarta, Kamis (11/11), dihadiri Presiden

Alur Naga Tercemar PULORAKYAT, Asahan (Waspada) : Alur naga di Dusun IV Bendorawa, Desa Opa Padangmahondang, Kecamatan Pulorakyat, Asahan, sejak empat bulan terakhir ini tercemar limbah sawit.Sedangkan permukaan alur tertutup gulma eceng gondok. Muslim Manurung, 56, salah seorang warga mengatakan, alur naga yang panjangnya 400 meter lebar 7 meter, dalam

Lanjut ke hal A2 kol. 1

Susilo Bambang Yudhoyono. Pemerintah melalui Keputusan Presiden No 52 TK/2010 akhirnya memberikan gelar Pahlawan Nasional hanya kepada dua tokoh, yaitu Dr Johannes Leimena dan Johannes Abraham Dimara. Sebelumnya, Kementerian Sosial mengajukan 10 nama tokoh yang telah diseleksi untuk memperoleh gelar pahlawan nasional kepada Dewan Gelar, Tanda Kehormatan, dan Tanda Jasa. Sepuluh tokoh itu adalah mantan Gubernur DKI Ali Sadikin, Habib Sayid Al Jufrie, mantan presiden HM Soeharto, mantan presiden KH Abdurrahman Wahid. Kemudian Andi Depu dari Sulawesi Barat, Johanes Leimena dari Maluku, Abraham Dimara dari Papua, Andi Makkasau dari Sulawesi Selatan, Pakubuwono X dari Jawa Tengah, dan Sanusi dari Jawa Barat.

erampang Seramp ang

Waspada/Rahmad F Siregar

BEKAS lintasan ular naga, tercemar limbah, Kamis (11/11).

- Jangan bosan doakan kami yo... - He...he...he...

Medan 24-32 C

P.Sidimpuan 20-30 C

R.Prapat 25-33 0C

Penyabungan 20-30 0C

Berastagi 17-260C


Sibolga 22-330C Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca 0

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

JUMAT, Wage, 12 November 2010/5 Zulhijjah 1431 H z No: 23325 * Tahun Ke-64

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Calhaj Plus Aceh Terlantar Di Medan

Ratusan Calhaj Terlantar Di Medan

Waspada/Anum Saskia

MENANGIS: Calhaj asal Takengon yang menangis di Hotel Sri Deli Medan. Mereka kecewa dengan sikap PT Azizi yang belum memberi kepastian keberangkatan haji setelah menyetor uang lebih dari 66 juta.

MEDAN (Waspada): Ratusan Calon jamaah haji dari berbagai kota seperti Medan, Tebingtinggi, Sergei, Batam, Riau, Lampung, Makassar, Aceh bahkan dari Kalimantan, merasa kecewa dan mengangis di Hotel Sri Deli Medan, karena gagal berangkat ke tanah suci untuk menunaikan ibadah haji. Padahal mereka telah menyetorkan uang kepada Biro Perjalanan Haji dan Umroh Azizi beralamat di Hotel Sri Deli dan Jalan Sutomo Ujung Medan. Nadia Nuzula salah seorang calon jemaah haji asal Bandar Lampung mengungkapkan, mereka sudah 13 hari menginap di hotel tersebut. Tapi sampai saat ini kapan keberangkatan mereka ke Arab Saudi tak jelas. Menurut Nadia, pihak penyelenggara perjalanan haji itu berjanji akan memberangkatkan mereka, kemarin (10/11) dengan membayar Rp 3 juta. “Setelah kami tunggu-tunggu perwakilan mereka tak juga datang ke hotel ini untuk merealisasikan janji tersebut. Pagi ini, masuk SMS dari Direktur Azizi Naslah Lubis yang minta kami membayar Rp 10 juta lagi agar visa kami keluar dan bisa berangkat Jumat (12/11) ini,” ujar Nadia yang keberangkatannya menunaikan beribadah haji ditemani suami. Permintaan uang tersebut disampaikan Nasla kepada karyawannya untuk diteruskan kepada jemaah haji via SMS. Dalam SMS tersebut, pihak Azizi berjanji akan menemui jemaah haji yang terlantar tersebut usai shalat Dzuhur. Tapi sampai Lanjut ke hal A2 kol 1


Sejumlah jamaah calon haji plus menunjukkan bukti surat pelunasan ongkos haji saat diterlantarkan di Medan, Sumut, Kamis (11/11). Sedikitnya 120 orang jamaah calon haji asal provinsi Aceh tersebut sudah seminggu berada di Medan menunggu kejelasan jadwal keberangkatan dari salah satu biro perjalanan haji di Medan yang menjanjikan akan memberangkatkan mereka ke Tanah Suci pada tanggal 1 November 2010 lalu.

Kasus Gayus, 9 Anggota Polri Tersangka Status Tersangka Gayus Akan Bertambah JAKARTA ( Waspada): Status terdakwa kasus mafia hukum, Gayus Tambunan segera bertambah. Mantan pegawai Direktorat Jenderal Pajak itu segera ditetapkan sebagai tersangka karena diduga menyuap petugas untuk keluar tahanan. “Gayus juga akan ditetapkan sebagai tersangka, sebagai penyuap,” kata Kepala Divisi Humas Polri, Irjen Pol Iskandar Hasan di Mabes Polri, Jakarta, Kamis (11/11). Gayus diduga tak hanya sekali keluar rumah tahanan. Berdasarkan pengakuan penjaga yang diperiksa karena Lanjut ke hal A2 kol 2

Istri Gayus Dapat Teguran Tertulis JAKARTA ( Waspada): Istri terdakwa kasus pajak Gayus Halomoan Tambunan, Milana Anggraeni ,30, mendapat teguran tertulis dari instansi tempatnya bekerja, DPRD DKI Jakarta, karena sering tidak masuk kerja. Kepala Sub Bagian Persidangan Pimpinan dan Panitia Sekretariat DPRD DKI Y Sofyan di Jakarta, Lanjut ke hal A2 kol 1

JAKARTA (Waspada): Sembilan anggota Polri menjadi tersangka yang diduga menerima suap dari terdakwa Gayus HP Tambunan agar dapat keluar dari Rumah Tahanan Markas Komando Brimob Kelapa Dua, Depok.

“Kesembilan anggota Polri yang diperiksa terbukti men e r i m a s u a p d a r i Ga y u s dengan total Rp50 juta hingga Rp60 juta,” kata Kepala Divisi Hubungan Masyarakat (Kadiv Humas) Polri, Irjen Pol Iskandar Hasan di Jakarta, Kamis (11/11). Sembilan anggota Polri yang bertugas saat kejadian yakni Briptu BH, Briptu DA, Briptu AD, Bripda ES, Bripda

JP, Bripda S dan Bripda B serta Kepala Rutan Mako Brimob, Kompol IS. “Untuk anggota mendapat suap Rp5 juta hingga Rp6 juta, sementara untuk Kompol IS masih belum tahu jumlahnya dan akan dicek kepada Gayus,” kata Iskandar menambahkan. Kadiv Humas mengatakan, sembilan anggota tersebut sudah ditahan sejak tanggal 8 November 2001.

“Tindakan yang dilakukan tersebut adalah inisiatif dari Kompol IS sendiri, tidak ada inisiatif dengan pihak luar,” kata Iskandar. Para tersangka dipersangkakan melanggar pasal 5 ayat 2, pasal 11, pasal 12 UndangUndang Nomor 20 Tahun 2001 Tentang Perubahan Atas Undang-Undang Nomor 31 Lanjut ke hal A2 kol 3

Setelah Todong Petugas LP

Pria Bersenpi AK 47 Bawa Kabur Empat Napi LHOKSEUMAWE (Waspada): Setelah menodong dan mengancam petugas Lembaga Permasyarakatan (Lapas) Kota Lhokseumawe, Kamis (11/11) seorang pria bersenjata api laras panjang bersama kawanannya berhasil membawa kabur empat orang narapidana (napi) kasus narkoba. Drama pembebasan napi dari penjara setempat merupakan tindakan nekat yang dilakukan kelompok bersenjata api ini pada tengah siang bolong dan mereka beraksi tanpa memakai sebo. Apalagi lokasi lapas setempat berdampingan dengan Makodim 0103 dan hanya berjarak 500 meter dari rumah dinas Kapolres Lhokseumawe AKBP Kukuh Santoso. Empat napi yang dibebas-

kan pelaku bersenjata api semuanya berkasus narkoba terhukum di atas lima tahun. Masing-masing adalah Azhari Bin Abu Bakar, 23, divonis 10

tahun, Yusrizal, 34, warga Dusun Rame Indah Desa Alue Pinang Kota Langsa, divonis 10 tahun, Rizal Antoni bin Jamaluddin alias Dek Gam, 33,

Lima Tersangka Penjudi Togel/KIM Ditangkap PANYABUNGAN ( Waspada ): Lima tersangka penjudi ditangkap aparat Polres Kabupaten Mandailing Natal dalam operasi penyakit masyarakat (Pekat) dengan sasaran judi togel dan KIM, di Kecamatan Siabu, Pekan lalu. Kapolres Madina AKBP Hirbak Wahyu Setiawan SIK didampingi Wakapolres Komisaris Polisi Hariyatmoko Sik, Kasat Reskrim AKP SM Siregar SH, Kasat Narkoba AKP Hendra, Rabu (10/11) mengatakan, kelima tersangka tukang tulis (rekap), pemasang (pembeli) dan pemilik kedai. Mereka masing-masing HM, 32, warga Desa Sihepeng, TB, 42, warga Desa Simaninggir, RN, 25 warga Desa Sihepeng, AS alias U, 27, warga Kel. Simangambat dan Lanjut ke hal A2 kol 3

divonis 6 tahun dan Said Sarbini bin Sulaiman, 45, warga Meunasah Blang Kecamatan Idi, Kabupaten Aceh Timur. Menurut petugas LP setempat M. Nur, setelah membebaskan empat napi, para pelaku kabur dengan kendaraan satu unit mobil jenis Kijang Kapsul ke arah barat. “Karena kejadiannya begitu cepat, mungkin kalau tidak salah mobil Kijang yang digunakan mereka bernomor plat B 80 HS. Siapa yang berani sama orang bersenjata api, biar pun ramai juga tidak mungkin dilawan dengan tangan kosong,” tutur Nur. Hingga berita ini diturunkan pihak Polres Lhokseumawe masih mengejar pelaku dengan mempersempit ruang Lanjut ke hal A2 kol 3

kan jenis kendaraan dan plat mobil yang digunakan,” ujar Nimor. Kabar itu berkembang terus, hingga saat pulang sekolah dari SMP I Lubuk Barumun, para siswa banyak yang memilih menghindari jalan umum karena khawatir. Hal yang sama juga diungkapkan Sutan Nagori Daulya, 60, warga Gotting Julu Kec. Huristak, Dikatakannya, di desanya beredar SMS yang menyebutkan penculikan anak sehingga akhirnya warga mencurigai setiap warga pendatang. Lanjut ke hal A2 kol 1

JAKARTA (Antara): Dewan Gelar, Tanda Kehormatan dan Tanda Jasa memastikan mantan Presiden Soeharto (alm) tidak mendapat gelar Pahlawan Nasional. Kepastian itu disampaikan dalam acara penganugerahan gelar pahlawan dan gelar kehormatan di Istana Negara, Jakarta, Kamis (11/11) yang dihadiri Presiden Susilo Bambang Yudhoyono.

Lanjut ke hal A2 kol 6

Pengedar Ganja Antar Provinsi Dibekuk PANYABUNGAN (Waspada): Satuan Narkoba Polres Kabupaten Mandailing Natal menangkap empat tersangka pengedar daun ganja kering, dari tiga lokasi yang berbeda. Tiga dari empat tersangka merupakan pengedar antar provinsi karena berasal dari Kota Padang, Provinsi Sumatera Barat. Selain itu, petugas juga menyita barang bukti 35 bal daun ganja kering, mobil Daihatsu Xenia BA 1142 BN warna silver, sepeda motor

Suzuki SPIN BA 6087 WW dan dua handphone. Kapolres Madina AKBP Hi r b a k Wa h y u Se t i a w a n d i d a m p i n g i Wa k a p o l re s Komisaris Polisi Hariyatmoko Sik, Kasat Reskrim AKP SM Siregar SH, Kasat Narkoba AKP Hendra Rabu (10/11) mengatakan, ke empat tersangka SN alias C, 38, penduduk Hutatua, Kec. Panyabungan Timur Mandailing Natal. Minggu (31/10) di Desa Lanjut ke hal A2 kol 1

Polres Madina Amankan Lima Perambah

Isu Culik Anak Resahkan Warga Padanglawas SIBUHUAN ( Waspada): Warga Kab. Padanglawas resah dengan munculnya isu penculikan anak yang beredar luas melalui SMS dan dari mulut ke mulut dalam sepekan ini dengan menyebutkan ada kelompok sedang mengintai warga yang lengah untuk diculik. Nimor Pasaribu, 16, warga Lubuk Barumun, kepada Waspada, Kamis (11/11) mengaku menerima SMS mengenai penculikan tersebut dari temannya. SMS tersebut mengatakan adanya penculikan anak untuk diambil anggota bagian dalam tubuhnya. “SMS itu juga menyebut-

Soeharto, Gus Dur Tak Dapat Gelar Pahlawan Nasional

Waspada/Gito Rolis

SIDANG Paripurna pembacaan rekomendasi DPR Aceh, Kamis (11/11) terhadap laporan anggaran tahun 2009 di gedung utama DPRA, terlihat sejumlah kursi anggota dewan kosong seharusnya dihadiri seluruh anggota dewan.

Pemerintah Aceh Berlomba Habiskan Uang Ruang Rapat DPRA Kosong

BANDA ACEH (Waspada): Juru Bicara BadanAnggaran (Banggar) DPRA Dalimi menyebutkan, aparatur Pemerintah Aceh berlomba menghabiskan uang dan bermalas-malasan menggali potensi pendapatan. Ungkapan itu tercetus di ruang paripurna gedung utama DPRA Rabu (10/11) malam. Namun, Kamis (11/11), ruang rapat paripurna terlihat kosong, hanya sekitar 30 anggota dewan yang mengikuti sidang tersebut. Berdasarkan laporan pendapat, usul dan saran Banggar

Dewan Perwakilan Rakyat Aceh (DPRA) terhadap pertanggungjawaban pelaksanaan APBA tahun anggaran 2009 yang dibacakan Dalimi, secara umum kinerja pendapatan dapat dikatakan kurang memuaskan. Tercatat, dari tingkat capaian realisasi anggaran sebesar 89,75% dari yang dianggarkan pada 2009, jika dibanding dengan jumlah pendapatan pada tahun 2008, jumlah pendapatan 2009 ini mengalami penurunan sebesar 12,58%. Dalam laporan itu secara umum APBA tahun 2009 Lanjut ke hal A2 kol 3

PANYABUNGAN ( Waspada): Tim gabungan Polres Mandailing Natal (Madina) dan Dinas Kehutanan mengamankan lima tersangka perambah dan penebang kayu di Hutan Produksi Terbatas (HPT) Laba Honas, Desa Batu Mundom, Kec. Muara Batanggadis. Tim dipimpin Kasat Reskrim AKP Sarluman Siregar awalnya menangkap empat pelaku saat menebang kayu di kawasan HPT itu. Seorang lainnya yang diketahui melakukan kegiatan imas tumbang dinyatakan menjadi Daftar Pencarian Orang ( DPO). Selain mengolah kayu tebangan menjadi kayu gergajian, bekas perambahan juga dibakar para pelaku untuk dijadikan areal perkebunan karet. Polisi juga mengamankan 17 unit chainsaw atau mesin gergaji potong dan puluhan lembar papan sebagai barang bukti. Tim juga mengamankan

barang bukti lain seperti peralatan chainsaw berupa bar, rantai, derigen, kalbulator, kikir, sambungan, kunci-kunc i . Ke m u d i a n 4 6 l e m b a r papan, 4 batang broti, satu lembar papan bertuliskan tanah milik keluarga Guntur Harahap 2.000 x 500 atau 100 hektare. Kelima tersangka, HMS, 41, warga Lorong III, Kel. Simarpinggan, Kec. Batang Angkola Selatan, Tapsel, PS, 25, warga Desa Garonggang, Kec. Angkola, HS, 17, warga Desa

Lanjut ke hal A2 kol 6

Serampang - Di luar menyuap di dalam menyuap, dasar tukang suap - He.... he....he....

Berita Utama

A2 3 Hari Menjelang ... Di beberapa titik pengangkutan di Jeddah untuk kendaraan yang mengangkut penumpang tujuan Makkah, para pemuda Saudi menolak untuk mengangkut mereka yang tidak punya izin karena hal itu mengandung resiko. ‘’ Banyak dari teman kami ditangkap dan kendaraannya ditahan karena mereka mengangkut orang tanpa izin resmi ke Makkah,” kata Dhafer Muhammad dari dalam mobil yang dikemudikannya di distrik Bab Makkah di Jeddah. “Mereka memeriksa satu per satu dan setiap mobil. Jika memiliki izin, mari kita samasama, kalau tidak, maaf saja.” Temannya, Waleed Mahdi, sudah memiliki dua warga India yang duduk di dalam mobilnya, Toyota Camry, dan dia masih harus menunggu dua orang lagi penumpang. Dia menda-

Karutan Mako Brimob, ... Brimob Kompol Iwan Siswanto diduga sebagai otak dari bebasnya Gayus dari Rutan Mako Brimob. “Kepala Rutan sudah dicopot. Pencopotannya terkait dugaan Gayus di luar rutan. Dari hasil penyidikan Bareskrim Mabes Polri, Kompol Iwan yang menyuruh sehingga terjadi penyuapan itu,” kata Iskandar kepada pers di Mabes Polri, kemaren. Menurut dia, pencopotan Iwan Siswanto dari Karutan, di-

Istri Gayus Tambunan ... Dia akan dimutasi ke Kecamatan Kelapa Gading. Prosesnya kini sedang berjalan. “Kemarin orang dari Walikota Jakarta Utara sudah telefon dan Rani (panggilan Milana) disuruh datang,” kata Kepala Sub Bagian Persidangan, Pimpinan dan Panitia Sekretariat DPRD DKI Jakarta, Sofyan FZ, saat ditemui di kantornya, Kamis (11/11). Dari data absensi, kata So-

Alur Naga Tercemar ... 4 meter selama ini dipercayai masyarakat adalah alur bekas lintasan ular naga. Bahkan, Muslim dalam beberapa tahun ini menikmati berkah alur naga, karena ikan di sana berlimpah. Tetapi, kondisi itu kini tinggal kenangan. “ Ikan tidak ada lagi sejak 4 bulan lalu, sebab alur air tertutup eceng gondok dan dicemari limbah kelapa sawit,” kata Muslim Manurung kepada Waspada, Kamis (11/11). Menurut Muslim, dari 400 meter panjang alur itu, 200 meter

Rektor IAIN ... jumlah guru besar tetap IAIN saat ini berjumlah 26 orang. “Kehadiran guru besar jelas merupakan salah satu barometer perkembangan sumber daya manusia kita yang semakin handal. Dibandingkan dengan IAIN dan Universitas Islam Negeri (UIN) lain, jumlah guru besar kita termasuk dalam peringkat memuaskan,” kata Prof. Fadhil. Sementara itu, Prof. Dr. H. Amiur Nuruddin MA dalam pidato pengukuhannya mengangkat tema “Kesejahteraan Sejati Dalam Perspektif Ilmu Ekonomi Islam”, Prof. Dr. H. Abd. Mukti, MA mengangkat tema “Kontribusi Studi Sejarah Pendidikan Islam dalam Pembaruan Pendidikan Islam di Indonesia pada Abad XX”. Prof. Dr. Fachruddin, MA, mengangkat tema “Reformasi Administrasi Pendidikan

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Ge7+, Rf7. 3. MxB+mat.

Jawaban TTS: TTS Topik







Jawaban Sudoku: 4 3 7 6 1 8 2 5 9

9 8 5 2 3 4 1 7 6

6 2 1 7 5 9 4 3 8

8 1 9 3 7 6 5 4 2

3 5 4 8 9 2 6 1 7

2 7 6 1 4 5 8 9 3

7 9 8 5 2 1 3 6 4

ambil karena dugaan menerima penyuapan uang sebesar Rp50-Rp60 juta, dan masingmasing 8 anggota lainnya menerima Rp5-Rp6 juta dari Gayus. “Tapi itu perlu pemeriksaan lebih lanjut dan cek silang ke Gayus serta mereka,” kata Iskandar. Mereka, sebutnya, dikenai pasal penyuapan. Sanksi terhadap ke sembilan orang tersebut yang ditetapkan sebagai tersangka dan ditahan 8 November 2010, terkena pasal 5 ayat 2 pasal 11, pasal 12, UU Tipikor. (j02) fyan, Rani terlihat jarang masuk. Bahkan selama September tercatat tidak pernah masuk. “Kalau di bagian persidangan, Rani masih terdaftar selama lima bulan ini. Tapi biasanya datang terus pergi lagi,” kata Sofyan. Karena kinerjanya yang buruk, Rani dikenai sanksi yang ditindaklanjuti ke Bagian Kepegawaian Daerah (BKD). “Dari BKD, katanya, akan dipindah ke Kecamatan Kelapa Gading,” kata dia. (VIVAnews) ditutupi eceng gondok. Dan, lebarnya yang semula mencapai 7 meter, hanya tinggal 5 meter akibat ditumbuhi ilalang. Bahkan, kondisi air di alur itu menghitam dan berminyak. “ Air ini tercemar limbah pabrik, sehingga baunya masam dan apabila dimanfaatkan kulit kita akan gatal. Ikan pun tak mau lagi berkembang biak di sini,” tutur Muslim. Imbasnya, Muslim dan keluarganya, termasuk masyarakat sekitar, tidak bisa lagi memanfaatkan alur air itu untuk menambah penghasilan. (a37) dalam Meningkatkan Kualitas Pendidikan”. Sedangkan Prof. Dr. Katimin, MAg dalam pidato pengukuhannya mengangkat tema “Menuju Tatanan Dunia Baru Hubungan Barat-Islam (Perspektif Politik)” dan Prof. Dr. Syafaruddin, M.Pd mengangkat tema “Pendidikan Islam dan Pengembangan Sumber Daya Manusia di Indonesia. (m41)

Arab Saudi Siaga ... Pangeran Nayef bin Abdul Aziz ketika ditanya mengenai kemungkinan ancaman al Qaida. “Kami siap untuk (menghadapi) setiap ancaman yang mungkin terjadi. Insya Allah, tidak ada apa-apa yang akan terjadi, karena rasa hormat pada ibadah ini,” katanya pada konferensi pers setelah parade pasukan keamanan dan pertahanan sipil untuk persiapan bagi musim Haji tahun ini. “Kami akan mampu menggagalkan aksi seperi itu,” katanya. Sekitar 2,5 juta jamaah Muslim diperkirakan akan turun ke kota suci Makkah di Arab Saudi barat untuk melakukan Ibadah Haji. (m07)

Tenda Jemaah ...

2. Mg7+, Re8.


pat penumpang seorang warga Turki Mehmut Ahmet Misiri. Namun, dia ragu ketika dia mengetahui bahwa pria Turki itu memakai ihram. “Apakah anda punya izin?” tanya Mahdi. “Ya,” jawab pria Turki itu. Namun, surat yang diperolehnya mengatakan lain. Dia memiliki satu iqama yang diterbitkan di Makkah, dan dia beranggapan bahwa dia dapat saja masuk dan keluar dari kota suci itu kapan dia mau. Pengemudi itu mengatakan jika dia penduduk Makkah, dia seharusnya tidak mengenakan ihram di Jeddah. Mencapai Masjidil Haram tidak begitu rumit. Segalanya telah di rencanakan dengan baik, dengan polisi lalulintas yang memimpin mobil dan kendaraan lainnya ke arah yang benar. Tak seorang pun diizinkan untuk memarkir kendaraannya sembarangan di mana saja.Tak boleh parkir dekat masjid. (an/m07)

1 4 2 9 6 3 7 8 5

5 6 3 4 8 7 9 2 1

Tenda-tenda tersebut sebagian besar masih dalam tahap penyelesaian akhir. Lampu dan alat pendingin ruangan sudah terpasang. Menurut salah seorang petugas di maktab 44, Abdus Salam, 46, masih diberi kelonggaran waktu sampai hari H. “Yang jelas, tanggal 9 (Dzulhijjah) siap semua,” kata Abdus Salam di lokasi pemondokan jamaah haji Indonesia di Arafah. Menurut Abdus Salam, lambatnya penyelesaian proyek pembuatan tenda bagi jamaah tersebut disebabkan lambatnya surat izin dari mauasasah. “Kalau keluar dari kemarin pasti langsung kami kerjakan. Makanya sampai sekarang, kami terus mengebut dalam pengerjaannya,” katanya. Selain persoalan bentuk fisik tenda, lokasi tenda jamaah juga kurang strategis yang mengakibatkan bendera Merah Putih tak bisa terpasang secara mencolok (tidak terlihat dari jarak jauh). Berbeda dengan Malaysia. bendera negeri Jiran itu dikibarkan mengelilingi kawasan maktab. Padahal, jumlah jamaah Malaysia hanya sepersepuluh dari jumlah jamaah haji Indonesia yang jumlahnya mencapai 221 ribu jamaah.

Lagi, Ratusan Calhaj ...

Waspada/Anum Saskia

CALHAJ asal Takengon menangis di Hotel Sri Deli Medan, mereka kecewa dengan sikap PT Azizi yang belum memberi kepastian berangkat haji setelah menyetor uang lebih dari 66 juta.

Kasus USU, MA Tolak Kasasi Penggugat-Tergugat MEDAN (Waspada): Mahkamah Agung (MA) RI menolak kasasi para penggugat dan tergugat terhadap putusan banding Pengadilan Tinggi Sumatera Utara terkait gugatan Chairuddin P Lubis terhadap Forum Perduli USU di Pengadilan Negeri Medan terkait penyebarluasan melalui media bahwa mantan Rektor USU itu melakukan korupsi keuangan di PTN yang dipimpinnya. Kuasa hukum Chairuddin P Lubis (mantan Rektor USU) Junaidi Matondang, SH, kepada Waspada, di Medan, kemarin mengatakan, putusan MA RI itu No.385 K/Pdt/2009. Menurut Matondang, dengan ditolaknya permohonan kasasi putusan banding PT Sumut (No. 174/Pdt/2008, tanggal 26 Juli 2008) kedua belah pihak, sama artinya telah meneguhkan putusan PN Medan No.187/ Pdt.G/2007/PN-Medan, 17 September 2007. Amar putusan PN Medan itu, kata Matondang, antara lain para tergugat (Forduli USU/Iskandar Zulkarnain dan

kawan-kawan) telah melakukan perbuatan melawan hukum terhadap penggugat (Chairuddin P Lubis), menghukum para tergugat untuk membayar ganti rugi berupa biaya advokat kepada penggugat Rp 50 juta, menyatakan bahwa tuduhan-tuduhan para tergugat yang disebarluaskan secara gradual dan atau terus-menerus dari waktu ke waktu (sejak 10 Juli sampai Agustus 2006) dengan menyesatkan media cetak dan elektronik serta selebaran (undangan terbuka) merupakan fitnah terhadap penggugat. Selain itu, menghukum para tergugat untuk memulihkan reputasi, harkat, martabat dan kehormatan penggugat dengan atas biaya para tergugat sendiri dengan memasang iklan permohonan maaf. ‘’Gugatan tersebut sehubungan dengan perbuatan para tergugat yang telah menyebarluaskan melalui media cetak, elektronik dan selebaran (undangan terbuka) bahwa penggugat (Chairuddin P Lubis) telah melakukan korupsi keuangan USU.

Antara lain dana pembangunan Rumah Sakit USU, danaYayasan USU dan Penerimaan Negara Bukan Pajak (PNBP) dan lainnya. Sedangkan terkait itu tidak ada putusan pengadilan, dan para tergugat telah menyampaikan pengaduannya ke Kejatisu, sehingga Kejatisu yang memiliki legalitas untuk menginformasikan itu kepada publik,’’ujar Matondang. Atas putusan Pengadilan Negeri Medan tersebut, pihak penggugat telah Aanmaning (teguran supaya melaksanakan sendiri putusan pengadilan agar terhindar dari eksekusi) dan eksekusi. Sedangkan tanggapan Matondang selaku kuasa hukum penggugat atas putusan MA dan putusan PN Medan tersebut, putusan itu sangat fundamental karena mengandung esensi yang kalau orang tidak boleh menyebarluaskan pemberitaan yang mendiskreditkan orang lain, dan hak itu sudah dilaporkan kepada pihak berwenang (penegak hukum). (m34)

Rahmat Shah Siap ...

hukum Rahmat memaparkan kronologis bukti keabsahan kepemilikan tanah sesuai hukum dan undang-undang yang berlaku. Di antaranya DPRD Kota Medan No 593/215 tertanggal 11 Mei menyatakan setelah mendapat penjelasan dari berbagai pihak terkait penelitian yang komprehensif dengan data-data yang ada, diharapkan BPN Medan segera memproses permohonan penerbitan sertifikat kepada Rahmat Shah. Selain itu, ganti rugi dari Pemko Medan yang pada saat itu dilakukan kepada Rahmat Shah oleh tim lengkap terpadu dan pihak BPN. “Waktu lahan

itu dibebaskan untuk proyek normalisasi Sei Badera dibayar kepada Rahmat. Jadi, kalau itu bukan miliknya, kenapa pembayaran pembebasan lahan itu kepada beliau (Rahmatred),” ujarnya. Ditambahkan, 27 Juli 2009, Pemprovsu mengirim surat ke KPK, isinya pihak Pemprovsu belum ada menempuh jalur hukum atas tanah tersebut, namun telah mengajukan permohonan ke BPN Kota Medan untuk menerbitkan surat sertifikat atas nama Pemprovsu, tetapi sampai saat ini BPN Medan tidak menerbitkan sertifikat tersebut. (h10/m34)

kah sehari-hari, ludes. “Tak ada yang tersisa, semua habis terbakar,” ujarnya kepada Waspada dengan suara parau. Tak dipersoalkan Sementara itu,Walikota Medan Rahudman Harahap mencoba menghibur pedagang dengan mengatakan, tidak usah terlalu mempersoalkan tiga pasar tradisional yang terbakar dalam tahun ini, termasuk Pasar Sore. Yang penting, katanya, bagaimana antisipasi agar peristiwa serupa tidak berulang dengan membangun sistem pencegahan dini. Saat itu Rahudman datang didampingi Direktur Utama PD Pasar Mustafa Sutan Nasution. Walikota menuturkan akan melakukan pengecekan kondisi lantai bangunan yang terbakar, apakah masih layak mengingat lantai beton pasar

hanya di atas permukaan tanah sehingga perlu dikaji kembali kekuatannya untuk menahan beban bangunan kios yang akan dibangun. Menyangkut permintaan pedagang soal posisi kios bangunan baru yang akan dibangun, Walikota menganjurkan pedagang segera membentuk kelompok dalam satu wadah resmi dan merumuskan kesepakatan sesama pedagang untuk diusulkan ke Pemko melalui Dirut PD Pasar. Wakil Ketua Umum Persatuan Pedagang Pasar Tradisional Medan (P3TM) H Harmon Habib didampingi Ketua II Tomi Japutra mempertanyakan sistem pengelolaan pasar tradisional yang dijalankan PD Pasar, baik dari sisi membangun usaha pedagang dan sistem pengamanan pasar. * Sahrizal

dan tidak kasasi ke Mahkamah Agung. “Saya kecewa dengan ucapan Gubsu yang ingin melakukan gugatan tersebut. Padahal tanah itu sudah jelas milik saya, dan sejak 1996 sampai saat ini setiap tahun membayar PBB Rp50 juta,” ujarnya,. “Gubsu telah melakukan pembohongan publik yang mengatakan tidak pernah kalah di pengadilan terkait masalah tersebut. Padahal sudah jelas pada putusan Pengadilan Negeri Medan Nomor 438/Pdt.G/2005/ PN/Mdn,” ucapnya. Rahmat. Pada kesempatan itu, kuasa

Walikota Hibur ... Para pedagang kecil dari penjual sayur, kain, pecah belah dan pedagang sarapan harus memulai usaha dari awal lagi dengan modal yang masih dicari. Adalah Heriandi Surbakti, 27, warga Gang Napindo salah satu korban. Ia tersentak bangun dari tidur karena teriakan ibunya seusai melihat api berkobar di sebelah rumahnya. Dengan langkah tergopohgopoh, ia keluar rumah sebab jarak api tak jauh dengan tempat tinggalnya. Penjual hiasan imitasi itu mengaku tak sempat menyelamatkan barang-barang dagangannya kecuali menyelamatkan diri bersama kakak dan kedua orang tuanya. Rumah dan kios sebagai tempat tinggal dan mencari naf-

Menurut Nadia, pihak penyelenggara perjalanan haji itu berjanji memberangkatkan mereka, kemarin (10/11) dengan membayar Rp3 juta. “Setelah kami tunggu-tunggu perwakilan mereka tak juga datang ke hotel ini untuk merealisasikan janji tersebut. Pagi ini, masuk SMS dari Direktur Azizi, Naslah Lubis yang minta kami membayar Rp10 juta lagi agar visa kami keluar dan bisa berangkat Jumat (12/11),” ujar Nadia yang keberangkatannya menunaikan beribadah haji ditemani suami. Permintaan uang tersebut disampaikan Nasla kepada karyawannya untuk diteruskan kepada jemaah haji via SMS. Dalam SMS tersebut, pihak Azizi berjanji menemui jamaah yang terlantar tersebut usai shalat dzuhur. Tapi sampai ashar, perwakilan Azizi tak kunjung datang. Pantauan Waspada, kondisi jamaah haji yang saat ini menginap di Hotel Sri Deli memprihatinkan. Usia mereka sudah tua, bahkan ada satu calon jemaah yang harus menggunakan kursi roda ke mana-mana. Fatimah, 68, asal Belawan mengaku sudah menyetor dana sebesar Rp66 juta kepada pihak Azizi. Karena kegagalan ini dia mengaku sangat kecewa. “Lantaran sudah tua, kami minta disediakan kursi roda dan perlengkapan lainnya. Kami pun menambah biaya Rp 14 juta lagi. Jadi, total biaya haji plus nenek Rp 80 juta,” kata Agus cucu nenek Fatimah. Calhaj asal Takengon, Aceh Tengah, bernama Azizah, 65, mengaku tergiur ikut berangkat dengan biro perjalanan haji ini karena tahun lalu tetangganya sukses berangkat. Mengaku usianya tidak muda lagi, perempuan yang berangkat dengan empat saudaranya ini memenuhi semua persyaratan yang diberikan pihak Azizi selaku penyelenggara ibadah haji dan umroh. “Usia saya sudah tua, kalau mendaftar sesuai quota haji bersama pemerintah, saya bisa berangkat tahun 2017,” kata Azizah yang mengaku sudah

WASPADA Jumat 12 November 2010 menjual ladangnya untuk mendapatkan uang lebih dari 66 juta dan sudah 12 hari berada di Hotel Sri Deli yang seyogianya akan berangkat 12 November ini. Sementara pihak Azizi melalui Konsultan, Dedi, mengaku kondisi ini di luar dugaan mereka sebab hingga hari ini visa para calhaj tidak bisa dikeluarkan oleh KedutaanArabSaudidenganjumlah jamaah 119 orang. Hingga pukul17.55,pimpinanAziziNazla Lubis dikabarkan masih berada di Jakarta dan akan kembali ke Medan jika ada pesawat. Sedangkan para calhaj hingga sore kemarin masih terlihat panik di Restoran Hotel Sri Deli sambil berharap kepastian dari pihak Azizi. Umumnya para jamaah ingin uang mereka dikembalikan, karena mereka yakin untuk berangkat tidak mungkin lagi, sebab data yang ada dari Arab Saudi pada 15 November ini telah dilaksanakan wukuf di Arafah. Bisa mengadu Di tempat terpisah, Kepala Kementerian Agama Sumatera Utara, Syariful Mahya Bandar mengatakan, pihaknya sangat menyesalkan kejadian ini.Tetapi, tetap saja tidak mempunyai kewenangan. Sebab biro perjalanan haji dan umroh itu urusannya langsung ke pusat. “Hanya saja, jika jamaah merasa keberatan dengan keadaan yang mereka terima saat ini, dan pihak biro perjalanan tidak bisa memberikan solusi apapun, mereka bisa mengadu ke Kemenagsu. Pihak Kemenagsu akan menjadi mediator antara jamaah dengan pihak Azizi untuk mengetengahkan pokok permasalahanyangmerekaalami.Tidak menutup kemungkinan Kemenangsu akan menyampaikan masalah ini ke pusat,” katanya. 15 Calhaj masih terlantar Di tempat terpisah, 15 calhaj plus asal Bagan Batu juga mengalami nasib yang sama. Hingga Kamis (11/11), mereka masih terlantar di sebuah rumah di Jalan Karya Dharma Gg. Karya Selamat No.17 Medan Johor. Pantauan Waspada, kemarin, calhaj yang mayoritas kaum ibu mulai tampak stres karena mereka batal berangkat ke Ta-

nah Suci yang dijanjikan berangkat sebelumnya oleh KBIH Humairah pada 3 November. Nenek Jaliah didampingi temannya Komariah, Sugimah, Sarah, Syahlawati, Butet, Sumarni, Sofiah menyatakan mulai jenuh sebelas hari tinggal di rumah tersebut. “Kami khususnya calhaj wanita dipastikan batal berangkat ke Tanah Suci tahun 2010 ini,” katanya sembari menyebutkan empat calhaj pria sudah diberangkatkan pada Rabu (10/11) malam melalui Jakarta. “Kami minta kebijaksanaan Agoesly, pimpinan KBIH Humairah untuk segera mengembalikan uang secara penuh, agar kami dapat kembali ke kampung halaman di Rokan Hilir, Bagan Batu, Riau. Kami sudah sangat rindu terhadap keluarga, anak, cucu, menantu. Kami ingin pulang secara bersama-sama agar masyarakat Bagan Batu mengetahui bagaimana kronologis sehingga gagal berangkat,” ujar mereka menambahkan buat apa lama-lama di sini karena sudah jelas tidak berangkat. Secara terpisah pengurus KBIH Humairah Hj. Asmiwati, mengatakan pihaknya sebagai pembimbing jamaah sama sekali tidak ada niat untuk mengecewakan, apalagi sampai menyengsarakan calhaj. “Bertahun-tahun KBIH Humairah memiliki cukup banyak jamaah di Kota Medan, dalam pelayanan memberangkatkan jamaah tidak ada kendali apapun semua berjalan lancar, aman,” ujarnya yang menyebutkan segala sesuatu sudah dipersiapkan termasuk pengurusan visa dengan dilengkapi syaratsyarat di Kedutaan Arab Saudi. “Pasalnya, visa sudah dibayar, namun tidak keluar juga hingga hari H-nya membuat kami bingung,” ujarnya. Dia menambahkan di kedutaan Arab Saudi mereka sudah melengkapi tanda pelunasan hotel, pembayaran tiket, barkode dan Injas. Namun dari 125 jamah yang tergabung pada kita yang keluar hanya 18 orang,” katanya sembari berjanji uang jamaah akan dikembalikan, tetapi menunggu pimpinan KBIH Agoesly. (m36/m25)

Berita Utama

A2 Ratusan Calhaj ....

Ashar perwakilan Azizi tak kunjung datang.Kondisi jamaah haji yang saat ini menginap di Sri Deli benar-benar memprihatinkan. Ditambah usia mereka yang rata-rata sudah tua. Bahkan ada satu calon jemaah haji yang harus menggunakan kursi roda kemana-mana. Fatimah,68 berasal dari Belawan mengaku sudah menyetor dana sebesar Rp 66 juta kepada pihak Azizi.Karena kegagalan ini dia mengaku sangat kecewa. “Lantara sudah tua, kami minta disediakan kursi roda dan perlengkapan lainnya. Kami pun menambah biaya Rp 14 juta lagi. Jadi total biaya haji plus nenek Rp 80 juta,” kata Agus cucu nenek Fatimah. Calhaj asal Takengon Aceh bernama Azizah,65 mengaku tergiur ikut berangkat dengan biro perjalanan haji ini karena tahun lalu tetangganya sukses berangkat. Mengaku usianya tidak muda lagi, maka perem-

Pengedar Ganja ....

Maga Lombang, Kec. Lembah Sorik Marapi, tersangka tertangkap tangan memiliki dan menguasai narkotika golongan I ( daun ganja kering) 12 ball yang dibungkus dengan plastik warna hitam dalam kantongan tas warna hitam. Tersangka SN akan menjual daun ganja kering itu kepada S yang beralamat di Ujung Gading Kab. Pasaman Sumbar dengan harga Rp 500 ribu per bal dan dia sudah menjual ganja kepada S dua kali. Pertama, 8 bal yang sudah dipress seharga Rp 500 ribu. Tersangka juga menerangkan ganja didapatkan dari hasil tanamannya di kebun daerah Dolok Torsihite Kec. Panyabungan Timur. ”Tersangka menanam 10 ribu batang di lahan seluas 50 x 50 meter dan setelah tujuh bulan dipanen,” ungkap Hirbak Wahyu Setiawan. Sementara, tersangka kedua dan ketiga merupakan pengedar antar provinsi yakni ES, 31, penduduk Jalan Olo Ladang Padang, Sumbar dan KR, 23, penduduk Jalan Pinang Sori Air Tawar Barat, Kodya Padang. Senin ( 8/11) tersangka tertangkap tangan memiliki dan menguasai ganja 5 bal dari

Isu Culik ....

Dengan isu tersebut, lanjutnya, warga resah dan khawatir takut peristiwa tersebut benar-benar terjadi di desanya. “Setelah menerima SMS itu, saya langsung telefon teman dan meminta untuk tidak menyebarkannya lagi, karena khawatir warga lain resah. Soalnya, di desanya itu umumnya para orang tua berada di

Istri Gayus Dapat ....

Kamis (11/11) mengatakan, dirinya sebagai atasan Milana telah mengirimkan surat teguran tertulis tersebut. “Selama dua bulan terakhir, yaitu bulan September, Oktober dan sampai 9 November dia tidak melaksanakan tugas dengan baik dan tidak selalu ada di tempat. Untuk itu saudari dikenakan sanksi teguran tertulis,” kata Sofyan membacakan surat teguran tertulis tersebut. Surat teguran bertanggal 10 November 2010 itu ditandatangani Sofyan dan diketahui Kepala Bagian Persi-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Ge7+, Rf7. 2. Mg7+, Re8. 3. MxB+mat.

Jawaban TTS: TTS Topik







Jawaban Sudoku: 4 3 7 6 1 8 2 5 9

9 8 5 2 3 4 1 7 6

6 2 1 7 5 9 4 3 8

8 1 9 3 7 6 5 4 2

3 5 4 8 9 2 6 1 7

2 7 6 1 4 5 8 9 3

7 9 8 5 2 1 3 6 4

1 4 2 9 6 3 7 8 5

5 6 3 4 8 7 9 2 1

puan yang beragkat dengan empat saudaranya ini memenuhi semua persayaratan yang diberikan pihak Azizi selaku penyelenggara ibadah haji dan umroh. “Usia saya sudah tua, kalau mendaftar sesuai quota haji bersama pemerintah, saya bisa berangkat tahun 2017 mendatang. Waktu yang cukup lama bagi orang yang kurang sehat seperti saya,”kata Azizah yang mengaku sudah menjual ladanganya untuk mendapatkan uang lebih dari 66 juta dan sudah 12 hari berada di Hotel Sri Deli yang seyogyanya akan berangkat tanggal 12 November ini. Sementara pihak Azizi melalui Konsultan bernama Dedi mengaku kondisi ini diluar dugaan mereka sebab hingga hari ini visa para calhaj tidak bisa dikeluarkan oleh Kedutaan Arab Saudi. Hingga pukul 17.55 WIB, pimpinan Azizi Nazla Lubis dikabarkan masih berada di Jakarta dan akan kembali ke Medan jika seseorang yang tidak dikenal untuk dibawa dan diserahkan kepada D di Padang dengan upah masing-masing Rp 1 juta apabila daun ganja tersebut sampai ke Padang. Kedua tersangka berangkat dari Padang menuju Laru Lombang dengan menggunakan mobil Xenia BA 1142 BN warna silver setelah diberikan oleh D uang perjalanan Rp 500 ribu dan kedua tersangka baru pertama kali menjemput daun ganja. Sementara, tersangka DP, 27, penduduk Jalan Koto Kaciak, Kec. Padang Selatan, Sumbar. Tersangka ditangkap, Senin ( 8/11) di Jalan Umum Desa Laru, Tambangan. Barang haram tersebut dibeli tersangka dari B penduduk Desa Hutatua, Panyabungan Timur untuk dijual maupun diedarkan kepada orang lain di wilayah Kodya Padang dengan harga Rp 1,5 juta per bal/per kg. Tersangka DP sudah empat kali membeli ganja dari B dipesan melalui handphone masing-masing 10 bal/per kg dengan harga Rp 400 ribu per ball/kilogram. Ke empat tersangka dijerat Pasal 111 Ayat ( 2) Subs Pasal 114 Ayat ( 2 ) subs Pasal 115 Ayat ( 2) UU Nomor 33 tahun 2009 tentang narkotika, ucapnya. (a24) kebun sementara anak-anak di desa,” katanya. Kapolsek Barumun AKP H Herwansyah Putra di Sibuhuan mengatakan, hingga saat ini di wilayah hukum Polsek belum ada kasus penculikan baik anak maupun orangtua. Sementara mengenai kabar penculikan yang beredar tersebut, dia mengatakan hal itu hanya isu yang kebenarannya diragukan. (crif) dangan Sekretariat DPRD DKI Heru Wiyanto. Dalam surat itu disebutkan teguran dilakukan berdasarkan Peraturan Pemerintah No.53/2010 tentang Disiplin PNS pasal 7 ayat (2). Sofyan mengatakan, Rani seringkali hanya absen ke kantor dan kemudian pergi dari ruangannya. “Saya sudah tegur (lisan) berkali kali,” katanya. Foke: Bisa Diberhentikan Sementara Gubernur DKI Jakarta Fauzi Bowo mengaku belum menerima laporan apapun dari pihak inspektorat DKI maupun Badan Kepegawaian Daerah (BKD) terkait masalah Milana Anggraeni, istri terdakwa kasus dugaan mafia pajak, Gayus Tambunan. Namun, Fauzi mengatakan, Rani yang merupakan Pegawai Negeri Sipil (PNS) ini bisa diberhentikan tidak hormat apabila terbukti membolos dalam jangka waktu lama. “Saya tidak mau berandaiandai. Yang jelas kalau memang kasusnya melampaui batas tertentu, bisa saja diberhentikan dengan tidak terhor mat,” ujar Fauzi saat ditemui di Balaikota, Jakarta, Kamis (11/11).. Foke, begitu biasa dia disapa, mengatakan masalah ini adalah kewajiban dari pimpinan unit tempat Rani bekerja, Sub Bagian Persidangan Pimpinan dan Panitia Sekretariat DPRD DKI Jakarta untuk melaporkannya ke Sekda.”Kemudian Sekda akan mengusulkan hukuman apa yang paling tepat,” tegasnya. (Ant/vivanews)

Status Gayus ....

diduga menerima suap, Gayus beberapa kali keluar tahanan sejak Juli 2010 yang lalu. Bahkan, foto mirip Gayus dan istrinya beredar tengah melihat pertandingan tenis di Bali. Terkait foto ini, lagi-lagi Mabes Polri mengaku belum bisa memastikan apakah benar-benar foto Gayus dan istrinya. “Kita belum sampai ke foto, kita masih terkait sembilan polisi yang terlibat,” kata dia. (VIVAnews)

ada pesawat. Sedangkan para calhaj hingga sore kemarin masih terlihat panik di Restoran Hotel Sri Deli sambil berharap kepastian dari pihak Azizi. Umumnya para jamaah ingin uang mereka dikembalikan, karena mereka yakin untuk berangkat tidak mungkin lagi, sebab data yang ada dari Arab Saudi tanggal 15 November ini telah dilaksanakan wukuf di Arafah. Bisa Mengadu Di tempat terpisah Kepala

Kementrian Agama Sumatera Utara, Drs H Syariful Mahya Bandar MAP mengatakan, pihaknya sangat menyesalkan kejadian ini. Tetapi, tetap saja pihaknya tidak mempunyai kewenangan. Sebab biro perjalanan haji dan umroh itu urusannya langsung ke pusat. “Benar, Kemenagsu tidak punya kewenangan. Hanya saja, jika jamaah yang merasa keberatan dengan keadaan yang mereka terima saat ini, dan pihak biro perjalanan tidak bisa memberikan solusi

apapun, mereka bisa mengadu ke Kemenagsu. Pihak Kemenagsu akan menjadi mediator antara jamaah dengan pihak Azizi untuk mengetengahkan pokok permasalahan yang mereka alami. Tidak menutup kemungkinan bahwa Kemenangsu akan menyampaikan masalah ini ke pusat, sekaligus memastikan bagaimana sebenarnya izin dari biro perjalanan itu, karena dalam pengurusan izinnya langsung ke pusat,” kata Mahya Bandar kemarin. (m36)

Kasus Gayus ....

sekali,” kata dia. Untuk memuluskan ulahnya, Gayus memberikan uang suap kepada Kepala Rutan Mako Brimob, Kelapa Dua, Depok. “Berdasarkan hasil pemeriksaan sementara, berapa yang diterima itu belum konkret, tapi paling tidak antara Rp50 sampai Rp60 juta untuk si Kompol (Kompol Iwan Siswanto), tapi akan dikroscek,” kata dia. Tak hanya si kepala rutan, Gayus juga diduga memberikan suap kepada penjaga rutan di bawah Iwan Siswanto. “Untuk anggota lain bervariasi ada yang Rp5 juta dan Rp6 juta,” kata dia. Berdasarkan penyelidikan Bareskrim, kata Iskandar, Kompol Iwan lah yang memiliki inisiatif yang menyebabkan bisa lolosnya Gayus keluar tahanan. “Sehingga tidak ada

kaitannya dengan orangorang di luar ini, tidak ada perintah dari orang alain,” kata dia. Kesembilan orang anggota yang terperiksa secara struktur berada di bawah Satuan Pengamanan Protokol (Satpamkol) Satuan Pelayanan Markas (Satyanma) Mabes Polri. Gayus yang keluar Rutan Brimob pada Jumat pagi (5/ 11), seharusnya balik kembali pada sore harinya, tapi sampai malam belum kembali. Menurut dua anggota polisi yang mengawal, Gayus sempat pulang ke rumahnya di Kelapa Gading. Mengenai adanya foto Gayus yang beredar sedang menonton turnamen tenis di Bali, Iskandar mengatakan akan melakukan investigasi terkait hal tersebut. (j02/ant/vivnews)

Lima Tersangka ....

dua blok kupon KIM. Sementara, dari SD alias S disita barang bukti uang Rp10 ribu, selembar kupon bertuliskan cobra yang telah ditulis angka-angka dan satu lembar kertas kecil yang bertuliskan angka-angka. Dari tersangka AS alias U disita barang bukti uang Rp125 ribu dan tiga lembar kertas rokok tempat penulisan rekapan nomornomor togel ,” ungkapnya.

Menurutnya, terhadap tersangka HM dan AS alias U dipersangkakan melanggar Pasal 303 KUH Pidana dengan ancaman hukuman paling lama 10 tahun penjara atau pidana denda Rp 25 juta. Kemudian TB, RN dan SD alias S dipersangkakan melanggar Pasal 303 Bis dengan ancaman hukuman paling lama 4 tahun atau pidana denda paling banyak Rp 10 juta. (a24)

Pemerintah Aceh ....

lisasi belanja meningkat senilai Rp1.927 triliun atau 33,72% dari realisasi belanja tahun 2008 senilai Rp5.715. triliun. Berdasarkan realisasi itu dewan menilai kinerja Pemerintah Aceh mempunyai kemampuan menaikkan belanja dan menurunkan pendapatan. Untuk itu ke depan, Juru bicara Banggar Dalimi mengingatkan eksekutif untuk meninggalkan kemalasan dan meningkatkan pendapatan di berbagai sektor.

Begitupun bila dirinci lebih lanjut, sumber Pendapatan Asli Aceh yang mengalami peningkatan yang sangat tinggi berasal dari zakat mencapai 754,98% dibanding dengan pendapatan tahun 2008. Sementara untuk sumber Pendapatan Asli Aceh yang bersumber dari pajak Aceh terealisasi sebesar 96,89%, dibanding Pendapatan Pajak Aceh tahun 2008 mengalami penurunan sebesar 0,47%. (gto)

Pria Bersenpi ....

Kemudian aksi kejar-kejaran pun masih berlangsung di kawasan Kecamatan Nisam antara polisi dengan kelompok bersenjata api tersebut. Kalapas Lhokseumawe Eddi Teguh Widodo mengatakan kejadian itu terjadi dengan spontanitas tanpa diduga sama sekali oleh petugas yang piket. Kronologis kejadian, sambut Eddi, sekira pukul 13:45 yakni di penghujung waktu akhir bertemu tanpa ada firasat atau tanda-tanda aneh. Eddi mengatakan, pada saat itu secara tiba-tiba seorang pria kurus berjaket warga krem mendobrak pintu masuk LP seraya menodongkan senjata ke arah petugas. “Petugas tidak berkutik ketika pelaku berteriak jangan bergerak sambil mengokang senjata apinya,” katanya. Dalam peristiwa itu, selain seorang pria bersenjata api yang nekat menerobos ke dalam LP, seorang lainnya menunggu di pagar halaman dengan dan mobil yang sudah

standby tidak dapat diperkirakan jumlah orang yang ada di dalamnya. Lalu, ungkap Eddi, setelah berhasil membuat petugas ketakutan, pria bersenjata api itu pun memaksa agar pintu tengah LP agar segera dibuka untuk membebaskan empat napi. Begitu pintu terbuka, empat napi yang dimaksud ternyata sudah dalam keadaan siap menunggu dan tanpa diminta langsung melesat keluar bersama pria bersenjata dengan langkah mundur. Drama pembebasan napi oleh kelompok bersenjata api ini hanya berlangsung singkat tidak lebih dari lima menit. “Semuanya melihat kejadian ini, saya juga melihat dari dalam, tapi tidak bisa berbuat apa-apa kecuali hanya melihat drama pembebasan tersebut. Kasus ini sudah saya laporkan ke Polres Lhokseumawe dan kini masih terus dilakukan pengejaran oleh polisi,” tandas Eddy. (b15)

Tahun 1999 Tentang Pemberantasan Tindak Pidana Korupsi junto pasal 55 Kitab Undang-Undang Hukum Pidana (KUHP) Tentang Turut Serta Melakukan Perbuatan Pidana. Keluar-Masuk Tahanan Sejak Juli Keluarnya Gayus dari Rutan markas Komando Brimob Kelapa Dua diduga tak hanya terjadi sekali saja. Berdasarkan keterangan yang diperoleh dari para penjaga rutan, keluarnya Gayus telah terjadi sejak beberapa bulan yang lalu. “Yang terungkap sekarang semenjak bulan Juli. Ini pengakuan dari kesembilan orang ini,” kata Iskandar Hasan. Sejak bulan itu, Gayus diduga berulangkali keluar tahanan. “Hampir tiap minggu dia bisa keluar dengan mempengaruhi penjaga, seminggu SD alias S, 26, warga Desa Sihepeng. Hirbak Wahyu menjelaskan,penangkapan di tiga tempat terpisah. Di Lorong IX Simaninggir Desa Sihepeng, Lorong IV Desa Sihepeng dan Lorong IX Kel. Simangambat. Dari tersangka disita barang bukti uang Rp63 ribu, selembar kertas kupon warna putih yang telah ditulis angka-angka serta

disebutkan senilai Rp9.791 tr iliun digunakan untuk anggaran belanja, sedangkan untuk anggaran pendapatan senilai Rp6.732 triliun. Dari total anggaran pendapatan itu yang mampu direalisasikan Rp6.042 triliun atau 89,75%. Dibanding realisasi pendapatan tahun 2008 terlihat menurun sebesar 12,58% dari realisasi pendapatan tahun 2008 Rp.6.911 triliun. Namun sebaliknya, reagerak pelarian para pelaku. Kapolres Lhokseumawe AKBP Kukuh Santoso via telefon seluler kepada Waspada kemarin membenarkan kejadian kelompok bersenjata api telah membawa kabur empat napi. Kapolres mengaku saat itu dirinya bersama anggota langsung terjun ke lapangan mengejar para pelaku yang sudah terdeteksi keberadaannya. “Sekarang kami masih melakukan pengejaran terhadap mereka. Ini saya di lapangan soal perkembangan nanti saja karena kami sedang mengejar mereka,” tegas Kapolres seraya menutup telefon. Informasi lain diterima Waspada dari anggota Polsek menyebutkan, polisi berhasil mendeteksi keberadaan pelaku dan mendesaknya hingga terpaksa meninggalkan kendaraan di kawasan Simpang KAA Krueng Geukuh Kecamatan Dewantara Kabupaten Aceh Utara.

WASPADA Jumat 12 November 2010

Soeharto, Gus Dur ....

timbangkan masukan publik dan juga aspek sosiologis dalam menentukan gelar pahlawan nasional bagi dua tokoh, yaitu Dr Johannes Leimena dan Johannes Abraham Dimara. Meski demikian, Ketua Dewan Gelar, Tanda Jasa dan Tanda Kehormatan yang juga Menko Polhukam Djoko Suyanto dalam konferensi pers di Ruang VIP Bandara Internasional Halim Perdanakusuma, Jakarta, Kamis, mengatakan bukan berarti tokoh lain yang telah diteliti oleh Kementerian Sosial namun tidak mendapatkan gelar Pahlawan Nasional dianggap tidak layak. “Bukan berarti tidak layak. Tapi pertimbangan publik, sosiologis,-masukan yang disampaikan masyarakat kepada anggota dewan menjadi pertimbangan dalam menentukan apakah seseorang mendapatkan gelar Pahlawan Nasional,” jelasnya. Sebelumnya, Kementerian Sosial mengajukan 10 nama tokoh yang telah diseleksi untuk memperoleh gelar pahlawan nasional yang diajukan

kepada Dewan Gelar Tanda Jasa dan Tanda Kehormatan. Djoko menjelaskan 10 tokoh tersebut sebenarnya telah menjalani penelitian di Kementerian Sosial yang berarti telah memenuhi syarat secara teknis dan juga administrasi khusus dan umum. Namun, lanjut dia, Dewan Gelar Tanda Jasa dan Tanda Kehormatan yang beranggotakan tujuh orang mempertajam dan memperdalam lagi usulan Kementerian Sosial itu dan akhirnya hanya mengajukan dua tokoh yang disetujui oleh Presiden Susilo Bambang Yudhoyono. Seluruh anggota Dewan Gelar Tanda Jasa dan Tanda Kehormatan, menurut dia, sepakat bahwa delapan tokoh lain yang diajukan oleh Kementerian Sosial tetap memiliki jasa besar kepada bangsa dan negara. Namun, kata Djoko, pertimbangan mendalam dari berbagai aspek termasuk masukan publik itulah yang akhirnya menentukan pemberian gelar pahlawan kepada Leimena dan Abraham Dimara yang akhirnya disetujui oleh Presiden.

Polres Madina ....

Dikatakan, GH memperoleh lahan 1997 melalui surat penyerahan dari masyarakat Desa Batu Mundom seluas 300 hektar, kemudian surat atas hak atas tanah seluas 130 hektar berupa surat segel. “Sementara sisanya berupa akte jual beli yang dikeluarkan Camat Muara Batang gadis atas nama Zulkifli Nasution dan surat di atas segel juga ditandatangani Camat Muara Batanggadis,” ungkap Kapolres. Sementara, Kasat Reskrim AKP Sarluman Siregar menjelaskan, bekas perambahan hutan tersebut juga dibakar untuk dijadikan areal perkebunan. Me n u r u t n y a , s e t e l a h diperiksa, ternyata keempat pelaku adalah orang suruhan OR, warga Tapanuli Selatan. Sedangkan lahan 130 hektare adalah milik Guntur Harahap,

warga Tapanuli Selatan. ”Rencananya kawasan hutan produksi terbatas akan dibabat habis dan dijadikan perkebunan karet. Saat polisi turun ke lokasi, sekitar 30 hektare kawasan hutan itu sudah gundul dan sebagian lagi sudah hangus terbakar,” terangnya. “Saat ini kita sedang meningkatkan operasi penyakit masyarakat di wilayah Polres Mandailing Natal sesuai perintah Kapolri dalam program 100 hari kerjanya,” terangnya. Kasat juga meneranngkan kelima tersangka dijerat Pasal 78 Ayat (2), Ayat (3) dan Ayat (5) juncto Pasal 50 Ayat ( 3) huruf a,b,c,d,e,f dan h UU RI No. 41/1999 tentang kehutanan juncto Pasal 55 Ayat (1) ke l-e KUH Pidana dengan ancaman hukuman 10 tahun penjara dan denda Rp5 miliar.(a24)

Pemerintah melalui Keputusan Presiden No 52 TK/ 2010 akhirnya memberikan gelar Pahlawan Nasional hanya kepada dua tokoh, yaitu Dr Johannes Leimena dan Johannes Abraham Dimara. Sebelumnya, Kementerian Sosial mengajukan 10 nama tokoh yang telah diseleksi untuk memperoleh gelar Pahlawan Nasional kepada Dewan Gelar, Tanda Kehormatan, dan Tanda Jasa. Sepuluh tokoh itu adalah mantan Gubernur DKI Ali Sadikin dari Jawa Barat, Habib Sayid Al Jufrie dari Sulawesi Tengah, mantan Presiden HM Soeharto dari Jawa Tengah, mantan Presiden KH Abdurrahman Wahid (Gus Dur) dari Jawa Timur. Kemudian Andi Depu dari Sulawesi Barat, Johanes Leimena dari Maluku, Abraham Dimara dari Papua, Andi Makkasau dari Sulawesi Selatan, Pakubuwono X dari Jawa Tengah, dan Sanusi dari Jawa Barat. Pertimbangkan Masukan Publik Pemer intah memper-

Suka Ramain, Kec. Angkola Selatan. Kemudian, GH, 54, warga Kel. Pasar Panggautan, Kec. Angkola Timur, GS, 22, warga Desa Pondok Rambe. Sementara yang DPO berinisial OR, 48, warga Pasar Lama Singalangan, Batang Angkola. Menurut Kapolres Madina AKBP Hirbak Wahyu Setiawan, SIk didampingi Wakapolres Komisaris Polisi Hariyatmoko, SIk, Kasat Reskrim AKP SM Siregar SH, Kasat Narkoba AKP Hendra, Rabu (10/11) menjelaskan, yang memerintahkan perambahan hutan adalah OR dan diketahui, yang memiliki lahan adalah GH. “GH dalam pemeriksaan dia mengaku memborongkan kepada OR untuk imas tumbang lahan 20 hektar dari 130 hektar di kawasan Laba Honas,” ujarnya.

Medan Metropolitan

WASPADA Jumat 12 November 2010


Mahasiswa IAIN Bentrok KeributanTerjadi Saat Pengukuhan 5 Guru Besar MEDAN (Waspada): Dua kelompok mahasiswa Institut Agama Islam Negeri (IAIN) Sumatera Utara terlibat bentrok pada saat berlangsungnya pengukuhan guru besar perguruan tinggi negeri tersebut, Kamis (11/11).


Dua kelompok mahasiswa terlibat bentrok, saling tarik dan dorong pada saat melakukan aksi unjuk rasa di depan gedung aula IAIN-SU, Jalan Willem Iskandar Medan Estate, Kamis (11/11).

Tingkatkan Kepedulian Pada Momen Hari Pahlawan MEDAN ( Waspada): Peringatan Hari Pahlawan 10 November pada hakikatnya merupakan ungkapan rasa syukur, wujud penghormatan kepada para pahlawan, karena para pahlawan telah menorehkan contoh dan teladan. Selain itu memberikan pengorbanan yang luar biasa. “Bagi TNI setiap peringatan 10 November senantiasa dijadikan sebagai momentum untuk melakukan instrospeksi apakah perjuangan bangsa ini masih segaris dengan perjuangan para pahlawannya, juga harus kita maknai sebagai momentum untuk melakukan refleksi historis dalam rangka memetik hikmah dan pelajaran,” kata Pangdam I/BB Mayjen TNI Leo Siegers dalam amanatnya yang dibacakan Kasdam I/BB Brigjen TNI Murdjito pada upacara Hari Pahlawan di Lapangan Makodam I/BB, Rabu (10/11). Pangdam juga menyampaikan tema peringatan Hari Pahlawan tahun 2010, yaitu “Dengan semangat nilai kepahlawanan kita tingkatkan kesetiakawanan sosial nasional” ini merupakan momentum untuk meningkatkan kepedulian dan kebersamaan untuk mengatasi berbagai masalah yang melanda bangsa indonesia. Hadir Irdam I/BB Kolonel Inf M Syahril Arsyad, para Asisten Kasdam I/BB, para Kabalakdam I/BB serta tamu undangan lainnya. (rel/cmai)

GMPI Gelar Seminarkan Bahaya Narkoba MEDAN (Waspada): Pimpinan Cabang Generasi Muda Pembangunan Indonesia (PC GMPI) Kota Medan akan melaksanakan seminar anti narkoba bertema: “Generasi Muda Tanpa Narkoba” yang akan dilaksanakan di Wisma PHI Jalan Gatot Subroto, Medan, Sabtu (13/11). “Seminar akan diikuti sekitar 100 orang peserta terdiri pelajar, mahasiswa dan pemuda.Sedangkan nara sumbernya Direktur Narkoba Poldasu Kombes Pol Jhon Turman Panjaitan dan Ketua DPD KNPI Kota Medan Zulham Effendi Siregar,” kata Ketua PC GMPI Kota Medan Muhammad Setia Budi Pandia di Medan, Selasa (9/11). Budi yang ketika itu didampingi Sekretaris Munawar Halil menegaskan, seminar dibuka Ketua PW GMPI Sumut yang juga Ketua DPW PPP Sumut H Fadly Nurzal. Wakil Sekretaris DPC PPP Kota Medan ini juga mengungkapkan mayoritas narapidana di Lembaga Pemasyarakatan (LP) merupakan generasi muda yang merupakan pemakai narkoba. Hal senada juga disampaikan Sekretaris GMPI Kota Medan Munawar Halil Siregar. Dia menegaskan, GMPI sebagai sayap PPP bertanggungjawab atas generasi muda agar terhindar dari narkoba, sebab jika generasi muda sudah terjebak dalam narkoba akan sulit untuk menggapai cita-cita yang sudah diidamkan. (m39)


SANTUNAN: Dirut Bank Sumut Gus Irawan Pasaribu berfoto bersama anak yatim piatu dan pengasuh Pesantren Yayasan Amal Sosial Al Washliyah Jl Karya Jaya Medan Johor, seusai menyerahkan bantuan sembako dan uang tunai.

Bank Sumut Bantu Panti Asuhan Dan Pesantren MEDANM (Waspada): Bank Sumut memberikan santunan untuk panti asuhan dan pesantren di wilayah Medan dan Deliserdang sebagai bagian dari kegiatan bhakti sosial dan syukuran atas hari jadi ke-49 bank tersebut. Dirut Bank Sumut Gus Irawan Pasaribu, Rabu (10/11), mengatakan, santunan senilai Rp10 juta berupa sembako dan uang tunai masing-masing diberikan kepada Panti Asuhan Guna SLB Melati di Jalan Masjid Pasar IX Tembung Kabupaten Deliserdang, Panti Asuhan Putra Muhammadiyah Jl Amaliun Gg Umanat Medan, Panti Asuhan Yayasan Al Washliyah Jl Ismailyah Medan, Panti Asuhan Yayasan Amal Sosial Al Washliyah Jl Karya Jaya Medan, Panti Asuhan Bani Adam Al Washliyah Jl Besar Medan-Belawan, Panti Asuhan Bait Allah Jl Puskesmas Medan dan Pesantren Hidayatullah Tanjung Morawa Kabupaten Deli Serdang. Selain santunan uang tunai Rp3 juta, bantuan Sembako berupa beras, gula pasir, susu kental, sarden, kecap, teh bubuk, minyak goreng, ikan teri, ikan asin belah, telur ayam dan sabun cream. Gus Irawan mengatakan, santunan tersebut merupakan tali kasih Bank Sumut sebagai wujud terimakasih dan rasa syukur kepada TuhanYang Maha Pengasih karena senantiasa membimbing Bank Sumut dalam menjalankan visi dan misinya. “Kami memohon didoakan agar seluruh pegawai Bank Sumut selalu diberi kekuatan oleh Allah SWT dalam menjalankan tugasnya sehari-hari,” katanya saat menyerahkan santunan ke Panti Asuhan Yayasan Amal Sosial Al Washliyah Jl Karya Medan. Selain Dirut, jajaran direksi lainnya yakni Direktur Umum MYahya, Direktur Pemasaran Zenilhar dan Direktur Kepatuhan Manarata Manik juga menyempatkan diri memberikan santunan masing-masing ke Panti Asuhan Bani Adam di kawasan Mabar, Pesantren Hidayatullah Tanjung Morawa dan Panti Asuhan Bait Allah di Jalan Puskesmas Medan. (m19)

CBD Dekat Landasan Pacu

Otoritas Bandara Diminta Surati Pemko MEDAN (Waspada): Bangunan tinggi seperti hotel dan pertokoan tidak boleh berdiri di kawasan Bandara Polonia Medan. Di mana pun di dunia, tidak pernah ada bangunan tinggi sekitar bandara karena dapat mengancam keselamatan penerbangan dan penumpang. Untuk kasus ratusan unit properti pertokoan dibangun di eks Lapangan Golf Polonia, berdekatan dengan landasan pacu (runway), otoritas bandara seperti Angkasa Pura II dan Administrator Bandara diminta segera menyurati Pemko untuk mempertimbangkan kembali izin yang diberikan kepada developer, demi keamanan dan kenyamanan penerbangan. Hal itu disampaikan Staf Menko Kesra yang juga Wakil

Sekretaris Jenderal DPP Partai Golkar Leo Nababan kepada wartawan, kemarin, saat bertolak ke Jakarta, terkait keberadaan properti pertokoan Central Business District (CBD) yang jaraknya kurang lebih 150 m dari landasan pacu seharusnya 300 meter. Nababan mengaku terkejut kenapa bisa berdiri bangunan di sana. Tentu hal itu akan mengancam keselamatan dan keamanan penerbangan. Dia meminta instansi terkait mempertimbangkan izin pendirian CBD dan bangunan-bangunan tinggi di sekitar bandara. “Tidak masuk akal saya kenapa bisa diberi izin pertokoan dan rencana hotel. Hal ini harus menjadi perhatian otoritas bandara dan Pemko,” katanya. Sebaiknya, pemilik bangu-

Syamsul Masih Ketua Golkar Sumut MEDAN (Waspada): Ketua DPD Golkar Sumatera Utara masih di bawah koordinasi Syamsul Arifin, meski dia ditahan Komisi Pemberantasan Korupsi (KPK) dalam kasus dugaan korupsi APBD Langkat. “Syamsul Arifin masih menjabat Ketua DPD Golkar Sumut dan semua keputusan harus melalui dia,” kata Wakil Sekjen DPP Partai Golkar Leo Nababan kepada wartawan di Bandara Polonia Medan menjelang bertolak ke Jakarta, kemarin. Kata Nababan, solidaritas jajaran Golkar cukup tinggi terbukti 33 DPD kabupaten/kota masih mendukung Syamsul sebagai ketua. Berarti semua kebijakan menyangkut Golkar harus melalui kebijakan dia. Wasekjen DPP Golkar menilai, tidak ada masalah di jajaran Golkar Sumut, meski Bung Syamsul di dalam tahanan.Yang penting saling menjaga kekompakan. Sementara itu, Nababan

bersama rekan-rekan di DPP Golkar turun ke Sumatera Utara dalam rangka konsolidasi dengan jajaran Partai Golkar terutama di Sibolga setelah HM Syarfi Hutahuruk terpilih menjadi walikota. Setelah Pilkada Sibolga masih ada yang perlu diselesaikan. “Setidaknya Syarfi menjadi Ketua Dewan Penasehat jajaran Golkar Sibolga, sambil menjabat Walikota Sibolga,” kata Nababan. Kartu asuransi Kata Wasekjen, ke depan, setiap orang yang dapat memegang Kartu Golkar diasuransikan kehidupannya. Asuransi ini dianjurkan kepada semua jajaran Golkar bahkan ada yang sudah dilakukan dan sedang berlangsung. Setiap orang yang memegang Kartu Golkar jika meninggal dunia dapat asuransi lebih kurang Rp2 juta dan kecelakaan memperoleh Rp5 juta, sedangkan kartunya gratis. (m32)

nan (investor) harus belajar dari pengalaman musibah pesawat Mandala di Jalan Jamin Ginting Medan yang menewaskan banyak penumpang dan merugikan dana tidak terhitung jumlahnya. Menurut Nababan, bandara baru di Kualanamu masih lama rampungya dan belum tahu kapan kepastian selesai. Untuk itu, keamanan Bandara Polonia harus terjamin. Nababan menegaskan, Pemko Medan harus selektif dalam memberikan Izin Mendirikan Bangunan (IMB) di sekitar bandara, sementara otoritas Bandara Polonia seperti Angkasa Pura II dan Administrator Bandara disarankan mengajukan surat keberatan ke Pemko tentang kehadiran pertokoan CBD dan bangunan-bangunan lainnya di sekitar bandara. Nababan juga melihat begitu dekatnya bangunan CBD dengan landasan pacu. Dia mengkhawatirkan keselamatan tamu-tamu negara dan pejabat asing. (m32)

Sedikitnya, dua orang mahasiswa menjadi korban pemukulan dari kedua belah pihak dan tidak ada aparat kepolisian yang turun dalam peristiwa tersebut. Peristiwa tersebut berawal dari aksi unjuk rasa yang dilakukan Aliansi Mahasiswa Peduli IAIN di depan gedung aula, tempat berlangsungnya pengukuhan guru besar sekira pukul 11:00. Mereka menuntut pejelasan pihak rektor tentang anggaran pengadaan komputer, laptop dan radio di Fakultas Dakwah. Selain itu meminta rektor menangkap pelaku korupsi di IAIN. Aksi itu sempat dihalau petugas keamanan kampus saat pendemo akan memasuki pelataran parkir, sehingga terjadi bentrokan di antara keduanya dan aksi saling dorong tidak bisa dihindarkan. Pada saat itulah sekelompok mahasiswa dari Fakultas Syariah yang tidak menginginkan terjadinya keributan pada pelaksanaan pengukuhan guru besar, turut membantu petugas keamanan agar tidak terjadi keributan. Namun yang terjadi malah, pihak pengunjuk rasa menuduh mahasiswa dari Fakultas Syariah tersebut sebagai provokator dan sebagai kelompok mahasiswa pembela pihak kampus. Akhirnya, keributan dan bentrokan pun tidak terhindarkan, salah seorang mahasiswa Ahmad Sena, dari Fakultas Syariah luka lembam pada mata sebelah kiri akibat terkena pukulan kelompok pengunjuk rasa. Tidak senang dengan perlakuan tersebut, kelompok mahasiswa Fakultas Syariah melakukan pengejaran terhadap mahasiswa yang diduga

sebagai pelaku pemukulan, sehingga Sarman juga mengalami luka-luka. Aksi bentrok dan saling kejar antara kedua kubu mahasiswa tersebut sempat mereda dihalau oleh pihak pengamanan kampus. Sementara kelompok mahasiswa dari Fakultas Syariah membubarkan diri, sedangkan kelompok mahasiswa pengunjuk rasa terus melakukan aksinya di biro rektor dan diterima oleh Pembantu Rektor III Lahmudin untuk berdialog di lantai II biro rektor tersebut. Salah seorang mahasiswa dari Fakultas Syariah, Rudi, menyebutkan, sebelumnya kedua kelompok mahasiswa tersebut sudah melakukan audiensi dan dialog agar tidak melakukan aksi unjuk rasa pada saat pelaksanaan pengukuhan guru besar IAIN tersebut, tetapi menggelar aksi keesokan harinya. “Namun mereka tetap bandal dan melakukan aksi, sementara kami tetap sepakat untuk menghormati pengukuhan guru besar. Kita ingin saat pengukuhan guru besar ini kondisinya aman,” tegasnya seraya mengecam tindakan para pengunjuk rasa yang berlaku anarki dan melakukan pemukulan terhadap rekannya. Bawa nama organisasi Selang beberapa saat kemudian, sekira pukul 12:15, suasana kembali memanas, bahkan kedua kelompok saling membawa bendera organisasi. Pasalnya, seratusan mahasiswa dari organisasi Himpunan Mahasiswa Islam (HMI) IAIN-SU mendatangi kelompok pengunjukrasa yang belakangan diketahui dari organisasi Persatuan Mahasiswa Islam Indonesia (PMII) IAIN-SU yang sedang

melakukan dialog dengan PR III di lantai II biro rektor IAIN. Seusai melakukan dialog, kelompok PMII langsung disambut kelompok HMI yang sudah menunggu. Bentrokan pun tidak bisa dihindarkan, mereka saling menantang dan saling tarik baju. Bahkan saat mereka turun dari lantai II, salah seorang dari atas melemparkan tong sampah. Akhirnya, kelompok mahasiswa berkumpul di tengah lapangan upacara kampus dan menantang untuk berkelahi sambil meneriakkan “hidup PMII”. Hal tersebut memancing emosi kelompok HMI dan langsung mengejar kelompok PMII untuk berkelahi sambil meneriakkan “hidup HMI”. Namun perkelahian itu tidak berhasil dilakukan, karena langsung dihalau pihak keamanan kampus dan alumni IAIN yang hadir serta Satuan Resimen Mahasiswa (Satmenwa) IAIN. Perseteruan kedua kelompok mahasiswa itu pun akhirnya reda setelah pimpinan masing-masing kelompok, baik dari PMII dan HMI maupun alumni yang turun tangan, ikut meredakan emosi kedua kelompok mahasiswa tersebut. Akan ditindak Sementara itu, Rektor IAIN Nur Ahmad Fadhil Lubis didampingi PR I Hasan Asari saat dikonfirmasi menyatakan, pihaknya sangat menyayangkan aksi tersebut. “Saya sangat memprihatinkan itu, padahal mahasiswa tugas pokoknya adalah belajar. Kemudian kalau mau demonstrasi itu hak mereka, namun ada aturan main mengenai unjuk rasa, karena sebagai mahasiswa terdidik harus ikut aturan,” ujarnya. Dengan kejadian ini, lanjut Fadhil, pihaknya akan menyelidiki kasus ini dan menggunakan petunjuk yang didapat, bagi mahasiswa yang melanggar tata tertib dan kode etik mahasiswa akan ditindak, mulai dari peringatan lisan, peringatan tulisan, bahkan DO (drop out).(m41)

A4 Zikir Akbar Tazkira Di Masjid Agung MEDAN (Waspada): Majelis Zikir Tazkira akan menggelar tausiyah, zikir dan doa di Masjid Agung, Minggu (14/ 11) pukul 7:30. Ketua Umum Tazkira Sumut KH Amiruddin MS (foto), Rabu (10/11) mengatakan, masyarakat muslim Sumut khususnya Kota Medan, sudah menjadikan zikir sebagai kebutuhan. Hal ini dibuktikan setiap kegiatan zikir selalu dihadiri ribuan jamaah. “Berzikirlah kamu agar hati menjadi tenang,” katanya. Menurutnya, Sumut terhindar dari bencana karena masih ada hamba Allah yang selalu berzikir. “Untuk itu, mari kita terus amalkan zikir itu untuk mengiringi amalan-amalan wajib,” ujar Buya KH Amiruddin. Amiruddin menambahkan, zikir yang akan dilaksanakan nantinya dirangkai dengan doa keselamatan untuk jamaah haji di tanah suci Makkah yang akan melaksanakan wukuf, doa untuk keselamatan Sumatera Utara, berikut pemimpin di daerah ini. “Usai berzikir kita akan berdoa untuk Sumatera Utara agar dijauhkan dari bencana, dan diberi keselamatan para pemimpin di daerah ini dari terpaan fitnah,” tutur Amiruddin. Tausyah akbar akan disampaikan Drs H Azhar Sitompul MA kandidat Doktor dari USM Malaysia, dan zikir dibimbing KH Amiruddin MS usai salat tasbih. Ditambahkannya, Majelis Zikir Tazkira pada 21 November diundang Pemerintahan Kota Tebingtinggi untuk menggelar zikir dan tausiah di kota lemang itu. Kepada jamaah yang akan ikut diminta segera mendaftar ke Rumah Zikir Tazkira di lantai II Gedung Takagama Tour & Travel Jalan B Katamso depan Istana Maimoon Medan. (cat)

Penggelapan Mobil Rental Terbongkar MEDAN (Waspada): Seorang mengaku pengacara ditangkap polisi atas tuduhan menggadaikan dua mobil rental jenis Daihatsu Xenia milik Joniar M Nainggolan. Tersangka berinisial AZH. Kepala Unit Kendaraan Bermotor (Kanit Ranmor) Polda Sumut AKP Erri Sofyan Lubis, Rabu (10/11) mengatakan, pihaknya sudah menetapkan AZH sebagai tersangka terkait pengaduan korban Joniar M Nainggolan dengan bukti No. Pol: LP/326/IX/2010/Siaga Ops tertanggal 22 September 2010. Sesuai laporan tertanggal 22 September 2010, perbuatan itu berawal 6 Agustus 2010, di mana tersangka mendatangi Joniar untuk menyewa dua unit mobil dengan biaya Rp4,5 juta satu mobil selama satu bulan. Joniar meminta KTP AZH untuk persyaratannya. Tetapi, sebelum jatuh tempo 3 September 2010, Joniar mendapat informasi mobilnya digadaikan oleh AZH dan Sulaiman kepada pihak ketiga berinisial MB di Berastagi, Tanah Karo. Atas informasi tersebut, korban melapor ke Poldasu hingga akhirnya kedua tersangka diamankan bersama dua unit mobil yang digadaikan.(m11)

Polisi Yakin BAP Helmi, Mursin P21 MEDAN (Waspada): Penyidik Tindak Pidana Tertentu (Tipiter) Direktorat Reskrim Poldasu meyakini Berita Acara Pemeriksaan (BAP) tersangka pengelolaan UISU secara ilegal, Helmi Nasution dan Chairul Mursin, dinyatakan lengkap (P21) oleh pihak kejaksaan. Sebab, setelah BAP dilimpahkan penyidik Poldasu 27 Oktober hingga Rabu (10/11), pihak kejaksaan tidak mengembalikannya. Sesuai aturan BAP itu diproses kejaksaan selama 14 hari sejak diterima dari penyidik Poldasu. “Kita menunggu 14 hari setelah dilimpahkan. Sepertinya BAP kedua tersangka (Helmi dan Chairul Mursin-red) tidak pulang lagi,” kata Kasubbid Humas Poldasu AKBP MP Nainggolan kepada wartawan, Rabu (10/11). Kata Nainggolan, hingga kemarin pihaknya masih menunggu petunjuk jaksa. Jika dinyatakan P-21, maka penyidik Poldasu segera menyerahkan kedua tersangka kepada jaksa penuntut umum (JPU). Humas Kejatisu Edi Irsan Tarigan dikonfirmasi wartawan melalui ponsel mengatakan, segera mengecek perkembangan kasus itu kepada Kepala Seksi Pidana Umum (Kasi Pidum). Sebelumnya, penyidik Tipiter Poldasu menjadikan Helmi Nasution dan Chairul Mursin sebagai tersangka dalam perkara tindak pidana, karena mengelola Universitas Islam Sumatera Utara (UISU) tanpa izin, setelah memeriksa sejumlah saksi dan atas pengaduan Ketua Kopertis wilayah Sumut-Aceh. (m11)

Polda Buru Pembunuh Kesuma Wijaya MEDAN (Waspada): Kapolda Sumatera Utara Irjen Pol. Oegroseno menginstruksikan jajarannya untuk mengungkap pelaku pembunuhan Komisaris Utama PT Sewangi Sejati Luhur Kusuma Wijaya yang sebenarnya. Instruksi itu disampaikannya melalui Kabid Humas Kombes Pol. H. Baharuddin Djafar menjawab pertanyaan wartawan terkait perkembangan terakhir kasus itu, kemarin. Menurutnya, penyelidikan baru untuk mencari pelaku pembunuhan sebenarnya masih terus berjalan. Pengejaran terhadap pelaku sedang difokuskan dibantu Polresta Medan. Di samping tim gabungan melakukan pengejaran, lanjut Baharuddin, proses sidang kode etik juga tetap berjalan. “Sidang kode etik bagi anggota Polri yang diduga bersalah dalam penanganan kasus ini masih berlanjut,” tegasnya. Menjawab wartawan mengenai dugaan keterlibatan mantan Kapoltabes Medan Kombes Pol Imam Margono dalam kasus itu, Baharuddin mengatakan, kasus ini masih dalam penyelidikan. Secara terpisah, Surya Ardinata dari Lembaga Bantuan Hukum (LBH) Medan selaku kuasa hukum Zainal Abidin korban penembakan anggota Polsekta Medan Kota yang dinyatakan bebas oleh hakim dari tuduhan membunuh Kusuma Wijaya, menyambut baik atensi Kapoldasu mengungkap kasus ini. “Kami sebagai kuasa hukum Zainal Abidin memberi apresiasi kepada Kapoldasu dan jajaran untuk menangkap pelaku pembunuhan Kusuma Wijaya,” tegas Surya. (m39/h05)

Perjudian Togel Digerebek MEDAN (Waspada): Sub agen dan penulis toto gelap (togel) ditangkap polisi dari unit vice control (VC) satuan tindak pidana umum Poldasu dari dua lokasi berbeda. Dari kedua tersangka, polisi mengamankan barang bukti ratusan ribu rupiah, rekap togel, telepon genggam dan lainnya. Kabid Humas Poldasu Kombes Pol. Baharudin Djafar kepada wartawan, Rabu (10/11), mengatakan, unit VC Poldasu menangkap seorang juru tulis (jurtul) togel merek “Hongkong” dari Kecamatan Labuhan Deli dan sub agen “Kim Star” dari kawasan Langkat. Dari Labuhandeli, polisi menangkap Budi Harto, 34, warga Dusun IX Jl. Sukaria, Desa Pematang Johar, Labuhandeli, Kab. Deliserdang, Senin (8/11) pukul 22:00, di sebuah warung tidak jauh dari kediamannya. Dari tersangka, polisi menyita satu telepon genggam, buku tulis berisi nomor togel, alat tulis dan uang tunai Rp60 ribu. “Pelaku menerima nomor pasangan melalui SMS, lalu mengirimnya ke nomor seseorang yang kini masih diburon,” ujarnya. Keterangan tersangka, omset didapat berkisar Rp1-Rp1,5 juta setiap putaran, sedangkan tersangka memperoleh komisi 20 persen. “Pelaku berperan sebagai juru tulis ini telah menjalankan profesinya sejak September lalu. Kita juga sedang mengejar bandarnya,” sebut Baharudin. Sementara dari Langkat, ditangkap Jhon Adil Tarigan alias Adil, 49, warga Jalan Perintis Kemerdekaan, Desa Bahorok. Dia ditangkap Senin (8/11) dari salah satu rumah yang dijadikan lokasi sub agen togel merek kim star. Dari tersangka disita satu telepon genggam, uang Rp400 ribu, 13 blok kupon “Kim Star” periode 22 Oktober dan 42 blok kupon kimstar23Oktober2010,31blokkuponkimstarperiode24Oktober, 77 blok periode 25 Oktober, 85 blok peiode 26 Oktober, 80 blok peiode 27 Oktober dan 12 blok periode 03 November 2010. (m11)

Medan Metropolitan

WASPADA Jumat 12 November 2010

36 CPNS Polri Penuhi Syarat MEDAN (Waspada): Kepolisian Daerah Sumut mengumumkan daftar Calon Pegawai Negeri Sipil (CPNS) Polri dari sumber pelamar umum Tahun Anggaran 2010 dari pendidikan SMA/SMK yang dinyatakan memenuhi syarat. “36 Nama CPNS Polri sumber pelamar umum khusus SMA/SMK dinyatakan memenui syarat,” kata Kabid Humas Poldasu Kombes Baharudin Djafar melalui Kasubid Humas AKPB MP Nainggolan, Kamis (11/11). Mereka yang dinyatakan memenuhi syarat mengikuti ujian tertulis, yaitu; Natalia Nopita Sinaga jurusan IPS, warga Jl. Garu II A Gg Anggrek No.5 Medan,Taufik Akbar jurusan IPS warga Jl. Gaharu Komplek PTP Blok C No.6 Medan, Khairuddin Rangkuti (IPS) warga Titi Pahlawan Gg Pringgan, Medan Marelan, Netty Patrisia Tampubolon (IPA), Asrama Brimob Blok 61 No.1,Yusuf Nodisten Gultom (IPS), Jl. Perjuangan Gg Silindit No.20 Medan, Erwin Jonfiter Sihotang (IPA) warga Jl. Jahe V No.2 P.Simalingkar, Selamat Rajagukguk (IPS) Jl. Sederhana No.24 Teladan, Medan, Tribayu Harivinarto (IPS), Kampung Durian No.34 C Parak Gadang Timur, Nana Febriana (jurusan Teknik Mesin) Dusun Simargalin RT05/01 Desa Parung Mulya, Karawang, Epsarunika Aritonang (IPA) warga Kampung Salam III Lingk. XII, Jaserep Sijabat (IPS) asal Pondok Rangon Kec. Cipayung, Jawa Timur, Boni

Brata Aries S (Pelayaran) warga AR.Saleh No.33 RT 13 Kel. Palmerah Lama Jambi, Juniel Parasian Siahaan (IPS) warga Afdeling VIII Dolok Ilir Nagori Dolok Ilir II Kec. Dolok Batu Banggar. Kemudian, Tanda Septiawan Hutajulu (Teknik Mekanik Otomotif), Jl. Pelita IV No.144A Medan, Eben Ezer Ginting (Teknik Mesin), Bunga Rampai 2 Simalingkar B, Medan, Muhammad Abdul Halim (Elektro) Titi Pahlawan Lingkungan IV Medan Marelan, Aryanto Pandapotan Purba (IPS) warga 5B56 Lingkungan VI Pulo Brayan Bengkel, Medan Timur, Diamon Romansa Bangun (IPA) warga Bendungan II Lingk. I Medan, Sri Ani Nanda Sari (IPS) asal Lingk. Padat Karya Aek Tape A, Rantau Selatan, Septia Diningrum (IPA), Askela Barak Kampar No.215 Kec. Binjai Utara, Dedy Fransisco Sibuea (Teknik Medan), Blok 20 Lingk. XV Belawan Sicanang, Hendrizal (Otomotif), warga Rimbo Tarok RT 004 RW 009 Kel. Kuranji Padang, Murniman Larosa (IPS) warga Pelud Binaka Km12 Dusun Bawadesolo Kec. Gunung Sitoli, Nias, Noniat Telaumbanua (IPA) asal Desa Hilidurawa Kec. Sawo, Nias Utara, Desman Rahmat Insani Giawa (IPS), Jl. Mawar Blok E

No.12 Asrama Polres Nias, Jimmy Fernando (IPS) Jl. Merica Raya No.105 P.Simalingkar. Selanjutnya, Foresman Zendrato (IPA) Jl. Golkar No.8 Gunungsitoli, Nias, Yunisokhi Mendrofa (IPA), asal Desa Lolowua Kec. Hili Serangkai, Nias, Dedy Syahputra Harefa (IPA), Jl. Pelita No.11 Kel. Ilir, Kec. Gunung Sitoli, Nias, Yulius Zebua (IPS) Desa Tethosi Kec. Bawolato, Nias, Oktoberlius Zamasi (IPS) warga Tetehosi Foa Kec. Gunungsitoli Idanoi Nias, Arif Jaya Lafau (IPS) Desa Dahana Kec. Bawolato, Nias, Rynto Arbeth Waruwu (IPA) Desa Ononamolo II Kec. Mandrehe Utara, Nias, Yanisudiati Lase (IPS) Jl. Sutomo No.15 Dahano Sogawugawu Kodya Gusit, Nias dan Lestariani Mendrofa (IPA) warga Anggrek No.20 Kel. Ilir, Kec. Gunungsitoli, Nias. Hasil ke-36 CPNS itu berdasar rujukan Kapoldasu No:Kep/ 478/XI/2010 tanggal 9 November 2010 tentang penetapan hasil pemeriksaan administrasi seleksi penerimaan CPNS Polri TA 2010 sumber pelamar umum khusus kualdik SMA/ SMK jurusan IPA/IPS, Komputer, Elektro dan Mesin. “Pengambilan nomor ujian bisa dilakukan Kamis (11/11) di BiroPersonellantaiIIIPoldasupukul08:00-15:00.Pelaksanaanujian tertulis dilaksanakan Sabtu (13/ 11) di Aula Kamtibmas Poldasu pukul 08:00. Peserta pria harus mengenakankemejaputihcelana hitam dan wanita kemeja putih rokhitam,”kataNainggolan.(m11)

Al Washliyah Jadikan HUT Ke-80 Momen Kebangkitan MEDAN (Waspada): Al Washliyah Kota Medan akan menjadikan HUT ke-80 sebagai momentum membangkitkan kembali organisasi keagamaan ini. Ketua PD Al Washliyah Kota Medan Yulizar P Lubis didampingi Ketua Panitia HUT Darius serta Sekretaris Azzam Rizal, Wakil Sekretaris Muslim Zakaria, Syamsul Rizal dan Dedy Suheri di Hotel Dharma Deli Medan, kemarin, mengatakan, Al Washliyah yang berdiri di Maktaf Islamiyah Tapanuli di Jalan Mesjid Medan pada 30 November 1930 itu, merupakan ormas Islam yang memiliki massa terbesar di Sumut. Disamping memiliki ratusan madrasah termasuk perguruan tinggi dan sejumlah panti asuhan. Dari lembaga madrasah dan panti asuhan itu, lanjutnya, Al Washliyah melahirkan ratusan dan ribuan para ulama dan sarjana dengan berbagai disiplin ilmu. Para kader Al Washliyah juga banyak yang menimba

ilmu di luar negeri seperti Timur Tengah. Ketika itu keberadaan Al Washliyah dan lembaga pendidikan yang dikelola berada pada masa keemasan. Akan tetapi, setelah berakhirnya masa kepemimpin pendiri eksistensi Al Washliyah secara bertahap mulai menurun yang pada akhirnya posisi itu saat ini nyaris diungguli oleh ormas Islam lainnya. Yulizar tidak dapat menguraikan secara rinci satu persatu penyebab kemunduran ormas Islam yang mempersatukan umat itu. Lagi pula hal itu tak lagi perlu dibahas, namun yang harus menjadi kajian bagaimana membangun kembali Al Washliyah di tengah-tengah umat yang sedang banyak mendapat tantangan ini. Mengingat hal itu, lanjutYulizar, pada HUT Ke-80 Al Washliyah tahun ini, PD Al Washliyah Medan yang menjadi tuan rumah akan menyelenggarakan berbagai kegiatan, seperti liga

futsal untuk organisasi bagian danPC(PimpinanCabang)memperebutkan piala ketua liga. Gerak jalan santai keluarga besar Al Washliyah pada 28 November 2010 dilanjutkan dengan luckdraw berhadiah utamanya berangkat umro dan ratusan hadia menarik lainnya. Kemudian takhtim dan tahlil untuk mengenang pahlawan pendiri Alwashliyah di lokasi berdirinya Alwashliyah Makhtaf Islamiyah Tapanuli di Jalan Mesjid Medan. Acara puncak adalah resepsi di Univa (Universitas Alwashliyah) di Jalan SM Raja pada 30 November 2010. Ketua Panitia Darius menyatakan terimakasih kepada Ketua PD Washliyah Medan Yulizar P Lubis yang berniat dan mempunyai kemauan keras untuk mengembalikan keberadaan AlWashliyah seperti pada masa-masa jayanya. Sebagai ketua panitia, Darius berharap dukungan semua pihak untuk menyuseskan HUT. (m14)

Warga Blokir Jalan, Protes Proyek Drainase Terbengkalai MEDAN (Waspada): Garagara dua minggu proyek penggalian drainase terbengkalai di Jalan Perbatasan simpang Jalan Rakyat, Kel. Tegalrejo, Kec. Medan Perjuangan, puluhan warga memblokir ruas jalan di persimpangan tersebut, Kamis (11/11) sekira pukul 09:00. Akibat pemblokiran tersebut, pengendara kendaraan bermotor tidak bisa melintasi JalanRakyatdanJalanPerbatasan. Sejumlah warga yang ditemui Waspada menyebutkan, aksi blokir jalan itu dilakukan karena sudah dua minggu lebih proyek penggalian drainase tersebut terlantar, sehingga warga di Jalan Perbatasan yang hendak ke luar masuk menuju Jalan Rakyat tidak bisa melintas. Dampak lainnya, bekas galian sepanjang 10 meter lebih terlihat menganga, sehingga dikhawatirkan bisa membahayakan warga yang melintas, terutama murid sekolah dasar yang setiap hari melintasi jalan tersebut. “Kami sudah mem-

buat surat keluhan dan protes kepada Lurah Tegalrejo tapi tidak ada tanggapan, sehingga kami terpaksa memblokir jalan tersebut agar pihak Pemko Medan mengetahui kondisi proyek yang terbengkalai itu,” sebut seorang warga yang berusia 50 tahun. “Pak Lurah Tegalrejo dan Camat Medan Perjuangan tidak peduli terhadap keluhan kami, maka kami mengambil inisiatif dengan memasang batu-batu besar, ban bekas serta riol ke tengah/badan jalan,” ujar beberapa warga. Lurah Tegalrejo Marwan P yang dikonfirmasi wartawan di lokasi pemblokiran tersebut, sempat mengaku tak mengetahui adanya proyek di wilayah kerjanya, meskipun warga sudah melayangkan surat protes terhadap keberadaan proyek yang terbengkalai itu. “Saya tidak tau ada proyek ini karena pemborong proyek tidak ada melapor kepada saya,” dalih Marwan.

Bahkan, Marwan sempat marah kepada seorang wartawan saat dikonfirmasi dirinya tidak menanggapi keluhan warga. “Jangan sudutkan saya. Saya capek di sini,” hardik Lurah Marwan kepada wartawan seraya menambahkan dirinya telah menghubungi Kepala Dinas Pekerjaan Umum Pemko Medan terkait adanya pemblokiran jalan tersebut. Petugas Polsekta Medan Timur yang turun ke lokasi melakukan pendekatan persuasif kepada warga. Berselang beberapa jam, warga akhirnya menyingkirkan kembali batubatu besar dan riol tersebut ke pinggir jalan dengan jaminan Kapolsekta Medan Timur akan menghubungi Kepala Dinas Pekerjaan Umum. Warga juga mengancam, bila Dinas PU Pemko Medan tidak juga melanjutkan pengerjaan proyek yang terbengkalai itu, mereka akan kembali memblokir Jalan Rakyat simpang jalan Perbatasan.(cat)

Waspada/Andi Aria Tirtayasa

Puluhan warga memblokir ruas Jalan Rakyat-Jalan Perbatasan karena proyek drainase sudah dua minggu terbengkalai, Kamis (11/11) siang.

Waspada/M. Ferdinan Sembiring

Seorang polisi lalu lintas Poltabes Medan mengacungkan pistol untuk mengamankan emosi massa terhadap pengendara mobil sedan melaju dengan kecepatan tinggi, diduga sakaw, di Jalan Jamin Ginting di depan Kompleks Perumahan Citra Garden Medan, Kamis (11/11).

Polisi Amankan Pengendara Mobil Diduga Sakaw MEDAN (Waspada): Petugas kepolisian, Kamis (11/11), mengamankan seorang pria mengenderai mobil Aerio dengan kecepatan tinggi di Jalan Letjen Djamin Ginting Medan. Mobil yang dikenderai pria yang bernama AY, 23, warga Sei Sikambing B Medan itu, rusak berat karena dilempari masyarakat. Pria itu bertindak nekat diduga ketergantungan narkoba atau sakaw. Sebelumnya, AY akan dimasukkan ke pusat rehabilitas narkoba di kawasan Lubuk Pakam, Kabupaten Deliserdang. Rupanya dia lari membawa kabur mobil orangtuanya. Dengan kecepatan tinggi di jalan raya, AY sempat menyenggol sepeda motor, mobil dan pejalan kaki. Petugas Lantas Polres Deliserdang pun melakukan pengejaran. Sampai di kawasan

Titi Kuning, ban depan mobil pecah. Pria itu tetap saja tidak mau berhenti. Petugas Polsekta Medan Baru memblokir Jalan Letjen Djamin Ginting. Akhirnya, pengendara ditangkap. Masyarakat berduyunduyun turun ke lokasi turut merusak mobil tersebut. Petugas langsung mengamankan amukan massa dan membawa pria itu ke markas Brimob Poldasu Jalan KHWahid Hasyim Medan. Sedangkan mobilnya dibawa ke Mapolsekta Medan Baru. Kapolsekta Medan Baru AKP Saptono mengatakan, pihaknya masih melakukan penyelidikan dan disebut-sebut yang bersangkutan lari ketika dibawa orangtuanya ke panti rehabilitas. “Dia diduga sakaw sehingga mobil tidak normal,” ujarnya.(m31)

Dua Kantor Bank UOB Buana Disita MEDAN (Waspada): Dua Kantor Bank UOB Buana di Jalan Palang Merah Medan, Kelurahan Kesawan dan Kompleks Tomang Elok Blok A No 55, disita eksekusi oleh juru sita Pengadilan Negeri (PN) Medan, Rabu (11/11). Pantauan wartawan sebelum melakukan sita eksekusi, juru sita lebih dulu membacakan penetapan PN Medan atas permohonan eksekusi yang disampaikan pemohon eksekusi PT Abdi Rakyat Bakti ke PN Medan. Permohonan eksekusi ini dikabulkan, menyusul Mahkamah Agung (MA) dalam putusannya menolak Peninjauan Kembali (PK)

yang diajukan Overseas Union Bank Limited beralamat di Raffles Place UOB Centre Singapura. Pelaksanaan sita eksekusi pertama terhadap kantor Bank UOB Buana di Jalan Palang Merah Medan pukul 10:00. Kemudian, tim juru sita Abdul Rahman menemui pimpinan cabang Bank UOB, kemudian membacakan penetapan PN. Petugas juru sita PN diketuai Abdul Rahman didampingi satuan pengamanan dari Polresta Medan langsung membacakan penetapan PN Medan. Selanjutnya, proses eksekusi terlaksana dengan lancar.(h05)

Empat Anggota Polsekta Medan Timur Diperiksa MEDAN (Waspada): Kasi Propam Polresta Medan Ajun AKP Subeno telah melakukan pemeriksaan terhadap empat anggota Polsekta Medan Timur. Saat ini pemeriksa masih mendalami hasil keterangan terperiksa terkait tertembaknya Aiptu Suharto oleh tersangka perampokan Indra Syahputra yang kini sudah menyerahkan diri. “Sudah dimintai keterangan kemarin dengan pemeriksaan interogasi secara marathon dan masih didalami lagi,” kata Subeno kepada wartawan, Kamis (11/11). Menurut Subeni, pemeriksaan lanjutan akan dilakukan setelah kondisi Aiptu Suharto benar-benar sehat dan layak untuk dimintai

keterangan. Pasalnya, Suharto masih harus menjalankan perawatan medis dengan serius. “Akan diperiksa lanjutan setelah kondisi Suharto cukup membaik,” ujarnya. Menurut Subeno, pemeriksaan terhadap ke empat anggota Polsekta Medan Timur ini, masih mengetahuikronologisyangsebenarnya,sehingga belum dapat dipastikan dikenakan sanksi hukum atau tidak. “Ya, belum tahu apa sanksinya.” Sementara itu, kondisi Aiptu Suharto anggota Reskrim Polsekta Medan Timur yang ditembak pada bagian pinggangnya sudah mulai membaik, meski harus menjalani perawatan jalan di RS Bhayangkara Jalan KH Wahid Hasyim Medan. (m39)

Kejatisu Periksa Kadis Kesehatan Nisel MEDAN ( Waspada): Tim penyidik Kejaksaan Tinggi Sumatera Utara (Kejatisu) memeriksa Kepala Dinas Kesehatan Pemkab Nias Selatan (Nisel), terkait kasus dugaan korupsi pengadaan alat-alat kesehatan dan obat-obatan di daerah itu senilai Rp3,5 miliar. “Benar, Kadis Kesehatan Nisel berinisial AD sudah memenuhi panggilan kita. Pejabat tersebut diperiksa masih sebagai saksi,” kata Asisten Tindak Pidana Khusus Kejatisu Erbindo Saragih, Kamis (11/11). Pemeriksaan AD, lanjut Erbindo, merupakan bagian dari tindak lanjut penyidikan terhadap kasus dugaan korupsi pengadaan alat-alat kesehatan dan obat-obatan di Dinas Kesehatan Nisel yang dilakukan tim penyidik tindak pidana khusus Kejatisu. Mengenai kemungkinan AD selaku bagian dari kuasa pengguna anggaran (KPA) ditetapkan sebagai tersangka, Erbindo mengatakan, hal itu masih dalam penyelidikan. “Semuanya

masih diselidiki apakah dia terlibat atau tidak, tergantung penyidikan dan bukti-bukti yang ada,” tegasnya. Sebelumnya, tim Pidsus Kejatisu menetapkan tiga tersangka yakni KH Pejabat Pembuat Komitem (PPK), AM staf program pada P2 Dinkes Nias Selatan selaku panitia pengadaan obat-obatan dan perbekalan kesehatan Dinas Kesehatan Nias Selatan serta KD selaku rekanan. Bentuk perbuatan korupsi tersebut dilakukan dengan mark up harga obat dan pengadaan obat tidak sesuai prosedur. Akibatnya, negara dirugikan senilai Rp2,5 miliar dari nilai pagu pengadaaan obat sebesar Rp3,5 miliar. Selain melakukan mark up, proses pemenang tender juga menyalahi ketentuan. Sebab, PPK melakukan penunjukan langsung kepada kontraktor yakni PT Safeta Rianda. Kemudian, pengadaan obat-obatan itu tidak mengikuti petunjuk Menteri Kesehatan. (h05)

Medan Metropolitan

WASPADA Jumat 12 November 2010


Pemprovsu Harus Proaktif Jangan Hanya Tunggu MenPAN Keluarkan Formasi CPNS MEDAN (Waspada): Badan Kepegawaian Daerah (BKD) Pemprovsu diminta untuk lebih proaktif mendesak Menteri Pemberdayaan Aparatur Negara (MenPAN) mengeluarkan formasi seleksi Calon Pegawai Negeri Sipil (CPNS) 2010, terutama formasi teknis dan kesehatan. “Jangan hanya menunggu, tetapi BKD harus jemput bola ke MenPAN,” kata Anggota Komisi A Bidang Pemerintahan DPRD Sumut Nurul Azhar Lubis kepada Waspada di gedung dewan Jalan Imam Bonjol Medan, kemarin. Nurul mengaku prihatin lambatnya menPAN merespon permintaan tentang formasi penerimaan CPNS 2010 di Sumut. Padahal kepastian soal penerimaan seleksi CPNS itu sangat ditunggu berbagai elemen masyarakat Sumut, terutama para pencari kerja. Menurut politisi Partai Persatuan Pembangunan (PPP) Sumut itu, dengan dikeluarkannya kepastian formasi CPNS, maka

masyarakat Sumut yang mengikuti seleksinya bisa mempersiapkan diri untuk mencari peluang terbaik.“Mi-salnya para tamatan SMA bisa tahu mereka akan ikut di daerah mana. Sebab saya dengar untuk daerah pemekaran akan tetap ada penerimaan untuk SLTA,” katanya. Karenanya, kata Nurul, BKD Pemprovsu dan kabupaten/ kota harus sensitif terhadap keinginan masyarakat terkait kepastian formasi penerimaan CPNS 2010. “Kan tidak mungkin DPRD yang menyurati MenPAN. Nanti dikira ada kepentingan apa pula anggota dewan dalam seleksi CPNS ini. Karenanya BKD yang seharusnya menyurati,” ujarnya.

LSM Penjara “UJ” Deklarasi Di Tugu A Yani MEDAN (Waspada): Sekjen LSM Penjara UJ Indonesia Rapioman Siregar menegaskan, LSM Penjara (Waspada 2/11) yang melakukan deklarasi di Tugu A Yani 28 Oktober lalu adalah LSM Penjara “UJ” pimpinan Usman SU Jabrik Siregar. Menurut rilisnya pada 2 November lalu menanggapi pemberitaan Waspada (2/11) dan keberatannya dari pihak LSM Penjara pimpinan Atur P Panggabean, Rapioman Siregar menambahkan terdapat kekeliruan dalam pemberitaannya, yaitu kurang mencantumkan “UJ” di pemberitaan adanya deklarasi di Tugu A Yani Medan 28 Oktober lalu itu. Sementara LSM penjara pimpinan Atur P Panggabean dalam surat bantahannya yang diterima Waspada, menjelaskan LSM Penjara telah membekukan Usman SU Jabrik Siregar selaku Ketua DPD LSM Penjara Sumut, melalui keputusan SK No 01123/DPP/LSM-PENJARA/SK/IX/2010 tertanggal 20 September 2010 yang ditandatangani oleh Ketua Umum DPP LSM Penjara Indonesia Ahmad Fachrie dan Sekjen Ungkap M yang dikeluarkan di Bandung.(m24)

Hari Ini Menhut Hadiri Seminar KAHMI MEDAN (Waspada): Menteri Kehutanan (Menhut) RI Zulkifli Husin akan tampil sebagai keynote speaker pada seminar berkaitan dengan pelantikan pengurus PMW Korps Alumni Mahasiswa Islam (KAHMI) Sumatera Utara, di Convention Hall Hotel Tiara Medan, Jumat (12/11) malam ini. Pimpinan kolektif KAHMI Sumut Husni Nasution didampingi Ketua Panitia Asrul Kidam dan Zahirsyah Nasution mengatakan hal itu dalam jumpa pers di Sekretariat PMW KAHMI Sumut Jalan DI Panjaitan Medan, Selasa (9/11). Menhut dalam orasi ilmiahnya nanti berjudul: “Perspektif Hutan Tanaman Rakyat Dalam Rangka Meningkatkan Kesejahteraan Rakyat dan Melestarikan Lingkungan”. Menhut juga akan melakukan penanaman pohon secara simbolis guna penghijauan di beberapa kabupaten/kota. Penanaman pohon merupakan kerjasama antara PTPN-4 dengan Dinas Kehutanan Provsu sedangkan PMW KAHMI Sumut bertindak sebagai mediator. Diharapkan dari acara pelantikan ini dijadikan momentum alumni di Sumatera Utara, agar bisa menyatukan persepsi dan membuang jauh-jauh anggapan bahwa KAHMI selama ini telah terjadi dualisme. Pelantikan pengurus PMW KAHMI Sumut periode lima tahun ke depan akan dilantik oleh Abidinsyah Siregar serta dihadiri sekitar 700-an undangan termasuk Anas Urbaningrum dari Pusat dan daerah antara lain H. Raden Mohd.Safii (Romo), H.Rusdi Nasution,Wakil Gubernur Sumatera Utara Gatot Pujonugroho sekaligus member ikan bimbingan.(m25)

PMI Rayakan Milad Ke-82 MEDAN (Waspada): Pemuda Muslimin Indonesia (PMI) Cabang Kota Medan akan menggelar berbagai kegiatan sosial dan sejumlah perlombaan seni dan budaya Islam, serangkaian peringatan Milad ke-82 pada 25 November 2010. Ketua Panitia Milad Ahmad Fuad Nasution didampingi Sekretaris Panitia M. Yamin Nasution dan Bendahara Panitia Lesmana Darma Tarigan kepada wartawan di Medan, Selasa (9/11), menjelaskan, seluruh rangkaian kegiatan akan dimulai 14-21 November 2010 dan ditutup pada malam temu ramah serta silaturahim dengan para senioren di Hotel Dharma Deli Medan, 18 Desember mendatang. “Kami tidak akan melupakan jasa-jasa pendahulu kami di PMI Sumut dan Medan. Itu sebabnya, pada puncak peringatan Milad ini, kami sengaja pertemukan sekaligus memberikan cenderamata sebagai bentuk penghargaan kepada para senioren,” ujarnya. Dalam kesempatan yang sama, Ketua PC PMI Medan Rinaldi Amri dampingi para Wakil ketua, Dicky Ambon dan M. Ikbal Lubis mengungkapkan rasa kegembiraannya sekaligus syukur kepada Allah SWT bahwa Pemuda Muslimin, khususnya di kota Medan, masih eksis dalam pembinaan dan pengkaderan angggotanya sehingga diharapkan dapat memberi manfaat bagi bangsa, negara dan agama Islam. Katanya, peringatan Milad PMI di Kota Medan, mungkin akan menjadi momentum awal kebangkitan PMI Dicky mengharapkan, Milad kali ini dapat membangun soliditas kader, membangun ukhuwah islamiyah dan silaturahim. (m41)

Sementara itu, Anggota Komisi A DPRD Sumut lainnya Marasal Hutasoit justru melihat ada indikasi tarik-menarik kepentingan dalam lambatnya kepastian formasi seleksi CPNS 2010. “Bisa saja rekomendasi formasi yang diajukan pemkab/ pemko ternyata bukan berdasarkan kebutuhan daerah, melainkan berdasarkan pesanan,” katanya. Akibatnya, tambah politisi Partai Damai Sejahtera (PDS) itu, bisa saja MenPAN kesulitan

mengakomodir permintaan formasi dari masing-masing pemko/pemkab di Sumut, karena tidak sesuai dengan mekanisme dalam penerimaan CPNS di Indonesia. Selain itu, kata Marasal, keterlambatan ini bisa saja disebabkan pemko/pemkab ternyata masih belum mengirimkan data tenaga honorer masing-masing. Sehingga MenPAN kesulitan untuk menyesuaikan jumlah formasi yang akan diterima. “MenPAN kan punya

target semua honorer sejak 2005 diangkat penuh pada 2010 ini. Jadi bisa saja mereka masih menunggu laporan dari kabupaten/kota, agar nantinya formasi CPNS baru itu bisa disesuaikan dengan tenaga honorer yang diangkat,” katanya. Karena itu, senada dengan Nurul,Marasaljugamemintaagar BKD Pemprovsu untuk menindaklanjuti lambatnya kepastian formasi CPNS Sumutdengan mengkonfirmasi langsung penyebabnya ke MenPAN.(h11)

Mahasiwa Unimed Ikuti Sosialisasi Limbah MEDAN (Waspada): Sosialisasi Safari Daur Ulang Limbah (Sadarilah) yang dilaksanakan Badan Lingkungan Kota Medan di beberapa universitas, mendapat sambutan hangat dari ratusan mahasiswa. Hal itu dapat terlihat saat sosialisasi daur ulang limbah di Fakultas Mipa Universitas Negeri Medan (Unimed), yang dibuka Kepala Lingkungan Hidup Kota Medan Ir Purnama Dewi, MM beserta Kepala LH Unimed Prof Dr Suharta MSC, saking antusiasnya mahasiswa banyak yang tak kebagian tempat duduk, bahkan terpaksa berdiri. Purnama Dewi dalam sambutannya mengatakan, permasalahan lingkungan seharusnya menjadi tanggung jawab kita bersama, terutama masalah sampah. Hal itu tertulis juga pada Undang-Undang Persampahan tahun 2008 yang mana isinya menyatakan tanggung jawab penaggulangan sampah merupakan tanggung jawab antara pemerintah dan masyarakat. Sementara itu Prof Suharta mengatakan, program Sadarilah ini, tanpa disadari sudah turut mendukung program Green Campus dan Green Scool. Sedangkan pembicara lain Prof DR Ir Abdul Rauf MP menyampaikan makalah soal membiasakan diri menghemat air dengan memanfaatkan sumur resapan, sekaligus memperbanyak lubang resapan air


SERAHKAN BANTUAN: Siswa/i dan guru Namira Islamic School Medan, Selasa (2/11), menyerahkan dana bantuan Rp6,1 juta di Kantor Peduli Ummat Waspada diterima staf Peduli Ummat Waspada (kiri ).

Hujan Masih Terus Terjadi MEDAN (Waspada) : Intensitas curah hujan di kawasan Medan khususnya pesisir timur Sumatera Utara dalam dua hari ini luar biasa, bahkan terus akan terjadi hujan. “Dengan demikian peluang banjir juga cukup besar,” kata Firman, kepala data dan informasi (Datin) Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I Stasiun Bandara Polonia Medan, Rabu (10/11). Kata Firman, menurut data BMKG Wilayah I, curah hujan yang terjadi ke depan akan berlangsung berturut-turut dalam beberapa hari,


Kepala Badan Lingkungan Hidup Kota Medan Ir Purnama Dewi, MM menyerahkan bor tanah alat membuat lubang biopori kepada Kepala Lingkungan Hidup Unimed Prof DR Suharta, MSC pada acara sosialisasi Safari Daur Ulang limbah di Unimed. (biopori) dan hal-hal sederhana lainnya yang mudah dilakukan masyarakat guna meminamalisasi kerusakan alam. Begitu juga Marwan Harahap dari Hayati Indonesia, membahas tentang upaya penyelamatan bumi yang dapat dilakukan masyarakat dengan melakukan penghijauan. Dalam sosialisasi itu juga turut Dewi BudiatiTJ Said yang di kenal de-ngan julukan Si Ratu Sampah. Dewi dengan cekatan mengajarkan cara mudah mendaur ulang sampah dengan biaya murah termasuk mempraktekkannya. Hal ini cukup menarik m-

inat ratusan mahasiswa dan mahasiswi, yang terlihat serius saat Dewi memaparkan metode pilah tanam (Pita) yakni metode khusus melenyapkan sampah basah tanpa mencemari lingkungan bahkan mampu meningkatkan unsur hara tanah. Dewi Juga menganjurkan agar setiap rumah tangga, restauran, perkantoran memiliki bank sampah. Dimana hasil dari bank sampah tersebut dapat langsung dijual ke pemulung. Sedangkan sampah yang tak bisa terurai dapat dijadikan anek kerajinan daur ulang ala si Ratu Sampah.(m41)

Runway Bandara Kualanamu Harus Tender Ulang MEDAN (Waspada): Tender ulang landasan pacu (runway) sepanjang 3 Km dan lebar 80 m mengakibatkan terlambatnya penyelesaian Bandara Kualanamu pengganti Bandara Polonia Medan. “Tender ulang diperkirakan memakan waktu lama, menyebabkan bandara kebanggaan masyarakat Sumut terlambat selesai,” kata Administrator Bandara (Adban) Polonia Medan, Razali Abubakar, ketika dikonfirmasi via selular, Selasa (8/11). Razali juga tidak dapat menjelaskan secara teknis, kenapa runway itu ditender ulang, padahal jalan lintas pesawat (taxi way) sudah lama selesai. Awalnya informasi terlambatnya pembangunan runway, disebabkan struktur pemadatan tanah bekas lahan perkebunan tersebut membutuhkan waktu, namun belakangan diketahui harusditenderulangpengerjaannya. “Kalau anggota Komisi V DPR RI Ali Wongso Sinaga mengatakan kalau tidak ada kendala teknis, bandara itu selesai akhir 2012, saya kira ada kemajuan dan mudah-mudahan tidak meleset, karena terminal penumpanng segera rampung dan terminal cargo sudah lama selesai,” kata Razali. Sebelumnya Razali juga mengeluhkan kalau Bandara Kwalanamu terlalu lama selesai, mengingat pergerakan penumpang dan pesawat melalui Bandara Polonia Medan mengalami peningkatan terus menerus.

Waspada/Abdullah Dadeh

Sementara itu anggota Komisi V DPR RI membidangi perhubungan, AliWongso Sinaga mengakui, terkendalanya penyelesaian proyek Bandara Kualanamu, lebih dikarenakan masalah teknis. Bandara Kualanamu tidak akan selesai akhir 2011 karena kendala teknis. Namun penyelesaian bandara pengganti Bandara Polonia Medan, diperkirakan akan selesai akhir 2012, sekaligus dapat beroperasi. Dia menjelaskan, masalah teknis yang menjadi kendala berupa pemadatan tanah pada sisi udara (air side) untuk landasan pacu membutuh waktu panjang supaya stabil dan aman untuk digunakan sebagai landasan pendaratan pesawat besar. (m32)

Soksi Ziarah Ke Makam Pahlawan MEDAN (Waspada): Memperingati Hari Pahlawan, sekitar 200 pengurus Sentral Organisasi Karyawan Swadiri Indonesia (SOKSI) Sumut dengan beberapa badan konsentrasi seperti Wira Karya Indonesia, Wanita Swadiri, Lembaga Seni Budaya Soksi, melakukan upacara dan ziarah di Makam Pahlawan Jln Sisingamangaraja Medan, Rabu (10/11). Upacara dipimpin Wakil Ketua Soksi Sumut Drs. Iman Swadiri Ginting berlangsung hikmad dirangkai dengan doa dan tabur bunga ke pusara para pahlawan. Dalam sambutannya, Iman mengajak seluruh kader mengambil momentum hari pahlawan ini sebagai titik tolak untuk berbuat kepada bangsa dan negara dengan mengisi pembangunan. “Sudah saatnya kita jauhkan konflik. Mari kita bersatu untuk membangun, hindari perpecahan dan perkuat barisan untuk menjaga NKRI dan berbuat untuk kesejahteraan rakyat Indonesia,” katanya. Sementara itu, Ketua Soksi Sumut Indra Alamsyah di dampingi Sekretaris Indrayani Nasution mengatakan, masih banyak citacita para pahlawan yang belum tercapai. Bahkan masih banyak masyarakat yang belum menikmati apa arti merdeka. “Padahal, apa yang dinikmati sekarang merupakan buah dari perjuangan para pahlawan. Tapi apakah yang bakal dinikmati para penerus kita akan tetap sama? Jika kita melihat kondisi saat ini, dengan banyaknya bencana alam, kasus kelaparan, pendidikan dan pengangguran, mari kita merenung dan menyadari bahwa apa yang diberikan para pendahulu kita jangan disia-siakan,” imbaunya.(h11)

Balita Tersiram Air Panas MEDAN (Waspada): Bocah perempuan Khairunisa, 2, warga Mabar Kec. Medan Deli tersiram air panas dibagian kedua kakinya, Kamis (11/11) siang. Pasien kini sedang mendapatkan perawatan intensif di RSU dr. Pirngadi Medan. Kejadian berawal saat anak keempat dari pasangan Sutarno, 38, dan Susilawati, 35, sedang bermain di dapur, yang kemudian tersenggol air rebusan genjer. “Saya nggak tahu pasti kejadiannya. Saya dan istri lagi kerja. Katanya dia kena air rebusan genjer yang dimasak neneknya, air rebusannya diletakkan di lantai seperti biasanya,” ujar ayahnya Sutarno, Kamis (11/11) sore. Sutarno menuturkan, saat kejadian, nenek korban sedang mencuci piring sedangkan kakak korban sedang menyapu halaman. “Mereka tahu setelah adiknya menjerit. Saya dijemput adik ipar dikerjaan,” katanya yang mengaku bekerja sebagai buruh. Sebelum dibawa ke RSU dr. Pirngadi, Khairunisa sempat dilarikan ke Klinik di Mabar kemudian dirujuk ke RS. Medika selanjutnya dikirim ke RSU dr. Pirngadi. Pantauan Waspada, sejumlah tim dokter membersihkan luka bakarnya di ruang IGD RSU dr. Pirngadi. Hingga Kamis sore, pasien masih berada di ruang IGD RSU dr. Pirngadi Medan. (cmai)

Waspada/Mursal AI

Khairunisa, 2, warga Mabar Kec. Medan Deli sedang berbaring di RSU dr. Pirngadi Medan, Kamis (11/11) sore. Kedua kaki Khairunisa diperban.

DBSU Keluhkan Kriminalisasi Kaum Buruh

Salah satu sudut terminal penumpang Bandara Kualanamu yang sedang dikerjakan. Gambar ini dijepret 3 bulan sebelumnya. Awalnya, terminal dalam negeri Bandara Polonia Medan didesain untuk 900 ribu penumpang/tahun, namun akhir tahun 2010 diperkirakan mencapai angka lebih kurang 6 juta orang. “Yang mengkhawatirkan lagi, rumah-rumah penduduk dan antena TV menjulang tinggi muncul di kawasan ujung landasan pacu 023 Bandara Polonia Medan menjadi larangan bagi pesawat-pesawat berbadan lebar seperti Airbus 330, Boeing 747-400 dan Boeing 737-400 dan sejenisnya,” tuturnya. Menurutnya, walaupun take off dan landing harus melawan arah angin, pesawat disarankan melalui ujung runway 05 bagian selatan Bandara Polonia.

terutama di kawasan pesisir timur Sumatera Utara baik kawasan Medan, Deliserdang, Langkat, Asahan maupun Labuhan Batu. Namun di kawasan pesisir barat, curah hujan juga berpotensi kepada banjir dan longsor seperti di kawasan Mandailing Natal, Tapanuli Tengah, Tapanuli Selatan dan kawasan Sibolga. Sementara soal gelombang laut, Firman menyatakan masih tinggi. Kawasan lautan Hindia dan Selat Malaka hingga saat ini masih mencapai 2 hingga 2,5 meter.(m32)


Pengurus SOKSI Sumut beserta Badan Konsentrasi Sumut melaksanakan upacara dan ziarah di Makam Pahlawan Medan, Rabu (10/11).

MEDAN (Waspada): Sejumlah organisasi buruh yang tergabung dalam Dewan Buruh Sumatera Utara (DBSU) mengeluhkan kriminalisasi terhadap buruh yang melakukan aksi demo menuntut hak-hak normatif kepada pengusaha. DBSU mencatat sedikitnya ada empat kasus kriminalisasi yang dialami kaum buruh di Sumatera Utara (Sumut) sejak 2005 hingga 2010. “Pasal 353 ayat 1 KHUPidana tentang perasaan tidak menyenangkan menjadi senjata perusahaan melaporkan buruh ke polisi,” kata Hawari Hasibuan dari Divisi Advokasi DBSU kepada wartawan di kantor LBH Medan, Rabu (10/11). Di dampingi Pahala Nap dari Korwil F SBSI 1992, Baginda dari Serikat Buruh Medan Independen (SBMI), M Amrul Sinaga dari Solidaritas Serikat Buruh Sumatera Utara (SBSU) dan advokat dari LBH Medan, Hasibuan mencontohkan kasus yang dialami Ketua dan Sekretaris Persatuan Serikat Pekerja (PSP) Nasional Rudi Efendi dan Parulian Simbolon yang dilaporkan ke Polres Deliserdang pada 26 Juli lalu dengan tuduhan melanggar Pasal 353 ayat 1 KUHP hanya karena menggelar aksi unjuk rasa menuntut hak-hak normatif di PT Siantar Top. “Kasusnya telah dilimpahkan ke PN Lubuk Pakam dan akan disidangkan pada 15 November 2010,” ujar Hasibuan. Menurutnya, jeratan pidana perbuatan tidak menyenangkan yang dijerat penyidik kepolisian

atas laporan pihak pengusaha terjadi di sejumlah kabupaten di Sumut. Hampir setiap tahun pengaduan yang dilakukan pengusaha terhadap buruh ke polisi dengan tuduhan melakukan perbuatan tidak menyenangkan . “Kami berharap kepolisian lebih teliti menyikapi persoalan sengketa perburuhan supaya jangan terjebak dijadikan alat bagi pengusaha untuk membungkam pergerakan buruh yang menuntut pemenuhan hak-hak normatif, “ ungkapnya. Hasibuan menilai, persoalan unjukrasa dan mogok bekerja akibat adanya persoalan antara buruh dan pengusaha semestinya diselesaikan sesuai UU tenaga kerja . “Kalau ada penganiayaan, baru masuk dalam tindak pidana,” jelasnya. Sementara Bendahara DBSU Mince Simatupang mengatakan, pihak kepolisian terkesan lebih menonjol menindaklanjuti laporan pengusaha ketimbang laporan pihak buruh sendiri. Contohnya, kasus pemukulan dilakukan personalia PT. Siantar Top terhadap salah seorang buruh. Hingga saat ini berkasnya masih dibolak-balik dengan pasal terlalu ringan. Sementara Adokat dari LBH Medan Surya Adinata meminta Kapoldasu melakukan koreksi terhadap pihak penyidik agar melaksanakan tugas secara proporsional dan profesional dalam menindaklanjuti laporan dari berbagai kalangan. (h05)

Narkotika Senilai Rp3 M Dimusnahkan MEDAN (Waspada): Narkotika jenis sabusabu dan ganja senilai Rp3.038.524.000 dimusnahkan di halaman Direktorat Narkoba Polda Sumut, Jl. SM Raja Km 10,5 Medan, Kamis (11/ 11) pagi. Rincian barang bukti hasil kejahatan yang dimusnahkan itu; sabu-sabu sebanyak 2.528 gram senilai Rp3.033.600.000 dan ganja 4.924 gram senilai Rp4.924.000 Hadir pada pemusnahan barang bukti, pihak Kejaksaan Tinggi Sumut, Dinas Kesehatan, Balai POM dan pihak Laboratorium Forensik Mabes Polri Cabang Medan. Sebelum pemusnahan barang bukti, dilakukan uji klinis terhadap narkotika jenis sabusabu dan ganja di hadapan undangan dan wartawan. Barang bukti yang dimusnahkan itu hasil tangkapan pada Agustus lalu. “Ini merupakan perintah undang-undang nomor 35 tahun 2009 tentang narkoba. Dari 2,5 kg sabu dan ganja seberat 4,9 kg ini, polisi juga mengamankan 10 orang tersangka, 3 diantaranya anggota Sat Pol Airud,” kata Direktur Dit Narkoba Poldasu Kombes Pol. Jhon Turman Panjaitan. Para tersangka yang kini diamankan di sel Dit Narkoba Poldasu dijerat pasal 114 ayat 2 subsider pasal 115 ayat 2 dengan ancaman penjara di atas 5 tahun. Saat pemusnahan barang bukti, dihadirkan 9 tersangka, diantaranya 3 anggota Satpol AirTanjungbalai yang terlibat melakukan tangkap lepas tersangka sabu-sabu dengan barang bukti 2.842 gr di kawasan Jl. Asahan, Kec.Tanjungbalai Selatan

Kodya Tanjungbalai (tepatnya di kantor Pol Air AsahandandiJl.HusniThamrinLingk.IIKelurahan Pahang, Kec. Datuk Bandar, Tanjungbalai). Tersangka lainnya, Handi Markos Tambunan, Viktor Halomoan Simanjuntak alias Viktor, Iwan Imandana alias iwan dan Heriansyah alias Heri Warga Jl. SM Raja, Medan. Mereka ditangkap di stasiun bus Medan Raya Expres dengan barang bukti 5.000 gram ganja, dimusnahkan 4.944 gram. Kemudian, Wahyudiditangkap ditangkap di Jl. KL Yos Sudarso XII, Kel. Glugur Kota, Medan Barat dengan barang bukti 50 gram sabu-sabu dimusnahkan 40 gr. Baru terima sampel Di tempat sama, Kepala Laboratorium Forensik Mabes Polri Cabang Medan, Kombes Pol. Syafrian Simin, dikonfirmasi hasil laboratorium muntahan dua kakak adik, Khairunisa, 10, dan M Sidiq, 7, yang meninggal diduga setelah memakan bakso, mengatakan, baru menerima barang bukti tersebut. “Kami baru menerima barang buktinya dari Polsekta Delitua, jadi masih dalam proses pemeriksaan,” kata dia, disela acara pemusnahan barang bukti narkoba. Simin mengatakan, belum dapat memastikan kapan pemerikasan selesai untuk mengetahui hasilnya. “Ya, saat ini belum, mungkin dalam waktu dekat,” katanya. Hal sama juga dikatakannya mengenai hasil pemeriksaan kebakaran Pasar Sukaramai Jl. AR Hakim. “Belum juga, masih memerlukan pendalaman,” tandasnya. (m11)

A6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000


- ACCORD VTIL M/T Gg. Coklat Met. - Odyssey Matic 97 Hitam. Hub: 0812 6594 2789

Informasi Pembaca

- HONDA CRV, 04, Hitam manual a/n. Sendiri dari baru. -Mercy 230-E, Boxer Thn. 90/Hitam. - Daihatsu Taruna 01, Tipe FGX. 0813 - 9663 8992/770 63610/DOGEN


Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU FEROZA SE THN. ‘95 Body dan Cat Orisinil, mulus, mesin siap pakai. sgt dirawat. Velg, Cobra, BR. Hub. 0813 9661 0354 / TP. DAIHATSU Xenia Xi VVTi Sporty Thn. 2009. W. hitam met, AC, Tape, VR, BR, Mirror, BK Medan, Original, sgt mulus, Jarang pakai, Harga: 132Jt/damai. Hub. (061) 77731399

DAIHATSU Feroza Th. 93. Warna hitam, BK Medan Asli, Velg Racing, AC, Tape, Hub. 77702406 Nego. DAIHATSU Zebra 1,3. Kharisma Prima 21 Thn. 1994. BK Mdn Asli, VR, BR, Tape, warna abu-abu met. Peminat Hub. 0821 6641 5998. Harga 21Jt/damai.

DAIHATSU CLASSY TH 90/91. BK Medan, Burgun Red, sangat mulus, orisinil. Jl. Jermal 4 No. 84. Denai. HP. 0811 63 70 63

DAIHATSU ESPASS THN. 95. W. Silvermet. 1.3cc. Lengkap. BK Mdn Asli. Hub. 0811 618906 DAIHATSU BARU UNTUK NATAL & THN. BARU Paket Kredit Spesial Untuk Xenia, Terios, Luxio & Gran Max. Dapatkan Juga Diskon, Kontrak Servis & Hadiahnya. Info: TRISNA - ASTRA 0813 6177 3589 / 77943677

ISUZU Panther LS 2,5 Turbo Matic Thn. 2001. Coklat Met, BK Mdn, Ban Baru Rp. 99 Jt. Hub. 913 27433

ISUZU Panther Box Thn. 2004, Wrn Biru box, cantik, pajak panjang. mbl sehat, siap pakai. Rp. 75Jt. 0813 9682 8808 ISUZU Panther PU Thn. 08. Wrn. Hitam. Pajak panjang, BK Medan, mobil terawat, Rp. 93Jt. 0813 6147 4566 # ISUZU 100% BARU (ASTRA) # Panther Pick Up Turbo........DP 8 Jt Panther LM, LV, LS, Touring...DP 35Jt Hub. Suprapto 0813 7507 0088 / 061-77860168

KIA Sportex 4x4 2001. Mulus, originil, BK Medan, lengkap, siap pakai. H. 70 Jt Nego. Hub. 0812 6357 9890

KIA PICANTO COSMO 5th CUMA 13,5Jt HP. 0813.7589.6778 Garansi


MITSUBISHI FUSO PS 190 Tronton 10 Roda, Tahun 2003 Kondisi masih bagus dan siap jalan. Hub. 0812 604 6823


MITSUBISHI T120 SS 2002. Pick Up Box Mulus, cantik. BK Medan Lengkap, Siap pakai. H. 37Jt. Hub. 0812 6472 6918 / 0812 6357 9890

Xenia Hanya DP 11 Jt-an Angsuran 2 Jt-an Terios DP 15 Jt-an ansuran 4 Jt-an Grand Max Pick Up, DP 7 Jt-an angsuran 2 Jt-an, dll. Proses Mudah dan dijemput 24 jam stand by. Pemesanan Hub. MANDA ASTRA- DAIHATSU. SM. Raja Medan. HP. 0812 6316 330 / (061) 6647 0080

- Pick Up DP 7 Jt-an / Angs. 2 Jt-an - Xenia DP 11 Jt-an / Angs. 3 Jt-an - Terios DP 15 Jt-an / Angs. 4 Jt-an Ready Stock. Proses Cepat & Muda, Data Dijemput. Pesan sekarang ke: Ahmad Arif SE Astra Daihatsu 061-76277692 / 0812 6005 2465

PROMO DAIHATSU NATAL Xenia DP 15 Jt-an/Angs. 3Jt-an New Terios DP 16 Jt-an/Angs. 4 Jt-an Granmax PU & MB DP 10 Jt-an Hub. GERY 0813 7694 1988 / 061.77722561

DAIHATSU Xenia 1.0 Thn.2005. Dijual Over Kredit. Type Li, BK Medan asli, warna biru. AC, Tape, VR, BR, CLRC, PS, Kembali DP. Rp. 53.000.000. Kredit 21 Bulan lagi. Hub. 0812 6038 561



Pajero Sport A/T. M/T, Fuso, Colt Diesel, L.300. Grandis, Lancer, T120, Ready Stock !!! Proses Cepat. Hub. Antonius Sinaga (061) 7628 3331 - 0812 6020 3974

MERCY Mini 200 73/74 HP. 0821 6031 3063 OPEL Blazer ‘97. BK asli Medan, lengkap w. Hitam. Harga Rp. 45Jt/ Nego. Hub. 0812 6477 946

Ready: Xenia, Terios, Luxio & Granmax MB. Bunga ringan/DP kecil. Trm Tkr Tambah !!! Hub. EDY 061-7772 3699 / 081 985 1688

OPEL Blazer 2000 mulus, orisinil, BK Medan, AC, Tape, CD, TV, Power, Super woofer, mesin bagus, siap pakai. H. 59Jt.Nego. Hub. 0812 6477 946

FORD Everest 4x4 M/T Thn. 2005. Biru met. Ban 5 Bh Baru, BK Mdn, pajak STNK Baru. Hub. 0815 3182 818

OPEL Blazer Montera Thn. 2001, Silver, BK Medan Rp. 59Jt. Hub. 0816 3113 953

HYUNDAI CAKRA 96 AC, Tape, VR, Wr. Hijau, BK Mdn asli. Hub. 0811 650 674

PU 1.5 DP 6 Jt-an. Angs. 3.170.700 APV Dp. 12 Jt-an Angs. 4.830.000 NB: Proses Mudah & Cepat Data dijemput Hub. 0812 6540 809 / (061) 7772 2121



Type 1,6 L A/T High Line


BUNGA O % atau


Hub. 0813 7616 7637

Rp. 91.000 Rp. 104.000

New G. Livina Hanya DP 20 Jt-an + Bunga Rendah + Cash Back + Proses Cepat Hadiah menarik New Nixan March. Coming Soon, BS Tukar Tambah Info Hub. 77026289 / 0819 7308 2002

SUZUKI Esteem 1.6 ‘96. Mrh Maron Met, AC, RT, VR, BR, PW, PS DP 13,5Jt. Angs: 1,3Jt. Mercy E-230 ‘96. New Eyes HTM, BK 2 Angka, DP 45Jt. Angs. 3.xx. Hub. 76.700.976 /0878.6912.9124


Warna silver orisinil seperti baru. H. 165Jt. Boleh Tukar Kijang Innova atau Kijang Kapsul Hub. 0812 6477 946 BK Baru.

SUZUKI CARRY 1.0 THN. 96. Alexander Pintu Blk. VR, BR, Hrg. 27,5 Nego. Hub. 0813 7067 9800

SUZUKI Baleno Next G. Thn. 2003. Hitam, BK Binjai Rp. 92Jt. Hub. 7786 3981 SUZUKI APV Type “X” Thn. 2005. W. Hitam met, AC, TP, CD, PS, PW, CL, BK asli Mdn, Bodi kaleng dan siap pakai. Peminat serius Hub. HP. 081-2608 - 5896

SUZUKI Vitara Thn. 93. Hub. 0852 6130 0833 TOYOTA COROLLA DX, 91 Putih met, BK Medan, H-29Jt/Nego. Hub. 0812 6012 8801 TOYOTA Soluna XLi ‘02, BK Mdn, Silver, AC, RT, Jok kulit, VS, BR, DP 21Jt. Angs: 2,3Jt ISUZU Panther 2,5 Hi-Sporty ‘97 Akhir, BK Mut, Hijau, DP 23 Jt. Angs: 2,1Jt. Hub. 76700.976/0878.6912.9124 TOYOTA Kijang Capsul Model LGX New Bensin 1.8 Thn. 2003. Hitam Met, sgt terawat, VR16, BR, PS, PW, CL, E. Miror. AC DB, Sound, DVD, MP4. Ada TV, Acesories Full. Hrg. 140Jt. Nego. Hub. 0813 7550 1012

TOYOTA AVANZA 1.3 THN. 2006 W. Biru, BK Mdn, Mesin, Body mulus, AC DB, PW, PS, C. Lock, Alarm. Harga damai. Hub. 081161 5411

TOYOTA Corolla Altis G M/T Thn. 2002. Hitam, BK Mdn Rp. 125Jt. Hub. 91144382 TOYOTA Kijang Kencana Thn. 96. AC, Tape, VR, PS, PW, BK Mdn. Hub. 0857 6236 5160 TOYOTA Kijang Commando 1.8 Dijual. Thn. 96 BR, VR, AC (DB), Mulus. 65Jt. Nego. Hub. 0812 6502 730

9 CM Rp. 126.000 10 CM Rp. 140.000

PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih TOYOTA GREAT ‘95 Biru metalik, mulus, pajak panjang, Siap pakai, Hub. 0813 966 10354 TOYOTA Kijang LGX 2001 Bensin warna silver, body mulus mesin siap pakai. Komplit, 1 nama BPKB Medan asli. Hub. 0813 9667 7792 UNTUK BESOK 1 Toyota Kijang 1994 MB 1 Toyota Kijang 1988 MB Jl. AR. Hakim No. 147. (Dulu Jl. Bakti) Wisma Bakti. H.0852 700 82 495



JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN




TOYOTA Kijang Commando Thn. 88/ 89. W. Abu2 met. Tape/AC, BR, VR, BK Asli Medan 6 Speed. Mobil cantik. 41Jt/ Nego. Hub. 0813 9610 8610

TOYOTA Corolla Twin Cam. 1.3 Thn. 88. W. Hitam, mobil cantik. 32Jt/Nego. 0813 6150 8497




TV, LCD TV, Kulkas, M. Cuci, Handycam, Camera, DSLR, Laptop, LCD Projector, PS 1,2, 3, PSP, Home Theater, Ampli, Blue ray, Sound Sistem, dll. Hub. MARKET ELECTRONIC. Telp. 8210097 - 061.76324682 Jl. S. Budi T. Sari 424 B. Dkt BNI

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat





ALAT MUSIK KEYBOARD KN-2600 Dijual Cepat Kondisi cantik. Harga damai. Hub. 0812 6539 3000


Surat Tanah SHM a/n. MANIPAR NAPITUPULU yang terletak Kec. Medan. Petisah Kel. Sei Putih Timur. HILANG/TERCECER

1 (Satu) Surat Perjanjian Pelepasan Hak dan Ganti Rugi An. DRS. H. BURHANUDDIN HARAHAP dengan No: 593/83/ 28/1987/3/SPPH-GR/DS/1987 dan No: 593/83/27/1927/3/SPPH DGR/DS/1987. Hilang/tercecer di Jln. Bambu Desa Helvetia Kec. Labuhan Deli.




AC 1 pk, 1,5 pk, 2 pk=1,3Jt s/d =1,9Jt. AC Window 700rb, AC Air Cooler=1 Jt. Kulkas 1 pt=600 s/d 950rb, 2 pt=650rb s/d 1,3Jt. K. 2 Pt Jumbo=2Jt. K. Show case 6 rak = 1.7 Jt. Kulkas Box, K. Prizer: 1,2Jt. M. Cuci 2 tb=900rb, 1 tb=600rb s/d 1,4Jt. P. Cliner =900rb. Hub. SENANG HATI: 770736374517509 Jl. Sekip 67 A (Jual/ Beli/ T.T)

Cepat, Mudah, Aman, Bunga Ringan 696 35000 Dicari Mediator


TOYOTA KIJANG P. UP THN. 94. Suzuki Carry 1.0 Thn. 96. Karoseri Alexander Harga Nego. Hub. 0821 6023 4813

T. Sari, Gagak Hitam, TASBI dan sekitarnya ke Harapan I, SMUN I, Supir ibu berpengalaman. RENTAL AVANZA ‘10 Hub. 0813 70430 346


Telp. 77677220 HP. 0813 7536 4412

BUTUH DANA Cukup BPKB Sepeda Motor Anda, dpt dicicil, disc. 1xcicilan, terjangkau. Aman. Pembayaran Resmi Hub. 0813 7525 3321


TOYOTA Yaris 2010 Dijual. Tipe J. Matic. Hub. 77886228




Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807

JUAL CEPAT . T OYOTA Fortuner 2.7 GLUX A/T 2006. Silver metalic. Kondisi baik, mulus. Hub. 0811 625455

RENTAL MOBIL RENTAL MOBIL MURAH Rp. 250.000/Hari Mobil: Avanza, Xenia. HP. 061.66477734, 0813 9779 1077 Maaf TP.

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput



BK Medan Hitam, BPKB 1 nama, mulus, serius Hub. 0812 6363 561 T. Perantara Fortuner Ready Stock Warna Putih Kijang Innova, Rush, Avanza, Yaris Bisa Cash Dan Kredit / Data dijemput Hub. 0813 6120 1719 / 6878 3325


IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

HA TI-HA TI terhadap penipuan yang ATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab

# TOYOTA 100% BARU # TRUCK DYNA Rp. 12 Jt-an...Innova, Avanza, Rush, Yaris, Vios, Bunga Ringan. Hub. 061-77875227 atau 0815 304 2382


11 CM Rp. 165.000 12 CM Rp. 180.000

Pelanggan Yang Terhormat

TOYOTA Kijang LGX Diesel Thn. 2001 wrana biru metalik BK Medan satu nama dari baru. Mulus, siap pakai. Hub. 0813 96101 939


Hubungi Dealer

7 CM 8 CM


Jumat, 12 November 2010

Fax. 4151359


Jaminan BPKB Mobil sepeda motor, Becak. Bunga 1,5%. BPKB Aman, Data Dijemput, Proses Cepat. HP. 061.66477734, 0813 9779 1077 Maaf TP



TERCECER BPKB a/n. Sofian Efendi Hasibuan. BK 6805 HV. Jl. Persatuan No. 35. No. Mesin: E402-ID-7897 43.

Jaminan BPKB, Mobil, Sp. Motor, Betor dan Taksi semua tahun, Surat Tanah. syarat ringan, Proses Cepat. Hub. 061-7633 6525 -0812 6081 3010



1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633 BUTUH DANA CEPAT Cabang Baru YOGA FINANCE Jaminan BPKB: - Sepeda Motor (Kereta) - Betor (beca bermotor) - Angkot (KPUM) - Mobil Pribadi SEMUA - TAHUN Alamat: Jl. Tritura No. 10 L Titi Kuning Medan. Telp. (061) 785 3281

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik)



CPU P1V, 80 GB, 1 GB, DDR II, DVD, CASING NEW Rp. Murah. 061-7654 7788, 0812 6547 788

GREAT SALE LAPTOP MURAH TERDAHSYAT 2010 REVOLUSI NOVEMBER TOSHIBA, ACER, HP, SUZUKI, IBM, Merk Terkenal, Kwalitas oke, Desain Mantap, Tahan Lama, Terjamin & Digaransi. Dapatkan barangnya skrg juga, banjir Bonus & Haidah. Utk Pembelian Hari ini tanpa syarat Hubungi dan Miliki segera di: * * * * * * *

Millenium Plaza Aksara Plaza Siantar Plaza Binjai Supermall Medan Plaza Millenium Plaza Merak Jingga

DIJUAL CEPAT Sepeda Motor Bebek 125cc TVS Made in India Ex Hadiah Thn. 2010. Hitam seperti baru 99% Hrg. Rp. 7,5Jt. Barunya 12 Jt. Hub. 0852 62303 667 - 0813 7536 3710

BSA ( Bir Ming Ham Small Army) 250cc. Roda dua, Thn. 1952, Plat Medan, Harga Rp. 28,5 Juta Nego. Hub. 0813 7567 0005

0852 0813 0813 0813 0812 0812 7643

1090 9742 9650 7078 6498 8882 2047


7422 2213 7030 2829 7006 1068




: : : : : : :





AC, KULKAS, MESIN CUCI B. Pasang, Instalasi, Cuci, Spare Part 061.76764660 “ 0812 6557 521

AC061 69678231- 0857 6078 7441 SINAR TEKNIK

SERVICE - REPARASI AC - KULKAS - M. CUCI. Siap Ditempat & Bergaransi


Surat Penyerahan Ganti Rugi Tanah Tgl. 23 Januari 2002 a/n. NORMAN. Yang terletak di Dusun VI Desa Tanjung Alamat Kec. Percut Sei Tuan. Telah Hilang/Tercecer sepanjang Jalan Paluh Gelombang Dusun VI Desa Tanjung Selamat Sampai ke Jl. Rawa Gg. Kumis 01 No. 11. Kel. Tegal Sari Mandala II. Kec. Medan Denai Pd Tgl. 25 Oktober 2010


Sertifikat Hak Tanggungan No. 196/BMD RHT/V/2002. Tanggal 10 Mei 2002. An. MAROJAHAN SIMANJUNTAK


Surat Tanah Sertifikat Hak Guna Bangunan No. 1866. Tertanggal W. Maret 1988, Yang beralamat Jl. Melati. W. No. 76. Blok 10 Perumnas Helvetia Medan, An. Alm. Muhammad Saleh.


Surat tanah a/n. SUHERMAN luas 587, SM2, Akte No. 17.8 Des 1973, Tanah terletak Jl. Cemara Kampung Pulau. Brayan Darat II Ling. 30





Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop) Ingin Promosikan Produk Anda


WASPADA Media yang Tepat untuk Iklan Anda


WASPADA Jumat 12 November 2010


Kasus Terbaru Gayus Pintu Masuk Reformasi Polri JAKARTA (Waspada): Terdakwa kasus mafia pajak Gayus Halomoan Tambunan lagi-lagi membuat kasus. Kali ini kasusnya bukan masalah pajak. Tetapi dugaan dirinya pekan lalu bisa keluar dari Rutan Mako Brimob di Depok Jawa Barat dan jalan-jalan ke Bali untuk menonton pertandingan tennis. Atas dugaan itu anggota Komisi III DPR RI Martin Hutabarat mendesak Kapolri Jenderal Timur Pradopo untuk segera mengusut dan mengungkap




Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis + iNTERNET....................... 600 Rb (1 bulan) WEB Programing......................................500 Rb (10 hari)

Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 WEBSITE:




tuntas kasus dugaan keluarnya Gayus Tambunan dari tahanan untuk menonton pertandingan tenis di Bali, pekan lalu. Karena jika benar, kasus ini merupakan kelalaian dari anggota Polri. Kasus ini bisa dijadikan pintu masuk untuk melanjutkan reformasi di tubuh Polri. “Komisi III meminta Kapolri segera mengungkap kasus jalan-jalan Gayus Tambunan yang diduga melibatkan internal Polri,” ujar Martin di Jakarta, Selasa (9/11).

Politisi Fraksi Partai Gerindra itu mengatakan, Kapolri harus menjadikan kasus ini bagian dari prioritas 100 hari kerjanya. Selain itu juga membuktikan janji-janjinya saat uji kelayakan dan kepatutan di Komisi III. “Saat itu Timur berjanji akan secara serius membenahi internalnya, melanjutkan reformasi di kepolisian dan mengungkap rekening gendut,” ujar politisi Partai Gerindra daerah pemilihan Sumut itu.

LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Ditambah uang kerajinan 50rb/bln Hub. Bpk Ridho (061) 453.1124/ 0852.755.23457 Jl. Ayahanda 73C Medan

Harga 250 Jt, 3 Kamar Tidur, 2 Kamar Mandi, Grasi, R. Tamu, R. Kel, Dapur, Taman, SHM, Fasilitas lengkap, Harga nego Hub. 0813.6238.6998

53 Ha, Bangun Purba Desa Tarean Hub. 0811.644.380

DIJUAL SEGERA KHUSUS MUSLIM Komp. Villa Setia Budi Permai Tipe 75: 9,5x15m² Jl. Setia Budi/ Jl. Kenanga Sari No. 5, KM 2, KT 3, Carport, dll Hub. 0856.5811.8887 (Tanpa perantara)

TA N A H D I J UA L U k . 8 x 2 0 m , S H M Jl. Menteng Raya Gg. Rahayu Pasar Merah depan Universitas Swadaya Hub. 0813.7044.0662 Serius, Maaf TP


Tukang Jahit Syarat: Berpengalaman menjahit dengan menggunakan mesin besar (mesin Brother, Mitsubishi) Hubungi: 0852.7035.8079


1. 2. 3. 4. 5. 6.

D3 atau Pernah Kuliah Usia maximal 24 tahun Jujur Tidak merokok Belum menikah Bersedia tinggal di Asrama Lamaran diantar langsung ke: Jl. Pasundan No. 78


Hubungi: GINDO 0813.9680.3777

Sabtu-Minggu, 11-12 Desember 2010


Tempat Pelaksanaan :

RAZ PLAZA CONVENTION HALL Jln. Dr. Mansyur No. 164 Medan Tempat Pendaftaran :

Sekretariat SCSU (081281318288) Dr.Hj.Ettylamurti ( 08126006719) Dwi Wanto, ST ( 08126341947) Masjid Agung (081260304600) TB.Sembilan Wali ( 061-4527285) Madinah Syariah ( 061-77798910) Raz Plaza Hall (081263818076)

Penyelenggara : Yayasan Shalat Center Sumatera Utara Sekretariat : Jln. Adam Malik No. 62 Medan




Operator Warnet/ Rental OFFICE BOY Lamaran antar: ACC. NET Jl. Sakti Lubis No. 27 DIBUTUHKAN PERAWAT Laki-laki Muslim di Klinik “Spesialis Jiwa Syifak” Jl. Beringin IV No. 161 Medan Helvetia, Syarat: Fc. Ijazah Akper, Transkip Nilai, KTP

Informasi Hub. 0812.6311.1123 (dr. Nisa)


1 (satu) orang Advokat Wanita utk memimpin kantor advokat di Medan, Peminat: datang langsung ke: Jl. Jend. Ahmad Yani VII No. 4 Kesawan Medan, bawa lamaran + CV + Pas photo: 2 lbr + FC, Kartu Advokat Hub. 0812.6348.1119


Seorang Sopir Umur 20 - 25, Muslim, Rajin Jujur/ Bertanggung jawab Hub. BUFET HALIM Jl. AR. Hakim No. 156 Depan Gg. Pendidikan Medan Hubungi langsung dengan membawa KTP/ SIM diutamakan luar kota Telp. (061) 734.9218 Pak Salim


Beberapa Orang Tukang Jahit, Diutamakan yang mahir Menjahit spray, Bed cover Hub. 0813.6235.1135 0813.9601.4427


Sekolah baru membthkaan guru TK min lls SMA, kreatif & suka dunia anak Hub Jl. KH. Wahid Hasyim 92 Medan Tp. 76235314 - 9158.3487 4533.875 - 456.9269


Butuh tenaga kerja P/W (17-35 thn) untuk posisi dlm kantor, syarat: - Pendidikan min SMU/ sederajat - Bawa surat lamaran lengkap + guntingan iklan ini untuk proses interview Penghasilan: Rp. 1.800.000/ bln Hub. IBU ZULFAH/ IBU SRI WAHYUNI HP. 0812.6388.5458 / 0852.9617.1659 Alamat kantor: Jl. Brigjen. Zein. Hamid No. 221C (±10m dari Pamplet Perumahan Seroja Indah) arah Delitua Medan NB: 5 Pelamar pertama langsung diterima kerja


Kami sebuah perusahaan yang bergerak dibidang dealer jasa & sparepart Otomotif.


Restoran “ASOKA CORNER”, membutuhkan karyawan/i untuk ditempatkan sebagai: A. WAITER B. KASIR C. CAPTAIN WAITER D. ASISTEN KOKI Persyaratan: 1. Pria/ wanita maksimal berusia 30 tahun 2. Minimal tamatan SMU/ SMK sederajat 3. Diutamakan yang berpengalaman dibidangnya masing-masing 4. Khusus bagi kasir, harus dapat mengoperasikan komputer Lamaran diantar langsung ke: RESTORAN ASOKACORNER di Jl. Ring Road No. 5 & 6 (simpang Jl. Bunga Asoka) Medan Lamaran diantar secepatnya dan akan segera di proses/ di interview Hubungi: (061) 822.7822 NB. Bagi yang tinggal diluar kota akan disediakan mess/ tempat tinggal khusus bagi karyawan Pria

Lembaga Riset Publik Indonesia (LARISPA INDONESIA) untuk dan atas nama KLien Kami: Akbid Matorkis, Akbid Baruna Husada, Akbid Armina Center, Akbid Namira Husada, Akbid Paluta Husada, membuka lowongan untuk pria dan wanita: 1. Tenaga Kependidikan Kepustakaan (KP) 2. Tenaga Kependidikan Laboraturium Komputer (LAB) 3. Tenaga Kependidikan Administrasi (ADM) Syarat-syarat: 1. KP: Sarjana Pustaka 2. LAB: Sarjana Kokmputer 3. ADM: Sarjana atau Diploma 4. Siap ditempatkan di daerah: Padang sidimpuan, Panyabungan, Gunung Tua, Sibuhuan 5. Diutamakan yang berpengalaman Lamaran lengkap sebelum 19 Nov 2010, diantar langsung atau melalui pos ke alamat: Jl. Sei Mencirim Komplek Lalang Green Land I Block: C 16 Telp. (061) 7771.3025 Atau melalui E-mail: Web: Hanya mereka yang memenuhi syarat yang akan dipanggil interview



Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUMAH Dijual, LT. 15x42,5:± 634m², SHM di Jl. Garu III No. 54 Medan, Harga Rp. 850 Jt/nego Hub. Ibu Evi HP. 0852.7601.2770

DISEWAKAN Rumah, Ring Roat, Gg. Dame No. 8, 6 Km Tdr, Keramik, Sewa 17 Jt, Jl. Sunggal No. 264, 2 KM, Harga sewa 12 Jt HP. 0852.7539.1494

RUMAH Dijual Rumah T. 36 Standar (SHM), Lok. Perum. Cendana Asri Psr. 7 Tembung H. 45 Jt Hub. 0813.7027.6878


Rumah siap huni Jl. Danau Marsabut, Uk. 525m², SHM Hub. 0813.7039.8988


Rumah dan Tanah Uk. L x P: 775m² Fasilitas Rumah 4 Kamar, 2 K. Mandi, Listrik, Air, Telepon, Jl. Menteng Raya Gg. Abadi No. 27 Psr. Merah - Medan Hub. 0898.2855.226 - 0852.6169.6286


Permanen Ukuran 11x14m, Lokasi di dekat Pajak Pagi Kp. Durian Hub HP. 0813.6194.4000 7664.0538


Di Komp. Villa Jasari Manunggal, Jl. Manunggal, Tipe 50, 2 Kamar Tidur, Lantai keramik, Ada carport dan Kanopi model minimalis, Cocok untuk pasangan muda, Harga 200 Jt Hubungi 0813.9758.6670


1 Rmh Uk. 4x15m, PAM, PLN, 2 Kmr Tidur, KM di dalam, R. Tamu, R. Makan, Bisa msk mobil Hubungi Ibu Ida 661.5773 / 7751.4041 Jl. Sukaria No. 2 Gg. Sado

DIJUAL RUKAN Di Jl. Juanda Baru SHM, 3½ Tingkat Hub. 735.1111 0813.7687.0000


Uk. 10x15m, Jl. Eka Surya Gg. Eka Jaya IV No. 24F Kelurahan Gedung Johor Hub. 0821.6030.9022


TANAH Dijual Kolam Air Tawar 4 Rante, SK Camat, Jl. Lebar Msk mobil, Lks Nagatimbul Tj. Morawa, H. 70 Jt Hub. 0813.7027.6878 TANAH Dijual Uk. 27x42m (Hook) (bisa sebahagian), Jl. Pasar I Rel Gg. Mesjid Marelan Medan Hub. 0812.6088.982 - (061) 6610.369


Ukr Luas: 92,5x41,5m², Sertifikat HM Jl. Binjai Stabat, Tandem Hulu II - Hamparan Perak, Hrg 650 Rb/meter, Pinggir jalan besar lintas Medan - Aceh Hub. 0813.6103.5562

Lokasi Dsn. I Aman Damai Desa Sei Semayang Kec. Sunggal (700m dari Jl. Medan Binjai - Km. 16,5) masuk dari Samping Galon Minyak, Mesjid Belok Ke kanan Tanah tinggi, Rata bebas banjir dekat Rumah penduduk cocok untuk yang kerja di Medan Hubungi: H. SALIMIK HP. 081.2601.8160 Jl. Binjai Km. 15,4 No. 7 AB Diski

Kirimkan langsung lamaran lengkap beserta daftar riwayat hidup ke: (Tulis kode posisi di sudut kanan atas, paling lama 14 hari sejak iklan ini terbit) HRD PT. PANCA PILAR TANGGUH Jl. Helvetia By Pass No. 16 Medan

Media yang Tepat untuk Iklan Anda




TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Free WiFi


Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

KENANGA CITI HOTEL My Residence in Medan


Distributor Chemical - Mesin Laundry Kiloan Jl. Sekip No. 64 Medan HP. 0812.813.18288


FORUM KOMUNIKASI & PENYEMBUHAN ALTERNATIF INDONESIA SPECIAL MENANGANI PROBLEM ASMARA & RUMAH TANGGA - Gendam Asmaradhana (Solusi Kilat) izin depkes: 448/15830 Problem Asmara & Rumah tangga Izin Kejati: 13270/DSP5.08 - Gendam Pedothish (pemutusan hubuBuka setiap hari kerja ngan asmara & Perselingkuhan PIL & WIL) - Puter Giling (Menarik/ memanggil orang yg minggat/ kabur), Suami, Istri atau pacar dalam waktu singkat, Insya Allah akan kembali dengan cepat - Penyembuhan segala macam penyakit medis - non medis “BERGARANSI” (kutukan, keturunan, bawaan & guna²) BISA JARAK - Pelaris jual tanah, rumah, toko, restoran, dll JAUH Alamat: Jl. Puri (± 300m dari RM. Famili, Jl. SM. Raja) No. 57F Medan Telp. (061) 7678.1087/ 0813.7040.5888

Model Terbaru


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410

PELUANG USAHA Pemasangan Depot Air Minum Isi Ulang Standart DEPKES

15 Jt - 35 Jt (Nego)

Air Mineral dan Sistem RO Jual alat-alat Depot Isi Ulang


Jl. Yos Sudarso Km. 15,5 No. 121 Medan RINALDI, S.Pd.I (061) 685.0456 HP. 0813.6214.3160


WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja


WC WC 0812 60444275 WC 0813 6147 0812



0813 7035 7291

4x24m, Jl. STM Hrg 210 Jt 6,5x20m, Jl. Bajak II Gg. Langsat Hrg 70 Jt/ SHM KPR Hub. 0812.6307.2300

Jl. Setia Budi



Setia Budi

Pasang Iklan WC 8442246 08126427 1725 “WASPADA” ADI Tumpat Sedot

Jl. Brayan Medan


Telp: 061 - 4576602


Ada Garansi


845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F







Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881

Door to Door Domestik & Int’l. SRT - MOVING Telp. (061) 7711.8811 Jl. B. Katamso 557 Medan - Ritra Group



Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir

Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun




Sofa, Jepara, K. kantor, Ganti kulit/ kain + Busa cat ulang perabotan, Murah dan garansi. NB. Tempahan sofa minimalis Hub. 7740.5997 (Anto)



PELUANG BISNIS 1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro Rp. 22 Jt s/d 38Jt 2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki Menyediakan Mesin RO dan Yamaha Hubungi:


HP. 0813.6119.8067 0813.7597.6445


mandiri power buy cicilan 0%



Hub: 7772.2123 / 7759.8123 HP. 081.165.1123




Harga Ter Murah


JL. KEDIRI NO. 36 MEDAN TELP. 451.6161



Serius Hub. (061) 7690.3888 Pak. H. Ramlan HP. 0812.6002.6171



Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106


Luas Bangunan: 50m² di Jl. Payabakung Raya Diski, T.M. Yusuf, Fas. 2 KT, RT, R. Mkn/ Dpr, 1 KM, Teras, Gypsum, Keramik, Sert. Hak Milik, Bisa dibantu KPR (Tanpa DP), Siap ditempati, Ling. Muslim






Persyaratan: Pria/ wanita, max 35 thn, pnddkn min. D3 semua jurusan pengalaman min. 2 thn, bersedai ditempatkan di sluruh area kerja perusahaan, dapat berkomunikasi dengan baik, pekerja keras dan mampu bekerja dengan target. (SS)


MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 340/Jl. Serdang Buka Sampai Jam 11 Malam Depan Gg. Sado Medan


Jl. Jamin Ginting No. 119 Pancur Batu 20353 Phone: (061) 7780.3003 Fax. (061) 836.2060 Mobile: 0812.605.8936 E-mail:

Ingin Promosikan Produk Anda Harian




Uk. Tanah 5x28m, Jl. Karya Jaya Ds. Batu Pab. Cangkik Surat SHM, TP 0813.6236.4940

Type 50, LT. 6x18, 2 KT, 1 KM, Taman, Pagar klg Jl. Denai Ujung/ Jl. Datuk Kabu Gg. Bukori (Aspal), Utk Muslim Hub. 0812.6307.2300


HUBUNGI: JL. TITIPAPAN GG. PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP. 457.6116 - 451.2319 HP. 0813.6137.2321 - 0819.3335.4444






10x10 Rp. 12.500.000 10x12 Rp. 14.000.000 10x13 Rp. 15.000.000

ini. Ini adalah soal sesungguhnya motif uang,” cetus Yani. Terdakwa kasus mafia pajak Gayus Halomoan Tambunan diketahui meninggalkan sel tahanannya di rutan Brimob Kelapa Dua, Depok pekan lalu. Mabes Polri mengakui jika Gayus diberikan izin untuk berobat karena mengaku sakit. Namun, dalam perkembangannya, seseorang yang mirip Gayus tertangkap kamera foto wartawan Kompas di Nusa Dua Bali.(j07)



Uk. 10x30m, Terletak di Jl. Tempuling Simp. Tombak Huk Hub. 0852.7545.9343


Yani menegaskan, dalam kasus ini, Kapolri tidak cukup hanya melakukan pemeriksaan dan penonaktifan pihak yang terkait. Tetapi yang terpenting adalah harus diungkap apa motif di balik keluarnya Gayus dari rutan. Yani bahkan menduga, bisa saja hal ini sudah terjadi berulangkali. “Tidak mungkin berani sampai di level atas, karena kan belum ada 100 hari kapolri ini. Apa lagi Kapolri itu berjanji dengan 10 komitmen itu akan memberangus hal-hal seperti






Mereka sedang mempersiapkan rencana untuk melakukan kunjungan ke rutan untuk mendapatkan informasi terkait hal ini. “Saya sedang koordinasi dan konsolidasi kawan-kawan untuk melakukan sidak. Dalam reses ini mungkin dalam 1-2 hari ini mungkin, sekarang kawan-kawan ini lagi di dapil,” tukas anggota Komisi III DPR dari Fraksi Partai Persatuan Pe m b a n g u n a n ( F - P P P ) , Ahmad Yani di Jakarta, Selasa (9/11).

Uk. 9x22m, Sertifikat Hak Milik Jl. Bajak II-H depan Villa Mutiara Marendal Hub. 0813.9673.6996 - 0815.310.8739


3 TKT COCOK UNTUK USAHA INTI KOTA, DP 100 JT Dijual 4 pintu ruko Jl. Senam No. 1 Simp Jl. Halat (samping Sekolah Negeri), LB. 4x16m, LT. 4x29m, Row depan 10m, Row belakang 3m, Fas. SHM, PLN, PDAM, Pintu plat besi, Cocok utk usaha, Perhotelan, Fotocopy, Praktek dokter, Kost²an, hospital, warnet, kantor NB:300meter dari Jl. Juanda dan Bandara Polonia, bisa bantu KPR, KPR per bulan 5 Jt, Harga 525 Jt, Sisa 2 unit, Full keramik, Siap huni ± 80 Jt

ngan dijemput anggota Polri. Namun, seseorang yang tampak mirip Gayus justru terlihat menghadiri Commonwealth Bank Tournament of Champions, Nusa Dua, Bali pada Jumat (5/11). Gayus Tambunan sendiri membantah telah keluar Rutan Mako Brimob. Gayus juga membantah jika dirinya sakit. Keluarnya terdakwa kasus mafia pajak Gayus Halomoan Tambunan dari rutan Brimob Kelapa Dua, Depok membuat geram anggota Komisi III DPR.


1 Rumah Baru, Lok. Perumnas Taman Putri Deli, Namorambe, 1 RT, 2 KT, 1 KM, Fas. SHM, PLN, PAM, Harga 70 Jt/nego Hub. 0858.3116.1447

1. Pria, usia max. 30 thn 2. Diutamakan pengalaman Sales min. 2 thn 3. Pendidikan min. SMA/sederajat 4. Tidak sedang dalam kuliah 5. Memiliki sepeda motor & SIM C 6. Computer (MS-Word & Excel) 7. Jujur, bertanggung jawab dan gigih Surat lamaran, pasfoto, fotocopy KTP & SIM kirim ke Jln. H. Adam Malik No. 50 Medan selambatnya 1 Minggu setelah iklan ini terbit.

Kami Perusahaan Distributor Consumer Goods yang sedang berkembang, saat ini membutuhkan tenaga profesional muda untuk mengisi posisi:


Martin mengaku sangat kecewa jika benar Gayus Tambunan jalan-jalan ke Bali atas bantuan Polri. “Sehingga terhadap oknum Polri yang mengatur perjalan Gayus ke Bali itu perlu mendapat sanksi yang tegas,” tegasnya. Sebagaimana diberitakan, Gayus dikabarkan keluar Rutan Mako Brimob pada Jumat (5/11) dan Sabtu (6/11). Polisi membenarkan bahwa Gayus diizinkan keluar dengan alasan sakit, tapi dia dikembalikan ke Rutan pada Sabtu (6/11) de-

Ingin Promosikan Produk Anda


WASPADA Media yang Tepat untuk Iklan Anda FD CD

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda




Kami memberi bukti bukan janji, alat vital besar dan panjang ditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama


Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin mencengkram, wangi. Buktikan disini (Bergaransi)

HP. 0812.8481.8889



Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)


Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481




Cucu Asli Mak Erot Bersama

Kejari : No.B.78/N.4.3/DSP.4/12/2008

1 . UNTUK PRIA : Alat vital loyo, pendek, kecil/tidak berfungsi/impoten total. Kurang kuat keras, plekcur (ejakulasi dini), letoy, tidak tahan lama, bahkan disepelekan pasangan jangan kuatir. KI TUBAGUS Ingin joss, datang dan buktikan disini.

2. UNTUK TERAPI WANITA (Berdarah Seperti Perawan) : Mengembalikan keperawanan (virgin), hasil bisa dicek ke dokter, menghilangkan keputihan, becek, bau tidak sedap, ingin mencengkram/wangi, buktikan disini (Bergaransi) Mengatasi penyakit yang secara medis tidak dapat disembukan antara lain : · Kelainan sex, homo sex, lesbi,gysex · Gangguan jiwa/mental. Kegelisahan, gila Kurang percaya diri, stress berat, suka marah · Suka cemas, kecanduan narkoba, dll JL. SM. RAJA Samping UISU masuk JL. SEMPURNA 300M NO. 49 MEDAN DIBUKA DISIANTAR: Jl. Medan No. 35 Depan Bakso Deli 2 HP. 0812.6827.7999


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

Luar Negeri Abbas Minta DK-PBB Sidang, Bahas Pemukiman Yahudi A8

AS Keberatan Dengan Tindakan Sepihak Palestina

RAMALLAH, Tepi Barat (Antara/Reuters): Presiden Palestina Mahmoud Abbas meminta sidang Dewan Keamanan PBB untuk bahas pembangunan pemukiman Yahudi di tanah yang diduduki di Tepi Barat, di mana Palestina bermaksud mendirikan sebuah negara. Dari Washington, Menteri Luar Negeri AS Hillary Clinton Rabu memperingatkan mengenai ‘tindakan sepihak’ yang dilakukan dalam dialog PalestinaIsrael, setelah Palestina mengajukan permohonan ke PBB mengenai pembangunan permukiman Yahudi. “Perundingan antara semua pihak adalah satu-satunya cara yang bisa menjadi sarana untuk menyelesaikan semua klaim yang muncul dari konflik

tersebut,” kata Hillary kepada wartawan ketika ditanya tentang rencana Palestina untuk meminta Dewan Keamanan menanganimasalahpermukimanyang telah membuat macet pembicaraan perdamaian. Presiden AS Barack Obama mengatakan Selasa, bahwa rencana pembangunan pemukiman tidak membantu pada pembicaraan perdamaian dan menambahkan bahwa tidak ada pihak yang melakukan upaya tam-

Jet Tempur Israel Jatuh Saat Latihan

bahan untuk mencapai terobosan. Israel mengatakan Senin, mereka akan meneruskan rencana untuk membangun 1.300 apartemen baru di tanah di dan sekitar Jerusalem yang dicaplok Israel menyusul perang Timur Tengah 1967. Sebanyak 800 unit rumah lagi telah direncanakan untuk dibangun di permukiman Ariel di Tepi Barat utara. “Sesuatu musti dilakukan pada tingkat internasional untuk menghentikan ekspansi pemukiman yang pemerintah Israel lakukan di Tepi Barat, termasuk di Jerusalem,” tegas Nabil Abdu Rdainah, jurubicara Abbas, Rabu (10/11). Abbas telah memerintahkan utusannya untuk PBB, tempat Palestina memiliki status pengamat, untuk meminta pertemuan itu, jelasnya pada

Reuters. Pembicaraan perdamaian dukungan AS yang dimaksudkan untuk mengakhiri konflik Palestina-Israel melalui pembentukan negara Palestina telah terhenti karena perselisihan mengenai pembangunan pemukiman Yahudi itu. Utusan Palestina itu, Riyad Mansour, mengatakan pada Reuters melalui telefon dari New York bahwa dia akan mengajukan permintaan itu melalui negara-negara Arab yang memiliki status keanggotaan penuh. Abbas, yang menentang kekerasan dalam mengejar negara Palestina, menyatakan pembicaraan langsung denghan Israel masih pilihan pertamana untuk mencari perdamaian.Tapi dia juga mengatakan dia akan minta dukungan AS dan Dewan

Keamanan PBB bagi pembentukan negara Palestina jika gagal pembicaraanitu,bagiandari“prosesperdamaian”yangtelahdimulai dua dasawarsa lalu. Negara-negara besar melihat pemukimanYahudi di tanah Palestina, yang memang tidak sah, sebagai rintangan bagi perjanjian perdamaian yang akan mengakhiri konflik yang telah berusia enam dasawarsa itu. Hampir 500.000 orang Yahudi tinggal di tanah Palestina yang direbut oleh Israel dalam perang Timur Tengah 1976 itu, tempat Palestina ingin mendirikan negara yang juga akan mencakup Jalur Gaza yang terpisah. Palestina, yang mengkhawatirkan bahwa pembangunan pemukiman itu akan membuat maksud untuk mendirikan ne-

gara menjadi tidak mungkin, menyatakan mereka tidak akan memulai lagi pembicaraan perdamaian hingga Israel setuju menghentikan semua pembangunan permukiman. Pembicaraan perdamaian telah dimulai awal Sepember lalu tapi tergelincir beberapa pekan kemudian ketika Israel mencabut pembatasan pembangunan permukiman di Tepi Barat yang telah negara itu berlakukan selama 10 bulan. Kabinet PM Israel Benjamin Netanyahu didominasi oleh partaipartai yang mendukung pemukim, termasuk partainya sendiri Likud. Israel mengatakan pencaplokan itu membuat Jerusalem “ibukotanya yang menyatu dan tak dapat dibagi”, tapi klaim itu tidak mendapat dukungan internasional.

JERUSALEM (Antara/AFP): Sebuah jet tempur F-16 milik AU Israel (IAF) jatuh di gurun Israel Utara sewaktu melakukan latihan terbang rutin, ujar pihak militer, Kamis (11/11). Pihak militer menjelaskan sebanyak dua awak pesawat hilang sehingga mereka mengirim sejumlah pasukan untuk melakukan pencarian dan penyelamatan bagi pilot dan navigator di kawasan Kawah Ramon, ujar seorang juru bicara militer. Jatuhnya pesawat F-16 buatan AS yang dirancang bagi AU Israel merupakan kecelakaan pertama jenis pesawat itu yang dipercaya dapat menjangkau kawasan musuh bebuyutannya, Iran. Komandan AU Israel, Ido Nehushtan, telah meminta penyelidikan atas kecelakaan itu dan telah melarang terbang armada F-16 secara berkala, ujar juru bicara itu. Kecelakaan itu terjadi pada Rabu malam, namun pihak militer Israel yang menerapkan patokan umum, melarang penyiaran berita sebelum keluarga para awak diberitahu.

Tiga Tewas Di Thailand Selatan Sebelum Kunjungan PM Abhisit YALA, Thailand (Antara/AFP): Pejuang bayangan menembak mati tiga warga di wilayah bergolak Thailand Selatan menjelang kunjungan perdana menteri untuk menemui korban banjir bandang, kata polisi. Berita kematian itu datang saat PM AbhisitVejjajiva melakukan perjalanan ke daerah selatan tersebut, di mana 58 orang tewas akibat banjir, membuat jumlah korban tewas di seluruh negeri dalam beberapa pekan belakangan menjadi 185, kata angka resmi terkini. Polisi menyatakan seorang Siam berusia 37 tahun ditembak di provinsi Pattani Selasa saat mengemudikan pick-upnya untuk bekerja. Dia diduga menjadi korban perlawanan, yang melanda wilayah itu lebih dari enam tahun. Seorang wanita Melayu berumur 39 tahun juga ditembak mati di provnsi Narathiwat dalam penyergapan, tak lama sebelum seorang remaja berumur 17 tahun tewas akibat kejadian serupa di Pattani, kata polisi. Pejuang melancarkan gerakan keras di wilayah berpenduduk sebagian besar suku Melayu dan berbatasan dengan Malaysia itu sejak awal 2004, menewaskan lebih dari 4,300 orang, baik suku Siam maupun Melayu. Namun, pegiat menguatirkan budaya pembiaran berkembang di daerah itu, dengan menuduh pihak berwenang menyalahgunakan kekuasaan besar mereka di bawah undang-undang keadaan darurat, yang pertama kali diberlakukan di kawasan tersebut pada 2005. Banyak dari warga suku Melayu di wilayah itu mengeluh diperlakukan sebagai warga negara kelas dua oleh pemerintah jauh di Bangkok, yang mereka katakan sejak lama berusaha melebur mereka ke arus utama suku Siam Thailand.

PM Irak Lanjut Untuk Empat Tahun Ke Depan BAGHDAD, Irak (AP): PM Nouri al-Maliki akan melanjutkan jabatannya untuk empat tahun ke depan setelah parlemen Irak yang berunding sampai larut malam sepakat membentuk pemerintah baru, kata para anggota parlemen. Kesepakatan yang dicapai Rabu (10/11) malam itu memecahkan kebuntuan yang melumpuhkan pemerintahan Irak dan meningkatkan kekhawatiran bahwa pemberontak akan memanfaatkan situasi guna melancarkan kerusuhan. Koalisi dukungan Sunni yang selama ini sangat keras menentang Nouri al-Maliki akhirnya bersedia bertugas di bawah pemerintahannya. “Syukurlah, pada akhirnya masalah ini selesai. Semua kelompok setuju,” kata anggota parlemen dari suku Kurdi Mahmoud Othman, yang ikut dalam perundingan selama hampir tujuh jam setelah pembicaraan dua hari sebelumnya. Seorang pejabat dalam koalisi dukungan Sunni, Iraqiya, membenarkan bahwa satu kesepakatan telah dicapai. Garis besar kesepakatan itu adalah Presiden Jalal Talabani akan tetap menjalankan jabatan seremonialnya dan koalisi Iraqiya akan memilih jubir parlemen, menurut para anggota parlemen tentang kesepakatan itu. Rencana yang disepakati itu juga akan membentuk dewan baru yang menangani masalah keamanan, meski belum jelas berapa banyak anggotanya. Sejak pemilu 7 Maret lalu, parlemen Irak tidak mencapai kata sepakat soal siapa yang akan memimpin pemerintah baru. Koalisi Iraqiya berhasil menguasai suara terbesar di mana kalangan Sunni yang bersaing dengan Syiah menguasai 91 kursi pemilu, dibanding blok al-Maliki yang hanya mendapatkan 89 suara. Namun, kemudian al-Maliki mendapat sekutu baru, Muqtada al-Sadr. Tidak jelas peran apa yang dimainkan al-Sadr atau faksi garis kerasnya dalam pemerintah baru itu. Pejabat AS selama ini khawatir pertemanan al-Maliki dengan mereka akan membuka pintu bagi pengaruh langsung Iran terhadap urusan dalam negeri Irak dan akan mengacau keamanan dan kebijakan perdagangan yang proBarat. Dan yang masih belum jelas apakah kelompok Kurdi, yang memainkan peran penting dalam politik Irak sejak jatuhnya Saddam Hussein, mendapatkan peluang lain selain jabatan presiden. (m18)

Prancis Beri Penghormatan Bagi Veteran Pejuang Muslim PP-1 PARIS, Prancis (AP): Satu upacara khidmat diselenggarakan di Masjid Raya Paris guna menghormati sejumlah pejuang Muslim yang berjuang demi Prancis dalam Perang Dunia I lalu. Menteri Pertahanan Herve Morin dan Menteri Urusan Veteran Hubert Falco ikut ambil bagian dalam upacara Kamis (11/11) itu, salah satu dari sejumlah acara yang nenandai ulangtahun ke-92 akhir Perang Dunia I. Presiden Prancis Nicolas Sarkozy juga menghidupkan lso obor abadi di tugu makan pahlawan tak dikenal, di bawah Arc de Triomphe Paris. Kira-kira 3.000 orang hadir untuk menyaksikan upacara tersebut. Kira-kira 1,4 juta orang tewas atau hilang semasa Perang Dunia I di Prancis, termasuk banyak warga Muslim yang memperjuangkan Prancis. Warga Muslim itu kebanyakan berasal dari negara koloni Prancis di Afrika Utara. Veteran terakhir Prancis dalam Perang Dunia I meninggal dunia Maret 2008. (m07)

Seorang Ibu Di Florida Jual Anak Untuk Beli Mobil MIAMI, Florida (Antara/Reuters): Seorang perempuan Florida dituntut karena berusaha menjual bayi lelakinya untuk membeli mobil, demikian keterangan polisi. Nenek bayi tersebut menjadi pialang dan mulanya meminta bayaran AS$75.000 tapi setuju untuk mengurangi harga AS$30. 000, ketika diberi tahu ‘calon pembelinya’ tak bisa memperoleh pinjaman dari bank, kata Departemen Pelaksana Hukum Florida (FDLE). Ibu dari bayi yang berusia delapan pekan tersebut, Stephanie Bigbee Fleming, 22, dari Bradenton, Florida, direnca-nakan menerima AS$9.000 dari penjualan bayinya, kata FDLE. “Fleming berencana membeli satu kendaraan baru dari uang yang diterimanya,” kata wanita jurubicara FDLE. Fleming juga memerlukan uang untuk membayar biaya pengadilan karena ia melanggar hukuman percobaan yang tak berkaitan dengan kasus penjualan bayinya, demikian isi dokumen penangkapannya. Fleming ditangkap Selasa (9/11). Sang nenek, Patty Bigbee, 45, ditangkap pekan lalu bersama pacarnya Lawrence Works, 42, keduanya dari Holly Hill, Florida. Ketiga orang itu menghadapi dakwaan penjualan anak secara gelap, dan Bigbee juga dituntut melakukan penipuan komunikasi, kata departemen tersebut. Menurut laporan penangkapan itu, Bigbee menawarkan untuk menjual bayi tersebut kepada seorang perempuan kerabat pada Oktober, dan menjelaskan ia telah merawat cucunya tapi ‘bukan sebagai ibu.’

WASPADA Jumat 12 November 2010

Filipina Siaga Setelah Kapal Dengan 25 Pelaut China Hilang


The Associated Press

Para demonstran berpawai di jalanan Kamis (11/11) dalam aksi unjukrasa anti-G20 di Seoul, Korea Selatan. Lebih dari 80 kelompok masyarakat ikut ambil bagian dalam aksi tersebut. Para pemimpin dunia datang berkumpul di Seoul 11-12 November guna membahas keadaan perekonomian global pada saat kelompok tersebut keluar dari krisis finansial.

Obama: Korut Harus Perlihatkan Keseriusan Untuk Berunding SEOUL, Korea Selatan (Antara/Reuters): Presiden AS Barack Obama bersama dengan sekutunya Korea Selatan, mendesak perubahan sikap Korea Utara untuk memulai perundingan kembali nuklir enam pihak, serta memberikan harapan pemberianbantuanekonomijika mereka berubah, Kamis (11/11). Negara Korut (Korea Utara) yang tertutup telah mengatakan akan mengulang perundingan pelucutan senjata nuklir sejak mereka keluar dua tahun lalu,

namun Seoul dan Washington mengatakan bahwa Korut pertama kali harus memperlihatkan ketulusan janji untuk pelucutan nuklir itu. Ketegangan di semenanjung itu menurun ke tingkat terendahnya selama lebih dari satu dekade pada Maret ketika kapal perang Korsel (Korea Selatan) bernama Cheonan tenggelam akibat torpedo yang menewaskan 46 awak kapal. Sebuah penyelidikan internasional menduga bahwa Korut

bertanggung jawab atas serangan tersebut, namun Pyongyang mengatakan mereka tidak terlibat. Obama di Seoul menyatakan bahwa Korut harus menangani masalah Korsel atas penenggelaman itu dan menghentikan kegiatan yang provokatif dengan menambahkan bahwa Pyongyang juga harus memenuhi kewajibannya dalam menghentikan program senjata nuklir. Presiden Korsel Lee Myungbak menyatakan bahwa dia dan

Obama “menegaskan kembali nilai yang harus Korut tunjukkan sebagai tindakan sadarnya dan sikap tanggung jawab pada tragediCheonandanhalituakanmenjadi titik awal kemajuan hubungan antara Utara dan Selatan”. Amerika Serikat merupakan satu dari lima kekuatan regional, bersama dengan Rusia, China, Jepang, dan Korsel yang tergabung dalam perundingan enam pihak untuk menghentikan program persenjataan nuklir Korut.

NATO Bunuh Tiga Warga Afghanistan KABUL, Afghanistan (Antara/AFP/Reuters): Pasukan pimpinan NATO di Afghanistan menyatakan sedang menyelidiki kemungkinan tentaranya membunuh tiga warga Afghanistan Rabu, pada saat pasukannya memerangi pejuang di bagian selatan negara itu. Korban di kalangan rakyat akibat pasukan asing, yang memburu pejuang, telah lama menjadi sumber utama ketegangan antara Presiden Hamid Karzai dengan Barat, terutama Amerika Serikat.

Aturan tentang penggunaan serangan udara oleh pesawat Pakta Pertahanan Atlantik Utara (NATO) dan pesawat AS pada tahun lalu sebagai tanggapannya, namun kejadian tetap muncul sesekali. Pada Rabu, Pasukan Bantuan Keamanan Asing (ISAF) pimpinan NATO dalam pernyataannya mengatakan “mencari kemungkinan tiga warga Afghanistan secara tak sengaja tewas dan satu luka oleh pasukan ISAF” dalam pertempuran dengan pejuang di daerah Sangin di

propinsi Helmand. Dikatakannya, empat warga Afghanistan dibawa ke pangkalan terdekat ISAF setelah pertempuran itu dan bahwa tiga dari mereka kemudian meninggal. Helmand adalah salah satu dari kubu tua Taliban di selatan dan titik luncur serangan besar pasukan ISAF pada tahun lalu. Panglima ISAF menyatakan keamanan membaik di beberapa bagian Helmand, tapi tetap banyak pertempuran di banyak daerah.

Dalam laporan tengah tahun, Perserikatan BangsaBangsa menyatakan korban di kalangan rakyat meningkat 31 persen pada enam bulan pertama 2010 dibandingkan dengan masa sama tahun lalu. Sebaliknya, kematian disebabkan oleh pasukan “pendukung pemerintah” -tentara Afghanistan dan asing- menurun tajam, kata laporan badan dunia itu, sebagian besar karena komandan memperketat aturan tentang penggunaan serangan udara.

MANILA, Filipina (AP): Pengawal pantai Filipina melakukan pencarian atas satu kapal barang Panama dengan 25 warga China anggota anak kapal di atasnya. Armand Balilo, seorang jurubicara pengawal pantai, mengatakan Kedutaanbesar China telah melaporkan kapal Nasco Diamond dan seluruh awaknya telah menghilang sejak Kamis (11/11) di dekat Batanes, provinsi paling utara Filipina. Balilo mengatakan sejumlah kapal pengawal pantai Filipina dan satu pesawat telah disiagakan untuk bergabung dengan operasi pencarian dan penyelamatan oleh pihak berwenang China. Dia mengatakan tidak ada rincian lebih lanjut tentang kapal itu dan awaknya. Hilang di pantai Okinawa Sementara itu, sebuah kapal kargo China hilang di lepas pantai pulau Jepang Okinawa dan orang-orang yang selamat dari kapal itu telah ditemukan, kata media negara Kamis (11/11). Berita singkat tersebut disiarkan oleh kantor berita China Xinhua tanpa memberikan rincian lain. Okinawa adalah tempat terdekat dari perairan itu, yang diklaim oleh kedua pihak, dan menjadi tempat terjadinya tabra-kan antara kapal pukat harimau China dengan kapal penjaga pantai Jepang pada September, yang kemudian memicu mema-nasnya sengketa diplomatik. Pasukan penjaga pantai Jepang mengakui membocorkan video tabrakan antara sebuah kapal penangkap ikan China dan kapal patroli Jepang yang disiarkan di internet. Tindakan itu dianggap dapat menyakiti upaya memperbaiki hubungan, kata media domestik Rabu.(m07)

Aung San Suu Kyi Kalah Dalam Sidang Pengadilan YANGON, Myanmar (AP): Ikon demokrasi Myanmar Aung San Suu Kyi mengalami kekalahan terakhir di pengadilan Kamis (11/11) namun para pembantu terdekatnya masih optimis bahwa dia segera diberikan kebebasan dari tahanan rumah oleh penguasa militer. Pemenang Hadiah Nobel Perdamaian itu seyogyanya menyelesaikan masa hukumannya Sabtu (14/11), hampir seminggu setelah pemilihan umum yang diselenggarakan tanpa kesertaan Suu Kyi dan secara luas dikritik sebagai memalukan. Junta belum mengkonfirmasi bahwa dia akan dibebaskan namun para pejabat pemerintah diam-diam mengatakan mereka membuat ‘berbagai persiapan seperlunya’ yang telah dilakukan untuk akhir pekan ini. Suu Kyi menyatakan dia boleh jadi telah memasuki kembali arena politik, yang katanya melalui para pengacaranya dia akan menyelidiki dugaan kecurangan dalam pemilihan begitu hasilnya disiarkan. Putra termuda dari dua anak Suu Kyi, Kim Aris, juga telah memperoleh visa Myanmar awal pekan ini, kata pengacaranya NyanWin, yang mengindikasikan bahwa dia akan diizinkan melihat ibunya untuk pertama kalinya dalam 10 tahun. Aris, 33, yang tinggal di Inggris dan telah berulangkali ditolak permohonannya untuk mendapatkan visa selama beberapa tahun. (m07)

Sport A9 Porprovsu Harusnya Sportif

WASPADA Jumat 12 November 2010

Chairul Azmi: Tuntutan KONI Medan Gugur MEDAN (Waspada): Maraknya pemakaian atlet dari luar Sumut untuk memperkuat satu daerah, seperti di cabang bulutangkis Porprovsu 2010, mendapat tanggapan serius dari Ketua Komisi E DPRD Sumut Brilian Moktar SE.

Waspada/Khairil Umri Batubara

Pemain voli putri Deli Serdang melepaskan smes saat melawan Pematangsiantar pada semifinal di GSG Unimed, Kamis (11/11).

Medan-DS Di Final Voli Putra/i Elvian Yakin Kawinkan Emas MEDAN (Waspada): Cabang bola voli Pekan Olahraga Provinsi Sumatera Utara (Porprovsu) 2010 dikuasai Kota Medan dan Deli Serdang. Final yang akan digelar di Gedung Serbaguna Unimed, Jumat (12/11) ini, putra-putri Medan akan menantang Deli Serdang. Putri Medan yang belum terkalahkan, Kamis (12/ 11), menang mudah atas tim Asahan 3-0 (25-13, 25-14, 2513) pada semifinal. Srikandi DS yang juga belum terkalahkan, melalui perjuangan yang cukup alot menundukkan Pematangsiantar 3-0 (26-24, 2519, 25-23) pada semifinal. Pelatih voli putri DS Elvian kepada Waspada menyatakan, yakin anak asuhnya akan mengalahkan Medan pada partai

puncak. “Bukan cuma putri, tapi juga tim putra. Kami yakin Deli Serdang akan mengawinkan emas voli Porprovsu,” ucap Elvian, didampingi asisten pelatih putri Sudarianto dan Herry Susanto. Menurut Elvian, performa Heria Riski, Nurdiana, Tri Maulani, Nadia Pratiwi, Cici Latinova, Jolanda, Nanda, Ratna,Yuli, Gita, Ayu Juliani dan Rahmi Aulia, terus menunjukkan peningkatan. Pelatih voli putra DS Ruzrali didamping Zulhammi Sianipar dan Sahrizal juga berkeyakinan sama. Apalagi anak asuh Ruzrali, baru kehilangan satu set saat mengalahkan Tebingtinggi 3-1 pada semifinal kemarin. Susanto, Ricky, Bambang, Hendra, Eka, Evan, Agus, Dani dan Gani, menuntaskan perla-

wanan tim Kota Lemang dengan skor 25-23, 24-26, 25-18, 25-23. Medan sebagai calon lawan pasukan Ruzrali, juga tak terkalahkan sampai final. Di semifinal, mereka kembali menunjukkan keperkasaannya dengan menundukkan Langkat 3-0 (25-22, 25-12, 25-16). Partai final voli digelar Jumat (12/11) ini mulai pukul 08.30 diawali perebutan juara 3-4 antara tim putra Asahan vs Langkat. Di kelompok putri, perebutan perunggu mem-pertemukan Asahan vs P.Siantar. Laga final putra dan putri akan digelar mulai pukul 14.00 WIB mempertemukan dua daerah bertetangga, Kota Medan kontra Kabupaten Deli Serdang. (h01/m20)

Protes Warnai Cabang Karate Anak Medan Membela Asahan MEDAN (Waspada): Kisruh status atlet bulutangkis Porprovsu 2010 merambat ke cabang lain. Arena pertandingan karate juga diwarnai aksi protes dari Forki Medan di GOR Kodam I BB Jalan Medan-Binjai, Kamis (11/11). Ketua Pengkot Forki Medan Ir Palti Simanjuntak dan Sekretaris Joan Berlin Damanik SSi MM mendatangi Ketua Panitia Zulkarnaen Purba. Mereka menanyakan karateka putri Nova Sinaga yang sebenarnya anak Medan, bertanding membawa nama Asahan. Nova asal Perguruan Inkanas, sudah terdaftar di Porkot Medan. Sebelumnya dia juga telah diajukan Forki Medan masuk tim pada Porwil menuju Porprovsu. Tapi dengan alasan umurnya belum mencukupi, panitia pertandingan tidak membolehkan Nova bertanding di Porwil. Maka, Forki Medan terkejut mengetahui atlet binaan PPLP Dispora Sumut ini bisa bertanding di Porprovsu bukan membawa nama Medan, melainkan Asahan. “Kenapa waktu di Por-

wil dia tidak bisa bertanding karena umurnya belum cukup. Padahal, Porwil adalah seleksi menuju Porprovsu, kenyataannya Nova bisa bertanding di Porprovsu atas nama tim KONI Asahan,” protes Berlin. Zulkarnaen Purba menjawab, pada technical meeting Rabu malam nama-nama karateka yang akan bertanding sudah dibacakan satu persatu, tapi tidak ada protes dari tim manajer Forki Medan. “Kenapa setelah atlet tersebut juara, baru mengajukan protes,” tanya Zulkarnaen. Forki Medan mengaku tidak akan tinggal diam, dan akan mengusut adanya indikasi terjadinya jual beli atlet di PPLP Dispora Sumut. Mereka akan melayangkan surat ke KONI Sumut dan Forki Asahan, memprotes kejadian atlet Medan bisa bertanding di kabupaten lain. Padahal KONI Sumut sudah komit untuk pembinaan atlet berdasarkan daerah masing-masing, tidak dibenarkan adanya jual beli atlet hanya untuk mendongkrak peringkat pada Porprovsu.

Sebelumnya, cabang karate dibuka secara resmi oleh Ketua Umum Pengprov Forki Sumut DR H Rahmat Shah didampingi Ketua Umum KONI Sumut H Gus Irawan Pasaribu SE Ak MM. Rahmat Shah kepada wartawan mengatakan, Porprovsu adalah PON mini yang menjadi tolok ukur penjaringan atlet untuk PON di Riau tahun 2011. Dia melihat perkembangan karate Sumut semakin pesat, setelah Porprovsu ini akan dilakukan penjaringan dari para juara. Dari penjaringan akan dilakukan seleksi lagi sampai ditetapkan tim inti untuk mengikuti Pra PON sebagai bagian dari tahapan menuju PON. Pada cabang karate ini, Medan mendulang 2 emas lewat kata beregu putra dan putri. Sergai juga meraih dua emas dari kata perorangan putra dan putri yang diraih Dwi Yuda dan Siti Asma. Tobasa lewat Dody Munthe meraih emas kumite -55 Kg, kumite -50 putri dimenangkan Srunita dari Langkat dan Kumite -55 Kg putri dijuarai Nova Sinaga dari Asahan. (h09)

DS Juara Umum Silat MEDAN (Waspada): Kontingen atlet silat Deli Serdang berhasil menambah 8 medali emas, 5 perak dan 5 perunggu pada nomor laga Pekan Olahraga Provinsi Sumatera Utara (Porprovsu) 2010 di Aula Asrama Haji Medan, Kamis (11/11). Sebelumnya, di nomor tunggal, ganda, regu (TGR) yang digelar Rabu (10/11) malam, DS telah mengumpulkan 5 emas, sehingga total raihan 13 emas, 5 perak dan 5 perunggu sekaligus tampil sebagai juara umum. Delapan emas nomor laga

Deli Serdang masing-masing dipersembahkan Rini Purba (A/pi), Dewi Ratih (C/pi), Dani Pradana (D/pa), Dinda Ayu P Sari (D/pi), Afriansyah (E/pa), Zumidar Oktina (E/pi), Ruri Dwi Febrianti (F/pi) dan Andi Zulkanen (G/pa). “Kita bersyukur akhinya mampu memenuhi target juara umum. Ini semua berkat perjuangan maksimal para atlet, dimana mereka mampu menunjukkan hasil dari latihan intensif selama ini,” ujar Jumono Tarigan, pelatih silat DS.

Problem Catur Putih melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

Tuan rumah Medan pada nomor laga kemarin hanya menyabet 1 emas, 3 perak dan 3 perunggu. Medali emas diraih Randi Andika Prana ( J/pa). Sebelumnya, Medan telah menyabet 1 emas, 2 perak dan 2 perunggu dari nomor TGR. Dengan demikian, total raihan medali tuan rumah 2 emas, 5 perak dan 5 perunggu untuk menduduki posisi kedua. Kegagalan atlet Medan pada partai final kemarin, banyak diakibatkan kelemahan fisik. Setidaknya ada dua atlet Medan


Pembina beberapa cabang olahraga itu mengatakan, kalau hal ini dilakukan berarti telah mencoreng nama baik daerah itu sendiri. Sebab, ajang Porprovsu yang merupakan kegiatan KONI Sumut, harusnya berjalan sportif dan jadi arena atlet binaan lokal dan bukannya dari luar daerah. “Memang ada peraturan KONI yang mengatakan kalau atlet dari daerah lain sudah menetap lama di tempat dia bermukim, itu dinyatakan sah mengikuti Porprovsu,” beber Brilian di Medan, Kamis (11/ 11). “Apalagi dia juga mengikuti Porwil daerah. Namun kalau atlet itu hanya didatangkan saat berlangsung iven empat tahunan ini untuk satu daerah, berarti harus diselidiki. PB Porprovu juga harus tegas menyikapi hal ini,” katanya lagi. Menurutnya, wajar KONI Medan melakukan protes atas kejadian ini. Sebab, KONI Medan yang diketua Drs H Zuhifzi Lubis telah melakukan pembinaan secara serius sejak dini dan tidak memakai atlet dari luar. “Sekali lagi saya mengatakan, KONI Medan telah melakukan pembinaan berbasis kedaerahan, sehingga harus didukung penuh,” tegas Brilian. Itu pula yang menurut dia,

terbentuk pada arena Porprovsu 2010 sebagai ajang pembinaan menuju PON XVIII Riau 2010. “Porprovsu kan ajang kompetisi untuk menghasilkan atlet handal,” jelasnya. “Jadi kalau ada atlet yang dipakai hanya untuk Porprovsu dan selanjutnya dikembalikan ke daerahnya, maka PB Porprovsu serta KONI Sumut harus secepatnya mendesak daerah yang memakainya untuk memulangkan atlet tersebut,” tambah Brilian. Ketua PB Porprovsu Drs Chairul Azmi Hutasuhut MPd secara terpisah mengaku, tuntutan KONI Medan untuk mendiskualifikasikan beberapa atlet dari luar daerah yang memperkuat Asahan dan Labusel, sudah dinyatakan gugur oleh tim tehnical delegated, karena tak kuat bukti. “Sudah kita serahkan kepada petugas mengenai hal ini dan dinyatakan gugur serta atlet dimaksud dapat bertanding memperkuat kedua kabupaten tersebut,” papar Chairul. Sedangkan manajer tim bulutangkis Asahan, Junaidi, menyangkal keras sanggahan atas keabsahan Subhan Hasan, Erwin Wihardi, M Rofik, Fajar Ari, Tunggul Mursito, Karisma serta beberapa atlet lainnya yang dinyatakan bukan atlet kelahiran

Daftar Medali Sementara (Emas, Perak, Perunggu) Deli Serdang Medan Sergai Tanah Karo Tapsel Tebingtinggi Binjai Asahan Langkat Labuhan Batu Tanjungbalai Batubara Samosir P.Sidempuan Sibolga P.Siantar

25 23 12 7 6 6 5 5 4 3 3 3 3 2 2 2

14 35 4 7 11 4 7 4 2 5 3 3 2 4 3 2

15 24 4 9 4 4 16 14 6 12 4 1 0 7 6 2

Labusel Nias Labura Simalungun Paluta Tobasa Taput Madina Diari Tapteng Phakpak Bharat Humbahas Gunung Sitoli Nias Selatan Padang Lawas

2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

1 0 2 2 0 0 3 1 0 0 0 0 0 0 0

4 0 4 2 1 0 0 2 3 2 0 0 0 0 0

Sumut. “Kita akan sanggah apa yang dituntut Medan. Sebab mereka hanya berlatih di Pulau Jawa bersama klubnya, tapi kelahiran dan putra Asahan,” ujar Junaidi. “Mereka memiliki kartu indentitas sebagai penduduk setempat. Apalagi tuntutan yang diajukan KONI Medan tersebut, dibatalkan oleh tim tehnical delegated yang ditunjuk oleh PB Porprovsu,” katanya lagi. Raja kecewa Ketua Kontingen Medan Julius Raja mengaku kecewa atas kinerja PB Porprovsu yang dinilai lamban dalam menangani kasus cabang bulutangkis ini. Pasalnya, selain status atlet yang dicurigai sudah jelas, juga sudah ada surat skorsing dari Pengprov

PBSI DKI Jakarta. Lambannya keputusan yang dibuat PB Porprovsu, menurut Raja, bisa berimbas kepada distribusi medali terhadap kontingen. “Kita ingin keputusan sudah ada sebelum partai semifinal nomor perseorangan dimainkan. Ketua Umum PB Porprovsu telah berjanji malam ini (Kamis, red) mereka akan rapat soal tersebut,” ucap Raja. Kontingen Medan, tambahnya, pantas mempertanyakan tindak lanjut kiprah pebulutangkis Jakarta tersebut, mengingat banyak atletnya yang bertemu Asahan dan Labusel di semifinal. Dalam jadwal semifinal, Jumat (12/11) ini, tunggal putri Medan Arinda jumpa Rina dari Asahan, Afni bertemu Ratih juga

dari Asahan. Di nomor tunggal putra, Lucas (Medan) melawan Subhan (Asahan) dan Herdianto versus Tunggul (Labusel). Untuk nomor ganda putri, pasangan Medan Muzelin/Afni bertemu Karisma/Ratih (Asahan), ganda putra Medan Herdianto/Teguh juga bertemu pasangan Asahan. Wakil Ketua Kontingen Medan Khairil Basri menduga, Panpel sengaja mengulur-ngulur waktu dalam mengambil keputusan, mengingat bukti sebenarnya sudah sangat kuat. “Harusnya Panpel bertindak cepat, supaya tidak ada kontingen yang dirugikan. Jika keputusan diambil setelah partai final, yang rugi adalah atlet yang bertemu mereka di semifinal,” tutur Khairil. (h09)

Waspada/Dedi Riono

Para atlet binaraga kelas 65 kg melakukan push down pada ajang Porprovsu 2010 di Gedung PPLT Medan, Kamis (11/11).

Medan Dominasi Medali ABB MEDAN (Waspada): Tuan rumah kota Medan tampil juara umum cabang angkat besi, berat dan binaraga (ABB) pada Pekan Olahraga Provinsi Sumatera Utara (Porporvsu) di Gedung Pusat Pendidikan dan Latihan Teknik (PPLT), Jl Karya Medan, Kamis (11/11). Medan yang sebelumnya baru merebut 4 medali emas, 6 perak dan 8 perunggu akhirnya tampil juara umum setelah kontingen binaraga yang bertanding di hari terakhir, berhasil menyabet 5 emas, 2 perak dan 3 perunggu. Dengan hasil itu, tuan rumah total mengoleksi 9 emas, 8 perak dan 11 perunggu. Lima medali emas kota Medan dari cabang binaraga masing-masing disumbangkan Agung (55 kg), Kiki (75 kg), Lilik Rusdianto (80 kg), M Arif (85 kg) dan Suwanto (85 kg). Kontingen Deli Serdang yang sukses

merajai cabang angkat berat, hanya mampu meraih 1 emas binaraga di kelas 65 kg dari Agus Muliadi. Dengan begitu, Deli Serdang total mengumpulkan 9 emas, 6 perak dan 4 perunggu untuk tampil di posisi kedua. Kontingen Serdang Bedagai yang menambah 1 emas dari cabang binaraga atas nama Hendra (70 kg), menduduki posisi ketiga dengan total 7 emas, 3 perak dan 1 perunggu. Disusul TebingTinggi (3-4-4), Pematangsiantar (2-2-1), Labusel (2-02), Binjai (1-2-3) dan Samosir (1-0-1). Pertandingan angkat besi, angkat berat dan binaraga Porprovsu 2010 yang digelar sejak 9 November lalu nyaris saja menciptakan rekor nasional baru angkat berat untuk jenis angkatan bench press. Sayang, aksi lifter Deli Serdang Mustakim yang hendak

Daftar Medali AAB Medan Deli Serdang Sergai T Tinggi P Siantar Labusel Tapsel Binjai Samosir L. Batu P Sidempuan Sibolga Tj.Balai Asahan

9 9 7 3 2 2 1 1 1 -

8 6 3 4 2 2 2 1 3 2 1 1 -

11 4 1 4 1 2 2 3 3 2 1 1

melakukan angkatan ketiga untuk jenis bench press dengan bobot barbel 201 kg gagal. Seandainya Mustakin sukses melakukan angkatan ketiga itu, maka dirinya memecahkan rekor nasional yang dicetak lifter Sumatera Barat, Doni Syahputra, seberat 200,5 kg. (m42)

PABBSI Tj. Balai Sumbang 2 Medali

Waspada/Dedi Riono

Pesilat kota Medan Huzaifah Sadli (kiri) gagal mempersembahkan medali emas nomor H putra setelah ditaklukkan Ario Wulan (Tebing Tinggi) 5-0 pada ajang Porprovsu 2010 di Aula Asrama Haji Medan, Kamis (11/11). yang harus menyerah dari lawan-lawannya saat pertandingan babak pertama baru dimulai. Mereka adalah M Endrik (E/pa) dan Indri Sari (E/pi). Bahkan, Endrik harus diboyong mobil ambulans menuju rumah sakit untuk mendapat perawatan intensif, setelah sempat pingsan saat berhadapan dengan atlet PPI Koni Sumut Afriansyah (Deli Serdang). Wasit menyatakan Afriansyah menang, karena tidak melakukan kesalahan pada duel itu. Binjai menduduki urutan


ketiga dengan 2 emas, 2 perak dan 5 perunggu. Diikuti Sibolga (1-1-3), Tapsel (1-2-0), Samosir (1-1-1), Asahan (1-0-1) dan T.Tinggi dengan 1 emas. (m42)

8 Besar Medali Silat Deli Serdang Medan Binjai Sibolga Tapsel Samosir Asahan T. Tinggi


13 2 2 1 1 1 1 1

5 5 2 1 2 1 0 0

5 5 5 3 0 1 1 0

1. Pilih/tulis tanpa spasi: Kafir Jahat, Kafir Juhud atau Kafir Nifaq adalah orang kafir yang hatinya mengakui adanya Tuhan, tapi lidahnya tidak mau menyatakan dan tidak mau mengamalkannya. 7. Terjemahan jihad bil-qalam adalah berjuang dengan _____. 8. Pilih/tulis tanpa spasi: Kafir Jahat, Kafir Juhud atau Kafir Nifaq adalah orang munafik yang lidahnya mengucapkan iman tapi hatinya mengingkari Tuhan. 9. Al-______ surat ke-25 Al Quran, artinya pembeda (Al Quran menjadi pembeda antara yang hak dan yang batil). 10. Undang-undang; Hukum; Kaidah. 11. Lembah tempat menyembelih qurban pada upacara haji. 12. Gelar haji perempuan. 15. Penganut paham golongan nasionalis ekstrim yang menganjurkan pemerintah otoriter. 16. Para malaikat penjaga siang dan malam berkumpul pada saat shalat: (Pilih/tulis tanpa spasi: Subuh dan Ashar; Subuh dan Zuhur atau Zuhur dan Ashar). 19. Kikir, pelit. 21. Majelis Ulama Indonesia. 22. Aku datang kepadaMu (ucapan dalam ibadah haji). 23. Sahabat Rasulullah, pengganti Abu Bakar, awalnya musuh

MEDAN (Waspada) : Pengcab PABBSI Tanjungbalai menyumbangkan 2 medali Porprovsu 2010 di Aula Balai Latihan Pendidikan dan tekhnik (BLPT ), Jln Karya Medan, Kamis (11/11). Binaragawan Adrianto yang bertarung di kelas 80 gram, berhasil mendulang perak. Sebelumnnya lifter putri menyumbangkan perunggu atas nama Jumiati di kelas 75 kg plus. Perjuangan atlet binaan Ketua PABBSI Tanjungbalai Ir H Abdul Azis MM itu patut mendapat acuangan jempol. Apalagi Adrianto selaku putra asli Tanjungbalai hampir saja menyumbangkan emas, tapi dewi fortuna ternyata belum berpihak. Usai memastikan perak, spontan Abdul Azis didampingi manager tim Mahdin Siregar SH dan ofisial Yusmada SH, saling berangkulan dengan Adrianto. “Alhamdulillah, kami

ganas Islam tapi berbalik menjadi muslim dan pendukung gigih Islam (tulis tanpa bin). 24. Kaum semasa nabi Lud.


2. Surat ke-108 Al Quran dan nama telaga. 3. Memberikan harta untuk kebajikan. 4. Tetangga, mesti berbaikan. 5. Arti dari jamrah al-’aqabah atau syaitanul-kabir (dua kata ditulis tanpa spasi). 6. Terjemahan jihad ‘alan-nafsi adalah berjuang melawan ______ (dua kata ditulis tanpa spasi). 10. Utuh, integral. Memahami Islam secara ______ = memahami Islam secara utuh, integral. 11. Timbangan amal perbuatan. 13. Al-______ artinya Hari Jumat, surat ke-62 Al Quran, ayat ke9 menyerukan orang-orang beriman melakukan shalat Jumat. 14. Bacaannya alhamdulillah. 17. Masyarakat/golongan penganut agama. 18. Usaha sungguh-sungguh membela agama Islam dengan mengorbankan harta, jiwa dan raga. 20. Menurut hadis, setiap penyakit ada _____nya. 21. Bahaya.


Ketua Pengcab PABBSI Tanjungbalai Ir H Abdul Azis MM, mengalungkan medali perak kepada Adrianto di Aula BPLT, Kamis (11/11). berhasil mencapai target,” jelas Abdul Azis. Menurutnya, atlet binaan PABBSI Tanjungbalai telah berusaha semaksimal mungkin untuk memperoleh medali, tapi sejauh ini hanya bisa memperoleh 2 keping saja. Mahdin Siregar didampingi

Yusmada berjanji, kontingen Tanjungbalai khususnya Pengcab PABBS pada Porprovsu mendatang akan berusaha memperoleh medali lebih banyak lagi. “Kami akan berjuang maksimal dan memberikan yang terbaik nantinya,” tekad Mahdin. (h01)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu 15 menit. Jawabannya lihat di halaman A2 kolom 1.



5 6 1 2 9

2 8 6



9 5




3 8




1 5 1

8 9 1 1 7 7

2 h204




Penyerang AC Milan Zlatan Ibrahimovic mencetak gol melalui tendangan penalti ke gawang Palermo di Stadion San Siro, Milan, Italia, Kamis (11/11) dinihari WIB.

WASPADA Jumat 12 November 2010

Hasil Rabu (Kamis WIB)

Hasil Rabu (Kamis WIB)

AC Milan vs Palermo Brescia vs Juventus Cagliari vs Napoli Catania vs Udinese Cesena vs SS Lazio Chievo Verona vs Bari Genoa vs Bologna Lecce vs Inter Milan AS Roma vs Fiorentina

Aston Villa vs Blackpool Chelsea vs Fulham Everton vs Bolton Man City vs Man United Newcastle vs Blackburn West Ham vs West Brom Wigan vs Liverpool Wolves vs Arsenal

3-1 1-1 0-1 1-0 1-0 0-0 1-0 1-1 3-2

3-2 1-0 1-1 0-0 1-2 2-2 1-1 0-2

Klasemen Liga Seri A

Klasemen Liga Premier

AC Milan Lazio Napoli Inter Milan Juventus AS Roma Sampdoria Chievo Palermo Catania Genoa Udinese Fiorentina Lecce Cagliari Brescia Bologna Cesena Bari Parma

Chelsea Man United Arsenal Man City Newcastle Bolton Tottenham Sunderland Liverpool Aston Villa West Brom Everton Blackburn Blackpool Fulham Stoke Birmingham Wigan Wolves West Ham

11 11 11 11 11 11 10 11 11 11 11 11 11 11 11 11 11 11 11 10

7 7 6 5 5 5 3 4 4 3 4 4 3 3 2 3 2 3 2 1

2 1 3 5 4 3 6 3 2 5 2 2 3 3 5 2 5 2 3 5

2 3 2 1 2 3 1 4 5 3 5 5 5 5 4 6 4 6 6 4

20-11 23 13- 9 22 18-11 21 13- 6 20 22-12 19 14-14 18 11- 8 15 11-10 15 17-16 14 9- 8 14 9-11 14 9-12 14 12-13 12 8-18 12 11-10 11 10-14 11 10-15 11 8-14 11 9-18 9 6-10 8

12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12 12

912 660 723 633 525 372 444 372 444 444 444 363 435 426 273 417 264 255 237 156

28- 5 28 24-13 24 24-11 23 15-10 21 21-16 17 18-17 16 14-15 16 12-13 16 13-15 16 13-16 16 16-21 16 13-11 15 13-14 15 19-26 14 13-13 13 13-18 13 14-17 12 9-21 11 11-20 9 11-22 8


Bintang kemenangan Arsenal Marouane Chamakh (kiri) selebrasi gol dengan rekan-rekannya di Molineux Stadium, Wolverhampton, Inggris, Kamis (11/11) dinihari WIB.

Duo Milano Berbeda Dua London Beruntung ROMA (Waspada): Dua tim sekota, AC Milan dan Inter Milan, meraih angka berbeda dalam merespon kekalahan pemimpin klasemen Liga Seri A, SS Lazio. Milan mengatasi Palermo 3-1 di San Siro, Rabu (Kamis WIB), sehingga naik ke puncak klasemen. Inter ditahan tuan rumah US Lecce 1-1, akibatnya turun setingkat ke peringkat empat digeser Napoli yang saat bersamaan menekuk Cagliari 1-0. Alexandre Pato membuka gol I Rossoneri menit 19, sebelum Armin Bacinovic menyamakan kedudukan untuk tim Sisilia itu. Namun tendangan penalti Zlatan Ibrahimovic dan gol akhir permainan dari Robinho, memastikan tiga angka I Rossoneri. Momen paling mendebarkan terjadi menit 77, ketika Massimo Ambrosini dijatuhkan lawan di dalam kotak penalti. Alenatorre Milan Massimiliano

Allegri mengakui, timnya beruntung mendapat hadiah 12 pas dari wasit atas insiden tersebut. “Ketika melihat tayangan ulang di televisi, kelihatan Ambrosini seperti menjatuhkan sendiri dirinya.Wasit kali ini lebih bagus, tapi pada lain lain kami selalu harus menghadapi tendangan penalti lebih banyak,” ujar Allegri. Di Lecce, juara bertahan Inter Milan bermain imbang buat kali kelima dalam 11 laga. Striker Argentina Diego Milito sempat membawa I Nerazzurri memimpin dengan mencetak golnya yang ketiga musim ini menit 76. Namun penyerang Uruguay Ruben Oliver, yang baru tampil lagi setelah selama ini

dihukum, menyamakan kedudukan tiga menit kemudian. Pada laga lainnya, Lazio kalah menyakitkan ketika menyambangi markas tim promosi Cesena. Marco Parolo yang mencetak gol tunggal kemenangan 1-0 tim tuan rumah, lima menit menjelang pertandingan usai. Hasil itu melanjutkan penurunan grafik I Biancoceleste binaan Edoardo Reja, yang akhir pekan lalu juga kalah 0-2 dalam derbi melawan AS Roma. Di Cagliari, Napoli yang mengakhiri duel dengan membawa dua pemain cedera, menang 1-0 berkat gol penyerang Argentina Ezequiel Lavezzi pada injury time. Tambahan tiga poin membawa Napoli ke peringkat tiga dengan menggeser posisi Internazionale. “Kami bermain bagus pada akhir laga. Bila kami dapat mempertahankan bentuk permainan

ini, maka kami bisa mendapat hasil penting pada pertandingan lain,” ucap Lavezzi. Juventus melorot ke urutan lima setelah bermain imbang 1-1 di Brescia. Alessandro Diamanti menyamakan kedudukan, setelah sebelumnya Fabio Quagliarella membuka angka untuk tim tamu. Tim urutan keenam Roma melanjutkan proses kebangkitannya dengan menggebuk Fiorentina 3-1, sehingga hanya terpaut lima poin dari puncak menyusul kemenangan ketiganya berurutan. Pemain Brazil Simplicio membuka angka Il Lupo di Stadion Olimpico dan Marco Borriello menggandakannya. Alberto Gilardino sempat mempertipis kekalahan LaViola, tapi Simone Perrotta menambah angka lagi buat Roma. (h01/ant/afp/ap)

LONDON (Waspada): Manchester Derby yang berakhir 0-0 antara City kontra United, Rabu (Kamis WIB), mendatangkan untung bagi dua klub raksasa London, Chelsea dan Arsenal. Chelsea memperpanjang sekaligus menambah keunggulannya di puncak klasemen Liga Premier dengan kemenangan 1-0 atas sesama tim London, Fulham. Gol Michael Essien menit 30, yang memastikan tiga poin The London Blues di Stamford Bridge. Arsenal memangkas jarak ketertinggalannya dari Setan Merah MU menjadi satu angka saja. The London Reds menaklukkan Wolverhampton Wanderers 2-0 lewat gol yang diborong Marouane Chamakh di Molineux Stadium. Hasil itu merupakan titik balik dari bencana dua raksasa London tersebut, yang akhir

MU Sindir City MANCHESTER (Waspada): Kiper Manchester United (MU) Edwin van der Sar menyindir Manchester City, setelah kedua klub itu bermain 0-0 dalam derbi Liga Premier. Van der Sar menuding, The City hanya mencari hasil imbang di markasnya sendiri, The City of Manchester Stadium. “City tidak berani menyerang dan hanya memilih bertahan. Mereka jelas bertujuan mencari satu poin,” sindir Van der Sar, seperti dilansir TribalFootball, Kamis (11/11). Hasil tanpa gol itu, menu-

rutnya, memang target James Milner dan kawan-kawan yang sebenarnya diuntungkan dengan status sebagai tuan rumah. “Kami sangat ingin menang, tapi mereka lebih defensif,” ujar Van der Sar. “Saya tidak banyak melakukan penyelamatan, hanya sekali saat tendangan bebas. Jika duel berlangsung lebih lama, mungkin kami mendapat lebih dari sekedar satu poin,” katanya lagi. Manajer City Roberto Mancini seperti membenarkan sindiran kiper veteran Belanda ter-

Tiga Alasan Messi Main Barca, Madrid Menang Telak MADRID (Waspada): Dua tim teratas La Liga Primera, Barcelona dan Real Madrid, sama-sama menang telak 5-1 pada leg kedua babak 32 besar Copa Del Rey, Rabu (Kamis WIB). El Barca pun memastikan satu tiket ke babak 16 besar setelah menggilas Cueta 5-1, sehingga lolos dengan gol agregat 7-1 pasca menang 2-0 pada leg pertama. Gol-gol El Catalan disumbangkan Nolito menit ketiga, Gabriel Milito menit ketujuh, Pedro Rodríguez (’50), Bojan Krckic (’64), dan Lionel Messi (’68). Pelatih Pep Guardiola mengaku, awalnya ingin menyimpan Messi karena sangat optimis timnya akan menang mudah meski tanpa harus menurunkan koleksi bintangnya. Namun dia kemudian memainkan ‘penyihir dari Argentina’ itu dengan tiga alasan. “Messi bermain untuk tiga alasan. Pertama, dia tidak latihan,” ujar Guardiola dalam AS, Kamis (11/11). “Kedua, Messi ingin bermain dan yang ketiga karena orang datang untuk melihat kami, termasuk Messi. Saya ingin fans juga menikmati pertandingan ini,” katanya lagi. Rival abadi Barca, Real Madrid, juga menang besar 5-1 atas Real Murcia. Kedua raksasa Spanyol itu gabung bersama Cordoba, Espanyol, Real Betis, Levante, Sevilla, Villarreal, Atletico Madrid, Deportivo La Coruna dan Almeria. (h01/vvn/as)


Lionel Messi (kiri) menaklukkan kiper Ceuta Fredson Tavares.

Hasil Rabu (Kamis WIB) Sevilla vs Real Union Irun *Sevilla lolos agregat Villarreal vs Poli Ejido *Villarreal lolos agregat Atl Madrid vs Las Palmas *Atletico lolos agregat Levante vs CD Xerez *Levante lolos gol tandang Deportivo vs Osasuna *Deportivo lolos agregat Almeria vs Real Sociedad *Almeria lolos agregat Real Madrid vs Murcia *Madrid lolos agregat Zaragoza vs Real Betis *Betis lolos gol tandang Barcelona vs Ceuta *Barcelona lolos agregat Ath Bilbao vs Alcorcon *Bilbao lolos agregat

6-1 10-1 2-0 3-1 1-1 6-1 1-2 4-4 2-1 3-2 2-1 5-3 5-1 5-1 1-2 2-2 5-1 7-1 2-0 3-0

Hasil Selasa (Rabu WIB) R Santander vs Cordoba *Cordoba lolos gol tandang Espanyol vs Valladolid *Espanyol lolos agregat

3-1 3-3 1-1 3-1

sebut. Sebab, Mancini mengaku puas bahkan merasa penampilan pasukannya sudah jauh lebih baik. “Tentu saja saya lebih suka mendapat satu poin ketimbang tak mendapat poin, kami cukup puas. Yang jelas, permainan kami makin membaik karena kami tidak kebobolan sampai menit terakhir,” papar Mancini dalam Soccernet. Dia juga mengakui, Citizens tidak memiliki banyak peluang untuk menyerang Patrice Evra cs. Satu-satunya peluang terbaik adalah tendangan bebas Carlos Tevez, yang berhasil ditepis Van der Sar. “Carlos merupakan pemain yang sangat penting bagi kami. Dia mampu bermain baik meskipun harus menghadapi benteng pertahanan lawan yang kuat,” dalih Mancini. (h01/tf/soc)

pekan lalu sama-sama menjadi pecundang. The Blues dijinakkan Liverpool 0-2 di Anfield, Young Guns dipermalukan Newcastle United di Emirates Stadium. Namun keuntungan Chelsea atas sukses menekuk Fulham, sedikit terguncang oleh kartu merah sang pencetak gol Essien pada injury time. Essien berarti akan absen menjamu Sunderland pada Minggu (14/ 11). Begitu pula Arsenal, yang terusik ulah kaptennya, Cesc Fabregas. Gelandang Spanyol itu melepaskan tendangan brutal terhadap Stephen Ward, sehingga bek Wolves tersebut mengalami cedera pergelangan kaki kiri.

Gunners unggul lebih dulu lewat salah satu gol tercepat musim ini. Chamakh menyarangkan gol ketujuhnya di liga dalam waktu kurang dari semenit dan menambahkan gol keduanya pada injury time. Tapi pahlawan Gunners sebenarnya adalah kiper Lukasz Fabianski, yang melakukan serangkaian penyelamatan gemilang untuk mengamankan kemenangan timnya. “Dia sangat, sangat bagus malam ini,” puji arsitek Arsenal Arsene Wenger. Di Eastlands, derbi Manchester mempertontonkan City dan United yang saling menahan, akibatnya duel nyaris tanpa peluang mencetak gol. Manajer MU Sir Alex Ferguson pun kecewa, karena timnya menemui jalan buntu. “Kami perlu perubahan, kami perlu memenangi pertandingan. Kami hanya punya dua peluang dari permainan ter-

buka, sehingga itu agak mengecewakan bagi kami,” sesal Ferguson. “Ini hasil yang pantas, tapi kami tidak menghitung hasil imbang sebagai target. Target kami adalah memenangi laga dan kami punya cukup keleluasaan untuk melakukannya,” ujarnya lagi, seperti dikutip dari AFP, Kamis (11/11). Di DW Stadium, Liverpool ditahan imbang 1-1 oleh tuan rumahWigan Athletic. The Reds tampak seperti akan meraih kemenangan keempat berturutturut di liga, setelah Fernando Torres menit ketujuh mencetak gol keempatnya dalam empat laga terakhir. Namun Wigan bangkit dan mencetak gol penyeimbang pada awal babak kedua ketika Hugo Rodallega menyarangkan tendangan rendah dari jarak 9 meter ke gawang kiper Pepe Reina. (h01/ant/afp/rtr)

PSG Lolos Semifinal

James Milner (kanan) kurang berani menyerang Patrice Evra cs. -AP-

PARIS ( Waspada): Paris Saint Germain yang belum terkalahkan dalam lima laga terakhir, Rabu (Kamis WIB), lolos ke semifinal Piala Liga Prancis setelah menang 3-1 atas Valenciennes. Gol Zoumana Camara, Christophe Jallet dan Pegguy Luyindula (foto), membalikkan keunggulan lawan lewat gol Mathieu Dossevi. “Saya lihat tim ini memiliki ambisi dan ingin melejit dalam semua kompetisi. Tentu saja ada risiko yang harus dihadapi,” kata Antoine Kombouare, mantan pemain yang kini menukangi PSG yang memenangi gelar Ligue 1 tahun 1994. Lurindula dkk mendominasi permainan, namun lebih


Hasil Rabu (Kamis WIB)

dahulu kecolongan gol tim tuan rumah. “Ada semangat dan moral yang kuat dalam tim dan itu terefleksi di lapangan,” jelas Jallet. “Ini piala yang ingin kami dapatkan dan malam ini kami memenangi pertandingan yang

Marseille vs AS Monaco Valenciennes vs Paris SG Montpellier vs Lille

2-1 1-3 2-1

Hasil Selasa (Rabu WIB) Auxerre vs Saint-Etienne


amat sulit. Kami dalam posisi baik saat ini dan semoga ini dapat berlanjut,” katanya lagi. (h01/uefa)

Sport Merah Putih Mulai Berkibar



Jumat 12 November 2010

GUANGZHOU (Waspada): Bendera Merah Putih berkibar dalam upacara di Perkampungan Atlet Asian Games 2010 di Guangzhou, China, Kamis (11/11) pukul 14.15 waktu setempat (13.15 WIB).


Beberapa wanita cantik China yang nantinya bertugas sebagai pembawa medali Asian Games XVI, diperkenalkan pada acara persiapan di lapangan tenis Guangzhou, Kamis (11/11).

Santia, Oka Pakai Visa Turis JAKARTA (Antara): Dua atlet nasional Santia Tri Kusuma (balap sepeda) dan Oka Sulaksana (layar), bisa juga bertolak ke Gaungzhou dengan memakai visa turis yang dikeluarkan Kedutaan China di Jakarta, Kamis (11/11). “Sebelumnya visa untuk 30 atlet belum rampung. Namun setelah didata ulang dan ditanyakan ke kedutaan China, akhirnya bisa turun Kamis (11/ 11) sore,” ujar Ketua Sport and Development KOI, Djoko Pramono. Djoko mengatakan, dengan dikeluarkannya visa masuk ke China untuk 30 atlet nasional tersebut, maka Santia dan Oka bisa berangkat lebih dulu ke Guangzhou karena jadwal lomba balap sepeda yang akan diikuti Santia diajukan dari 15 menjadi 13 November 2010. Santia menurut Djoko memerlukan persiapan baik karena

kondisi cuaca dan suhu cukup dingin di Guangzhou karena harus berhadapan dengan atletatlet terbaik dari Asia. Atlet dari cabang lainnya seperti sepak takraw, dayung, karate dan taekwondo, menurut rencana bertolak Jumat (12/11) ini atau disesuaikan dengan jadwal pertandingan mereka. Djoko menambahkan, para atlet yang berangkat belakangan sebagian besar merupakan atlet andalan Indonesia seperti Oka (layar) Faisal (karate) dan Santia (balap sepeda) dan bila ketiganya terlambat tiba di Guangzhou dipastikan akan mengganggu persiapan mereka. Pada kesempatan lain Ketua Umum PB ISSI Phanny Tanjung mengatakan, terlambat berangkat karena faktor visa bukanlah kesalahan atlet dan pengurus KONI-KOI yang harus bertanggung jawab. Namun ia menyatakan ber-

syukur visa milik Santia sudah rampung dan bisa tampil dalam lomba sesuai jadwal. Santia akan tampil di nomor trek 500m pada 13 November 2010. “Saya berharap kasus keterlambatan visa masuk China yang dialami Santia tidak mengganggu mental tandingnya dan semoga ia mampu menyuguhkan prestasi gemilang bagi kontingen Indonesia,” ucap Phanny Tanjung.

Mulai berkibarnya Merah Putih itu menandai kehadiran kontingen Indonesia secara resmi untuk mengikuti pertandingan pada pesta olahraga empat tahunan tersebut, yang diikuti 45 negara Asia. Upacara pengibaran bendera Merah Putih dilakukan bersamaan dengan pengibaran bendera India dan Lebanon, diikuti sekitar 50 atlet perwakilan kontingen Indonesia. Acara juga dihadiri Ketua Umum KONI-KOI Pusat Rita Subowo dan wakil komandan satuan tugas Asian Games Aslizar Tanjung. Dalam upacara yang berlangsung singkat dan sederhana itu, kontingen Indonesia mengenakan pakaian training merah putih dan topi merah. Saat upacara berlangsung matahari bersinar terang sehingga membuat cuaca sangat panas menyengat. Namun para atlet dan ofisial Indonesia tidak beringsut sedikit pun dan terus mengikuti upacara itu dengan khidmat. Seusai upacara, Rita Subowo menginformasikan bahwa tuan rumah China membangun komplek Perkampungan Atlet tersebut dengan dana sekitar Rp16 triliun dan terdiri atas 50 blok. Masing-masing bertingkat 13, berdiri kokoh dan tertata rapi. “Saya kebetulan mengikuti persiapan Asian Games ini dan beberapa kali diundang Komite Olimpiade Asia untuk meninjau ke sini. Sekarang komplek apartemen ini semuanya sudah terjual dengan nilai Rp32 triliun atau dua kali lipat,” tutur Rita. Menurutnya, kondisi itu menunjukkan bahwa olahraga telah menjadi industri. Dia pun mengaku terkesan dengan tuan rumah China yang telah mempersiapkan pesta olahraga empat tahunan ini dengan sangat

baik. Penjagaan ketat Satu hari menjelang upacara Pembukaan Asian Games 2010 yang digelar Jumat (12/ 11) ini, penjagaan ketat diberlakukan di perkampungan atlet dan pusat media. Para tamu diperiksa secara saksama, termasuk seluruh barang bawaan mereka. Panitia mengerahkan polisi dan sukarelawan untuk melaksanakan penjagaan di berbagai sudut kota, perkampungan atlet, perkampungan media dan teknisi, serta di tempat-tempat pertandingan. Jalan-jalan di seputar perkampungan atlet ditutup dan hanya boleh dilalui bus dan mobil yang melayani panitia, ofisial, dan atlet. Kamis siang juga dilakukan pertemuan anggota Komite Olimpiade Asia di Guangzhou. Rita yang ikut hadir menyatakan, OCA mendorong lebih banyak lagi pembina-pembina olahraga dari Asia untuk menjadi anggota IOC. Hal ini disebabkan jumlah anggota IOC dari Asia masih kalah banyak dibandingkan dari Eropa. Padahal dari segi jumlah penduduk dan wilayah, Asia jauh lebih luas dan penduduknya juga lebih banyak. “Karena itulah OCA mendorong generasi muda Asia untuk aktif menjadi ketua cabangcabang olahraga, federasi cabang olahraga di Asia maupun di dunia,” jelasnya. “Ketua Federasi Olahraga Dunia akan otomatis menjadi anggota IOC. Jumlah anggota IOC dari Asia saat ini hanya 20 orang sementara dari Eropa terdapat 53 orang. Banyak hal yang dapat dilakukan di IOC terutama untuk memajukan prestasi olahraga negara-negara Asia,” tambah Rita. (yuslan/ant)

Emas Catur Untuk Simalungun, Batubara

Lin Dan Fokus Beregu

MEDAN (Waspada): Pecatur Simalungun MN Binsar Marbun dan Yola Yolanda asal Batubara (putri) memperoleh medali emas catur Porprovsu 2010 yang berakhir di Mess Naniko Jl Kutilang Sei Sikambing Medan, Kamis (11/11). MP Binsar Siahaan, selalu memimpin sampai babak delapan dan diprediksikan bakalan memperoleh emas, ternyata harus puas menempati posisi ketiga (perunggu). Di babak sembilan (terakhir), Binsar Siahaan kalah dari MN Pondang Damanik (Asahan) untuk mengantongi nilai 7 Match Point (MP), sedangkan

GUANGZHOU (Antara/ AFP): Superstar bulutangkis China Lin Dan menegaskan, fokusnya dalam Asian Games adalah pada iven beregu dan bukan perburuan pribadinya untuk meraih medali emas tunggal putra. “Kompetisi beregu adalah prioritas saya,” ungkap Lin, yang dianggap sebagai pebulutangkis terbaik sepanjang masa dan salah satu nama terbesar di Guangzhou 2010. Peraih medali emas Olimpiade dan tiga kali juara dunia itu, gagal meraih gelar juara Asian Games empat tahun lalu di Doha. Tapi pria berusia 27 tahun itu menyatakan, tetap tidak berkonsentrasi pada kejayaannya sendiri. “Tentu saja setiap pemain ingin maju dari baik menjadi lebih baik lagi tetapi seharusnya tidak terobsesi oleh itu,” katanya kepada kantor berita Xinhua, Kamis (11/11). “Sebagian besar pemain top dunia ada di Asian games, sehingga dalam satu pertandingan di sini, satu kesalahan kecil saja bisa membuat Anda kehilangan kemenangan,”

MN Pondang Damanik meraih perak (7 MP). Namun Pondang unggul dalam pengumpulan nilai solkof 50 dan Binsar 47,5. Sebaliknya, Binsar Marbun meraih emas dengan nilai 7,5 MP, sedangkan pecatur muda andalan Sumut, MN Pitra Andika (Medan), hanya menempati posisi kelima (5,5 MP) atau sama dengan MN Bakhori Nasution (P Sidimpuan), Cipta Sembiring (Karo), Sinton Tarigan (Karo) dan Masa Sitepu. MP Marihot Simanjuntak (Medan) menempati posisi keempat (6 MP). Acara penutupan dan penyerahan medali dihadiri oleh

Ketua Umum dan Sekretaris Umum Pengprov Percasi Sumut Parlindungan Purba SH MM dan Perry Iskandar, Ketua Umum KONI Sumut H Gus Irawan SE Ak MM, Ketua Umum FORKI SU H. Rahmat Shah serta Kajati Sumut Sution Usman Adji SH selaku Ketua Dewan Pembina Pengprov Percasi Sumut. Di bagian putri, Yola Yolanda (Batubara) memperoleh medali emas dengan perolehan nilai 6,5 MP. Perak dan perunggu direbut Maria Herlina Siahaan (Medan/6 MP) dan Charlely Tessi (Karo/5,5 MP). (m20)

Batubara Bidik 10 Besar Porprovsu BATUBARA (Waspada) Kontingen Kabupaten Batubara membidik 10 besar pada Pekan Olahraga Provinsi Sumatera Utara (Pordasu) 2010, mengingat para atletnya masih mencari pengalaman. “Kami menargetkan masuk 10 besar. Insya Allah bisa tercapai berkat perjuangan atlet Batubara nanti,” harap

Ketua KONI Batubara Hadi Suriono yang dihubungi via ponsel di Medan, Kamis (11/11). Hingga Kamis, Hadi menambahkan atlet Batubara sudah mengumpulkan 3 medali emas, 2 perak dan berharap bisa bertambah. Emas ketiga didapat hasil perjuangan pecatur putri Yolanda. Sebelumnya dua emas disabet Soni Gunawan

(lompat jauh dan loncat tinggi), sedangkan dua perak diperoleh dari cabang pencak silat. Hadi masih berharap pada cabor tinju dan karate sebagai upaya mencapai target 10 besar. Di Porprovsu 2010 ini, Batubara hanya mengikuti enam cabor, yaitu pencak silat, atletik, tinju, angkat berat, catur dan karate. (a30)

60 Karateka Kala Hitam UKT MEDAN (Waspada): 60 Karateka dari berbagai tingkatan sabuk mengikuti Ujian Kenaikan Tingkat (UKT) baru-baru ini di Dojo Pusat Perguruan Karate Kala Hitam, Museum TNI AD Jl H Zainul Arifin No.8 Medan. Meski harus melewati ujian berat, Chyntia, Dennis Chandra dan William Tanri dari dojo Perguruan Methodist 2 Medan, serta Yudi Trankaly, Wim Pranata, Heru Agus Pratama dari dojo Bank Indonesia, berhasil menyandang sabuk hitam. Keenamnya diuji dalam kemampuan beladiri jarak dekat, menengah dan jauh. Kemudian diharuskan melakukan pertarungan bebas (jiju kumite). Kancho Winta Karna, penyandang DAN-III karate aliran Kyokushinkai dan murid langsung Masutatsu Oyama, Kamis (11/11) di Medan menyata-

kan, karateka sabuk hitam memang dituntut menguasai semua cara bela diri. “Jarak dekat misalnya, bagaimana mengatasi lawan yang sudah merangkul dan menangkap,” kata Winta Karna. Dalam pertarungan bebas diuji akal, bagaimana mengambil keputusan untuk melancarkan tendangan dan pukulan. Kancho (guru besar) Winta Karna juga menguji gerakan dasar seperti pukulan, tangkisan dan elakan. Ujian lainnya adalah memukul benda keras, peserta dibebaskan menghancurkan sasaran genteng semen, riol beton dan batu bata dengan menggunakan bagian tubuh apa saja. Kancho Winta Karna pun meminta murid Perguruan Kala Hitam ‘mempercantik diri’ dengan ilmu pengetahuan.


Angeline memecah 5 buah genteng semen dengan pukulan tangan (shuto) dalam UKT PB Kala Hitam. Selain itu, berhasil lulus ujian naik ke sabuk coklat (kyu 2) delapan orang antara lain Hikmah Agung, Christopher, Christine Lina, Steven Ongko, Yoelizar Citra dan Bestario. Sedangkan yang lulus Kyu 4 (Sabuk Hijau) antara lain Angeline, Venny,

Lindawaty, Calvin. Kancho Winta Karna mengungkapkan, di dojo pusat dalam waktu dekat juga akan diadakan seleksi sebagai persiapan Kejurnas Kala Hitam memperebutkan Piala Pangdam I/ BB Januari 2011. (h09)

tambah Lin Dan. Bulu tangkis Asian Games mempertandingkan nomor beregu dan perorangan, dengan China yang kuat tampaknya akan menyapu bersih. “Itulah mengapa Asian Games adalah tempat mengalahkan,” ucap pelatih kepala tim China Li Yongbo. “Jika para pemain bermain habis-habisan pada kompetisi beregu, mereka kehilangan performa untuk pertandingan perorangan,” katanya lagi. Asian Games akan dibuka Jumat (12/11) ini, sedangkan kompetisi bulutangkis dimulai pada Sabtu (13/11).

Waspada/Austin Antariksa

Skuad PSMS Medan besutan Zulkarnain Pasaribu dipastikan tidak didukung sponsor pada musim kompetisi Divisi Utama 2010/2011.

Ayam Kinantan Tanpa Sponsor Bintang PSMS Pesta Gol MEDAN (Waspada): Logo sponsor yang sejatinya terpampang di kaos tim klub saat berputarnya kompetisi dipastikan tidak akan dialami PSMS Medan. Hal itu dikarenakan Ayam Kinantan kembali tidak didukung sponsor untuk Divisi Utama Liga Indonesia 2010/ 2011 nanti. Kondisi ini mirip dengan musim lalu, bahkan bisa dibilang lebih baik karena masih terpampang logo apparel salah satu penyedia produk olahraga nasional yang menyediakan perlengkapan kostum untuk bertanding dan latihan. Musim ini, dipastikan tak satu sponsor pun hinggap di seragam pemain. Sekretaris Umum PSMS Idris SE, beralasan pihaknya telah mendapatkan sponsor namun dialihkan kepada tim Bintang PSMS yang akan berlaga di Liga Primer Indonesia (LPI) pada Januari mendatang. Menurut Idris, tim PSMS

asuhan Suharto akan digandeng sponsor yang semula untuk tim asuhan Zulkarnain Pasaribu. Sebelumnya, pengurus menyatakan ada beberapa pihak yang mau bekerjasama, namun ucapan itu tak terbukti. Di sisi lain, jersey baru yang akan dikenakan untuk kompetisi sudah tiba di Mess Kebun Bunga. Paket tersebut berisi kostum tanding, latihan, baju santai, jaket, tas, kaos kaki serta seragam pelatih bermerek salah satu produsen perlengkapan olahraga. Terlihat sebagian kostum telah diberi nama dan nomor punggung, sedangkan lainnya masih sebatas mencantumkan nama pemain. Sementara itu, Bintang PSMS kembali mencatat kemenangan pada rangkaian ujicobanya. Kali ini, PS PLN harus mengakui ketangguhan tim besutan Suharto 1-7 dalam laga ujicoba Kamis (11/11). Tujuh gol disarangkan tim

yang diproyeksikan mengikuti LPI antara lain dua dari Safari dan masing-masing satu gol dari Syafri Juanda Ginting, Bambang Nurdianto, Noci Yoseph, Heri Suwondo dan Mardiansyah. Menurut Pelatih Bintang PSMS, Suharto, peningkatan ter-lihat pada stamina anak asuhnya yang mulai konsisten. “Yang paling kita lihat meningkat stamina anak-anak. Meraka mampu tampil konsisten dalam dua babak. Setiap kehilangan bola mereka juga segera bangkit untuk mengejarnya,” ujarnya. Begitupun dirinya masih dalam tahap menentukan pemain dari seleksi selama sebulan terakhir. “Kita masih ingin mengurangi pemain. Sudah mulai ada gambaran, tapi penentuannya Sabtu (13/11) nanti pada ujicoba berikutnya,” tambah eks gelandang PSMS era 1980-an ini. (m33)

Waspada/Yuslan Kisra

Ketua Panitia Nasional LPI Prof Dr Thoho Kholik didampingi sekretaris dan Yeyen Tumena (kiri) memberikan keterangan pers di Kantor Menegpora, Jakarta, Kamis (11/11).

LPI Tolak Perubahan Panpel Sumut JAKARTA (Waspada): Sekretaris Panitia Pusat Liga Pendidikan Indonesia (LPI) Edi Prasetyo menegaskan, pihaknya tidak akan menggubris permintaan perombakan kepanitian LPI lokal Sumut. Sebab, pihaknya masih mengacu pada SK Gubsu yang telah menetapkan kepanitian lokal wilayah Sumut untuk lima tahun ke depan yang dimulai dari 2009 silam. “Kami memang menerima surat permintaan perombakan kepanitiaan lokal LPI untuk wilayah Sumut. Nomor suratnya saya lupa, tapi sudah kami terima. Hanya saja, kami tidak akan menggubris dan masih tetap mengaku panitia lama yang diangkat melalui SK Gubsu,” tegas Edi. Dia menyatakan demikian

kepada Waspada di Kantor Menegpora, Jakarta, Kamis (11/ 11), seusai memberikan keterangan pers terkait pelaksanaan LPI edisi kedua yang mulai digeber 6 November mendatang. Perubahan kepanitiaan lokal Sumut sesuai yang diinginkan pihak tertentu itu, lanjutnya, bisa saja dilakukan jika ada SK Gubsu yang baru yang secara otomatis menggugurkan SK sebelumnya. Selama tidak ada SK yang baru, imbuhnya, panitia LPI pusat tetap mengakui keabsahan panitia lokal Sumut yang lama. Ketua Panitia LPI Pusat Prof Toho Cholik Mutohir di tempat yang sama mengatakan, kejuaraan sepakbola untuk tingkat SMP, SMA dan Perguruan Tinggi se-Indonesia edisi kedua memiliki beberapa perbedaan de-

ngan edisi sebelumnya. Salah satunya adalah sistem pertandingan yang nantinya langsung mempertemukan juara-juara provinsi di tingkat nasional. “Pada edisi pertama tahun lalu, juara tingkat provinsi masih kami adu di tingkat wilayah. Untuk edisi kedua tidak lagi, jadi ada 32 tim yang nantinya akan tampil di babak final tingkat nasional untuk setiap kategori SMP,” paparnya. Yeyen Tumena, Ketua Bidang Kompetisi Panitia LPI Pusat, memaparkan bahwa pihaknya sudah melakukan koordinasi dengan Mendiknas untuk menempatkan pemain yang terpilih melanjutkan pendidikan di PPLP (Pusat Pendidikan dan Latihan Pelajar) yang tersebar di seluruh Indonesia. (yuslan)



WASPADA Jumat 12 November 2010

Podium Pertama Jadi Harga Mati ABU DHABI (Waspada): Kemenangan menjadi harga mati buat Fernando Alonso saat tampil di GP Abu Dhabi 2010, Minggu (14/11) nanti. Pasalnya, Alonso tidak mau pusing menghitung kemungkinan lain untuk memastikan gelar juara dunia. Dengan keunggulan delapan poin dari peringkat kedua Mark Webber (Red Bull), 15 dari Sebastian Vettel dan 24 angka dari driver McLaren Lewis Hamilton, Alonso sebenarnya punya beberapa opsi untuk merebut kampiun. Namun, pembalap Ferrari itu tegas menolak perhitungan selain memastikannya dengan meraih podium teratas pada balapan di Yas Marina akhir pekan ini. “Hasil di Interlagos membuat kami leluasa menentukan nasib. Dengan kemenangan

atau finish di posis kedua, maka kami tidak butuh perhitungan lain,” tulis Alonso di blog pribadinya seperti disitat Autosports, Kamis (11/11). “Pendekatan kami untuk semua balapan tidak pernah berubah. Kami tahu jika berhasil memastikan semuanya berjalan dengan sempurna, maka kami juga akan punya peluang mencapai target yang sudah dicanangkan sejak awal musim,” sambungnya. Menyikapi fakta mobil milik Red Bull lebih cepat dari Ferrari,

pembalap Spanyol itu sama sekali tidak gentar. Alonso bahkan percaya tim berlisensi Austria tersebut masih bisa dikalahkan. “Pasti bisa, meski tahu lawan utama kami sangat kuat. Mereka memiliki mobil terbaik untuk segala tipe sirkuit, tapi bukan berarti mereka tidak bisa dikalahkan,” lanjut mantan pembalap Renault itu. Dibandingkan Alonso dan Webber, nilai Sebastian Vettel dalam perebutan gelar juara dunia Formula 1 tahun ini adalah yang paling kecil. Kendati demikian, pria asal Jerman ini masih memprioritaskan dirinya sendiri. JikaVettel menang di seri pamungkas tersebut dan Webber finish di belakangnya, Alonso

cuma butuh finish keempat untuk merengkuh titel. Kepada F1Live, Vettel menegaskan membidik pole position dan selanjutnya memenangi balapan. Sementara itu, dilaporkan GP Abu Dhabi 2010 mendapat sambutan dengan antusiasme besar. Pihak penyelenggara pun mengabarkan tiket telah terjual habis. Kepala Eksekutif Motorsports Management, Richard Cregan mengungkapkan, tahun lalu juga tiket terjual habis sebelum pelaksanaan sesi latihan digelar. “Kami sangat bangga bisa menyelenggarakan balapan di sini. Seperti diketahui bahwa kami akan melihat pemenang gelar juara 2010,” ujar Cregana. (m33/auto)

Yao Ming Cedera Lagi HOUSTON, AS (Waspada): Cedera kembali dialami center Houston Rockets, Yao Ming.

Menghadapi Washington Wizards dalam lanjutan kompetisi NBA di Washinton, Kamis (11/

11), Rockets pun tumbang 91-98. Dalam laga tersebut, pebasket asal China itu bermasalah dengan otot kaki kirinya. Sejak tahun lalu, Yao Ming sesungguhnya sudah akrab dengan cedera. Pria berpostur 2,29 meter itu bahkan harus absen sepanjang musim 2009/2010 setelah kaki kirinya dihantam cedera. Sempat terancam pensiun dini, Yao ternyata masih bisa berkompetisi musim ini. Demi menjaga kondisinya, kubu Rockets membuat kebijakan khusus dengan hanya memperbolehkanYao bermain maksimal 24 menit per game dan tak akan dimainkan untuk dua laga beruntun. “Kelihatannya sesuatu di dekat pergelangan kaki. Kami akan segera melakukan scan dan pemeriksaan detil, namun sementara ini saya tak bisa bilang apapun,” sahut Yao di situs resmi timnya. Di Orlando, Utah Jazz mem-

beri tuan rumah Magic kekalahan pertamanya di kandang. Tampil di Amway Center, Jazz tidak kuasa menahan dominasi Magic di tiga kuarter pertama. Akan tetapi, Deron Williams cs mengamuk di kuarter penentu hingga akhirnya memenangkan pertandingan 104-94. Williams sendiri mencetak double-double sekaligus terpilih sebagai pemain terbaik pasca mengoleksi total 30 angka, lima rebound dan 14 assist. Paul Millsap juga tampil gemilang dengan kemasan 23 poin. Dari San Antonio, Spurs berhasil mengalahkan LA Clippers 107-95 dan mempertajam rekor kemenangannya atas lawannya itu. Berdasarkan statistik, Spurs belum pernah kalah dari Clippers sejak Maret 2006. Bintang Spurs adalah Manu Ginobili dan Richard Jefferson yang sama-sama mendulang 22 poin. Guard Spurs, Tony Parker, menambah 21 angka dan sembilan assist. (m33/ap)

Hasil Kamis (11/11)


Yao Ming (kanan) tak kuasa menghindar dari cedera kala membela Houston Rockets melawan Washington Wizards, Kamis (11/11).

Milwaukee Bucks vs Atlanta Hawks Charlotte Bobcats vs Toronto Raptors New Jersey Nets vs Cleveland Cavaliers Golden State Warriors vs New York Knicks Oklahoma City Thunder vs Philadelphia 76ers Dallas Mavericks vs Memphis Grizzlies Minnesota T’wolves vs Sacramento Kings

108-91 101-96 95-87 122-117 103-109 106-91 98-89


Empat kandidat juara F1 2010 masing-masing, Sebastian Vettel (kiri), Fernando Alonso, Lewis Hamilton dan Mark Webber pose bersama usai temu pers GP Abu Dhabi di Sirkuit Yas Marina, Kamis (11/11).

Monfils Tutup Jalan Verdasco PARIS (Waspada): Petenis Prancis Gael Monfils (foto) mengalahkan Fernando Verdasco 6-7 (4), 7-6 (2), 7-5 pada Turnamen Paris Masters, Kamis (11/ 11). Atas keberhasilannya ini, Monfils membuka jalan bagi Andy Roddick, Tomas Berdych dan David Ferrer meraih tiket ATP Tour Finals akhir bulan ini di London. Sebenarnya, Verdasco memiliki kans merebut satu tiket turnamen akhir tahun tersebut dengan catatan menembus final. Tetapi kegagalannya tersebut menjadikan petenis Spanyol ini gagal mendampingi Rafael Nadal yang sudah lebih dulu menyegel satu tempat. Dengan demikian, lengkap sudah daftar delapan pemain yang akan beradu kekuatan di London mulai 21 November mendatang. Tiga nama tersebut akan mendampingi Nadal, Roger Federer, Novak Djokovic, Andy Murray dan Robin Soderling yang sudah lebih dulu lolos. Monfils, unggulan 12, kini menapaki perempatfinal Paris Masters. Di babak delapan besar, petenis Prancis itu akan bertemu pemenang antara Murray (unggulan ketiga) dengan Marin Cilic (Kroasia). Hasil positif juga diraih Roddick yang melaju ke perempatfinal setelah menang straight set 6-3, 7-6 atas petenis Latvia Ernests Gulbis. Selanjutnya, petenis AS ini akan menghadapi unggulan keempat Robin

Soderling (Swedia) yang menuntaskan laju Stanislas Wawrinka (Swiss) 7-6, 6-3. (m33/rtr)

Pasang Iklan Telp. 4528431 HP. 081370328259 Email:


Sumatera Utara

WASPADA Jumat 12 November 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:11 12:24 12:11 12:18 12:18 12:15 12:11 12:07 12:14 12:13

‘Ashar 15:33 15:46 15:33 15:40 15:40 15:37 15:33 15:29 15:36 15:35

Magrib 18:11 18:21 18:11 18:16 18:17 18:17 18:12 18:08 18:14 18:12



Shubuh Syuruq


19:21 19:33 19:22 19:27 19:28 19:28 19:23 19:19 19:25 19:23

04:42 04:57 04:42 04:51 04:50 04:43 04:42 04:37 04:44 04:45

04:52 05:07 04:52 05:01 05:00 04:53 04:52 04:47 04:54 04:55

L.Seumawe 12:17 L. Pakam 12:10 Sei Rampah12:09 Meulaboh 12:21 P.Sidimpuan12:08 P. Siantar 12:09 Balige 12:09 R. Prapat 12:06 Sabang 12:24 Pandan 12:10

06:09 06:25 06:10 06:19 06:18 06:10 06:09 06:05 06:12 06:13

Zhuhur ‘Ashar 15:39 15:32 15:31 15:43 15:30 15:31 15:31 15:28 15:46 15:32





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:15 18:10 18:09 18:20 18:11 18:10 18:10 18:08 18:21 18:12

19:26 19:21 19:20 19:31 19:22 19:21 19:21 19:18 19:32 19:23

04:49 05:41 04:40 04:52 04:36 04:39 04:38 04:35 04:57 04:39

04:59 04:51 04:50 05:02 04:46 04:49 04:48 04:45 05:07 04:49

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:10 12:12 12:21 12:14 12:11 12:18 12:06 12:17 12:10 12:09

18:12 18:12 18:19 18:16 18:11 18:17 18:07 18:17 18:11 18:09

19:23 19:23 19:30 19:27 19:22 19:28 19:18 19:28 19:22 19:20

04:39 04:41 04:54 04:43 04:42 04:50 04:36 04:47 04:38 04:39

04:49 04:51 05:04 04:53 04:52 05:00 04:46 04:57 04:48 04:49

Panyabungan 12:07 Teluk Dalam12:14 Salak 12:12 Limapuluh 12:08 Parapat 12:10 GunungTua 12:07 Sibuhuan 12:06 Lhoksukon 12:16 D.Sanggul 12:10 Kotapinang 12:05 AekKanopan 12:07

06:17 06:08 06:07 06:20 06:04 06:07 06:06 06:02 06:25 06:06

15:32 15:34 15:43 15:36 15:33 15:40 15:28 15:39 15:32 15:31

06:06 06:09 06:22 06:11 06:10 06:17 06:04 06:14 06:06 06:07

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Kader Militan Didukung Pimpin PAN Sergai SEIRAMPAH (Waspada): Berdasarkan hasil pertemuan forum kebersamaan Dewan Pimpinan Cabang Partai Amanat Nasional (DPC PAN) Kab. Serdang Bedagai sepakat dalam Musyawarah Daerah (Musda) PAN ke III yang akan digelar akhir Desember mendatang akan mensukseskan serta ikut memilih yang sekaligus mendukung kader yang benar-benar militan untuk menjadi Ketua terpilih DPD PAN priode 2010-2015. Hal itu diungkapkan oleh Ketua Forum Kebersamaan DPC PAN Sergai Khairul Siregar, SPd, Sekretaris Nirwan Barus, SPd dan Ketua DPC PAN Bintang Bayu Toni Sitepu kepada Waspada, Senin (8/11) di Sei Rampah. “ Pernyataan ini merupakan hasil komunikasi dengan beberapa ketua DPC PAN yang tidak bisa hadir lewat telefon selular di antaranya DPC PAN Dolok Merawan, DPC PAN Sipispis, DPC PAN Tanjungberingin, DPC PAN Sei Rampah , serta anggota Forum Kebersamaan lainnya,” papar Khairul Siregar. (ces)

Kejari Seirampah Diminta Usut Dana Anggaran Pelabuhan Mini SEIRAMPAH (Waspada): Kejari Sei Rampah diminta untuk mengusut tuntas dugaan penyimpangan dana anggaran pembangunan proyek pelabuhan mini dengan nilai Rp10 miliar yang dibangundiDusunI,DesaBaganKuala,Kec.Tg.Beringin,Kab.Serdang Bedagai. Sebabbegituproyekselesaidikerjakanhampirsemuabangunan yang terbuat dari beton itu kondisinya kini sudah retak-retak, sehingga membuat keresahan bagi warga Tg.Beringin khususnya warga Desa Bagan Kuala. Wakil Ketua LSM Printis Kab.Serdang Bedagai Juhari di Sei Rampah,Selasa (9/11) menuturkan, proyek yang bernilai Rp10 miliar itu hingga kini belum jelas titik terang hasil pemeriksaannya yang dilakukan Kejari Sei Rampah, padahal waktunya sudah begitu lama. (a07)

Ngisap Ganja Ditangkap T. TINGGI (Waspada): MI,20 warga Dusun III, Desa Kutabaru, Kec. Tebingtinggi, Kab. Sergai mengaku mengisap ganja sebelum mengapeli pacarnya di malam minggu. Hal itu diakuinya supaya lancar berbicara dan merayu sang pacar. Duda anak satu ini, mengaku sering mengisap ganja ketika hendak pergi ke rumah pacar di Desa Paya Pinang, Kec. Tebing Syahbandar, Kab. Sergai. Aktifitas itu dilakukannya semenjak sekitar tiga bulan lalu, setelah berkenalan dengan pacar barunya itu. Ia sendiri sudah pisah dengan istri pertamanya karena orang tua istrinya sudah tidak lagi menyukainya. Dalam aktifitasnya itu, satu bungkus kecil ganja dicampur dengan rokok menjadi tiga batang. Ganja diperoleh tanpa membeli dari temannya bernama Dona (DPO) warga Batubara. Setiap dia butuh maka dia pergi kesana. Tersangka Dona diakuinya dikenal di pasar malam di Kota Bayu sewaktu ia bekerja di sana. Menurut keterangan di Mapolres Tebingtinggi, Senin (8/11) tersangka MI tertangkap tim Sat. Narkoba Polres Tebingtinggi yang sedang melakukan patroli di sekitaran Desa Paya Lombang dan Kota Baru, Minggu (7/11) malam sekira pukul 20:30. (a09)

Jangan Warnai Pendidikan Dengan Kekerasan BINJAI (Waspada): Komisi Perlindungan Anak Indonesia Daerah (KPAID) Kota Binjai minta pendidikan tidak melakukan kekerasan terhadap siswa. Ketua KPAD Binjai Halim Ginting mengemukakan Selasa (9/ 11) masih banyak cara mendidik terhadap siswan selain kekerasan. Apalagi tindakan sikap mendidik dengan kekerasan terhadap anak, sudah tidak pantas. Menyinggung kasus di SMP Negeri 8 Binjai bisa melahirkan citra jelek pendidik. Kasus itu sudah diselesaikan dan orang tua dan Kepsek saling maaf. Bahkan Kasek SMP Negeri 8 Binjai Subur,MPd mengaku tidak ada melakukan penganiyaan dan 11 siswa yang tercatat bermain sepakbola di halaman sekolah kini dibimbing oleh guru bimbingan konseling. Halim Ginting berharap, ke depan tidak ingin lagi mendengar terjadi penganiayaan terhadap siswa. Halim berharap pendidik harusmemberikanpendidikandenganaktifagarasiswamempunyai etika. (a03)

Jalan Di P. Brandan Diaspal P.BRANDAN (Waspada): Beberapa ruas jalan di Kecamatan Babalan, Langkat sudah selesai diaspal. Menurut pengamatan Waspada di lapangan pekerja bekerja pada malam hari . Menurut pekerja kalau malam hari kendaraan tidak lalu lalang dan tidak mengganggu pekerjaaan dan alat berat tuturnya. Jalan yang terkena aspal adalah Jalan Mesjid, Jalan Babalan dan juga Jalan Pelabuhan Kelurahan Sei.Lepan Kec.Sei.Lepan. (c02)

Jembatan Jalan Lingkar Pelawi Rampung P.BRANDAN (Waspada):Pekerjaan jembatan rangka baja Jalan Lingkar Pelawi, Pangkalanbrandan Langkat sudah selesai dikerjakan, kata Ir Situmorang kepada Waspada baru-baru ini. Dikatakan, pekerjaan pemasangan jembatan rangka baja ini sudah selesai dikerjakan dan tinggal pengaspalan. Menunggu pada pekerjaan berikutnya Bupati Langkat Ngogesa Sitepu akan mempercainya lagi pada pekerjaan tahap berikutnya setelah rapat paripurna DPRD-Langkat pada jembatan Mangga, Kecamatan Selesai yang panjangnya mencapai 80 meter dengan kontruksi rangka baja Australia seperti di Jalan lingkar SecuraiAlur Dua. (c02 )

15:29 15:36 15:34 15:30 15:32 15:29 15:28 15:38 15:32 15:27 15:29




Shubuh Syuruq

18:10 18:17 18:13 18:08 18:10 18:09 18:09 18:14 18:12 18:07 18:08

19:21 19:28 19:24 19:19 19:21 19:20 19:20 19:25 19:23 19:18 19:19

04:34 04:41 04:41 04:38 04:39 04:35 04:34 04:49 04:39 04:34 04:36

04:44 04:51 04:51 04:48 04:49 04:45 04:44 04:59 04:49 04:44 04:46

06:02 06:09 06:09 06:05 06:07 06:02 06:02 06:16 06:07 06:01 06:04

Soal GBI Antiokhia

Surat Pemko Jangan Jadi Macan Kertas, Anggota DPRD Bantah T. TINGGI (Waspada): Surat Camat Kec. T.Tinggi Kota yang memberikan waktu pengurusan selama satu tahun kepada jemaat Gereja Bethel Indonesia (GBI) Antiokhia untuk mengurus perijinan ruko sebagai tempat ibadah, hendaknya tak jadi macan kertas. Pemko Tebingtinggi, dalam hal ini Camat Kec. T.Tinggi Kota diminta tegas dalam penegakan peraturan. Pernyataan itu disampaikan Rusman alias A Tak, warga komplek perumahan Tebing Indah Permai, Kamis (11/11), sehubungandengansuratCamatT.Tinggi

Kota yang memberikan waktu selama satu tahun pada jemaat GBI Antiokhia untuk mengurus izin penggunaan ruko sebagai tempat ibadah. “Pemerintah kita ini lucu, masak kita yang benar didiskriminasi, tapi yang salah malah ditoleransi,” cetus A Tak. Dikatakan, jemaat GBI Antiokhia jelas sudah melanggar SKB 2 Menteri, melanggarPerdasoalperuntukan bangunan, tapi bisa bertahuntahun melakukan kegiatan. Sedangkan hak warga yang menolak justru terus menerus diabaikan, padahal langkah kami benar dan dilindungi peraturan, kata dia. A Tak juga menginformasikan, larangan parkir di komplek TIP sesuai surat Camat, ternyata tak diindahkan jemaat GBI. “Buktinya mereka terus saja parkir kendaraan di komplek,” ungkap

warga yang tinggal berhadapan dengan rumah ibadah itu. Camat T.Tinggi Kota Sri Imbang Jaya, menyatakan belum tahu adanya pelanggaran yang dilakukan jemaat GBI soal parkir yangdikeluhkanwargaTIP.“Nanti saya cek,” ujar dia. Bantah Membacking Sementara itu, anggota DPRD kota Tebingtinggi Pahala Sitorus yang dituding warga membacking pengumpulan tanda tangan persetujuan ruko sebagai tempat ibadah di perumahan Deli Pesona Indah (DPI), membantah tudingan warga. Dikatakan, meski tempat ibadah itu berdekatan dengan rumahnya, Pahala Sitorus, mengatakan sebelumnya tidak mengetahuiadaaktifitasperibadatan di sana. “Saat terjadi keributan itu, saya tahunya ketika istri Kepling memanggil. Jadi tak ada sangkut pautnya sama saya,”

tegas anggota Fraksi Partai Golkar DPRD itu.. Malah, Pahala Sitorus menegaskan saat terjadi rapat di rumah Kepling, persoalan tanda tangan yang dihimpun harus dibatalkan dan diulang, merupakan usulan dirinya.Dasarnya,katadia,karena pengumpulan tanda tangan tak

diawali dengan keterangan lengkap pada warga untuk apa tanda tangandibuat.“Sayayangusulkan itu, jadi saya merasa difitnah soal ini,” kilah dia. Keterangan usulan itu, dibenarkan Camat Kec. Bajenis Fery F Lubis. Camat Kec. Bajenis Fery F Lubis, mengemukakan sudah

meminta jemaat GBI komplek DPI menghentikan kegiatan mereka terlebih dulu. Alasannya, kegiatan itu melanggar Perda, karena menyalahi peruntukan. “Jika mereka mau beribadah di sana harus ada rekomendasi dari FKUB, sebelum beribadah,” tegas Camat.(a08)

Pj Walikota Tebingtinggi Harus Klarifikasi Soal Pencalonan Diri MEDAN ( Waspada): Pj. Walikota Tebingtinggi, Eddy Syofian diminta harus segera menenangkan masyarakat Tebingtinggi dengan menyampaikan perkiraan jadwal pelaksanaan Pilkada ulang. Serta klarifikasi soal isu ketertarikannya untuk ikut mencalonkan diri dalam Pilkada ulang tersebut. “Harusnya PjWalikota memberikan sinyalemen jelas kepada masyarakat. Misalnya kepastian bahwa dia tidak akan mencalonkan diri, atau perkiraan jadwal pelaksanaan Pilkada ulang,” kata anggota DPRD Sumut daerah pemilihan Sergai, Tebingtinggi, Hidayatullah,SEkepadaWaspada, Kamis(11/11)menyikapisemakin panasnya suhu politik di Tebingtinggi belakangan ini. Menurut Ketua Fraksi Partai Keadilan Sejahtera (PKS) DPRD Sumut itu, sangat wajar jika masyarakat Tebingtinggi menduga ada indikasi pelaksanaan Pilkada ulang segaja diperlambat, agar Pj. Walikota sempat mensosialisasikan diri kepada masyarakat. Karena memang, selama ini tidak ada penjelasan jelas dari Pj. Walikota terkait jadwal pelaksanaan Pilkada ulang. Hidayatullah menilai, sebenarnya sah-sah saja Pj Walikota mencalonkan diri dalam Pilkada. Namun secara etika hal tersebut dinilainya kurang pantas. Karena

akan semakin menegaskan bahwa yang bersangkutan menjadi Pj Walikota Tebingtinggi karena kepentingan pribadi. “Tugas Pj Walikota itu kan untuk menghantarkan sampai pelaksanaan Pilkada. Karena itu secara etika, saya kira kurang pantas kalau dia mencalonkan diri. Tapi secara hukum sah-sah saja, karena sudah banyak contoh penjabat kepala daerah yang ikut mencalonkandiridalamPilkada,” jelasnya. Lebih lanjut Hidayatullah mengaku heran kenapa Pilkada ulangTebingtinggi bisa diperlambat. Padahal menurutnya, akan lebih baik jika pelaksanaan keputusan Mahkamah Konstitusi(MK) itu disegerakan. Karena semakin lambat pelaksanaan Pilkadaulangmakaakansemakin banyak rumor berkembang di masyarakat. Dia juga menilai persoalan belum selesainya pembahasan RAPBD 2011 tidak bisa dijadikan alasan mengapa jadwal pelaksanaan Pilkada ulang belum bisa diungkapkan. Karena jika pembahasan RAPBD selesai tahun ini, maka sudah bisa diperkirakan Pilkada ulang akan dilaksanakan pada Januari atau Februari 2011. “Disinilah seharusnya pemimpin itu memberikan sinyal yang jelas kepada masyarakat, agar masyarakat tenang. Karena

untuk membangun itu diperlukan kebersamaan dan kekompakan masyarakat,” jelasnya. Bahwa ada perbedaan pendapat antara sesame dewan itu biasa, tapi itukan sudah ada sebelumnya. Makanya DPR juga harus ada perbedaan pendapat. Dan ini tidak akan selesai kalau konflik ini dilanjutkan. Jadi DPRnya yang harus mencari solusi. PjWalikotaTebingtinggi yang dihubungi Waspada via HP menyatakan, dirinya belum pernah membicarakan soal pencalonan dirinya untuk maju sebagai calon walikota. Soal Pilkada menurutnya adalah urusan KPU. Disebutkan Eddy Syofian, dirinya sampai saat ini menjalankan tugas sebagai Pj Walikota sebagaimana amanat dari Pemprovsu dan tidak pernah melanggar aturan dan peraturan. Ditegaskannya dirinya tidak pernah menyatakan niat untuk maju selama ini. Namun secara terpisah, anggota DPRD Sumut dapil Sergai, Tebingtinggilainnya,FadlyNurzal menilai lambatnya Pilkada ulang murni karena perbedaan pendapat di DPRD kota tersebut. “Jadi murni di legislatif, dan tidak ada hubungannya dengan walikota,” kata Ketua Fraksi Partai Persatuan Pembangunan itu. (h11/ m10)

RM Ar Rahman L. Pakam Galang Dana Merapi LUBUKPAKAM (Waspada) : Remaja Masjid Ar Rahman di Desa Bakaran Batu, Kec.Lubukpakam melakukan penggalangan dana untuk membantu korban bencana Gunung Merapi di Kabupaten Sleman, Yogyakarta. “Penggalangan dana ini rencananya berlangsung selama satu minggu, sehingga diharapkan bantuan yang dikumpulkan bisa lebih bermanfaat bagi korban di sana,” kata Nazir Masjid Ar Rahman Arisman, Minggu (7/11). Arismanmenjelaskan,penggalangandanayangmerekalakukan merupakan bentuk kepedulian terhadap korban bencana Gunung Merapi yang masih banyak memerlukan bantuan baik berupa material, makanan, pakaian dan obat-obatan. Ketua Remaja Masjid Ar Rahman Haris Fadhil menambahkan, mereka juga prihatin atas bencana Gunung Merapi yang sudah merenggut ratusan korban jiwa dan harta benda. (a05)

Zhuhur ‘Ashar

Waspada/Andi Nasution

MENJELASKAN: Redaktur Sumatera Utara Waspada M Zeini Zen dan Reporter Bidang Sekolah Dede Juliadi sedang menjelaskan proses awal berita hingga cetak di hadapan puluhan siswa dan guru MTs Negeri Stabat, Kab. Langkat di dapur redaksi Harian Waspada, Kamis (11/11).

MTsN Stabat Berkunjung Ke Waspada MEDAN(Waspada):35Siswa MTsn Stabat, Kabupaten Langkat didampingi tujuh dewan guru antara lain Febrina, Syamsiah Nasution, Evi Junita, Bahar, Amir Aspan, Sofyan dan Nurul Afrah mengunjungi Harian Waspada yang disambut hangat Redaktur Sumatera Utara M Zeini Zen dan Reporter Bidang Sekolah Dede Juliadi, Kamis (11/11). Para siswa itu terlihat antusias dan santai mendengarkan paparan M Zeini Zen di Gedung Bumi WartaWaspadamengenaisejarah singkat Harian Waspada yang didirikan H Moehammad Said dan Hj Ani Idrus sejak 11 Januari 1947. “Kemudian pada 2005 lalu Presiden RI ketika itu Megawati Soekarno Putri meresmikan Harian Waspada sebagai bentuk pengakuan pemerintah terhadap dua tokoh pers Sumatera Utara

yakni H Moehammad Said dan Hj Ani Idrus,” kata M Zeini Zen. Menurut Zen, hingga kini Waspada bisa bertahan dan tetap eksis di tengah persaingan ketat media. “Kini Waspada memiliki mesin percetakan dengan kapasitas12menitmampumenghasilkan 10 ribu eksemplar. Selain itu Waspada juga masih memiliki satu unit mesin cetak zaman penjajahan Belanda yang hanya ada tiga unit di Indonesia,” sebut Zen. Dikatakan Zen, saat ini Waspada terdiri dari beberapa halamanantaralainhalamannasional, nusantara, daerah Sumatera Utara dan Aceh, Medan Metropolitan, ekonomi dan bisnis, opini, olahraga dan pada hari tertentu memiliki edisi khusus seperti Mimbar Jumat yang sering menjadi referensi ustadz pada khutbah Jumat.

“Sabtu ada halaman kreasi dan Minggu halaman remaja, anak, wanita, cerpen, kesehatan, inovasi teknologi. Dan Sabtu juga memiliki liputan khusus histori,” papar Zen. Disamping itu, lanjut Zen, selain Waspada cetak juga memiliki Waspada epaper yang dapat diakses melalui internet dan Harian Berita Sore. SyamsiahNasution,danguru lainnya mengharapkan dengan kunjungan tersebut dapat menambah wawasan dan ilmu pengetahuan terutama Teknologi, Informasi dan Telekomunikasi (TIK) terhadap guru dan siswa. Di akhir kunjungan, para siswa dan guru meninjau ruang redaksi Harian Berita Sore dan Harian Waspada untuk melihat proses perolehan berita, pracetak hingga cetak. (csn/m43)

Waspada/Eddi Gultom

TERGENANG: Jalinsum Tebingtinggi,Galang saat ini kondisinya banyak yang rusak. Seperti terlihat bada gambar di kawasan Kota Galang air tergenang sehingga mempersulit bagi orang yang melintas. Gambar ini direkam,Rabu(10/11).

Jalinsum T. Tinggi-Dolok MasihulL. Pakam Memprihatinkan SEI RAMPAH(Waspada): Jalan Lintas Sumatera (Jalinsum)yangmenghubungkanKotaTebingtinggi, DolokMasihul,GalangdanLubukpakankondisinya banyak yang hancur. Namun hingga saat ini belum ada tanda tanda untuk diperbaiki. Demikian pantauan wartawan saat melintasi jalan itu, Rabu (10/11). Jalinsum yang terlihat rusak itu tepatnya di Desa Pekan Kamis dan Batu 12, Kec. Dolok Masihul sepannjang lebih kurang 10 kilometer kondisinya berlubang-lubang besar sehingga menyulitkan bagi pengguna jalan yang melintas. Selain di Desa Pekan Kamis dan Batu 12 yang

rusak itu juga di kawasan Kota Galang, tepatnya 200 meter mau memasuki Kota Galang bila datang dari arah Kec. Dolok Masihul. Air bergenang disepanjang jalan itu sehingga kendaraan yang melintas baik roda dua maupun roda empat terpaksa perlahan lahan. Untuk memperlancar arus lalu lintas yang merupakan jalan pintasTebingtinggi Lubukpakam yang banyak dimanfaatkan orang itu diminta kepada Dinas PU Provinsi Sumatera Utara untuk segera memperbaikinya,sebab bila dibiarkan berkepanjangan jalan itu akan lebih parah lagi yang mengakibatkan terhambatnya arus lalu lintas. (a07)

Preman Pengadaan Barang Dan Jasa Harus Diberantas TANJUNGMORAWA (Waspada) : Kapoldasu Irjen Pol Oegroseno bertekad memberantas mafia proyek atau pelelangan dalam pengadaan barang dan jasa, baik dananya bersumber dari APBD maupun APBN. “Kebijakan ini ditegaskan langsung Bapak Kapolri karena masuk dalam 100 hari program kerjanya,” ujar Oegroseno didampingi Karo Logistik Kombes Pol Sudarsono dan Kabag Faskon AKB PolArsenusPurbaketikamenerimaaudiensiForum Jasa Konstruksi (Forjasi) Sumut di Mapolda Sumut Jalan Sisingamangaraja, Tanjungmorawa, Selasa (9/11). Rombongan Forjasi dipimpin Ketua Umum Rickson Sibuea bersamaWakil Ketua Bidang Hubungan Antar Lembaga Henri R Situmorang, Wakil Ketua Bidang Penelitian dan Pengembangan Makmur Marpaung,Wakil Ketua Bidang Hukum Hotlan Napitupulu dan Wakil Ketua Bidang Hubungan Masyarakat Juang Harahap. Dikatakan, implementasi kebijakan ini sudah berjalan.Jajarannyasedangmemantaupelaksanaan pengadaan barang dan jasa di Sumut. Imbauan kepada instansi penyelenggara pengadaan telah dikoordinasikan, termasuk akan memampangkan spanduk imbauan pemberantasan mafia proyek di persimpangan jalan. Dengandemikian,lanjutnya,tidakadalagiruang gerak bagi oknum berniat melanggar aturan pengadaan, sebagaimana yang disyaratkan dalam Keppres Nomor 80Tahun 2003 tentang pengadaan Barang dan Jasa Pemerintah, sebagaimana yang diubah pada Perpres 54 Tahun 2010. “Kami memberi perhatian terhadap pemenang proyek yang menawar harga 25 persen lebih rendah

dari harga pagu. Itu sudah tidak benar lagi, sejauhmana efisiensi biaya dan efektifitas kerja yang dilakukan. Kasus-kasus seperti ini akan kami dalami karena mengindikasikan kuatnya terjadi praktik KKN,” jelasnya. Ketua Umum Forjasi Sumut Rickson Sibuea melaporkan banyaknya praktik tidak sehat dalam pelaksanaan pengadaan barang dan jasa, baik yang dananya dari APBD provinsi, kabupaten/kota maupun APBN. “Praktik menghalang-halangi peserta mendaftar di pengadaan, bukan barang baru di Sumut. Itu sudah sering terjadi dan bahkan merajalela. Antara lain di Kota Medan dan Langkat serta daerah lainnya di Sumut kental diperagakan,” jelas Rickson. Padahal, lanjut Rickson, pemilihan penyedia jasacukupvitalkarenaberhubungandengankualitas pekerjaan yang dihasilkan. “Kalau dia tidak berkualitas, hasil pekerjaannya pasti tidak bagus. Yang rugi adalah negara. Uang sudah disiapkan, namun hasil pekerjaan kurang bagus. Ini juga merugikan masyarakat yang langsung merasakan dampak dari hasil pekerjaan itu,” katanya. Wakil Ketua Bidang Hubungan Antar Lembaga Henri R Situmorang menambahkan kesiapan Forjasi untuk bermitra dengan Poldasu. “Kami siap bekerjasama membongkar jaringan mafia proyek di Sumut ini. Ini adalah keresahan kita bersama,” ujarnya. Kapoldasu menyambut positif niat Forjasi menegakkan peraturan dan efisiensi penggunaan uang negara lewat pengadaan barang dan jasa. “Kami senang karena Forjasi turut membantu tugas kami dalam rangka memberantas praktik KKN di Sumut,” lanjutnya kembali. (m38)

Waspada/HM Husni Siregar

PUKUL GONG : Wakil Bupati Deliserdang H Zainuddin Mars memukul gong yang disaksikan unsur Muspida, Ketua TP PKK Ny Hj Anita Amri Tambunan pertanda dibukanya Bulan Balita XXVIII, di Balairung Pemkab Deliserdang, Kamis (11/11).

B2 DPRD Batubara Temukan Pembuatan Jembatan Tak Selesai TALAWI (Waspada) : Tim Reses DPRD Batubara asal Dapil IV (Tanjungtiram/Talawi) menemukan pembuatan jembatan tak selesai di Desa Padang Genting, Talawi, Rabu (10/11). Hal itu sesuai plang proyek pembuatan jembatan menghubungkan Dusun I ke Dusun IV Padang Genting ukuran 4 x 16 meter asal dana APBD Batubara 2010 Rp.688.356.900 dikerjakan UD TD. Tim reses terdiri Sakroni, Sahrial Guci, Usman, Rizky Aryetti, Naffiar, P Pandiangan, Efendi Tanjung terkejut mendapat keterangan petugas PU T.Sinaga yang mengatakan pembangunan jembatan tak selesai tahun ini karena kekurangan dana untuk lantai dan akan dianggarkan tahun 2011. “Bagaimana bisa terjadi bangunan jembatan tak siap karena sudah dianggarkan dananya hampir Rp700 juta, apakah sebelum RAB pihak PU maupun konsultan tidak lebih dulu melakukan survei,” jelas Sakroni.(a30)

Bambang Irawan, Ketua Dewan Pendidikan Labura AEKKANOPAN (Waspada) : Pj Bupati Labura Drs Asrin Naim melalui Plt Sekda H Amhiruddin Naipospos melantik kepengurusan Dewan Pendidikan (DP) Labura periode 2010-2013 di kampus ULBSimpangSeranggong,Desa DamuliPekan,KecamatanKualuh Selatan, Labura, Selasa (9/11). Pelantikan kepengurusan DP itu berdasarkan SK Pj Bupati Nomor 420/243/DISDIK/2010, tentang Pembentukan Dewan Pendidikan Kabupaten Labura Periode 2010 - 2013, terdiri dari Ketua Bambang Irawan, Wakil Ketua Dalmidi, Sekretaris Agus Purnomo,Wakil Sekretaris Baharuddin, Bendahara Marahalim dan wakil bendahara J Harianja. Pj Bupat Labura melalui Plt Sekda H Amhiruddin Naipospos dalam sambutannya mengatakan, dewan pendidikan merupakan lembaga mandiri, dibentuk dan berperan dalam meningkatkan mutu pelayanan pendidikan sekaligus perwujudan visi Provinsi Sumatera Utara di bidang pendidikan Rakyat Tidak Bodoh, serta bertugas untuk melakukan pengawasan proses pendidikan di Labura. (csi)

Penyandang Cacat Batubara Terima Kursi Roda LIMAPULUH (Waspada) : Sebanyak 45 penyandang cacat yang tersebar pada tujuh kecamatan di Batubara mendapat bantuan kursi roda dan tongkat ketiak dari Dinas Sosial Batubara. ‘’Tahap awal bantuan disalurkan kepada 14 penyandang cacat berasal dari Kecamatan Medang Deras, Air Putih dan Seisuka,’’ tutur Kepala Dinas Sosial Batubara Zainal Alwi di sela-sela penyerahan bantuan bagi penyandang cacat yang berlangsung di aula Kantor Camat Seisuka, Rabu (10/11). ‘’Dalam minggu ini semua bantuan telah tersalurkan secara keseluruhan,’’ katanya. Sedangkan 14 penyandang cacat menerima bantuan yakni 6 kursi roda 8 tongkat ketiak. Kepada penyandang cacat juga diberikan bantuan uang sebagai pengganti ongkos transportasi bersumber dari APBD Batubara 2010. (a11)

Bupati Batubara Sumbang Hewan Kurban LIMAPULUH (Waspada) : Meskipun saat ini berada di tanah suci Makkah menunaikan ibadah haji, Bupati Batubara OK Arya Zulkarnain dan keluarga tetap memberi perhatian penuh terhadap masyarakat di daerah kepemimpinannya dengan memberikan hewan kurban untuk disembelih pada Hari Raya Idul Adha 1431 H untuk dibagikan kepada masyarakat yang berhak menerima. ‘’Ini sesuai pesannya dari Makkah melalui SMS kepada saya untuk memberikan hewan kurban berupa tiga ekor lembu untuk disembelih di Desa Bogak, Bagan Dalam dan Limalaras, Kec. Tanjungtiram dan dagingnya diberikan kepada masyarakat,’’ kata Asisten II Setdakab Batubara H Iskandar Lubis, Selasa (9/ 11). Tiga ekor sapi merupakan kurban OK Arya dan keluarga. Para SKPD di lingkungan Pemkab Batubara juga masingmasing menyumbangkan hewan qurban untuk disembelih pada desa-desa ditentukan. ‘’Ini kepedulian SKPD menyumbangkan hewan kurban nanti,’’ katanya.(a11)

Lomba Bulan Balita Dan Bina Generasi Muda LIMAPULUH(Waspada):Tim Penggerak PKK Kab.Batubara mengadakan kegiatan lomba bulan balita (bawah lima tahun) bina generasi muda meliputi lomba balita cerita, mewarnai dan melukis. Ketua TP PKK Batubara Khadijah Arya diwakili Rahmawati Sofyan menyatakan itu pada rapat kordinasi digedung Bina Prestasi di Lima Puluh Senin (8/11). Tim dewan juri nantinya melakukan penilaian secara fair setiap cabang perlombaan maupun revitalisasi posyandu dan bina generasi muda dengan harapan posyandu yang ada disetiap desa dapat berjalan.Selain melakukan kordinasi dengan Dinas Pendidikan dalam menggerakan pendidikan bagi anak usia dini (PAUD).’’Kita harapkan setiap kegiatan nanti dapat berjalan dengan baik dan dukung seluruh elemen,’’ujarnya. (a11)

Ulumahuam Labusel, 10 Besar Desa Percontohan Se-Sumut SILANGKITANG (Waspada): Desa Ulumahuam, Kecamatan Silangkitang, Kabupaten Labuhanbatu Selatan (Labusel) masuk nominasi 10 besar desa percontohan untuk tingkat Provinsi Sumatera Utara. Demikian disampaikan Plt Penjabat Bupati Labusel Drs H. Abdul Rajab Pasaribu MM saat Kunjungan EvaluasiTP PKK Provsu pada Desa/Kelurahan Percontohan PKK di Desa Ulumahuam, Senin (9/11). Bupati menyampaikan, sebagai salah satu desa yang akan dievaluasi, tentunya merupakan kebanggaan bagi daerah Labusel karena evaluasi merupakan tindak lanjut monitoring dan evaluasi TP PKK Provsu yang dipimpin KetuaTP PKK Sumut Ny Hj Fatimah Habibi Syamsul Arifin pada15 Oktober lalu.(a27)

Proses Tender Proyek Dinas PU Dan Pendidikan Labusel Diintervensi MEDAN(Waspada):Prosestenderproyekpelelanganpekerjaan pengadaan jasa pemborongan pembangunan drainase serta pendidikan yang ada di Labuhanbatu Selatan umumnya diduga selalu diintervensi pejabat terkait. Presidium Aliansi Pemuda Labuhanbatu Khairuzzaman Siregar, bersama Amnur Rifai, ketua PW Pemuda Bulan Bintang Sumatera Utara Fahrijal Dalimunthe, Sekretaris Forum Komunikasi Intelektual Muda Sumatera Utara Hasanuddin Siregar dan ketum Ikatan Alumni IAIN Sumatera Utara Lahmuddin Ritonga mengatakan kepada Waspada, Senin (8/11). Kata Fahrijal, intervensi seperti di Dinas PU ada tender pembangunan drainase dengan nilai proyek Rp 3 miliar. “Memperhatikan penetapan panitia pengadaan barang/jasa dengan beraninya memenangkan penawaran tertinggi, kami menduga antara panitia pengadaan barang/jasa, PPK, kadis dan pemenang telah melakukan tindakan yang tidak terpuji KKN”, tegas Khairuzzaman dan Fahrijal. Atas tindakan dan perbuatan panitia pengadaan barang/ jasa, PPK, Kepala Dinas, Dinas PU Pertambangan dan Energi Kabupaten Labuhanbatu Selatan Tahun Anggaran 2010, maka PT.RizqiTunggal Pratama telah membuat surat pengaduan kepada Kepala Kejaksaan Tinggi Sumatera Utara di Medan, dengan No. : 56/PT-RTP/XI/2010 tanggal 08 November 2010 ditandatangani Direktur Fitra Irama Lubis.(m25)

Sumatera Utara

WASPADA Jumat 12 November 2010

Keputusan MK Musibah Demokrasi Di T. Balai TANJUNGBALAI (Waspada): Keputusan Mahkamah Konstitusi (MK) yang memerintahkan KPUD Tanjungbalai untuk melakukan pemungutan suara ulang di 17 kelurahan di daerah itu merupakan musibah bagi warga Kota Tanjungbalai. Demikian dikatakan Ketua Fraksi PDI Perjuangan Leiden Butar-Butar saat membacakan pandangan umum terhadap rancangan peraturan daerah tentang pertanggungjawaban pelaksanaan APBDTA 2009 dan perubahan anggaranpendapatandanbelanja daerahTA 2010, di Gedung DPRD Tanjungbalai, Kamis (11/11). Dikatakan Leiden, F PDIP menyesalkan terjadinya praktik money politics yang dilakukan oleh salah satu pasangan calon, serta adanya keterlibatan aparatur pemerintahan sebagaimana tertuang dalam amar putusan MK pada 28 September 2010 lalu yang berdampak tercorengnya demokrasi serta merugikan keuangan daerah. Untukitu,kataLeiden,FPDIP mengharapkan agar pegawai negeri sipil daerah yang diduga

terlibat upaya memenangkan salah satu calon walikota/calon wakil walikota pada pemungutan suara 26 Agustus 2010 lalu sesuai denganamarkeputusanMKditindaklanjuti dan diproses. Dalam pandangan fraksinya, Leiden meminta kepada walikota untuk merespon dan tanggap terhadapkeluhandanjeritanmasyarakatkecilterutamanelayanakibat tingginya harga minyak tanah yang dijual sampai Rp7.000 per liter, padahal harga tersebut melanggar ketentuan NET yang berlaku. “Kita melihat kebijakan pemerintahuntukmencabutsubsidi minyak tanah dengan konversi gas telah dimanfaatkan pengusaha pangkalan untuk berspekulasi menaikkan harga minyak tanah secara tidak manusiawi,” ucap Leiden. Oleh karena itu, kata Leiden, FPDIP meminta Walikota Tanjungbalai untuk menindak tegas serta memberikan sanksi pencabutan izin terhadap pangkalan minyak tanah yang telah melanggar ketentuan harga subsidi sertamelakukanpengawasandan pendistribusiannya. Fraksi Patriot Peduli Bangsa meminta walikota untuk menertibkan tempat-tempat maksiat seperti di daerahWater Front City dan Jalan Arteri. “ Kami juga berharap kepada kepolisian agar

memberantas perjudian yang akhir-akhir ini semakin marak,” ucap anggota fraksi Ainul Fuad. Sedangkan Fraksi Partai Demokrat meminta kepada satuan kerja perangkat daerah (SKPD) agar dapat merealisasikan proyek dan kegiatan sesuai dengan jadwal, sehingga tidak ditemukan lagi program yang tidak tepat waktu dan terkena luncuran. Beban Sementara itu, FMPB-SU (ForumMahasiswaPeduliBangsa Sumatera Utara) menilai beban Kota Tanjungbalai akan semakin berat jika keputusan Mahkamah Konstitusi (MK) tidak ditindaklanjuti secara hukum terhadap tersangka pasangan calon walikota pada Pemilukada Tanjungbalaiyangmelakukanpolitikuang. “Takadaalasanlainagarputusan MK bermanfaat positif harus dilakukan proses hukum terhadap tersangka tanpa kecuali,” tegas Ketua FMPB-SU Mukhlis Ritonga didampingi Sekretaris Syahbana Hidayat di Medan, Kamis (11/11). FMPB SU, tegas Muklis, tidak menginginkan hanya proses pelaksanaan tentang Pilkada saja ditindaklanjuti dengan melakukan Pilkada ulang di 17 kelurahan, tapi juga proses tindak pidana. Di samping mengganti oknum diPanwasluyangdidugaberperan dalam kasus tersebut. (a37/crs/ m14)

Kerusakan Hutan Di Asahan Kesalahan Semua Pihak KISARAN (Waspada): Bupati AsahanTaufanGamaSimatupang menyatakan, kerusakan hutan lindung merupakan kesalahan semua pihak, disebabkan semua masyarakatbutuhhidup,sehingga diperlukan pelestarian kembali. Hal itu dikatakannya kepada Waspada, saat berkunjung di RSUD Kisaran, Selasa (9/11) didampingiKepalaBapeda,Mahendra, Direktur RSUD Kisaran, dr Herwanto, SpB, serta Kabag Humas, Rahmad Hidayat Siregar. Menurutnya, akibat kebutuhan hidup masyarakat , sehingga mereka melanggar undang-undang dan menggarap wilayah hutan, sedangkan petugas hutan terbatasuntukmemantauwilayah hutan yang mencapai puluhan ribu hektare. “Kita akan membicarakan kembali dengan Dinas Kehutanan Kabupaten Asahan, untuk menjaga kelestarian hutan lindung Asahan. Dengan melakukan program memberi wilayah yang boleh diolah masyarakat dengan salah satu syaratnya

harus menanam kayu hutan di sela-sela tanaman mereka, dengan demikian hutan kita akan kembali meskipun memakan waktu cukup lama. Hutan itu merupakan paru-paru dunia, kita wajib menjaganya.” ungkap Taufan. Disinggungdengantersangka perambahhutandiDesaSeiTempurung,KecamatanSeiKepayang Timur,KabupatenAsahan.Taufan mengatakan itu bukan bukan tupoksinya. “Masalah tersangka perambah hutan, itu bukan koridor saya,” katanya. Gagal Sebelumnya, Aktivis Lingkungan, Zasnis Sulungs, dikonfirmasi Waspada beberapa waktu lalu, mengatakan penanaman seribu pohon di Kabupaten Asahan dinilai gagal disebabkan perambah hutan, seperti di wilayah Hutan Tormatutung. Berdasarkandatayangtertulis di atas kertas luasnya mencapai 45 ribu ha, namun investigasinya di lapangan, kawasan itu telah dibuka sebanyak 25 ribu ha. Hal

yang sama terjadi di hutan Nantalu, begitu juga dengan Hutan Mangrove di pesisir pantai Timur Asahan tepatnya di Sei Tembilik, Bagan Asahan dan Sei Tempurung, Kecamatan Sei Kepayang Timur. Namun yang mengecewakan yang ditahan hanya pekerja, dan alat berat yang diamankan, sedangkan pelaku utamanya masih bebas dari hukum. “Sebaiknya pemerintah menyelesaikan masalah perambah hutan dan menahan aktor utamanya, baru dilakukan program penanaman seribu pohon di wilayah yang telah dirambah. Bukanhanyamengkampanyekan program sedangkan kenyataannya bertentangan di lapangan. Dan hal itu merupakan tanggung jawab pemerintah dengan meningkatkan pengawasan,” jelas Zasnis. Di lain tempat, Koordinator Polisi Hutan Kabupaten Asahan, TR Nainggolan, mengakui kawasan hutan lindung Register 5/A Nantalu seluas 46 ribu ha dengan

OK Naik Haji, Gong Berbunyi: Positif LIMAPULUH (Waspada): Tulisan Nurkarim Nehe berjudul “OK Naik Haji, Gong Berbunyi” merupakan hal positif jika dibaca cermat dan mendalam. SekjenGemkaraAhmadYani, Kamis (11/11), mengatakan hal itu kepada Waspada. “Jangan menanggapi suatu pemberitaan dengan gegabah namun hendaklah dicermati secara mendalam,” ujarnya. Yani menegaskan tulisan Nehe itu tidak ada memojokkan pihaklain,jaditidakrelevandinilai “sesatlagimenyesatkan”dikaitkan kedekatan dengan Bupati Batubara OK Arya Zulkarnain. “Makanya jangan gegabah dalam menanggapi suatu pemberitaan tanpa melihat secara

objektif isinya…, di tangan dingin pasangan OK Arya Zulkarnain/ Gong Matua Siregar maupun pantunpembukadanalineaakhir tulisan Nurkarim Nehe, adalah penegasan sinerjisitas, jangan bercerai,” tandas Ahmad Yani. Dikatakan sesuai UU dan Peraturan yang berlaku, Wakil Bupati Batubara Drs H Gong Matua Siregar dihunjuk sebagai Plt Bupati Batubara selama OK Arya Zulkarnain berangkat haji. “undang-undangmengamanahkan demikian,: tambahnya. Secaraterpisah,KetuaDewan Pendidikan Kabupaten Batubara Drs Sofyan Alwi,M.Hum usai meninjau pembangunan SMPN 1 Talawi sekaligus menyerahkan bantuan mitra kerja penerbit

mengatakan Plt Bupati Batubara Gong Matua Siregar dapat “banyak membaca” aturanaturantugasdanfungsipokoknya sebagai Wakil Bupati. “Tugas wakil membantu program yang dijalankan Bupati sehingga tidak sampai salah, di sisi lain elemen masyarakat dapat berbuat positif bagi kemajuan Batubara terutama di sisi pendidikan dalam memberikan kontribusi apa saja yang bisa dibuat,” tandasnya. SofyanmengisyaratkanBatubara kaya akan mitra kerja seperti perusahaan swasta maupun BUMN. “Perbanyaklah kegiatan positif sehingga yang tidak-tidak terlupakan,” tukas Sofyan Alwi. (a11/csap)

Manusia Mulia Bukan Karena Pangkat Dan Harta MEDAN (Waspada): Ketua Umum Majelis Zikir Tazkira Sumut Buya KH Amiruddin, MS mengatakan, manusia mulia bukankarenapangkatdanhartanya. Tetapi, dinilai dari akhlaknya. “Apalah artinya kekayaan kalau tidak beakhlak mulia. Apa yang dilakukan keluarga besar alm Ir H Sudjono Giatmo sebagai wujud mengenang jasa-jasanya dalamduniapendidikandansosial patut ditiru dan dicontoh pihak lain,” katanya dalam tausiyah pada Haul ke-16 wafatnya H. Sudjono Giatmo sekaligus zikir bersama di SMK Budhi Darma, Kec. Air Putih, Kab. Batubara, Kamis (4/11). Hadir Wakil Bupati Asahan M. Surya, Sekdakab Batubara Drs. H. Sofyan MM, Camat Air Putih, Ketua Pembina Yayasan SMK Budhi Darma Hj. Khairiyah Sudjono (istri almarhum), Kepala SMKBudhiDarmaDr.TatangDwi Supratikno (anak almarhum) dan mewakili Keluarga Besar almarhum Letkol Inf. Khairuddin SusiantosertasiswaSMKBudhiDarma. Sedangkan dalam zikir bersama yang dipandu Buya KH Amiruddin MS ditandai penyantunan 60 anak yatim-piatu. Menurut Buya, ada orang

Waspada/Rasudin Sihotang

TABUNG GAS: Satu unit rumah hangus terbakar di Lingk. IV, Kel. Seiraja, Kec. Seitualang Raso, Kota Tanjungbalai, Kamis (11/11) sekira pukul 11:30. Belum diketahui secara pasti penyebab kebakaran, namun dari lokasi kejadian diamankan beberapa barang bukti termasuk tabung gas ukuran 3 kilogram. Foto direkam Kamis (11/11).

Jago Merah Hanguskan Satu Unit Rumah TANJUNGBALAI (Waspada) : Satu unit rumah hangus dilalap si jago merah di Lingk. IV, Kel. Seiraja, Kec. Seitualang Raso, KotaTanjungbalai, Kamis (11/11) sekira pukul 11:30. Informasidihimpun Waspada,pemilikrumah Rahmat Aulia, 35, tengah bekerja mengangkat kayu tak jauh dari rumahnya. Namun, sekira pukul 11:00, dirinya melihat api tengah berkobar melalap rumahnya. “ Saat melihat rumahku terbakar, aku ingat anakku tadi aku tinggalkan sendirian disana, lalu kukejar ternyata telah diungsikan di rumah warga lain,” ucap Rahmat. Rahmat menuturkan, sebelum pergi bekerja dirinya mengaku memasak air di samping rumahnya menggunakan kayu bakar. Namun lanjut Rahmat, api telah dipadamkan dengan air

mengingat anaknya akan ditinggal sendirian di rumah. Sedangkan Lurah Seiraja, Hadi Lubis mengatakan belum mengetahui secara pasti penyebab kebakaran, karena korban masih dimintai keterangan. Kapolres Tanjungbalai AKBP Puja Laksana melalui Kapolsek Seitualang Raso AKP Ruslan Lubis didampingi Kanit Intel Aipda A Pasaribu mengatakan, belum bisa memastikan penyebabnya kebakaran, namun dugaan sementara api berasal dari bekas kayu bakar memasak air. Dari lokasi kejadian, diamankan beberapa barang bukti seperti alat memasak dan sebuah tabung gas ukuran 3 kilogram. (crs)

Soal Inalum, Pemerintah Segera Fasilitasi Pertemuan Daerah LIMAPULUH (Waspada) : Kepala Pusat Penerangan Kemen-terian Dalam Negeri Doni Redho Nijar Moenik segera melakukan koordinasi kepada Kepala Direktur Aset Investasi Hendro untuk memfasilitasi pertemuan 10 kepala daerah/ kota di lingkup Danau Toba untuk mendapatkan porsi yang signifikan menyusul berakhirnya perjanjian induk PT Inalum pda 2013. ‘’Mudah-mudahaninisudahdapatkitaketahui dalam waktu dekat memfasilitasi pertemuan 10 kepala daerah dan Pemprovsu terkait berakhirnya perjanjian induk PT Inalum,’’ kata Asisten II Setdakab Batubara H Iskandar Lubis, Selasa (9/11). Porsi diterima daerah selama ini dinilai belum memadai bagi masyarakat terutama Batubara merupakan lokasi tempat peleburan aluminium PT Inalum melalui anual fee diberikan. “Keinginan daerah mendapat aplaus dari pemerintah pusat dan DPD serta DPR Komisi IV dan mendukung daerah mendapatkan kontribusi Inalum terwujud,” katanya. Sedangkan pihak Inalum diakuinya tidak

mencampuri masalah ini karena sepenuhnya merupakan kewenangan pemerintah pusat. Menunggu Sedangkan membangun Kawasan Ekonomi Kusus (KEK) di Kuala Tanjung meliputi Seisuka dan Medang Deras, Pemkab Batubara tinggal menunggu turunnya tim dari Institut Teknologi Sepuluh November (ITS) Surabaya untuk melakukan kajian di berbagai sisi sampai nantinya membuat master plan. ‘’Inisalahsatubagiandariperjanjiankerjasama dengan ITS yang ditandatangani pada 30 September 2010 lalu di Surabaya oleh Bupati Batubara OK Arya Zulkarnain dan Rektor Prof DR Ir Priyo Suproto,’’ ujarnya. Selain membangun SDM merupakan salah satu pilar utama Pemkab Batubara, pengkajian pengembangan wilayah atas KEK diharapkan Batubara menjadi salah satu daerah termaju unggulan di Sumut sebagaimana keinginan OK Arya. (a11)

Alumni Paskibraka Labura Demo Dispora AEKKANOPAN(Waspada):Sekitar20-ansiswa dari berbagai sekolah di Kab. Labuhanbatu Utara yang tergabung dalam alumni Paskibraka melakukandemonstrasididepankantorDinasPemuda dan Olahraga di Aekkanopan, Kamis (11/11). Puluhan siswa itu menuntut pembayaran honor saat mereka menjadi pengibar bendera merahputihsaatupacaraperingatanHUTKemerdekaan RI bulan Agustus lalu. Saat melakukan unujuk rasa, para siswa berdialog langsung dengan Kadispora Drs M Nur Khalidi. “Saat itu mereka dijanjikan menerima honor Rp40.000 perhari untuk satu orang sebanyak 48 orang selama 18 hari sehingga setiap orang menerimaRp720.000namunkenyataannyahingga saat ini kami hanya menerima honor Rp200.000 perorang,” kata para pendemo. Dikatakan, selain itu mereka juga dijanjikan akan dibawa jalan-jalan ke Padang, Sumatera Barat dan Sekda Labura menjanjikan saat jalanjalan akan diberi uang saku Rp400.000, tapi hingga saat ini hal itu tidak direalisasikan. Saat melakukan aksi itu mereka membawa

poster bertuliskan“Mana janji masnismu Dispora” dan“Apakahiniyangdiajarkankepadaanaknegara”. Kadispora M Nur Khalidi dihadapan para alumni Paskibraka Labura tersebut mengungkapkan, honor yang sudah diberikan memang tertampung di dalam APBD namun karena anggaran saat itu minim maka Dispora mengajukan penambahan anggaran dalam P APBD dan hingga saat ini P APBD Labura yang baru disahkan DPRD sedang dievaluasi Gubsu. “Jadi adik-adik bersabar menunggu pengesahan P APBD dan jika P APBD sudah diserahkan keSKPDmasing-masingmakakamiakanlangsung menyerahkannya kepada adik-adik,” katanya dan menambahkan pihaknya tidak ada menahannahan honor tersebut dan tidak akan menggelapkannya. Meskipun sempat terjadi adu mulut antara siswa dan Kadispora dimana para siswa meminta kepastian kapan honor mereka dibayarkan dan kapan berangkat jalan-jalan ke Padang. Usai menerima penjelasan Kadispora para siswa itu membubarkan diri. (a29)

Alihfungsi Lahan Mangrove Di Pulausembilan Dihentikan Waspada/Ist

KELUARGA BESAR: Buya KH Amiruddin MS berjubah didampingi Wakil Bupati Asahan M Surya foto bersama dengan keluarga besar alm H Sudjono Giatmo dengan latar belakang foto almarhum. yangsalih,tetapihanyauntukdirinya sendiri. Tetapi, alm. H. Sudjono Giatmo, kesalihannya juga disumbangkan untuk orang lain dengan mendirikan lembaga pendidikan SMK Budhi Darma. Dalam ajaran Islam, lanjutnya, memperingati wafatnya seseorang tidak dilarang, asalkan semata-mata untuk mengenang jasa-jasanya, bukan untuk mengkultuskannya.

Ketua PembinaYayasan SMK Budhi Darma Hj Khairiyah Sudjono dalam sambutannya mengatakan, kegiatan Haul ini dilaksanakan setiap tahun bertujuan bukan untuk mengkultuskan alm H Sudjono Giatmo. Tetapi, dia sebagai pemegang amanah perlu mengenang jasa-jasa dan pengabdian dari almarhum untuk para generasui muda bangsa. (m43)

PANGKALANSUSU (Waspada):Tim terpadu dari Pemkab Langkat hentikan kegiatan alih fungsi hutan mangrove di kawasan Desa Pulausembilan, Kec. Pangkalansusu, Selasa (9/11) sore. Tim yang turun diantaranya Ka Satpol PP, Bappeda, Kadis Perikanan dan Kelautan, Kadis KehutanandanPerkebunan(Hutbun),Ka.Lingkungan Hidup dan Camat Pangkalansusu beserta staf. Pada kesempatan itu, tim menyegel 3 unit exscavator berikut mengamnkan 6 buah kunci kontak alat berat.Petugas kesulitan menyita 3 unit excavator dari kawasan, sebab pekerja lapangan tidak kooperatif. Kadishut mengatakan, alihfungsi lahan mangrove, baik yang berada pada areal penggunaan lain (APL) maupun pada kawasan hutan negara yang tidak memiliki izin harus ditindak. Dasar penindakan karena pengusaha tidak memiliki legalitas seperi Izin Usaha, Izin HO, Tata Ruang, PengelolaanWilayah Pesisir dan izin lainnya seperti izin dari Menhut.

Sementara, Bappeda melalui stafnya menganggap,pengusaha yang melakukan alih fungsi kawasan hutan mangrove di Desa Pulau Sembilan ini telah melanggar Tata Ruang. Dikatakan, huutan mangrove di wilayah ini sesuai dengan ketentuan tidak boleh dialihfungsi untuk dijadikan perkebunan kelapa sawit. Kelestarian kawasan pesisir ini harus tetap dipelihara. Mengingat daerah Pulausembilan dikelilingi laut, maka mempertahankan ekosisten mangrove dianggap penting untuk menahan intrusi air laut serta menahan ombak jika sewaktu-waktu terjadi bencana tsunami. Kabag Humas Pemkab Langkat, Syahrizal, dikonfirmasi Waspada, Rabu petang terkait alih fungsi hutan di sejumlah kawasan pesisir di Telukaru mengatakan, beberapa daerah lainnya sedang menjadi kejadian. Dikatakan, daerah lainnya akan dikenakan sanksiyangsama,tapihalitumembutuhkankajian, sebab yang berkompeten menentukan apakah itu kawasan hutan mangrove atau tidak adalah BPKH Sumut.(a02)

WASPADA Jumat 12 November 2010

Sumatera Utara

Walikota P. Siantar Sidak Ke Puskesmas

Dewan Pengawas PDAM Tirtauli Diganti Di Tengah Jalan

P. SIANTAR (Waspada): Menindaklanjuti agenda 100 hari kerja demi terwujudnya visi dan misi pembaharuan menuju Pematangsiantar mantap, maju dan jaya, Walikota Pematangsiantar Hulman Sitorus, Senin (8/11) melakukan inspeksi mendadak (sidak) ke Puskesmas dan beberapa sekolah negeri. Walikota didampingi Kakan Satpol Hasudungan Hutajulu dan Kabag Humas dan Protokoler Pemko Daniel Siregar melakukan sidak pertama ke Puskesmas Kesatria. Di Puskesmas Kesatria, Walikota mengharapkan petugas Puskesmas agar lebih meningkatkan pelayanan kesehatan kepada masyarakat dengan tanggungjawab. Sesudah ke Puskesmas, walikota langsung meninjau SD Negeri 71, 72 dan 74 serta kunjungan ke SMA Negeri 2 dan SMK Negeri 1. “Kami meminta agar para guru bekerja lebih aktif dalam mengajar untuk meningkatkan kualitas siswa,” katanya.(a14)

Polres-Pemkab Siap Nyamankan Warga PAMATANGRAYA (Waspada) : Bupati Simalungun JR Saragih didampingi Wakil Bupati Hj Nuriaty Damanik bersama sejumlah pimpinan SKPD Pemkab Simalungun menghadiri rapat analisa dan evaluasi situasi keamanan ketertiban masyarakat (Kamtibmas) yang digelar di Mapolsek Raya, Kec. Raya, Selasa (9/11). Rapat evaluasi Kamtibmas dipimpin Kapolres Simalungun AKBP Marzuki diikuti Kabag, Kasat dan Kapolsek se jajaran Polres Simalungun. Kapolres Simalungun AKBP Marzuki mengatakan, pihak Polres Simalungun akan melaksanakan program penempatan satu orang satu Polisi di setiap Nagori (desa) dan kelurahan di Simalungun. AKBP Marzuki menyampaikan terimakasih kepada masyarakat danPemkabSimalungunkarenamendukungpelaksanaanPemilukada Simalungun pada Agustus 2010 lalu yang berlangsung lancar, aman dan tertib. Bupati Simalungun JR Saragih dalam arahannya mengatakan, pemerintah dan pihak kepolisian adalah sebuah keluarga besar yang sama-sama mempunyai tujuan untuk mewujudkan kenyamanan dan keamanan di tengah-tengah warga. (a15)

Korem 022/PT Peringati Hari Pahlawan P. SIANTAR (Waspada): Korem 022/PT memperingati Hari Pahlawan ke-65 tahun 2010 di lapangan upacara Makorem 022/ Pantai Timur, Rabu (10/10) dengan Irup Kasrem 022/PT Letkol Inf Ahmad Dimyati mewakili Danrem 022/PT Kolonel Inf Karsiyono. Dalam peringatan itu, Kasrem 022/PT Letkol Inf Ahmad Dimyati membacakan amanat Panglima TNI Laksamana TNI Agus Suhartono, SE yang menyebutkan Hari Pahlawan merupakan salah satu tonggak penting sejarah perjuangan nasional. Kapenrem 022/PT Mayor Caj Drs Prinaldi menyebutkan selain peringatan itu turut dilaksanakan kegiatan ceramah dan kegiatan keagamaan. Kegiatan ceramah akan dilaksanakan pada hari Kamis (11/11) dengan penceramah Dosen Fakultas Hukum USI Ridwan Manik, SH.MH, dan sebelum kegiatan ceramah, seluruh personil Makorem 022/PT dan Dinas Jawatan akan menyaksikan lebih dulu film dokumenter Makorem 022/PT di aula Makorem 022/PT. Selanjutnya, pada hari Jumat (12/11), imbuh Kapenrem, akan dilaksanakan kegiatan keagamaan. “Bagi personil yang beragama Islam diintegrasikan dengan kegiatan shalat Jumat dan sekaligus melaksanakan zikir dan doa bersama di Masjid Asy Syuhada, komplek Makorem 022/PT, sedang bagi yang beragama non muslim melaksanakan acara kebhaktian di Aula Makorem 022/PT. (a14)

Bupati Hadiri HUT Ke-30 Vihara Maitreya Kirti PERDAGANGAN (Waspada): Bupati Simalungun JR Saragih bersamaWakilnya Hj Nuritay Damanik serta Ketua DPRD Simalungun Binton Tindaon menghadiri perayaan HUT ke-30 Vihara Maitreya Kirti (VMK) di Kota Perdagangan, Kec. Bandar, Simalungun, Minggu (7/11) malam. Menurut Ketua Panitia HUT ke-30Vihara Maitreya Kirti Suriyanto, kegiatan ini merupakan wujud syukur kepada Tuhan Yang Maha Esa yang memberikan karunia rahmat kepada masyarakat khusunya umat Buddha. Selanjutnya dalam menyabut HUT ini, pihaknya bersama unsur Mupika Bandar mengadakan bersih lingkungan dan memberikan santunan kepada 100 keluarga ekonomi lemah dari berbagai agama. Bupati Simalungun JR Saragih berterima kasih kepada keluarga besarVMK yang peduli terhadap perkembangan sosial masyarakat dan mau berbagi rasa bersama warga. (a15)

Proyek Pembangunan Jembatan Lae Serre Belum Rampung SALAK (Waspada): Proyek pekerjaan pembangunan jembatan Lae Serre tahap II tahun anggaran (TA) 2010 yang bersumber dari DAU (Dana Alokasi Umum) berbiaya Rp565.400.000 dengan pelaksana pekerjaan CV Solfa Raya di Kecamatan Sitellu Tali Urang (STU) Jehe, Kabupaten Pakpak Bharat hingga kini belum juga rampung dikerjakan. Berdasarkan dokumen kontrak kerja yang dikeluarkan Dinas PU dan Perhubungan Pakpak Bharat saat itu, yaitu masa pelaksanaan proyek tersebut mulai dikerjakan 23 Juli dan berakhir 23 Oktober 2010. M Sagala, selaku PPTK (Pejabat Pelaksana Teknis Kegiatan) pada Dinas PU setempat ketika ditemui di ruang kerjanya, Rabu (10/ 11) mengatakan, masalah ini karena keterlambatan pekerjaan yang diakibatkan perancah dari pada jembatan ketika itu goyang ataupun faktor lainnya yang tidak mendukung yaitu curah hujan yang tinggi. Dan, imbuh Sagala, volume hasil pekerjaan sudah mencapai 50 persen dengan meliputi bidang pekerjaan yaitu pemasangan gelagar jembatan dan diafragma. Sedangkan sebelumnya, pekerjaan pada tahap I meliputi pekerjaan pembangunan abutmen/pondasi dan tembok. (c08)

Polres Karo Amankan 15 Pelaku Judi Dan Narkoba KABANJAHE (Waspada) : Polres Karo dalam razia yang dilakukan selama dua hari mengamankan 14 pemain judi jenis kartu dan seorang pengedar narkoba jenis ganja. Tim mengamankan barang bukti satu set kartu domino kartu joker dan sejumlah uang yang dipakai dalam permainan judi. Dalam razia itu diamankan 5 PNS dan 2 guru di lingkungan Pemkab Karo dari 4 TKP yakni di Desa Ketaren (Kabanjahe), Korpri (Berastagi), Sukadame (Tigapanah) dan Katepul (Kabanjahe) Kab. Karo. DemikiandikatakanKapolres Karo AKBP Ig Agung Prasetyoko, kepada wartawan, Rabu (10/11) di halaman Mapolres Karo, Kabanjahe. Dengan memperlihatkan tersangka dan barang bukti kepada pers, Kapolres Karo didampingi Kasat Reskrim AKP Lukmin Siregar, Kasat Narkoba AKP Ahzar menjelaskan,operasi“Pekat”yang dimulai 8 sampai 20 November berhasil menjalankan razia sesuai program 100 hari Kapolri. (cmm/ a17)


Waspada/Micky Maliki

DIPINDAHKAN: Truk membawa bantuan logistik dari kantor bupati dipindahkan ke kantor Dinas Sosial lama di Jalan Mariam Ginting Kabanjahe untuk digudangkan, Kamis (11/11).

Bantuan Sinabung Digudangkan KABANJAHE (Waspada): Bantuan logistik yang berada di lantai satu dan dua kantor Bupati Karosebagianmulaidipindahkan (digudangkan) ke kantor Dinas Sosial (Dinsos) lama di Jalan Mariam Ginting Kabanjahe, Kamis (11/11). Bantuan logistik yang dipindahkan berupa tikar, sarung, selimut,minyak makan dan mi instan yang seluruhnya benda yang tidak mudah busuk namun sebagian bantuan logistik seperti telur sebanyak 16.500 butir telah dimusnahkan semua akibat su-

dah membususk tidak layak dikonsumsi para pengungsi. Tomy Sidabutar, staf bagian sosial kantor bupati yang ditemui Waspada menyatakan, barang logistik bantuan para donatur yang disimpan di lantai satu dan dua kantor bupati. Soal adanya barang ada yang hilang maupun yang terbuka segelnya itu, menurut Sidabutar, itu bukan tanggung jawab pihaknya dan itu merupakantanggungjawabsatpolPPyang berjaga di kantor bupati. Ketika dihubungi via ponsel

mengatakan, pihaknya hanya menjagakantorbupatidanbukan menjaga barang logistik bantuan Sinabung jelas kepala kantor (Kakan) Satpol PP yang berkantor di kantor Bupati Karo Drs Irwan Ganti Tarigan Kadis Sosial Drs R Refaya Barus mengatakan, pihaknya belum mengetahui adanya kehilangan maupun yang rusak sebab itu bukan tanggungjawab DinasSosialtetapitanggungjawab kepala gudang yang ada di kantor Bupati Karo.(cmm)

Orang Tua Murid MTs Sibande Datangi Kantor Kementrian Agama Pakpak Bharat SALAK (Waspada): Beberapa orang tua murid Desa Sibande, Kecamatan Sitellu Tali Urang (STU) Jehe, Kabupaten Pakpak Bharat didampingi Aminullah Berutu, Ketua DPC PPP, Joton Boangmanalu Ketua Komite MTs Sibande dan guru kelas, Kamis (11/11) mendatangi Kantor Kementerian Agama Kabupaten Pakpak Bharat. Adapun maksud kedatangan mereka adalah untuk mempertanyakan masalah dari pada operasional MTs Sibande yang akhirakhir ini tenaga pengajar sudah semakin berkurang dalam menjalankan aktifitasnya. Hal itu disebabkan karena sekian bulan para

gurunya tidak menerima honor. Sehingga hal ini menyebabkan proses belajar dan mengajar selama ini menjadi terganggu, dan status dari pada MTs Sibande nantinyaakanmenjaditerkendala untuk dinegerikan. Ditambah lagi, jumlah murid MTs Sibande kian berkurang, dari 90 menjadi tinggal 50 murid lagi dikarenakan telah dipindahkan orang tuanya. Ironisnya lagi, ke50 murid MTs Sibande itu kini menjadi tidak terdaftar dalam mengikuti UAN (Ujian Akhir Nasional). Oleh karena itu, Aminullah Berutu kepada Pelaksana Tugas (Pgs) Kepala Kementerian Agama

Pakpak Bharat Drs Syafrizal Bancin didampingi Seksi Kependais dan Pemberdayaan Masjid Dra Farida Ros br Purba meminta dengan tegas agar permasalahan ini secepatnya untuk dituntaskan karena nantinya MTs Sibande akan terancam tutup sehingga menyebabkan anak didik putus sekolah. Drs Syafrizal Bancin (Pgs Ka Kementerian Agama Pakpak Bharat) terhadap warga menyebutkan,dianyamerespondengan postif akan kedatangan orang tua murid dan permasalahan ini secepatnya akan diselesaikan, ujarnya. (c08)

Kejari Kabanjahe Sita Dokumen Dari Kantor DPKAD Karo KABANJAHE (Waspada) : Pihak Kejari Kabanjahe menyita sejumlah dokumen yang berhubungan dengan dugaan tindak pidanakorupsipekerjaanpembangunan 708 kiosTempat Penampungan Sementara (TPS) pedagang yang menjadi korban kebakaran di Pusat Pasar Kabanjahe sebesar Rp1,9 miliar yang bersumber dari dana APBD Kabupaten Karo TA 2009, Selasa (10/ 11) sore. Pihak Kejari yang dipimpin Kasipidsus Albert Pangaribuan didampingiKasiIntelRizalSiregar menyita sejumlah dokumen dari ruang Bidang Pasar Dinas PendapatanPengelolaKeuangandan Aset Daerah (PPKAD) Kabupaten Karo seperti lampiran peraturan Bupati Karo, administrasi mulai dari tahap tender hingga selesainya pengadaan proyek itu. Menurut Kajari Kabanjahe Muda Huta Suhut melalui Kasipidsus Albert Pangaribuan, Selasa (9/11) dalam kaitan itu, tiga orang telah ditetapkan sebagai tersangka. Ketiga tersangka masingmasing sebagai Pejabat Pembuat Komitmen (PPK) berinisial RT, Pejabat Pelaksana Teknis Kegiatan (PPTK) KS dan rekanan yang mengerjakan proyek itu dari PT

Batu Garut Sakanusa Utama berinisial ESM. “Terkait dengan itu, Selasa (9/ 11) jaksa penyidik menyita dokumen yang berhubungan dengan pekerjaan itu seperti lampiran peraturan Bupati Karo. Dokumen ini untuk melengkapi pemeriksaan tindak pidana korupsi yang nantinya dirampungkan untuk diteruskan ke proses persidangan,” ungkapnya. Penetapan ketiga tersangka tersebut setelah memeriksa 13 saksi dan 2 saksi ahli telah ditemukanadanyabuktipermulaanyang cukup dalam pengadaan proyek itu dengan cara melakukan pengurangan volume pekerjaan, sehingga ada kerugiaan negara sebesar Rp145 juta. AlbertPangaribuanmengaku ketiga tersangka masih dalam pemeriksaan dan belum melakukan penahanan, karena masih tetap kooperatif menjalani pemeriksaan. “Apabila tersangka tidak kooperatif menjalani pemeriksaan bakal ditahan,” ungkapnya. 708 Kios pusat Pasar Kabanjahe terbakar pada 22 Desember 2008 lalu. Sementara yang terealisasi dibangun baru 618 kios. PembangunanTPSituukurannya bervariasi mulai 2 x 3 m2 dan 2 x 3m2 dan telah dikerjakan

sebanyak 618 kios. Pembangunan kios untuk tempatpenampungansementara para pedagang itu masingmasing, sebanyak 70 TPS yang ditempatkan di Jalan Mumah Purba, 96TPS di Jalan Abdul Kadir, 38 TPS di Nabung Surbakti, 36 TPS di Jalan Sudirman, 16 TPS Komplek Konen Kabanjahe Plaza di lantai dasar, 66TPS di Komplek Konen dan 151 TPS di Kabanjahe Plaza. Sisanya 90 unit TPS belum dibangun. (c06)

PEMATANGSIANTAR (Waspada): Dewan Pengawas PDAM Tirtauli Kota Pematangsiantar periode 2009-2012 diganti Walikota Hulman Sitorus, SE di tengah jalan atau belum selesai periodenya hingga Dewan Pengawas yang diganti itu menyatakanWalikota akan digugat ke PTUN. “Penggantian itu tidak sesuai dengan Permendagri Nomor 2 tahun 2007 tentang organ dan kepegawaian PDAM dan sudah melanggar hukum. Keberadaan Dewan Pengawas dan Direksi PDAM periodik yakni tiga tahun dan empat tahun,” sebut Dewan Pengawas PDAM Tirtauliperiode2009-2012terdiriMidukPanjaitan, SH selaku Sekretaris, Polin RF Sinaga, ST, Ir. Bonatua dan Hendri Dunan Sinaga, SP kepada sejumlah wartawan, Rabu (10/11). Sementara, KetuaDrsJonsonSimanjuntak,MSibelumdapat dihubungi. Seperti diketahui, Walikota diwakili Sekda Drs. Donver Panggabean, MSi melantik Dewan Pengawas PDAM Tirtauli yang baru terdiri Ketua Leonardo Simanjuntak, SH.MHum, Sekretaris Fery SP Sinamo, SH, anggota Drs. TJ Sihombing, Andi Azhari, SH dan Drs. Wesly Nainggolan di ruang rapat PDAM Tirtauli, Rabu (10/11). Pelantikan itu turut disaksikan direksi PDAM Tirtauli terdiri Dirut Badri Kalimantan, SE, MM, Dirum Hotner Simanjuntak, SE dan Dirtek Ir. Robert Sibarani, Pengacara PDAM Tirtauli Ridwan Manik, SH.MH, para pejabat Pemko di antaranya Kabag Humas dan Protokoler Drs Daniel Siregar dan lainnya. Ketika hendak dikonfirmasi kepada Sekda tentangpenggantianitu,SekdadidampingiDirut PDAM Tirtauli tidak mau menjawab dan hanya menyodorkan pidato pelantikan untuk dibaca wartawan, padahal pidato itu sudah dibacakan saat pelantikan. Sekda akhirnya meninggalkan wartawan dengan menaiki mobil dinas pejabat lain dan bukan mobil dinasnya. Kabag Humas dan Protokoler yang dihubungi hanya mengatakan nanti akan dijawab dan turut pergi. Menurut Miduk Panjaitan, penggantian

itu tanpa pemberitahuan kepada mereka apalagi alasan penggantian mereka. “Penggantian itu jelas cacat hukum dan kami akan mengadakan perlawanan hukum sesudah SK pemberhentian sampai kepada kami. Sampai sekarang belum ada sampai kepada kami SK pemberhentian” Miduk turut mempertanyakan apakah Dewan Pengawas itu melanjutkan periode mereka atau periode baru, karena belum ada penjelasan. Menjawab pertanyaan, Miduk menyebutkan Dewan Pengawas bisa diganti meski belum habis periodenya kalau merugikan perusahaan atau berhalangan tetap. “Padahal, sesudah periode kami, PDAM Tirtauli yang selama ini terus merugi, saat ini sudah bisa beruntung meski dalam jumlah relatif kecil mencapai Rp 30 juta.” Selain itu, sebut Miduk, mereka sudah berhasil melakukan lobi ke pusat hingga PDAM Tirtauliakanmendapatkucurandanayangsudah diajukan ke Kementerian PU mencapai Rp 62 milyar. Menyinggung keterlibatan Direksi PDAM Tirtauli dalam penggantian itu, Miduk menegaskan sesuai pernyataan Direksi PDAM Tiirtauli yang dihubungi Selasa (9/11) malam, mereka tidak tahu menahu tentang penggantian itu dan merekamengatakanhanyadiperintahkanPemko membersihkan ruang rapat PDAM Tirtauli sebagai tempat pelantikan Dewan Pengawas baru. Menurut Miduk, sesuai informasi mereka terima, sesudah penggantian Dewan Pengawas itu akan dilakukan penggantian Direksi periode 2010-2014 dan Dewan Pengawas baru itu akan ditugaskan melakukan seleksi Direksi PDAM Tirtauli yang baru. Menjawabpertanyaan,Midukmenyebutkan perekrutan Dewan Pengawas yang baru dilantik itu pun tidak jelas, karena sesuai ketentuan, perekrutan dilakukan melalui pengumumanWalikota dan selanjutnya diseleksi serta berdasarkan ketentuan itu personil Dewan Pengawas berasal dari tiga elemen terdiri eksekutif, profesional dan pelanggan. “Selama ini, kami tidak pernah mendengar ada pengumuman penerimaan Dewan Pengawas.”(a14)

Dirut RSUD Sidikalang Potong Gaji Staf Rp30 Ribu SIDIKALANG (Waspada): Untuk kegiatan Hari Kesehatan Nasional (HKN), Direktur Umum RSUD Sidikalang, Dairi, memotong gaji para stafnya Rp30 ribu per orang dan dari dokter umum Rp50 ribu per orang. Salah seorang staf di RSUD Sidikalang yang tidak bersedia disebut namanya mengatakan, uang tersebut langsung dipotong dari gaji November 2010, tanpa ada koordinasi atau pemberitahuan sebelumnya. Dikatakan, untuk kegiatan HKN tahun ini, sudah ditampung dalam APBD Dairi. Namun gaji staf masih saja disunat oleh direktur umum, tanpa ada pemberitahuan. Disebutkan, pemotongan gaji itu bukan saja hanya dialami yang bertugas di RSU. Tetapi petugas di berbagai Puskesmas termasuk Puskesmas pembantu dan Pustu, semuanya berjumlah sekitar 370 orang ikut merasakan pemotongan gaji itu.

Direktur Umum RSUD Sidikalang dr Daniel Sianturi dikonfirmasi Waspada, Rabu (10/11) lewat telefon selularnya mengakui memang ada pemotongan gaji tersebut sebanyak Rp30 ribu dari staf dan dari dokter umum Rp50 ribu per orang. Daniel mengatakan, pemotongan untuk disumbangkan kepada seluruh pasien berupa buah,jenisapeldanjerukmanissebagaibingkisan dalam rangka memperingati HKN yang jatuh pada 10 November 2010. Dikatakan, pemotongan gaji itu atas kesepakatan panitia HKN. Ketika ditanya untuk kegiatan HKN sudah ditampung dalam APBD Dairi, namun masih dibebankan kepada staf dan dokter, Daniel Sianturi mengatakan, dana yang ditampung dalam APBD terlalu sedikit dan tidak cukup untukmembiayaiseluruhkegiatanHKN.Ditanya berapa besar dana yang ditampung dalam APBD, Daniel Sianturi tidak dapat menjawab. (a28)

Sejak Mei-Oktober 2010, Polres Binjai Tangani 10 Kasus BINJAI (Waspada) : Polres Binjai Unit Reskrim sejak 22 Mei hingga 26 Oktober 2010 menangani sebanyak 10 kasus kriminal dengan 15 tersangka yang terlibat dalam kasus perjudian Togel (Toto Gelap) Singapura dan judi Kim, kasus pencurian dan kasus penggelapan. Hal tersebut dikatakan Kapolres Binjai AKBP Dra Rina Sari Ginting melalui Kasat Reskrim AKP Ronni Bonic didampingi KBO (Kaur Bin Ops) Iptu Robin Ginting, Selasa (9/11) di Polres Binjai. Menurut Kasat, untuk kasus judi Togel Singapura dan Kim, pihaknya terus memburu para tersangka baik Jurtul (Juru Tulis) dan agen serta bandar, namun untuk mengungkapkan kasus ini selalu putus di tengah jalan karena Jurtul tidak pernah mengaku siapa agen mau pun bandarnya. Kasus penggelapan sepeda motor dengan

lima tersangka masing-masing SB, KB alias Ilul, AW, BMS alias Budi serta S alias Man dengan barang bukti 5 unit sepeda motor sebagai modus oprandi mereka mengambil sepeda motor di showroom dan digadaikan tanpa BPKB dan STNK. Kemudian kasus penggelapan sepeda motor lainnya dengan tersangka IS alias Indra, 30, warga Pasar IV Namotrasi, Sei Bingai, dengan barang bukti satu unit sepeda motor Yamaha Vixson BK 5538 RA korbannya Ade Pramana. Kasus perjudian jenis Togel Singapura sebanyak 3 kasus dengan tersangka 3 orang, masing-masingYbrS,30,wargaSeiBingai.Barang bukti 2 lembar kupon Togel Singapura uang Rp260.00, KF alias Ello, warga Binjai Barat, barang bukti 1 blok kupon judi Togel Singapura dan uang Rp73.000. (a04)


Sumatera Utara

WASPADA Jumat 12 November 2010

PDIP Sering Kecewa Terhadap Kader Waspada/Sukri Falah Harahap

ZIARAH: WakilWalikota Padangsidimpuan Mara Gunung Harahap menabur bunga ke pusara salah seorang pahlawan di Taman Bahagia, Rabu (10/11).

Walikota P.Sidimpuan: Mari Atasi Masalah Bangsa P.SIDIMPUAN (Waspada):Walikota Padangsidimpuan Zulkarnain Nasution mengajak seluruh rakyat bangsa ini untuk menjadikan peringatan Hari Pahlawan 2010 sebagai awal penyelesaian semua persoalan bangsa. Karenadengansemangatjuangparapahlawanyangrelaberkorban jiwa raga dan harta demi kemerdekaan, diyakini segala persoalan yang dihadapi bangsa ini akan terselesaikan satu per satu. Zulkarnain Nasution menyampaikan itu dalam amanat tertulis yang dibacakan Sekretaris Daerah Sarmadhan Hasibuan, pada resepsi peringatan Hari Pahlawan 2010, Rabu (10/11). “Mari jadikan hikmah peringatan Hari Pahlawan ini sebagai inspirasi mengatasi masalah kebangsaan.Sepertikemiskinan,pengangguran,kesehatan,pendidikan, narkoba, terorisme dan konflik kerusuhan antar warga,” katanya. Wakil Walikota Padangsidimpuan Mara Gunung Harahap saat membacakan amanat Menteri Sosial mengatakan, bangsa yang besar adalah bangsa yang menghargai jasa para pahlawannya. Sebelumnya, rombonganWakilWalikota melaksanakan upacara dan tabur bunga di Taman Bahagia Makam Pahlawan. Upacara dipimpin Wakapolres Kota Kompol Maradolok Siregar. Kemudian dilakukan penyerahan bingkisan kepada para veteran dan janda veteran. (a20)

P. SIANTAR (Waspada): PDIP sudah sering kecewa terhadap para kader yang bergabung dengan PDIP hanya untuk mencari kedudukan dan kekuasaan serta keluardariPDIPsesudahberhasil. “Sesuai pesan Ketua Umum DPP PDIP, Ibu Megawati Soekarnoputri, dalam pembentukan pengurus periode 2010-2015 di tingkat anak ranting atau lingkungan, tingkat ranting atau kelurahan dan anak cabang atau kecamatan di Kota Pematangsiantar, tidak diperlukan lagi para kader seperti itu,” sebut Ketua DPC PDIP Pematangsiantar Timbul M Lingga, SH melaluiWakil Ketua Bidang Infokom Togi Siregar, Wakil Ketua Bidang Hukum dan HAM Amri Simanjuntak, SE dan Bendahara Rudel Sipayung, SPd di kantor DPC PDIP, Jalan Ricardo Siahaan, Kamis (11/11). MenurutTogi, DPC PDIP Pematangsiantar mentargetkan pembentukanpengurusditingkat bawahitumulaidarianakranting, ranting dan anak cabang selesai akhir Desember 2010. “Anak ranting akan dibentuk sebanyak 106 ranting dari sebelumnya masih 10 anak ranting, 53 ranting dari 48 anak ranting yang sudah adadandelapananakcabangdari sebelumnya masih enam anak

cabang. Target itu pasti bisa tercapai.” Togi menjelaskan target itu sesuai SK DPP PDIP Nomor 002A/TAP/DPP/VI/2010 Bab XVI Pasal 30 (3) yang menyebutkan pembentukan anak ranting, rantingdananakcabangharusselesai pada akhir bulan Desember 2010. “DPC PDIP Pematangsiantar sudah selesai melaksanakan sosialisasi SK 002-A kepada seluruh pengurus, baik tingkat ranting maupunanakcabangakhirOktober 2010. SK 002-A itu merupakan petunjuk teknis pelaksanaan musyawarah anak ranting, ranting dan anak cabang.” Amri menambahkan pola pembentukanpengurussekarang sistembottom upatau dari bawah dulu dibentuk dan sesuai pola itu hingga bila belum ada anak ranting, tidak akan ada ranting dan bila belum ada ranting, tidak akan ada anak cabang. “Pengurus anak ranting sebanyak-banyaknya tujuh orang yang berhak mengusulkan satu calon ketua rantingdanbeberapanamacalon ketua anak cabang serta menetapkantigautusankemusyawarah ranting. Sementara, pengurus ranting maksimal 9 orang dan anak cabang maksimal 11 orang.” Menjawab pertanyaan, Amri

menyebutkan sesuai SK 002-A, PDIP saat ini sudah menjadi partaiterbukadanmenjadipengurus tidak harus sudah menjadi anggota selama empat tahun. PDIP sudah terbuka dengan adanya kemajuan terhadap datangnya orang-orang yang mau bergabung bersama PDIP.” Menyinggung tentang beberapa pengurus anak cabang tidak sejalan dengan pengurus DPC PDIP saat pembentukan pengurus DPC PDIP periode 2010-2015,

2 Truk Angkut Kayu Diamankan

Amri menyebutkan, sepanjang anggota tidak membuat pelanggaran,tidakadalaranganmenjadi pengurus. Namun, bagi anggota atau pengurus yang sudah pernah mendapat peringatan melalui rapat pleno pengurus saat ini, sesuai SK 002-A seluruh pelanggaran yang dilakukan diselesaikan didalamkongresdantidakseperti dulu pelanggaran di tingkat anak cabang diselesaikan di tingkat cabang. (a14)

KABANJAHE (Waspada) : Polres Tanah Karo mengamankan dua truk bermuatan kayu di Jalan Lintas Kabanjahe-Berastagi, berikut kernet dan sopirnya, karena diduga tidak memiliki dokumen lengkap, Senin (8/11) malam. Informasi yang diperoleh di kepolisian, kedua truk bernopol BK 8140 LK dan B 8831 JN membawa kayu dari Desa Tingga Lingga hendakmenujuMedan.NamunketikamelintasdijalanrayaKabanjaheBerastagi kedua truk tersebut dihentikan aparat kepolisian saat melakukan razia. Ketika petugas memeriksa dokumen kelengkapan kayu yang dibawa, ternyata sopir dan kernet tidak dapat memperlihatkan dokumen yang diminta. Untuk pengusutan lebih lanjut, aparat kepolisian memboyong kedua truk itu ke Mapolres Karo. Kapolres Tanah Karo melalui Kasat Reskrim AKP Lukmin Siregar ketika dikonfirmasi wartawan melalui telefon selularnya, Selasa (9/11) mengakui pihaknya mengamankan dua truk bermuatan kayu itu. “Namun setelah diperiksa ternyata memiliki dokumen lengkap dari Dinas Kehutanan Karo. Kayu yang dibawa bermuatan jati putih. Jadi hanya sebatas pelanggaran administrasi saja,” katanya. (c06)


WASPADA Jumat 12 November 2010


Siswa Kesurupan SMPN I Tapaktuan Libur TAPAKTUAN (Waspada): Karena tak tahan siswinya sering kesurupan diduga diganggu roh jahat yang gentayangan, SMPN 1 Tapaktuan, Kabupaten Aceh Selatan terpaksa meliburkan selama tiga hari.

Waspada/Syahrul Karim

Walikota Langsa Drs Zulkifli Zainon, MM menyerahkan secara simbolis bantuan/santunan kepada dua anggota veteran Kota Langsa di Upacara Peringatan Hari Pahlawan di halaman kantor Pemko Langsa, Rabu (10/11).

50 Anggota Veteran Kota Langsa Dapat Bantuan Di Hari Pahlawan LANGSA (Waspada): Peringatan Hari Pahlawan tahun 2010, telah memberi arti tersendiri bagi anggota veteran di Kota Langsa. Mereka tidak hanya diundang untuk mengikuti acara seremonial seperti tahun-tahun lalu, tetapi warga pejuang kemerdekaan ini juga menerima bingkisan dariWalikota Langsa Drs Zulkifli Zainon, MM yang menjadi pembina upacara pada Hari Pahlawan di halaman Kantor Pemko Langsa, Rabu (10/11). “Veteran telah berbuat untuk negeri ini. Jasa mereka kepada bangsa sangatlah besar sehingga mereka layak mendapat penghargaan. Pahlawan adalah bagian yang tidak terpisahkan dari sejarah lahirnya Republik Indonesia dan kehidupan bangsa termasuk anggota veteran yang telah berjuang membela Negara,” ujarnya seusai acara.

Dalam hubungan tersebut, Pemerintah Kota (Pemko) Langsa memberikan bingkisan berupa bantuan uang tunai kepada setiap anggota veteran yang ada di Kota Langsa. Bantuan yang diberikan per orang senilai Rp500.000 yang diserahkan pada acara peringatan Hari Pahlawan di halaman kantor Walikota. “Seluruhnya, ada 50 orang,” kata H. Sahar, pejabat Dinsos yang menangani pemberian santunan tersebut. Menurut catatan dan sesuai dengan keterangan Kabid Pemberdayaan dan Bantuan Sosial Kantor Dinsos Kota Langsa H. Sahar bahwa bantuan kepada anggota veteran ini merupakan yang pertama kali diberikan Pemko Langsa. Selama ini mereka hanya diundang saja pada hari upacara, tetapi tahun ini Pemko menyantuni mereka. (b26)

SPBU Sering Kehabisan Stok SINGKIL (Waspada): Sentral Pengisian Bahan Bakar Umum (SPBU) di Kabupaten Aceh Singkil, terutama jenis premium dilaporkan sering kehabisan stok BBM, namun di sejumlah kios pengecer minyak yang berlokasi di sekitar SPBU, masih tersedia. Pertamina Aceh dan badan pengawas SPBU diminta untuk melakukan inspeksi. Pantauan Waspada, Rabu (10/11) di SPBU Singkil yang berlokasi di sekitar Bundaran Kampung Pulo Sarok, bahan bakar minyak (BBM) jenis bensin kehabisan stok yang ditandai dengan penulisan tanda “habis”. Selain kualitas BBM yang diragukan, harga jual di kios mengalami kenaikan harga mencapai 35 persen, “Kalau di SPBU harga bensin Rp4.500 per liter di kios pengecer senilai Rp6. 000 bahkan kalau semakin lama SPBU tidak punya stok harga tersebut bisa lebih tinggi lagi,” ujar Dedi di Singkil, Rabu (10/11).

“Takaran atau argo liter dan kualitas minyak SPBU disini juga harus diawasi pihak berkompeten agar konsumen tidak dirugikan,” usul Acu warga Pulo Sarok, Singkil sebelumnya. Hal serupa juga sering terjadi di Rimo dan Lipat kajang, dua lokasi terpisah SPBU yang ada di Kabupaten Aceh Singkil. Selain seringnya kehabisan stok yang mengecewakan konsumen, warga di sana juga meminta Pertamina Aceh dan Badan pengawas SPBU untuk melakukan inspeksi agar fungsi SPBU milik umum tersebut lebih meningkatkan pelayanan mereka. Bahkan BBM SPBU bersubsidi di Aceh Singkil ditenggarai warga sebagian diselewengkan oknum dan kelompok tertentu. “Anehnya sejumlah kasus yang menyimpang itu tidak pernah diproses hukum hingga ke meja hijau, sehingga terkesan tidak ada membuat efek jera,” kata Putra mengkritisi. (b30)

Langkah itu dilakukan berdasarkan saran para normal dan hasil musyawarah para dewan guru. “Setelah bermusyawarah dengan dewan guru, kami berinisiatif meliburkan sekolah mulai 9 s/d 11 November 2010,” ujar M. Yusuf Ibrahim, S.Pd, Kepala SMP 1 Tapaktuan, kepada wartawan di Tapaktuan, Kamis (11/11). Menurut dia, kebijakan meliburkan sekolah ini, sudah dilaporkan ke Dinas Pendidikan Aceh Selatan. Ia berharap kondisi sekolah dapat normal kembali

pasca libur tiga hari ini. Liburan ini juga dimaksudkan dalam rangka pengusiran roh halus oleh para normal, yang keberatan dipublikasikan identitasnya. Kesurupan yang menimpa ratusan siswa itu terjadi dalam dua pekan terakhir.Diduga karena dirasuki roh jahat bergentayangan, karena di dalam komplek sekolah ini terdapat kuburan orang Belanda tempo doeloe. “Kami sudah berusaha menangani masalah itu dengan melakukan pengajian yasin, doa bersama dan meminta bantuan paranormal (dukun), diduga iblis yang bernaung di lokasi sekolah sangat keras,” ucapnya. Menurut M. Yusuf, dalam bulan ini saja sudah tujuh dukun melakukan usaha pengusiran roh jahat, namun belum ada perubahan. Akibatnya proses belajar mengajar tidak maksimal dilaksanakan, karena setiap pagi mulai jam 07:30 hingga 10:00, selalu disibukkan dengan

peristiwa kesurupan, dengan jumlah korban 10 sampai 20 siswa. Dari informasi yang diperoleh menurut ilmu kebathinan, penyebab terjadinya kesurupan di sekolah itu, karena adanya pengaruh roh jahat bergentayangan dan sudah mendiami salah satu pohon yang terdapat di pekarangan sekolah. Saat ini pohon itu sudah ditebang. M. Yusuf mengakui, peristiwa ini memang sudah menahun, dewan guru dan wali murid resah, siswa-siswi dihantui ketakutan akibat sering penampakan makluk halus berkulit hitam, tinggi basar dan berwajah seram. Indikasi pengaruh roh jahat itu bisa berakibat badan pegal, lemas, seperti ditindih beban berat, hilang kesadaran bahkan berteriak histeris dan meronta-ronta. Herannya, pelajar yang terkena kersurupan di rumah, malah sembuh ketika dibawa ke sekolah.(b19)

Cuaca Buruk, Nelayan Nekat Melaut IDI RAYEUK, Aceh Timur (Waspada): Meski cuaca buruk dan tidak menentu serta kerap mengancam Selat Malaka, namun ribuan nelayan di Dermaga Kuala Idi, Kabupaten Aceh Timur, tetap melaut mengingat tanggungjawab ekonomi keluarga. “Nelayan tatap melaut di Kuala Idi, padahal kondisi laut belakangan amat mengancam Selat Malaka. Buktinya, bebeberapa hari yang lalu KM Victory, tenggelam akibat hantaman ombak dan angin kencang,” ujar Sekjen Panglima Laot Lhok Idi, Heri kepada Waspada, Kamis (11/11) di Idi. Kata dia, nelayan di pesisir pantai Kuala Idi, Kabupaten Aceh Timur, nekat melaut meski Badan Meteorologi Klimatologi dan Geofisika Aceh, telah me-

ngeluarkan larangan melaut karena cuaca buruk dan gelombang tinggi, dalam beberapa pekan terakhir di Aceh. Menurut Heri, para nelayan tetap melaut untuk memenuhi kebutuhan hidup sehari-hari. “Nelayan hanya mencari nafkah dengan mencari ikan di laut,” kata heri seraya menambahkan, belakangan gelombang tinggi di perairan Selat Malaka terjadi sejak dua pekan lalu. Dia menyebutkan, akibat cuaca buruk di laut lepas, dalam beberapa hari terakhir nelayan tidak berani mengemudikan perahunya ke tengah laut, karena khawatir kapal tenggelam, sebagaimana terjadi beberapa waktu lalu satu unit kapal nelayan milik H. Zaini, tenggelam di perairan Kab. Aceh Tamiang. Akibat ketakutan nelayan,

lanjut Heri, hasil tangkapan nelayan merosot mencapai 40 persen. “Hasil tangkapan menurun. Kondisi ini telah terjadi sejak dua pekan yang lalu, dan hal ini terus berlaku selama musim penghujan tiba antara Oktober, November dan Desember,” sebut Heri seraya menandaskan, terkait cuaca buruk pihaknya tidak dapat berbuat apapun, kecuali hanya mengingatkan nelayan untuk waspadai ombak dan angin kencang di laut. Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui Kasat Pol Air, Aiptu Zainir ketika dikonfirmasi Waspada kemarin secara terpisah membenarkan, kondisi laut belakangan sulit diprediksi. Meski cuaca buruk, namunnelayantetapmalautkarena terbentur faktor ekonomi.(cmad)

DPRK Agara Rotasi Pimpinan Komisi KUTACANE (Waspada): Untuk proses pemerataan dan demokrasi, lembaga DPRK, Kamis (11/11) akhirnya sepakat melakukan rotasi dan menetapkan kepemimpinan komisi sebagai alat kelengkapan dewan. Pembacaan keputusan komisi-komisi di hadapan pimpinan dan Ketua Fraksi, Ketua Banleg, Banmus, Banggar dan BK DPRK tentang susunan pimpinan dan anggota komisi baru itu, disampaikan langsung oleh Ernita, BuhariSelian,Ir.BudimansyahdanIrwandiDesky. Adapun keputusan komisi-komisi yang telah ditetapkan pimpinan DPRK tersebut yaitu, Ketua Komisi A dipercayakan kepada Erda Rina Pelis SP menggantikan ketua lama Ernita dari Partai Golkar. Ketua Komisi B dipercayakan kepada Hj. Samsiar dari Partai Patriot, menggantikan ketua lama Rasidin, S.Ag, Ketua Komisi C dipercayakan kepada Abdul Malik dari Partai Golkar menggantikan Ir. Budimansyah dari Partai Aceh dan Ketua Komisi D dijabat H. Marhusin Beruh dari Partai PDK menggantikan Ketua lama M. Fahrian dari Partai Demokrasi Pembaruan. Ketua DPRK HM. Salim Fakhri, SE. MM didampingi Wakil Ketua Drs. H. Syahbuddin. BP dalam sambutannya mengatakan, rotasi

pimpinan di komisi-komisi sebagai alat kelengkapan dewan merupakan kesepakatan awal 25 anggota DPRK terpilih periode 2009-2014. Sebab itu, kesepakatan merotasi dan melakukan pergantian pimpinan di komisi secara bergiliran untuk masa jabatan satu tahun sekali, merupakan agenda dari DPRK yang harus dilaksanakan. “Saya percaya ketua, wakil ketua dan sekretaris komisi–komisi yang telah diputuskan dan ditetapkan ini, akan mampu bekerja baik, bila ada program pimpinan komisi sebelumnya, belum sempurna, maka selayaknya disempurnakan, tapi bila kurang sudah baik, maka dilanjutkan kembali,” ujar Fakhr mengingatkan. Ke depan, tugas pimpinan komisi sebagai alat kelengkapan dewan semakin berat dan membutuhkan energi serta pengabdian yang lebih, karena masih banyak agenda dan tugas penting dewan yang harus segera diselesaikan, mengingat tugas itu berdampak luas bagi masyarakat dan daerah. Fakhri mengatakan, masih ada tiga agenda besar yang masih menunggu untuk dibahas dan diselesaikan dewan, tugas tersebut yaitu Rancangan Perhitungan APBK 2009, Rancangan Perubahan APBK 2010 dan Rancangan ABPK 2011.(b27)

GAMBA GEUTANYO > Neu poto keujadian meunarek ngon kamera HP 3,2 mega piksel, kirem ngon MMS keu 08192110147. Na imbalan pulsa 20 ribee keu poto nyang di peuteubit.


Manajemen RSUD Nagan Raya foto bersama pihak Caritas Swiss, Anggota DPRK Nagan Raya, lembaga pendamping dari Yayasan Ekosistem Lestari (YEL), dan mantan anggota DPD-RI Adnan NS, Selasa (9/11).

RSUD Nagan Raya Bakal Jadi Rujukan Pantai Barat Selatan NAGAN RAYA (Waspada): RSUD Kabupaten Nagan Raya yang dulunya hanya sebuah Puskesmas Ujong Fatihah, saat ini telah menjelma menjadi rumah sakit yang sangat modern dan lengkap. Bahkan para medis serta manajemennya juga telah mendapatkan pelatihan secara khusus, sehingga diharapkan mampu memberikan pelayanan kesehatan terbaik kepada para pengunjung. Ke depannya RSUD Nagan Raya ini diharapkan dapat menjadi pusat rujukan di wilayah Pantai Barat Selatan Aceh, demikian paparan salah seorang pencetus pendirian RSUD Nagan Raya, yang juga mantan anggota DPD-RI, Adnan NS, usai evaluasi bersama, dihadiri Caritas Swiss selaku donator dan juga lembaga yang menjadi pendukung utama pembangunan RSUD Nagan Raya, pihak manajemen RSUD, anggota DPRK Nagan Raya, serta Yayasan Ekosistem Lestari (YEL) sebagai lembaga pendamping, Selasa (9/11). Menurut Adnan.NS, dipilihnya Nagan Raya sebagai lokasi pendirian RSUD yang berfasilitas modern dan berstandar international tersebut lebih disebabkan faktor geografis dan strategis. “Karena paska tsunami yang melanda Aceh pada 2004 silam, seluruh kawasan Aceh nyaris berada di area rawan bencana. “Sehingga pemilihan lokasi untuk bangunan publik seperti Rumah Sakit tentu diharuskan di lokasi yang aman dan memiliki akses yang mudah dengan masyarakat,” papar Adnan. Bettina Iseli, dari Caritas Swiss yang juga Program Coordinator untuk Indonesia, menjelaskan bahwa pembangunan RSUD Nagan Raya tersebut telah menghabiskan dana Rp45 miliar. (sdp)

Bupati Aceh Timur Minta PNS Tingkatkan Pengetahuan LANGSA (Waspada): Bupati Aceh Timur Muslim Hasballah mengatakan Pegawai Negeri Sipil (PNS) memegang peran penting dan sangat strategis dalam mengemban tugan pemerintahan dan pembangunan. Sebab itu, dukungan sumber daya manusianya bagi seorang aparatur sengatlah dibutuhkan dan menjadi unsur utama agar mampu bekerja secara maksimal dalam mengemban tugas-tugas secara keseluruhan. “Sosok PNS yang diharapkan adalah aparatur yang memiliki kompetensi yang sangat memadai,” tandas Bupati Aceh Timur yang diwakili Asisten Administrasi Umum Sekdakab Abdul Munir, SE dalam sambutannya pada acara pembukaan pendidikan dan latihan (Diklat) Prajabatan angkatan XI dan XII untuk GolonganIII di Aula SKB Langsa, Rabu (10/11). Kompetensi dan pengetahuan yang lebih memadai ini, terkait upaya mencapai tujuan nasional sebagaimana disebutkan dalam pembukaan UUD 1945. Tujuan yang ingin diwujudkan antara lain memajukan kesejahteraan umum dan mencerdaskan kehidupan berbangsa. Menurut Bupati Aceh Timur, pendidikan dan latihan (diklat) pra jabatan wajib diikuti bagi calon PNS. Diklat prajabatan bagi CPNS golongan-III tersebut, menurut Kepala BKPP Aceh Timur Bustami, SH, dilaksanakan dua tahap dengan total jumlah peserta 120 orang. “Semua peserta ini sudah golongan-III,” kata Bustami yang didampingi dua Kabidnya Syahnan dan Sofyan Hadi. (b26)

Bupati Dan DPRK Agara Tinjau Asrama Mahasiswa Di Medan

Waspada/Muhammad H. Ishak

MELAUT: Satu unit kapal ikan terlihat keluar dari muara Dermaga Kuala Idi, Kab. Aceh Timur, Kamis (11/11) pagi. Meski cuaca buruk, namun nelayan di sana tetap melaut.

Direktur RSUD Singkil: Tak Ada Mal Praktek SINGKIL (Waspada) : Direktur Rumah Sakit Umum Kabupaten Aceh Singkil membantah kalau rumah sakit yang dipimpinnya melakukan mal praktek. ”Tidak benar kalau terjadi mal praktek,” ujar Drg. Nasrul yang dikonfirmasi Waspada, Kamis (12/11) di Kantor Bupati Aceh Singkil. Menurut Nasrul, mal praktek merupakan perbuatan yang melanggar hukum dan tidak terpuji apalagi terjadi di RSU Pemerintah, sebab merupakan pelanggaran kode etik bagi profesi seorang dokter. ”Apabila itu dilakukan harus ditindak, namun itu tidak pernah terjadi di Rumah Sakit Umum Aceh Singkil,” bantahnya.

”Apa yang disampaikan pasien ataupun Wakil Bupati Aceh Singkil H. Khazali saat Sidak kemarin (11/11) itu, tidak benar sama sekali,” katanya menambahkan, ”Karena siapa pun dokter yang menangani pasien tau persis obat apa yang akan diberikan, begitu juga dengan penyakit, dokter akan akan menyampaikan setelah dilihat dari hasil laboratorim. Jadi tidak sembarangan,” ujarnya Menanggapi masalah kasus yang menimpa Agam, warga Rimo, pasien yang divonis terkena DBD akibat salah memberikan obat yang di dalam infus terdapat nyamuk, Nasrul mengatakan akan mempelajarinya dulu. ”Karena kita harus menca-

ri kebenarannya kepada dokter yang menangani pasien. Yang jelas tidak benar kalau terjadi mal praktek,” sebutnya lagi. Sebelumnya Wakil Bupati Aceh Singkil H. Khazali yang ditemui Waspada di tempat yang sama mengatakan sudah memanggil Direktur RSUD Aceh Singkil untuk hadir, Kamis (11/ 11). ”Jika terbukti terjadi mal praktek di RSUD Aceh Singkil akan kita tindak tegas dan ini tidak main–main,” ujar Wabup yang langsung menuju mobilnya untuk menghadiri acara di Makodim 0109/Singkil. Agam, pasien DBD yang diduga menjadi korban mal praktek RSUD Aceh Singkil kemarin langsung dirujuk ke RS di Medan.(cb02)

MEDAN (Waspada): Bupati dan DPRK Aceh Tenggara (Agara) meninjau asrama mahasiswa Aceh Tenggara yang ada di Jl. Pelajar Gg Alas No 12 Medan. Rombongan ini juga meninjau beberapa lokasi tanah yang direncanakan untuk pembangunan asrama putra bagi mahasiswa Agara yang sedang kuliah di Medan. Bupati Aceh Tenggara Ir H Hasanuddin B MM, Rabu (10/11) mengatakan pihaknya menaruh perhatian yang sangat besar terhadap mahasiswa-mahasiswa asal Aceh Tenggara yang sedang menuntut ilmu di Kota Medan. “Kami tidak ingin mahasiswa Aceh Tenggara yang sedang menuntut ilmu di Medan ini terlantar ataupun terputus kuliahnya. Oleh karena itu Pemkab Aceh Tenggara sangat mendukung realisasi rencana pembangunan asrama putra untuk mahasiswa asal Aceh Tenggara,”papar Bupati Aceh Tenggara yang menyebutkan asrama mahasiswa Aceh Tenggara di Jl. Pelajar, Gg Alas Medan sudah saatnya dikembangkan karena tidak lagi dapat menampung mahasiswa Aceh Tenggara yang kuliah di Medan. Bupati Aceh Tenggara yang didampingi Ketua DPRK Aceh Tenggara M Salim Fakhri, Ketua Fraksi Partai Golkar H Wadjidun P, Kepala Dinas Pengairan Aceh Tenggara Ir M Husein, Kepala Bappeda Jarwansah S.Pd MAP MM, Kepala Rumah Sakit Umum Aceh Tenggara dr Bukhori SpPD, Camat Lawe Sigala-gala Drs M Ridwan berkunjung ke Medan selain untuk meninjau asrama mahasiswa Aceh Tenggara, juga menghadiri halal bi halal sesama warga Aceh Tenggara di perantauan khususnya Kota Medan yang diselenggarakan oleh Sepakat Segenep Keluarga Kutacane Aceh Tenggara (SKKAT) Menurut Ketua SKKAT Medan Sumut Drs Syamsul Bahri Selian, menyebutkan tidak ada istilah terlambat, namun halal bi halal Sepakat Segenep Keluarga Kutacane Aceh Tenggara - Medan Sumatera Utara yang diselenggarakan di Hotel Semarak International menjadi lebih bermakna dengan kehadiran Bupati Aceh Tenggara, Ketua DPRK Aceh Tenggara dan beberapa Kepala Dinas dan anggota DPRK di Aceh Aceh Tenggara. (m29)

Efisiensi Ubah Trase Lingkar Berpotensi Beragam Makna


Warga melintas di jalan yang tergenang air di Kota Langsa setelah diguyurhujan satu jam,Rabu 10/11). Pengirim Munawir Sazli, Aceh Timur,0813970987xx

JIKA satu tim work melaksanakan sebuah proyek dengan anggotanya berasal dari berbagai disipilin ilmu dan keahlian, efesiensi bisa menjadi sebuah kata beragam makna. Apalagi kalau sudah masuk muatan kepentingan, efesiensi malah dapat berbeda tipis dengan pemborosan, kolusi, korupsi dan nepotisme (KKN). Panitia pembebasan tanah untuk jalan lingkar Kota Langsa telah membuktikan hal itu, demi untuk “efesiense” panitia rela meminggirkan hasil survei tim ahli dan menggantinya dengan hasil survei sendiri. Sekda Kota Langsa, Syaifullah, SH, MM, MH secara implisit membenarkan hal itu. Dalam klarifikasinya terhadap berita Waspada “Warga Minta Pembebasan tanah Jalan Ling-

kar Jangan Dimanuplasi,” (Jumat/5/11), dia menjelaskan tidak dipakainya hasil survei tim ahli dari Dinas PU karena efisiensi.“Ubah Trase Lingkar, Efesiensi Anggaran,” demikian judul berita yang kembali dilansir Waspada, Selasa (9/11) sekaligus sebagai jawaban Sekda terhadap berita protes warga sebelumnya. “Efisiensi” model seperti ini sebenarnya bukanlah hal baru terjadi di Kota Langsa. Bahkan sebelum Kota Langsa berdiri sendiri masih bergabung dengan Kabupaten Aceh Timur pun sudah banyak efisiensi-efisiensi lain yang dilakukan. Hasil dari efisiensi-efisiensi itu hingga kini masil terlihat dan masyarakat dipaksa mengurut dada serta menanggung akibatnya. Contoh-contoh efisiensi yang sudah lalu cukup banyak.

Antara lain yang terbesar Proyek Pembangunan Terminal Terpadu Langsa,demi efisiensi,tempat warga Kota Langsa menunggu kenderaan umum untuk berangkat keluar kota itu dibangun pada jalur “strategis” yang banyak menimbulkan masalah. Sehingga sampai sekarang para penumpang yang naik maupun turun bus masih enggan menggunakannya. Demikian juga pembangunan Proyek Tempat Pendaratan Ikan (TPI) di Desa Birem Puntong, karena alasan efisiensi akhirnya menjadi pembangunan yang mubazir. Pembangunan kantor Camat Langsa Baro lain lagi, karena alasan efesiensi saat pembebasan lahan, sekarang kantor pelayanan masyarakat tersebut menjadi langganan banjir. Saat pembangunan

perumahan untuk warga reklamsi Pusong dilakukan reklamasi juga menjadi bahan pertimbangan,sehinggasetelahperumahan itu selesai, bertahun-tahun masalah pemindahan warga Pusong justru tidak bisa selesai. Jika efesiensi dan keindahan dipadukan, seperti alasan Sekda mengubah trase lingkar, pembangunan trotoar jalan A.Yani agaknya paling cocok menjadi contoh. Karena setelah trotoar baru itu dibangun langsung bisa digunakan para pedagang untuk berjualan. Dengan begitu nilai efesiensinya langsung terlihat, tanpa harus membangun toko retribusi pedagang bisa diperoleh dari trotoar. Kembali pada alasan efesiensi mengubah trase jalan lingkar, menurut Sekda Syaifullah, SH, MM, MH, bisa menghemat-

kan anggaran dan menambah keindahan. Yang menjadi pertanyaannya, kenapa sebelumnya tim ahli dari Dinas PU Kota Langsa harus dilbatkan dalam melakukan survei jika hasil yang merekarokomendasikanternyata tidak berencana untuk dipakai. Kita berharap efisiensi ini tidak akan berakhir seperti yang dilakukan mantan Kabag Umum TM. Tarkun ketika melakukan pengadaan komputer, karena akibatnya yang bersangkutan sekarang telah berurusan dengan hukum. Mudah-mudahan panitia pembebasan tanah untuk trase jalan lingkar kali ini bisa belajar dari pengalamanpengalaman masa lalu. Agar jangan sampai terjadi dengan alasan efisiensi malah menambah kerja pada masa mendatang. Ibnu Sa’dan



WASPADA Jumat 12 November 2010

Penculik Surveyor Divonis 2,5 Tahun

Bupati Pidie Jaya: Siswa Jangan Bolos

LHOKSUKON, Aceh Utara (Waspada): Majelis hakim Pengadilan Negeri Lhoksukon, Aceh Utara, Rabu (10/ 11) siang menjatuhkan vonis, masing-masing 2,5 tahun penjara untuk lima terdakwa penculik dua surveyor PT Arga Pasca Rencana (APR) yang terjadi di pesisir Kec. Seunuddon, Aceh Utara, beberapa bulan lalu. Majelis Hakim dipimpin Tauhari Tafsirin SH, menyatakan para terdakwa, terbukti bersalah karena dengan sengaja membawa dan menyekap paksa kedua korban secara melawan hukum. Selain hukuman penjara selama 2,5 tahun, majelis hakim juga mewajibkan para terdakwa membayar biaya perkara. Atas putusan ini, kelima tervonis, masing-masing Faisal alias Polo, Samsul Bahri alias Jol, M Al-Khalidi alias Jal bin A Gani, Rusli SPd alias Dekli bin Abdullah dan Zakaria alias Rio alias Riau bin M Yusuf, belum menyatakan banding. Majelis hakim memberi tenggang waktu selama dua pekan bagi para tervonis untuk memutuskan apakah menerima atau menolak putusan tersebut. Seperti diberitakan sebelumnya, dua surveyor PT Arga Pasca Rencana (APR), yang sedang meneliti kawasan pantai Seunuddon, diculik sekelompok orang di perairan Kuala Catok, Desa Teupin Kiyuen, Kecamatan Seunuddon, Aceh Utara. Tak lama berselang, polisi berhasil menangkap kelima tervonis di sejumlah tempat terpisah, termasuk di Peureulak, Aceh Timur. (cmus)

MEUREUDU (Waspada): Bupati Pidie Jaya Drs. H.M. Gade Salam mengingatkan pelajar tidak bolos sekolah dan duduk di warung kopi pada jam belajar. “Bila kedapatan ada pelajar nongkrong di warung kopi pada jam belajar, saya perintahkan camat dan seluruh anggota Muspika seluruh Pidie Jaya, menangkap mereka. Selanjutnya panggil guru dan wali murid. Bina mereka” tegas Gade Salam, saat meresmikan penegerian delapan sekolah yang dipusatkan di SMA Negeri Jangka Buya, Kamis (11/11). Mulai sekarang sebut dia, seluruh Muspika dalam Kabupaten Pidie Jaya diinstruksikan untuk melakukan patroli secara rutin. Patroli itu dilakukan jangan hanya pada jam belajar sekolah umum. Tetapi, pada jam-jam malam di saat pelajar melakukan pengajian juga diperintahkan untuk melakukan patroli. Sebab, pada saat jam pengajian anak-anak juga bolos dan memilih nongkrong di warung kopi. Bupati mengatakan, Pidie Jaya yang usianya masih seumur jagung jangan dirusak generasinya dengan narkotika, semisal ganja dan sabu-sabu. Sebab dari data yang diperoleh dirinya dari kepolisian, salah satu daerah di Pidie Jaya terkenal dengan sarang narkotika. Imej buruk itu harus segera diperbaiki atau ditinggalkan. “Jangka Buya, Bandar Dua dan beberapa kecamatan lain terkenal dengan daerah santri, karena banyaknya pesantren. Tetapi imej baik itu jangan dinodai dengan Narkotika, jauhi narkotika karena akan merusak generasi muda kita” sebut Gade. Pada kesempatan itu, bupati juga mengingatkan guru untuk tidak lagi meminta siswanya membeli rokok atau kopi. Sebab, itu sangat tidak mendidik. (b20)

Tenaga Kesehatan Puskesmas Sudah Lima Tahun Kerja Tanpa SK LHOKSEUMAWE (Waspada): 143 Tenaga kesehatan di sejumlah Puskesmas dalam wilayah Pemko Lhokseumawe bekerja tanpa melalui SK Walikota. Kendati mereka mulai mengabdi sejak 2003 lalu, namun tidak bisa diangkat sebagai pengawai negeri lewat jalur honorer. Koordinator Perawat Bakti Lhokseumawe, Said Khaidir ketika mendatangi gedung DPRK bersama ratusan tenaga kesehatan lainnya, Rabu (10/11), mengakui jumlah seluruh tengaa bahkti yang belum mendapat SK Walikota mencapai 192 orang. 143 diantaranya telah bekerja di atas lima tahun, bahkan di antara mereka bekerja sejak tahun 2003. “Sebagian besar dari kami sudah aktif bekerja di Puskesmas dan Pustu sebagai tenaga bakti sejak tahun 2003,” tegas dia yang menuntut bisa diangkat menjadi PNS, seperi honorer lainnya. Untuk menampung aspirasi para tenaga medis, DPRK menerima delapan orang wakil perawat di ruangan gabungan komisi. Pertemuan yang dipimpin Wakil Ketua DPRK Suryadi juga dihadiri Ketua Komisi-D bidang Kesehatan Tgk Abdul Aziz bersama sejumlah anggota dewan lainnya, Asisten III Setdako Lhokseumawe Arifin Abdullah, Kadis Kesehatan Sarjani Yunus, serta Kepala Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) Sabaruddin. Kepala BKPP Kota Lhokseumawe Sabaruddin menjelaskan, para tenaga bakti ini tidak memenuhi persyaratan untuk dimasukkan dalam data honorer yang akan menjadi CPNS. Sebab mereka tidak di-SK-kan oleh Walikota atau Kepala Dinas Kesehatan serta tidak memiliki daftar penerimaan gaji sejak tahun 2005. (b17)

70 Bendahara Di Setdakab Bireuen Ikuti Pelatihan SDM BIREUEN (Waspada): Untuk meningkatkan kemampuan dalam menjalankan tugas dan tanggung jawab sekitar 70 bendahara dilingkungan Setdakab Bireuen ikut pela-tihan peningkatan sumber daya manusia, selama tiga hari mulai 8-10 November di Oproom Sekdakab setempat. Ketua Panitia Pelaksana, Yusman SE melalui Kabag Humas, M.Zubair, SH kepada Waspada, Rabu (10/11), pelatihan yang dibuka Bupati Bireuen Nurdin Abdul Rahman itu bertujuan meningkatkan kemampuan para bendahara dalam pengelolaan keuangan. “Peserta terdiri atas bendahara penerimaan sebanyak 11 orang, bendahara pengeluaran 47 orang serta ditambah bendahara pembantu sebanyak 12 orang,” sebutnya. Sedangkan pemateri lanjut M Zubair, adalah Kadis Pengelolaan Keuangan dan Kekayaan Daerah, Drs Zulkifli. Kepala Bapedda Ir. Razuardi,MT dan Muzakkar A.Gani,SH Msi serta dari BKPP Banda Aceh.(amh)

Hewan Qurban Sepi Pembeli KOTA LHOKSEUMAWE (Waspada): Zulkifli, 40, salah seorang penjual hewan qurban kambing, yang mangkal di depan Bank Indonesia Lhokseumawe, Rabu (10/11), saat diwawancarai Waspada mengaku sepi pembeli. Harga kampingperekorberkisarantaraRp1,7jutahinggaRp2jutaan. “Sudah beberapa hari kami mangkal di sini, baru beberapa ekor kambing terjual. Kondisi ini sangat berbeda dengan tahun lalu. Tahun lalu, jumlah pembeli cukup banyak, sampai-sampai kami kekurangan kambing,” kata Zulkifli, warga Uteun Bayi dan mengaku rutin berjualan kambing untuk qurban setiap tahun di Lhokseumawe. Menjawab Waspada, Zulkifli mengatakan, kambing qurban sepi dari pembeli akibat melemahnya perekonimian warga. Kondisi ini dirasakan hampir semua orang. “Banyak yang bilang, tahun 2010 merupakan tahun yang paling sulit. Kami tidak tahu apa penyebabnya,” kata dia. Dari hasil pengamatan, jumlah kambing yang akan dijual Zulkifli mencapai sepuluh ekor dan telah dijejerkan di trotoar jalan. Dia berharap, semua dagangannya laku hingga menjelang hari raya Idul Azhar 1431 H. (cmun)

Waspada/Maimun Asnawi

KAMBING QURBAN: Sepuluh ekor kambing qurban dijejerkan penjual di trotoar jalan depan Bank Indonesia Lhokseumawe. Foto diabadikan kemarin (11/11).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *


Berangkat (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:35 JT 397 Medan/Jakarta 20:00 JT 307 Jakarta

06:40 12:15

12:55 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *

FY 3401 Penang ** 14:10 FY 3400 Penang “” * Setiap Senin, Rabu, Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

12:45 14:30

Waspada/Muhammad Riza

SMA JANGKA BUYA DINEGERIKAN: Bupati Pidie Jaya H.M.Gade Salam resmi menegerikan delapan sekolah swasta di daerah itu. Peresmian penegerian sekolah-sekolah itu dipusatkan di SMA Negeri Jangka Buya, Kamis (11/11).

RS Penuh, Pasien Terpaksa Dirawat Di Lorong LHOKSUKON, Aceh Utara (Waspada): Jumlah pasien di Rumah Sakit Umum Daerah (RSUD) Cut Meutia, Lhokseumawe, dilaporkan membeludak. Semua ruang rawat inap penuh, sehingga seorang pasien terpaksa ditempatkan di lorong ruang bedah. Keterangan dihimpun Waspada, pasien itu bernama Jalaluddin, 35 asal Desa Ceubrek, Kec. Syamtalira Aron, Aceh Utara. Lelaki ini harus masuk rumah sakit, Kamis (11/11) sekitar pukul 09:00 WIB,

karena telapak kaki kanannya luka serius akibat terinjak cangkang keong emas, saat sedang bekerja di sawah. “Darah yang keluar cukup banyak. Sontak saja, saya menjerit minta tolong dan warga lainnya yang kebetulan juga sedang membajak sawah langsung membawa saya ke RS. Sakit sekali. Ngilu dan berdenyut-denyut. Bahkan, sesaat setelah peristiwa itu, saya sempat pitam. Dalam perjalanan ke RS, saya juga sempat pingsan,”kata Jalaluddin saat dibesuk sejumlah

wartawan, kemarin. Sejumlah perawat yang sempat diwawancara, mengungkapkan, seluruh ruangan rawat inap sedang penuh pasien. Itu sebabnya, Jalaluddin terpaksa ditampung di lorong ruang bedah.“Ini hanya bersifat sementara. Nanti siang pasien itu ( Jalaluddin-red) sudah bisa dirawat di ruang biasa karena ada pasien yang pulang,”kata seorang perawat seraya melarang wartawan menulis namanya dalam berita.(cmus)

Polisi Aceh Jaya Temukan Satu Hektar Ladang Ganja BANDA ACEH (Waspada): Aparat kep o l i s i a n d a r i Po l re s Ac e h Ja y a menemukan satu hektar ladang ganja di kawasan Gunong Beutong, Gampong Baro Lamtengoh, Kecamatan Sampoiniet, Aceh Jaya, Rabu (10/11). Selain barang bukti, polisi juga mengamankan dua orang diduga petani sekaligus pemilik kebun ganja tersebut. Kedua orang yang diduga kuat pemilik kebun ganja tersebut, Syam, 34, warga Desa Sentosa Krueng Sabee dan Ib, 30, warga Desa Gampong Baro Lamteungoh, Kecamatan Sampoiniet, Aceh Jaya. Hasil pemeriksaan pada hari itu, kedua pemuda tersebut telah ditetapkan sebagai tersangka. Kapolres Aceh Jaya AKBP Drs Galih Sayudo kepada wartawan, Kamis (11/ 11) mengatakan, keberhasilan tim Satuan Narkoba Polres Aceh Jaya dibantu Polsek Sampoiniet mengungkapkan keberadaan kebun ganja di Gunong Beutong

itu berawal dari tertangkapnya Syam bersama tujuh ons daun ganja kering siap edar. Syam dan barang bukti itu ditangkap di rumahnya, Selasa (9/11). “Dari situ anggota kemudian melakukan pengembangan dan diperoleh pengakuankalauyangbersangkutanadalahpenjual ganja sedangkan rekannya Ib adalah sebagai petani ganja,” kata AKBP Galih Sayudo. Berdasarkan keterangan tersangka Syam, kata kapolres, aparat kepolisian dari Satnarkoba dibantu Polsek Sampaoinit melakukan pengejaran terhadap Ib dan berhasil menangkapnya Kamis (11/11) di Gampong Baro Lamtengoh, Kecamatan Sampoiniet. Dalam pemeriksaan sementara, Ib mengakui bahwa dirinya memiliki kebun ganja yang siap panen di Gunong Beutong. Kebun ganja seluas satu hektar itu memasuki panen kedua dengan ketinggian batang mencapai satu setengah meter. “Menurut pengakuan tersangka, ini ada-

lah panen kedua.Yang pertaa dulu sudah dipanen, tapi sayang yang pertama dulu kita tidak tau,” kata Kapolres Aceh Jaya AKBP Drs Galih Sayudo. Kapolres juga mengungkapkan, berdasarkan keterangan tersebut, aparat kepolisian Aceh Jaya yang ia pimpin langsung bertolak ke lokasi untuk mengecek kebenaran keterangan itu dan melakukan pemusnahan. Mengutip keterangan kedua tersangka, Kapolres Aceh Jaya Galih Sayudo mengatakan, panen pertama beberapa bulan lalu diedarkan diwilayah Aceh, khususnya di Kabupaten Aceh Jaya. “Kita akan terus memberantas semua jenis narkotika yang beredar di wilayah hukum Polres Aceh Jaya ini, sehingga barang haram itu tidak beredar lagi di tengah masyarakat. karena barang haram ini merupakan barang yang dapat merusak jiwa manusia terutama generasi muda,” tandasnya. (b09)

Haiti Belajar Rehab-Rekon BANDA ACEH (Waspada): 11 Delegasi Pemerintah Haiti dipimpin Jean Alix Nicolas, deputi Direktur Jenderal Program Bantuan Pembangunan berkunjung ke Aceh dan ingin belajar (lesson learned) proses Rehabilitasi dan pasca gempa bumi dan tsunami melanda yang Aceh enam tahun lalu. Haiti merupakan salah satu negara yang pernah mengalami musibah gempa bumi seperti halnya Aceh beberapa tahun lalu. Dalam kunjungan ke Kantor Bappeda Aceh, Kamis (11/11), delegasi Pemerintah Haiti diterima Kepala Bappeda Ir Iskandar M.Sc.

Dalam pertemuan tersebut Kepala Bappeda Aceh menjelaskan tentang peran pemerintah dengan dukungan dunia internasional dalam memulihkan kembali kehidupan Aceh di bawah koordinasi BRR NAD-Nias selama empat tahun. Dijelaskan, keberhasilan Rehabilitasi dan Rekonstruksi di Aceh diawali berhasilnya membangun kepercayaan masyarakat dunia dan donor dalam proses pembangunan kembali Aceh. Sistem yang digunakan di antaranya melalui sistem monitoring RundDataBase yang dapat diakses oleh seluruh masyarakat dunia. Selain itu, Selain itu, keber-

hasilan Rehabilitasi dan Rekonstruksi karena dilakukan berbasis masyarakat dan transparan Sementara, Jean Alix Nicolas diakhir sambutannya menyampaikan terima kasih kepada MDF melalui Deputi AcehNias Recovery Program Bank Dunia T. Safriza Sofyan yang telah menfasilitasi pertemuan dengan Pemerintah Aceh diwakili Bappeda Aceh.Pemerintah Haiti juga mengakui, proses Rehabilitasi dan Rekonstruksi Aceh merupakan proses pembelajaran terbaik bagi masyarakat dunia secara umum dan Haiti khususnya. (b09)

Al-Kalam Gelar Diklatsar Jurnalistik LHOKSEUMAWE (Waspada): Guna mengasah kemampuan menulis para mahasiswa, Al-Kalam STAIN Malikussaleh menggelar kegiatan Pendidikan Tingkat Dasar (Diklatsar) Jurnalistik dengan menghadirkan tiga pemateri dari unsur pers media cetak dan elektronik, termasuk Harian Waspada. Kehadiran lima pemateri insan pers dari media cetak dan, elektronik dalam kegiatan Diklatsar Jurnalistik ini menjadi kebanggaan tersendiri bagi para mahasiswa setempat, yang mendapat kesempatan untuk lebih mengenal luas dan memahami beban tugas seorang wartawan dalam menyajikan tulisan berita. Maimun Asnawi wartawan Harian Waspada, Arafat Nur wartawan Harian Waspada, Zainal Bakri wartawan Media Metro TV bertindak sebagai nara sumber, bersama praktisi lain. Menurut Darmadi, Lembaga Pers Mahasiswa sangat dibutuhkan untuk menjadi lembaga menyalurkan bakat menulis bagi mahasiswa. Dengan adanya pers kampus diharapkan kreatifitas mahasiswa dengan menulis dapat tersalurkan dengan baik. Untuk itu mahasiswa diharapkan agar dapat lebih mengasah kemampuannya dalam menulis dengan cepat dan tepat. “Dengan adanya Lembaga Pers Mahasiswa, kemampuan mahasiswa

dapat terus diasah setiap saat agar mampu menulis dengan baik, dan ini menguntungkan bagi mahasiswa baik dalam menyelesaikan tugas-tugas kuliah atau mendapatkan kesempatan kerja di media massa,” sebut Darmadi. Ketua Panitia Diklat Dasar Jurnalistik Asfi Maryani mengatakan, Diklat Dasar Jurnalistik AL KALAM itu

dilaksanakan berlangsung sampai Kamis (11/11) dan diikuti oleh 25 orang peserta. Pemateri yang akan mengisi kegiatan tersebut antara lain, Maimun Asnawi, SH.I (Harian Waspada), Zainal Bakri (Metro TV), Hamdani, AG,MA (Dosen Dakwah STAIN) dan Arafat M.Nur (cerpenis), serta Darmadi Sulaiman, S.Sos I (Pembina LPM AL KALAM). (b15)

Waspada/Zainuddin Abdullah

TERIMA PIAGAM: Maimun Asnawi, SH.I, (kiri) wartawanWaspada, usai memaparkan materi tentang Teknik Pembuatan Berita dan Peliputan, menerima sertifikat dari Husaini, Panitia Pelaksanakan Diklatsar Jurnalistik yang digelar Al-Kalam STAIN Malikussaleh, Rabu (10/11).

Hutan Geumpang Masih Bagus SIGLI (Waspada): Kawasan hutan lindung di kawasan survei tambang emas di Geumpang, Kabupaten Pidie, yang dilakukan beberapa perusahan masih dalam kondisi baik, demikian laporan warga Geumpang kepada Waspada, Kamis (11/11). “Hutan di kawasan survei tambang emas dilakukan beberapa perusahaan resmi masih bagus dan tidak dirusak karena perusahaanperusahan itu hanya bekerja mengambil sample tanah dan batu yang diduga mengandung kadar emas,” kata Muhammad, salah seorang warga Geumpang yang sering beraktivitas di sekitar hutan tersebut. Ia mengatakan, bohong bila ada pihak-pihak yang menyatakan selama dilakukan survei di kawasan gunung Geumpang, hutannya telah rusak. Karena setahu dia hutan di kawasan itu masih lebat dan suhunya dingin. Tingkat kelembaban hutan di sekitar itu juga bagus. Bagi warga yang ingin bepergian ke hutan itu harus memakai baju tebal seperti jaket agar tidak kedinginan. “Sampai pukul 12.00 siang kita bicara, keluar asap dari mulut. Sekarang coba bayangkan sedingin apa suhu di kawasan hutan itu. Kalau ada yang bilang hutan Geumpang telah rusak itu bohong,” katanya. Kepala Dinas Koperindagkop Pidie Said Mulyadi, kepada Waspada, beberapa waktu lalu mengatakan, ada 12 perusahaan yang sedang survei kadar emas di dalam perut hutan geumpang tersebut. Perusahaan-perusahaan itu sangat menjaga hutan dan mereka tidak mau merusak hutan karena hutan sumber hidup manusia. Dari laporan yang diterimanya perusahaan-perusahaan itu hanya mengambil contoh tanah dan bebatuan yang ditenggarai mengandung kadar emas, selanjutnya batu dan tanah itu dibawa ke laboratorium untuk diselidiki. Contoh batu dan tanah yang diduga mengandung kadar emas itu diambil sangat dalam menggunakan bor yang sebesar matanya serta dilakukan bukan pada satu titik. Dari lahan 10 hektar itu mereka mengebor pada titik yang diduga tanah dan bebatuan yang mengandung kadar emasnya saja. Hingga kini sebutnya, belum ada laporan dari pihak manapun kadar emas yang terkandung dalam tanah dan bebatuan di Geumpang emasnya sudah bisa diambil. Said meminta kepada masyarakat supaya bisa mendukung dan tidak terpengaruh dengan informasi yang dapat merugikan daerah.(b20)

Mahasiswa FT Unimus Studi Banding Pembangunan Bandara BIREUEN (Waspada): Puluhan mahasiswa Fakultas Teknik (FT) Sipil Universitas Almuslim (Unimus) Peusangan, Bireuen melaksanakan studi lapangan pembangunan proyek Bandara Baru Kuala Namu, Medan. Kegiatan yang berlangsung selama tiga hari ini adalah dalam rangka untuk memenuhi salah satu mata kuliah tentang lapangan terbang. Dekan Fakultas Teknik Sipil Universitas Almuslim H. Ismail, ST.MT yang didampingi koordinator lapangan Ir.H.Munardi, MT kepada Waspada,Selasa(9/11)menyebutkanjumlahmasiswayangstudybanding ada sekitar 72 orang dan diterima pimpinan PIU (Project Implementation Unit) pembangunan sisi darat Bandar Udara Kuala Namu. Sementara, Rektor Universitas Almuslim Drs Amiruddin Idris, SE, MSi melalui Kabag Humas Kemahasiswaan, Zulkifli S.Kom mengatakan, sangat mendukung kegiatan mahasiswa Fakultas Teknik. “Kegiatan tersebut dapat menambah wawasan dan keilmuan mahasiswa dan apalagi proyek lapangan terbang suatu proyek terbesar di Indonesia dan cukup banyak ilmu dan pengalaman yang bisa diambil oleh mahasiswa,” jelas Rektor. “Rektor berpesan agar mahasiswa dapat memanfaatkan momen study lapangan itu untuk menambah wawasan dan bagian dari perbandingan ilmu yang diperoleh secara teori dibangku kuliah. Kita akan terus melengkapi berbagai peralatan praktek mahasiswa sesuai dengan kondisi kebutuhan laboratorium guna untuk memenuhi kualitas lulusan dan menurutnya studi lapangan,” katanya lagi. (amh)

Matang Kuli Timu Juara MTQ LHOKSUKON, Aceh Utara (Waspada): Kafilah Kemukiman Matang Kuli Timu, keluar sebagai juara umum Musabaqah Tilawatil Quran (MTQ) ke 30 tingkat Kecamatan Pirak Timu, Aceh Utara, yang di gelar di Desa Alue Bungkoh, Kamis (11/11) Ketua Panitia, M Yusuf, yang menghubungi Waspada via telefon, kemarin, menjelaskan, MTQ itu memperlombakan cabang tilawah, tartil, fahmil dan syarhil, dengan jumlah peserta 56 orang dari dua kemukiman yang ada di Kecamatan Pirak Timu, yakni kemukiman Matang Kuli Timu dan Kemukiman Pirak Timu. “Para pemenang ini, nantinya akan mewakili kecamatan pada lomba MTQ ke 30 tingkat Kabupaten Aceh Utara yang rencananya akan diselenggarakan, di Kecamatan Baktia Barat—Sampiniet, 23 November,” imbuhnya. Sementara Camat Pirak Timu, Saifuddin SE, yang juga dihubungi via telefon, mengharapkan, para pemenang tingkat kecamatan itu tidak mudah puas dan terus mengasah kemampuan mereka demi meraih prestasi terbaik di MTQ tingkat kabupaten.(cmus)

Jelang Muscab, Sejumlah Kandidat Ketua PPP Bireuen Bermunculan BIREUEN (Waspada): Menjelang Musyawarah Cabang (Muscab) ke III Partai Persatuan Pembangunan (PPP) Kabupaten Bireuen yang akan dilaksanakan pada Sabtu (13/11) di aula Hotel Purnama Raya, sejumlah kandidat calon ketua partai politik berlambang ka’bah itu mulai bermunculan. Dilaporkan, para elit di partai itu mulai memasang ‘ranjau’ merebut dukungan dari Pengurus Anak Cabang pada tingkat kecamatan. Informasi yang dihimpun Waspada, Rabu (10/11) mengatakan, sejumlah kandidat yang bakal bertarung pada Muscab itu antara lain Dra. Hj. Nurbaiti A. Gani, Murdani Yusuf, SE (keduanya anggota DPRK Bireuen), berikut tokoh muda dan pengusaha asal Matangglumpang Dua, Said Fajri, SH. Selain tiga kandidat calon ketua PPP itu, sejumlah kalangan menilai nama-nama calon pimpinan partai itu nanti kemungkinan bermunculan kembali pada saat musyawarah digelar. Ketua Pelaksana Muscab PPP Kabupaten Bireuen, Said Fajri yang dikonfrimasiWaspada kemarin mengatakan, kendati sejumlah namanama itu sebagai kandidat ketua mulai dibicarakan sejumlah pemerhati politik di Bireuen, namun secara formalnya belum dapat dikatakan sebagai kandidat. “Karena untuk menjadi kandidat secara resmi apabila mereka (yang namanya tersebut diatas) sudah menyatakan maju sebagai calon pada saat Muscab digelar,” ucap Said Fajri seraya menandaskan, siapapun yang terpilih nantinya tentunya harus dengan pertarunganpertarungan yang fair. (cb03)

Ekonomi & Bisnis Pengusaha Sayangkan UMP Naik Tiap Tahun


WASPADA Jumat 12 November 2010

MEDAN (Waspada): Dewan pengupahan perwakilan dari unsur Asosiasi Pengusaha Indonesia (Apindo) Sumatera Utara menyayangkan angka upah minimum provinsi (UMP) mengalami perubahan setiap tahunnya. Padahal ada ketentuan menyatakan upah itu harus ditinjau minimal dua tahun sekali atau penyesuaian kenaikan upah dapat dilakukan dua tahun sekali. Begitupun, pihaknya harus mengikuti mekanisme sesuai dengan keputusan dewan pengupahan keseluruhan dari unsur tenaga kerja, pengusaha, dewan pakar, dan dinas tenaga kerja. Sekretaris Apindo Laksamana Adhyaksa kemarin menyatakan meski perubahan UMP setiap tahunnya disayangkan, namun melihat kondisi perubahan harga berkaitan dengan tingkat inflasi saat ini, hal ini dapat diterima dengan di-

lakukannya evaluasi setiap tahunnya. “Tentunya dalam merumuskan penyesuaian upah banyak aspek yang harus dipertimbangkan selain harga barang, ataupun biaya hidup. Namun sektor usaha marginal juga perlu diperhatikan agar tetap bisa bertahan hidup,” ujarnya. Dengan demikian, lanjutnya, hal ini juga selain dapat mempertahankan tenaga kerjanya juga biaya produksi hingga proses akhir yaitu penjualan. “Sehingga jika perusahaannya maju otomatis kehidupan tenaga kerjanya juga semakin baik,” lanjutnya. Kadisnakertrans Sumut,

Rapotan Tambunan di Medan, Rabu (10/11) menyatakan hasil kenaikan UMP 2011 merupakan hasil keputusan pengupahan daerah terdiri dari asosiasi pengusaha, tenaga kerja, dewan pakar dari perguruan tinggi, dan disnakertrans hanya mengambil jalan tengah yang terbaik. “Di satu sisi hal ini sesuai dengan survei KHL di setiap kabupaten/kota se Sumatera Utara juga menerima masukan dari asosiasi tenaga kerja dan asoasi pengusaha, serta masukan dari dewan pakar mana yang layak atau pas untuk kehidupan tenaga kerja,” ujarnya. Dengan demikian, lanjutnya, setelah keputusan itu keluar dan ditandatangani oleh Gubernur Sumatera Utara tidak ada yang dapat dibantah atau disesalkan baik oleh pengusaha sendiri maupun tenaga kerja.

“Karena hal ini merupakan hasil dari mekanisme penentuan UMP ditinjau dari kebutuhan hidup layak (KHL) sesuai dengan inflasi yang terjadi pada 2010 dan prediksi inflasi pada 2011,” ujarnya. Setelah dilakukan survei, lanjutnya, KHL yang paling rendah adalah di daerah Serdang Bedagai dengan biaya hidup layaknya hanya berkisar Rp1.090.000 an sedangkan tertinggi ditempati oleh Nias Selatan mencapai Rp1,5 juta. Rapotan Tambunan meyakinkan data yang akan disampaikan tentang berapa besar jumlah UMP akan diumumkan setelah ditandatanganinya keputusan tersebut oleh Gubernur Sumatera Utara. “Dibandingkan tahun sebelumnya UMP 2011 mengalami kenaikan,” ujarnya kembali. (m38)

2011, Aceh Terima Rp46 M Alokasi Dana Pasar ACEH UTARA (Waspada): Muhammad Azhari, anggota KomisiVI DPR-RI dari Partai Demokrat, Kamis (11/11) via telefon kepada Waspada menyebutkan, Provinsi Aceh tahun depan mendapatkan jatah dana alokasi anggaran pembangunan pasar dari APBN senilai Rp46 miliar. Dana tersebut diberikan untuk pembangunan sarana dan prasarana perdagangan dalam menghadapi persaingan perdagangan dunia. Mengingat kondisi perekonomian dalam negeri belum kuat, akibat pengaruh krisis global pada tahun

2007 dan 2008, ditambah masuknya produk-produk impor dari China sebagai implikasi diberlakukannya Asean China Free Trade Area. Ke Rp46 miliar dana itu, kata Azhari, akan diserahkan kepada 10 kabupaten/kota di Provinsi Aceh, yakni Kabupaten Bener Meriah Rp2,5 miliar, Subulussalam Rp2,5 miliar, Aceh Barat Rp5 miliar, Aceh Tamiang Rp12,5 miliar, Aceh Besar Rp2,5 miliar, Aceh Tenggara Rp2,5 miliar, Banda Aceh Rp15 miliar, Langsa Rp5 miliar, Bireuen Rp2 miliar dan Kabupaten Aceh Utara Rp2,5 miliar.

“Kita berharap, ke depan pasar tradisonal lebih dicintai oleh masyarakat. Selama ini, pasar tradisonal dianggap pasar kumuh, rawan tindak kejahatan dan tidak nyaman. Pasar tradisional semakin terdesak keberadaanya oleh banyaknya ekspansi supermarket maupun waralaba yang merebut konsumen. Upaya menghidupkan kembali pasar tradisional dilakukan sebagai langkah memperkuat perekonomian dalam negeri,” kata Ir. Muhammad Azhari, salah seorang anggota bagian anggaran di DPR-RI.

Lanjutnya, keengganan masyarakat berbelanja di pasar tradisional telah menguntungkan sejumlah pasar modern yang telah tumbuh di setiap pelosok Indonesia. Untuk menggairahkan kembali pertumbuhan sarana infrastruktur pasar rakyat pemerintah melalui kementerian Perdagangan dan Komisi VI DPR RI dalam pembahasan alokasi anggaran Kementerian Tahun Anggaran 2011 memberikan prioritas khusus bagi Pembangunan dan revitalisasi sarana perdagangan rakyat ini. (cmun)

Harga Meroket, Konsumen Incar Emas Batangan MEDAN (Waspada): Meningkatnya harga emas di pasar internasional yang sempat menembus level 1.400 dolar AS per troy ounce dan memicu emas kualitas 99,99 persen di pasar lokal menjadi Rp405 ribu lebih per gram telah menarik minat konsumen sehingga banyak yang mengincar emas batangan. Omset pedagang dari penjualan emas batangan dalam tiga hari terakhir meningkat sebesar 25 persen dari penjualan sebelumnya yang sering mengalami sepi transaksi. Sementara itu kenaikan harga emas tersebut juga merubah pola transaksi yang biasanya didominasi pembeli tetapi saat ini lebih banyak konsumen yang menjual kembali perhiasan emasnya ke pedagang dibanding yang membeli. Menurut Rusdi Faisal Nasution pedagang emas Toko Siregar Jaya Jln AR Hakim, Rabu

(10/11), harga emas saat ini mencapai puncaknya, setelah menembus level Rp405 ribu per gram kemarin lalu turun cukup tajam namun hingga tutur perdagangan Rabu tersebut masih bertengger di Rp400 ribu per gram. Naiknya harga emas saat ini tidak menyurutkan usaha pedagang, karena walaupun lebih banyak orang yang menjual kembali perhiasannya ke pedagang dibanding yang membeli tetapi pedagang tetap mendapat untung dalam transaksi tersebut, ujarnya. Perbandingan transaksi di saat harga emas melonjak saat ini, lanjutnya, 70 persen masyarakat menjual kembali perhiasannya kepedagang sedangkan yang membeli turun menjadi 30 persen, tetapi kenaikan jumlah konsumen yang menjual tersebut akibat menurunnya yang membeli. Sementara itu adanya trend kenaikan harga emas

yang cukup tinggi ditambah bakal banyaknya dolar AS yang digelontorkan oleh pemerintah Amerikat Serikat (AS) pada tahun mendatang telah memicu tingginya minat masyarakat berinvestasi ke emas, sebutnya. Omset pedagang dari penjualan emas batangan dalam tiga hari terakhir meningkat sebesar 25 persen dari penjualan sebelumnya yang sering mengalami sepi transaksi, Sedangkan pihaknya juga melayani penjualan emas batangan mulai dari kode 99,5 persen hingga 99,99 persen. Pembeli emas batangan dilayani mulai dari ukuran 10 gram hingga 100 gram bahkan lebih dengan kualitas 99,99 persen dan kode 99,5 persen yang dijual di pasaran dengan harga standar loco, sebutnya. Rusdi mengakui naiknya harga emas di pasar lokal lebih dipengaruhi oleh faktor eksternal di luar negeri setelah

Paket Unlimited Harian Terlengkap Dari Telkomsel DALAM upaya menyediakan ragam layanan mobile internet berkualitas dengan harga yang semakin terjangkau, Telkomsel menghadirkan 3 paket unlimited harian t e r l e n g k a p, y a k n i p a k e t u n l i m i t e d TELKOMSELFlash, Paket Facebook & Chat, dan Paket BlackBerry Unlimited. Pelanggan bisa menikmati serunya berinternet tanpa batas yang didukung jaringan terluas berkualitas dengan kecepatan akses tinggi dan koneksi yang stabil melalui lebih dari 36.000 BTS di seluruh Indonesia. Paket Unlimited TELKOMSELFlash merupakan varian terbaru paket unlimited harian. Pelanggan dapat mengakses internet berkecepatan tinggi TELKOMSELFlash untuk chatting, social networking, email, browsing, dan downloading tanpa batas hanya dengan Rp5.000 perhari. Paket ini berlaku bagi pelanggan simPATI, Kartu As, dan Flash Unlimited. Paket Unlimited TELKOMSELFlash Rp5.000 perhari ini bisa dinikmati pelanggan yang ingin berinternet menggunakan ponsel maupun modem yang dihubungkan dengan komputer atau laptop. Untuk registrasi paket, pelanggan cukup akses *363#, yang merupakan single menu browser untuk seluruh paket layanan data Telkomsel, lalu pilih Rp 5.000 Flash Unlimited pada menu Unlimited Harian. Pelanggan yang hobi meng-update status di Facebook dan chit-chat seru bisa memperoleh Paket Facebook & Chat menggunakan mig33, Nimbuzz, dan eBuddy hanya dengan Rp1.000 perhari. Sementara pelanggan yang ingin menikmati unlimited layanan pushmail, chatting, browsing, dan social networking di BlackBerry-nya, tersedia Paket BlackBerry Unlimited harian seharga Rp5.000 perhari. Menurut Vice President Area Sumatera, Mirza Budiwan sebagai operator selular yang berkomitmen menghadirkan layanan internet berkualitas yang semakin terjangkau bagi seluruh masyarakat Indonesia, kami menyediakan berbagai pilihan paket unlim-


ited harian dengan harga yang sangat murah. Paket-paket ini dirancang untuk mengakomodasi kebutuhan penggunaan layanan data yang sifatnya insidental, di mana pelanggan belum memiliki kebutuhan untuk mengakses internet setiap harinya. Sebagai mitra resmi Apple di Indonesia, kini Telkomsel juga telah menyediakan paket perdana Flash Unlimited untuk iPad dengan harga Rp75.000. Paket perdana micro simcard yang didisain khusus untuk komputer tablet buatan Apple ini berisi pulsa senilai Rp75.000 dan bonus internet sebesar 5 MB, di mana pelanggan dapat menikmati Paket Flash Unlimited seharga Rp75.000 dengan kecepatan akses hingga 1 Mbps yang dirancang sesuai kebutuhan iPad. Untuk memudahkan pelanggan dalam memonitor sekaligus mengontrol jumlah pemakaian TELKOMSELFlash-nya, tersedia layanan info real time penggunaan Flash Unlimited melalui SMS bebas biaya. Pelanggan cukup kirim SMS, ketik UL INFO, lalu kirim ke 3636. Seiring penggelaran jaringan HSDPA/HSPA+ untuk layanan mobile broadband di 25 kota, Telkomsel telah meningkatkan kapasitas bandwidth untuk international internet gateway menjadi 9 Gbps. Kenyamanan pelanggan Telkomsel dalam memaksimalkan kecepatan TELKOMSELFlash juga didukung lebih dari 7.000 Node B (BTS 3G) yang tersebar di berbagai wilayah Indonesia dari Sumatera hingga wilayah Indonesia Timur.

membanjirnya dolar AS akibat pemerintah paman Sam tersebut menggelontorkan dana stumulus sebanyak 600 miliar dolar AS pekan lalu, ujarnya. Harga emas menurut perkiraannya masih akan terus berada dalam trend kenaikan harga hingga akhir 2011, hal tersebut didorong kebijkan AS yang menggelontorkan dolar AS dalam jumlah besar untuk mendukung perekonomian negaranya dengan resiko kurs dolar melemah terhadap mata uang lainnya. Sementara itu banyak investor asing yang menyimpan asetnya ke dalam bentuk emas untuk melakukan lindung nilai akibat kian terpuruknya nilai tukar dolar AS di banyak negara, ujarnya.(m40)

KP2KP - Pemkab Madina Sosialisasi BPHTB PANYABUNGAN (Waspada): Kantor Pelayanan Penyuluhan Dan Konsultasi Perpajakan (KP2KP) Panyabungan, bekerja sama dengan Pemda Madina (Mandailing Natal) melaksanakan sosialisasi pengalihan Bea Perolehan Hak atas Tanah dan Bangunan (BPHTB), dari Dirjen Pajak ke pemerintah daerah (Pemda), Rabu (10/11) di Aula Kantor Bupati Madina. Acara dibuka Pj Bupati Madina, Aspan Syofian Batubara dihadiri Kanwil Ditjen Pajak Sumut II, Junjungan Sihombing, KP2KP Panyabungan, Darma Uzzaman, dan KPP Pratama Padangsidimpuan, A. Situmorang masing-masing narasumber. Peserta sosialisasi terdiri dari Kepala Dinas, Kabag, Bank, BPN, Notaris, serta camat se Madina. Para narasumber Dirjen Pajak menyampaikan, sosialisasi bertujuan menekankan dan memberi pemahaman tentang cara supaya pemda dapat memungut pajak BPHTB, sehingga bisa menjadi salah satu sumber pemasukan (PAD) tehadap daerah. Hal itu sesuai dengan berlakunya undang-undang nomor 28 tahun 2009, tentang pajak daerah dan restribusi daerah. Dengan demikian, setiap pemda/ pemko harus mampu memungut BPHTB dari tiap transaksi objek pajak baik itu tanah atau bangunan. (csh)

Waspada/ Miki Maliki

SUSUN CABAI : Seorang pedagang sayur mayur di pasar sayur Berastagi sedang menyusun cabai yang kini harganya mulai melambung menjelang Hari Raya Idul Adha hingga akhir tahun. Foto direkam, kemarin.

Harga Sayur Di Tanah Karo Mulai Naik BERASTAGI (Waspada): Harga sayur mayur di Tanah Karo mengalami fluktuasi dan cenderung naik pasca meletusnya Gunung Sinabung Agustus lalu. Dari data sementara yang dikumpulkan Waspada di pekan sayur mayur di Berastagi hampir seluruh jenis sayur mayur mengalami kenaikan dari harga sebelumnya seperti wortel yang sebelumnya Rp500 naik menjadi Rp3.000, tomat yang sebelumnya Rp3.500 naik menjadi Rp6.000 perkg, cabai merah yang sebelumnya Rp12.000 naik menjadi Rp 22.000 per kg, cabai hijau yang sebelumnya Rp8.000 naik menjadi Rp12.000 per kg,

bawang merah Rp12.000 naik menjadi Rp16.000 per kg, bawang putih yang sebelumnya Rp20.000 naik menjadi Rp22.000 per kg dan kol yang sebelumnya Rp2.000 naik menjadi Rp2.300 per kg. Menurut salah seorang pedagang perantara (perkoper) Nande Lambok, kemarin, fluktuasi harga sayur mayur diperkirakannya bertahan hingga akhir tahun menanti hasil produksi sayur dari kecamatan yang berada di kaki Gunung Sinabung, termasuk Kecamatan Nanam Teran, Payung dan Simpang Empat kembali memasuki pasar di Berastagi. Kurangnya pasokan sayur

mayur dari Naman Teran yang lokasinya berjarak 3 km dari kaki Gunung Sinabung diperkirakan karena sebagian petaninya mengalami gagal panen akibat meletusnya Gunung Sinabung dan menyemburkan debu dan membuat petani terpaksa menunggu waktu tanam. Saat ini sebagian petani setempat mulai menanam sayur mayur termasuk cabai dan tomat. Disamping sayur yang kini harganya mulai melambung, buah-buahan yang berasal desa di Karo juga mengalami kenaikan. Di pasar buah Berastagi seperti jeruk yang sebelumnya Rp10.000 naik menjadi 18.000 per kg, terong Belanda sebe-

lumnya Rp12.000 naik menjadi Rp15.000 per kg, markisa manis (markisa bandung sebelumnya Rp7.000 naik menjadi Rp 10.000 per kg, markisa Berastagi sebelumnya Rp10.000 naik menjadi Rp12.000 per kg dan alpokat sebelumnya Rp8.000 naik menjadi Rp 10.000 per kg. Namun dari beberapa jenis buah-buahan yang mengalami kenaikan ada juga harga yang stabil seperti Kasemak bertahan harga Rp 8.000 per kg, strawbary Rp40.000 per kg. Sedangkan buah Pepino tidak ada terlihat di pasaran karena jenis buah ini hanya sedikit ditanam para petani tanah Karo. (cmm)

Popularitas Kentang Hutagodang Redup PANYABUNGAN (Waspada): Kejayaan petani kentang di Hutagodang, Kec. Ulupungkut, Kab. Mandailing Natal makin meredup. Bahkan masyarakat melirik tanaman alternatif yang lebih menjanjikan dan ramah lingkungan. Hal itu disampaikan tokoh masyarakat Hutagodang yang juga Koordinator Umum Batang Pungkut Green Conservation (BPGS) Syaf Lubis kepada Waspada di Pasar Kotanopan, Sabtu ( 6/11). Syaf yang akrab disapa Ucok mengatakan, tahun 1980-an merupakan periode emas dalam bercocok-tanam kentang di Ulupungkut. Pada waktu itu, ekonomi masyarakat petani sangat menggembirakan karena produksi kentang di lahan yang subur masih sangat tinggi dan harga cukup kompetitif. Hampir setiap musim panen para petani memperoleh hasil cukup memuaskan bahkan bisa membeli barang keperluan rumah tangga.”Namun mulai akhir 1990-an, produksi kentang mulai menurun karena serangan hama, tanaman kentang tidak lagi tumbuh dengan baik sehingga hasilnya pun menurun atau tidak lagi seimbang biaya yang dikeluarkan dengan hasil diperoleh pada setiap panen. “Sekarang biaya tanam semakin mahal karena pupuk dan

obat-obatan yang digunakan harus lebih banyak dari pada musim tanam sebelumnya. Hal itu harus dilakukan kalau ingin hasil panen sepadan,” ujarnya. Bibit tak berkualitas Dia katakan kejayaan tanaman kentang yang merupakan tanaman pokok masyarakat Ulupungkut, terutama Desa Hutagodang, kini terancam akibat bibit di tingkat petani sekarang ini tidak lagi berkualitas, sementara perhatian pemerintah dinilai kurang membina petani. “Bertanam kentang di daerah itu sampai tahun sembilan puluhan sangat menguntungkan, karena di samping kondisi tanah cukup subur, produksi tanaman kentang sangat menjanjikan, artinya kalau petani menanam 1 kg bibit masih bisa menghasilkan 8 sampai 15 kg kentang segar apabila musim panen tiba,” ungkapnya. Namun sekarang, kalau petani menanam bibit 1 kg, hasil yang diperoleh hanya berkisar 3 hingga 4 kg. “Jangankan untuk memperoleh hasil yang lumayan, bibit kentang yang di tanam petani sekarang ini banyak mati muda, maksudnya belum lagi berbuah sudah layu dan busuk,” terangnya. Hal itu terjadi, kata Syaf, karena bibit kentang yang dita-

Ekspor Kakao Sumut Melonjak 78,39 Persen MEDAN (Waspada): Komoditas Kakao (coklat) pada tahun 2010 ini dirundung banyak hambatan, di luar negeri dengan tuduhan mengandung zat kimia berbaya, bahkan dalam negeri keluarnya kebijakan pemerintah memberlakukan pungutan Bea Keluar (BK) yang berlaku 1 April 2010, namun ternyata ekspor tetap tegar bahkan mengalami peningkatan. Komoditas makanan yang sangat digemari masyarakat ini melalui pelabuhan Belawan International Container Terminal (BICT) hingga Triwulan III-2010 malah justru melonjak drastis hingga mencapai 78,39 persen dibanding periode serupa 2009. Walau di bulan pertama diberlakukannya BK terhadap kakao April 2010 aktivitas ekspornya sempat anjlok hingga 68,58 persen. Asisten Manajer Hukum dan Humas Pelindo I BICT Suratman menjelaskan, Rabu (10/11), hingga September 2010 aktivitas ekspor kakao yang dikapalkan melalui dermaga internasional BICT sebanyak 27.489 ton. Sementara periode serupa jumlahnya 15.409 ton atau meningkat sekitar 78,39 persen. Suratman mengakui di bulan pertama diberlakukannya BK terhadap komoditas kakao,

aktivitas ekspor kakao melalui BICT anjlok hingga 68,58 persen yakni dari 7.066 ton selama Maret menjadi 2.220 ton. Selain itu, jelas juru bicara pengelola terminal peti kemas terkemuka di luar Pulau Jawa itu, pasca diberlakukannya BK terhadap kakao, aktivitas ekspor kakao melalui BICT mencapai titik terendah yakni 1.076 ton. “Padahal sebelumnya ekspor komoditas yang selalu eksis memperkuat barisan ekspor Sumut tersebut paling rendah 4.000 ton lebih.” “Namun secara kumulatif aktivitas ekspor komoditas kakao melalui terminal peti kemas BICT melonjak drastis yakni dari 15.409 ton pada priode Januari - September 2009 menjadi 27.489 ton atau naik sekitar 78,39 persen,” kata Suratman. Lonjakan ini memang sangat mengejutkan karena sebelumnya kebijakan ini mendapat protes keras dari Asosiasi Pengusaha Indonesia (Apindo) namun kebijakan ini tetap diberlakukan , terhitung 1 April 2010. Kebijakan ini melalui Keputusan Menteri Perdagangan Nomor. 15/N-DAG/PER/3/2010 mengenakan bea keluar (BK) terhadap komoditas kakao. BK ditetapkan berdasarkan harga patokan ekspor (HPE). (m35)

nam petani sekarang kurang berkualitas karena sudah turun temurun, sehingga masa pertumbuhannya sangat terbatas. Tapi yang jelas, akibat mutu bibit kentang kurang baik ini, para petani pasrah bahkan di antaranya kurang bergairah lagi. Untuk menggali kembali kejayaan tanaman kentang Hutagodang, para petani sangat mengharapkan perhatian serius dari pemerintah daerah, utamanya dalam pengadaan penakar benih kentang di daerah itu, sehingga mereka dengan mudah mendapatkan bibit berkualitas. Selain itu, harap Ucok, untuk meningkatkan perekonomian rakyat di Ulupungkut, instansi terkait perlu memberikan bantuan bibit kentang varietas unggul kepada petani, seperti bibit kentang Belanda dan Herta, karena produksi jenis itu dinilai cukup tinggi dan sangat

cocok dikembangkan di daerah itu, karena 1 kg bibit ditanam bisa menghasilkan kentang segar 20 kg hingga 30 kg. “Warga sudah ada yang mencoba menanam kentang jenis Herta dan ternyata hasilnya sangat memuaskan karena dari 1 kg bibit bisa mencapai 10 kg hingga 18 kg,” tambahnya. Selain bibit kentang , masyarakat Ulupungkut yang dikenal gigih dan ulet dalam mengelola bidang pertanian di Madina, juga sangat mengharapkan bibit padi varietas unggul didrop ke daerah itu. Ulupungkut merupakan daerah pertanian, tetapi bibit tanamannya tidak layak pakai. Bukan modal berdagang yang masyarakat butuhkan di sana, karena berdagang di sana cukup terbatas, tetapi yang dibutuhkan adalah bibit tanaman padi varietas unggul agar kehidupan meningkat, pintanya. (a24)

Melirik Kampoeng Kaos Madina “ KAMPOENG Kaos Madina” disingkat KKM, itulah nama kumpulan sejumlah generasi muda produktif yang berkreasi diberbagai bidang kerajinan di Jalan Jambu Lintas Timur, Kelurahan Sipolu-polu, Kecamatan Panyabungan, Kabupaten Mandailing Natal. Di KKM ini, karya andalan dikembangkan di bidang budaya dan parawisata yang diabadikan dalam bentuk desain grafis di atas t-shirt berkualitas. Produk dihasilkan penuh pesan-pesan moral dan pelestarian budaya maupun sumber daya alam bidang parawisata. Selain itu, ada juga kerajinan batik Madina, miniatur rumah adat (Bagas Godang), kemudian Gordang Sambilan, mainan kunci, dan gelas-gelas hias. Semua produk tersaji dengan rapi dengan harga terjangkau semua lapisan. Awalnya, KKM ini lebih dominan dikenal dengan sebutan Maulana Production. Namun, melihat perkembangan produksi punya peluang me Nasional, Maulana Production ditingkatkan nama menjadi Kampoeng Kaos Madina tanggal 22 Oktober 2010. Produksi KKM ini dipimpin Awaluddin Nasution selaku direktur utama, dan Sobir Lubis sebagai inisiator dan Inspirator awal mula lahirnya sejumlah karya kerajinan, dengan menempa dan menggembleng sejumlah anak-anak muda kreatif dan terampil. Jika dulunya karyawan hanya 5 orang, sekarang berjumlah 25 orang. Dalam mengembangkan usaha lewat perkuatan modal, KKM menggandeng Bank PTPN. Kemudian melakukan studi banding ke Institut Teknologi Bandung (ITB) di bidang senibaru-baru ini. Berkat kerja keras penuh semangat dan doa, produksi pesanan kerajinan Kaos Kampoeng Madina yang dulunya 500 potong, sekarang sudah mencapai 10.000 potong. Di KKM ini, para pelanggan/pembeli bisa memesan kaos dengan motif gambar dan kata-kata yang di inginkan. “ Tentukan selera dan kata-kata, kita akan berikan yang terbaik,” ucap sang Direktur, Awaluddin dengan senyum. Sedangkan lisensi KKM bekerja sama dengan PT. Caladi Lima Sembilan di Bandung, yang tertuang dalam kesepakatan (MOU) nomor: 080/C59/BDG/CXT/ 2010. Karena itu bahan-bahan baku dominant didatangkan dari Bandung. Pemasaran produk KKM saat ini masih di wilayah kabuapaten kota di Sumut, Jakarta, Pekanbaru, Medan, Palembang, Bandung dan Bogor. Tapi juga sampai ke mancanegara lewat kerja sama hotel internasional di Indonesia, tempat biasa wisatawan dari berbagai Negara singgah. Sekalipun rumah produksi KKM sudah mulai berkembang, namun yang namanya kendala tetap saja ada. Saat ini misalnya, KKM menghadapi masalah pemasaran dan permodalan untuk mengembangkan usaha kerajinan dalam skala besar, supaya bisa banyak merekrut kalangan pengangguran. Melirik potensi dimiliki kerajinan KKM, seharusnya Pemda Madina melalui Dinas Perindustrian Dan Perdagangan mencari investor dan jangan tinggal diam. Lewat pameran , produk KKM seharusnya ditampilkan disamping produk andalan Madina lainnya. Sarmin Harahap



WASPADA Jumat 12 Nopember 2010

Sekitar Rencana Holding PTPN Oleh Emir Rizal Lubis Struktur organisasi akan dilakukan penyesuaian yang akan berimbas terhadap penyesuaian personalia tingkat kepala bagian, kepala urusan dan seterusnya sampai level paling bawah


Optimis Ujian CPNS Bisa Bersih Dari KKN


asyarakat, khususnya pelamar CPNS di seluruh Indonesia boleh bernafas lega dengan keluarnya peringatan dari Komisi Pemberantasan Korupsi (KPK) yang sudah mewanti-wanti para pejabat di daerah agar jangan “menjual” kursi lowongan Calon Pegawai Negeri Sipil (CPNS) tahun 2010 ini. Sudah menjadi rahasia umum kalau selama ini, banyak oknum pejabat ‘’memainkan’’ jatah CPNS. Bahkan 100 persen KKN karena banyaknya pejabat yang ‘’menjual’’ kursi CPNS seharga Rp100 juta lebih untuk formasi sarjana, Rp50an juta untuk formasi SMU. Hemat kita, peringatan KPK berdampak positif. Masyarakat merasa yakin sistem ujian CPNS nanti lebih terbuka dan jujur sehingga siapa pun bisa lulus asalkan berkualitas. Sikap optimis masyarakat itu bukan tanpa alasan karena ‘’track record’’ KPK masih bisa diharapkan untuk bertindak tegas bagi pelaku penyuapan atau penerima gratifikasi apalagi korupsi. Hingga detik ini tidak satu tersangka korupsi pun yang ditangani KPK bebas dari hukuman. Sudah seratus orang lebih kalangan pejabat dan mantan pejabat negara anggota eksekutif, legislatif dan judikatif yang mendekam dalam penjara. Kalau mengacu pada peringatan yang hampir sama kepada Depag pertengahan tahun lalu hampir dapat dipastikan bakal terjadinya perubahan signifikan dalam penerimaan CPNS yang diperkirakan berlangsung bulan depan. KPK tegas mengingatkan agar mata rantai pengeluaran Ongkos Naik Haji (ONH) dipangkas, dan mewanti-wanti panitia haji tidak melakukan ‘’mark up’’ di sejumlah bidang, seperti biaya pesawat terbang, biaya penginapan di Makkah dan Madinah, biaya kesehatan, biaya transportasi sampai biaya untuk petugas. Hasilnya? Tidak disangka-sangka ONH tahun 2010 turun drastis sampai Rp6 juta rupiah per jamaah. Kalau jumlah jamaah haji kita mencapai 220 ribu orang, berarti berkat peringatan Intisari KPK kepada jajaran Depag pimpinan Suryadharma Ali (Menteri Agama) terselamatkan Rp1,3 triliun yang biasanya tidak jelas Peringatan KPK agar pemanfaatannya. Memang faktor menguatnya rupiah atas panitia seleksi CPNS be- dolar Amerika mempengaruhi, namun kanar-benar bisa mencipta- lau saja tidak ada peringatan KPK terhadap belum tentu ONH bisa turun setajam kan transparansi. Bebas Depag itu. Pasti banyak saja cara dan akal-akalan dari panitia haji untuk merugikan para jaKKN. maah haji. Apalagi daftar tunggu calon jamaah semakin padat dan panjang. Untuk bisa mendapatkan jatah berangkat haji seseorang harus segera mendaftar dengan menyetor sekurangnya Rp20 juta ke bank, begitupun mereka harus menunggu giliran sampai 4 tahun lebih. Bahkan di Aceh dan P. Jawa umat Islam harus sabar menunggu sampai tujuh tahun. Justru itu, peringatan dari pimpinan KPK Haryono Umar sangat positif, melegakan masyarakat khususnya pencari kerja di pemerintahan. KPK tegas mengingatkan, jika ada pejabat daerah berupaya meloloskan peserta seleksi CPNS dengan cara yang tidak fair, seperti menerima uang, barang, atau dijanjikan sesuatu, maka itu masuk kategori suap, bukan lagi gratifikasi, maka bisa dijerat dengan tindak pidana penyuapan dengan sanksi hukuman 20 tahun penjara. Kita harapkan KPK tidak hanya sekali saja mengingatkan para pejabat di daerah terkait sudah mendekatnya jadwal pendaftaran CPNS. Perlu diulang beberapa kali dengan penegasan yang lebih tegas lagi agar mereka tidak berspekulasi menerima uang suap dari peserta seleksi CPNS. Dalam tindak pidana penyuapan pihak penyuap juga dikenai sanksi pidana. Jadi, dua-duanya sama-sama kena pasal penyuapan, ancamannya maksimal 20 tahun penjara. Lamanya hukuman itu jelas melampaui sanksi bagi para koruptor yang pada umumnya hanya dihukum 4-5 tahunan penjara saja. Justru itulah kita harapkan semua proses penerimaan CPNS harus dilakukan terbuka, jangan ada yang ditutup-tutupi, dari mulai awal sampai akhir (pengumuman). Sistemnya harus terbuka sehingga pelamar mengetahui berapa nilai dan peringkatnya. Panitia ujian CPNS harus menampilkan daftar peringkat serta nilai yang didapat para peserta yang mengikuti proses seleksi dengan jujur. Dengan mengumumkan hasil tes secara transparan berarti menjadikan proses seleksi penerimaan CPNS nanti lebih terbuka, dan masyarakat pun akan lebih puas menanggapi hasil seleksi. Ke depan kita bisa berharap roda pemerintahan semakin baik, terbentuknya pemerintahan yang bersih, siap melayani masyarakat. Bukan aparatur negara yang minta dilayani. Model ‘’jual-beli’’ dalam penerimaan CPNS harus distop, semua pihak seharusnya sadar bahwa sistem KKN yang tumbuh subur di negeri kita dewasa ini akibat dari sistem rekrutmennya sarat KKN, semuanya pakai uang, sehingga ketika duduk melayani rakyat otaknya korup bagaimana mengembalikan uangnya ketika masuk CPNS. Untuk itulah semua pihak, elemen masyarakat samasama mengawal jalannya ujian CPNS, mengadukan pejabat yang masih nekat melakukan KKN ke KPK.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN  Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817.  Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan:


encana Kementerian BUMN membentuk holding company kemungkinan yang terlebih dahulu dan sebagai model percontohan BUMN yang diholding adalah holding di bidang Agro industri seperti PTPerkebunanNusantara.MenteriBUMN Mustafa Abubakar memperkirakan tahun ini, akan diholding 15 BUMN yaitu 14 perusahaan BUMN perkebunan dan satu perusahaan PTRNIakandijadikanholding (perusahaaninduk).Artinya15perusahaan digabung menjadi satu perusahaan atau perusahaan induk (holding). Maksud holding dilakukan untuk memperkuat produksi dan modal sektor perkebunan yang dapat bersaing dengan negara-negara tetangga. Mengingat tahun 2010 yang sudah tinggal beberapa bulan lagi, menteri mengharapkan bahwa tahun ini ada progres yang signifikan walau belum tentu selesai. Kalau dilihat kilas balik, terlihat nasib PTPN yang akan diholding terus mengalami perubahan sejak diambilalih dari perusahaan Belanda/asing menjadi perusahaannasional.PadaawalnyaPerusahaan Perkebunan ini merupakan perusahaan yangdioperasikandidasarkankepadajenis komoditi. Misalnya adanya perusahaan perkebunan yang khusus mengolah karet, sawit, teh, tembakau dll. Selanjutnya dalam perjalanannya berubah menjadi Perusahaan Negara Perkebunan (PNP), berubahlagimenjadiPTPerkebunan(PTP) yang terdiri dari 33 perusahaan di Indonesia.Tahun1996PTPdirestrukrisasimenjadi 14 perusahaan perkebunan yang diganti namanya PT Perkebunan Nusantara (PTPN) yang menjalankan aktivitasnya berkedudukan di tempat pusat operasinya di daerah provinsi. Alasan dari perubahan yang beberapa kali terjadi di tubuh BUMN Perkebunan cukup sederhana. Alasan tersebut yaitu agar perusahaan perkebunan milik negara

ini dalam aktifitasnya lebih efektif, efisien dan kinerjanya lebih meningkat dari sebelumnya yang diharapkan dapat lebih berkompetitif dan tidak adalagi BUMN Perkebunan yang merugi. Namun dalam perjalanannya BUMN Perkebunan apa yang diharapkan juga tidak sesuai kenyataan. Tetap saja ada PTPN yang merugi. Menurut Menteri BUMN (Bisnis Indonesia19/10)konsepholdingPTPN,yakni digabungkan semua PTPN menjadiholdingbesaratau menjadi Invesment Holding. Perusahaan dibagi berdasarkan komoditasnya (subholding) yaitu sawit, gula, karet, aneka tanaman(teh,kopidankakao). Dengan adanya perubahan ini bila diamati reaksidikalanganmasyarakat perkebunan (PTPN) kelihatan rencana ini dianggap biasa-biasa saja artinya mereka tak ambil pusing, karena barangkalisudahterbiasadengan perubahanyangdialami.Yang penting menurut mereka penghasilan tak berkurang, tidak ada PHK. Bahkan bagi karyawan PTPN yang kinerja perusahaannya selama ini kurang menggembirakan, sangat menyambut holding PTPN, karena dengan holding akan ada perbaikan penghasilan menurut mereka. Lain halnya karyawan PTPN yang selamainisudahbaikkinerjaperusahaannya, mulai sedikit bimbang karena kemungkinan penghasilan akan mengalami degradasi akibat akan adanya penyesuaian penghasilan. Ini untuk menyahuti keseragaman rata-rata penghasilan di perusahaanholding.Padahalselamainipenghasilan berbeda di antara PTPN berdasarkan kebijakan yang dilakukan manajemen dengan serikat pekerja dalam upaya untuk

meningkatkan kinerja di masing-masing PTPN dan juga tidak terlepas dari keputusan Pemerintah Daerah tentang penetapan Upah Minimum Privinsi (UMP). Dampak Dampakholding,biladilihatdarisudut pandangkepentinganstakeholders,secara urusanadministrasiakanmenambahjalur keputusan.Kalaubiasanyabisadiputuskan di Kantor Direksi di wilayah provinsi, namun setelah diholding diperkirakan harus menunggu sampai ke Kantor Direksi (pusat) tingkat holding. Bila saat ini setiap PTPN (ada 5 direksi), bila 14 PTPN jumlah direksi yang ada sekarang lebih kurang 70 direksi. Maka kalau terjadi holding di PTPN di tingkat holding ada 5 direksi dan di tingkat subholding karena dibagi berdasarkan komoditas seperti sawit, gula, karet dan aneka tanaman. Masing-masing subholding ada 3 direksi (Dirut, Dir.Operasional dan Dir. Umum), jadi di subholdingada 12 direksi seluruhnya. Berarti jika dibandingkan sebelum holding akan berkurang posisi 53 direksi, demikian juga komisarisnya juga akan berkurang. Dengan holding berarti struktur organisasi akan dilakukan penyesuaian yang kemudian juga akan berimbas terhadap penyesuaian kepada personalia tingkat kepala bagian, kepala urusan dan seterusnya sampai level paling bawah. Dari sudut biaya karena sudah berkurangnya direksi dan komisaris maka biaya tentu akan berkurang. Demikian juga kesempatan bagi tenaga pimpinan untuk menjadi direksi sangat kecil sekali jika dibanding saat 14 PTPN (70 direksi) dan bila di tingkat holding cuma akan ada 5 direksi dan subholding ada12 direksi jadi keseluruhan akan ada 17 direksi. Sebagaimana pandangan M Ikhsan Modjo dalam tulisannya melihat pengalaman pemerintah mendirikan institusi sejenis. Misalnya Badan Penyehatan Perbankan Nasional (BPPN), sebab, konsep BPPN tidak jauh berbeda dengan konsep perusahaan induk BUMN yang akan

dibentuk.Walau memiliki perbedaan tujuan, ide dasar kedua badan tersebut adalah pembentukan lembaga super yang menjadi sentral pengelolaan aset negara. Keduanya juga menerapkan mekanisme korporat dan memakai jasa profesional di luar birokrasi pemerintah. Dengan berbagai masalah yang ditujukan ke BPPN, seperti suap, kolusi, penyalahgunaan wewenang, hingga penghamburan uang negara, gaji selangit, fasilitas yang melebihi yang diberikan perusahaan, tingkat recovery rate yang hanya sebesar 28%. Bahkan perhitungan lain dari Center for Banking Crisis (CBC) menunjukkan tingkat yang lebih rendah lagi sekitar 1 persen hingga 2,9 persen. Menurut M. Ikhsan Modjo dari situ, korporatisasi atau holdingterbuktibukanjaminanperbaikan kinerjanya lembaga yang mengelola aset negara. Sebaliknya korporatisasi yang diiringi sentralisasi pengelolaan justru bisa mendatangkankerugiandalamskalayang lebih tidak terperikan. Kalau kita sedikit mengkaji ke belakang, masa lalu usaha perkebunan yang yang disebut berdasarkan komoditas, seperti teh waktu itu dikelola PTP VIII, tembakaudikelolaPTPIXdlllagi.Bilaterjadi harga teh dan tembakau turun, maka konsekuensinya akan mendatangkan kerugian yang lebih tidak terperikan. Dengan demikian tentu kita bertanya apakah selamanya harga, sawit, karet dan yang lainnya tetap stabil atau terus menunjukkan tren meningkat. Kalau harga di pasar menurun gimana? Oleh karena itu pada masa Menteri Syarifuddin Baharyah (PTPN di bawah kelola Departemen Pertanian) masing-masing PTPN agar tetap eksis diupayakan dengan mengelola usahanya dengan berbagai komoditi. Penutup Terlepas dari pro dan kontra terhadap perubahan bentuk di PTPN untuk holding kitamengharapkanperubahanakan lebih maju lagi kedepan. Jangan sebaliknya belumsatumasalahselesaitimbulmasalah baru, akhirnya demikian nasib PTPN senantiasaterusberubahseiringpenggantian menteri. Penulis adalah Pemerhati Perkebunan

Inalum; Awas Bujuk Rayu Saudara Tua Oleh Sofyan Harahap Jadi,mengherankan jika dikatakan Inalum merugi,apalagi kalau hasil auditnya tidak transparan


iwa nasionalisme berbagai elemen bangsa mendidih mendengar Jepangmasihtetapngototinginmemperpanjang kontrak pengelolaan PT Inalum. Apalagi isunya, kalau dikelola bangsa sendiri Inalum bakal hancur menjadi besi tua. Menurutcatatan,kerjasamaIndonesia dan Jepang di PT Inalum akan berakhir tahun 2013 dan setelah itu opsi ada di tangan pemerintah Indonesia, apakah meneruskan kerjasama dengan format baru, atau mengambil alih 100 persen kepemilikan sahamnya. Perusahaan yang berlokasi di Kuala Tanjung, Kabupaten Batubara, Sumatera Utara (Sumut) itu berdiri pada 6 Januari 1976 dengan investasi awal sebesar 411 miliar yen. Sebanyak 58,88 persen sahamnya dikuasai konsorsium asal Jepang dan sisanya dikuasai pemerintah Indonesia. Menurut Nasril Kamaruddin selaku Dirut PT Inalum, jika memutuskan untuk tidak memperpanjang kerjasama pada tahun 2013, pemerintah Indonesia harus membayar ganti rugi atau membayar kepemilikan saham pihak Jepang sebesar 58,88 persen dari total aset perusahaan. Ganti rugi dapat dibayarkan sesuai nilai bukuatausesuainilaipasarasetpadatahun 2013 nanti. Indonesia bisa memilih mana yang lebih murah, berdasarkan nilai buku atau nilai pasar. Nasionalis atau kacung? Pertanyaannya: Bagaimana masa depan Inalum pasca 2013? Jawabnya terpulang pada pemimpin bangsakita.Presidenbersamaparamenteri terkait plus pejabat Sumutlah yang akan memutuskannya. Jadi, sangat tergantung situasi dan kondisi yang berkembang dalam beberapa bulan mendatang. Hemat kita, hanya dua kemungkinan yang bakal terjadi. Pertama,merebutInalumtanpasyarat. Jika itu terjadi, masyarakat khususnya warga Sumut, pasti bangga.Ternyata pemimpinnya masih memiliki jiwa nasionalisme. Apalagi kalau putusan itu diambil segera di bulan ini saat bangsa kita merayakan Hari Pahlawan 2010. Kedua, menyerah dengan ‘’imingiming’’ tawaran baru yang menggiurkan. Sepertihalnyapadakonsepawaldidirikannya Inalum harapan bangsa kita sangat besar, terutama warga Sumut bakal menerima anugerah, bakal sejahtera dan kawasan Inalum bakal menjadi kota satelit. Nyatanya tidak demikian, karena Inalum katanya lebih banyak menderita kerugian dengan berbagai alasan, seperti apresiasi

mata uang jepang (Yen) terhadap dolar Amerika. Kita berharap opsi kedua dibuang jauhjauh. Tapi kalaupun itu terjadi, semakin kuatlah image negatif bahwa pemimpin kita hanya sekadar ‘’kacung’’nya bangsa lain dalam hal ini Jepang sebagai‘’saudara tua’’. Masyarakat Sumut sejak lama menginginkan Inalum diambil alih dari Jepang tanpasyarat.Artinya,berapapunkompensasi berupa utang yang yang masih tertinggal tidak menyurutkan kita untuk mengambil alih perusahaan di Kab. Batubara itu. Harapan itu terbuka setelah Menteri Badan Usaha Milik Negara (BUMN) MustafaAbubakarmenegaskan,Indonesia sanggup mengambil alih proyek Inalum yang saat ini merupakan proyek patungan antara Indonesia dengan Jepang. Bahkan, mantan Gubernur Aceh itu sudah sampai pada biaya ganti ruginya. Berapa pun dana yang dibutuhkan untuk mengambil alih kita sanggup, kita sudah hitung-hitung, katanya penuh keyakinan. Bagi 13 juta warga Sumut pengambilalihan Inalum merupakan kebanggaan. Apalagi kontribusi perusahaan itu sangat kecil bagi Sumut. Hanya segelintir pejabat dan masyarakat saja yang menikmati. Mayoritas warga Sumut, termasuk warga Asahan –saat ini masuk kabupaten baru (Batubara)— tidak merasakan hasilnya. Saat listrik di Sumut‘’byar pet’’ Inalum juga kurang peduli membantu dengan berbagai alasan, takut terganggu produk aluminiumnya. Setelah ‘’digertak’’ dan ‘’diancam’’ kelompok massa baru Inalum menyalurkan listriknya ke PLN. Padahal, potensi Inalum luar biasa besar (dan sebenarnya menguntungkan) jika dikelola dengan benar lewat manajemen terbuka. Dengan menjual listriknya saja sudah untung,apalagidibarengidenganmenjual produk aluminiumnya. Produkaluminiumdipasarinternasional (dunia) semakin diminati. Bahan ini bisa dibuat berbagai produk. Bahkan, sejumlah komponen pesawat pun dari dibuat dari aluminum. Prospeknya cerah karena kemasan makanan yang berasal dari aluminium bisa didaur ulang, tidak terbuang percuma apalagi sampai menimbulkan polusi. Jadi, mengherankan jika dikatakan Inalummerugi,apalagikalauhasilauditnya tidaktransparan.Cenderung‘’akal-akalan’’ pihak Jepang untuk tetap bisa mengelola Inalumdanmengautkeuntungankenegaranya, setiap tahun dan sebanyak-banyaknya. Masalah kerugian selalu digembargemborkan dengan tujuan Inalum tetap

dalam penguasaan Jepang. Andai memang Inalum merugi, pastilah pihak Jepang senang jika pemerintah Indonesia mengambil alihnya. Jepang tak perlu sewot dan selalu mengulur waktu untuk melakukan perundingan. Untung saja, desakan massa menguat untuk mengambil alih Inalum dengan konsekuensi apapun juga, baru Jepang melemah dan berjanji akan menambah investasinya ratusan juta dolar AS lagi buat pengembangan kapasitas produksi aluminium sekaliguspembangkitlistrik.Kondisiseperti itu jelas semakin mencurigakan. SaatnyakitategasterhadapJepangagar Inalum segera dikelola putra-putri Indonesia. Potensi SDM kita lebih dari cukup sehingga tidak perlu takut Inalum bakal hancur jika ditangani anak-anak bangsa sendiri. Semakin cepat Jepang angkat kaki semakin baik. Pemerintah Indonesia tidak perlu ragu untuk mengambil alih secara penuh sekaligus mengelola sendiri perusahaan pelebuhan aluminium itu. Pasti untung, pasti lebih berkembang, asalkan dikelola secara profesional dengan mengutamakan putra daerah. Jauhkan Inalum dari KKN, semua pihak wajib mengawal aset berharga warga Sumut itu. Positif Seorang teman di Inalum, ia pernah menjabat salah satu direktur di PT Inalum dalam omong-omong dengan penulis menceritakan bahwa kondisi pabrik dan teknologi yang dimiliki Inalum cukup baik dan membanggakan. Melalui “technical improvement” kinerja Pembangkit Listrik (PLTA-Asahan-2) dan Pabrik Peleburan dapat beroperasi di atas kapasitas desain. Bahkan di atas rata-rata kinerja beberapa Smelteryangadadidunia.Bahkan,Inalum dapat meningkatkan kemampuan kapasitasnya menjadi sekitar 13% di atas kapasitas desain yaitu kira kira 255.000 ton per tahun yang dikelola sepenuhnya oleh putra-putra Indonesia secara mandiri. Catatan dalam beberapa tahun terakhir ini Inalum berhasil membukukan keuntungan bersih rata-rata 120 juta US$/ tahun,walaupunsejakOktober2008terjadi krisis keuangan global, namun berdasarkan kondisi aktual saat ini, maka diharapkan akumulasi kerugian bisa habis pada tahun fiskal 2010 dan pada tahun 2013 nanti Inalum sudah bisa mendapatkan akumulasi keuntungan. Selain itu, pinjaman Inalum juga akan lunas pada tahun 2012 bahkan mungkin bisa lebih cepat lagi sehingga beban biaya pinjaman yang selama ini menjadi bagian dari biaya operasi sekitar rata 10% akan menjadi nihil dan bagian ini akan menjadi bagian keuntungan Inalum. Dengan demikian maka keuntungan Inalum akan menjadi lebih besar dari yang bisa didapat saat ini. Semuanya positif sehingga memang tidak boleh ada pihak yang menghalangi pengambilalihan Inalum, kecuali

mereka-mereka yang pro-penjajah. Penutup Semakinkuatdesakanmasyarakatuntuk mengambil alih Inalum agar dikelola bangsa sendiri karena kontribusi Inalum terhadapkesejahteraanwargaSumutselama tiga dasawarsa sangat minim. Alasan kerugian Jepang perlu diklarifikasi karena tidak masuk akal dengan menyertakan auditorindependenyangtidakpro-penjajah. Pasca 2013 Inalum harus lebih baik. Pemerintah pusat boleh saja melibatkan PLN untuk mengelola pembangkit listrik tenagaair(PLTA)Asahan,sementarapabrik aluminium akan dikelola oleh Antam dan perusahaan sekuritas yang membantu pembiayaan pengambilalihan pabrik aluminium. Namun Pemprovsu tidak boleh ditinggalkan. Saham Pemprovsu diharapkan dapat dinikmati seluruh warga Sumutdalambentukpembangunanfasilitas pendidikan, kesehatan, perekonomian rakyat dll. Oleh karena itu, opsi pengambilalihan Inalum hukum wajib. Rakyat Sumut menangis andai saja pemerintah pusat/daerah termakan bujuk rayu dan‘’akal-akalan’’ saudara tuanya bangsa penjajah: Jepang.** Penulis adalah wartawan Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Bantuan pengungsi Sinabung diperjualbelikan - Apa gak takut kualat? * CBD harus berjarak 300 m dari Runway Polonia - Sekarang sudah tak berjarak * KA jurusan R.Prapat-Medan memprihatinkan - Awak duduk pun tak tenang!


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Balyan Kadir Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Mimbar Jumat

WASPADA Jumat 12 November 2010

Meneladani Pengorbanan Nabi Ibrahim AS Oleh Drs H.As’ad Marlan, MAg


ari raya Idul Adha akan hadir kembali di tengahtengah umat Islam. Kehadirannya membawa pesan kepada umat manusia untuk sejenak merenungkan kembali tentang pembelajaran terhadap peristiwa sejarah anak manusia yang sangat besar yaitu pengorbanan Nabi Ibrahim AS yang telah terjadi lebih kurang lima ribu tahun yang silam. Fenomena sejarah itu selalu aktual untuk dibicarakan dan menjadi teladan sepanjang zaman, sebab manusia tanpa kecuali, terutama umat Muhammad SAW yang beriman dalam menjalani hidup dan kehidupan ini selalu diiringi dengan berbagai macam ujian dan tantangan. Betapapun kecilnya ujian akan terasa berat dan sukar untuk dihadapi, dan hal itu hanya dapat dilalui dengan baik manakala manusia sanggup menundukkan hawa nafsu dan mengendalikan diri dari rayuan syaitan. Rintangan dan tantangan Sejak masa remaja Nabi Ibrahim AS adalah pejuang yang selalu mentauhidkan Allah SWT, sedangkan masyarakat dan lingkungan sekitarnya mayoritas musyrik penyembah berhala. Beliau mengajak mereka meninggalkan sesembahan yang menyesatkan itu untuk menyembah Allah yang tidak ada sekutu bagi-Nya. Namun ajakan itu tidak digubris dengan baik, tetapi justru ditentang dan dianggap subversif. Mereka tetap ingin mempertahankan agama dan budaya nenek moyang mereka. Hal ini dijelaskan Allah SWT : “Berkata mereka (kaum musyrik) kami mendengar pemuda menyebut-nyebut (mencerca) sembahan kami (berhala) ia bernama Ibrahim”. (QS. Al-Anbiya : 60). Nabi Ibrahim AS semakin gencar dan dahsyat. Beliau dimusuhi bahkan oleh keluarganya sendiri. Dan akhirnya sampai pada klimaksnya beliau dibakar hiduphidup. Namun api yang berkobar itu tidak diizinkan Allah membakar dan menyakiti Nabi Ibrahim AS. Hal ini difirmankan Allah SWT: “Wahai api, menjadi sejuklah engkau dan aman bagi Ibrahim”. (QS. Al-Anbiya : 60). Nabi Ibrahim sebagai pemimpin dan pejuang mempunyai rasa tanggung jawab terhadap masa depan bangsanya beliau sempat cemas sebelum mendapatkan keturunan yang nantinya diharapkan dapat melanjutkan estafet da’wah perjuangannya. Disamping terus berjuang. Nabi Ibrahim AS sambil terus berdo’a agar dianugerahi keturunan yang saleh. Do’anya yaitu : “Ya Tuhan Kami (Allah) berikan kabar baik dengan lahirnya anak yang berbudi luhur dan sabar (Ismail)”. (QS. Ash-Shaffat : 100-101). Allah mengabulkan do’a Nabi Ibrahim setelah beliau berusia lanjut (90 tahun lebih). Kemudian realisasi do’a Nabi Ibrahim sampai pada puncaknya tatkala Allah memberikan keturunan dari Ismail AS, manusia pilihan terbaik yang menjadi rasul, sampai kepada Nabi Muhammad SAW pembawa rahmat dan penyempurna akhlak. Pelajaran dan teladan

Sebagaimana kita ketahui bahwa disyariatkannya menyembelih kurban pada hari raya Idul Adha dan pada hari-hari tasyrik adalah untuk mengenang kembali peristiwa yang terjadi pada Nabi Ibrahim AS. Suatu ujian yang sangat berat telah dicoba oleh Allah kepada beliau. Keimanan Nabi Ibrahim diuji. Allah memberikan wahyu kepadanya agar menyembelih putranya yang bernama Ismail. Putra yang sangat disayanginya dan menjadi buah hati selama ini ternyata harus disembelih dengan tangannya sendiri. Kenyataan, kecintaannya kepada Allah tidak boleh dikalahkan oleh kecintaan kepada anak. Perintah Allah menyem-belih anaknya harus dilaksanakan meskipun dengan hati yang terasa berat. Ismail sebagai puteranya lalu dipanggil dan diberitahu mengenai perintah Allah itu. Ternyata Nabi Ismail AS, puteranya bukan merasa susah dan khawatir, melainkan justru bersemangat mendorong ayahnya untuk melaksanakan apa yang diperintahkan Allah SWT. Firman Allah SWT: “Ibrahim berkata”Hai anakku,sesungguhnya aku melihat dalam mimpi bahwa aku menyembelihmu”., Ia menjawab: “ Hai ayahku, kerjakanlah apa yang diperintahkan kepadamu, Insya Allah kamu akan mendapatiku termasuk orang-orang yang sabar”. (QS. Ash-Shaffat : 102). Dari pelajaran yang merupakan inti dari akidah dan syariat Islam, diantaranya: Pertama, Allah menguji Mahabbah (kecintaan) Nabiullah Ibrahim AS. Tingkat mahabbah seorang ayah terhadap anaknya, biasa sangat tinggi. Apalagi Ismail AS merupakan dambaan sejak ia dalam kandungan ibunya Siti Hajar. Mahabbah terhadap anak seringkali melalaikan cinta Bapak terhadap Allah SWT. Nabi Ibrahim diuji. Ternyata tauhid di dalam dadanya sangat mendalam, sehingga ia tidak bergeming sedikitpun dari mahabbahnya terhadap Allah SWT. Kedua, kesayangan kepada anak seringkali berlebihan, sehingga seorang ayah lebih memprioritaskan bagi anaknya, lebih dari yang lainnya. Dalam bidang apapun. Apalagi, jika anaknya betul-betul memanfaatkan kelemahan akhlak ayahnya. Maka seringkali dalam berbagai bidang kehidupan terjadi fenomena tersingkirnya satu pihak yang lebih berhak atas sesuatu urusan, hanya karena ia kalah bersaing dengan anak si pembuat keputusan. Dalam bidang politik, hal ini disebut dengan nepotisme. Ketiga, dakwah Islam memerlukan pengorbanan, apapun bentuknya. Dalam rangka pengabdian kepada Allah Ibrahim AS telah rela mengorbankan anaknya demi tegaknya syiar Islam di muka bumi. Lebih dari itu, pengorbanan juga juga merupakan manifestasi rasa syukur manusia atas nikmat-nikmat yang telah diterimanya. Allah SWT berfirman : “Sesungguhnya Kami telah memberi kepada engkau nikmat yang banyak, maka shalatlah dan berqurbanlah”. (QS. AlKautsar :1-2). Wallahu A’lam Bishshawab. ● Penulis adalah: Guru MAL IAIN-SU Medan.

Drama Haji Oleh Abdul Hakim Siregar, MSi


ayaknya pertunjukan drama, lokasi dan setting haji tak dapat tidak, mesti dikerjakan di Makkah. Namun, sebelum ke tanah suci, pemerintah/petugas haji telah menyeleksi kesehatan para calon haji (Calhaj) untuk berhaji. Termasuk, para Calhaj sudah mengikuti manasik haji di daerah, latihan simulasi haji, sebelum mereka terjun melaksanakan haji yang sesungguhnya, di Makkatulmukarramah (kota Makkah yang mulia). Ibadah yang hanya wajib sekali seumur hidup ini, tidak saja memerlukan biaya puluhan juta, tetapi juga membutuhkan ketahanan fisik. Karena, berbagai kewajiban dan rukun haji adalah kerja gerak fisik, seperti melontar jumrah, sa’i, dan tawaf. Apalagi, pelaksanaan haji melibatkan jutaan orang dari berbagai negara, budaya, karakter, dan ras berbeda. Akan tetapi, di balik itu semua (ketangguhan fisik dan perbedaan negara dan budaya), lakon haji mengharuskan kerjasama, menghindari perilaku rafas (perilaku tercela/tidak senonoh), fasik, dan pertikaian, saat berhaji. Jika, sebelum keberangkatan haji, para Calhaj mengikuti manasik haji yang hendak mereka laksanakan ketika beribadah haji di Makkah. Sepulang haji, mestinya mereka tidak lagi rafas, tidak fasik, dan tidak bertikai, itulah hasil training dan di antara nilai haji selama di Makkah, di tanah air menjadi haji mabrur. Kita juga dapat memperdalam spirit lakon haji sebagaimana dikemukakan Dr Ali Syariati, dalam bukunya Hajj, diterjemahkan oleh Anas Mahyuddin dalam bahasa Indonesia, terbitan Pustaka tahun 1983, layak direnungkan. Pemikiran Ali Syariati, cendikiawan Muslim asal Iran ini, disebut-sebut memengaruhi jutaan kaum muda Iran, sehingga terjadilah revolusi memakzulkan rejim Pahlevi tahun 1979, yang dikomandani oleh Imam Khomaini. Dua tahun setelah wafatnya Ali Syariati, tahun 1977. Inilah beberapa spirit haji yang dikemukakan Ali Syariati dalam pertunjukan haji: Esensi haji Menurut Ali Syariati esensi haji ialah evolusi manusia menuju Allah. Haji contoh simbolis filsafat penciptaan Adam. Jelasnya, haji merupakan pertunjukan bersama: penciptaan, sejarah, keesaan, ideologi Islam, dan umat. Di dalam lakon itu ada beberapa syarat: Allah sutradaranya; tema yang diproyeksikan ialah aksi orang yang terlibat di dalamnya: Adam, Ibrahim, Hajar, dan Setan para pelakunya; skenanya: masjidil haram, bukit Safa-Marwah, Arafah, Mina, Kabah, siang-malam, matahari terbit, matahari terbenam, berhala, qurban, pakaian Ihram, dan Halq (memotong rambut).Walhasil, kata Ali Syariati, Andalah yang memainkan semua drama itu. Tidak peduli apakah Anda pria atau wanita, tua atau muda, berkulit hitam atau putih, Anda aktor utama dalam lakon itu. Andalah yang berperan sebagai Adam, Ibrahim, dan Hajar. Pertunjukan pun dimulai, sang aktor (manusia) harus berganti pakaian, sebab pakaian melambangkan pola preferensi, status, dan perbedaan. Karena itu, apa pun ras dan sukumu lepaskanlah semua topeng (pakaian), serigala (melambangkan kekejaman dan penindasan), tikus (melambangkan kelicikan), anjing (melambangkan tipu daya), dan domba (melambangkan penghambaan). Demikian pula, segala bentuk keakuan dan kecenderungan mementingkan diri sendiri kuburlah di miqat. Setelah itu, pakailah dua helai pakaian, sehelai taruhlah di bahu, sehelai lagi lilitkan di pinggang. Lalu, bergabunglah dengan kerumunan manusia, sehingga keakuan sudah terkubur, tinggallah kita dalam kebersamaan. Setelah mengenakan pakaian ihram, maka berjalanlah dengan penuh semangat. Ingatlah state ini hanyalah tempat wukuf (berhenti) sebentar. Lalu, lanjutkan lagi state lain, tujuan terakhirnya ialah menghampiri Allah. Bagi manusia, segalanya bersifat sementara, binasa, dan musnah, tetapi gerakan itu haruslah terus-menerus menuju keabadian dan kesempurnaan, tujuannya Tuhan. Ini merupakan gerakan pergi dan kembali. Dari Makah

pergilah ke Arafah (innalillaahi=sesungguhnya kita kepunyaan Allah) dan dari Arafah kembalilah ke Makkah (wa innaa ilaihi rajiuun=dan sesungguhnya kepada-Nyalah kita kembali). Arafah merupakan titik awal sejarah manusia, yakni Adam dan istrinya. Mubit (bermalam) di Muzdalifah dan Mina Arafah mulai menghilang ditelan malam. Begitu matahari terbenam, ambillah keputusan melanjutkan kembali perjalanan. Di dalam setiap tahap engkau hanya berhenti sebentar, bukan menetap. Melalui mubit (bermalam) ini ketahuilah hidup ini hanya sesaat. Di keheningan malam, selain berzikir kepada Allah, di tengah banyaknya orang, engkau bagai setitik garis atau setetes di antara banyaknya tetesan, mengalirlah dengan mengikuti arus. Berjuanglah dengan harapan dan keimanan seperti orang yang tanpa diduga diserang oleh malam/musuh. Karena itu, engkau harus memungut dan menyiapkan krikil, yang dipergunakan di pagi hari melontar/jumrah di Mina. Melontar Jumrah Inilah sebuah pertempuran, tembaklah berhala itu, engkau memainkan peran Ibrahim melontar Syetan yang menghalanginya mengurbankan Ismail, anaknya. Termasuk di dalamnya melontar kecenderungan hawa nafsu yang berlebihan. Tawaf Tawaf (mengelilingi Kabah) merupakan sebuah gerakan dan sirkulasi. Kabah melambangkan ketetapan (konstansi) dan keabadian Allah, sedangkan manusia berbondong-bondong yang mengelilinginya melambangkan aktivitas dan transisi makhluk ciptaan-Nya, aktivitas dan transisi yang terus-menerus. Tawaf contoh sistim mo-notheisme (tauhid) yang mencakup orientasi sebuah partikel (manusia). Allah adalah pusat eksistensi; Dia-lah titik fokus dunia fana ini. Sebaliknya, manusia sebuah partikel yang bergerak dengan mengubah posisinya seperti seharusnya. Antara manusia dan Tuhan ada hijab, dan jarak itu tergantung kepada jalan yang dipilih manusia dalam sistim ini. Oleh karena itu, ketika tawaf manusia harus menceburkan dirinya dan hilang di tengah keramaian orang. Inilah gelombang dan lautan manusia yang bergerak mengelilingi Kabah. Sa’i antara Sofa dan Marwah Larilah dari Sofa ke Marwah sebanyak tujuh kali. Di sini, engkau berperan sebagai Hajar, seorang budak perempuan dari Ethiopia. Hajar merupakan teladan kepasrahan dan kegigihan tekad, ia tidak berpangku tangan menunggu hujan turun dari langit, tetapi bangkit dan bergerak mencari air. Hajar teladan ibu yang bertanggung jawab, berjuang, bergerak, seorang ibu yang mencintai, menyendiri/sendirian, mengelana, mencari, dan menanggung penderitaan serta kekawatiran. Sa’í merupakan perjuangan fisik. Sa’i berarti mengerahkan seluruh tenaga di dalam pencarian air dan roti untuk menghilangkan lapar dan dahaga yang engkau tanggungkan beserta anakanakmu. Sa’i adalah perjuangan mencari kebutuhan dari alam, memperoleh air dari bebatuan. Halq (bercukur) atau Taqsir (memotong rambut) Ketika Sa’i berakhir di Marwah, potonglah rambutmu. Tanggalkanlah pakaian ihram dan kenakan pakaianmu yang biasa. Engkau bebas dan memenangkan pertunjukan. Dari bukit Marwah pergilah ke sumur Zamzam, ambilah minumlah sekedarnya, basuhlah mukamu, dan bawalah sedikit ke negeri asalmu untuk dibagikan kepada orang lain (Ali Syariati). Air salah satu simbol kehidupan, berbagi dan berbahagialah karena engkau telah ber-halq/ tahallul, menutup (ending) drama ini dengan kemenangan pribadi dan sosial. Tetapi, tetaplah waspada dan teruslah berjihad, memerangi kecenderungan hawa nafsu berlebihan, ini jihad akbar, sebuah perubahan hidup yang berkelanjutan, tak kunjung sirna. ● Penulis adalah: Guru PAI pada MTs Swasta YPKS, SMA Swasta NI, & MTs N 2 Padangsidimpuan


Mengakses Kebesaran Tuhan Melalui Thawaf F

ungsi yang sangat besar dari ibadah thawaf (pada pelaksanaan ibadah haji) adalah membangun hubungan yang harmonis antara manusia dengan Allah. Sekalipun ibadah ini dilakukan berulang kali (sebanyak 7 putaran) namun aksesnya tidak akan pernah tercapai jika tidak dihayati secara serius. Keseriusan ini muncul dari hati yang suci dan tekad yang mendalam untuk lebih mendekatkan diri kepada Allah. Pesan-pesan yang ingin disampaikan melalui ibadah thawaf ini adalah untuk mengajari manusia dalam mencari kebesaran Allah. Pencarian ini harus dilakukan berulang kali sebagaimana halnya ibadah thawaf yang dilakukan sebanyak 7 (tujuh) kali putaran. Dengan demikian maka pencarian akan esensi dan eksistensi Allah tidak akan pernah berhenti sebelum sampai kepada sasaran yang diinginkan. Terdapatnya sarana-sarana yang mengiringi ibadah thawaf pada prinsipnya semakin menambah kredit point untuk mengakses keagungan dan kebesaran Allah. Sarana-sarana dimaksud seperti Ka’bah, bacaan-bacaan ketika thawaf, syarat-syarat untuk melakukannya dan jumlah putaran yang dilakukan yang masing-masing memiliki kontribusi dalam menghayati pelaksanaan ibadah thawaf. Penghayatan yang baik terhadap ibadah thawaf akan melahirkan sifat ta’zhim (kagum) terhadap kebesaran Zat Yang Maha Kuasa. Implikasi dari sifat kagum terhadap Zat Yang Maha Kuasa ini dapat munumbuhkan keyakinan bahwa kehadiran Allah sangat dekat dalam kehidupan ini. Perasaan dekat kepada Yang Maha Kuasa akan melahirkan sifat khauf (takut) dan raja’ (harap). Thawaf termasuk salah satu perbuatan ibadah haji yang di dalamnya terdapat nilai-nilai spritual yang tinggi khususnya dalam mengakses kebesaran Allah Swt. Guna mendapatkan akses ini maka pelaku thawaf tidak perlu kasak-kusuk untuk menyelesaikan putaran secepatnya. Adapun yang penting baginya adalah penghayatan yang serius terhadap nilai-nilai spritual dari setiap putaran yang dilakukan. Bacaan-bacaan asma Allah yang dikumandangkan sewaktu thawaf semakin menambah khidmatnya penghayatan terhadap nilai-nilai spritual dimaksud.

Oleh Dr Achyar Zein, MA

Penghayatan nilai-nilai spritual disini adalah kemampuan menangkap sifat-sifat kesempur-naan Allah. Implikasi dari peng-hayatan ini akan membuat setiap pengabdian yang dilakukan kepada-Nya selalu dilandasi oleh keikhlasan. Pentingnya penghayatan nilainilai spritual ini dapat dilihat melalui objek yang dikelilingi yaitu Ka’bah sebagai salah satu lambang kesucian di atas dunia. Melalui lambang kesucian ini maka orangorang yang melakukan thawaf harus berada dalam keadaan yang suci. Kesucian ini tidak hanya sebatas kesucian lahiriyah seperti pisik akan tetapi kesucian bathiniyah seperti hati juga sangat perlu. Perbuatan thawaf dengan mengelilingi Ka’bah sebanyak tujuh kali putaran semakin memberikan peluang untuk mengakses kebesaran Allah. Jika selama ini keberadaan Ka’bah hanya sebatas khayalan, khususnya bagi orang-orang yang belum menunaikan ibadah haji, maka pada saat ini Ka’bah sudah merupakan benda konkrit karena para jamaah berhadapan langsung dengannya. Oleh karena itu orang-orang yang sudah melakukan thawaf harus memiliki nilai plus dalam beribadah bila dibanding dengan orang-orang yang belum melakukannya. Untuk mendapatkan nilai-nilai spritual dalam thawaf ini maka syarat-syarat yang sudah ditentukan dalam pelaksanaannya harus ditaati dengan baik dan benar. Syarat-syarat dimaksud tidak hanya sebatas tata cara yang sudah diatur dalam pengertian pisik akan tetapi yang lebih penting lagi adalah persyaratan moral yaitu kesucian jiwa. Kesucian pisik dan jiwa ini

diharapkan dapat saling menopang untuk melakukan akses melalui ibadah thawaf ini. Urgennya persyaratan moral ini disebabkan prediket bangunan yang dikelilingi adalah lambang kesucian sehingga pengaruhnya akan signifikan jika dilakukan dengan jiwa yang suci. Jika salah satu syarat thawaf adalah suci dari hadats besar dan kecil maka persyaratan ini harus dimaknai dengan kesucian jiwa karena keduanya sama-sama penting untuk mendekati Zat Yang Maha Suci. Persyaratan ini dianggap sangat penting supaya setiap putaran thawaf memberikan makna tersendiri sehingga masing-masing putaran memberikan kontribusi bagi putaran berikutnya. Akumulasi dari semua putaran ini memunculkan pemahaman bahwa Ka’bah adalah hebat namun masih berstatus makhluk. Dan oleh karena itu kehebatan Pemilik Ka’bah jauh lebih besar dan sempurna dari Ka’bah itu sendiri. Keberadaan Ka’bah, jumlah dan tatacara putaran serta bacaan-bacaan thawaf adalah sebagai sarana dan prasarana untuk lebih mudah mengakses kebesaran Allah Swt. Dalam tataran ini kekaguman pelaku thawaf (para jamaah yang sedang menunaikan haji) tidak boleh terhenti dengan melihat Ka’bah karena di balik itu masih ada Zat Maha Kuasa yang paling penting untuk dikagumi. Putaran thawaf yang berlawanan dengan arah jarum jam menarik juga untuk dianalisis. Putaran jarum jam bergerak ke arah kanan sedangkan putaran thawaf bergerak ke arah kiri. Menurut para ahli jika arah putaran dilakukan ke kanan (seperti arah jarum jam) maka aksesnya adalah ke bawah dan sebaliknya jika dilakukan ke kiri maka aksesnya adalah ke atas. Mengingat bahwa putaran thawaf mengarah ke kiri maka pelaku thawaf akan naik ke atas sehingga sangat mudah baginya menangkap keagungan dan kebesaran Allah. Pada kondisi ini pelaku thawaf sudah dapat me-

nginternalisasi sifat-sifat kesempurnaan Allah yang akhirnya dapat merasakan bahwa kehadiran Allah sangat dekat dengan dirinya. Melalui pendekatan ini maka Allah menjadi sumber kontrol dalam kehidupannya sehingga dirinya terhindar dari perbuatan dosa. Posisi pelaku thawaf yang berada di atas sangat mempengaruhi cara pandangnya terhadap keberadaan dunia. Ketika posisinya di atas maka dunia ini akan dilihatnya kecil dan sedikitpun tidak ada rasa ketertarikan dalam hatinya untuk merebut dunia. Dunia diposisikannya hanya sebatas telapak tangan dan sama sekali tidak pernah dimasukkan ke dalam hati dan jiwanya. Kemudian pelaksanaan thawaf ini juga mengajarkan kepada pelakunya bahwa dunia ini serba terbatas dan akhirnya manusia akan kembali kepada keadaan semula. Apapun yang kita kerahkan untuk mencari dunia namun akhirnya tetap saja kembali kepada titik nol sebagaimana halnya dengan pelaksanaan thawaf itu sendiri. Kepuasan dalam mengeruk kesenangan duniawi hanya bersifat temporal, semu, membosankan dan tidak pernah mengenal garis finish. Kepuasan yang hakiki dan abadi hanya ada pada ‘pangkuan ilahi’ dan karenanya ajaran filosopis thawaf menunjukkan agar manusia kembali secepatnya ke ‘pangkuan ilahi’ karena disinilah sumber kepuasan yang hakiki dan abadi. Banyak manusia yang sudah sukses mendapatkan material duniawi yang berlimpah tapi mengaku bahwa semua yang ada pada genggamannya hanya mengantarkannya kepada kebahagiaan yang semu. Akhirnya mereka kembali mendekati Allah dan disinilah mereka dapat merasakan sumber kebahagiaan yang sebenarnya. Implikasi yang dapat terlihat dari orang-orang yang berhasil melaksanakan thawaf dengan baik dan benar adalah kepuasan bathin karena sudah dapat merasakan kehadiran Allah sangat dekat dengan dirinya. Kepuasan bathin ini ditandai dengan pelaksanaan ibadah yang berkualitas sehingga dirinya memiliki perbedaan plus baik ibadah yang berkaitan dengan Allah terlebih lagi ibadah yang berkaitan dengan manusia.

Dimensi Sosial Ibadah Haji


ita merasa bahagia dan bersyukur bahwa kaum Muslim Indonesia yang berziarah ke Tanah Suci semakin meningkat. Peningkatan yang cukup menggembirakan itu tentunya harus diiringi dengan suatu upaya penggalian terhadap makna dan relevansi ziarah tersebut secara lebih substansial. Pada hakikatnya ibadah haji bukan merupakan serangkaian ritual semata, lebih dari itu, yaitu napak tilas perjalanan hamba-hamba Allah yang suci; Nabi Ibrahim, Hajar dan Nabi Ismail. Peristiwa yang mereka jalani amat historis, sebab itu banyak memberikan pelajaran. Haji merupakan ibadah yang amat penting. Ibadah ini, oleh para ulama, ditempatkan sebagai rukun Islam yang ke lima. Haji merupakan rutinitas ritual yang dapat mengantarkan pelakunya menjadi manusia yang bersih. Rasulullah bersabda, “Siapa yang melakukan haji tidak melakukan rafats, dan tidak berbuat fasik ia kembali sebagai hari pada ia dilahirkan oleh ibunya.” Mencari makna Secara general dapat dipahami, setiap pelaksana ibadah haji bertujuan untuk memperoleh haji mabrur. Tujuan itu bukannya tanpa alasan, terkait dengan hal ini, Rasulullah bersabda, “Sebaik-baik amal ialah; iman kepada Allah dan RasulNya, kemudian jihad fi sabilillah, kemudian haji mabrur.” Hadis ini mendapat penguatan dari teks hadis lain, “Jihadnya orang yang sudah tua dan jihadnya orang yang lemah dan wanita ialah haji mabrur.” Indikator haji mabrur tidak mesti diukur dari bingkai penampilan fisikal saja. Tapi, ritualisme tersebut terangkai melalui komitmen yang kuat dan solidaritas sosial yang tinggi. Ibadah haji bisa dinilai baik dan dikatakan mabrur bila secara sosial pelaksananya memberikan manfaat kepada orang-orang yang ada di sekitarnya. Dalam sebuah hadis ditegaskan, “…tidak ada balasan bagi haji mabrur kecuali surga. “ Dengan kata lain surga adalah tempat yang pantas bagi orang yang hajinya mabrur. Hadis ini mengajak kita membuat satu renungan fundamental. Dari

Oleh KH. Amiruddin, MS

sini, timbul pertanyaan lebih lanjut, “Mengapa haji mabrur balasannya surga?” Secara semantis, yaitu dengan memahami makna haji mabrur itu sendiri, kata “mabrur” berasal dari baha-sa Arab yang artinya mendapatkan kebaikan atau menjadi baik. Kalau kita lihat akar katanya, kata “mabrur” berasal dari kata “barra”, yang berarti berbuat baik atau patuh. Dari kata barra ini kita bisa mendapatkan kata “birr-un, al-birru-u” yang artinya kebaikan. Dengan kata lain haji mabrur adalah haji yang akan mendapatkan kebaikan. Sering juga dikatakan sebagai ibadah yang diterima Allah. Dalam terminologi yang lebih luas, haji mabrur adalah haji yang mendatangkan kebaikan bagi pelakunya atau pelakunya selalu memberi kebaikan kepada orang lain. Jika definisi itu dibalik, maka haji yang mardud (tertolak) adalah haji yang tidak mendatangkan kebaikan bagi pelakunya atau pelakunya tidak memberikan kebaikan kepada orang lain. Jika dipahami secara seksama, kata mabrur memiliki dua makna sekaligus, yaitu menjadi baik dan memberikan kebaikan. Makna itu menegaskan bahwa pelaksana ibadah haji adalah orang yang akan menjadi baik sekaligus selalu memberikan kebaikan kepada orang lain. Dalam hal apakah kebaikan itu harus diwujudkan? Allah berfirman, “Kamu tidak akan mendapatkan kebaikan yang sempurna, sebelum kamu mendermakan sebagian dari hartamu yang kamu cintai.” (QS. Ali-Imran/3: 9). Ayat ini didukung pula oleh firman Allah yang lain, “Bukanlah

menghadapkan wajah kamu ke arah timur dan barat itu suatu kebajikan, akan tetapi sesungguhnya kebajikan itu adalah beriman kepada Allah, hari kemudian, malaikat-malaikat, kitab-kitab, para Nabi, dan memberikan harta yang dicintainya….” (QS. AlBaqarah/ 2: 177). Dua ayat tersebut menjelaskan substansi kebaikan (birr). Hal itu dapat terwujud dengan memberikan harta yang dicintainya kepada orang lain. Karena kata mabrur seakar dengan kata “birr”, sebagaimana disebutkan pada dua ayat itu, maka haji mabrur adalah haji yang pelaku-nya selalu berbagi kepada orang lain. Dimensi sosial Ada cerita menarik di kalangan para sufi tentang haji mabrur ini. Dikisahkan sepasang suami istri berniat kuat menunaikan ibadah haji. Dengan susah payah pasangan ini mengumpulkan bekal. Karena waktu itu haji melalui jalan darat dan jarak yang harus ditempuh adalah ribuan kilometer, mereka juga harus membawa bekal yang banyak agar tidak kekurangan. Di tengah perjalanan, mereka memasuki kampung yang kehidupan penduduknya sangat miskin dan dilanda kelaparan. Kondisi kampung yang menyedihkan itu menyentuh hati suami istri tersebut. Benak mereka dipenuhi dengan keragu-raguan. Akan tegakah mereka membiarkan orang-orang ini mati kelaparan, sedangkan di tangan mereka berdua ada bekal, meskipun untuk perjalanan haji yang sudah amat lama mereka idamidamkan. Dalam suasana terenyuh ini terpikir oleh mereka untuk memberikan saja bekal haji yang sedang mereka bawa. Lalu mereka pulang. Sampai di rumah ternyata mereka disambut oleh seseorang yang pakaiannya putih bersih. Orang yang belum mereka kenal ini mengucapkan selamat bahwa mereka berdua telah diberkati Allah mendapatkan haji mabrur. Tentu saja pasangan ini menyangkal, karena mereka merasa tidak menunaikan ibadah haji. Namun orang yang tidak dikenal itu tetap mengucapkan kata selamat ke-

pada pasangan suami istri tersebut atas kemabruran haji mereka. Dalam tradisi sufistik, ceritacerita semacam itu bisa didramatisir sehingga tidak perlu diuji kebenarannya. Yang penting bagi kita adalah menangkap filosofi yang terkandung. Jika ditafsirkan secara moderat, cerita itu memberikan kesan bahwa kita dipersilahkan menunaikan ibadah haji sebanyak yang kita mau. Hanya saja, rutinitas itu harus diikuti kepedulian sosial yang kita berikan kepada orang lain. Artinya, ibadah haji harus kita wujudkan ke ruang publik dan kita letakkan dalam konteks sosio kultural yang dinamis. Memang ibadah haji merupakan serentetan ritual yang tata cara pelaksanaannya sudah ditentukan secara baku. Meskipun demikian, jika ditelusuri lebih dalam, ibadah haji memberikan pesan moral yang begitu luas. Pertemuan tahunan haji mengisyaratkan bahwa mereka adalah bersaudara walaupun mereka dipisahkan bahasa, bangsa, dan letak geografis yang berjauhan. Kaum Muslim tidak sendirian, mereka mempunyai saudara yang amat banyak. Mereka ibarat satu tubuh yang menguatkan. Mereka harus saling mempedulikan nasib saudara mereka. Selain itu, jika pelaksana haji melanggar sebuah larangan, maka mereka harus membayar dam (denda). Membayar dam termasuk rangkaian ritual yang berkonsekuensi logis pada tindakan sosial. Sesudah mereka tiba di kampung halaman masing-masing, para hujjaj harus mewujudkan nilai-nilai haji itu di tengah-tengah masyarakat. Jika keadaan ini merupakan concern yang signifikan di dalam mind set (pola pikir), maka predikat haji mabrur secara otomatis sudah disandang. Haji mabrur tidak hanya menjadikan pelakunya sebagai orang yang baik dari waktu ke waktu, tapi juga komitmen yang tak pernah henti untuk memperhatikan nasib saudara-saudaranya. Itulah sesungguhnya dimensi terdalam haji mabrur. Wa Allahu A’lam. ● Penulis adalah: Pendiri Dan Pembina Majelis Dzikir Tazkira Sumatera Utara.

Mimbar Jumat

B10 U

Sekrup Kecil Penggerak Ekonomi Islam

pacara Pengukuhan Guru besar bagi sebuah lembaga pendidikan tinggi merupakan hal biasa. Upacara itu bahkan telah menjadi rutinitas akademiki. Demikian pula halnya dengan IAIN-SU yang pada hari ini tanggal 11 November 2010. IAIN-SU kembali mengukuhkan lima orang guru besarnya, tiga guru besar Fak. Tarbiyah, dan selebihnya adalah guru besar Fak. Syari’ah dan Fak. Ushuluddin. Artikel ini dipersembahkan untuk Prof. Amiur yang bagi saya tidak hanya sebagai seorang guru tetapi juga senior bahkan sebagai orang tua. Banyak temanteman juga merasakan hal yang sama. Namun lebih dari itu alasan yang paling kuat adalah karena perannya dalam pengembangan ekonomi Islam di Sumut - bersama rekannya, Prof. Dr. M. Yasir Nasution – yang tidak dapat dipandang kecil. Andaipun tulisan ini menyebutnya sebagai sekrup kecil namun sesungguhnya perannya sangat besar. Prof. Amiur lahir pada tanggal 11 Agustus 1951 di Bukit Tinggi Sumatera Barat. Masa kecilnya dihabiskannya di Bukit Tinggi di bawah asuhan ayah bundanya. Setelah menyelesaikan sarjana muda di Sekolah Tinggi Agama Islam Syekh Djamil Djambek, Prof. Amiur menyelesaikan pendidikan doktoralnya (Drs) dii IAIN (sekarang UIN)Syarif Hidayatullah Jakarta pada tahun 1979. Selanjutnya Prof. Amiur menyelesaikan S2-nya di IAIN yang sama pada tahun 1987. Ketika studi S2, beliau menulis tesis yang berkaitan dengan Ijtihad Umar Ibn Al-Khattab: Studi Perubahan Hukum dalam Islam. Tesis yang selanjutnya diterbitkan oleh Rajawali Pers menggambarkan pemikirannya tentang hukum Islam. Jelas terlihat dari buku tersebut, Prof. Amiur Nuruddin sangat mengagumi kecerdasan Umar Ibn Al-Kahttab dalam memahami ayat-ayat AlQur’an; berani dan kontekstual. Umar berani melampaui pemaknaan terhadap zahir teks untuk menangkap substansi ayat. Ijtihad Umar sesungguhnya menggambarkan dinamis dan progresipnya hukum Islam. Sampai di sini menurut saya, jika Amiur

Catatan Pengukuhan Prof. Amiur Nuruddin Sebagai Guru Besar Fakultas Syari’ah IAIN-SU

Oleh Azhari Akmal Tarigan

mampu menangkap semangat hukum Islam sebagaimana tampak pada ceramah, tulisan dan kuliah-kuliahnya, itu setidaknya karena pengaruh Ijtihad Umar Ibn Al-Kahttab yang sejarahnya telah dikenalnya sejak masih kecil. Adapun pendidikan S3-nya di selesaikan di IAIN (sekarang UIN) Sunan Kalijaga Yogyakarta pada tahun 1994. Disertasinya berjudul, Konsep Keadilan dalam Al-Qur’an dan implikasinya terhadap tanggungjawab moral. Dari disertasi ini, kendati nuansa hukum Islamnya masih tampak, namun telah terjadi pergeseran perhatian Porf. Amiur dari hukum Islam ke ekonomi Islam khususnya pada aspek moral ekonomi Qur’ani. Bagaikan bola salju, FKEBI sebagai kendaraan yang digunakan IAIN-SU kala itu terus bergerak seolah tak terbendung. Banyak kegiatan yang dilakukan FKEBI terlebih-lebih pada saat Amiur menjadi nakhodanya menggantikan Prof. Yasir Nasution. FKEBI terlibat tidak saja dalam konteks sosialisasi ekonomi dan perbankan syari’ah, tetapi juga berjuang merubah paradigma berpikir dikotomik umat Islam kala itu. Sulit untuk dibantah, ‘Islam ibadah’ yang terlalu mendominasi kesadaran umat, membuat kita terlambat mengenal konsep ekonomi Islam. Padahal konsep ekonomi Islam itu sangat integral dengan ajaran Islam itu sendiri. Bahkan di dalam Al-Qur’an banyak sekali terminologi yang

dipakai menggunakan istilah ekonomi seperti, tijarah (perdagangan), al-ba’ (jual beli), qard (kredit), khusrin (rugi), fadl (keuntungan) dan sebagainya. Sayangnya, konsep-konsep ini terlalu dipahami secara teologis. Akhirnya nuansa ekonominya tidak terangkat. Sampai di sini peran Prof. Amiur menjadi penting. Persentuhan intelektualnya dengan Prof. M. Quraish Shihab pakar tafsir Asia selama menempuh pendidikan di Pasca Sarjana, membuat Amiur memiliki kemampuan untuk mengelaborasi konsep-konsep kunci AlQur’an dan mengkon-tekstualisasikannya dengan persoalan ekonomi. Konsep falah contohnya tidak hanya dipahami dalam konteks akhirat, tetapi bagaimana menjadi visi kehidupan masa depan manusia. Falah merupakan sebuah kondisi yang memungkinkan seseorang mengembangkan potensi dirinya, terbebas dari belenggu kemiskinan dan memperoleh kekayaan emosional dan spiritual. Human Falah sejatinya adalah konsep manusia ekono-mi Islam yang khas. Demikian pula ketika Prof. Amiur menguraikan ayat-ayat Jum’at sebagaimana yang terdapat pada surah Al-Jumu’ah. Jelas di sana terdapat kata-kata al-bai’, tijarah, dan fadl. Perintah tinggalkan jual beli dipahaminya adalah dalam kerangka membangun keseimbangan diri – bukan sekedar haram melakukan jual beli pada saat azan dan hendak shalat Jum’at. Prof. Amiur bukan saja se-orang pemikir tetapi juga aktifis ekonomi Islam. Tidak berlebihan jika ia disebut sebagai mujahid ekonomi syari’ah. Semua potensi dirangkulnya. Berbagai lembaga perbankan syari’ah, asuransi syari’ah, bisnis riil syari’ah, dan ormas-ormas Islam disimpulnya menjadi satu dalam acara pencanangan ekonomi Syari’ah di Sumatera Utara pada tahun 2000-an. Gubernur Sumut Rizal Nurdin

mencanangkan gerakan Ekonomi Syari’ah. Saat itu, Ekonomi Syari’ah yang pada awalnya dipandang asing sekarang telah memasuki ruang-ruang kesadaran pejabat negara. Untuk IAIN-SU, Amiur bersama pimpinan IAIN dan Fakultas Syari’ah membuka program D2 Manajemen Perbankan Islam. Disebabkan lulusan DII (diploma dua) dipandang tidak memadai, dibukalah program DIII MPKS pada tahun 1997-1998. Selanjutnya pada tahun 2002, Fakultas Syari’ah IAIN-SU akhirnya membuka program S1 studi Ekonomi Islam. Selang beberapa tahun berikutnya, PPS IAIN-SU juga membuka S2 untuk Ekonomi Islam. Yang menarik adalah, di Fakultas Syari’ah kala itu yang bertindak sebagai dekannya Prof. Amiur sendiri. Beliau kala itu mengembangkan dua kajian sekaligus di Fak Syari’ah, hukum Islam yang memang menjadi core Fak. Syari’ah dan Ekonomi Islam sebagai keilmuan baru. Sampai sekarang, Prodi Ekonomi Islam menjadi prodi yang sangat diminati. Di atas segala-galanya, Amiur tidak pernah mau dipuja apa lagi dibesar-besarkan. Hidup baginya harus mengalir apa adanya. Tidak perlu pakai topeng. Jika iapun disebut sebagai sekrup kecil, Prof. Amiur tidak pernah tersinggung. Namun saya harus jujur. Sekrup kecil itu ternyata perannya cukup besar. Andai ia longgar, mesin tidak dapat bergerak dan berjalan. Demikianlah, jika ekonomi Syari’ah berkembang di Sumut cukup baik, ternyata di dalamnya ada sekrup kecil yang menentukan pergerakan itu. Dalam acara Ulang Tahun Prodi Ekonomi Islam beberapa waktu yang lalu, saya katakan, spirit ekonomi Islam itu sesungguhnya salah satunya berada pada diri Pak Amiur. Sungguh, mahasiswa Ekonomi Islam ingin merasakan dan mencicipi dan selanjutnya menelan dengan selektif pemikiran-pemikiran dari seoranhg Profesor baru. Semoga. ● Penulis adalah: Ketua Prodi Ekonomi Islam Fakultas Syari’ah IAIN-SU Medan

Antara Alquran Dan Alhadis


asulullah SAW bertanya kepada Mu’adz ketika akan mengutusnya menjadi hakim ke negeri Yaman dengan bersabda: “Dengan apa engkau memutuskan hukuman?” Mu’adz menjawab: “Dengan Kitab Allah”. Maka tanya Nabi lagi : “Jika engkau tidak menemui hukumnya dalam kitab Allah?” Maka Mu’adz menjawab lagi : “Dengan Sunnah Rasulullah SAW”. Kemudian Nabi bertanya lagi, ‘’Bila tidak engkau temui dalam Sunnah Rasulullah”. Maka Muadz menjawab, “Aku akan berijtihad dengan pikiranku.” (H.R At-Turmudzi). Petunjuk Nabi SAW diatas pertanda menyuruh kita, dahulukanlah huku-hukum dari Alquran, baru hukum dari Alhadis (shahih). Bila tidak ditemui hukum pada Alquran dan Alhadis, barulah boleh kita menggunakan hukum/petunjuk/pedoman yang dikemukakan oleh ulama (ijtihad). Adapun pendapat ulama sebagai argumentasi yang digunakan Sdr Lc, MA, pada tulisan di Mimbar Jumat tgl 8-10-2010. 1.Imam Asyafi (bukan imam Syafi’i RA) berkata : “Allah tidak akan menyiksa seorang hamba karena

Oleh dr Arifin S. Siregar

meninggalkan atau mengerjakan sesuatu yang diperselisihkan ulama dan perselisihan (perbedaan pendapat) ulama adalah rahmat bagi umat ini” 2. Ibnu Qudamah Al-Hambali mengatakan: “Perbedaan ulama adalah rahmat dan kesepakatan mereka adalah hujjah”. 3.Kemudian sdr Nasir Lc, MA, berkata, kenyataan, belum ada sejarah yang mencatat bahwa umat Islam berperang karena berselisih pa-

Konsultasi Al-Quran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Al-Quran, yang meliputi: tajwid, fashohah, menghafal Al-Quran, Ghina (lagu) Al-Quran, Hukum dan ulumul Al-Quran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustaz, zakat identik dengan fakir, miskin, amil, muallaf, fisabilillah. Dalam arti kata, mereka-mereka itu yang mendapat bagian dari zakat fitrah .Zakat yang dirubrik konsultasi al-qur’an secara umum. Jadi kalau zakat harta bisakah untuk membantu membangun mesjid. Mohon dijelaskan, terima kasih. Dari jemaaah Tebing Tinggi. Jawab : Terimakasih atas pertanyaanya. Jawaban kami terhadap pertanyaan saudara tentang zakat untuk membangun masjid mendapat komentar membangun dari pembaca yang lain. Kami akui bahwa zakat untuk masjid yang kami setujui itu sesungguhnya dengan syarat yang cukup ketat. Kami tampilkan kembali jawaban kami: “ bahwa bagi komunitas miskin yang belum ada masjid untuk mereka dan tidak punya dana sosial lain untuk membangunnya, maka boleh zakat untuk membangun itu. Jika punya dana cadangan lain dari non zakat, kami kira dana zakat tidak dapat digunakan untuk itu. Adapun komunitas yang dalam perang ideologi, bila memang dalam rangka membentengi aqidah mereka diperlukan masjid, maka dana zakat atas nama fisabillah dapat digunakan untuk itu”. Menurut kami, Masjid untuk daerah kita terutama Medan dan kotakota sekitarnya agaknya tak mencukupi syarat untuk mendapatkannya. Sekali lagi ini adalah pendapat kami saja, jika ada yang berbeda, sungguh, kami tidak akan memaksakan pendapat kami. Kelanjutannya, jika boleh, apakah zakat harta atau zakat fitrah. Kami mengambil pendapat yang mengatakan bahwa pemberian zakat fitrah lebih didahulukan dan diprioritaskan kepada para fakir dan miskin ketimbang asnaf yang lain.(Yusuf Al-Qardhawi. fiqh zakat. hal 965) Jadi peluang diberikan kepada masjid adalah zakat harta bukan zakat fitrah. Wallahu A’lam. Al-Ustadz H. Ismail Hasyim, MA

ham tentang qunut, azan shalat Jumat 2 kali, shalat qabliyah Jumat, tahlilan di kematian, tarawih 11 dan 23 rakaat. Saya kemukakan pernyataan bahwa “Perbedaan (perselisihan) pendapat ini, adalah laknat”: 1.QS Ali Imran 103 dimana Allah SWT berfirman: “Dan berpegang teguhlah kamu semuanya kepada tali (Agama) Allah dan janganlah kamu berpecah belah…… dst”. 2.QS Ali Imran 105 dimana Allah SWT berfirman: “Janganlah seperti orang yang berpecah belah dan berselisih (pendapat), setelah sampai kepada mereka keterangan yang jelas. Bagi mereka (yang masih berselisih pendapt dan berpecah-belah) siksaan yang berat”. 3.QS Hud 118-119 dimana Allah SWT berfirman : “ …. dan mereka senantiasa orang-orang yang berselisih (pendapat). Kecuali orang-orang yang diberi rahmat oleh Tuhan-Mu”. 4.QS An-Nisa’ 59 : “Apabila kamu berbeda pendapat, kembalilah pada Allah (Al-Qur’an) dan Rasul-Nya (Hadis)”. Menurut saya, dari firman Allah di atas, Allah SWT melaknat perbedaan pendapat yang dilestarikan atau yang dipelihara. Maksudnya: munculnya beda pendapat itu alamiah, cuma jangan dipelihara atau dilestarikan, usahakan terus mendiskusikannya, mencari kata sepakat. Dalam ilmu Hadis, shahihnya satu hadis juga ditentukan oleh matan (materi isi) dari Hadis itu. Suatu hadis meski sanad/rawinya shahih, dianggap tidak shahih, bila matan (materi/isi) Hadis itu bertentangan dengan nash-nash yang qathi (Al-Qur’an, Hadis mu-tawatir, ijma’ dan logika yang sehat). Misal: “Anak zina itu, tidak dapat masuk surga sampai tujuh turunan”. Hadis ini adalah palsu karena matannya bertentangan dengan QS An-Najm 38: “Dan seorang itu tidak akan memikul dosa orang lain” (Kitab “Ikhtisar Mushtalahul Hadis” oleh Drs.Fathur Rahman). Mantan Menteri Agama RI KH Dr Mukti Ali pernah mengatakan: “Di kalangan ulama-ulama Indonesia kini, apabila mereka dihadapkan kepada masaalah hukum, maka disatu pihak lebih mendahulukan melihat pendapat ulama, kemudian setelah itu baru mencari dasar-dasarnya dari Alquran dan Alhadis. Dan di lain pihak, lebih mendahulukan mencari dalilnya dari Al-Qur’an dan Hadis, baru melihat pendapat ulama mujta-hid tentang masalah tersebut”. (Kitab: “Peringatan Khaul Bukan Dari Ajaran Islam”) oleh: K.H Drs.Imron A.M).

Memaksakan kehendak Ada beberapa hal yang dikemukakan sdr H.M Nasir Lc, MA : Pertama: Kenapa ada orang memaksakan kehendak supaya orang mengakui shalat qabliyah Jumat itu Bid’ah (tidak Sunnah/ haram/sesat). Saya tidak memaksakan kehendak, hanya sekedar menyampaikan, agar umat tahu. Jangan disembunyikan nash Qur’an dan Hadis shahih. Misalnya : QS Ali Imran 103, 105 dan QS Hud 118, 119 di atas. Kedua: Kenapa merasa benar sendiri ? Saya merasa benar, karena apa yang saya kemukakan merasa didukung oleh nash-nash AlQur’an dan Hadis (sahih). Ketiga : Adanya “perbedaan pendapat” kenyataan belum ada menyebabkan umat Islam berperang. Perbedaan pendapat yang dilestarikan, jelas kenyataan berakibat “perang”. Perang tidak selamanya mesti angkat senjata. Bisa perang urat syaraf. Bisa dalam bentuk saling mengejek, saling tidak teguran, tidak berkunjungan, debat tegang isang, beribadah berkotak-kotak (masjid tertentu), penyelenggaraan jenazah saling merasa caranya yang benar/berhak atau ada tuduhan ungkapan: faham tua/faham muda, dan sebagainya. Saya berikan satu bukti, di mana seharusnya kita meniru Aisyah RA (istri Nabi SAW), dimana lebih mengutamakan Alquran dan Alhadis. Sebagai contoh saya kemukakan dibawah ini sebuah Hadis (H.R Muslim): “Dan tatkala Umar RA dan Ibnu Umar RA menyatakan bahwa mayit dapat ditimpa siksa akibat ratapan keluarganya atasnya”. Qasim bin Muhammad berkata : “Ketika perkataan Umar RA dan Ibnu Umar RA sampai kepada Aisyah RA maka Aisyah RA spontan bereaksi : “Sesungguhnya omongan dua orang yang tidak dusta dan didustakan, tapi pendengaran itu bisa salah”. Kemudian Ibnu Abbas berkata: Telah berkata Aisyah RA: …Cukuplah buat kamu se-mua Alquran (QS An Najm 38) yang menyatakan: “Dan tidaklah seseorang dapat ditimpa dosa akibat dosa orang lain”. (H.R Muslim). Maka saya menyimpulkan bahwa timbulnya perbedaan pendapat adalah wajar, tapi jangan dilestarikan, cari penyelesaiannya dengan diskusi yang mempedomani Alquran dan Alhadis (shahih). Demi ukhuwah Islamiyah, mari kita amalkan Aqidah/Ibadah yang disepakati kebenarannya oleh semua umat/ulama sehingga umat tidak berpecah, berkotak-kotak. ●Penulis adalah dokter Spesialis Kulit dan Kelamin

WASPADA Jumat 12 November 2010

Awas Hadits Dhaif Tentang Haji Setiap muslim pastilah mengetahui bahwa ibadah haji ke Baitullah merupakan salah satu rukun Islam kelima. Dan kini, bulan pelaksanaan haji telah datang, jutaan calon haji dari seluruh dunia menunggu waktu Wukuf di Padang Arafah. Berangkat ke tanah suci, melaksanakan ibadah haji dan umrah ini merupakan impian setiap insan beriman mewujudkan perintah Allah SWT lewat firmannya: “Mengerjakan haji adalah kewajiban manusia terhadap Allah, yaitu bagi orang yang mampu mengadakan perjalanan ke Baitullah. Barangsiapa mengingkari kewajiban haji maka sesungguhnya Allah Maha Kaya (tidak memerlukan sesuatu) dari semesta alam.” (Ali ‘Imran: 97). Namun yang sangat disayangkan, banyak sekali hadits dhaif/lemah yang tersebar seputar ibadah yang agung ini. Terkadang, hadits-hadits itu dijadikan pegangan oleh sebagian kaum muslimin yang awam tentang hadits Rasulullah shallallahu ‘alaihi wa sallam. Padahal dalam syariat yang mulia ini, hadits dhaif tidak boleh dijadikan sandaran dalam suatu amalan, sekalipun dalam fadhailul ‘amal. Sebagai bentuk peringatan bagi kaum muslimin berikut ini kami sebutkan sedikit dari sekian banyak hadits dhaif yang berkaitan dengan ibadah haji dan umrah. Semua kita harus mengawasinya. Seputar Keutamaan berhaji: “Orang yang berhaji akan memberi syafaat kepada 400 orang ahlu bait –atau Nabi mengatakan: 400 orang dari ahlu bait (keluarga)nya.” (Al-Imam Al-Albani rahimahullah menyatakan hadits ini mungkar, diriwayatkan oleh Al-Bazzar dalam Musnad-nya. Lihat Adh-Dha’ifah no. 5091). Berikut ini: “Berhajilah kalian niscaya kalian akan merasa berkecukupan.…” (Al-Imam Al-Albani menyatakan hadits ini dhaif, diriwayatkan oleh Ad-Dailami, 2/83. Lihat Adh-Dha’ifah no. 3480). (Dikutip dari berbagai sumber).

Idhul Adha Antara Teori Mathla’ “Dan janganlah kamu meniru orang-orang yang berpecah belah dan berselisih sesudah datang keterangan yang jelas kepada mereka. Mereka itulah mendapat siksa yang berat.” Qur’an surah Ali Imran ayat 105.

Oleh Fachrurrozy Pulungan


ebagaimana diberitakan, bahwa pemerintah c/q Kemeterian Agama RI telah berketetapan menjatuhkan tanggal 1 Dzulhijjah 1431 H jatuh pada hari Senin 8 Nopember 2010, dan itu artinya 10 Dzulhijjah jatuh pada hari Rabu tanggal 17 November 2010. Hal itu berdasarkan rukyat dan hisab yang dilakukan oleh badan yang berwenang mengkajinya dan melaporkannya kepada Kementerian Agama. Sementara, sebagain umat Islam melalui organisasinya telah melakukan perhitungan (hisab) dan menetapkan tanggal 1 Dzulhijjah 1431 H jatuh pada Minggu 7 November 2010, yang berarti Idhul Adha jatuh pada tanggal 10 Dzulhijjah 1431 H, hari Selasa. Dari kedua ketetapan di atas akan terjadi dua kali shalat Idul Adha, yaitu pertama pada hari Selasa, 16 November, dan kedua, dilakukan pada hari Rabu 17 November. Bagi masyarakat awam, hal ini membingungkan. Persoalan ini memang bukan masalah yang baru, tetapi tetap hangat untuk terus digulirkan dan diperbincangkan. Masalah penetapan awal bulan Qomariah merupakan persoalan klasik yang senantiasa actual. Klasik karena masalah ini sudah menjadi pemikiran para ahliahli fiqih sejak awal-awal Islam. Aktual, karena hampir setiap tahun, terutama menjelang penetapan awal Ramadhan, Idul Fithri, dan penetapan Idhul Adha selalu mengundang polemik dan nyaris mengancam persatuan dan kesatuan umat Islam. Dalam kajian Fiqih, ada hukum yang apabila ada hal yang menyangkut atau bersifat kemasyarakatan, campur tangan Ulil Amri (pemerintah) diperlukan. Karena ada kaedah ushulnya yang populer “hukmul hakim ilzamun wayar fa’ul khilafi” (keputusan hakim/pemerintah itu mengikat dan menyelesaikan perbedaan pendapat). Lebih lanjut dikatakan, demi tercapainya kesepakatan umum keseragaman dan kebersatuan umat, pemerintah perlu campur tangan. Dan ia adalah satusatu nya instansi yang berwenang menetapkan dan mengumumkan awal bulan hijriah kepada masyarakat. Apabila pemerintah (Qadhi/Hakim) telah menetapkan, dan berdasarkan kajian yang matang dari pihak yang dipercaya dan didukung data-data yang otentik, maka ketetapan pemerintah itu berlaku umum dan mengikat.

Menurut kajian Fiqih jumhur fuqoha menyepakati bahwa dalam pelaksanaan Idul Adha hanya dikenal dengan teori “Mathla’” (letak geografis), dimana masing-masing negara Islam memberlakukan mathla’ setempat. Hal ini dikatan juga oleh ahli fiqih Indonesia, Prof. Ibrahim Husein, dan juga Prof Quraisy Syihab, bahwa dalam hal penetapan tanggal 10 Dzulhijjah kita tidak boleh mengikuti Saudi Arabia. Kalau kita mengikuti, kita akan ketinggalan. Karena bulan Qoma-riah dimulai dari barat, ini berarti Saudi Arabia lebih duluan. Sedangkan bulan Syamsiah dimulai dari Timur. Dalam perhitungan hari-hari Syamsiah, negara kita lebih dahulu dari Arab Saudi. Dengan demikian mathla’ kita berlainan dengan mathla’ Arab Saudi. Kajian Fiqih lainnya juga menetapkan bahwa Idhul Adha adalah hari sesudah hari Arafah, dan hari Arafah hanya ada satu, yaitu ketika jamaah haji melakukan wukuf. Dan itu hanya ada di Arab Saudi. Dengan demikian bila telah diketahui hari Arafah nya, maka keesokan harinya adalah hari raya Idhul Adha. Menurut para ahli, hari sesudah hari Arafah itulah yang menjadi ukuran, walau letak geografis satu Negara berbeda dengan Arab Saudi. Artinya, jika hari Arafah jatuh pada hari Senin tanggal 15 November, sebagaimana yang diberitakan media ini (Selasa 9 November) maka Idhul Adha jatuh pada hari Selasa 16 November. Dalam hal penetepan kedua tanggal yang berbeda ini, hendaknya kita semua bisa arif, bijaksana. Memelihara persatuan dan kesatuan itu lebih diutamakan, dari pada mencari-cari kelemahan orang lain kemudian meyalah-nyalahkannya. Jika kemudian pemerintah secara pasti mengeluarkan pengumuman penetapan Idhul Adha 1431 H, dengan surat edarannya itulah yang terbaik, sebagaimana kaedah ushul fiqih di atas, bahwa keputusan pemerintah berlaku untuk umum dan sifatnya mengikat. Janganlah kita suka meminta keputusan pemerintah dalam hal yang tidak kita sukai, tapi kemudian disisi lain apa yang kita maui, kita tidak memerlukan pemerintah. Misalnya, kita meminta pemerintah menjustifikasi Ahmadiah, tapi kita tidak ikut dengan keputusannya tentang Idhul Adha. Wallahu a’lam. ●Penulis adalah: Dai/juru dakwah Islam

Kapankah Kita Berpuasa Arafah? Oleh H. Ismail Hasyim, MA


uasa ‘arafah adalah puasa yang dilakukan pada hari ‘arafah yaitu hari kesembilan dari bulan Zulhijjah. (Qulyubi wa’amirah, juz 2, hal 73). Hadis Rasululah menginformasikan puasa ‘arafah ini di antaranya. Dari Abi Qatadah Rasulullah bersabda: ‘Puasa hari ‘arafah dapat menghapus dosa selama dua tahun, yaitu satu tahun yang lalu dan satu tahun yang akan datang” (HR Jamaah kecuali, Bukhari dan Turmudzi). Dari Hafsah beliau bersabda: “ Ada empat perkara yang tidak pernah ditinggalkan Rasulullah, yaitu Puasa ‘Asyura, Puasa sepertiga bulan yakni bulan Zulhijjah, Puasa tiga hari tiap-tiap bulan dan dua rakaat shalat sebelum subuh” (HR Ahmad dan Nasai). (Sayyid Sabiq, fiqh Sunnah, Jilid I, Dar Al-Fikr, hal 380). Dari hadis di atas dapat difahami bahwa puasa bulan Zulhijjah dimulai tanggal satu sampai sembilan Zulhijjah dan puasa yang sangat dikuatkan (mu’akkadah) adalah puasa pada hari kesembilan yaitu hari ‘arafah (Syekh M.Arsyad Al-Banjari, Sabilul Muhtadin, hal 158). Khusus puasa ‘arafah ini diperuntukkan hanya bagi mereka yang sedang tidak wukuf di’arafah, mengingat ada hadis, “Rasulullah melarang berpuasa pada hari ‘arafah di’arafah” (HR Ahmad, Abu Daud dan Nasai, Ibnu Majah). Dan hadis dari Umul Fadhal ia berkata: “Mereka bimbang mengenai puasa Nabi di ‘arafah, lalu saya kirimi susu, maka beliau meminumnya sedang ketika itu beliau berkhutbah di ‘arafah” (Muttafaq ‘alaih). Berkata Tumudzi: “Para ulama memandang sunnat berpuasa pada hari ‘arafah keculai bila berada di’arafah” (Fiqh Sunnah, hal 380 dan lihat juga Abi Ishaq Asy Syirazi, Muhazzab. Dar Al-Fikr hal 261). Tahun ini berbeda Tahun 2010 ini, tampaknya terjadi perbedaan antara pemerintah dan Pimpinan Pusat Muhamamadiah dalam menetapkan ‘Idul Adha. Pemerintah menetapkan hari Rabu tanggal 17 November 2010, sedang Pimpinan Pusat Muhammadiah menetapkan hari Selasa tanggal 16 November 2010. Sedang pemerintah Arab Saudi menetapkan tanggal 16 November 2010 adalah hari raya “Idul Adha dan telah menginstruksikan kepada jamaah haji untuk bersiap-siap ‘Arafah 15 November 2010. (Harian Republika,

Selasa, 09-11-2010). Kedua pendapat ini dapat dibenarkan secara fiqh, karena didasarkan pada ilmu dan penelaahan yang mendalam. Perbedaan ini menyebabkan terjadinya perbedaan dalam menetapkan puasa ‘Arafah. Bagi pemerintah Indonesia berarti puasa ‘Arafah 16 November 2010, sedang bagi Pimpinan Pusat Muhammadiah puasa ‘Arafah jatuh 15 November 2010. Prinsip Ihtiyath (kehati-hatian) Dengan prinsip kehati-hatian, maka sebaiknya kita memilih puasa ‘Arafah pada hari Senin tanggal 15 November 2010, hal ini disebabkan : 1. Sekiranya kita memilih tanggal 16 November 2010, maka ada keraguan kita tentang status puasa pada hari tersebut, karena ada sebahagian orang yang telah melaksanakan shalat ‘Idul Adha. Puasa pada hari raya ‘Idul Adha jelas keharamannnya. Seandainya memang benar ‘Idul Adha pada tanggal 16 itu, maka bukannya kita mendapat pahala tetapi malah mendapat dosa. 2. Seandainya pula pada tanggal 15 November 2010 bukan hari ‘Arafah, (sesuai dengan pendapat yang berhari raya 17 November 2010), maka tidaklah mengapa berpuasa pada hari itu, karena memang tidak ada larangan puasa pada hari kedelapan, malah ada sunnahnya untuk melaksanakan puasa pada hari pertama sampai kesembilan dan termasuklah hari kedelapan Zulhijjah. Kalau ada yang mempermasalahkan niatnya yang tidak cocok, misalnya dia berniat puasa ‘Arafah padahal sesungguhnya hari itu adalah hari kedelapan Zulhijjah, maka kalaupun sekiranya puasa tidak bermakna, setidaknya puasanya tidak mengahasilkan dosa. 3. Tampaknya ada hubungan antara puasa ‘Arafah dengan dengan hari ‘Arafah. Hal ini dapat kita tangkap dari larangan Rasulullah bagi mereka yang sedang wukuf agar jangan berpuasa, puasa ‘Arafah itu hanyalah bagi mereka yang tidak wukuf. Artinya orang sedang berwukuf di ’Arafah mendekatkan diri kepada Allah dengan berdo’a, sedang kita yang tidak berada di ‘arafah mendekatkan diri kepada Allah dengan berpuasa. Jadi orang berwukuf kita berpuasa. Wallahu A’lam. ● Penulis adalah: Pemerhati Sosial Keagamaan

Mimbar Jumat

WASPADA Jumat 12 November 2010


Pendidikan Islam Dalam Perspektif Alquran Hadits Dhaif: Minta Ampunan Sebelum Jamaah Masuk Rumah Hadits-hadits berikut ini juga tergokong dhaif: “Berhajilah kalian, karena sesungguhnya haji itu mencuci dosa-dosa sebagaimana air mencuci kotoran.” (Al-Imam Al-Albani rahimahullah menyatakan hadits ini maudhu’ (palsu), diriwayatkan oleh Abul Hajjaj Yusuf bin Khalil dalam As-Saba’iyyat, 1/ 18/1. Lihat Ad-Dha’ifah no. 542). Juga hadits ini: “(Menunaikan ibadah) haji bagi orang yang belum berhaji itu lebih baik daripada sepuluh peperangan. Dan (ikut serta dalam) peperangan bagi orang yang telah berhaji itu lebih baik daripada sepuluh haji….” (Al-Imam Al-Albani rahimahullah menyatakan hadits ini dhaif, diriwayatkan oleh Ibnu Bisyran dalam Al-Amali, 27/117/1. Lihat Adh-Dha’ifah no. 1230). “Apabila engkau bertemu dengan seorang haji, ucapkanlah salam padanya dan jabatlah tangannya, serta mohonlah padanya agar memintakan ampun bagimu sebelum ia masuk ke dalam rumahnya, karena orang yang berhaji itu telah diampuni.” (Al-Imam Al-Albani rahimahullah menyatakan hadits ini maudhu’, diriwayatkan oleh Ahmad, 2/69 dan 128, Ibnu Hibban dalam Al-Majruhin, 2/265, Abusy Syaikh dalam At-Tarikh, hal. 177. Lihat Adh-Dha’ifah no. 2411). Sama halnya dengan ini: “Siapa yang meninggal dalam sisi ini, baik ia berhaji atau berumrah, niscaya amalnya tidak dipaparkan kepadanya dan tidak akan dihisab. Dan dikatakan kepadanya: ‘Masuklah engkau ke dalam surga.’” (Al-Imam AlAlbani rahimahullah menyatakan hadits ini mungkar, diriwayatkan oleh Ad-Daraquthni, 288. Lihat AdhDha’ifah no. 2187). Oleh karena itu, jangan mudah termakan hadits dhaif seputar haji. Ikuti hadits yang benar-benar shahih agar ibadah kita diterima Allah SWT. (Dikutip dari berbagai sumber).

Qurban Dan Pengorbanan Oleh H. Syarifuddin Elhayat Allah mengutus Nabi dan RasulNya selain ada yang hidupnya ‘sederhana’ tapi juga tidak sedikit Rasul Allah itu adalah orang yang kaya. Ibrahim salah seorang nabi yang Allah jadikan sebagai seorang kaya. Dalam sebuah kisah disebutkan, Nabi Allah Ibrahim yang pada mulanya lahir dan dibuang oleh tangan orang tuanya ke hutan belantara karena takut dengan rezim kediktatoran Namruj ketika itu,kemudian terlahir menjadi seorang yang mandiri, bahkan menjadi seorang pahlawan kebenaran yang berdebat dengan ayahnya Azar sipembuat patung itu,kemudian hadir berhadapan dengan penguasa diktator Namruj hingga diapun harus dihukum bakar oleh penguasa zalim. Dalam menapak kehidupannya Ibrahimpun menjadi seorang dewasa yang berumah tangga dengan harta yang lebih dari cukup. Dalam melakukan aktifitas kehidupan bermasyarakat,Ibrahim selain seorang Nabi dan rasul Allah yang aktif mendakwahkan agama Allah yang hanif, dia juga seorang dermawan yang sangat-sangat dikenal dimasanya. Pernah satu kali, Ibrahim menyembelih 300 onta dan 1.000 ekor kambing dan seluruh sembelihan itu dibagikan kepada masyarakat sekitar.Tidak tanggungtanggung tuan,—1000 kambing,300 onta. Karena luar biasanya,pengorbanan itu, masyarakat memujinya, “Wahai tuaan, alangkah hebatnya kedermawanan tuan memberikan hewan sembelihan buat kami warga masyarakat sehingga kamipun sangat merasakan kehadiran bantuan tuan dalam kehidupan kami, “begitu kira-kita kata se-orang yang memuji dan memberikan ungkapan-nya pada Ibrahim. Akan halnya Ibrahim spontan saja diapun berkata,”Ini sebetulnya belum seberapa untuk mensyukuri apa yang diberikan Tuhan kepada saya,kalau perlu anakpun akan kukorbankan (kusembelih) sebagai pengabdianku kepada Tuhan. Kalimat ‘akan kusembelihkan kukorbankan’ itu di ijabah oleh Allah sebagai nazarnya Ibrahim. Allahpun memberinya karunia seorang anak yang lahir dari rahim isterinya Siti Hajar,—Ismail namanya. Pintar dan cerdas serta soleh dalam berorang tua. Satu malam, Ibrahim bermimpi,”Ya Ibrahim bayar nazarmu,” dan diapun mendapat perintah agar anaknya satusatunya sibiran tulang itu harus dia sembelih dengan tangannya sendiri.—Pada mulanya Ibrahin merasa itu hanyalah mimpi permainan tidur belaka,—akan tetapi mimpi itu datang selama tiga malam berturut-turut, hingga diapun yakin kalaulah itu wahyu dari Allah. Diapun panggil Ismail kecil yang baru berusia sekira 12an tahun itu,-Ibrahim utarakan mimpi yang dia alami.”Anakku, tadi malam ayah bermimpi, ayah akan menyembelihmu dengan tangan ayah sendiri,”kata Ibrahim.Siti hajar mendengar ucapan itu menyela,” Mungkin mimpi itu hanya permainan tidur belaka, cobalah urungkan niatmu untuk tidak melakukannya wahai suamiku Ibrahim, namun jika benar itu perintah Allah aku sama sekali tak bisa membantah,”kata Hajar.Akan halnya Ibrahim dengan tenang dia berkata,”Ayah… laksanakanlah seperti apa yang diperintahkan kepadamu, dan aku,—Insyaallah akan sabar menerimanya,”.Singkat cerita Ncek, merekapun berangkat suatu tempat di wilayah Mina (daerah Makkah),dia baringkan Ismail,-berulang kali dia lihat anak kesayangan itu bahkan sempat berdialog dengan Setan yang menggodanya mengurungkan niatnya.Ismail berkata,” Ayah baringkan saja aku agar aku tidak merasa sakit,tajamkan pisaunya agar mudah sembelihannya, pejamkan matamu saat akan menyembelihku agar engkau tidak bimbang,dan simpan baju darah sembelihan agar orang tidak tertanya-tanya dan sampaikan salam peluk ciumku buat ibu dan jangan sekali perlihatkan bajuku yang berbercak Ash-Sholihin Jl. Badak Lingk. I Kel. Bandar Utama Al-Amin Jl. Aman Kel. Deblod Sundoro/Bagelen Al-Hidayah Lingk. 03 Kel. Tanjung Marulak Hilir Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Al-Hasanah Jl. Kartini No. 16-A Al-Mukhlis Jl. A. Yani/Sakti Lubis Al-Muthmainnah Lingk. I Kel. D.Sundoro Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung Al-Muttaqin Jl. Sofyan Zakaria Lingk. 2 Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir Darul Jannah Jl. Bhakti LKMD Lingk. I Kel. Lalang Jami’ Jl. Batu Bara Kel. Satria Jamik Kel. Rambung Kec. Tebing Tinggi Kota Lembaga Pemasyarakatan Jl. Pusara Pejuang No. 3 Raya Kota Tebing Tinggi Deli Syuhada Jl. Iskandar Muda No. 70 Taqwa Jl. Bakti Kota Tebing Tinggi INDRAPURA Jami’ Indrapura KISARAN Agung Jl. Imam Bonjol No. 182 Abrarul Haq Haji Kasim Jl. Budi Utomo Kel. S.Baru An-Nur RSU Ibu Kartini PT. BSP Tbk Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Bakar PT. Bakrie Sumatera Plantation Tbk Asment Al-Hidayah Jl. Cokroaminoto Al-Huda Jl. K.H. Ahmad Dahlan No. 1 Al-Husna Jl. Arwana Kel. Sidomukti Al-Husna Simpang 6 Kel. Kisaran Barat Al-Jihad Jl. Dr. Setia Budi No. 54 Kel. Selawan Al-Muttaqin Jl. Ir. H. Juanda Kel. Karang Anyer

darah nanti,” kata Ismail.Ibrahim memulai ‘tugas’ itu, dia arahkan pisau benar-benar ke leher putranya Ismail dan dalam mata terpejam dia rasakan betul bahwa pisausembelihan benar-benar mengenai leher Ismail dan tersembelih. Namun begitu dia buka matanya, alangkah terkejutnya Ibrahim, bahwa Ismail tidak apa-apa sedangkan disampingnya ada seekor kibas (kambing) yang telah tersembelih.Dia rangkul putranya Ismail sambil berucap takbir...Allahu Akbar kabiro, Walhamdulillahi Katsiro, Wa subhanallahi Bukratan wa ashila, shodaqa wa’dah,wa nashoro abdah. Itulah konon, asal muasal ibadah qurban,—Rasu Muhammad saw pernah ditanya,”Ya Rasulullah apakah qurban itu,- Rasul menjawab,” Sunnata Abiikum Ibrohiim,-Sunnah bapak kamu Ibrohim…Kisah yang ana nukilkan di atas merupakan sejarah yang masyhur di kalangan kita. Namun bagi saya, ada pesan yang tersimpan di dalamnya. Pertama semakin kuat kita melaksanakan perintah Allah dan beribadah kepadaNya,maka semakin sibuk pulalah setan untuk mencari jalan menggoda kita. Konon, setan dan iblis tuaan sangat gelisah dan resah ketika ada ummat ini untuk takwa dan ibadah kepada Allah. Itulah yang harus kita waspadai tuaan.Kejadian yang berkelindan dihadapan kita dalam keseharian hari ini tidak lepasi “intervensi” setan agar kitapun larut menjadi kesetanan. Maka terjadilah iri mengiri,dengki hasad dan hasud, hingga kitapun tidak pernah lagi aman dalam kehidupan. Kedua, kekompakan dalam sebuah keluarga sangat dibutuhkan dalam lingkungan keluarga,sehingga dengan itu keda maian, ketenangan dan kebahagiaan akan ditemukan. Ingat Ncek,kebahagiaan dan kedamaitenangan tidaklah selamanya ditemukan pada orang yang hidup berlebih dan materi berlimpah.Bukankah masih ada orang yang merasa sunyi ditengah keramaian,merasa miskin ditengah tumpukan hartanya, merasa terkucil di tengah-tengah rumah gadangnya yang bagaikan istana,kepanasan padahal dia ditengah hembusan AC yang dingin, bahkan dia merasa sakit padahal kata dokter dia sangat sehat. Bukankah hari ini kita temukan,keluarga bagaikan tidak sekeluarga.Artinya sang ayah makan di rumah makan, sang ibupun tak pernah lagi menyentuh dapur, sementara sang anak makan bersama pembantu.Tidak ada lagi jamaah dalam keluarga. Komunikasi,—hanya dilakukan lewat telepon genggam,akibatnya lunturlah kasih saying, pupuslah kerinduan dan canda tawa menjadi barang langka. Allaah,Allaaah,betul tak Ncek.Meskipun sebaliknya masih ditemukan keluarga yang kehidupannya sangat sederhana,rumah beratap seadanya, berlantai semen berlampu teplok tapi dari rumah yang seadanya itu ditemukan kedamaian,ketenangan yang bukan meraka rasakan tapi juga bagi orang lain,karena dari ‘gubuk istana’ itu terdengar ada jamaah, ada lantunan ayat Allah dan ada senyum tawa dengan ukhuwah yang menyatu. Karena itu, menarik mauizdoh kisah Ibrahim, dalam menapak kehidupan ini,butuh qurban dalam arti ketaqorruban kita kepada Allah, butuh pengorbanan dalam memberikan bantuan,meskipun kita tidak harus menjadi korban.Masih sangat banyak ‘korban’ yang membutuhkan qurban dan pengorbanan kita tuan dan itu harus kita lakukan kendati seekor burung dara hatta membuang sebuah duri dari tengah jalan.”Tangan” alam ini terlalu lebar dan luas untuk menunggu uluran kita. “jangan biarkan sebiji debu berkumpul menjadi unggukan bukit yang siap menghentak kita,atau setetes air berhimpun menjadi danau yang menyiram tenggelamkan kita, juga jangan biarkan lembut sepoi hembusan angin menyatu berpirau menerbangkan kita,lantaran kita enggan berkorban. Itulah Qurban dan pengorbanan tuan. Syihabuddin, S.Pd.I Lahmuddin Mahyuddin Ardi, R. Masrisyah, S.Pd.I Aminullah, Lc Nusri Batubara, S.Ag, SH Drs. Ngatiran, MBA Drs. H. Akhyar Nasution Muslim Istiqomah A. Yasin De Frasong Salim W. Wijaya Ansori, S.Ag H. Djufri M. Mangkuto T. Azmi, S.Sos.I Drs. Daulat P. Sibarani M. Ridwan Syam H.M. Amin E.H, Lc Abd. Rahman Rivai, S.Ag Sutrisno, S.Ag Lahmuddin Tanjung Drs. H. Nurul Ihsan Sitorus Drs. H. Sorkam Butar-butar H. Salman Tanjung, MA Masrul, BR Drs. H. Parenta Siregar H. Nummat Adham, MA Drs. Malkan Harahap, SH, M.Hum Drs. Bob Yuswardi, PD

(Makalah Ini Disampaikan Pada Seminar Nasional Di UNIVA Medan)


lquran bukan hanya kitab pedoman bagi manusia (hudan linnas), lebih dari itu, Alquran juga merupakan sumber pendidikan dan ilmu pengetahuan yang mengajarkan manusia dengan ciri khas bahasanya yang tidak ada tandingannya di dunia ini. Dengan gaya bahasanya yang lembut, susunan dan balaghahnya yang indah, sehingga mempunyai nilai tersendiri terhadap pendidikan plus berupaya mengajak para pendidik dan ilmuan untuk meng-gali maksud kandungannya agar manusia lebih mendekatkan diri kepada-Nya. Petunjuk pendidikan di dalam Alquran tidak dijelaskan secara detail, akan tetapi lebih dijelaskan secara garis-garis besar sehingga menuntut para pendidikan untuk mengkaji dan merumuskan agar sentuhan Alquran dengan pendidikan dapat dirasakan. Allah Swt berfirman: Dengan kitab itulah Allah menunjuki orang-orang yang mengikut keridhaan-Nya ke jalan keselamatan dan (dengan kitab itu pula) Allah mengeluarkan orang-orang itu dari gelar gulita kepada cahaya yang terang benderang dengan seizin-Nya dan menunjuki mereka ke jalan yang lurus. (QS. AlMaidah: 16). Aplikasi dari ayat tersebut nampak jelas pada sosok kepribadian Nabi Muhammad Saw seorang Rasul, seorang murabby, seorang muallimin dan muaddib, yang paling berhasil mendidik masyarakat di zamannya, sehingga beliau dijadikan contoh teladan bagi umatnya dan masyarakat (baca : Para Sahabat) nya dapat dijadikan umat percontohan. Allah Swt berfirman : Sesungguhnya pada diri Rasulullah itu terdapat contoh teladan yang baik bagimu yaitu orang-orang yang mengharap (rahmat) Allah dan (kedatangan) hari kiamat dan dia banyak menyebut Allah (QS. Al-Ahzab: 21). Idealnya yang menjadi tujuan utama Pendidikan Islam adalah membangun umat yang Rabbani, umat yang betul-betul sadar akan jati dirinya sebagai

Oleh H.M. Nasir Lc, MA

hamba Allah Swt dan tidak menghambakan dirinya kepada ilmu pengetahuan itu sendiri. Allah Swt berfirman: Dan Aku tidak menciptakan jin dan manusia melainkan supaya mereka menyembah-Ku. (QS. Az-Zariyat: 51). Maksudnya Allah tidak menciptakan jin dan manusia kecuali untuk menjadikan tujuan akhir atau hasil dari segala aktivitas hidup sebagai pengabdian kepada Allah. Hal demikian itulah yang disebut umat Rabbani, yaitu umat yang meyakini eksistensinya dari Allah dan diserahkan kepada Allah dan pada gilirannya akan mendapatkan konvensasi (pahala) dari Allah Swt. Allah Swt berfirman: Hendaklah kamu menjadi umat yang Rabbani (orang yang sempurna ilmunya dan taqwanya kepada Allah) karena kamu selalu mengajarkan kitab dan disebabkan kamu tetap mempelajarinya. (QS. Ali Imran : 79). Konsep pendidikan Islam Dalam Kamus Besar Bahasa Indonesia edisi ketiga tahun 2003, konsep diartikan sebagai 1. rancangan atau buram surat, 2. ide atau pengertian yang diabstrakkan dari peristiwa konkrit, 3. gambaran mental dari objek, proses ataupun yang ada di luar bahasa yang digunakan untuk memahami hal-hal lain. Sedangkan pengertian Pendidikan menurut para pakar di antaranya, Prof Dr Abdullah Nashih Ulwan, menjelaskan “pendidikan manusia seutuhnya, akal dan hati-

nya, rohani dan jasmaninya, keterampilan yang diperlukan dirinya, maslahat, bangsa dan negara” (Tar-biatul Awlad th : 1992). Menurut Undang-Undang Sistem Pendidikan Nasional (Sisdiknas) bab I ayat 1, Pendidikan adalah usaha sadar dan terencana untuk mewujudkan suasana belajar dan proses pembelajaran agar peserta didik secara aktif mengembangkan potensi dirinya untuk memiliki kekuatan spritual keagamaan pengendalian diri, serta keterampilan yang diperlukan dirinya, masyarakat, bangsa dan negara. (UU. Sisdiknas no. 20 th.2003). Sedangkan menurut Muhammad Natsir, Pendidikan diartikan sebagai pimpinan jasmani dan rohani menuju kesempurnaan, kelengkapan arti kemanusiaan dengan arti sesungguhnya. (Mohammad Natsir, 1945 : 87) Endang Saifuddin Ansari secara lebih tehnis mendefenisikan Pendidikan Islam adalah proses bimbingan (pimpinan, tuntutan, dan usulan) oleh subyek didik terhadap perkembangan jiwa (pikiran, perasaan, kemauan, intuisi) dan raga obyek didik dengan bahan-bahan materi tertentu pada jangka waktu tertentu, disertai evaluasi tertentu sesuai ajaran Islam. (Endang Saifuddin, 1976 : 85). Seminar Pendidikan Islam se-Indonesia pada tahun 1960 merumuskan pengertian Pendidikan Islam sebagai : Bimbingan terhadap pertumbuhan rohani dan jasmani menurut ajaran Islam dengan hikmah, mengarahkan, mengajarkan, melatih, mengasuh dan mengawasi berlakunya semua ajaran Islam. (Muzayyin Arifin, 2003: 15) Konsep pendidikan menurut Alquran Konsep pendidikan di dalam Alquran berlaku universal, tidak hanya terbatas pada manusia saja, akan tetapi mencakup segala aspek jagat raya yaitu dengan memposisikan Allah Swt sebagai murabby (pendidikan) yang Maha Agung, karena kata-

kata rabb, di dalam Alquran sering dikaitkan dengan alam semesta, terutama di dalam surat al-Fatihah yang selalu diulang-ulang oleh seorang muslim di dalam shalatnya, Alhamdulillâhi rabbil ‘âlamîn (segala puji bagi Allah murabby sekalian alam). Konsep Pendidikan Islam paling tidak dipresentasikan melalui tiga term, pertama tarbiah, kedua ta’lim, ketiga ta’dib. Kata tarbiah berasal dari akar rabba, yurabbi, tarbiah yang mengandung arti mengasuh, bertanggung jawab, memberi makan, mengembangkan, memelihara, membersihkan, menumbuhkan dan memproduksi mencakup aspek jasmani dan rohani, bahkan menurut Quraisy Syihab termasuk amanah, ancaman bahkan siksaan, yang menarik tiga makna yang terakhir bila dihubungkan dengan pendidikan agak sulit diterima oleh nalar manusia. Sejatinya, amarah, ancaman dan siksaan dipandang negatif bila terlepas dari makna pemeliharaan dan pendidikan. Terkadang orang tua memukul anaknya sang anak merasa diperlakukan dengan tidak wajar, akan tetapi setelah dia dewasa sang anak baru merasakan bahwa pukulan tersebut sangat bermanfaat dan baik bagi memotivasi dirinya dalam upaya proses pendewasaan bagi dirinya. Demikian pula perintah untuk memukul anak yang tidak shalat bila mencapai usia 10 tahun, dipandang bermanfaat untuk pendidikan spritualnya. Sebab sang anak belum mengetahui sama sekali manfaat shalat yang dikerjakannya melainkan apabila dia telah menekuninya dan membiasakannya. Ibaratkan seorang anak yang sakit yang belum mengetahui sama sekali manfaat dari obat yang dikonsumsinya sehingga seorang dokter harus memaksanya untuk memakan obat demi untuk kesembuhan fisiknya, semuanya itu dipahami dalam konteks pemeliharaan dan pendidikan. Wallahua’lam ● Penulis adalah Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Pembantu Rektor IV Universitas Al Washliyah (UNIVA) Medan.

Qurban dan Manifestasi Kesempurnaan Pengabdian


erjuangan tanpa ”pengorbanan” akan sulit jika bukannya ”mustahil” untuk memperoleh kemenangan. Pengabdian tanpa ”qurban” juga tidak sampai, jika bukannya ”musthil” untuk dapat memperoleh ”maqam muqarrobin” yakni orang-orang yang dekat denganNya. Sebagai sebuah ilustrasi misalnya, jika untuk dekat dengan seseorang yang kita cintai saja, kita harus melakukan berbagai hal yang menarik simpatiknya bahkan mengorbankan banyak hal untuk dapat memperoleh kedekatan dan rasa cintanya. Begitulah, peristiwa agung yang perlu kita teladani pada musim haji ini adalah perjuangan Nabi Ibrahim. Pengorbanan Nabi Ibrahim menjadi warisan ibadah yang disyariatkan kepada kaum muslimin. Ibadah yang dimaksud adalah ibadah haji dan penyembelihan hewan kurban bagi orang-orang yang memiliki ekonomi mapan. Tanggal 10 Dzulhijjah mengingatkan kita kepada sejarah yang dilakoni keluarga Nabi Ibrahim as. Dari sejarah itu dapat diambil pelajaran bahwa semakin kuat iman seseorang, semakin berat cobaan dan ujian yang dihadapinya. Ibarat sebuah pohon, semakin tinggi pohon itu semakin keras pula angin yang menerpanya. Nabi Ibrahim kembali di uji oleh Allah. Ia bermimpi, Allah memerintahkannya untuk menyembelih Ismail putra tunggal yang amat di cintainya. Sehari sesudah mimpi itu, nabi Ibrahim merenungkan apakah mimpinya itu benar-benar datang dari Allah atau bukan. Karenanya hari itu disebut ”yaumut tarwiyah” hari perenungan. Pada hari kedua, barulah ia yakin bahwa mimpi itu benar-benar datang dari Allah yang dinamakan ”yaumul arafah” hari men-

(Memetik Hikmah Dan Pesan Keabadian Qurban) Oleh Ahmad Sabban Rajagukguk MA

dapat pengetahuan dengan sadar. Akhirnya pada hari ketiga, Nabi Ibrahim mengambil keputusan dengan keyakinan bulat ”yaumun nahar” yaitu hari melaksanakan penyembelihan. Banyak hikmah yang dapat dipetik dari peristiwa agung yang dilalui Ibrahim dan anaknya. Peristiwa ini sekaligus menjadikan pengorbanan Ibrahim as masuk dalam ranah keabadian dalam ajaran Rasul Saw. Hikmah dan pesan keabadian itu tersimpul di antaranya adalah: Pertama, untuk mendekatkan diri kepada Allah atas segala kenikmatan yang telah dilimpahkan-Nya yang jumlahnya demikian banyak, sehingga tidak seorangpun dapat menghitungnya. Hikmah secara eksplisit dan tegas tentang ibadah qurban ini, telah diungkapkan dalam Alquran: “Dan telah Kami jadikan untuk kamu unta-unta itu sebahagian dari syi’ar Allah, kamu memperoleh kebaikan yang banyak padanya, maka sebutlah olehmu

Ikhwaniyah Kel. Gambir Baru Kel. Kisaran Timur Nuur-Ashshiyam Jl. F.L. Tobing Kel. Lestari Nurul Iman Kel. Lestari Kec. Kota Kisaran Timur Nurul Yaqin Jl. K.H. Agus Salim Pasar Lama Nurul Huda Jl. Malik Ibrahim No. 37 Siti Zubaidah Jl. Budi Utomo No. 285

Drs. H. Zulhaidir Abu Jibran, S.Ag Drs. H.M. Khosim Parpaung Drs. H. Abdul Rasyid Sutrisno, S.Sos H.M. Kosim Marpaung, S.Ag

LABUHAN BATU An-Nur Desa Kuala Bangka Baiturrahman Kec. Kualuh Hilir

A. Kadir Domo Ahmad Syarifin, S.Pd.I

BATU BARA Al-Munawwarah Desa Dipare-pare Kec. Air Putih Al-Musyawarah Dsn V Desa Sipare-pare Kec. Air Putih Jami’ Al Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Huda Desa Tanah Tinggi Kec. Air Putih Nurul Iman Dusun V Pasar Lapar Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih Quba Tanjung Kubah Kec. Air Putih

Masren Banurea, S.Pd.I Azhari Yasir Siregar H. Mawarmin Lubis Burhanuddin Lubis Azwan Lubis Muslim AR H. Zulkarnain Ismail

PEMATANGSIANTAR Al-Ikhlas Jl. Nagur Kel. Martoba

Drs. H. Rasyid Nasution

RANTAU PRAPAT Al-Qodar Jl. Terpisang Mata Atas

Drs. Abdul Jawad Batubara

S I B O L GA Al-Munawar Sibolga Jl. Tapian No. 10-A

Izuddin Lubis

LHOKSEUMAWE Islamic Centre Lhokseumawe Baiturrahman Lhokseumawe

Drs.Tgk.H. Mursyid Yahya, M.Pd Tgk.H. Syamaun Risyad, Lc

nama Allah ketika kamu menyembelihnya dalam keadaan berdiri (dan telah terikat). Kemudian apabila telah roboh (mati), maka makanlah sebahagiannya dan beri makanlah orang yang rela dengan apa yang ada padanya (yang tidak meminta-minta) dan orang yang meminta. Demikianlah Kami telah menundukkan untua-unta itu kepada kamu, mudah-mudahan kamu bersyukur.” (QS Al-Haj/ 22:36) Kedua, hikmah menyembelih hewan kurban pada hari raya haji juga adalah untuk mengabadikan salah satu sunnah yang dicontohkan oleh Nabiyullah Ibrahim AS yang mendapatkan perintah melalui mimpi untuk menyembelih anaknya yang sangat disayangi dan dicintainya, yaitu Nabiyullah Ismail AS. Karena ketundukkannya kemudian Allah menggantikan Ismail dengan seekor kibas yang terus berlanjut sampai akhir zaman. sebagaimana diungkapkan kisahnya dalam Alquran surat Ash Shaffat ayat 102-111. Ketiga, mengabadikan dan menghidupkan makna takbir, karena pada hari raya Idul Adha, dari tgl 10 hingga 13 Dzul Hijjah, yakni hari nahar (penyembelihan) dan hari-hari tasyriq. Syariat agama kita menggariskan, bahwa pada setiap hari raya, baik Idul Fitri maupun Idul Adha, setiap Muslim diperintahkan untuk mengumandangkan takbir. Hal ini memberikan isyarat kepada kita, bahwa kebahagiaan yang hakiki hanya akan terwujud, jika manusia dengan setulusnya bersedia

Istiqamah PT. Arun R. Jannah Lhok Mon Puteh Al Falah Keude Aceh Al Fitrah Korem 001/Lilawangsa Syuhada Mon Geudong Al Muttaqin Hagu Teungoh Darussalam Hagu Selatan Taqwa Kp. Jawa Baru Syuhada Kp. Jawa Lama Al Hikmah Cunda Babut Taqwa Polres Lhokseumawe Al Mabrur Mns. Mesjid Babul Huda Panggoi At Taqwa Paloh Al Bayan Politeknik Ubudiyah Punteut At Taqwa Muraksa R. Jannah Alue Awe BIREUEN Masjid Agung Bireuen Masjid Besar Kutablang Masjid Besar Peusangan Masjid Besar Peusangan Selatan Masjid Ridha Kec. Jeumpa Masjid Besar Ke. Kuala Masjid Besar Juli Masjid Baitunnur Peudada Masjid Besar Peulimbang Masjid Baiturrahim Jeunieb Masjid Besar Kec Simpang Mamplam Masjid Besar Samalanga

memberikan pengakuan dan fungsi kehambaannya di hadapan Allah Swt. Di samping itu semua, Hari Raya Qurban pun merupakan Hari Raya yang berdimensi sosial kemasyarakatan yang sangat dalam. Hal itu terlihat ketika pelaksanaan pemotongan hewan yang akan dikorbankan, para mustahik yang akan menerima daging-daging kurban itu berkumpul. Mereka satu sama lainya meluapkan rasa gembira dan sukacita yang dalam. Yang kaya dan yang miskin saling berpadu, berinteraksi sesamanya. Luapan kegembiraan di hari itu, terutama bagi orang miskin dan fakir, lebih-lebih dalam situasi krisi ekonomi dan moneter yang dialami sekarang ini, sangat tinggi nilainya, ketika mereka menerima daging hewan kurban tersebut. Syariat qurban ini, kaum muslimin dilatih untuk mempertebal rasa kemanusiaannya, mengasah kepekaannya dan menghidupkan hati nuraninya. Ibadah qurban sarat dengan nilai kemanusiaan dan mengandung nilai-nilai sosial yang tinggi. Oleh karenanya kaum Muslim yang tidak mampu mewujudkan nilainilai kemasyarakatan, dianggap sebagai pendusta agama. (QS. AlMâun/107:1-3). Pengorbanan apakah yang telah kita berikan demi terwujudnya cita-cita hidup sebagai hamba Allah yang Muslim dan Mukmin. Untuk itu, hikmah dari peristiwa qurban yang dialami Nabi Ibrahim merupakan suatu pelajaran yang perlu diteladani. ● Penulis adalah Pimpinan PT Bank Syariah Mandiri Petisah Medan, Penggiat Spiritualitas dan Sufistik Keagamaan, Dosen IAINSU dan Mahasiswa S3 IAIN-SU. Tgk.H. Syahrial Ghazali, Lc, MA Drs.Tgk.H. Asnawi Abdullah, MA Tgk.H. Azhari Abdullah Tgk.H.M. Ali Amin, BA Drs.Tgk.H. M.Daud Hasbi, M.Ag Tgk.H. Muhammad Jamal Tgk. Mahyiddin Tgk. Saifuddin, Lc Tgk. Nazaruddin, MA Tgk. Zainuddin Tgk. Abdullah Nafi Tgk. Syamsul Bakhtiar Tgk. Saiful Anwar Tgk. H. Kamaruddin Tgk. H.M. Daud Syafi’i Tgk. Amirullah, Lc Tgk. Nazir Bayu Tgk. H. Munawar Khalil, MA Tgk Drs H Jamaluddin Abdulllah Tgk Yusuf Hasan Tgk M Ali Husen Tgk Subki Tgk Mahdi Tgk Abdul Majid Drs Tgk Hasan Basri Abu H Saifuddin Ilyas Tgk Khalili Tgk Sulaiman Tgk Helmi Abbas Tgk Abu bakar

B12 MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Al-Ikhwanul Wathan Jl. A.R. Hakim Gg. Langgar Al-Ikhwaniah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Makmur Jl. A.R. Hakim Gg. Langgar No. 25 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Dame No. 27 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Istiqlal Jl. Halat No. 53 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Darul Ikhlas Jl. Batu No. 13 Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. 8A Khairiyah Jl. Rahmadsyah Gg. Subur 192 Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Muslimin Jl. Dr. Sun Yat Sen No. 71 Kota Matsum I Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Silaturrahim Jl. Bromo Gg. Silaturrahim No. 11 Silaturrahim Jl. Emas No. 10 Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Megawati Taqwa Puri Jl. Puri No. 183 Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No. 240-AR Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8 MEDAN AMPLAS Ar-Rahman Jl. Dame Kel. Timbang Deli Al-Hidayah Mapolda SU Jl. S.M.Raja Km.10,5 No. 60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Huda Jl. Bajak I No. 2-A Kel. Harjosari II Al-Hilal Asrama Widuri Eks Brigif 7 Jl. S.M. Raja Al-Muhajirin Jl. Bajak II H Gg. Nasional No. 100-D Al-Waqif Jl. Sempurna Kel. Sudirejo I Baiturrahman Jl. Bajak III Kel. Harjosari II Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Nurul Barkah Jl. Selambo IV No. 29 Nurul Iman Jl. S.M. Raja Km. 09 Timbang Deli Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Ramadhan Jl. Garu VI Kel. Harjosari I Raya Taqwa Jl. S.M. Raja Km.5,5 No.1 Kel. Harjo Sari Salman Jl. STM Kel. Sitirejo II Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1 B MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Al-Amanah Jl. Diponegoro No. 30-A Kp. Gd. Keuangan Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Dakwah Jl. Dr. Hamzah No. 2 Kampus USU Istiqna Kel. Titi Rante Muslimin Jl. Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede No. 42 Nurul Huda Jl. K.H. Wahid Hasyim Asrama Brimob Nurul Huda Jl. Letjen Djamin Ginting Km. 8 K. Bekala Taqwa Kampus II Jl. Setia Budi No.79-B/Jl.Sei Serayu Taqwa Padang Bulan MEDAN BARAT At-Taqwa Jl. Puteri Hijau No. 14 Al-Furqan Jl. Karya II Kompl. Ex Kowilhan Kel. KB Al-Istiqomah Jl. Putri Hijau No. 01 Komp. Deli Plaza Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Massawa (Arab) Jl. Temenggung (Arab) No. 2,4,6 Baitus Syifa RS. Tembakau Deli PTP Nusantara-II Haji Maraset Jl. Sei Deli No. 139 Jami’ Jl. Merdeka No. 3 Pulo Brayan Kota Nurul Islam Jl. Karya No. 203. Kel. Karang Berombak Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6 Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Rabithatul Muslimin Lingk. 14 Gelugur Kota Syuhada Jl. Danau Toba No. 2 Kel. Seil Agul Taqwa Jl. Karya Gg. Madrasah No. 24 Taqwa Jl. Karya Gg. Purwosari No. 34-A

Daftar Khatib Shalat Jumat Drs.Jamaluddin Pohan, MA Drs. H. Naziruddin Idris, Lc Drs. Supardi Lubis Drs. DarwisHarahap H. Burhanuddin Parinduri, MA Ahmad Khawari Drs. H. Legimin Syukri Asri Koto Drs. Asroruddin Saidi Drs. H. Muslim M. Putra Komaruddin Dalimunthe Drs. H. Harmyn Tanjung Drs. H. Zainal Arifin Drs. Mas’ud Panjaitan Drs. Syaefuddin Daulai Irwan Syahputra, S.Ag, MA Drs. H. Sanadi Sitorus H. Ismail Malik Drs. M. Yunus Daulay Drs. Syahman, H.S. Mahmuddin, BA Drs. Usman Hasibuan, SH Mex Zainis Chaniago Mex Zainis Tjaniago Drs. Mario Kasduri, MA Drs. Khudri Lubis Husni Mubarok,S.Pd.I Drs. Tanwir Siagian Harisman Arifin Mashur Utama, S.Ag Drs. Rozali Umar Batubara Muchlis Saragih, S.Ag Drs. Ramli AT H. Salman Alfarisi, MA H. Jalaluddin AM, MA Drs. Mhd. Arsyad Drs. H. Burhanuddin, P. Agusman Damanik, MA Drs. M. Nurdin Hasbi Al Mawardi Lubis, S.Pd.I Drs. Hayat Harahap Asrizal Tanjung, S.HI Drs. Bahran Tanjung Drs. Mustamam Batubara, MA Drs. H.M. Nurdin Amin, Lc, MA Junaidi, S.Pd.I, M.SI Drs. H. Sangkot Saragih Drs. H. Suparmin Sareh H. Murthado Sulaiman, S.Ag Umul Aiman Lubis, S.Hai H. Taufiq Haris, Lc M. Amin, S.Ag H. Zulfikar Hajar Drs. M. Sholihul Amri Drs. Ali Asri Junaidi Arshad, S.HI Dr. H. Zulhadi, MA Drs. Kayat Drs. H. Mustamir H.M. Nasir Drs. H. Mahmuddin Sirait Drs. Sarwo Edy, M.:Ag Drs. H. Muchlis Nasution Drs. Mulkan Daulay Jumanah Nasution, S.Ag Drs. Hakimuddin Saragih Drs. H. Ahmad Taufiq, SH Drs. H. Nasrun Jami, MA Drs. Ponidi Sabari Drs. H. Ramlan Y. Rangkuti, MA Drs. Maragading Drs. Mukhsin Yahya Gunawan, S.Pd.I Irwan Nasution, S.Pd.I

MEDAN BELAWAN As-Sa’adah Belawan Jami’ Belawan Jl. Selebes Belawan Muslimin Ujung Baru Pelabuhan Belawan Taqwa Jl. Medan-Belawan Km. 22 Taqwa Jl. Veteran Belawan

Ismail Harun, S.HI H. Zulkarnain Drs. H. Burhanuddin, MA Drs. Masyaluddin Berutu Irwan Nasution, S.Pd.I

MEDAN DELI Ar-Rahim PT. Jasa Marga Jl. Simpang Tanjung No. 1-A Ar-Ridha Komplek TNI AL Barakuda Tg. Mulia Hilir Ar-Rakid Jl. Kol Laut Yos Sudarso As-Sa’adah Jl. Aluminium IV Gg.Tawon Tg. Mulia Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg. Mulia Al-Ikhlas Jl. Aluminium III Kel. Tg. Mulia Al-Ikhlas Complek Jl. Bank Kompl. Deli Raya Titi Papan Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun Ling. 18 Tg. Mulia Darussalam Pasar III Jl. Suasa Selatan Mabar Hilir Jamik Jl. K.L. Yos Sudarso Km. 6,2 Jami’iyyatush Shoolihiin Jl. Almunium I Lk. XIII Nurul Iman Jl. Sidomulyo Ujung Lingk. XXVII

Drs. Waizul Qani, M.Ag Nurtuah Tanjung Ibnu Saud Mahyudi, S.Ag Maimun Elba Drs. H. As’ad Marlan, M.Ag H.M. Ali Nasution, Lc, M.Ag Drs. H. Musa Yahya Parentah Lubis, S.Ag Amal Pasaribu Drs. Zulfarman Lubis Fachri Isnomo, M.Ag Helmi Fahmi Dalimunthe, M.Ag

MEDAN DENAI Ar-Ridha Jl. Camar 18 Perumnas Mandala Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Al-Ansor Jl. Raya Tenggara Gg. Ansor Al-Fajar Jl. Harapan Pasti No. 50 Kel. Binjai Al-Hidayah Jl. Menteng Indah VI H Kel. M.Tenggara Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Al-Hasanah Jl. Merpati I No. 1 Kel. Kenangan Baru Al-Muslimin Jl. Menteng II Gg. Pembangunan Lingk. XI Al-Mukhlishin Jl. Bromo Ujung/Jl. Selamat Kel. Binjai Al-Mukhlishin Jl. Enggang I Perumnas Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Quba Jl. Denai/Rawa No. 233B Kel. Tegalsari I Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahmin Jl. Pelajar Timur Gg. Darmo No. 5 Hijratur-Ridho Jl. Selamat Ujung Gg. Subrah Jannatul’alim Jl. Pancasila/Rawa Cangkuk IV No. 1 Mislimin Jl. Selam II No. 47 Kel. Tegal Sari Mandala I Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Nurul Islam Jl. M. Nawi Harahap Kel. Binjai Nurul Iman Jl. Rawa Lr. Sedar Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Taqwa Jl. Jermal III No. 10 Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Pancasila Gg.Masjid No.1 Kel.T.S.Mandala III

Syahrul Anwar, S.Pd.I Sudirman Drs. H. Anwar Noor Siregar Syaiful Amri, S.Ag Drs. H. Abdurrahman H. Hasan Basri Lubis, Lc Drs. Syawaluddin Harahap Jamaluddin, S.Pd.I Drs. Darwin Nasution H. Matardi E., SH Drs. Kemal Fauzi Drs. Irfan Irawan Drs. M. Syarawi Muhanjis Darwin Pasaribu, S.Ag H.M. Silahuddin, S.Pd.I Drs. Ahmad Azizi, AM Khairul Sholeh, S.Ag H. Bahauddin Nasution, Lc Drs. Suramin Hadi Drs. H. Syamsul Rizal, P. Abdul Aziz, S.Pd.I Drs. MuslimWahid Siregar Drs. Satiman Drs. Zulkarnaen Lubis, MA

MEDAN HELVETIA An-Nur Jl. Budi Luhur No. 75-A Ar-Raudhah Jl. Persatuan No. 22-AR As-Syarifah Jl. Pembangunan Kompl. Pondok Surya At-Taubah Jl. Prona No. 12 Lingk. VII Cinta Damai Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Furqan Jl. Kamboja Raya No. 02 Perumnas Helvetia Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Al-Hasanah Jl. Setia No. 41 Tg. Gusta Al-Ikhlas Jl. Bakti Luhur No. 113 Kel. Dwikora Al-Ikhlas Jl. Jongkong Komplek Dolok Sumut Al-Ikhlas Jl. Teratai II Blok 18 Perumnas Helvetia Al-Ishlah Jl. Kapten Muslim No. 54-A Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Al-Mustaqim Jl. Kapten Muslim No. 226 Al-Masturah Jl. Binjai Km. 7,8/Jl. Sekolah No. 29 Darussalam Jl. Asrama No. 11 Istiqomah Jl. Amal Luhur No. 86 Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Shilaturrahmi Jl. Gaperta Gg. Sekolah, 120 Taqwa Sukadono Jl. Pemasyarakatan Gg. Mesjid No.7 Taqwa Jl. Setia No. 30 Tg. Gusta Taqwa Jl. Kapten Sumarsono Gg. Safar Taqwa Jl. Kapten Muslim Gg. Jawa Taqwa Jl. Kamboja Raya No. 319 Blok IV

Usman Matondang H. Fahmi Mahyar Drs. H. Lukman Hakim Drs. Budiman DamriTambunan, S.HI, S.Pd.I Drs. Abdul Majid Drs. H. Khairuddoroin Drs. M. Labib Maulana Drs. H. Suhaimi Hasby, Lc Drs. Idrus Uteh Amirwan, S.Ag Drs. Idris Ginting Drs. A. Wahab Kalimantan Drs. Khairul Anwar, MA Drs. H. Burhanuddin Damanik Drs. H.K. Akmal Rangkuty Edi Syahputra Siregar, S.Ag Drs. H. Abdul Hadi Drs. Najamuddin Lubis Drs. H. Samiun Mas Drs. Syamsuddin Amin Nuzli Rahmendra Drs. H. Suprapto Drs. Syahrul, MA Abu Hadid

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Gudung Johor Amaliyah Perumahan Citra Wisata Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning

Ishak Ahmad, BA Drs. Nazaruddin H.P. Siregar, BA

Ar-Raudhah Komplek Risva I Blok V Assyafi’iyah Jl. Suka Tari No. 9 Ainul Iman Jl. Eka Warni I Kel. Gedung Johor Annazhirin Jl. Karyawisata Kel. Gedung Johor Al-Amin Jl. Eka Surya Gg. Eka Kencana Al-Badar Jl. Karya Dharma No. 19 Kel. Pkl. Masyhur Al-Firdaus Lingk. II Kel. Gedung Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Huda Jl. Eka Surya Pasar V Gg. Sidodadi Al-Ikhlas Jl. Karya Tani Lingk. VIII Pkl. Masyhur Al-Muslimin Jl. Suka Luhur Kel. Suka Maju Al-Muharram Jl. Eka Budi Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mustafa Jl. Karya XII-XIV/Mustafa Raya Al-Qisth Kejaksaan Tinggi Jl. Abd. Haris Nst. P.Mashur Baiturrahman Perumahan Johor Indah Permai 1 Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Baitussalam Jl. Brigjen Katamso Gg. Rapi Titi Kuning Baitussholihin Jl. Karya Bakti No. 71 Kel. P. Masyhur Baitul Iman Jl. Karya Jaya Asrama Arhanud P. Masyhur Fajar Ramadhan Komplek Perum.Johor Indah Permai II Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Nurul Ikhwan Jl. Karya Kasih Lingk.VII Pangk. Masyhur Nurul Aldys Jl. Karya Bakti No. 34 Pkl. Masyhur Nurul Falah Jl. Eka Rasmi 42 Kel. Gedung Johor Sunnah Rabithah Jl. Karya Darma-Pangk. Masyhur

Sofwan Harahap, S.Ag H. Sarto Syarif, Lc M. Mauddin Nasution, S.Ag Drs. H. Syahlan Harun H. Agus Rizal K., S.HI Azman, S.HI Drs. Amrin Yunus Drs. H.M. Yahya Tambunan Drs. Ali Imron R. Drs. Zarlan Lubis Drs. H. Indra Harahap, MA Prof. Usman Nasution Drs. H.A. Taufik Lubis Hendra Siregar, S.HI Drs. H. Nazaruddin Hasibuan Hayat Harahap, S.Pd.I Drs. H. Syamsuddin Hasan Drs. H. Sueb Saragih Drs. Ahmad Syarbaini Muhrodli Drs. H. Zul Akmal Nasution, MA H. Sugeng Wanto, MA Ferry Syahbuddin, S.HI H.M. Irfan Said Batubara Musthofa Kamal R. S.Ag, M.Hum Mukhlis Mua’z, S.HI Drs. H. Rusli, MR. Mawardi

MEDAN KOTA Al-Hidayah Jl. Saudara Kel. Sudirejo-II Al-Hasanah Jl. Tg. Bunga II No. 60 Kel.Sudirejo II Al-Ikhlas Jl. Salak No. 09 Al-Ikhlas Thamrin Plaza Al-Ikhas Jl.Jati-III/Jl.Pelajar Timur Gg.Perbatasan No.13 Al-Mashun Jl. Sisingamangaraja Da’wah Jl. Sakti Lubis Gg. Amal No. 5 Kel. Sitirejo-I Islamiyah Jl. Jati III No. 85 Teladan Timur Jamik Jl. Air Bersih Gg. Satu/Rela Kel. Sudirejo-I Jami’ Teladan Jl. Teladan/Gembira No. 2 Muslimin Jl. Air Bersih Lingk. III Kel. Suderejo I Mua’llimin Jl. S.M. Raja Kp. Keluarga No. 33 Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Pahlawan Muslimin Jl. Pencak Kel. Pasar Merah Barat Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Raya Pusat Pasar Setia Amal Jl. Sakti Lubis Gg. Pegawai Kel. Sitirejo Taqwa Jl. Demak No. 3 Taqwa Jl. Jati III Cabang Pasar Merah Taqwa Jl. Mahkamah K-36 Thawalib Jl. S.M. Raja Gg. Isa No. 7

Drs. Ahmad Wazir Drs. Son Haji Harahap Drs. Zulkifli Defrizal Lubis, S.Pd.I Drs. H. Yusdarli Amar H. Mohd. Nasir, Lc, MA H.M. Syukur Abrazain, BA Drs. Muhyiddin Maskur Drs. Jamaluddin Juliadi, S.Pd.l Drs. Usman Batubara Drs. H. Usman Ismail Prof. DR. H. HasballahThaib, MA Drs. H. Hafidz Ismail Drs. Rizaluddin Drs. H. Askolan Lubis, MA Drs. Sariman Al-Faruq Maulana Siregar, S.Ag, MA H. Ruskan Nawawi Mustafa Lubis STIQ Drs. Ade Mustahdy Ali

MEDAN LABUHAN Al-Husein Jl. Raya Griya Martubung Kel. Besar Drs. M. Syafii Nasution Al-Muhajirin Jl. Pancing I Gg.Rambai Lingk.IV Kel.Besar Drs. Abd. Majid Syam Al-Mukarramah Jl. Cingguan Kel. Martubung Drs. Adlansyah Baitul Ikhwan Jl. T. Lestari 12/198 Griya Martubung Drs. M. Nizar Rangkuti Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Drs. H. Azhari Tanjung Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Muhammad Syahri Nurul Ikhwan Jl. Helvetia By Pass Gg. Masjid No. 234 Drs. M. Mukhtar Hasyim, S.Pd. MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 No. 420 Kel. Kp. Baru Al-Husna Jl. Teratai Al-Muhajirin Jl. Letjend. Suprapto No. 2 Al-Mujtahidin Jl. B.Zein Hamid Gg. Lori Kp. Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ ‘Aur Jl. Kampung Aur Kel. Aur Jami’ Kamp. Baru Medan Jl.Brigjen Katamso No. 53 Muslimin Jl. Bridjend. Katamso Lingk. II Pantai Burung Nurul Iman Kampung Baru Pasar Senen Lembah PT. Bank Negara Indonesia (Persero) Jl. Pemuda No.12 MEDAN MARELAN

H. Ruslan Efendi, Lc M. Nasir, S.Ag H. Azhari AkmalTarigan, M.Ag Ahmad Zaini H. Mudawali, S.Pd.I A. Muaz Tanjung, S.Pd. Drs. Anshari Drs. M. Dian Harahap Drs. Su’it Bukhori Muslim Lubis, S.Ag Prof.DR. HasballahThaib, MA

Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Ar-Ridha Jl. Jala IX Lingk. 4 Kel. Paya Pasir Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Taqwa Jl. Marelan Raya Pasar 3 Timur

A. Fachruni Drs. Abdul Jalil Zulkarnain Drs. Tenerman

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Auditorium 001 Indosat Medan Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Al-Amin Jl. Prof. H.M. Yamin SH, 482 Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Al-Falaah Jl. Ibrahim Umar No. 3 Al-Hidayah Jl. Pahlawan Gg. Anom No.12 Lingk. III Al-Huda Jl. Malaka No. 117 Al-Hurriyah Jl. M. Yakub No. 17 Al-Ikhlas Jl. Setia Jadi Gg. Masjid Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Al-Muslimin Jl. Gerilya No. 1 Al-Majidiyah Jl. Prof. H.M. Yamin SH Gg. Belimbing Hidayatul Ihsaniyah Jl. Sentosa lama Gg. Aman No. 5 Istiqomah Jl. Bambu Runcing/Pahlawan Ikhwaniyah Jl. M. Yacub No. 3 Ikhsaniah Jl. Gurilla No. 31-A. Kel. Sei Kera Hilir I Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Perjuangan 45 Jl. Prof. H.M. Yamin SH No. 51 Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Taqwa Jl. Pelita II No. 10 Kel. Sidorame Barat Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Taufiq Jl. Mesjid No. 120 Kel. Tegal Rejo

Drs. Adi Sucipto, M.Ag M. Rais, M.Pd. M.SI Drs. Abdullah Djamil, M.SI Musa Abdul Ghoni, S.Ag Akmal Al-Kautsar, S.HI H. Ali Amran Zakaria, Lc Drs. H. Muhidin Gurning Drs. H. Musa Yahya Drs. Musonnib Siregar Drs. H. Abu Bakar Adnan Drs. Hasrat Effendid, S. Drs. Tarmizi, AR Muhammad Zainul, S.Ag Drs. Marwanuddin, S. Drs. Pantis Simamora Drs. H. Tarmizi Lubis, S.Pd.I Adenan Ritonga, MA Drs. H. Romsil Harahap Drs. Samin Pane, M.Ag H. Muhammad Nud Abubakar Azhari Akmal Tarigan, M.Ag Drs. Efi Brata, MA Prof. DR. H. NawirYuzlem, MA M. Suud Tambunan, S.Ag Drs. H. Imran Siregar

MEDAN PETISAH Amaliyah Jl. M.Idris No. 22 Kel. Sei Putih Timur II Annas Komplek Diskes Jl. Ibus Raya/Jl. Rotan Ar-Ridhwan Jl. Abd. Hamid No.28 Kel.Sei P. Tengah As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Al-Hidayah Jl. Periuk Gg. Masjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Istiqamah Pasar Petisah Istiqomah Jl. Abdul Hamid No. 70 Nurul Hidayah Jl. Tinta No. 69 Kel. Sei Putih Barat Nurul Haq Jl. Listrik No. 12 Raya Aceh Sepakat Jl. Mengkara No. 2 Setia Al-Mukarram Jl. Sikambing Gg.Patimura No. 9 Ubudiyah Jl. Kebun Bunga/Jl. Jend. S. Parman Taqarrub Jl. Darussalam No. 24 MEDAN POLONIA

H. Rakib Maas, BA Drs. Syahrinal A. Lubis Drs. M. Bakri Pasaribu Drs. Efendy Arief Usmar Chan H.A. Daud Lubis H.M. Azhari Lubis H. Abdur Rahman S., Lc, MA Andi Sumitra, M.Ag Suwarto Drs. H. Bahrum Saleh Hsb., MA Drs. Muhammad Rafiq, MA Drs. Abdur Rahman Drs. H. Ali Amran Skd. DR. H.M. Muzakir, MA

Amaliyah Jl. Balai Desa Gg. Amal No. 43 Kel. Polonia Al-Hidayah Jl. Starban Kel. Sari Rejo Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Baitussalam Kosek Hanudnas III Baitut Tahmid KPPBC Tipe A2 Bakti Jl. Mongonsidi Baru I No. 11 Dirgantara Lanud Jl. Imam Bonjol No. 52 Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

H. Imam Muhdi Hasballah, M.Ag Drs. Yusuf As’adi Abdul Latif, S.Ag Drs. M. Ilyas Mustawa H. Darwin Zainuddin, Lc, MA Drs. H. Ulumuddin Hamsyi Sarman, S.Ag Drs. Indra Budiman Drs. M. Kasim Yusuf

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Al-Ghufron Jl. Suka Baru No. 21 Kel. P. Bulan Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Al-Ikhlas Pasar VII, Padang Bulan Al-Istiqomah Jl.Sei Asahan Gg. Masjid No. 3 Al-Ikhwan Jl. Bunga Wijaya Kesuma Psr-IV Pd. Bulan Al-Muttaqin Jl. Setia Budi Gg. Tengah No. 11 Jami’ Jl. Pasar I Lingk. VIII Tg. Sari Muslimin Jl. Setia Budi Kel. Tg. Sari Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. Pd. Bulan Nurul Mukmin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Nurul Iman Jl. Penerbangan No. 77 Kompl. Perhub. Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Nurussalam Jl. Bunga Cempaka No. 53 Kel. Pd.Bulan Taqwa Jl. Bunga Wijaya Kesuma Gg.Masjid Taqwa No.1 Taqwa Jl. Abdul Hakim No. 2 Tg. Sari

Drs. H. Anshari P., MA Ramli Kardi Drs. Mahyuddin Daulay Drs. Edi Purnomo Drs. Wahid Hasan Drs. Hasanul Arifin Drs. Bahtiar Agisni Rodi H., S.Ag, S.Pd.I Drs. H. Mhd. Ishak Ibrahim H.M. Nuh Abdul Muis, MSP H.M. Azhar M. Tinti Lingga H. Dhanil Harun, SH Drs. Yusuf Arhad Drs. H. Ramli Nasution Drs. H.M. Nur Hasibuan PCM Tanjung Sari Drs. Asrizal Tanjung

MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Ar-Ridha Jl. Darussalam No. 52-A Kel. Babura Ar-Ridho Jl. Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Komplex BTN Dusun III Sei Semayang

Zulhamsyah Lubis, S.Pd.I Drs. H. Ismail Zannah Mayor Caj. Drs. Zakaria Ansor Suwarno

Al-Amin Jl. Setia Budi No. 202 Kel. Tanjung Rejo Al-Basyir Jl. Garuda No. 78-B Sei Sikambing B. Al-Badar Jl. Binjai Km. 6,8 Medan Al-Falah Jl. Murni No. 27 Tg. Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sekambing B. Al-Hafiiz Jl. Pinang Baris No. 142 Al-Ikhlas Dusun XII Desa Sei Semayang Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Al-Ikhlas Jl. Beo No. 15 Al-Ikhwan Eks Komplek PTP III Desa Lalang Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Dsn.V Diski Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muttaqin Jl. Hanura No. 10 Kel. Tanjung Rejo Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Al-Muhajirin Kompl. Pondok Karya Kodam-I/BB Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Al-Mu’awanah Jl. Puskesmas I/Jl. Seroja Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Dermawan Jl. Rajawali No. 19 Sei Sikambing-B Nurul Hikmah PT.Perkebunan Nusantara-III Kandir Mdn Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Istiqamah Kec. Medan Sunggal Isti’adah Jl. Amal No. 4 Kel. Sunggal Ikhwanul Muslimin Dusun VII Gg.Damai D.Paya Geli Jamik Jl. Pinang Baris No. 19 Kel. Lalang Jamik M.Jayak Jl. Gatot Subroto Km. 5,5 No. 184 Mukhlisin Jl. Darussalam/ Sei Rokan Nurul Huda Jl. Garuda No. 29 Sei Sikambing-B Nurul Huda Jl. Serayu No. 38 Kel. Babura Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Riyadussholihin Lingk. XIV Kel. Sei Sikambing-B Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Jl. Gatot Subroto No. 180 Syuhada Jl. Balam Lingkungan XIII Sei Sikambing-B Silaturrahim Jl. Perintis Kemerdekaan D.Sei Semayang Taqwa Jl. Setia Budi No. 59 Tanjung Rejo Taqwa Jl. Merpati Gg. Mushollah Sei Sikambing-B Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel Amal Ridha Jl. Cemara Pulo Brayan Bengkel Baru Arrahim Jl. Purwosari Gg. Masjid/Puskesmas. P.B.B. Ash-Sholah Jl. Pendidikan No. 39 Kel. Glugur Darat I Al-A’la Jl. Pembangunan I No. 46 Krakatau Kel. GD Al-Barkah Jl. Setia Jadi Kel.Glugur Barat I Al-Furqoan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.Bengkel Al-Ikhlas Hub.Dam-I/BB Jl. Timor No. 23 Al-Ikhwan Jl. Prajurit No. 28 Gg. Bali Kel. Glugur Darat Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Komplek PTPN-II Bustanul Huda Jl. Perwira I Lingk. VIII P.B. Bengkel Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nurul Iman Jl. Bambu VI Kel. Durian Nurul Yaqin Jl. Bukit Barisan I No.74 Kel.Glugur Darat II Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Syuhada Jl. Budi Pengabdian No.2 Perum Pemko Mdn Taqwa Jl. Sutomo Ujung Gg. A No. 47 Kel. Durian Taqwa Kampus UMSU III Jl. Kapt. Mukhtar Basri No. 3 Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.Brayan Darat I Taqwa Jl. Mustafa No. 1 Glugur No. 1 Kp. Dadap Taqwa Pulo Brayan Bengkel MEDAN TEMBUNG Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel. Bantan At-Tawwabin Jl. Pimpinan No. 1 Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Al-Bayan Jl. Gurilla No. 10 Kel. Sidorejo Al-Falah Jl. Pukat Banting IV No. 10 Al-Hidayah Jl. Sering/Keruntung Gg. Hafazah No. 1 Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5-B Al-Huda Jl. Tuasam Gg. Aman Al-Ikhlas Jl. Mandala By Pass. Gg. Tengah Lingk. II Al-Ishlah Jl. Pukat V Kel. Bantan Timur Al-Istiqomah Komplek Veteran Medan Estate Al-Ijtima’iyah Jl. Letda Sujono No. 152 Al-Muhajirin Jl. Garuda II Perumnas Mandala Al-Muqorrobin Jl. Pukat II No. 52 Bantan Timur Al-Muhtadin Jl. Bantan No.15-A. Lingk.III Kel. Tembung Baiturrahman Kampus Unimed Jl. Willem Iskandar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Darul Jalal Jl. Taut/Sukaria No. 29-A Hidayatullah Jl. Medan Utara No. 3 Lingk-VII Hidayatul Muslimin Jl. Bersama No. 105 Lingk. 5 Hidayatul Ubudiyah Jl. Kapten M.Jamil Lubis No.16-A Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Raya Muslimin Jl. Pukat I No. 9 Kel. Bantan Timur Taqwa Jl. Belat No. 76 B Taqwa Jl. Enggang Raya No. 85 Taqwa Jl. Kolam No. 01 Kampus I Medan Estate Taqwa Ranting Sidorejo Hilir MEDAN TUNTUNGAN Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Ikhlas Jl. Nyiur Raya Blok 10 B Perum Simalingkar Al-Ikhlash Cengkeh Jl. Cengkeh X No. 1 Kel. Mangga Al-Ikhlash Jl. Nilam 11 Kel.Mangga Perum Simalingkar Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Muhajirin Jl. Kopi Raya II Blok A Perum Simalingkar Al-Muhajirin Jl. Seroja Komplek Medan Permai Al-Muhtadin Jl. Kemiri Raya I No.1 Blok-G Simalingkar Al-Munawwarah Jl. L.Putra No.19A Komp. Kejak/Kedok Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baitul Rahman Jl. Rami II Simalingkar Iklab Jl. Letjend. Jamin Ginting Km. 12,5 No. 100 Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Silaturrahim Jl. Kapas 13 No. 49 Taqwa Jl. Sawit Raya Perumnas Simalingkar DELI SERDANG Amal Islamiyah Jl. Sudirman Kel. Lubuk Pakam Pekan Ainul Yaqin Jl. Pembangunan IV No. 30 An-Nurul Hakimiyah Jl. H.M. Ya’kub No. 51 Ar-Ridho Jl. Jati Pasar VIII Dsn Gambir Dns Bd. Kalippa Al-Furqon Perumahan Bumi Tuntungan Sejahtera DSC Al-Falah Jl. Pasar V No. 73 Dusun XIV Desa Tembung Al-Muttaqien Gg. Kolam Deli Tua Al-Muttaqin Jl. S.M. Raja Km.12 Gg. Rasmi Tg. Morawa Al-Salam Jl. Raya Medan-Namorambe Kom. Pisu No.1 Baiturrahman Jl. Merica Raya Blok F Kec. Pancur Batu Baitussalam Dagang Kerawan-Tg. Morawa Jami’ Jl. Irian No. 79 Kel. Pekan Tg. Morawa Jami’ Jl. T. Imam Bonjol No. 17 Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Jami’ Asysyakirin Delitua Jl. Medan-Delitua Km.11,5 Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Khairul Fatihin Dusun II Tg. Morawa-A Lembaga Pemasyarakatan Klas II-B Jl.Sudirman No.27 Nurul Burhanuddin Desa Kedai Durian Gg. Cempaka Nursa’adah Jl. Medan-Tg. Morawa, Km. 12 Raya Al-Firdaus Jl. Batang Kuis Ds XI Desa Bdr Klippa Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Taqwa Jl. Diponegoro No. 1 Lubuk Pakam B I N JA I Agung Kota Binjai Amal Jl. H. Agus Salim No. 14 Kel. Jatinegara Aminin Jl. DR. Wahidin No. 7 Kel. Sumber Mulyorejo An-Nur Jl. Veteran No. 7 Kel. Tangsi Ar-Rahmah Turiam Kel. Tanah Tinggi Al-Hidayah Jl. Talam Kel. Nangka Istiqomah Jl. T. Amir Hamzah Kel. Jatinegara Nurul Falah Jl. Sisingamangaraja No. 60 ST A B AT Al-Furqan Lingk. I Musyawarah Kel. Kwala Bingai Baiturrahman Jl. T.M. Sech Dusun III Suka Makmur TEBING TINGGI Amal Muslimin Kampung Rao Amaliyah Jl. K.F. Tandean No.344 Lingk. V Kel. B.Sakti

WASPADA Jumat 12 November 2010 Drs. H. M. Nur Hasibuan Drs.Tohiruddin Harahap, S.Ag Drs. Asman Ali Nur Harahap Drs. Mhd. Yusuf Tanjung Drs. Agus Suhaedi Drs. H. Mahmuddin Sirait Dahlil Akbar, SE, HHC H. Dja’far Husein Drs. Ngadiman, G. Sahiruddin, S.Ag Amaluddin, S.Ag Drs. Misnan Prof. Dr. H. Amroini, MA H. Zainal Arifin, MA H. Alhudan Nasution, S.Sos Drs. H. Adlan Sirait Abdul Rahim, MA Drs. H. Khairuman Arsyad, M.Hum Drs. Ali Amnar Tambunan Khairul Harahap, S.Pd.I Drs. Idrus Uteh Drs. H. Asnan Ritonga, Lc Drs. H. Syarifuddin, D. Drs. H. Muniruddin, M.Ag Masrahim Salaby Drs. Hakimuddin Drs. H.M. Syahnun Drs. Zainal Arifin H. Fuad Husain, Lc Dr. H. Ramli Abdul Wahid, MA Drs. H. Irham Maulana Hsb. Drs. H.R. Taufiq Syaiful Aziz Drs. Lili Suheri Drs. H. Syu’aibun, M. Hum Drs. H. Adlan Sirait Turman Nasution, S.Pd.I DR. Ir. Abdur Rauf, MS Drs. M. Syafi’i Nasution Drs. Khalidin Musa Drs. Khaidir Sulaiman Drs. Asran Nasution Drs. Taharuddin, AG Drs. H. Juliardi Drs. Bahari Ahmad Syarwan Nasution, S.Ag Drs. Darfikri Drs. Rasmidi Drs. Syahnin Siregar Drs. Husni Ritonga, M.Ag Drs. Syahruddin Nasri Hsb. Drs. Adenan Ritonga, M.Ag Drs. Juanda Sirait Drs. Asfan Abdullah Prof. DR. H. Muhammad Hatta, MA Abdul Halim Nasution H.M. Thohir Ritonga, Lc Dr. H. Hasan Mansyur Nst., MA Drs. H.M. Samin Pane Drs. Mahyuddin Nasution, MA Dr. H. Mahyuddin Nst., MA H. Suhaidi Arfan, Lc Drs. Samsuri Matondang Drs. Abdul Kadir Jailani Drs. H. Zulkarnain M. Nur, SH, M.H Junaedi Damiswar, BA Prof. DR. Lahmuddin L. MEd Drs. Syahridin Tanjung Drs. H. Tengku Yusuf Drs. Adnan, M.Ag Drs. H. Syahmenan Hasibuan Andi Syahputra, S.HI Drs. H. Ngatimin Solehuddin, S.Ag Risdianto, S.Ag Drs. Bahron Nasution H. Abdul Hamid Rangkuty Suheri, S.Ag H. Arifinsyah, MA Drs. Syarifuddin Umar Lubis Drs. Dairobi Butar-butar Shufriadi H. Iqbal Ahmed Sauki’i, Lc Drs. T.H. Baharuddin Siregar Syahrilluddin, S.Pd.I Syaifuddin Daulay Hasanuddin Hasugian Drs. Zakaria Drs. Syahridan Salamudin, MA Drs. Baharuddin Lubis Drs. H. Sutan Syahril, D. H. Jafar Muhammad Drs. H. Syamsuddin Nur H. Achyar Nasution, Lc, MA Faizal Lubis Fakhruddin AR, S.Ag, MA Dr. Ali Imran Sinaga, MA Tumiyar, S.Sos.I Agus Rizal, S.HI Aminuddin, SH, S.Pd.I Nur Rahman, SH Drs. Ahmad Suhardi Matondang Hudri, M. Nurrahman, SH Azhar Pulungan H.M. Yusuf, BA Drs. H. Syafii Susanto, MA Syafruddin Syam, MA M. Subhan, S.Ag Syahril Dalimunthe, S.Ag Sya’ban Lubis, S.HI Aminudin H. Bahrel Datuk, SE, MM Rusli Ismail, S.Ag Dr. H. Zulhendi, Lc, MA Rahmat Hidayat H. Alamsyah Nasution Syafi’i Zein, S.Ag Syahril Bashrah, S.HI, S.Pd.I Masnun Syafi’i, Drs. H. Nasrun Zakaria Drs. Samsul Bahri H. Syafiar, M.Ag M. Rasyid, S.Pd.I H. Habibullah Drs. Mujahiduddin, M.Ag Zaidil H. Sugianto, Lc Drs. Ali Mansur Lubis Drs. Harmaini Margolang Drs. H.M. Syukri Yusuf Drs. Muntaqo H. Ahmad Iqbal, Lc H. Darma Effendi SH, MA Drs. H. Lukman Hakim Siregar Drs. Faizal Lubis Drs. H. Pandapotan Harahap Mhd. Syawal Afani, S.Ag Hajar Aswadi, MA H. Nurbain A. Athyah, Lc H. Farhan Rawi, S.Pd.I H. Safria Andy, MA Syahrin Pasaribu, S.Sos.I Drs. Lukmanul Hakim H. Achmad Mahfuzh Drs. H.M. Thahir Suyetno Zulkarnen, S.Ag

Waspada, Jumat 12 November 2010