Issuu on Google+

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

JUMAT, Kliwon, 11 Januari 2013/28 Safar 1434 H

Terbit 32 Halaman (A1-8, B1-12, C1-12)

No: 24099 Tahun Ke-67

Hari Ini, 66 Tahun WASPADA

Sambutan Gubernur Sumatera Utara Pada HUT Ke-66 Harian Waspada

Komitmen Dan Konsistensi Menjaga Kualitas Pers

Assalamualaikum Warahmatullahi Wabaraakatuh. HARI ini, 66 tahun silam Surat Kabar Waspada terbit pertama kali di tengah kondisi krisis bangsa yang berjuang mempertahankan kemerdekaan. Syukur Alhamdulillah, koran kebanggaan masyarakat Sumatera Utara Waspada hari ini memasuki usia yang ke-66 tahun. Saya atas nama pribadi, juga Pemerintah dan seluruh masyarakat Provinsi Sumatera Utara mengucapkan Selamat Ulang Tahun yang ke-66 kepada Harian Waspada. Semoga di usia yang ke-66 ini, Waspada semakin menunjukkan eksistensinya dengan tetap berpijak pada motto “Demi Kebenaran dan Keadilan”. Sejak terbit pertama kali pada 11 Januari 1947, Waspada

HARI bahagia itu kembali tiba, tentu kami sambut dengan sukacita. Hari ini Jumat,11 Januari 2013 Harian WASPADA yang didirikan Alm. H. Moh Said dan Almh Hj Ani Idrus genap berusia 66 tahun. Tiada kata yang paling pas diucapkan pada momentum ini, kecuali ‘’Alhamdulillah’’ karena kami —segenap keluarga besar WASPADA terdiri dari staf redaksi, pimpinan, bagian percetakan, iklan, pemasaran dll—sangat bersyukur pada Allah SWT atas segala limpahan rahmat dan karunia-Nya. Masa 66 tahun tentunya bukan jangka waktu singkat. Ibarat usia manusia sudah sangat dewasa sehingga dalam

Lanjut ke hal B9 kol. 1

Harga Eceran: Rp2.500,-

SALAH satu Harian Waspada terbitan tahun 1947. H. Mohd Said (inzet kiri) dan Hj Ani Idrus (inzet kanan).

Lanjut ke hal B9 kol. 1

Gunakan Hak Pilih Pilgubsu MEDAN (Waspada): Plt. Gubsu H Gatot Pujo Nugroho mengajak masyarakat untuk lebih berperan aktif dan menggunakan hak pilihnya pada pemilihan kepala daerah (Pilkada) Gubernur Sumut periode 2013-2018 pada 7 Maret 2013.

“Saya mengajak warga masyarakat untuk menggunakan hak pilihnya pada Pilgubsu. Bagi yang namanya belum terdaftar sebagai pemilih, mohon untuk proaktif menanyakan ke pihak

kelurahan,” katanya saat bersilaturrahmi dengan masyarakat di Desa Bangunsari dan Desa Silobonto, Kec. Silau Laut, Kab. Asahan, Rabu (9/1) malam.

Dalam silaturahmi tersebut, selain Gatot, turut hadir Bupati Asahan Taufan Gama Simatupang dan sejumlah pejabat lainnya. Komisi Pemilihan Umum

Provinsi Sumatera Utara telah menetapkan daftar pemilih tetap sebanyak 10.295.013 jiwa untuk pemilihan gubernur dan wakil gubernur dengan perincian 5.091.149 pemilih laki-laki

dan 5.203.864 pemilih perempuan. Dalam Pilgubsu yang akan digelar pada 7 maret 2013, KPU Sumut juga telah menetapkan tempat pemungutan suara (TPS) 26.443 unit.

Gatot mengatakan, dana yang telah dianggarkan untuk Pilgubsu Rp600 miliar. Padahal dana tersebut jika dipergunakan

Lanjut ke hal A5 kol. 1

Waspada Dan Intelektualisme IAIN SU Prof. Dr. H. Nur A Fadhil Lubis, MA Rektor IAIN SU BAGAIMANA relasi Waspada dengan Intelektualisme IAIN SU? Pertanyaan ini menarik untuk dikaji lebih lanjut. Tepat tanggal 11 Januari 2013, Waspada sudah berusia 66 tahun. Usia yang tidak lagi muda jika dibandingkan dengan usia manusia. Namun jika ditilik dari masa yang dibutuhkan untuk membangun sebuah peradaban, usia 66 tahun sesungguhnya masih tergolong muda. Kendati baru 66 tahun, kiprah Waspada dalam membangun peradaban manusia

Lanjut ke hal B9 kol. 3

WaspadaWaspada/Arianda Tanjung

CAGUBSU Gus Irawan Pasaribu mendampingi Pemimpin Umum Harian Waspada dr. Hj. Rayati Syafrin, MBA dan komisaris Waspada H. Indra Buana Said meniup lilin kue HUT ke 66 Waspada dalam kunjungannya ke Waspada Jl. Brigjen Katamso Medan, Kamis (10/1).

Datuk Hargai Sikap Netral Waspada

Gus Bawa Kue HUT

JAKARTA (Waspada): Datuk Srilelawangsa H. Syamsul Arifin, SE menghargai sikap netral Harian Waspada dalam Pilgubsu, sehingga akan memberikan pembelajaran politik bagi masyarakat Sumut dalam memilih pemimpinnya. Sebagai media independen Waspada berada di tengah masyarakat yang akan menentukan pelihannya. Untuk itu, kata Datuk,Waspada bisa hidup dan langgeng 1000 tahun lagi dengan tetap mengedepankan serta menyuarakan ‘Kebenaran dan Keadilan’. Hal tersebut disampaikan Datuk dalam perbincangan khusus

DATANG tiba-tiba pukul 10:00, Kamis (10/1), Gus Irawan Pasaribu, calon gubernur Sumut nomor urut 1 langsung menuju lantai 1 Harian Waspada. Baginya Harian Waspada sudah tak asing lagi. Sebab tahun lalu, dia terpilih sebagai man of the year versi Harian Waspada pada ulang tahun ke 65. Kunjungan itu disambut Pemimpin Umum Harian Waspada dr. Hj. Rayati Syafrin, MBA, yang sudah menantinya bersama staf redaksi, karyawan dan pegawai. Sepertinya Gus Irawan memang ingin membuat sedikit kejutan. Bagaimana tidak, kemarin dia datang dengan kue ulang tahun bertuliskan angka 66 tahun. Gus langsung menyerahkan kue itu kepada Rayati Syafrin. “Saya berdoa harian ini bisa tetap eksis, kian sukses berjuang

Lanjut ke hal A2 kol. 5

Lanjut ke hal B9 kol. 5

Berita Cagubsu

Antara

Amri Tambunan: LUBUKPAKAM (Waspada) : Bupati Deliserdang Drs H Amri Tambunan melalui Wabup H Zainuddin Mars menerima audiensi pengurus Pimpinan Daerah Dewan Masjid Indonesia (PD-DMI) Kab. Deliserdang di ruang kerja Wabub di Lubukpakam, Kamis(10/1). Audiensi berkaitan, PD- DMI Deliserdang akan melaksanakan Musda pada 26 Januari 2013. Pada pertemuan itu, Wabup H Zainuddin Mars didampingi Asisten I H Syafrullah S.Sos MAP, Kaban Kesbang Drs H Hasbi Nasution, Kadis Infokom Drs Neken Ketaren, staf Bagian Kemasyarakatan Setdakab dan staf Kankemenag Kab. Deliserdang. Lanjut ke hal A5 kol. 3

Effendi Simbolon: MEDAN (Waspada): Calon Gubernur Sumatera Utara (cagubsu) Drs Effendi Simbolon tak kuasa menahan haru ketika melihat jasad Lomoris Simbolon, Kamis (10/1). Lomoris merupakan ketua tim relawan Effendi SimbolonJumiran Abdi yang meninggal akibat tersengat listrik saat memasang baliho Esja Selasa lalu. Effendi datang bersama Jumiran Abdi ke rumah duka di Dusun III Sei Priok Paya Mabar, Kec. Tebingtinggi, Serdangbedagai. Effendi Simbolon mengaku terpukul mendengar kabar ada yang harus kehilangan nyawa karena ingin membantu perjuangan mereka untuk maju di pemilihan gubernur mendatang. “Tak banyak yang bisa saya katakan inang,amang,hanya ucapan turut berduka cita lah yang bisa saya sampaikan, karena jujur saya sangat terpukul dengan kejadian ini, “ujar Effendi. Lanjut ke hal A5 kol. 6

Gatot Selalu Hangat Dengan 5 Putrinya Anak-anakmu bukanlah anak-anakmu Mereka adalah anak-anak kehidupan yang rindu akan dirinya sendiri Mereka terlahir melalui engkau tapi bukan darimu Meskipun mereka ada bersamamu tapi mereka bukan milikmu NUKILAN di atas adalah puisi karya Kahlil Gibran, seorang penyair legendaris berdarah Lebanon. Kahlil mengetuk hati para orangtua, mengingatkan bahwa anak-anak bagaimana pun keadaan ayah- ibunya tetaplah memiliki jiwa mereka sendiri. Menyadari kemerdekaan anak-anaknya,

membuat H Gatot Pujo Nugroho dan Sutias Handayani membebaskan lima putrinya memilih jalan hidup mereka masing-masing. Sebagai orangtua , mereka hanya mengarahkan serta menjaga agar pilihan-pilihan itu tidak melenceng dari ajaran agama. Buah pernikahan keduanya pada Mei 1990, Gatot dan Sutias dianugerahi 5 orang putri. Mereka adalah Afifah Radhiyatullah, 21, Fauzia Dinny Hanif, 20, Rumaisho Hanny Muti’ah, 19, Maryam Balqis Salimah, 18, dan Aisyah Nailah Rabbaniy, 16. Sutias menuturkan, lima putrinya selalu

Lanjut ke hal A2 kol. 1

TERDAKWA kasus dugaan suap kepengurusan anggaran Kemendiknas dan Kemenpora Angelina Sondakh didampingi ayahnya Lucky Sondakh dan mantan istri Adjie Massaid, Reza Arthamevia usai sidang pembacaan vonis di Pengadilan Tipikor Jakarta, Kamis (10/1).

28 Rumah Vonis Angie 4,5 Musnah Tahun Penjara Di T. Karo TANAH KARO (Waspada): Sebanyak 27 rumah semi permanen di desa Juhar Kuta (Juhar Perangin angin dan Juhar Tarigan), Kec. Juhar , Kab. Karo, terbakar , Kamis (10/1) siang. 12 Rumah lagi terpaksa dirusak guna mencegah agar api tidak menjalar. Sedangkan di Desa Semangat Gunung, Kec. Merek, Kab. Karo satu rumah semi permanen milik Naik Surbakti,

Lanjut ke hal A5 kol. 1

JAKARTA (Waspada): Majelis hakim Pengadilan Tindak Pidana Korupsi (Tipikor) Komisi Pemberantasan Korupsi, menjatuhkan vonis 4 tahun 6 bulan penjara kepada terdakwa Angelina Sondakh (Angie) dalam kasus gratifikasi anggaran di Kemendikbud dan Kemenpora, Kamis (10/1). Angie juga diwajibkan membayar denda Rp 250 juta subsider 6 bulan kurungan. Sidang vonis yang dipimpin ketua Majelis Hakim Sudjatmiko menyatakan Angie terbukti sah dan meyakinkan

terbukti melakukan tindak pidana korupsi secara berkelanjutan. Angie dijerat melakukan tindak pidana korupsi sebagaimana diatur dan diancam dalam pasal 12 ayat a, pasal 5 ayat 2 dan pasal 11 Undangundang (UU) Nomor 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi. Mantan wakil sekretaris jenderal Partai Demokrat ini didakwa menerima uang sebanyak Rp12,58 miliar serta 2,35 juta

Lanjut ke hal A2 kol. 7

Gempa 6.0 SR Guncang Aceh BANDA ACEH (Waspada): Gempa berkekuatan 6.0 SR, menguncang Bumi Serambi Makkah, Aceh,Kamis(10/1) pukul 20:47. Gempa berada di 4,52 Lintang Utara dan 95,04 Bujur Timur dengan kedalaman 77 km berpusat di perairan Aceh Jaya,

Lanjut ke hal B9 kol. 5

Serampang Waspada/Ist

GATOT bersama istri dan kelima anaknya. Keluarga yang hangat adalah gambaran kehidupan Plt.Gubsu ini.

- Pokoknya Waspada tetap teruna - He...he...he...

Berita Utama

A2

WASPADA, Jumat, 11 Januari 2013

Datuk Hargai Sikap ... kepada Waspada di Jakarta pada Rabu (9/11), dalam rangka HUT ke-66Waspadapada11Januari2013. Sebagai warga dan tokoh masyarakat Sumut, kata Datuk, saya sepuluh jari dan satu kepala sangat menghormati sepak terjang Waspada yang sejak pra kemerdekaan sampai era reformasi ini tetap menyuarakan kebenaran dan keadilan. “Bukan suatu hal yang mudah menggapai usia 66 tahun, Waspada telah menunjukkan

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ......, Kb4+. 2. Bc2, BxB+. 3. Rb1, Ma2+mat. (Jika 2. Rc3, Ka2+mat atau jika 2. Rb1, Ma2+mat).

Jawaban TTS:

Gatot Selalu ... berpesan kepada mereka berdua agar dalam aktivitas sehari-hari tidak diistimewakan. Tak heran jika Gatot dan Sutias berusaha menghindarkan embel-embel anak gubernur dalam kehidupan sehari-hari putra-putri mereka. “Mereka khawatir jika orang tahu merekaanakGubernur,akanmembuatpenilaianguruataudosenjadi kurang objektif,” tutur Sutias. Sedikit berbeda dengan istrinya, Gatot justru mengaku ingin sesekaliberjalanbarenganak-anak dalam kegiatan di depan umum. Misalnya menghadiri undangan kolega,maupunacara-acarasosial. “Kadang ingin juga jalan bareng anak-anak, tapi saya harus menghargaisikapdanpilihanmerekaitu,” kata Gatot yang sebenarnya tak terlalumengkhawatirkankeobjektivan orang pada anak-anaknya. Di tengah kesibukan sebagai pemimpinmasyarakat,Gatotselalu meluangkanwaktuuntukbersama putra-putrinya.SaatshalatShubuh menjadiwaktupalinghangatbagi keluarga ini. Karena di pagi hari, Gatot dan Sutias bisa berkumpul dengan anak-anaknya dalam kondisi fresh, kecuali Rumaisho Hanny Muti’ah yang sedang berkuliah di Al Azhar, Mesir. “Paling sering, usai shalat Shubuh,merekaolahragabersama

dan sarapan bareng. Aktivitas di meja makan jadi kegiatan paling seru. Karena semua ngumpul sebelum anak-anak pergi sekolah dan kuliah,” kata Ivana, seorang staf di rumah dinas gubernur. Saat di rumah, imbuh Sutias, Gatot paling senang ngumpul bareng putri-putrinya. Begitu pulang kerja, hal pertama yang dilakukan mantan dosen Politeknik Negeri Medan itu adalah mendatangikamaranak-anak.Takhanya menanyakan kabar, tapi juga bercanda dengan mereka. Aktivitas favorit keluarga ini adalah ngumpul bareng sambil nonton televisi. Hubungan Gatot dengan kelima putrinya memang sangat

akrab.Bahkanketikamasihkuliah di Bandung, Gatot rajin membawa anak-anaknya yang masih kecilberwisatanaiksepedamotor. Kini,meskidekatdanakrab,Gatot dan Sutias selalu meminta anakanak mereka tetap bergaya hidup sederhana, mandiri dan tidak aji mumpung.Tidakbolehmentangmentang,dansombongmeskiabi dan umminya menduduki posisi penting di provinsi ini. Tentang anak-anak, hal yang palingberkesanbagiGatotadalah ketika dia menjadi orang yang membantu Sutias melahirkan putri ketiganya, Rumaisho. Putri yang kini kuliah di Kairo itu, lahir di rumah kontrakan mereka di

kawasan Titi Kuning. “Saat itu hanya ada kami berdua di rumah, prosesnya berlangsungcepatdanlancar.Taksempat lagi ke rumah sakit, bidan datang setelah persalinan usai,”tutur Gatot yang mengaku tak bisa melupakan pengalaman itu. Kedekatandengananak-anak, menurutGatotdanSutiassesungguhnya jadi hal wajib bagi setiap orangtua.Kebersamaandankehangatan komunikasi yang terjaga adalahmodalutamamewujudkan keluarga yang harmonis. Hanya dengan kebersamaan dan komunikasiyangterbukalah,setiap anak tetap mau terbuka pada orangtuanya. (m28)

GusMan-GanTeng Saling Kejar MEDAN (Waspada): Pertarungan CagubsuCawagubsudibursaSCWA(SiapaCagubsu-Wagubsu Anda) sepertinya menjadi gambaran Pilgubsu sesungguhnya. Seperti perkiraan sebagian warga Sumut dua pasang kandidat yang paling bersaing di Pilgubsu nanti adalah GusMan dan GanTeng. Hari ini giliran pendukung GusMan pula melakukan aksi kirim kupon terbilang besar sehingga rating kandidatnya kembali terdongkrak menjadi nomor satu melampaui GanTeng. Sedangkan pendukung GanTeng hari ini sepertinya menurunkan suhu setelah sempat tancap gas beberapa hari. Akibatnya terjadi situasi saling kejar

antara GusMan dan GanTeng di bursa SCWA. Selengkapnya posisi bursa SCWA hari ini sbb: GusMan 55%, GanTeng 41%, ESJA 3%, CHFadly 1% dan Amri-RE 0%. Harian Waspada mengedarkan kupon SCWA dalam rangka untuk mencari tahu siapa pilihan pembaca pada Pilgubsu 7 Maret 2013 mendatang. Pendukung Cagubsu-Wagubsu yang ingin berpartisipasi untuk menaikkan rating kandidatnya dalam bursa SCWA dapat mengisi kupon yang tersedia di halaman Pentas Pilkada sesuai petunjuk yang ada. Panitia hanya menghitung fisik kupon yang dikirim dan membuat persentasenya. (tim)

TTS Topik

Mimbar Jumat

Jawaban Sudoku:

2 5 3 8 6 1 7 9 4

6 1 9 4 3 7 8 2 5

8 7 4 9 5 2 6 3 1

9 4 5 6 1 8 3 7 2

7 8 1 2 9 3 4 5 6

3 2 6 7 4 5 1 8 9

4 3 8 5 2

1 9 2 3 7 4 9 5 1 6 7 8

5 6 7 1 8 9 2 4 3

sikap satria dalam menyampaikaninformasiyangsenantiasaturut andildalammembangunkehidupanberbangsa,khususnyamasyarakat di Sumut, membangun dengan jiwa semangat kebenaran dan keadilan,” kata Datuk. Siapapun dia (masyarakat Sumut), tahu akan Waspada yang punya andil besar mencerdaskan kehidupan masyarakat Sumut.“Sebagaimediatertuasaat ini, Waspada tentu sudah memiliki santan yang profesional di bidang media. Tidak banyak media yang bertahan seperti Waspada.Karenaitusayapenuhharapan agar Waspada tetap hidup 1000 tahun lagi dan terus memperjuangkan kebenaran dan keadilan di tengah-tengah kehidupan masyarakat,” kata Datuk. Datuk mengatakan, sebagai media yang dipercaya dan terpercaya Waspada harus lebih cepat dan akurat lagi mengambil peran di tengah masyarakat termasuk dalam pembangunan semua line agar Sumut tetap berjaya

dalam ikatan NKRI. Sebentar lagi, lanjut Datuk, masyarakat Sumut akan menentukan pimpinanannya dalam Pilkada Sumut. Karena itu, Waspada tetap memiliki peran dan andil besar memberikan informasi dan ruang tentang siapa saja calon Gubernur Sumut agar masyarakat bisa menjatuhkan pilihannya dengan tepat. Sejak kecil, remaja sampai dewasa dan berbagai aral melintang, dari organisasi hingga partai politik yang dilalui Datuk,

Waspada merupakan barometer setiap langkahnya. “Karena itu saya sangat berharap, Waspada terus dan dapat memberikan informasi terpercaya kepada masyarakat Sumut. Dengan kepercayaan masyarakat, Waspada tetap akan hidup sampai kapan pun,” tutur Datuk. Kelahiran Waspada yang dibidani sepasang tokoh pers H. Mohammad Said dan Hj. Ani Idrus merupakan kecemerlangan dalam menata kehidupan berbangsa dan bernegara. (j02)

Vonis Angie ... dolar AS dalam kurun waktu Maret 2010 hingga November 2010. Uang yang diterima Angie tersebut diberikan oleh Grup Permai terkait pengurusan proyek sejumlah universitas di Ditjen Pendidikan Tinggi Kemendikbud. Janda mendiang Adjie Massaid itu belum menentukan sikap apakah menerima atau keberatan atas putusan hakim tersebut. ”Akan saya konsultasikan dengan pengacara saya. Saat ini saya pikirpikir,” kata mantan Putri Indonesia itu. Sebelumnya Jaksa Penuntut Umum (JPU) dari KPK menuntut Angie dengan hukuman 12 tahun penjara dan denda Rp 500 juta subsider 6 bulan penjara. JPU juga menuntut Angie membayar uang pengganti Rp12 miliar dan 2,3 juta dolar AS.(j02)

WASPADA Jumat, 11 Januari 2013

Roy Suryo Pamitan Untuk Jadi Menpora JAKARTA (Antara): Sembari menunggu pengumuman Menteri Pemuda dan Olahraga yang baru, Roy Suryo pamitan kepada Fraksi Partai Demokrat, kata Ketua Fraksi Partai Demokrat Nurhayati Ali Assegaf yang membenarkan Roy telah meminta izin meninggalkan DPR RI menggantikan Andi Mallaranggeng. “Sore ini saya di-sms dan ditelepon oleh Roy Suryo. Intinya adalah ingin berpamitan karena akan menjadi Menpora,” kata Nurhayati di Jakarta, Kamis (10/1). Nurhayati mengungkapkan, Roy meminta izin meninggalkan DPR RI sambil menunggu pengumuman Menpora defenitif yang akan diumumkan Presiden Susilo BambangYudhoyono. “Dia (Roy) mengatakan, pamitan ini sambil menunggu pengumuman besok,” kata Nurhayati. Nurhayati bersyukur anggota Komisi I DPR RI itu dipercaya oleh Presiden Yudhoyono. “Tentu saya bangga. Tapi saya berpesan kepada Roy untuk menjalankan amanat yang diberikan oleh Presiden SBY dan juga masyarakat Indonesia,” ujar Nurhayati. Kamis pagi tadi Roy dipanggil Menteri Sekretaris Negara Sudi Silalahi setelah belakangan ini namanya santer disebut sebagai calon Menpora baru. Sebelumnya beredar nama Khatibul UmamWiranu, Achsanul Qosasi dan Ramadhan Pohan.

Berita Utama Martin Minta Dahlan Iskan Benahi Ratusan BUMN JAKARTA (Waspada): Politisi partai Gerakan Indonesia Raya (Gerindra), yang juga anggota Komisi III DPR RI, Martin Hutabarat meminta Menteri Badan Usaha Milik Negara (BUMN) untukmenghentikan aksi sensasinya. “Hentikanlah sensasi. Fokuslah pada pembenahan BUMN, “ ujar Martin kepada Waspada, Kamis (10/1) di Gedung DPR Jakarta.

Menurut Martin, sejak jadi Menteri BUMN dan mulai disebut-sebut sebagai salah satu calon presiden (capres), pada pemilihanpresiden(pilpres)2014, Dahlan Iskan semakin sering menjadi sorotan pers karena tindakan-tindakanya yang sensasional. Dia mengakui dari aksi Dahlan, ada yang diapresiasi masyarakat karena tindakannya yang populis seperti membuka pintu antrean jalan tol, makan di Warteg pinggir jalan, naik

kereta api bersama penumpang KA, atau tidur di rumah penduduk. Namun ada juga yang menimbulkan kontroversi seperti keberaniannya melaporkan anggota-anggota DPR yang diduga memalak BUMN, dan terakhir mengenai mobil baru yang diaku-aku sebagai buatan Indonesia, dimana Dahlan Iskan sendiri langsungmelakukanujicoba,yang akhirnya berurusan dengan kepolisian dan sudah dipanggil ke Polda Jatim, karena dianggap tidak melalui prosedur yang wajar. Melihat begitu banyaknya tindakan-tindakan Dahlan Iskan yang menimbulkan kontroversi, Martin mempertanyakan kinerja Dahlan setelah memangku jabatan Menteri BUMN setahun ini. “Kita mempertanyakan, bagaimana sebenarnya hasil kinerja Dahlan Iskan ini sebagai Menteri BUMN ? Kita rindu mendengar Menteri BUMN menunjukkan prestasinya,” ujarnya. Prestasi yang kita harapkan, tambah Martin, kita ingin Dahlan membenahi ratusan BUMN yang dipimpinnya.Tapi, harapan itujarangterlihatdanditunjukkan oleh Dahlan Iskan. Yang terdengar, kata Martin, adalah prestasinya selama memimpin PLN, sebuah BUMN vital yang oleh BPK dilaporkan telahmenimbulkanpemborosan keuangan negara hampir Rp38 triliun sewaktu di pimpin Dahlan tahun 2011 . “Jangan-jangan kita salah memiliki Menteri BUMN, yang diangkat oleh Presiden Susilo Bambang Yudhoyono hanya karena pencitraan, bukan karena prestasi,”tukasnya.Meskipunkita menghargai beberapa tindakan

Dahlan Iskan yang berani, seperti menolak korupsi dan melaporkan anggota DPR yang memalak BUMN ke Badan Kehormatan DPR. Melihat prestasinya yang minim selama setahun ini memimpin Kementerian BUMN, kita meminta agar Dahlan Iskan berhenti membuat sensasisensasidanpencitraan,danmulai fokus untuk membenahi BUMN yang ratusan jumlahnya, “ tutup Martin Hutabarat. (aya)

A3 BNPB Tegaskan Indonesia Siaga Darurat Bencana GORONTALO (Antara): Deputi Bidang Penanganan Darurat Badan Nasional Penanggulangan Bencana (BNPB) JunjunganTambunanmengatakanseluruhwilayahdiIndonesia saat ini ditetapkan berstatus siaga darurat bencana. “BadanMeteorologi,KlimatologidanGeofisikamenyatakan dalam waktu 60 hari ke depan cuaca cenderung ekstrem sehinggapotensiterjadinyabencanaalamcukuptinggi,”katanya di Gorontalo, Kamis (10/1). Berdasarkan pertimbangan itu, BNPB mengambil keputusan untuk menetapkan seluruh wilayah di Indonesia dalam status siaga darurat bencana. Dalam 60 hari ke depan berpotensi terjadi bencana alam,” katanya. Apalagi, kata dia, akhir-akhir ini sejumlah wilayah di berbagai provinsi di Indonesia dilanda banjir dan longsor. “Dengan status siaga darurat bencana, pemerintah daerah diharapkan bisa lebih tanggap dalam mengantisipasi timbulnya korban jiwa maupun kerugian materi akibat bencana alam,” katanya. Ia mengatakan status siaga darurat bencana lebih fokus terhadap antisipasi kemungkinan terjadinya bencana.

Luar Negeri A4 Meshaal Temui Abbas Bahas Rujuk Palestina

WASPADA

Jumat, 11 Januari 2013

KAIRO, Mesir (AP/Antara/Xinhua-OANA): Kepala Politbiro Gerakan Perlawanan Islam (Hamas) Khaled Meshaal dan Presiden Palestina —yang juga pemimpin Fatah — Mahmoud Abbas, Rabu malam, memulai pertemuan mereka di Kairo mengenai perujukan antar-Palestina, demikian laporan kantor berita resmi Mesir, MENA. Pembicaraanmereka,yangditaja oleh Mesir, bertujuan menerapkankesepakatanperujukanyang ditandatangani pada 2011 antara Fatah dan Hamas. Rabu pagi, PresidenMesirMohamedMoursime-

ngadakan pembicaraan terpisah dengan Meshaal dan Abbas mengenaimasalahuntukmenyegarkankembalifailperujukan,demikian laporan Xinhua Kamis (10/1). Hamas menang dalam pe-

71 Tahanan Irak Penghuni Abu Ghraib Terima Ganti Rp48 M WASHINGTON (AP): Satu kontraktor pertahanan yang dituduh dalam satu gugatan ganti-rugi berkomplot menyiksa para tahanan di penjara Abu Ghraib di Irak telah membayar tuntutan AS$5,28 juta (kira-kira Rp48 miliar) untuk 71 mantan tahanan antara 2003 dan 2007. PenyelesaiankasusyangmelibatkanperusahaankontraktorEngility Holdings Inc. itu menandai keberhasilan pertama usaha gugatan yang dilakukan oleh para pengacata mantan para tahanan di Abu Ghraib danpusattahananlainnyagunamengambildanadarisalahsatukontraktor pertahananASdalamgugatandugaanpenganiayaan.Kontraktorlainnya, CACI, diperkirakan akan diajukan ke depan pengadilan kasus tuduhan yang serupa pada musim panas mendatang. Skandal penjara Abu Ghraib terkuak pada kampanye pemili-han kembali Presiden GeorgeW. Bush tahun 2004 ketika foto grafis yang dibuatsejumlahprajuritdibocorkankemediamassa.Merekamenunjukkan sejumlahtahananyangtelanjangditumpukdiatassatusamalaindalam blokselpenjara,narapidanadiborgolkebarselmerekadanberkerudung dan kabel untuk sengatan listrik, di antara adegan mengejutkan lainnya. Dalam kegemparan internasional berikutnya, Bush mengatakan praktek itu “menjijikkan.” Menurutal-ArabiyaRabu(9/1),perusahaanswastaEngilityHolding yang membawahi L-3 Services, badan penerjemah penjara Irak harus membayarAS$5,28jutaataulebihdariRp48miliarkepada71narapidana di penjara Abu Ghraib, Bagdad, antara tahun 2003 dan 2007. Pembayaran kompensasi ini baru terungkap setelah media Barat menemukan berkas gugatan hukum terhadap perusahaan tersebut. L-3memilikisekitar6.000penerjemahuntuktentaraASdipenjaratersebut. Perusahaan ini memper-bolehkan para penerjemahnya untuk ikut dalammenyiksadanmelecehkanparatahanandiseluruhIrak. Pengacara para tahanan, Bazher Azmy, menolak memberitahukan berapa porsi kompensasi yang diberikan pada masing-masing korban.(m10)

Tabuk Di Arab Saudi Diselimuti Salju Langka TABUK, Arab Saudi (Waspada): Para penduduk Tabuk, kota yang terletak di baratlaut Arab Saudi, merasa berpiknik di kawasan pegunungan dan tempat-tempat lainnya yang diselimuti salju putih pada saat kota itu merasakan curah salju langka sejak Selasa lalu. Para pengunjung dari luar kawasan itu serta penduduk lokal menikmati curah salju yang jarang itu Rabu (9/1), teristimewa mereka yang menuju Gunung Allouz, yang telah dipenuhi dengan mobil. Sementara pihak keamanan, lalulintas dan kesehatan berada di berbagailokasiuntukmengarahkanlalulintasdanmemberikanpelayanan seperlunya,direkturlalulintasTabuk,Brig.MuhammadbinAliAl-Najjar, mengingatkan para pelancong yang ingin naik gunung bahwa jalanan agak licin di pegunungan. Dia juga menyerukan pada para pengemudi agar mematuhi aturan batas kecepatan dan berkomunikasi dengan pihak berwenang untuk mendapatkan bantuan atau informasi. Patroli lalulintas berada di jalanan tersebut untuk mengatur lalulintas dan memberikan bantuan kepada yang membutuhkan, katanya. (m10)

Pendapatan Dari Pelayanan Haji Hanya 3 Persen Dari GDP Saudi PARA EKONOM memperkirakan pendapatan Kerajaan Arab Saudi dari pelayanan Haji dan Umrah tahun 2012 tercatat lebih dari 62 miliar Riyal Saudi (sekitar AS$16,5 miliar atau Rp165 triliun), meningkat 10 persen dibanding tahun 2011 lalu. Mereka juga mengatakan pendapatan dari pelayanan Haji itu hanya menyumbang tiga persen dari GDP (gross domestic product). Fahd Al-Andeejani, seorang dosen ekonomi, mengatakan ada prospek baik bagi pembangunan industri nasional. “Kami perlu pasar yang lebih spesial untuk memenuhi kebutuhan para jamaah yang datang berhaji dan berumrah,” katanya menambahkan. Fahd mengatakan ada prospek menggembirakan bagi pengadaan restoran Asia, Eropa dan Amerika di Makkah dan Madinah. Dia menyatakan hal itu dalam menyoroti daya beli yang berkembang di Saudi sebagai akibat dari kenaikan gaji dan harga minyak. Al-Andeejani memperkirakan pengeluaran tahunan dari seorang jamaah Umrah sekitar beberapa puluh juta rupiah. Lebih dari tujuh juta jamaah datang ke Saudi untuk berhaji dan berumrah dan uang yang mereka keluarkan bisa meningkatkan perekonomian Arab Saudi. Dia menyerukan agar disediakan pelayanan kelas dunia untuk ibadah Haji dan Umrah. Banyak investasi yang diperlukan untuk pelayanan ini. Dia memperkirakan total pendapatan Kerajaan dari Haji dan Umrah di lebih dari 62 miliar Riyal Saudi. Al-Andeejani menyerukn usaha yang lebih besar untuk menciptakan kesempatan kerja lebih banyak bagi warga Saudi selama musim Haji dan Umrah. “Meski pasar Haji dan Umrah besar, penjualan produk Saudi termasuk barang-barang produk Saudi terlalu rendah,” kata Khaled Al-Qurashi, pemilik satu perusahaan Haji dan Umrah. Dia mengatakan barang kerajinan tangan produksi keluarga Saudi kurang memanfaatkan pasar yang seharusnya dilakukan demi kesuksesannya. Berbicara kepada harian berbahasa Arab Asharq Al-Awsat, Al-Qurashi mengatakan barang-barang sovenir Saudi menghadapi persaingan ketat melawan produk China. Dia menegaskan perlunya memperkuat kemampuan para pria dan wanita Saudi membuat barang-barang sovenir yang inovatif dengan suatu sentuhan Makkah dan Madinah untuk dijual kepada para jamaah dan para wisatawan lainnya. Dia yakin bahwa produk Saudi dapat menghasilkan pemasukan 500 juta Riyal Saudi sampai 800 juta Riyal Saudi pertahunnya jika benar-benar dipasarkan. Fahd Al-Kabkabi, pemilik beberapa toko yang menjual sovenir dan benda oleh-oleh, mendesak para pemuda Saudi untuk memulai usaha wiraswasta kecil dan menengah untuk menghasilkan barangbarang hadiah ke pasar untuk diperdagangkan di antara para jamaah. “Ini merupakan sarana potensial bagi para wiraswastawan muda Saudi untuk memasuki dan mengembangkan kemampuannya bersaing dengan produk lain. Itu juga dapat menciptakan lapangan kerja lebih banyak bagi warga Saudi,” katanya menambahkan. “Kita perlu lebih banyak mempro-duksi barang-barang buatan Arab Saudi yang dapat dijadikan hadiah untuk dibawa pulang oleh para jamaah. Al-Kabkabi mendesak para pedagang agar mempromosikan produk Saudi dengan memberikan kepada para pria dan wanita Saudi kesempatan untuk memamerkan barang-barang produk mereka di toko-toko milik Saudi. Menurut Abdul Hameed Abalarry, direktur Bandara Internasional King Abdulaziz di Jeddah, kira-kira enam juta jamaah asing melakukan Umrah selama 2012. Dia berbicara tentang koordinasi antara Kementerian Haji dan Otorita Umum Penerbangan Sipil (GACA) dalam pengiriman jamaah ke bandara, yang katanya kementerian telah sepakat untuk tidak mengirim setiap jamaah ke bandara tanpa konfirmasi booking. Para pejabat GACA di pintu masuk Terminal Haji memastikan bahwa hanya para jamaah dengan konfirmasi booking yang diizinkan masuk bandara guna menghindari kepadatanan penumpang di terminal itu, katanya. (an/mujo)

milihan anggota parlemen Palestina pada 2006 dan merebut Jalur Gaza dengan kekerasan setahun kemudian dan mengekang Pemerintah Otonomi Nasional Palestina(PNA)—pimpinanFatah— di Tepi Barat. PadaMei2011,HamasdanFatahmenandatanganikesepakatan perujukan yang diperantai Mesir diKairo.Berdasarkankesepakatan itu, kedua gerakan sepakat untuk membentukpemerintahperalihan yang terdiri atas tokoh teknokrat. Belakangan, kedua faksi Palestina itu sepakat untuk menyelenggarakan pemilihan umum pada Mei 2012. Desember 2012, para pemimpin Gerakan PerlawananIslamdanFatahsepakatuntuk secara jujur melaksanakan kesepakatan perujukan diperantarai Mesir itu. Abbas dan Meshaal pertama akan ‘bertemu dengan kepala intelijen Mesir sebelum mengadakan pertemuan segitiga dengan Presiden Moursi,’ kata jurubicara kepresidenan Yasser Ali. Azzam al-Ahmad, yang bertanggung jawab atas upaya re-

konsiliasi antara partainya Fatah, yang Abbas adalah pemimpinnya, mengatakan bahwa Abbas sedang bepergian ke Mesir atas undangan Moursi untuk mem-

bahas masalah tersebut. Meshaaldanparaajudantiba di Kairo dari Doha pada Selasa untuk kunjungan beberapa hari, kata kantor berita resmi MENA.

Hamas dan Fatah telah berselisih sejak gerakan Islam itu merebut

dan menguasai Gaza pada Juni 2007, menyusul kemenangan

pada pemilu parlemen Palestina tahun sebelumnya. (m10)

A5

WASPADA Jumat, 11 Januari 2013 28 Rumah Musnah ...

Amri Tambunan ...

terbakar. Rumah milik Seken br Tarigan dan Nd Prado br Ginting yang bersebelahan terpaksa dirusak. Tidak ada korban jiwa, kerugian miliaran rupiah. Informasi Waspada peroleh,di Desa Juhar, 27 rumah yang terbakar masing masing dihuni , Pilip Peranginangin,Umar Pinem, Ramban Perangin angin, Gas Andel Tarigan, Panlong Ramban, Kurdat Ginting, Tomas Ginting, Edak Ginting, Kisar Pinem, Parte Pinem, Andel Tarigan, Pa Tio Perangin-angin, Agus Sembiring, Nd Reni br Sembiring, Nd Rayat br Pinem, Dose Tarigan, Tomas Ginting’s, Nd. Japulung br Sebayang, Ingan Pulung Tarigan, Jaman Sinuraya, Alasen Tarigan, Deka tarigan, Harta Tarigan, Loman Tarigan, Pasma Sembiring, Jaukur Tarigan, Nd Kurdat br Tarigan. Asal api diduga dari sebuah toko. Bupati karo Kena Ukur Surbakti yang mendapat informasi segera meninjau lokasi.Sedangkan, 3 unit mobil Pemadam Kebakaran yang didatangkan dari Kabanjahe dengan jarak sekitar 45 Km bekerja keras selama 3 jam untuk menjinakan kobaran api . Untuk mencegah kobaran api 12 unit rumah tinggal lainya beserta losd desa terpaksa dirusak. Setelah api padam, Bupati Karo mengumpulkan warga di losd desa ( Jambur Sibayak) dan menyerahkan bantuan sembako kepada korban kebakaran. Bupati berharap agar warga tabah menghadapi peristiwa ini. Sementara Kepala Desa Juhar Perangin-angin Delna Sembiring Depari, didampingi tokoh masyarakat Jaman Sinuraya, dalam pertemuan itu mengusulkan kepada Bupati Karo agar Pemkab dapat memfasilitiasi satu unit mobil pencegah kebakaran untuk di kecamatan Tigabinanga, mengingat setiap terjadi peristiwa kebakaran, mobil pemadam selalu terlambat datang karena jarak tempuh yang cukup jauh dari Kabanjahe. Sedangkan Kapolsek Juhar, AKP Gunawan Hery S didampingi Danramil Juhar Kpt Inf. J Surbakti menyebutkan, pihak keamanan memasang police line.Sedangkan, Camat Juhar Tomy Sidabutar, menyarankan kepada Kepala Desa dan sanak saudara agar memberikan tumpangan tempat tinggal sementara bagi korban sampai rumah warga dibangun.(c10/a36)

Ketua PD-DMI Kab. Deliserdang H Sulaiman Hasibuan didampingi Zulkarnain,H Amin Rasyid Nasution bersama Ketua PanitiaMusdaChairuddinSiregar menjelaskan, rencana Musda PD DMI pada 26 Januari 2013 digelar di Aula Taman Pramuka Cadika Lubukpakam. Untuk itu, mereka berharap Bupati H AmriTambunanmembukapelaksanaanMusda yangmengusungthema “Dengan MusdaPDDMI Kab.Deliserdang, kitajadikansebagaiwahanasilaturrahim dalampeningkatankualitas kerja untuk meningkatkan peran masjid dalam penanaman nilai agama terhadap umat Islam “. Menurut Sulaiman, melalui

Gunakan Hak Pilih ... untuk pembangunan jalan dipastikan dapat membenahi ratusan kilometer jalan-jalan yang rusak. Untuk itu,Gatot sangat berharap masyarakat menggunakan hal pilihnya dan jangan sampai Pilgubsu hanya menghasilkan partisipasi pemilih yang minim. “Padahal dana Rp600 miliar itu bisa membuat setidaknya sepanjang 200 km. Jadi sayang kalau uang itu terbuang percuma, uang itu adalah uang kita, mari nanti pada 7 Maret kita berbondong bondong datang ke TPS untuk memilih gubernur dan wakil gubernur periode 2013-2018,” katanya. Sementara Bupati Asahan Taufan Gama Simatupang mengungkapkan banyaknya bantuan yang telah diberikan Pemprov Sumut pada kabupaten tersebut, baik bantuan untuk nelayan, pembangunan jalan maupun lainnya. “Tahun ini saja Kab. Asahan yang saya dengar mendapat bantuan dari APBD sebesar Rp300 miliar. Artinya Gatot Pujo Nugroho selaku Plt Gubernur Sumut memiliki pandangan khusus pada kabupaten ini. Dengan keberhasilannya membangun Sumut, kita mengharapkan dia dapat melanjutkan kepemimpinannya pada periode 2013-2018,” katanya.(m28)

Musda ini diharapkanbisa diperoleh berbagai masukan seputar perkembangan dan kemajuan manajemen masjid di daerah ini yang jumlahnya 1.866 buah dan 800 mushalla. Selain itu akan diperolehmasukantentangfungsi masjid/mushalla sebagai tempatibadahsekaligustempatpembinaan mental spritual umat. Wabup H Zainuddin Mars dalamarahannya menyampaikan terimakasih dan bangga atas rencana digelarnyaMusdaPDDMI Kab.Deliserdang, yang pada intinya bertujuan pengembangan keagamaan,yangmerupakan tugas utama bagi kita di saat bangsa ini sedang menghadapi tantangan besar yakni memudarnya pengamalan nilai-nilaiagamaditengah-

tengah kehidupan. Saat ini, kita telah kehilangan jatidiri, termasuk sebahagian dari generasimudakita sudah terkontaminasi karena larut dengan perkembangan zaman dan teknologi yang cendrung besikap keras serta hilangnya rasa kasih sayangdan persaudaraan.Sehingga maraknya berbagai hal yang merusak moral. Pada kesempatan itu,Wabup melalui PD DMI mengajak umat untuk selalu memakmurkan masjid. Tidak hanya pada saat melaksanakan ibadah shalatsaja, tetapi sangat baik untuk tempat bermusyawarahbagi kemaslahatan umat terutama bagi pembinaan mental para generasi muda. (a06)

Effendi Simbolon ... Effendi yang langsung ke rumahdukasetibanyadariJakarta mengatakanuntukmenghormati perjuangan almarhum, ia secara pribadi akan menjamin biaya pendidikan bagi kedua buah hati Lomoris Simbolon. “Saya tidak bisa memberikan apa pun untuk menghilangkan kesedihan keluarga,tapi saya berharap keinginan dan niat saya memberikanbiayapendidikanbagi Vittauli Simbolon dan Okto Alexius Simbolon hingga sarjana bisa meringankan sedikit dari kesedihan keluarga, “ imbuh Effendi.

Sementara calon wakil gubernur Jumiran Abdi menambahkan kata-kata penghiburan yangmerekasampaikanbukanlah sebagai pengobat duka dan sedih keluarga,tapi merupakan bentukkesedihankarenaadayang rela berkorban nyawa untuk mendukungperjuanganmenjadi gubernur dan wakil gubernur Sumatera Utara. “Kepergian beliau harus menjadi cambuk bagi kami yang masih akan terus berjuang hingga Pilgubsu nanti, sehingga pengorbanan almarhum tidak sia-sia, “ujarnya. Sementara itu,Mulyadi Simbolon yang berbicara mewakili

pihak keluarga mengatakan, almarhum meninggal sebagai relawan pendukung Esja,karena itu keluarga berharap cita-cita ESJA bisa terwujud,sehingga pengorbanan almarhum tidak sia-sia. “Kami bangga, Bapak Effendi dan Bapak Jumiran mau datang kemari untuk mengucapkan langsung kata-kata berbelasungkawa kepada kami.Untuk itu,kami dari pihak keluarga hanya bisa berdoa supaya perjuangan Bapak tidak terhenti sampai disini,tapi justru berhasil sebagai pemenang,sehingga pengorbanan anak kami ini tidak sia-sia,” ujar. (m49)

Sport Kampanye Vucinic A6

Juventus Vs AC Milan 2-1 TURIN, Italia (Waspada): Mirko Vucinic mencetak gol di masa injury-time, Rabu (Kamis WIB), sehingga membawa Juventus menembus semifinal Piala Italia dengan mengatasi AC Milan 2-1. Vucinic pun kampanye, tidak ada pemain bintang dalam skuad The Old Lady. “Tidak ada primadona di Juventus. Setiap orang di sini mengerahkan kemampuan terbaik dari menit pertama sampai akhir laga,” tegas striker asal Montenegro itu dalam SkySport Italia, Kamis (10/1). Menurut Vucinic, sukses Si Nyonya Tua menggebuk Il Diavolo Rosso juga tak terlepas dari permainan tim dan semangat pantang menyerah. “Karakter itu membuat tim menjadi unik,” ucapnya. “Saya belum bisa dalam level terbaik, kondisi saya sejauh ini

masih terus berkembang. Saya perlu bekerja keras untuk menjaga kebugaran agar bisa bermain selama 90 menit,” tekad mantan bomber AS Roma tersebut. Dalam duel perempatfinal di Juventus Stadium itu, Stephan El Shaaraway lebih dahulu membawa Milan memimpin menit keenam, memanfaatkan umpan Kevin-Prince Boateng. Berselang enam menit, Sebastian Giovinco menyamakan kedudukan dengan melepaskan tendangan melengkung dari jarak 20 meter. Super Juve yang mengalahkan I Rossoneri di semifinal

Hasil Rabu (Kamis WIB) Juventus v AC Milan

musim lalu, mendominasi permainan meski mengistirahatkan kiper Gianluigi Buffon dan playmaker Andrea Pirlo. Menjelang akhir waktu normal, M’Baye Niang yang masuk sebagai pemain pengganti di babak kedua, melepaskan sundulan yang nyaris memberikan kemenangan bagi tim tamu. Tendangan bebas Riccardo Montolivo juga gagal membuahkan hasil. Vucinic kemudian muncul sebagai bintang kemenangan I Bianconeri. Mendapat operan dari Paolo De Ceglie menit 95, dia menembakkan bola melewati kiper Marco Amelia. Ini sekaligus balasan setimpal Juve atas kekalahan mereka dari Milan di Liga Seri A, November silam. “Itu respon kuat setelah Minggu lalu, dan saya senang kami menerapkan sistem kami,” tutur allenatore Antonio Conte, mengomentari kekalahan 1-2 Super Juve di kandang

2-1

Hasil Selasa (Rabu WIB) SS Lazio v Catania

3-0

Selasa, 15 Januari (GMT) Inter Milan v Bologna

20:00

Rabu, 16 Januari (GMT) Fiorentina v AS Roma

20:00

sendiri saat menjamu Sampdoria akhir pekan lalu di Seri A. “Ini laga yang seimbang. Terciptanya gol kedua karena kami membuat kesalahan di pertahanan yang memungkinkan mereka melakukan serangan balik,” ratap Massimiliano Allegri, pelatih Milan. “Kami memiliki beberapa peluang untuk menyamakan kedudukan setelah gol Vucinic. Kami terus mengembangkan permainan dan kami layak mendapatkan hasil yang lebih baik di laga ini,” pungkas Allegri. (m15/ant/rtr/sky)

Sukses Bersejarah Swansea LONDON ( Waspada): Swansea City memberikan kejutan kedua di semifinal pertama Piala Liga Inggris, Rabu (Kamis WIB), setelah mempermalukan tuan rumah Chelsea 2-0 di Stamford Bridge, London. Meski tidak sehebat kemenangan 4-1 yang didapat tim kasta keempat Bradfrod City atas AstonVilla pada Selasa (Rabu WIB), sukses Swansea atas sesama tim divisi teratas tetap merupakan kejutan besar. “Kami telah punya beberapa hasil bersejarah musim ini, tapi menang di sini merupakan hal istimewa. Mereka memberi kami dua gol, Anda memang mesti mencetak gol saat melawan mereka,” ujar Michael Laudrup, manajer The Swans. “Ini pertarungan hebat, kami tim yang selalu berusaha untuk menyerang. Namun ketika Anda bertandang melawan juara Eropa, Anda harus berubah,” tambah striker legendaris Denmark itu melalui Sky Sports, Kamis (10/1). Kedua gol Si Angsa Putih merupakan hasil dari dua blunder bek Branislav Ivanovic.

AP

STRIKER Swansea Danny Graham memanfaatkan kesalahan bek Branislav Ivanovic untuk membobol gawang Chelsea di Stamford Bridge, London, Kamis (10/1) dinihari WIB. Striker Spanyol yang sedang berada dalam permainan terbaiknya, Miguel ‘Michu’ Perez, yang direkrut transfer hanya dengan biaya dua juta pounds dari Rayo Vallecano, membuka sukses Swans menit 39. Itu merupakan golnya ke-16 musim ini dengan cara tembakan melengkung setelah Ivanovic salah saat mengontrol bola.

Manajer Chelsea Rafael Benitez memasukkan Frank Lampard dan Demba Ba untuk berupaya menyamakan kedudukan, namun gol balasan yang dinanti tidak juga tercipta. Jelang laga usai, klaim penalti Ba ditolak wasit dalam debutnya bersama Si Biru di Stamford Bridge pasca diboyong dari Newcastle United.

Pesan Dari Hatrik Ronaldo MADRID ( Waspada): Cristiano Ronaldo (foto) menjadi figur mengesankan di Santiago Bernabeu, Rabu (Kamis WIB), ketika mencetak hatrik untuk memenangkan Real Madrid 4-0 atas Celta Vigo pada leg kedua perempatfinal Piala Raja Spanyol. Ronaldo pun langsung mengirim pesan kepada para pendukung Madrid, supaya selalu mendukung Los Blancos dan entrenador Jose Mourinho. “Kami harus bersatu dan membutuhkan fans untuk mendukung kami, masih banyak laga yang bisa kami menangkan,” pesan Ronaldo, seperti dilansir Soccerway, Kamis (10/1). Mourinho dikecam karena

mencadangkan kiper sekaligus kapten Iker Casillas dalam dua laga terakhir. Dia lebih memilih Antonio Adan, yang kena kartu merah menit keenam saat El Real menang 4-3 atas Sociedad akhir pekan lalu di La Liga Primera. Ronaldo melalui hatrik golnya ke gawang Celta menit 3, 24 dan 87, berharap polemik Casillas-Mourinho segera berakhir. Satu gol Real lainnya disumbangkan Sami Khedira menit 89. Dalam duel ini bek Sergio Ramos dikeluarkan dari lapangan setelah mendapat kartu kuning kedua menit 72. “Ini menjadi catatan khusus, Cristiano sudah mencetak lima gol dalam dua laga terakhir ini. Dia menjadi pemain terbaik turnamen ini dan kami beruntung memiliki dia,” ujar Direktur Real Emilio Butragueno. (m15/ant/rtr/sw)

Waspada/Yuslan Kisra

KETUA Umum PSSI, Djohar Arifin Husin, bersama Delegasi AFC di Kantor KOI, Senayan, Jakarta, Kamis (10/1).

AFC Minta PSSI Pakai Power JAKARTA (Waspada): AFC memberi penguatan kepada PSSI di bawah pimpinan Djohar Arifin Husin, saat melakukan pertemuan dengan induk olahraga sepakbola Indonesia, bersama Komite Olahraga Internasioanal (KOI) di Kantor KOI, Senayan Jakarta, Kamis (10/1). Penguatan tersebut diberikan AFC menyikapi persoalan yang terjadi di pentas sepakbola nasional saat ini. Sebagai federasi resmi, PSSI diminta AFC menggunakan power untuk menegakkan aturan, dalam hal ini Statuta PSSI maupun FIFA. “Kami diminta bertindak tegas dalam menyelesaikan masalah yang terjadi. AFC memberi dukungan penuh agar PSSI bisa menyelesaikan permasalahan, terutama menyangkut adanya penolakan pemain membela timnas,” urai Djohar seusai bertemu Presiden AFC, Zhang Jilong. Diakui Djohar, dalam pertemuan yang juga dihadiri Sekjen AFC Alex Sosay dan Ketua KOI Rita Subowo, pihaknya sudah melaporkan semua upaya yang telah dilakukan untuk menyelesaikan masalah, terutama menyangkut dualisme kompetisi. “Dari laporan yang kami sampaikan, delegasi AFC menerima dengan baik. Karena itulah Zhang yang juga Acting President AFC langsung meminta kami menggunakan power dalam menyelesaikan masalah,” kata Djohar. (yuslan)

4-0 5-2 2-0 3-0 1-2 6-2

Hasil Selasa (Rabu WIB) Valencia v Osasuna Valencia menang agregat Malaga v Eibar (III) Malaga menang agregat

Justru tim tamu menambah golnya menit lewat Danny Graham juga memanfaatkan blunder Ivanovic. Ini merupakan gol keempat Graham dalam empat partai berturut-turut. Klub Wales itu akan berupaya mengamankan hasil positif ini pada leg kedua semifinal di Stadion Liberty, 23 Januari mendatang. “Masih ada gunung untuk didaki, Chelsea memiliki begitu banyak kualitas. Kami harus bermain dengan intensitas sama, mereka masih dapat menang dan mencetak tiga atau empat gol ke gawang kami,” tutur Laudrup. The Blues sebenarnya lebih dominan sepanjang pertandingan. Fernando Torres yang diturunkan sejak awal mengalami kebuntuan, kendati ditopang empat gelandang lincah Juan Mata, Oscar, Ramires, dan Eden Hazard. “Kami memiliki Mata, Ramires, David Luiz, dan 23 peluang. Jika melawan tim yang main lebih bertahan ke dalam dan Anda masih memiliki banyak peluang, saya tidak berpikir untuk hanya membicarakan satu pemain,” jelas Benitez. (m15/ant/sky/dm) AP

Hasil Rabu (Kamis WIB) Real Madrid v Celta Vigo Madrid menang agregat Real Zaragoza v Levante Zaragoza menang agregat Sevilla v Real Mallorca Sevilla menang agregat

WASPADA Jumat 11 Januari 2013

2-1 4-1 4-1 5-2

AP

BINTANG kemenangan Juve Mirko Vucinic (kiri) merayakan gol di atas derita dua pemain Milan di Juventus Stadium, Kamis (10/1) dinihari WIB.

Aroma Juara Lakers Lenyap SAN ANTONIO, AS (Waspada): Kekalahan sepertinya melekat pada Los Angeles Lakers yang belum jua bangkit dari keterpurukannya dalam lanjutan kompetisi NBA musim ini. Lima kekalahan beruntun resmi digapai Lakers setelah ditaklukkan San Antonio Spurs 105-108. Bertandang ke markas Spurs di AT&T Center, Kamis (10/1), Spurs langsung meninggalkan Kobe Bryant cs 24-17 di kuarter pertama. Jelang babak pertama berakhir, Tony Parker menjadi inspirator performa Spurs untuk keunggulan 54-45. Di kuarter ketiga, Spurs dan Lakers saling kejar mengejar angka dengan tuan rumah sempat unggul jauh 83-66. Namun, Lakers bangkit dengan kombinasi three point dari Metta World Peace, Kobe Bryant, dan Earl Clark. Alhasil, Lakers mengejar dan memasuki kuarter keempat dengan motivasi tinggi. Setelah Kobe dan Steve Nash bahu-membahu membawa Lakers mengejar ketinggalannya, Spurs memupus harapan tersebut lewat aksi gemilang

AP

HADANGAN tiga pebasket San Antonio Spurs menyulitkan bintang LA Lakers Kobe Bryant (24) mencetak poin dalam lanjutan kompetisi NBA di AT&T Center, San Antonio, Kamis (10/1). Manu Ginobili. Kini, Lakers berada di urutan 11 Wilayah Barat dengan rekor 15-20 dan Spurs di posisi ketiga (28-10). Parker memimpin Spurs dengan 24 poin dan Ginobili menyumbang 19 angka, sedangkan

Lakers dimotori Kobe yang mendulang 27 poin didampingi 23 angka milikWorld Peace. Usai pertandingan, Kobe pun melampiaskan kekecewaannya. “Kalah lima kali beruntun?! Ini sudah kelewatan dan harus

segera dicari perbaikan dalam waktu dekat. Bila tidak, Lakers dipastikan menjadi penonton dalam babak playoff musim ini,” ketus Kobe yang kesulitan meladeni kawalan Kawhi Leonard sepanjang permainan.’ Di TD Garden, trio dahsyat Boston Celtics berperan penting saat menjamu Phoenix Suns. Bedanya, trio itu diwakili tim pelapis Celtics yang meliputi Jeff Green, Jason Terry, dan rookie Jared Sullinger. Green mencetak 14 angka, Terry menambah 13, dan Sullinger menoreh 12 poin 16 rebound bagi Celtics yang menang 87-79. Hasil lain, Cleveland Cavaliers vs Atlanta Hawks 99-83, Toronto Raptors vs Philadelphia 76ers 90-72, Utah Jazz vs Charlotte Bobcats 112-102, New Orleans Hornets vs Houston Rockets 88-79, Oklahoma Thunder vs Minnesota T’wolves 106-84, Milwaukee Bucks vs Chicago Bulls 104-96, Denver Nuggets vs Orlando Magic 108105, LA Clippers vs Dallas Mavericks 99-93. (m33/ap)

Peterhansel Perkuat Posisi Puncak ARICA, Chile (Waspada): Juara bertahan Stephane Peterhansel membuka peluang meraih gelar juara Reli Dakar ke-11, ketika memperkuat posisi tercepat secara keseluruhan (overall) setelah menyelesaikan tahapan kelima dari Peru ke Chile, Kamis (10/1) pagi WIB. Pereli asal Prancis itu berada di urutan kedua pada tahapan kelima sepanjang 172 kilometer dari Arequipa ke Arica, unggul satu menit 23 detik di belakang rekan setimnya yang mengendarai Mini, Nani Roma dari Spanyol. Tapi jarak Peterhansel dengan lawannya, yang sehari sebelumnya 5 menit 16 detik menjadi 9 menit 54 detik atas pereli dari Qatar Nasser al-Attiyah, juara 2011,yang sempat tersesat di padang pasir. “Perlombaan berat dan merupakan hal esensial untuk menemukan jalur yang benar,” ujar Peterhansel. “Saya harus mengejar Nasser yang berada di depan dan

8 Besar Klasemen Mobil 1. Stephane Peterhansel (FRA/Mini) 10 jam 55 menit 32 detik, 2. Nasser al-Attiyah (QAT/Buggy) 9:54, 3. Giniel De Villiers RSA/Toyota) 33:50, 4. Leonid Novitskiy (RUS/Mini) 37:35, 5. Nani Roma (ESP/ Mini) 37:43, 6. Guerlain Chicherit (FRA/SMG) 56:34, 7. Ronan Chabot (FRA/SMG) 1hr 10min 35sec, 8. Bernard Errandonea (AND/SMG) 1 h 18:17.

8 Besar Klasemen Motor

AP

STEPHANE Peterhansel (kanan) pose dengan krunya di atas podium Rali Dakar 2013, setelah menyelesaikan tahapan kelima dari Peru ke Chile. ia mengawalinya dengan baik. Secara keseluruhan, amat mengasikkan. Tapi terkadang lintasan berbatu, sehingga kami harus amat hati- hati,” katanya lagi. Untuk sepeda motor, pereli Prancis David Casteu yang memacu Yamaha, tampil tercepat dengan waktu satu jam 39,42 menit. Pimpinan keseluruhan

1. Olivier Pain (FRA/Yamaha) 11 jam 51 menit 29 detik, 2. David Casteu (FRA/Yamaha) 1:15, 3. Cyril Despres (FRA/KTM) 6:07, 4. Ruben Faria (POR/ KTM) 13:34, 5. Jordi Viladoms (ESP/Husqvarna) 13:36, 6. Alessandro Botturi (ITA/Husqvarna) 14:00, 7. Jakub Przygonski (POL/KTM) 19:00, 8. Javier Pizzolito (ARG/Honda) 25:45.

Olivier Pain, juga di atasYamaha, terpaut satu menit 09 detik di belakang tapi tetap di puncak klasemen dengan celah waktu satu menit 15 detik. Lomba tahapan keenam berlangsung sepanjang 313 kilometer dari Arica ke Calama. PT W-Standard Indonesia Sementara itu, perusahaan

asal Indonesia yaitu PT WStandard Indonesia turut menjadi sponsor salah satu tim yang berlaga di ajang Reli Dakar 2013. PT W-Standard Indonesia mensponsori tim Can-AM di kelas ATV dengan pebalap Daniel Mazzucco dalam reli padang pasir yang dimulai pada 5 Januari hingga 20 Januari tersebut. (rzl/ant/afp)

A7

Sport

WASPADA Jumat, 11 Januari 2013

Suimin Belum Puas Menang 3-0 MEDAN (Waspada): Suimin Diharja mengakui belum puas karena belum bisa menuntaskan pencarian skuad terbaiknya untuk kompetisi Divisi Utama 2012-2013. Dalam ujicoba melawan PSAD, Kamis (10/1), PSMS Medan menang 3-0 melalui gol M Affan Lubis, Novianto, dan Aun Carbiny. “Masih banyak pekerjaan rumah yang harus dikerjakan,” aku pelatih PSMS Liga Indonesia (LI) tersebut seusai pertandingan di lapangan Yon Zipur I, Jl Kapten Muslim Helvetia Medan. Disebutkan, pemain sudah menjalani 40 persen pola latihan yang sebelumnya diterapkan. Suimin juga mengaku ujicoba tersebut ditargetkan untuk memperoleh starting line-up untuk kompetisi nanti. Hingga kini, baru enam pemain yang didapat Suimin. Asisten Pelatih Suharto menyebutkan hal senada. Suharto

mengaku masih membutuhkan beberapa game lagi untuk menuntaskan pemain dalam starting eleven. Melawan PSAD, Suharto mendapatkan hal penting dalam mencari pemain terbaik, termasuk beberapa evaluasi penting, seperti kekurangan di sektor depan atau kolektivitas tim yang membaik. “Kita masih kurang di lini depan dan second striker, kita harus membenahi itu secepatnya,” sambung Suharto menambahkan pressure pemain dan finishing sudah menunjukkan peningkatan. PSMS kembali akan menggelar ujicobanya melawan PS Putra Mencirim pada Minggu (13/1). Suimin kembali akan menjadikannya ajang mencari skuad terbaiknya. (m18)

Syakir Resmi Persiba BANDA ACEH (Waspada): Gelandang muda masa depan Aceh, Syakir Sulaiman (foto), resmi diikat klub Indonesian Super League (ISL), Persiba Balikpapan. Kontrak berdurasi satu musim pun digenggam mantan pemain PSSB Bireuen dan Persiraja Banda Aceh ini. “Alhamdulillah Bang, Sabtu (12/1) besok saya sudah bergabung dengan Persiba,” kata Syakir kepada Waspada saat latihan ringan di Stadion H Dimurthala, Banda Aceh, Kamis (10/1). Sejatinya, kata Syakir, dia sudah bergabung dengan Arif Kurniawan cs sebelum laga Persiba kontra Pelita Bandung Raya di Stadion Si Jalak Harupat, Kamis (10/1). Namun, penerbangan penuh dan dirinya baru mendapat seat pesawat Sabtu pagi. Berlabuhnya Syakir ke skuad Beruang Madu tak terlepas dari andil pelatihnya di Persiraja. Pasalnya, Herry Kiswanto yang kepincut dengan talenta pria kelahiran Bireuen 30 September 1992 ini. Herkis juga mem-

Waspada/Arianda Tanjung

GELANDANG PSMS M Affan Lubis (tengah) berupaya melepaskan diri dari hadangan pemain PSAD dalam laga ujicoba di lapangan Yon Zipur I, Kamis (10/1).

Andik Batal Datang MEDAN (Waspada): Pemain Tim Nasional pada sesi latihan di Stadion Mini USU, Kamis (10/ 1), diikuti 20 dari 56 pemain yang dipanggil dalam persiapan Pra Piala Asia 2015. Andik Vermansyah yang dijadwalkan tiba di Medan, batal hadir. Pelatih Nilmaizar mengakui pemain Persebaya Surabaya yang dipanggil mengikuti program Pelatnas Pra Piala Asia 2015, sejatinya tiba di Medan, Kamis malam. Namun pemain Bajul Ijo yang hadir hanya Taufik dan Endra Prasetya.

Nil mengaku tidak mengetahui alasan Andik belum bergabung dengan rekan-rekannya. Namun mantan pelatih Semen Padang itu optimis pemain yang tengah lagi “naik daun” ini tetap mengikuti Pelatnas di Medan. Diakui ada penambahan jumlah pemain yang dipanggil. Dari 51 nama, kini bertambah menjadi 56 pemain. Mereka yang dipanggil di antaranya Ortisan Salossa (Persipura Jayapura), Yonas Magai (PS Persipura), Mario Alberto Aibekop (PSBS Baik), dan Nopendi (Per-

siba Bantul). Minimnya kehadiran pemain Timnas di Medan bukan hanya mendapat perhatian dari masyarakat, namun juga pelatih sepakbola asal Sumut. Sakino Nugroho, mantan pelatih Medan Jaya, mengakui Nilmaiar belum dapat penuh menjalani program tanpa skuad lengkap. “Jadi Nilmaizar hanya dapat menerapkan latihan small game. Namun, saya yakin program dapat dijalankan setelah 13 Januari saat seluruh pemain sudah hadir,” katanya. (m18)

Pacuan Kuda Meriahkan HUT Bener Meriah Waspada/Munawardi Ismail

boyongnya membela Laskar Rencong musim lalu di pentas Indonesian Premier League. Syakir tampil impresif saat membawa Aceh FC menjuarai Piala Gubernur Aceh 2012 pada 22 Desember lalu. Dia menjadi ruh permainan tim racikan Effendi HT. Selain Syakir, Herkis juga memboyong dua pemain Persiraja lainnya, yakni Yudi Khoeruddin dan Arif Kurniawan. (b07)

REDELONG ( Waspada): Ratusan kuda dari tiga kabupaten di Aceh bersaing dalam ajang pajuan kuda tradisional di Lapangan Sengeda, Bener Meriah, 9-13 Januari 2013. Ketiga kabupaten yang ambil bagian adalah Bener Meriah dengan 96 ekor kuda, Aceh Tengah (86), dan Gayo Lues (41). “Event ini digelar dalam rangka memeriahkan HUT Ka-

bupaten Bener Meriah ke-9, yang jatuh tepat pada 9 Januari 2013,” ujar Panitia Pelaksana, Abd Rahman, Kamis (10/1). Dikatakan, perlombaan ini mempertandingkan 35 ronde per hari, di mana sejumlah empat ekor kuda dilepas dalam setiap rondenya. Dalam perlombaan ini, panitia menyediakan hadiah total senilai Rp125 juta. “Untuk babak semifinal dan

final akan berlangsung Sabtu (12/1) dan Minggu (13/1),” ucap Abd Rahman sembari menyebut ajang ini sebelumnya dibuka resmi oleh Bupati Bener Meriah, Ruslan Abd Gani. Juga digelar turnamen catur tingkat pelajar SLTP dan SLTA. Turnamen catur digelar satu hari penuh pada Jumat (11/1) ini yang akan diikuti sekira 60 pelajar. (cb09/b33)

Devi Bangga Ikut VMTA 2013 MEDAN (Waspada): Visit Medan Trail Adventure 2013 yang menempuh perjalanan Medan-Bukit Lawang pada 1213 Januari ini akan turut dimeriahkan sejumlah kroser wanita. Devi Alviani (foto) salah satu kroser wanita yang siap ambil bagian dalam event berskala nasional itu. Mahasiswi jurusan hukum Universitas Islam Kediri ini mengaku senang bisa kembali mengunjungi Sumut, khususnya Kota Medan. “Ini kedua kalinya saya di Sumatera Utara setelah sebelumnya pernah mengikuti adventure extreme di Danau Toba,’’ ujar Devi yang mengaku trek di daerah Sumatera Utara bagus buat adventure dan sarat tantangan. “Saya bangga sekali bisa tampil di event kali ini, Mas. Apalagi trek Medan-Bukit Lawang saya dengar dari teman-teman sangat bagus dan penuh tantangan,” sebut dara cantik berusia 20 tahun ini dengan logat khas Jawa. Ditambahkan, olahraga sepeda motor telah ditekuninya sejak tiga tahun silam. Meski mengaku belum pernah ke Bukit

Waspada/Surya Efendi

Lawang, Devi memiliki feeling lokasi tersebut pasti sangat menarik. “Saya pasti akan datang lagi setelah ini,’’ sebut wanita yang memiliki sepeda motor Kawasaki KLX 150 dan akan mengendarai motor KTM pada adventure Medan-Bukit Lawang. Menurut rencana, Visit Medan Trail Adventure 2013 akan diikuti dan dilepas Wali Kota Medan, Drs H Rahudman Harahap MM, di Jl Pulau Pinang, Lapangan Merdeka Medan, Sabtu (12/1) besok. (m46)

Sri Kembali Pimpin NPCI Binjai BINJAI (Waspada): Sri Rahayu kembali terpilih menjadi Ketua National Paralympic Committee Indonesia (NPCI) Kota Binjai periode 2012-2017 dalam Musyawarah Cabang di Kantor KONI Binjai, Kamis (10/1). Sri kembali dipercaya menduduki jabatan tersebut setelah terpilih secara aklamasi. Selanjutnya, Sri diberi waktu untuk membentuk personalia kepengurusan bersama anggota tim

formatur. Muscab NPCI Binjai dibuka resmi Kadis Pariwisata dan Olahraga Binjai, Eka Edy Saputra, dan dihadiri Ketua KONI Binjai H Juli Sawitma Nasution. Seusai terpilih, Sri mengatakan dalam Pekan Paralympic Nasional (Peparnas) 2012 di Riau, atlet Binjai berhasil meraih 4 medali emas, 4 perak, dan 1 perunggu bagi Sumut. (a04)

Problem Catur

TTS TOPIK

MENDATAR

Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1 A

B

C

D

E

F

MIMBAR JUMAT

G

H

1. Tidak mempunyai apa-apa untuk menutupi kebutuhannya dan tidak meminta-minta ke sana ke mari. 4. Orang yang meminta-minta ke sana ke mari kepada orang banyak (orang seperti ini bukan miskin menurut HR Muslim). 9. Orang-orang yang lemah (ekonominya dsb). 10. Pemberian sesuatu kepada fakir miskin atau yang berhak di luar kewajiban zakat dan zakat fitrah. 11. Baik (perbuatan dsb). 12. Malu; Cela. 13. Kemudian hari; Kerabat. 15. Singkatan Kiai Haji. 16. Menyerah(kan) sepenuhnya (kepada Tuhan). 18. Al-_______, ummul Quran. 19. Perbuatan baik mendatangkan pahala. 20. Pemeriksa; Inspektur; Penyampai berita duka. 22. Singkatan Alaihis-salam. 24. Pemimpin (pada shalat berjamaah); Kepala (negeri dsb). 26. Wudu; Membersihkan sebagian anggota badan sebelum shalat. 28. Keputusan yang diberikan oleh mufti tentang suatu masalah. 29. Huruf ke-18 abjad Arab. 30. Perbuatan hina bersanggama bukan suami istri.

31. Nazar; Fatwa. 32. Al-______, (Pengumpat) surat ke 104 Al Quran. 33. Pengembara.

MENURUN

1. Produksi lebah sebagai obat. 2. Pengakuan lisan dua kalimat. 3. Kepanjangan “im” dari imtaq: ____dan takwa. 5. Perluasan wilayah negara dengan menduduki wilayah negara lain (dalam sejarah Islam ada lima babak/tahap). 6. Nama peristiwa penetapan Ali sebagai wali oleh Nabi Muhammad SAW sekembali dari haji wada’. 7. Kotanya Ka’bah. 8. Sahabat; Pemilik. 11. Kafir (bahasa Aceh). 13. Kain pembungkus mayat. 14. Maskawin. 15. _____bin Walid, panglima perang yang disebut Saifullah. 17. Alam semesta. 21. Air yang dibawa para jamaah haji dari Makkah. 22. Surat ke-95 Al Quran. 23. Singkatan Sallallahu Alaihi Wa Salam. 25. Orang yang baru masuk Islam. 27. Saat tertentu; Tempo. 28. Tidak kekal: Segala yang ada di dunia___ belaka.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan dalam waktu kurang dari 20 menit. Jawabannya lihat di halaman A2 kolom 1.

3 9 5

5 6

8

3 8 7

1 7 8 5 7 6 1 5 9 3 5

2

1

6 7 3 1

5 2

*****41

A8

Sport

Radwanska Tanpa Cela

SYDNEY, AS (Waspada): Petenis peringkat empat dunia, Agnieszka Radwanska (foto), berhasil mengawali tahun 2013 dengan meraih tiket final turnamen Apia International di Sydney Olympic Park, Kamis (10/1). Petenis asal Polandia itu mengalahkan andalan China, Li Na, 6-3, 6-4. Pertarungan antara Radwanska, juara di Auckland, Selandia Baru, pekan lalu, melawan Li Na yang sukses di Shenzhen pekan lalu,berlangsungketatdanmenarik. Dengan kemenangan itu, Radwanska berhasil membalas tiga kekalahan dari Li Na musim laludiMontreal(Kanada),Cincinnati (AS), dan Beijing (China). “Ini seperti sebuah pengulangan dari final Auckland, di mana saya rasa juga mendapatkan tujuh atau delapan match

point sebelum akhirnya menang,� ungkap Radwanska yang mengaku bahagia melaju ke final. Rekor delapan kemenangan beruntun petenis yang akrab disapa Aga itu sekaligus membuktikan diri patut diperhitungkan jelang grand slam pertama tahun ini, Australia Terbuka. Di final, Radwanska akan berhadapan dengan Dominika Cibulkova. Petenis Slovakia tersebut dipastikan menjadi penantang Aga di partai puncak, setelah mengalahkan Angelique Kerber. Melawan petenis Jerman itu, Cibulkova menang 6-2, 4-6, 63.Alhasil,Cibulkovamemilikisatu kesempatan untuk menambah pundi-pundi gelarnya. Hingga sekarang, petenis berusia 23 tahun itu baru mengoleksi dua gelar WTA. (m33/ap)

Kejutan Kido/Pia SEOUL (Waspada): Ganda campuran Indonesia, Markis Kido/Pia Zebadiah, melaju ke perempatfinal KoreaTerbuka Super Series Premier 2013, usai menang di babak kedua, Kamis (10/1). Sayangnya, hal tersebut gagal diikuti Muhammad Rijal/Debby Susanto yang takluk dari duet tuan rumah. Tampil di SK Handball Stadium, Seoul, Kido/Pia menang atas Peng Soon Chan/Liu Ying Gooh melalui pertarungan selama 58 menit. Unggulan ketiga asal Malaysia disingkirkan 12-21, 21-15, 21-13. Pada awal set pertama, kedua pasangan sempat sama kuat. Namun, Chan/Gooh terus menunjukkan dominasinya hingga menutup game 21-12. Enggan tersingkir lebih dini, Kido/Pia tampil lebih agresif pada set kedua, hingga menang 21-15. Di set penentuan, Kido/Pia tampil lebih solid dan menang 21-13 . Sementara itu, Rijal/Debby gagal melaju ke perempatfinal lantaran ditundukkan pasangan Korea, Ki Jung Kim/ Kyung Eun Jung. Sempat memberi perlawanan ketat, Rijal/Debby gagal menjaga konsistensi hingga tumbang 20-22, 14-21. Sebaliknya,Tontowi Ahmad/ Liliyana Natsir mendampingi Kido/Piaberkatkemenanganatas Kenichi Hayakawa/Misaki Matsutomo. Pasangan Jepang itu disingkirkan unggulan kedua asal Indonesia tersebut 6-21, 11-21 dalam tempo 21 menit. Di tunggal putra, Soni Dwi Kuncoro merebut kemenangan keduanya. Setelah mengalahkanBoonsakPonsana(Thailand), babakkeduadilewatiSonydengan kemenangan atas Yong Zhao Ashton Chen (Singapura) 21-14,

21-13. Ganda putri ditandai kegagalan dua wakil tersisa, yakni Aprilsasi Putri/Vita Marissa dan Meiliana Jauhari/Greysia Polii. April/Vita, pasangan debutan, gagal membuat kejutan setelah tersandung di tangan unggulan keempat Kyung Eun Jung/Ha Na Kim asal Korsel 14-21, 12-21. Di lain pihak, Meiliana/ Greysia dikalahkan Misaki Matsutomo/Ayaka Takahashi. Unggulan ketiga asal Jepang itu mengakhiri laju Meiliana/Greysia dengan kemenangan rubber-set 20-22, 21-8, 21-5. (m33/tsw)

AP

WASPADA Jumat, 11 Januari 2013

Medan Metropolitan

WASPADA Jumat 11 Januari 2013

B1

Polsek Sunggal Bongkar Sindikat Curanmor MEDAN (Waspada): Tim Khusus (Timsus) Reskrim Polsek Sunggal membongkar sindikat pencurian kendaraan bermotor (curanmor) antar provinsi. Dalam penyergapan yang dilakukan secara terpisah, Kamis (10/1), polisi berhasil menangkap tujuh tersangka. Informasi yang diperoleh Waspada di lapangan, para tersangka yang ditangkap yakni, BS, 25, penduduk Pulo Brayan; OK. MKA, 27, (PNS) penduduk Jln. Gatot Subroto, Kelurahan Sei Sikambing C, Kecamatan Medan Helvetia; Rdn, 26, penduduk Jln. Setia, Kelurahan Tanjungrejo, Kecamatan Medan Sunggal; SS, 35, penduduk Jln. Murni, Kelurahan Tanjungrejo, Kecamatan Medan Sunggal; BF, 26, penduduk Jln. Abadi, Kelurahan Tanjungrejo, Kecamatan Medan Sunggal; Rn, 52, penduduk Jln. Abadi, Kelurahan Tanjungrejo, Kecamatan Medan Sunggal. Dari para tersangka, polisi menyita barang bukti berupasepedamotorKawasakiNinja BK 6991 BF dan kunci letter T. Sedangkan tersangka HS, 29, penduduk Jln. Lembaga Pemasyarakatan, Tanjunggusta ditangkap di sebuah rumah Jln. Setiabudi Medan. Selain menangkap tersangka HS, polisi menyita dua sepedamotor, sejumlah spare parts sepadamotor, belasan plat BK dan lainnya. Kapolsek Sunggal Kompol M. Luther Dachi, SH, SSos didampingi Kanit Reskrim Iptu Bambang Gunadi Hutabarat, SH, MH dan Panit Reskrim Aiptu G Manalu, SH mengatakan, terbongkarnya sindikat curanmor tersebut bermula ketika polisi melakukan operasi hunting di kawasan Ringroad, Medan Sunggal. Saat itu, tersangka OK. MKA ditangkap karena mengendarai sepedamotor tanpa dilengkapi dokumen kendaraan. Kemudian, polisi melakukan pengembangan dan menangkap tersangka berinisial BS. Setelah itu, polisi menciduk tersangka Rdn, SS, BF, Rn. Ketika diinterogasi, tersangka BS mengaku sudah lebih tujuh kali melakukan pencurian sepedamotor di Medan. Seluruh sepedamotor hasil curian tersebut dijual ke Aceh. Sementara tersangka HS mengaku sudah belasan kali melakukan pencurian sepedamotor di wilayah hukum Polresta Medan. Sepedamotor yang

Waspada/Ismanto Ismail

KANIT Reskrim Polsek Sunggal Iptu Bambang Gunadi Hutabarat, SH, MH (kiri) dan Panit Reskrim Aiptu G Manalu, SH (kanan) menginterogasi tersangka kasus curanmor dan kasus narkoba di halaman Mapolsek tersebut, Kamis (10/1) sore. dicuri tersebut dijual kepada penadah di Medan dan Aceh. Polsek Medan Kota Sebelumnya, Polsek Medan Kota menangkap empat tersangka curanmor dari kawasan Jln. Pintu Air I Gg. Langgar. Keempat tersangka yakni Sy, 29, warga Jln. Brigjen Katamso Gg. Kenanga; BN, 26, warga Jln. Brigjen Katamso Gg. Indra; ZA, 19, warga Jln. Pintu Air I dan AW, 17, warga Jln. Pintu Air. Kapolsek Medan Kota Kompol Sandy Sinurat mengatakan kepada wartawan, Rabu (9/1), dari keempat tersangka disita tiga sepedamotor yakni Mio Sporty merah BK 5369 LD, Mio Soul merah BK 2632 ABG dan Smash hitam biru tanpa nomor polisi. “Penangkapan keempat tersangka bermula dari informasi masyarakat. Kemudian, polisi menindaklanjutinya hingga dilakukan penggerebekan,” ujarnya. Berdasarkan hasil pemerik-

saan, kata Sandy, tersangka berdalih hanya meminjam sepedamotor. Setelah didalami, ternyata mereka bermaksud menjual sepedamotor tersebut. “Sepedamotor Mio Sporty merah tidak sesuai dengan nomor rangka yang tertera di STNK,” katanya seraya menambahkan keempat tersangka dikenakan pasal 372, 363 sub 480 KUHPidana. Sandy mengimbau pemilik sepedamotor Mio Sporty BK 5369 LD agar datang ke Mapolsek Medan Kota dengan membawa surat-surat kendaraannya. Sedangkan tersangka Sy mengatakan, sepedamotor Mio Sporty itu merupakan barang gadaian dari tetangganya Ragil, warga Jln. Brigjen Katamso Gang Kuali. “Dia (Ragil) menggadaikan sepedamotor itu ke saya Rp500 ribu dengan alasan sakit,” sebutnya. Narkoba Di tempat terpisah, Polsek

Sunggal menangkap dua tersangka yang menyimpan satu bungkus ganja dalam gulungan uang kertas pecahan Rp2.000, Rabu (9/1) malam. Tersangka yang menyimpan ganja di celana dalamnya ini, ditangkap di kawasan Ringroad, Medan Sunggal. Kedua tersangka yakni H, 25, dan Hsd, 23, penduduk Jln. Bunga Asoka, Gg Bersama, Kelurahan Asam Kumbang, Kecamatan Medan Selayang. Kapolsek Sunggal Kompol M Luther Dachi, SH, S.Sos, didampingi Kanit Reskrim Iptu Bambang Gunadi Hutabarat, SH, SH dan Panit Reskrim Aiptu G. Manalu, SH mengatakan, awalnya polisi menghentikan tersangka yang mengendarai sepedamotor. Ketika dihampiri, tersangka H berusaha melarikan diri. Namun polisi berhasil menangkap tersangka. Saat digeledah, polisi menemukan daun ganja yang disimpan di celana dalam

dan satu batang rokok bercampur daun ganja. Tersangka H mengaku membeli daun ganja seharga Rp5.000 untuk dipakai sendiri. Dalam kasus itu, kedua tersangka dijebloskan ke dalam tahanan Mapolsek Sunggal. (m36/m27)

Medan Metropolitan Dua Kubu Umat Islam Nyaris Bentrok

B2

WASPADA Jumat 11 Januari 2013

PT. Jatimasindo Gagal Mematok Lahan Pembangunan Masjid MEDAN (Waspada): Lambannya proses hukum yang dilakukan Polresta Medan atas kasus perubuhan Masjid Raudhatul Islam, telah menimbulkan masalah baru. Kini, umat Islam yang terpecah menjadi dua kubu dengan membawa nama organisasi masing-masing, nyaris terlibat bentrok. Kericuhan itu terjadi ketika pihak PT. Jatimasindo hendak mematok lahan untuk pembangunan masjid baru di Jln. H Adam Malik Gg. Peringatan, Kelurahan Silalas, Kecamatan Medan Barat, Kamis (10/1). Pantauan Waspada di lapangan, peristiwa itu bermula ketika pihak PT. Jatimasindo

mengikutsertakan massa yang mengenakan atribut Perguruan Tapak Suci dan Komando Kesiapsiagaan Muhammadiyah Sumatera Utara. Mereka datang ke lokasi dan hendak melakukan pematokan lahan untuk pembangunan masjid baru. Sekira pukul 10:00, massa yang mengenakan atribut Perguruan Tapak Suci dan Komando Kesiapsiagaan Muhammadiyah Sumatera Utara serta sejumlah aktivis mahasiswa terlihat berkumpul di pos sekuriti perumahan belakang Hotel Emerald Garden. Mereka membawa berbagai perlengkapan untuk melakukan pematokan lahanpembangunanmasjidbaru. Sementara, massa dari Aliansi Ormas Islam Sumatera Utara bersama sejumlah ja-

maah dan pengurus Badan Kemakmuran Masjid (BKM) Raudhatul Islam berkumpul di sekitar Masjid Raudhatul Islam. Rencananya, pihak PT. Jatimasindo akan membangun masjid baru yang berlokasi sekira 100 meter dari lokasi Masjid Raudhatul Islam yang telah dihancurkan pengembang tersebut beberapa tahun silam. Sebelum dilakukan pematokan lahan, dilaksanakan pertemuan antara pihak PT Jatimasindo diwakili Drs. Anwar Bakti dengan pengurus Aliansi Ormas Islam dan BKM Raudhatul Islam di dalam masjid tersebut. Aliansi Ormas Islam diwakili Ustadz Indra Suheiri dan Drs. Leo Imsar Adnan, Murwinto dari BKM Raudhatul Islam dan Indra Syafeii dari Persaudaraan

Pekerja Muslim Indonesia. Pertemuan yang berlangsung selama dua jam itu, tidak membuahkan hasil. Kedua belah pihak tetap bertahan dengan pendiriannya masing-masing. “Masjid Raudhatul Islam berstatus wakaf dan tidak bisa dipindahkan kecuali demi kepentingan umum. Namun, perubuhan masjid yang dilakukan PT Jatimasindo ternyata untuk kepentingan bisnis pengembang dan bukan kepentingan umum. Karena itu, kami membangun kembali Masjid Raudhatul Islam di tempat semula,” tegas Ketua Umum Aliansi Ormas Islam Sumut Drs. Leo Imsar Adnans. Kini, tambah Leo Imsar, Aliansi Ormas Islam dan BKM Raudhatul Islam telah mem-

bangun kembali masjid yang telah dihancurkan oleh pengembang kapitalis tersebut. Upaya adu domba Sementara Ustadz Indra Suheiri menilai, pembangunan masjid baru yang letaknya berdekatan dengan Masjid Raudhatul Islam merupakan upaya adu domba yang dilakukan oknum tertentu terhadap umat Islam. “Pembangunan masjid baru tersebut merupakan upaya adu domba terhadap sesama umat Islam. Dalam hal ini, pihak pengembang berhasil mempengaruhi oknum-oknum tertentu. Padahal, sebelumnya oknum tersebut termasuk orangorang yang giat memperjuangkan pembangunan kembali Masjid Raudhatul Islam. Kini,

oknum tersebut telah berpaling dan berpihak kepada PT Jatimasindo,” kata Ustadz Indra Suheiri. Guna mencegah terjadinya hal-hal yang tidak diinginkan, Ustadz Indra Suheiri meminta Kapolresta Medan segera mengusut tuntas kasus perubuhan Masjid Raudhatul Islam dan Masjid Al Kahiriyah yang telah dilaporkan sejak beberapa tahun lalu. Sampai saat ini, kasus perubuhan kedua masjid tersebut belum juga dilimpahkan ke pengadilan. Sementara itu, pengurus BKM Raudhatul Islam Murwinto menjelaskan, pihaknya tetap membangun kembali masjid yang telah dirubuhkan itu dengan swadaya umat Islam dan para jamaah. “Saat ini, Masjid Raudhatul Islam tetap dalam

pembangunan kembali,” tegasnya. Usai pertemuan tersebut, massa Aliansi Ormas Islam dan BKM Raudhatul Islam tetap bertahan di sekitar masjid. Sedangkan massa dari PT Jatimasindo yang mengenakan atribut Perguruan Tapak Suci dan Komando Kesiapsiagaan Muhammadiyah berkumpul di pos sekuriti komplek perumahan. Awalnya, massa dari pihak pengembang ini hendak melintas di depan masjid menuju lahan yang akan digunakan sebagai lokasi pembangunan masjid baru. Namun kedatangan mereka dihadang oleh massa dari Aliansi Ormas Islam yang bertahan di halaman depan Masjid Raudhatul Islam. Sempat terjadi ketegangan, namun sejumlah

personel dari Polsek Medan Barat berhasil mengendalikan situasi Salah seorang pengurus Forum Komunikasi Aktivis Masjid Sumut sangat menyayangkan adanya organisasi seperti Perguruan Tapak Suci dan Komando Kesiapsiagaan Muhammadiyah Sumatera Utara yang dimanfaatkan untuk mengawal pematokan lahan baru pembangunan masjid tersebut. “Kami sangat mengharapkan adanya klarifikasi dari pengurus Muhammadiyah apakah kehadiran massa dengan atribut Perguruan Tapak Suci dan Komando Kesiapsiagaan Muhammadiyah Sumatera Utara ini secara resmi diketahui pengurus Muhammadiyah atau tidak,” ujar aktivis tersebut.(h04)

Satu Lagi Sepedamotor Milik Perampok Ditemukan MEDAN (Waspada): Tim Khusus (Timsus) Reskrim Polsek Medan Baru kembali menemukan sepedamotor Yamaha Jupiter MX warna biru tanpa memakai plat yang dipergunakan perampok sadis bersenjata kelewang, dari rumah kosong di Jln. KaryaVII, Tanah Garapan, Kec. Sunggal, Delisergang, Kamis (10/1) siang. Sebelumnya juga polisi telah menyita sepedamotor Yamaha Jupiter warna merah tanpa plat BK keadaan ringsek yang dipakai dua anggota komplotan perampok yang tewas akibat ditabrak korbannya. Kedua sepedamotor yang sudah diamankan itu adalah kendaraan yang dipergunakan komplotan perampok sadis berkelewang itu melakukan kejahatan. Sehari sebelumnya Rabu (9/ 1), petugas menemukan sepedamotor Yamaha Mio bodong diduga hasil kejahatan dari

kawanan perampok bersenjata kelewang itu, dari semak-semak tidak jauh dari lokasi tempat tinggal kawanan perampok di Jln. Karya VII, Tanah Garapan, Desa Helvetia, Deliserdang. Informasi Waspada peroleh di lokasi penemuan sepedamotor, Tim Khusus (Timsus) Reskrim Polsek Medan Baru dipimpin Kanit Reskrim AKP Andik Eko Siswanto SH, dibantu Panit Reskrim Ipda Sehat Tarigan SH, bersama Kades dan Kadus melakukan penyisiran sejumlah rumah diduga tidak ada penghuninya. Berdasarkan informasi dari masyarakat, petugas langsung menggerebek salah satu rumah di Jln. KaryaVII, Tanah Garapan, Desa Helvetia, Deliserdang, ditemukan sepedamotor Yamaha Jupiter MX warna biru pada bagian depan dan belakang ringsek akibat ditabrak mobil korbannya. Selanjutnya, sepe-

Dua Oknum Sabhara Diperiksa Propam Poldasu MEDAN (Waspada): Propam Polresta Medan menyerahkan dua oknum anggota Sabhara yang diduga terlibat pelecehan seksual ke Propam Poldasu untuk menjalani pemeriksaan, Kamis (10/1). Kedua oknum polisi tersebut yakni Briptu HS dan Briptu MWS dibawa ke Poldasu dikawal Kasi Propam Polresta Medan AKP Beno Sidabutar dengan tuduhan menelanjangi Anak Baru Gede (ABG) saat dalam mobil di Jalan Ring Road, Minggu (6/1) malam. “Mereka kita bawa ke Propam Polda untuk dimintai keterangan oleh penyidik,” kata AKP Beno Sidabutar. Menurutnya, pemeriksaan kedua oknum polisi ini dilakukan oleh pihak Propam Polda Sumut. Diprosesnya kedua oknum polisi ini di Propam Polda Sumut, karena korbannya membuat pengaduan kesana. “Korbannya buat laporan ke Polda, jadi diproses disana,” ujarnya. Ditanya mengenai hukuman yang diberikan kepada kedua oknum polisi ini, Beno Sidabutar belum dapat memastikannya. “Belum tahu, pimpinan sidang nanti yang menentukannya,” sebutnya. Kata Beno, hukuman Pemberhentian Tidak Dengan Hormat (PTDH) terhadap kedua polisi tersebut menunggu putusan sidang pidananya. “Kalau hukumannya diatas 3 bulan, maka akan di PTDH,” tuturnya. Dikonfrontir Sementara itu, Kasubdit IV Reknata (Remaja Anak danWanita) Direktorat Reskrimum Polda Sumut AKBP Juliana akan mengkonfrontir antara korban dan pelaku, untuk membuktikan kebenaran atas kasus yang melibatkan personel Sabhara Polresta Medan ini. Sebab antara korban dan pelaku memiliki argumen yang menyatakan pembelaan diri. ”Pihak pelapor dan terlapor akan dikonfrontiruntukmengetahuikejadianyangsebenarnya,”ujarJuliana. Hingga kemarin, kata Juliana, pihaknya telah memintai keterangan sejumlah saksi termasuk orangtua korban yang telah melaporkan kasus itu ke Polda Sumut. Menurut dia, kedua anggota Sabhara Polresta Medan Briptu MWS dan Briptu HS juga telah diperiksa Bidang Profesi dan Pengamanan (Bid Propam) Polda Sumut. Jika dalam proses penyidikan benar sesuai dengan yang dilaporkan pihak korban, maka kedua anggota kepolisian tersebut terancam 15 tahun penjara.“Briptu MWS dan Briptu HS disangkakan dengan Pasal 335 Undang Undang Perlindungan Anak No. 23 tahun 2002 dengan ancaman hukuman 15 tahun,” sebutnya. Sebelumnya, dua anggota Sabhara Polresta Medan yakni Briptu MWS dan Briptu HS diduga melakukan pelecahan seksual terhadap dua pelajar SMA di Medan, yakni D, penduduk Jalan Sunggal, dan A, penduduk Jalan Sei Padang. Kedua korban mengaku diminta menanggalkan pakaian di Jalan Ringroad, Minggu (6/1) malam. Kemudian keduanya dibawa ke Mako Satuan Sabhara Polresta Medan hanya mengenakan pakaian dalam dan tangan diborgol. (m39/m27)

Aceh Sepakat Cabang II Serahkan Bea Siswa MEDAN (Waspada): Aceh Sepakat Cabang II Medan, kembali menyerahkan Rp14 juta bea siswa kepada para siswa/siswi berprestasi di Medan. “Penyerahan bea siswa kali ini kepada 11 siswa/i Mifthahussalam,” kata Ketua DPC II Aceh Sepakat Medan HM Husni Mustafa SE, di sekretariat Jln. Mangakara Medan, Kamis (10/1). Menurut dia, penyerahan bea siswa sudah dilaksanakan kepada ke 11 siswa/i di antaranya enam siswa/i SMA, satu siswa Madrasah Aliyah, satu siswa SMK, dua pelajar SMP (Mifthahussalam) dan satu mahasiswa Universitas Cut Nyak Dhien. Pada penyerahan bea siswa itu hadir Wakil Ketua DPC II Aceh Sepakat H Armen R Yusuf, Sekretaris T Munthadar, Wakil Sekretaris Irsan ST, dan Imam Masjid Tgk. Sulaiman. Kata Husni, penyaluran bea siswa itu merupakan lanjutan dari tahun sebelumnya yang juga diberikan kepada anak-anak berprestasi dari keluarga kurang mampu. Selain itu, tambah Munthadar, Aceh Sepakat Cabang II telah menyalurkan zakat produktif untuk pelaku usaha mikro dan kecil bagi pengembangan usahanya. Pihaknya juga memberi bantuan sosial kepada pasien yang tidak mampu berobat, total zakat yang disalurkan mencapai Rp41 juta. (m32)

damotor itu dibawa ke Mapolsek Medan Baru. Kapolsek Medan Baru Kompol Jean Calvijn Simanjuntak SH, SIK, MH mengatakan, pihaknya sedang melakukan pemeriksaan terhadap sepedamotor milik perampok. Sedangkan timsus hingga kini terus memburu seorang kawanan perampok sadis bersenjata kelewang berinisial HS diduga yang mengendarai sepedamotor Yamaha Jupiter MX warna biru tersebut. Sebelumnya diberitakan, kawanan perampok sadis berkelewang yang telah berulangkali beraksi di Medan, dilumpuhkan korbannya sete-

lah dua kendaraan mereka ditabrak mobil korban yang melakukan pengejaran di Jln. Sudirman depan Hotel Polonia Kamis (3/1) dinihari pukul 03:00. Akibatnya, dua anggota kawanan perampok sadis warga Jln. Karya VII, Tanah Garapan, Desa Helvetia, Kecamatan Sunggal, Deliserdang, tewas yakni Dony Gultom alias Joni Gultom, 25, dan Ronald Sitepu, 16. Sedangkan dua lagi menderita luka berat yakni Josua Purba, 26, menjalani perawatan di ruang ICU RS Bhayangkara Poldasu dan Dapot Hutauruk, 16, (patah tangan kiri) mendekam di ruang tahanan polisi di RS Bhayangkara Poldasu. (m36)

Waspada/Ismanto Ismail

PANIT Reskrim Polsek Medan Baru Ipda Sehat Tarigan SH (kanan) memperlihatkan bagian belakang sepedamotorYamaha Jupiter MX warna biru penyot ditabrak mobil korban.

Korupsi Pengadaan Truk

Dua Kali Diperiksa Tidak Ditahan

Mantan Bupati Palas Kabur Mantan Kadishub Samosir MEDAN (Waspada): Polda Sumut akhirnya “kecolongan”, setelah mantan Bupati Padang Lawas (Palas) Basyrah Lubis yang dijadikan tersangka kasus korupsi proyek multi years Palas sebesar Rp6 miliar melarikan diri (kabur). Tersangka diketahui kabur ketika penyidik Tindak Pidana Korupsi (Tipikor) Poldasu hendak menjemput yang bersangkutan di kediamannya untuk dilakukan penahanan. Kaburnya mantan Bupati Palas itu dibenarkan Direktur Dit. Rerkrimsus Poldasu Kombes Pol. Sadono Budi Nugroho. “Saat ini Basyrah Lubis diburon, ada beberapa tempat yang kita curigai sebagai lokasi persembunyiannya, tetapi dia sudah tidak ada. Tim juga sudah mengejar hingga Jakarta di seputaran Mangga Dua, juga tempat-tempat lainnya, tetapi belum berhasil menemukannya,” kata Sadono kepada wartawan, di Mapoldasu, Kamis (10/1). Menurut Sadono, saat tersangka diperiksa Jumat (21/12), dibenarkan pulang dengan jaminan keluarga dan pengacaranya. Kemudian, Rabu (26/12), dia hadir kembali ke Polda untuk pemeriksaan lanjutan, juga

didampingi pengacara Benny Harahap. Namun usai pemeriksaan tersangka kembali dipulangkan dengan alasan untuk melengkapi berkas dan dokumen yang diperlukan. Namun rencana pemeriksaan lanjutan pada Jumat (4/1), Basyrah Lubis tidak hadir dengan alasan sakit. Melalui pengacaranya Benny Harahap, tersangka mengirimkan surat sakit kepada penyidik dan berjanji akan memenuhi panggilan berikutnya setelah sembuh. Disaat itulah kesempatan Basyrah Lubis melarikan diri. Sementara Direktur Dit Reskrimsus Kombes Sadono Budi Nugroho yang di desak wartawan terkait tidak ditahannya Basyrah Lubis, mengatakan tersangka tidak ditahan karena sakit dan minta di opname. Kata Sadono, tim penyidik Subdit III/Tipikor tengah berusaha mencari tersangka yang sudah kabur. Bahkan, kata dia, pemberitahuan keberadaan tersangka juga tidak ada, karenanya Basyrah Lubis diburon. Tetapi Sadono kembali meyakinkan wartawan akan menahan Basyrah Lubis karena dinilai tidak kooperatif. Kasus itu,

menurutnya, ditangani Bareskrim Mabes Polri, Polda Sumut dan Polres Tapsel dengan tersangka Basyrah Lubis, Ketua DPRD Palas HM Ridho Harahap, Kadis PU Ir ChairulWindu, Pejabat Pembuat Komitmen (PPK) Abdul Hamid Nasution, dan Bendahara Umum Daerah Paruhum Daulay. Tetapi Poldasu hanya menangani pemeriksaan Basyrah Lubis dan Ketua DPRD Palas. Sedangkan yang lainnya ditangani Polres Tapsel. Sadono mengatakan, rencananya setelah pemeriksaan Basyrah Lubis rampung, pihaknya segera memeriksa Ketua DPRD Palas, karena surat izin pemeriksaan sudah keluar dari Plt Gubsu. Proyek itu berasal dari Dana Alokasi Khusus dan Dana Alokasi Umum (DAK/DAU) TA 2009 Pemkab Palas, antara lain untuk pembangunan prasarana perkantoran (proyek multi years) yang dibangun di lahan seluas 5 Ha. Berdasarkan audit Badan Pemeriksa Keuangan dan Pembangunan (BPKP) Sumut, kerugian negara sebesar Rp6.048. 827.227,73. Selain itu ada temuan pembayaran alat berat untuk proyek tersebut juga masih menunggak.(m27)

Bulan Ini, Pasar Sukaramai Dibangun MEDAN (Waspada): Pasar Sukaramai mulai dibangun pada bulan ini. Ditargetkan pembangunannya membutuhkan waktu selama 11 bulan dapat dioperasionalkan sebelum akhir 2013. Saat ini, sudah ada investor lokal yang bersedia membangun, kemudian menyerahkannya kepada Pemerintah Kota (Pemko) Medan untuk dikelola PD Pasar. “Dalam bulan ini Pasar Sukaramai akan kita bangun. Investor tersebut akan merancang desainnya hingga membangun pasar keseluruhan dengan dana mereka. Setelah dibangun nanti akan diserahgunakan kepada Pemko Medan. Kerjasamanya dalam bentuk bangun serah guna,” kata Dirut PD Pasar Medan Benni Sihotang kepada Waspada, Kamis (10/1). Benni mengatakan, investor yang bersedia membangun Pasar Sukaramai yakni PT Karsa Maganda. Investor tersebut sudah berpengalaman dalam membangun pasar di seluruh Indonesia. Setelah Pasar Sukaramai dibangun, selanjutnya

sebanyak 732 kios yang ada akan disewakan kepada pedagang dan pengelolaannya diserahterimakan kepada Pemko Medan. “Kita sudah mendata ada sebanyak 732 kios pedagang yang dulu terbakar. Karena itu, investor akan membangun kembali sebanyak 732 kios,” terang Benni. Saat ini, kata Benni, pihaknya sudah mensosialisasikan rencana pembangunan Pasar Sukaramai tersebut dan pedagang menyatakan setuju. Menurutnya, harga sewa kios masih terjangkau oleh pedagang. “Harganya masih terjangkau. Tapi saya lupa rinciannya karena harganya kan berbeda-beda,” jelasnya. Untuk mekanismenya, kata Benni, sebelum Pasar Sukaramai dibangun, maka investor akan membangun pasar penampungan yang berlokasi di kawasan itu juga. Pembangunan pasar penampungan ditargetkan akan selesai selama satu bulan. “Mulai senin (14/1), investor akan membangun pasar

penampungan. Kita targetkan pasar penampungan ini selesai satu bulan dan pembangunan Pasar Sukaramai selesai 10 bulan. Jadi, pengerjaannya kita targetkan 11 bulan, sehingga di akhir tahun sudah bisa dioperasikan,” papar Benni. Wali Kota Medan Rahudman Harahap mengatakan, pihaknya sudah menandatangani kerjasama antara Pemko Medan dan pihak investor yang akan membangun Pasar Sukaramai. Dalam tahun ini, ada tiga pasar yang akan direvitalisasi dengan bantuan dana dari Menperindag. “Nanti dari Deperindag akan ada bantuan dana untuk merevitalisasi tiga pasar tradisional,” terang Rahudman. Tahun 2012, Pusat Investasi Pemerintah (PIP) telah memberikan pinjaman senilai Rp77,4 miliar. Pemberian pinjaman kepada Pemerintah Kota Medan ini ditujukan untuk revitalisasi tiga pasar tradisional yakni Pasar Marelan, Pasar Jawa Belawan dan Pasar Kampung Lalang. (m50)

Divonis 30 Bulan Penjara

MEDAN (Waspada): Mantan Kadis Perhubungan Pemkab Samosir Maringan Simbolon divonis 2,5 tahun (30 bulan) penjara, denda Rp50 juta subsider satu bulan kurungan, karena melakukan tindak pidana korupsi terhadap dana pengadaan empat unit truk. Majelis hakim Pengadilan Tindak Pidana Korupsi (Tipikor) Medan diketuai Muhammad Nur dalam putusannya dibacakan di ruang Cakra IV Pengadilan Negeri (PN) Medan, Kamis (11/1) mengatakan, terdakwa dinyatakan melanggar Pasal 3 UU RI No.31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi jo Pasal 55 KUHPidana. Dalam pertimbangan hakim, di antaranya tidak ditemukan alasan pemaaf bagi terdakwa. Terdakwa tidak mendukung program pemerintah dalam pemberantasan korupsi, dan tindakannya menimbulkan kerugian negara. Sebelumnya Jaksa Penuntut Umum (JPU) menuntut terdakwa Maringan agar dipenjara selama 4,5 tahun (54 bulan), denda Rp200 juta. Sebagaimana diketahui, dalam perkara ini terdakwa Maringan Simbolon, selaku Kadis-

hub Samosir, dalam pengadaan truk itu sebagai Kuasa Pengguna Anggaran (KPA) disinyalir menyetujui pembayaran keempat unit truk yang tidak sesuai kontrak. Sehingga menimbulkan kerugian negara senilai Rp1,083 milliar. Dalam perkara yang sama, majelis hakim telah menjatuhkan vonis 5 tahun penjara terhadap Happy J Silalahi, selaku Direktur I CV Morahi Jaya. Dia divonis dalam perkara korupsi pengadaan truk beranggaran Rp1,2 miliar dari Kementerian Pembangunan Desa Tertinggal untuk Kabupaten Samosir tahun 2010. Selain itu, majelis hakim juga memvonis terdakwa Happy agar membayar denda senilai Rp100 juta, yang dapat diganti dengan pidana penjara selama tiga bulan. Bahkan, rekanan Pemkab Samosir ini dihukum membayar uang pengganti kerugian negara senilai Rp1,083 miliar subsider dua tahun kurungan. Happy dinyatakan terbukti bersalah melakukan tindak pidana korupsi sebagaimana diatur dalam Pasal 2 UU RI No.31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi.

Putusan hakim tersebut lebih ringan dibandingkan tuntutan Jaksa Penuntut Umum (JPU) KR Tamba dan Josua Ginting, yakni tujuh tahun enam bulan (7,5 tahun) penjara, denda Rp200 juta subsider enam bulan kurungan, serta uang pengganti senilai Rp1,083 miliar subsider empat tahun kurungan. Atas vonis hakim terdakwa didampingi penasehat hukumnya menyatakan pikir-pikir, apakah menerima putusan itu atau mengajukan upaya hukum banding. Sebagaimana diketahui dalam perkara ini, terdakwa Happy J Silalahi yang dipercaya Pemkab Samosir untuk pengadaan empat unit truk, dianggap sebagai orang paling bertanggungjawab. Sebab dia “menyulap” kepemilikan kendaraan roda enam itu, seharusnya milik Pemkab Samosir menjadi milik perseorangan. Hal tersebut dikuatkan dari barang bukti berupa empat STNK, didalamnya tertulis nama perseorangan, bukan milik Pemkab Samosir. Sebagai rekanan yang dipercaya, terdakwa diduga telah melakukan tindak pidana korupsi atas pembelian empat unit truk itu. (m38)

RM Cahaya Minang Dibobol Maling MEDAN (Waspada): Rumah Makan Cahaya Minang di Jln. Aksara simpang Jln. Sejati, Kel. Bantan Timur, Kec. Medan Tembung, Kamis (10/1) sekira pukul 04:00, dibobol kawanan maling. Sedikitnya, 30 karung goni beras raib dibawa kabur. Akibat pencurian itu, Lukman, 50, pemilik rumah makan, mengalami kerugian sekira Rp3 juta, sedangkan kasusnya sudah dilaporkannya ke Polsek Percut Seituan. Kepada petugas, Lukman menuturkan, pencurian itu diketahuinya sekira pukul 05:00, setelah mendapat kabar dari tetangganya M Yakup, 60, bahwa pintu depan rumah makannya sudah dalam posisi terbuka. Korban kemudian ke tempat usahanya itu melakukan pemeriksaaan. Ternyata, 30 goni karung beras miliknya sudah tak ada lagi.

Selanjutnya Lukman melaporkan pencurian itu kepada July Erlina Lubis, 40, Kepala Lingkungan 1, Kel. Bantan Timur, Kec. Medan Tembung, yang mendapat informasi itu, langsung mencari tahu para pelakunya. Oleh Lukman, bersama istrinya kemudian mendatangi Mapolsek Percut Seituan, untuk membuat laporan. Petugas yang menerima laporan korban, kemudian turun ke lokasi untuk melakukan cek tempat kejadian perkara (TKP). Sementara itu, Kepling I July Erlina Lubis yang mendengar pengakuan M Yakup, memberitahukannya kepada suaminya dan langsung melakukan pencarian terhadap para pelaku. Setelah mendapatkan informasi identitas pelaku, lalu July mendatangi kediaman pelaku dan meminta agar mengem-

balikan beras curian tersebut kepada korban. Pelaku yang masih dirahasiakan namanya, mengembalikan beras curian tersebut kepadanya sebanyak 7 goni, yang selanjutnya diserahkannya ke rumah makan korban. “Saya mendapat identitas pelaku dari kepling lingkungan 14, Kel. Bantan Timur Pak Syarial. Soalnya dia nampak pelaku bawa beras itu di becak. Terus saya lacak ke rumah pelaku. Saya tengok ada 7 karung beras di rumahnya. Jadi langsung aja saya minta kepada pelaku itu berasnya,” ujarnya. Hingga kini petugas Polsek Percut Seituan masih menunggu laporan lanjut dari korban. Sebab, korban belum membuat laporannya ke ruang penyidik, melainkan hanya melaporkan kejadian itu ke SPKT saja. (h04)

WASPADA Jumat 11 Januari 2013

Dua Pecandu Narkoba Ditangkap MEDAN (Waspada): Dua pecandu narkoba ditangkap petugas Polsek Medan Timur usai membeli sabu-sabu di Jln. Mesjid Taufik, Kel. Tegalrejo, Kec. Medan Perjuangan, Rabu (9/1) sekira pukul 13:00. Dari tersangka BK, 27, dan JS, 24, keduanya warga Komplek PJKA Jln. Gaharu, Kel. Gaharu, Kec. Medan Timur, disita barang bukti satu paket sabu-sabu senilai Rp500.000. Informasi yang diperoleh di kepolisian, penangkapan tersebut berawal ketika petugas curiga melihat gerak-gerik kedua tersangka yang mengendarai sepedamotor baru saja keluar dari Jln. Mesjid Taufik, Kec. Medan Perjuangan, yang selama ini dikenal sebagai lokasi penjualan narkoba. Petugas kemudian mengikuti keduanya dan saat masuk ke Komplek PJKA bangsal Jln. Gaharu, mereka langsung dicegat. Polisi memaksa keduanya mengeluarkan isi kantong celana masingmasing. Dari dalam kantong celana BK, ditemukan 1 paket sabusabu dalam kemasan plastik kecil, sedangkan dari dalam kantong celana JS ditemukan sisa SS dalam plastik kecil. Kanit Reskrim Polsek Medan Timur AKP Ridwan SH, ketika dikonfirmasi membenarkan penangkapan tersebut. Menurut dia, kedua pecandu SS itu masih menjalani pemeriksaan. “Kedua pelaku masih menjalani pemeriksaan, sedangkan identitas pengedar narkoba di Jalan Mesjid Taufik sudah diketahui dan masih dalam pelacakan,” sebut Ridwan. (h04)

Medan Metropolitan B3 Jackpot Kampung Kubur Digerebek Judi Samkwan Tuntungan Tidak Tersentuh Hukum MEDAN (Waspada): Puluhan anggota Reserse Poldasu dibantu 20 personel Brimobda Sumut bersenjata lengkap menggerebek permainan judi jackpot dari dua lokasi di kawasan Kampung Kubur, Medan Petisah, Kamis (10/1). Enam tersangka ditangkap dari dua lokasi tersebut dengan barang bukti 9 mesin jackpot, 100 koin dan uang Rp127 ribu.

Wakil Direktur Dit Reskrimum Poldasu AKBP Wawan Munawar di dampingi Kasubdit III Umum AKBP Andry Setiawan dan Kanit Judi Kompol Saptono mengatakan kepada wartawan, sebelum melakukan penggerebekan, polisi mengintai lokasi perjudian tersebut selama sepekan. “Sudah satu minggu kita intai. Rencananya lima hari lalu akan digerebek, tetapi gagal karena informasinya bocor. Baru hari ini berhasil digerebek,” kata

Wawan. Menurut Wawan, pihaknya banyak menerima informasi tentang praktik perjudian jenis jackpot di Medan, salah satunya di kawasan Kampung Kubur. “Selain di Kampung Kubur, ada beberapa lokasi yang sedang kita intai. Penggerebekan judi ini akan terus dilakukan,” tegasnya. Di Kampung Kubur, pengelola perjudian itu menempatkan mesin jackpot di lorong-lorong (gang), sehingga tidak terpantau. “Sembilan mesin yang

kita amankan ini bukan dari satu lokasi, tetapi dari beberapa lorong di Jln. Taruma dan Jln. Zainul Arifin, Kampung Kubur. Permainannya menggunakan koin seharga Rp1.000. Jika menang, maka para pemain mendapatkan hadiah puluhan kali lipat.,” kata dia. Enam tersangka yang diamankan yakni pengelola dan penyedia tempat jackpot berinisial SR, 29, warga Kampung Kubur, serta lima pemain masingmasing DS, 36, (satpam), warga

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.20 08.45 10.30 11.55 14.10 15.55 17.55 18.45 19.55 09.45 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

08.00 09.45 11.10 13.20 14.20 15.10 17.10 19.10 22.00 12.25 17.55

CITILINK 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Batam

8.40 18.50 20.05 10.00 14.20

Jakarta Jakarta Jakarta Batam Batam

QG-830 QG-832 QG-834 QG -881 QG-883

08.05 09.05 09.35 13.15 17.55

QG-831 QG-833 QG-835 QG-880 QG-882

Pukul

AIR ASIA 1 Kuala Lumpur QZ-8050 06.05 2 Kuala Lumpur QZ- 8054 11.20 3 Kuala Lumpur AK- 1351 08.00 4 Kuala Lumpur AK-1355 17.25 5 Penang QZ-8072 10.40 6 Penang AK-5837 18.30 7 Kuala Lumpur AK-1357 21.25 8 Baangkook QZ-8084 17.00 9 Bandung QZ-7987 08.25 10 Surabaya QZ-7611 11.35 11 Bandung QZ-7981 17.10 12 Banda Aceh QZ-8022 11.00 13 Pekanbaru QZ-8028 07.00 Selasa, Kamis, Sabtu

Kuala Lumpur QZ-8051 Kuala Lumpur QZ-8055 Kuala Lumpur AK-1350 Kuala Lumpur AK-1354 Penang QZ-8073 Penang AK-5836 Kuala Lumpur AK-1356 Bangkok (2,4,6) QZ-8085 Bandung QZ-7986 Surabaya QZ-7610 Bandung QZ-7980 Banda Aceh QZ-8023 Pekanbaru QZ-8029 Selasa, Kamis, Sabtu

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

Waspada/gito ap

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284

11.45 17.55

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283

11.05 17.15

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Batam

Y6-594 Y6-596 7P-568

16.00 18.15 12.25

Jakarta Jakarta Batam

Y6-593 Y6-595 YP-567

13.00 15.15 10.30

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Jadwal Perjalanan Kereta Api No KA

Nama KA

U.2 Sri Bilah U.4 Sri Bilah U.6 Sri Bilah U.8 Sri Bilah U.1 Sri Bilah U.3 Sri Bilah U.5 Sri Bilah U.7 Sri Bilah U.10 Sri Bilah U.12 Sri Bilah U.9 Sri Bilah U.11 Sri Bilah U.14 Putri Deli U.16 Putri Deli U.18 Putri Deli U.13 Putri Deli U.15 Putri Deli U.17 Putri Deli U.22 Siantar Ekspres U.21 Siantar Ekspres PLB 7000 Sri Lelawangsa PLB 7002 Sri Lelawangsa PLB 7004 Sri Lelawangsa PLB 7008 Sri Lelawangsa PLB 7010 Sri Lelawangsa PLB 7012 Sri Lelawangsa PLB 7001 Sri Lelawangsa PLB 7003 Sri Lelawangsa PLB 700 Sri Lelawangsa PLB 7009 Sri Lelawangsa PLB 7011 Sri Lelawangsa PLB 7012 Sri Lelawangsa

Kelas

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Dari

Tujuan

Berangkat Datang

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan

08.00 10.30 15.00 22.50 08.05 14.35 16.55 23.25 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 05.00 09.50 12.15 14.40 05.20 08.55 06.30 11.00 13.30 15.50

13.16 15.31 20.18 03.34 13.12 19.49 21.50 04.21 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.22 05.52 10.42 13.07 15.32 07.22 09.47 07.22 11.52 14.22 16.42

�Informasi��Pemesanan��-Stasiun���KA��Medan��(061)�4514114,��-Stasiun��KA���R.�Prapat�(0624)�21617.

DUA anggota Brimobdasu bersenjata laras panjang menggiring enam tersangka judi jackpot Kampung Kubur ke ruang pemeriksaan Reskrimum Poldasu, Kamis (10/1).

Jln. Sekip Petisah Timur; Ram, 50, warga Jln. Zainul Arifin, Petisah Tengah (pedagang);Yun, 34, (penarik becak), penduduk Jln. Taruma; Riz, 35, (penarik becak) penduduk Jln. Taruma dan Ronald Hasibuan, 39, (penarik becak) penduduk Jln. Darussalam. “Berdasarkan pengakuan tersangka, pemilik jackpot adalah seorang pria berinisial R, warga Kampung Kubur, yang kini masih diburon. Para tersangka dijerat pasal 303 dengan ancaman lima tahun penjara,” tambah Wawan. Tentang keberadaan 20 anggota Brimob, Wawan mengatakan, untuk mengantisipasi terjadinya hal-hal yang tidak diinginkan. “Hanya untuk back up saja, kalau ada masalah di lapangan,” kata dia. Tidak tersentuh Sementara itu, praktik perjudian jenis samkwan di kawasan Tuntungan tidak tersentuh hukum. Penggerebekan yang dilakukan polisi berulangkali, tidak pernah membuahkan hasil. Diduga rencana penggerebekan itu selalu dibocorkan oknum sehingga pengelola markas judi bisa secepatnya mengosongkan lokasi tersebut. Pihak Polresta Medan yang dikonfirmasi Waspada hanya menyatakan segera memantau lokasi judi di kawasan Tuntungan tersebut. Mereka mengaku tetap komit memberantas semua bentuk perjudian yang ada di wilayah hukum Polresta Medan. “Semua bentuk perjudian tetap kita berantas. Mengenai keberadaan judi di kawasan Tuntungan segera kita pantau lagi,” kata Kasat Reskrim Kompol Yoris Marzuki melalui Kanit Judi Sila AKP Edy Safari, Kamis (10/1).

Kemarin, kata Edy, pihaknya sudah melihat lokasi tersebut tapi tidak ada aktivitas perjudian. “Sudah kita pantau lokasinya, tapi tidak ada kegiatan judi. Kepada masyarakat yang mengetahui adanya judi, segera lapor kepada pihak kepolisian,” jelasnya. Menurut Edy, untuk memberantas praktik perjudian dibutuhkan partisipasi masyarakat dalam memberikan informasi kepada pihak kepolisian. “Peran warga sangat dibutuhkan untuk memberantas penyakit masyarakat ini,” tambahnya. Togel Sementara itu, seorang bandar judi toto gelap (togel), ditangkap Reskrim Unit Judi Sila Polresta Medan dalam penyergapan di Jln. Pertahanan Patumbak, Rabu (9/1). Dari tersangka P, 40, polisi menyita uang ratusan ribu rupiah, rekapan judi togel dan handphone berisi pesan singkat berupa angka judi togel untuk dijadikan barang bukti. Informasi di Polresta Medan, penangkapan bandar judi togel itu berawal dari informasi masyarakat. Bandar judi togel yang berlokasi di Jln. Pertahanan ini memiliki omset puluhan juta rupiah untuk sekali putaran. Kemudian polisi melakukan penyelidikan dan menyamar sebagai pemasang togel. Ketika tersangka hendak menerima uang tersebut, polisi langsung menyergapnya dan mengamankan sejumlah barang bukti. Kanit Judi Sila AKP Edy Safari ketika dikonfirmasi membenarkan penangkapan bandar judi togel tersebut. “Tersangka P sudah kita periksa dan kini mendekam di ruang tahanan Polresta Medan menunggu berkasnya dilimpahkan ke jaksa,” katanya.(m27/m39)

Mantan Kacab PT TJSU Tipu Kuasa Menjual Dari PT Atakana Sah Perusahaan Miliaran Rupiah Sidang Lanjutan Kasus BNI SKM Medan

MEDAN (Waspada): Kedua notaris Diana Uli Siburian dan Lila Mutia yang dihadirkan jaksa penuntut umum sebagai saksi menyatakan, kuasa menjual yang diberikan oleh PT Atakana Company adalah sah. Kuasa tersebut diberikan dalam bentuk akta otentik (notariil), dan hanya dapat dicabut atau dibatalkan oleh keseluruhan pemegang saham PT AC dan penerima kuasanya. Kesaksian Diana Uli Siburian, selaku notaris yang membuat akte kredit antara PT Atakana dengan BNI SKM Medan, kuasa tersebut bukanlah termasuk ‘kuasa mutlak’, dan ditandatangani langsung oleh seluruh pemegang saham PT Atakana Company dihadapan saksi selaku notaris. Pada November 2010, salah satu pemegang saham PT Atakana M Yusuf meminta Diana untuk membuatkan draf RUPS dan kuasa. “Para pemegang saham PT Atakana mendatangi kantor saya secara bertahap. Mereka sudah membaca draf perjanjian itu. Lalu M Aka menandatangani akta RUPS dan akta kuasa. Saat itu mereka memang tidak datang bersamaan ke kantor saya. Memang saat itu saya pertanyakan kenapa tidak samasama datang, tapi para pemegang saham mengaku sudah ada kesepakatan. Dalam RUPS dinyatakan para pemegang saham memberi kuasa kepada Boy Hermansyah untuk melunasi pinjaman PT Atakana di BNI SKM Medan. Membayar hasil penjualan SHGU No.102 kepada masing-masing pemegang saham,” ujar Diana. Sementara itu, saksi Lila Mutia mengatakan, dirinya selaku notaris di Medan yang juga

PPAT (Pejabat Pembuat Akta Tanah) serta rekanan di BNI SKM Medan sejak 2010 hingga sekarang. Untuk menjadi rekanan, dirinya harus membuat permohonan, SK pengangkatan, SK PPAT, serta melampirkan riwayat hidup ditujukan kepada Pimpinan Wilayah BNI yang disetujui Pimpinan BNI SKM Medan yakni Radiyasto. Saksi mengaku hanya membuat akte perjanjian Jaminan Hak Tanggungan atas tanah, fidusia atas benda-benda bergerak, corporate guarantee, personal guarantee, Jaminan HT SHGB 02 dan fidusia yang sudah terpasang, akte permohonan Boy Hermansyah ke BNI SKM Medan (akte perjanjian jual beli) No.29 tanggal 24 Desember 2010, akte perjanjian jual beli antara PT Atakana dengan PT BDKL (Bahari Dwi Kencana Lestari). “Tugas PPAT membuat akte-akte tanah di wilayahnya. Boy Hermansyah pernah meminta saya membuatkan akte perjanjian jual beli SHGU No. 102. Sebelum membuat perjanjian itu, bu Titin memanggil saya saat itu dan bilang mudahmudahan ibu nanti bisa ditunjuk BNI untuk membuat akteakte permohonan kredit Boy Hermansyah,” ujarnya. Dalam perjanjian jual beli atau balik nama SHGU No.102 itu, Boy Hermansyah sebagai pemgang kuasa dari PT Atakana dan sekaligus Boy Hermansyah pula yang mewakili PT BDKL. Hal itu berdasarkan surat kuasa No.4 tanggal 16 November 2010 hasil RUPS PT Atakana yang menyebutkan, seluruh pemegang saham memberikan kuasa pada Boy Hermansyah

selaku Direktur PT BDKL untuk menjual, menguasai tanah sesuai dalam SHGU No.102 seluas 3.455 hektar yang terletak di Provinsi Daerah Istimewa Aceh, Kabupaten Aceh Timur, Kecamatan Rantau Peureulak, Desa Berandang. Kelak di kemudian hari, SHGU No.102 itu dipergunakan Boy Hermansyah sebagai jaminan ke BNI SKM Medan. “Selanjutnya saya membuat perjanjian jual beli itu. Namun kemudian muncul masalah. Salah satu pemegang sahamnya M Aka menarik kuasanya tanpa persetujuan pemegang saham lainnya. Kuasa itu ditariknya sebagian secara sepihak artinya hanya dia sendiri yang menarik kuasanya. Saya juga nggak tahu kenapa M Aka menarik kuasanya atas SHGU No.102 tersebut yang telah diberikan kepada Boy Hermansyah,” sebut Lila. Bukan itu saja, M Aka juga melakukan pemblokiran atas SHGU No.102 ke Kantor Badan Pertanahan Nasional. Tindakan M Aka tersebut tanpa adanya persetujuan dari tiga pemegang saham PT Atakana Company lainnya. Padahal M Aka hanya memiliki saham 45 persen di PT Atakana Company. “Saat itu ada pengikatan jual beli. Padahal surat kuasa dari seluruh pemegang saham PT Atakana sudah diberikan kepada Boy Hermansyah. Karena SHGU No.102 itu diblokir, maka statusnya masih atas nama PT Atakana,” tuturnya. Usai mendengarkan keterangan saksi-saksi, majelis hakim menunda persidangan hingga pekan depan dengan agenda mendengarkan keterangan saksi lainnya. (m38)

LSM Islamic Malaysia AID Bantu Anak Kurang Mampu MEDAN (Waspada): Lembaga Swadaya Masyarakat (LSM) Islamic Malaysia AID yang bergerak di bidang kemanusiaan akan melaksanakan kegiatan sosial dengan membantu 40 anak-anak dari keluarga kurang mampu. “Ini merupakan program perdana bagi LSM Islamic Malaysia AID di Medan. Kami akan ke Panti Asuhan Putri Aisyiah di Jln. Santun Medan, Jumat (11/ 1) pagi. Setelah itu melaksanakan kegiatan di Konjen Malaysia Jln. Diponegoro Medan pukul 15:00,” kata Wakil LSM Islamic Malaysia AID di Indonesia Alfian

Buyung Enek yang datang ke Redaksi Waspada, Kamis (10/1). Penyerahan bantuan tersebut dihadiri Konjen Malaysia di Medan Ahmad Rozian Abd. Ghani serta tokoh masyarakat Melayu Sumut Anita Daryatun serta undangan lainnya. Buyung menjelaskan, LSM Islamic Malaysia IAD terdaftar di bawah Pertubuhan Organisasi Malaysia yang menyalurkan bantuan kemanusiaan kepada masyarakat miskin, kaum dhuafa, janda dan anak yatim piatu atau anak-anak dari keluarga kurang mampu serta korban bencana alam.

Misi dan perjuangan utama Islamic Malaysia AID (IMA) adalah membantu rakyat Malaysia yang miskin dan dhuafa tanpa memandang agama, bangsa dan warna kulit. Namun IMA juga mendapat sumbangan dana untuk melaksanakan program-program kemanusiaan di luar Malaysia, khususnya Indonesia. “Program ini untuk mempererat tali silaturahmi antara Indonesia dan Malaysia guna mensosialisasikan tanggungjawab yang diamanahkan kepada kami,” demikian Buyung Enek.(m24)

MEDAN (Waspada): Mantan Kepala Cabang PT Top Jaya Sarana Utama (PT TJSU) distributor barang elektronik merek Toshiba ditangkap petugas Subdit II/Cyber Crime Direktorat Reserse kriminal Khusus Poldasu, Kamis (10/1). TersangkaSJ,37,wargaJln.Kenari,MedanHelvetia,yangkinibekerjasebagaiSalesBrandHotelSoechi Novotel,ditangkapbersamaseorangpegawaibagian piutang PT TJSU berinisial SP, 26, warga Medan. “Keduanya diduga telah memanipulasi data dan pengubahan data transaksi penjualan dan telah ditahan atas kerugian uang perusahaan senilai miliaran rupiah dalam jangka waktu satu tahun,” kata Direktur Dit. Reskrimsu Poldasu Kombes Pol. Sadono Budi Nugroho didampingi Kasubdit II/Cyber Crime AKBP Agus A. Kedua tersangka, akan dijerat dengan pasal 372 KUHPidana tentang penggelapan dan pasal 24 UU nomor 11 tahun 2008 tentang Informasi Transaksi Elektronik (ITE) dengan ancaman hukuman di atas lima tahun penjara. Sadono mengatakan, modus dilakukan

tersangka SJ memerintahkan karyawannya SP memanipulasi dan mengubah data transaksi penjualan.“Seharusnya si A yang membeli barang tapi dalam transaksi penjualan dicantumkan nama orang lain atau B, sehingga perusahaan tidak dapat melakukan penagihan, tetapi diamdiam dana penjualan ditagih tersangka untuk keuntungan pribadi,” ujarnya. Namun, ketika aksinya mulai diketahui pihak perusahaan, tersangka resign (undur diri) dari perusahaan itu, kemudian pindah kerja sebagai Brand Manager Soechi Novotel Hotel Jln. Cirebon, Medan. Barang bukti yang diamankan polisi, uang hasil penarikan dari nasabah Rp30 juta, namun dokumen-dokumen transaksi penjualan sudah sempat dibakar tersangka. “Kita masih mencari data-data lain, juga menghitung kerugian perusahaan. Untuk sementarakitaperolehketerangankerugianmencapai miliaran rupiah,” sebut Sadono mengatakan, penangkapan berdasarkan laporan PT TJSU berkantor pusat di Jakarta. Sedangkan alamat distribusi di Medan di Jln. Letda Sujono.(m27)

Penumpang Angkot Dihipnotis Laptop, HP, Dan Perhiasan Lewong MEDAN (Waspada): Seorang wanita penumpang angkutan kota (angkot) jadi korban kejahatandenganmodushipnotissehinggabarang-barang berharga miliknya berupa laptop, handphone Black Berry, cincin berlian, dan lainnya lewong. “Korban Agustina Br Nainggolan, 23, diduga dihipnotis dua pelaku yang dikenalnya dalam angkot, di Jln. Setiabudi, Kel. Tanjungrejo, Kec. Medan Sunggal,” kata saksi mata kepada Waspada di lapangan, Rabu (9/1) sore. Saksi mata mengatakan, peristiwa itu terjadi pada Selasa (8/1), korban Agustina, penduduk Jln. Dr. Mansyur Gang Saudara Medan, naik angkot Sudako dari Pasar I, Padangbulan Medan. Dalam angkot, korban Agustina duduk dekat dua pelaku. Tiba-tiba, seorang pelaku menegur korban sambil menunjuk ke lantai angkot. “Uang kau jatuh dik.” Korban lalu melihat ke lantai angkot memang ada uang pecahan Rp20 ribu berlipat. Pelaku kemudian mengambil uang itu dan memberitahukan kepada korban bahwa dilipatan uang ada perhiasan emas dan surat pembelian emas. Selanjutnya, pelaku mengajak korban membagi tiga emas tersebut.

Korban dan pelaku bersalaman sekaligus saling berkenalan. Kemudian kedua pelaku dan Agustina sama-sama turun dari angkot. Diduga kena hipnotis, korban menuruti saja ajakan pelaku naik becak motor (bettor) menuju ke salah satu kedai untuk membeli minuman. Di dalam betor, pelaku dengan mudah mengambil barang milik korban berupa laptop, hadphone, dan cincin berlian. Usai menguasai harta benda korban, ketiganya turun dari betor. Selanjutnya, pelaku menyuruh korban naik angkot lagi dan menunggu di rumahnya Gang Saudara. Tunggu punya tunggu, dua pelaku tidak datang dan Agustina baru sadar menjadi korban penipuan dan pengelapan barang miliknya. Kemudian korban membuat laporan pengaduan ke Polsek Sunggal. Kapolsek Sunggal Kompol M Luther Dachi SH, S.Sos mengatakan, pihaknya sudah menurunkan personelnya ke lapangan untuk melakukan penyelidikan. “Kita sudah mengambil keterangan korban dan sejumah saksi lainnya. Sedangkan pelakunya masih dalam buronan,” ujarnya. (m36)

Dugaan Korupsi Rp2,3 M

Mantan Dirut Penyertaan Modal Binjai Ditahan MEDAN (Waspada): Mantan Direktur Utama Badan Usaha Penyertaan Modal Perusahaan Daerah (PD) Kota Binjai Nazri Kamal dijebloskan ke dalam sel tahanan Mapolda Sumut atas dugaan penyelewengan dana penyertaan modal selama 2006 hingga 2009 sebesar Rp2,3 milar. “Penahanannya sudah dilakukan pukul 17:00 tadi. Dia (Nazri Kamal) ditahan atas dugaan korupsi dana penyertaan modal Kota Binjai setelah hasil audit Badan Pemeriksaan Keuangan dan Pembangunan (BPKP) Sumut, terdapat kerugian negara sebesar Rp2.339.000.000,” kata Direktur Dit. Reskrimsus Poldasu Kombes Pol. Sadono Budi Nugroho kepada wartawan, Kamis (10/1). Penyelewengan anggaran negara itu dilaku-

kan tersangka dengan cara meminjam dana kepada pihak ketiga tanpa izin Wali Kota dan DPRD Binjai. Karena itu, dan pinjaman tersebut tidak pernah masuk ke dalam kas PD Binjai, tetapi pembayaran pinjaman dibebankan ke dalam APBD Binjai. Dalam kasus itu, menurut Sadono, tersangka Nazri Kamal akan dijerat Pasal 19 ayat (1) huruf a dan ayat 2 Perda No. 12 Tahun 2005 Jo Pasal 2 dan 3 UU No. 31/1999 tentang korupsi dengan ancaman di atas lima tahun penjara. “Kita juga masih menelusuri dugaan keterlibatan pihak lain dalam kasus itu, karena tidak tertutup kemungkinan ada orang lain yang terlibat,” sebutnya.(m27)

B4 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca AC BR CL ND DB

: : : : :

Bursa Automotive

Air Condition Ban Radial Central Lock Nippon Denso Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Ve l g R a c i n g :Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000

HONDA Accord Cielo Thn. 1997. Mesin Vtec, Hijau. Hub. 0823 6342 3546 HYUNDAI Santa FE M/T Thn. 2002. Hitam, BK Mdn Rp. 72Jt Nego. Hub. 0852 7538 3218

7 CM 8 CM

Rp. 91.000 Rp. 104.000

TERCECER TERCECER

1 (Satu) Buah BPKB BK 6386 IT. An. Saspandi SH. Alamat Dsn. II DS Sei Gelugur Kec. P. Batu D/S.

HILANG

Th. 2005, War na hitam, manual, Hub. 0853 6091 9127

K I A

All New Picanto 1,2 DP Mulai 20 Jt-an All New Rio 1,4 DP mulai 30 Jt-an Hadiah langsung: - Kaca Film Solard Gard Full Emergency Kit, Car Cover, Mud Guard Hub: ADE 0852 9608 6218

Surat Pelepasan dan Penyerahan Hak dengan ganti rugi. Nomor 592.2/740/135/VI/ 2001. Tgl. 18 Juni 2001. A/n. H. Abdul Wahid Nasution yang terletak Jl. GN. Kinibalu Lk. II Kel. Tanah Merah Luas +/- 3.370m2

P R O M O DA I H AT S U B A R U Ready Stock Xenia, Terios, Gran Max, P.U & MB, Luxio, Raih Hadiah Besar 1,5 Kg/ Uang Rp. 1M dan Hadiah² Menarik lain Hub: PT. Astra Daihatsu, Pairen 0812 6305 0708

MITSUBISHI Kuda Diamond Bensin Thn. 2002. AC DB, Tape, VR, PS, PW, CL, jok kulit, silver, BK Mdn Rp. 83Jt. Hub. 0853 6161 5977

TERCECER STUK BK 9171 CO. No. Uji AB. 01.017459 a/n. EDDI. PAPMINGOTAN SIMARMATA. Alamat Jl. Tanggok Bongkar No. 59 Medan.

# ASTRA DAIHATSU PROMO #

MITSUBISHI L300, Pick Up 97 BK Asli Medan, Siap pakai. Mulus, masih kaleng, Ban 5 Baru. Hub. 0852 6169 8586

STUK BK 9109 LE/A. No. Uji Jkt 45730. A/n. Syarif Teddi. Alamat Jl. K.L. Yos Sudarso Merek Nisan.

GEBYAR TAHUN BARU

MITSUBISHI L300 Pick Up Dijual. Solar, BK Medan, nama sendiri. Cantik, siap pakai. Thn. 93. Hub. 0812 639 3235

STUK BK 8229 FR. No. Uji Mdn 12005. A/n. Faisal Ahmad R. Alamat Jl. Tenis No. 21 Medan. Merk Mitsubishi.

BULAN UNTUNG BELI XENIA BARU GRATIS GRATIS SERVICE, OLI SPARE PART 3 THN DISC GEDE

HUB: HASIBUAN ASTRA 0812 6362 4634

NISSAN Grand Livina 1.5 XV Thn 2007 Dijual, BK Medan, Balik DP 55, Angs. 2,2 Jt-an 44 kali lagi Hub. 0878 6976 3838 - 7635 0413

REAL Van DRV Thn. 2003. Warna hijau metalik, pajak baru, balik DP 18,5Jt. Sudah Bayar 18 kali / 1802.000/bulan HP. 0813 6179 0291

NISSAN X Trail 2009, 2.0 AT, W. Hitam, Kondisi mulus, Jarang pakai Hub. 0812 6595 820

DAIHATSU Espass Pick Up 2005 Hitam, mobil siap pakai. Balek DP 18Jt. Udah Bayar 8 kali. 1.550.000/bulan kredit 3 thn. di ACC HP. 0852 6040 8971

OPEL Blazer LT Injection Biru met Th. 96. Mulus, orisinil, mesin sehat, AC Dingin. Hrg. 46Jt Nego. Hub. 0823 6261 5557

Realvan GX Thn. 2004 Silver metalic pajak 1 thn, 1 nama, Jl. Veteran Raya/Simp. Paya Pasir HP. 0823 6753 4488

TOYOTA Fortuner Bensin V 4x4 Matic Thn. 2007, hitam, BK Mdn Rp. 265Jt. Hub. 9132 7433

PAKET AWAL TAHUN Xenia DP 19 Jt-an Angs. 4 Jt-an Terios DP 18 Jt-an Angs. 5 Jt-an Pick Up DP 12 Jt-an Angs. 2 Jt-an Ready Stock, Full Disc, Data Dijemput Hub: IRNANDA 0813 7580 2895 / 0821 6761 2659

TOYOTA KIJANG JANTAN DIJUAL Thn. 93. Biru met, AC DB, Tape, PWR, VR, BR, Mobil mulus. Hrg. 52Jt. Damai. Hub. Jl. Pancing komplek IAIN SU. Jl. Kemuning Baru Blok-B No. 9. Hub. 0857 61600 719

DIJUAL

TOYOTA Avanza G Hitam Over Kredit Th. 2011. Mulus, orisinil, Balik DP 70Jt. Nego. Sisa 18 x 5.300.000. Hub. 0812 6063 7823

CHEVROLET AVEO

Ready stock Xenia, Terios, Pick up, Luxio, Sirion, DP Murah , Data dijemput, Full diskon Hub. Riky 0812 6595 820 - 0878 67 0000 29 Xenia, Terios, Granmax READY STOCK *GRATIS SERVICE 3 THN, *HADIAH UTAMA EMAS 1KG Hub. AFJANI 0812 653 1129

Pick Up Zebra Espass 2001. Biru tua. HP. 0813 6233 5574. TP ASTRA DAIHATSU Bulan Untung Beli Daihatsu. Pembelian Xenia, Terios, Grand Max, Pick Up, berkesempatan memenangkan Undian Emas atau uang 1,5M. DP Sangat rendah. Bunga Pinjaman, cicilan murah. Hub. 0852 769 100 79

DIJUAL

DAIHATSU Box Espass 2006. Box Aluminium. Hub. 0821 6889 5127 DAIHATSU Grand Vitara ‘07 JLX, Silver, BK Mdn, mobil simpanan, Serius Hub. 0813 75 111114, TP. #BELI DAIHATSU BARU BERHADIAH EMAS & DUIT#

Gran Max PU DP 14 Jt-an Angs. 2Jt-an (47 bln) Xenia 1.3 RDlux DP 30Jt-an Angs. 4 Jt-an (59 bln) Proses Cepat, Berlaku dalam & luar kota, dijamin langsung keluar. Mobil Hub. Ahmad Nasution. Astra Daihatsu 0812 60052465 24 jam.

# BELI DAIHATSU BERHADIAH EMAS #

Xenia.........Angsuran mulai 1 Jt-an Terios.........Angsuran mulai 1 Jt-an Granmax PU... Angsuran mulai 80 rb-an/hari. Hub. FERRY 0821 6736 3637

DAIHATSU XENIA 2006 Li Warna Silver, VVTI, PW, Hub. 0853 7267 3866

PROMO TAHUN BARU 2013

TOYOTA BARU ASTRA

Avanza, Innova, Fortuner PURBA: 0813 9736 0333 -0878 6946 5276

TOYOTA Vios Th. 2007/W. Silver metalik, satu nama / BK Medan asli. Hub. 0853 589 55525 TOYOTA Avanza Th. 2008. Wrn hitam, Tipe G. Lengkap, BK Mdn. Butuh Uang. HP. 0813 6212 2339

TOYOTA Corolla SE Salon ‘87. Lengkap, cantik, Ban Baru. Hrg. Nego. HP. 0823 7085 9931

BURSA BUTUH DANA

BU T U H DAN A

Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

PINJAMAN DAN CEPAT

* HONDA All New CRV, FMC. 2,4 AT. Ready Stock!!. * New Brio, DP 27 Jt-an. Atau Angs. 2 Jt-an * Jazz & Freed, DP 70Jt-an. Atau Angs.3 Jt-an Hub. 0 8 1 3 7 6 4 5 2 2 6 8

Proses 3 Jam Cair. 3 Juta - 10 Milyar. Jaminan : SHM, SK Camat, HGB, BPKB Mobil, Spd. Mtr. Mobil Kredit, Take Over / Bantu Pelunasan BPKB. Hub. Family Finance 0813 622 90001, 0813 7044 6668. (Sdr. ARI) No. sms.

HONDA Jazz Biru 2005 matic, Cat asli, mobil sangat original. Km. Rendah. 0852 7552 8833 - 061.7794 8752

Ingin Promosikan Produk Anda

HONDA Civic VTI 2001 Mulus, warna silver. Hub. 0838 2065 9476 HONDA Civic Genio warna merah met, Thn. 92. Sangat mulus/siap pakai. HP. 0813 7602 6026

Harian

WASPADA Media yang Tepat untuk Iklan Anda

TERCECER

TERCECER

TELAH HILANG/TERCECER Asli Surat Pernyataan Penguasaan Fisik Bidang Tanah Tgl. 18 Mei 2011. Ya n g d i k e t a h u i K e p a l a Kelurahan Tanjung Mulia.

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602

AMANAH UMROH

Terimakasih

BURSA

PHOTO COPY

BURSA JASA

TERCECER

Urus Cepat HO, SIUP, HO dll Medan, Deliserdang, Binjai Hub. 0821 6082 2587

PLN-TELKOM-SPEEDY-PULSA-ASURANSI-DLL HUB: 0852 6246 6163 - 0878 6781 2463

MARPHY JAYA

Surat Akta Pelepasan Hak Atas Tanah dan Kuasa Nomor 69. Tanggal 15-9-1999. a/n. Mustafa Kamal. Dibuat dihadapan Notaris Pagit MariaTarigan. 0812 6508 4030

-

UMROH Umroh Reguler 9 Hari Umroh Reguler 11 Hari Umroh Reguler 14 Hari Umroh Plus Cairo Umroh Plus Turkey Umroh Plus Dubai Umroh Plus Aqso

BURSA

ALAT MUSIK

Pesawat via Singapore

DAFTAR SEGERA

GEDUNG GELORA PLAZA Lt. 1

Jl. SM. Raja No. 4 / 18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488

MULTAZAM - UMROH -

MANASIK HAJI 2013 HAJI PLUS/ KHUSUS UMROH REGULER 9HR (10, 17, 25 FEBRUARI) UMROH REGULER 13HR (20 FEBRUARI) UMROH PLUS MESIR 11HR (BULAN MARET) UMROH PLUS TURKEY 11HR (28 MARET) UMROH PLUS AQSHO (BULAN APRIL) UMROH RAMADHAN: AWAL - PERTENGAHAN - AKHIR - 1 BULAN

MANASIK SETIAP HARI SABTU : PKL. 14.00-16.00 WIB HARI MINGGU: PKL 09.00-11.00 WIB TEMPAT MANASIK: MESJID AGUNG MEDAN MULAI MANASIK: 27 JANUARI 2013

BURSA

SEGERA DAFTARKAN KE KANTOR PUSAT MULTAZAM

BUSANA/ ACCESORIES

JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP. (061) 457 6116 FAX. (061) 451 2319 HP: 0813 6137 2321 - 0812 6495 8456

PECI MAHKOTA MENJUALPECI TEMPAHAN

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

BURSA ELEKTRONIK

SERVICE

2013 26 Februari & 5 Maret 27 Februari 1, 10 Februari 16 Maret 13 Maret 20 maret 22 Maret

Bagi Jamaah luar kota menginap di Hotel Madani (Gratis) KANTOR:

HILANG

WC

Dapatkan Discount dan Hadiahnya

BURSA ALAT BERAT

Peralatan/ Perlengkapan Olah - Raga Serta Musik dengan

TERSEDIA: TALI-BAND, CONVENYORBELT, TALI KIPAS, PULLY2, GERGAJI KAYU & GERGAJI TAPIOKA

HARGA ISTIMEWA

KONSTRUKSI

WC WC

TUMPAT / SEDOT HP. 0813 6151 3698 0853 7276 7755

Ayooo....!!! Tunggu apa lagi Segera kunjungi:

TK. ANIL SPORT

Jl. P. BRAYAN MEDAN

HP. 0813 7035 7291

Jl. Jend. A Yani No. 46 Telp. (061) 457 5746 Medan

Ada Garansi

BURSA

TUMPAT/ SAL. AIR

LOWONGAN

845.8996 0812.631.6631

DICARI CEPAT GURU TK

Bergaransi/ Jl.Kpt. Muslim

HORAS ENGINEERING Tel (061) 4571382, 4574733

Cash Back 5 Juta

DP RINGAN KREDIT 1-4 THN PROSES MUDAH & CEPAT

Orang yg ingin bekerja mandiri, SebagaiINDEPENDENDISTRIBUTOR Potensi penghasilan Part Time --> 2 Jt s/d 5 Jt Full time --> 5 s/d 10 Jt/bulan Dan akan dibimbing

Hub. T. SITI RAHMAH 0812 6056 2302 YANUARLIN LUBIS 0812 6477 875

KREDIT VIA:

DIBUTUHKAN

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20-22 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

Playgroup, SMU/ D3/ S1 Syarat Kreatif datang langsung Jl. Karya Wisata No. 23A Johor Tp. 786 1690 - 786 2156 Medan

DICARI

HAD IAH TAP E MO BIL

Hubungi Dealer

Iklan Anda Dijemput Khusus Wilayah Medan Hub. 0813 6207 8393 Wilayah Marelan, Labuhan, Belawan Hub. 0812 6390 660

Pelanggan Yang Terhormat

BUKA LOKET PEMBAYARAN ON LINE

DIJUAL Mesin cetak offset Toko Type 820. Yang berminat Hubungi: Telpon: (061) 415 7880 Tanpa Perantara.

HARGA BELUM TERMASUK PPN 10%

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

TERCECER

BURSA PERCETAKAN

FAX.4561347

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab

Telah tercecer 1 (Satu) buah sertifikat Tanah An. SUDARI. Tanah seluas 595 m2 di Jl. Gg. Raya Lk. VIII Kel. Binjai Estate. Kec. Binjai Selatan Kota Binjai.

Surat SK Camat atas nama: Mesliana Br. Simbolon. Terletak di Jl. Gandum II Kel. Durian Kec. Bajenis. Kota T. Tinggi. Ukuran tanah: P: 17m - L: 6M. Luas: 17x6=102m

Jumat, 11 Januari 2013

Harian WASPADA

TERSEDIA: SEGALA MACAM PLAT SARINGAN dan KAWAT SARINGAN STAINLESS STEEL & SARINGAN TAPIOKA

HORAS ENGINEERING Tel (061) 4571382, 4574733 TERSEDIA: segala macam HAMMER MILL dan GRINDING MACHINE

UD. Mitra Lestari, Lgs dicari beberapa org Tenaga kerja utk menjadi : SALESMAN - Mampu bekerja keras dan disiplin - Min. SMU (sederajat) - Khusus berdomisili di Langsa - Max. usia 28 tahun Kirimkan ke alamat: UD. MITRA LESTARI Jl. Iskandar Muda No. 8D (tepatnya dibelakang Sejahtera Swalayan) Langsa Surat lamaran diantar paling lambat 1 minggu setelah iklan ini terbit.

BURSA

PROPERTY

Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik RUMAH Mewah Dijual di Jl. Purwosari Krakatau Dkt Cemara Asri Uk. 7,5x15mtr, 3 KT, 2 KM, SHM, Rp. 320 Jt Hub. 0821 6603 3261 - 0813 7537 8119

HORAS ENGINEERING Tel (061) 4571382, 4574733

KLINIK TERAPY/ ALAT VITAL

MAK EROT YANG TERUJI DAN TERBUKTI

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 - www.ter apialatvital.com

RUMAH Baru minimalis Hanya 95 Jt, SHM, 2 KT, 1 KM, Belakang Swalayan Suzuya, Tanah 600 Helvetia Marelan dkt Themepark Water Boom anak-anakHub. 0812 604 88854 - 0813 9627 9192

RUMAH Dijual Uk. 8x19m di Jl. Kawat 6 Gg. Mufakat No. 3 B Hub. 0813 7635 5483 Tanjung Mulia Hilir

RUMAH Dijual Jl. Psr. 8 Temb/ Gambir, T.46, DP 11 Jt, Angs. 1,3 Jt, T.37, DP 8,5 Jt, Angs: 1,1 Jt, Grand Algeria, Dihuni ±80 KK, Sisa sdkt lagi sebelum harga naik Hub. 0853 6214 3595

RUMAH Dijual, Luas Tanah 146m² Jl. Sakti Lubis Gg. Pegawai No. 91B 0852 0602 5521 Kec. Medan Kota

RUMAH Dijual, DP 50 Jt, Angs. 3,5 Jt, T.90, 4 Kt, 4 KM, Granit, SHM, Lok. tinggi Jl. Abadi - Ggk Htm, Petronas, Tasbi, McD, Akses banyak Hub. 0852 7690 3900 - 0852 7599 9279

RUMAH DIJUAL

Di Jl. Mandor Krakatau LT. 640m², LB. 250m², SHM Hub. 0813 7000 1688

RUKO DIJUAL

Jl. Utama No. 33 (Pekan Batang Kuis, Status (SHM), Uk. Tanah 4,5x38m, Bangunan 4,5x17m Harga Rp. 550 Jt Hub. Haji M. Chan HP. 0821 6387 6242

RUMAH DIJUAL/ DISEWAKAN Rumah ukuran 9x40m, KT 4, Garasi Jl. Beringin Gg. Sehat No. 10 Medan Kec. M. Sunggal antara Jl. Amal dan Seroja Harga 400 Jt dan sewa 15 Jt/nego Hub: 0852 7539 1494

RUMAH PERMANEN DIJUAL Di Jl. Pasar 7 Tembung, Status (SHM), Uk. Luas Tanah 1100m², Seharga Rp. 1,250M Hub. Pak Haji 0821 6387 6242

RUMAH DIJUAL

Terletak di Jl. Amaliun Gg. Mujur No. 3 Medan, Status (SHM), Uk. Tanah 14,20x20,45m Harga Rp. 525 Jt Hub. 0821 6387 6242

RUMAH DIJUAL

RUMAH HANYA RP. 290 JT

Villa Belibis Jl. Belibis daerah Ringroad Setia Budi, 9x12,5m, 3 KT, 2 KM, Carport, List, PAM, SHM, Telp, Aman, Nyaman, Dkt Mesjid, Makro, Indomaret, Mall, Ringroad/tempat kuliner Hub. 0853 7085 6789

TANAH

TANAH DIJUAL

Ukuran 18x100m (4,5 Rante), Lokasi di Tanjung Morawa Desa Bandar Labuhan Bawah pinggir jalan, Aspal mulus Hub. 0812 6316 8109

KEBUN Sawit Luas 36 H, Umur 6 s/d 10 Thn, Terawat, Jln Bagus, 6 Km dari PKS, Lokasi Pulo 3 Aceh Tamiang 0852 9668 7659 TANAH Dijual Uk. 15x29mtr di Pondok Surya Jl. Sinumba II (dkt Jl. Karya Sei Agul & RSU Sufina Azis) Hub. 0813 9627 9192 - 0812 604 88854 TANAH DICARI untuk dibeli Luas ±110mtr (Uk. 6x16mtr), daerah Jl. Krakatau, Jl. Bilal, Jl. Pancing, Jl. Karya, JL. Gaperta dan sekitarnya Hub. 0853 3035 3999 - 7635 0413

TANAH DIJUAL

Uk. 58,25x34,50m, Luas 2000,88mm Desa Durian Dusun II Kec. Pantai Labu Kab. Deli Serdang HP: 0813 7559 3571 0852 7087 9901 Nini

BURSA

KESEHATAN

PIJAT TRADISIONAL MBAK NIATI

HUB: 0812 2822 4745 (NO SMS)

Uk. 8x15m, Perumahan Insan Citra Griya (ICG) Blok AA 19, Jl. AR. Hakim Psr. I T. Sari Medan

KLINIK TRAPY ALAT VITAL MAK HJ. ICOT Ditangani langsung

H. UST. YUSUF/ H. ABIDIN

Selang Flexible Untuk Menyalurkan Uap Panas & Cairan Panas. Juga Tersedia bermacam-macam magnet.

HORAS ENGINEERING Tel (061) 4571382, 4574733

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222

WASPADA Jumat 11 Januari 2013

Medan Metropolitan

B5

Waspada/gito ap

WAKA Polsek Medan Kota AKP Parulian Sihombing didamping Kanit Reskrim Iptu Gunawan memberi pengarahan kepada anggota geng kereta SL, saat pembubaran geng kereta itu di Mapolsek Medan Kota.

Ramai-ramai Ke Polsek Medan Kota

Geng Kereta SL Bubarkan Diri MEDAN (Waspada): Mapolsek Medan Kota mendadak ramai di datangi puluhan pelajar berseragam putih abu-abu, Rabu (9/1) sekira pukul 16:30. Mereka bukan membuat laporan, melainkan menyatakan sikap untuk membubarkan diri dari geng kereta yang mereka bentuk pada awal 2012. Remaja belasan tahun itu dengan kesadaran sendiri menyatakan sikap membubarkan komunitas geng keretanya secara tertulis di hadapan penegak hukum. Kemudian satu persatu mereka di data. Dalam pernyataan tertulis itu, mereka juga siap menjadi mitra polisi memberi informasi atas keberadaan geng

kereta di Kota Medan. Ikrar pembubaran geng kereta disaksikanWaka Polsek Medan Kota AKP Parulian Sihombing. “Kami dengan ini menyatakan membubarkan diri dan siap membantu polisi memberikan informasi geng kereta di kota Medan,” ujar mereka yang tergabung dalam Simple Life (SL). Ketua Simple Life Binsar Leberty, 15, mengatakan, alasan mereka membentuk geng kereta untuk memperat persahabatan yang dijalani sejak di bangku SMP. “Baru satu tahun kelompok ini berdiri, tujuan kami membentuknya untuk memperat persahabatan saja,” kata dia. Sedangkan alasan mereka membubarkan kelompok itu karena takut terlibat bentrokan

dengan geng kereta lainnya, serta menjadi incaran polisi. Mereka menyatakan ingin menjadi mitra polisi membantu menjaga Kamtibmas Kota Medan. Ditanya berapa kali membuat tindakan meresahkan masyarakat dan tindakan kriminal, warga Jln. Air Bersih itu membantah melakukan aksi tersebut. “Tidak pernah kami melakukan tindak kejahatan,” sebutnya. Waka Polsek Medan Kota AKP Parulian Sihombing mengatakan, untuk pertama kali di Polsek Medan Kota sekolompok geng kereta berikrar membubarkan diri. “Baru pertama kali ini,” sebutnya, kemudian mendata nama-nama anggota geng kereta itu. Pendataan dilakukan untuk

memantau kemungkinan para remaja itu melakukan tindakan kriminal. “Kita catat dulu, mana tahu mereka berbuat kriminal di wilayah Polsek lain, tinggal menyerahkannya saja,” tutur Sihombing. Menurutnya, wilayah hukum Polsek Medan Kota memang kerap menjadi perlintasan geng kereta, karena itu razia

rutin akan tetap dilakukan. Sedangkan pengawasan terhadap puluhan pelajar tersebut tidak berhenti, karena Polsek Medan Kota juga berkoordinasi dengan pihak sekolah untuk saling mengawasi. “Mereka tetap kita awasi dan sudah kita lakukan koordinasi dengan pihak sekolah. Jadi polisi dan sekolah sama-sama melakukan peng-

awasan,” ujarnya. Ke depan, Sihombing berharap para pelajar itu menjadi mitra yang baik menjaga Kamtibmas dan memberikan informasi keberadaan geng kereta di Medan. Setelah dilakukan pendataan, satu persatu pelajar itu meninggalkan Mapolsek dan kembali ke rumah masingmasing.(m27)

Pengendara Sepedamotor Tabrak Pejalan Kaki, 1 Tewas, 2 Kritis MEDAN (Waspada): Pengendara sepedamotor Revo BK 2166 QM yang belum diketahui identitasnya, menabrak dua pejalan kaki saat menyeberang di Jln. Sisingamangaraja Km 10 depan GKPI, Kel. Timbangdeli, Kec. Medan Amplas, Rabu (9/ 1) sekira pukul 20:00. Akibatnya, pejalan kaki bernama Kartina Harahap, 45, warga Jln. Sisingamangaraja Medan, tewas sedangkan temannya Prentiana Peranginangin, menderita luka-luka dan kini dirawat di Rumah Sakit Nursaadah, Tanjungmorawa. Informasi yang diperoleh di kepolisian, malam itu pengendara sepedamotor Revo dan temannya bernama Riza Vionita, 18, warga Jln. Sisingamangaraja Km 11,5, hendak pulang dari arah inti Kota Medan menuju Jalan Medan-Tanjungmorawa. Persis di depan gereja GKPI, pengendara sepedamotor Revo tiba-tiba menabrak dua pejalan kaki yang sedang menyeberang jalan. Diduga kecelakaan itu terjadi karena penglihatan pengendara sepedamotor kurang awas, apalagi di kawasan tersebut agak gelap.

Akibat ditabrak, Kartina Harahap dan temannya Prentiana Peranginangin terpelanting ke tengah jalan. Korban Kartina Harahap menderita luka serius, bagian kepalanya robek dan segera dilarikan ke RS Nursaadah. Meski sudah mendapat perawatan serius, korban akhirnya meninggal. Sedangkan Prentiana Peranginangin masih mendapat perawatan intensif. Selain kedua korban, teman pengendara sepedamotor bernama Riza Vionita yang dibonceng, juga mengalami luka robek di bagian kepala dan kaki. Sementara pengendara sepedamotor langsung menghilang usai kejadian. Di tempat terpisah, pengemudi mobil bernama Cindityani, 34, warga Jln. Laksana, Kec. Medan Area, menabrak sepasang suami istri Atmaja Sahputra, 32, dan Afni, 25, di Jalan HM Yamin, Kamis (10/1) dinihari. Bukan itu saja, pengemudi mobil juga menghantam ruko milik Mohan Sigh. Peristiwa berawal saat Cindityani yang mengemudi mobil Avanza BK 1065 QP melaju dari arah Jln. Perintis Kemerdekaan

menuju Simpang Aksara. Saat di persimpangan Jln. Sentosa Lama, tiba-tiba pengemudi Avanza menabrak pasangan suami istri yang sedang mengendarai sepedamotor RX King BK 5069 BQ dari belakang. Diduga mengantuk, Cindityani bukan hanya menabrak pasutri itu, mobilnya banting setir ke arah kiri sehingga menabrak rumah toko (ruko) milik Mohan Sigh. Seketika situasi di lokasi kejadian langsung dipadati oleh sejumlah warga. Namun, dalam kecelakaan itu tidak ada menelan korban jiwa. Pasangan suami istri yang ditabrak itu hanya mengalami luka ringan.Warga yang melihat peristiwa ini dengan cepat menghubungi Petugas Sat Lantas Polresta Medan. Dua personel Unit Laka Sat Lantas Polresta Medan Aiptu Basuki dan Aiptu Syahnan segera mengamankan mobil dan sepedamotor tersebut ke Unit Laka. Kasat Lantas Polresta Medan Kompol Risya Mustario membenarkan kecelakaan tersebut. “Benar, sopir dalam keadaan ngantuk,” ujarnya singkat. (h04)

Bina Marga Provsu Gelar Silaturahmi MEDAN (Waspada): Keluarga besar Dinas Bina Marga Provsu menggelar acara silaturahmi Tahun Baru 2013 di halaman kantor tersebut Jln. Sakti Lubis No. 7-R Medan, Kamis (10/1). Ketua Panitia Antoni Brena, ST, MM didampingi Kasubbag Umum HM Riduan Harahap, SSos, MAP dan Bendaharawan Rudi Hartono mengatakan, kegiatan ini dihadiri seluruh jajaran Dinas Marga Provsu. Di antaranya Kepala UPT dan Kepala Balai Pelaksanaan Jalan Nasional I Ir. Wijaya Seta, Kadis Bina Marga Provsu Ir. HM. Arman Effendy Pohan,MSi; Asisten II Ekbang Dr. Sabrina, MSi mewakili Plt Gubsu dan staf ahli bidang Pemberdayaan Masyarakat Zulfi Taufik, SH serta seluruh pegawai, para pensiunan. “Silaturahmi Tahun Baru 2013 bertujuan untuk menjalin keakraban di antara pimpinan, staf dan seluruh pegawai guna menyatukan persepsi dalam meningkatkan etos kerja dan memberikan pelayanan kepada masyarakat secara prima,” ujar Antoni. Kadis Bina Marga Provsu Ir. HM Armand Effendy Pohan mengharapkan kegiatan ini jangan semata-mata dijadikan acara seremonial tapi dapat mempererat hubungan yang baik dalam keluarga besar Bina Marga. Kemudian, meningkatkan kinerja di bidang masing-masing dalam memberikan pelayanan kepada masyarakat secara maksimal. “Sebagai pimpinan, saya mengucapkan terimakasih kepada jajaran panitia yang telah berupaya keras mengadakan silaturahmi Tahun Baru 2013. Semoga di tahun 2013 ini seluruh staf dan pegawai memiliki semangat yang tinggi dalam berkarya sebagai PNS dengan meningkatkan kinerja secara ikhlas dan cerdas,” pinta Armand Effendy Pohan.(m24)

Pengurus MKI Sumut Dikukuhkan MEDAN (Waspada): Dewan Pendiri Majelis Khonghucu Indonesia (MKI) mengukuhkan kepengurusan MKI Provinsi Sumatera Utara, kepengurusan Kota Medan, dan kepengurusan Kecamatan Medan Area, di Sekretariat MKI Sumut Jln. Gandi Medan, Minggu (23/12). Pengukuhan dilakukan oleh Suardi, mewakili dari tiga orang Dewan Pendiri MKI (Tjie Siong, Libio Satia, dan Suardi) yang juga turut menghadiri pengukuhan tersebut. Pengurus Kota Medan yang dikukuhkan antara lain, Ketua Henry Kho, Sekretaris Hendra Wijaya, dan Bendahara Marysa Salim. Sedangkan pengurus Kecamatan Medan Area, Ketua Sariawaty, Sekretaris Karsono, dan Bendahara Eri Hendri. Suardi berharap pengurus yang sudah dilantik dapat bekerja dengan baik dan maksimal dalam melakukan pembinaan kepada umat Khonghucu, dan selalu menjalin hubungan yang baik dengan tokoh-tokoh lintas agama di daerahnya masing-masing.(m26)

Terkait Pembubaran RSBI

Kadisdiksu Akan Koordinasi Dengan Kemendikbud MEDAN (Waspada): Kepala Dinas Pendidikan Sumut (Kadisdiksu) Drs Syaiful Syafri menyebutkan, akan segera melakukan koordinasi dengan Kementerian Pendidikan dan Budaya RI terkait keputusan MK pembubaran Rintisan Sekolah Bertaraf Internasional (RSBI). “Dengan diterbitkan keputusan MK terkait RSBI, berarti RSBI itu ditutup. Kita saat ini akan melakukan koordinasi dengan Kemendikbud RI, karena menteri pendidikan telah mengakui keputusan MK tersebut,” kata Syaiful kepada wartawan, Rabu (9/1). Menurut dia, untuk RSBI yang ada di Sumut, nantinya hasil koordinasi dengan menteri akan disampaikan ke sekolahsekolah RSBI. “Kita pasti akan beritahu kepada sekolah RSBI. Apapun hasil koordinasi dengan menteri selanjutnya kita sampaikan ke pihak penyelenggara RSBI. Kita undang mereka,” kata Syaiful yang menjelaskan, semua sekolah mendapat tempat yang sama di mata pemerintah baik aspek pelayanan, aspek sarana prasana, dan aspek bantuan. Kata dia, secara rincian ada 16 SMK RSBI di Sumut, yakni SMKN 2 Kisaran, SMKN 1 Percut Seituan, SMKN 1 Lubuk Pakam, SMKN 2 Tebing Tinggi, SMKN 1 Padang Sidempuan, SMKN 3 P Siantar, SMKN 8 Medan,

SMKN 3 Medan, SMKN 1 Siatas Barita, SMKN 1 Raya, SMKN 2 Doloksanggul, SMKN 1 Balige, SMK Telkom Sandhy Putra Medan, SMK Teladan Medan, SMK Tunas Pelita Binjai, dan SMK Amir Hamzah Indrapura. Sedangkan untuk SMA adalah SMAN 1 Medan (APBN), SMAN 2 Balige, SMAN 1 Matauli Pandan, SMAN 2 Plus Sipirok, SMAN 1 Brastagi, SMAN 1 Tebing Tinggi, SMAN 1 Sidikalang, SMAN 2 Kisaran, dan SMAN 2 Lubuk Pakam. Sedangkan SMP RSBI antara lain SMPN 1 Medan, SMPN 1 Tebing Tinggi, SMPN 1 Binjai dan SMP 1 Sidikalang. “Untuk swasta SMA Swasta Sutomo 1 (Mandiri), SMA Swasta Plus Shafiyatul Amaliyah (Mandiri), namun yang jadi ketetapan MK itukan yang negeri,” ujarnya. Beri Solusi Sebelumnya, Anggota DPDRI asal Sumatera Utara Parlindungan Purba SH mengatakan, pemerintah harus segera memberikan solusi pada siswa di RSBI terkait nasibnya. Jangan sampai keputusan MK yang seharusnya membuat siswa lebih baik karena tidak dibebankan pada pembayaran yang mahal, menjadi dilema. “Segeralah berikan solusi dan pemberitahuan kepada pihak sekolah, siswanya akan ujian akhir sekolah dan akan naik kelas. Apakah harus di-

samakan dengan kelas reguler atau ada cara lainnya,” kata Parlindungan. Tunggu Pemerintah Sebelumnya Kepala SMAN 1 Medan Ahmad Siregar mengatakan, SMAN 1 Medan sebagai sekolah RSBI tetap menunggu keputusan pemerintah. “Kita hargai keputusan MK itu, cuma kita menunggu petunjuk dari kementerian,” katanya. Dia menjelaskan, sebenarnya tidak terlalu terkejut dengan keputusan MK terkait RSBI karena memang sejak beberapa bulan lalu, Dirjen Pendidikan Dasar dan Menengah sudah menginformasikan kalau kalah di MK, maka akan dibuat program yakni sekolah unggulan, tapi yang jelas kementerian tetap berupaya agar ada keunggulan yang diharapkan bisa bersaing secara internasional. “Artinya, jika kita telusuri latar belakang RSBI awal Sekolah Standar Nasional (SSN). Ini program kementerian agar murid-murid yang pintar didorong bisa bersaing internasional, tentunya program di kabupaten/ kota 1 sekolah. Tapi karena di daerah tidak memenuhi persyaratan, apa yang diprogramkan tidak jalan. Bayangkan dari 33 kabupaten/kota hanya ada 4 RSBI untuk SMP,” sebutnya. Sedangkan Kepala SMKN 1 Percut Seituan Drs Kasni MPd, mengaku belum mendapat

sosialisasi terkait keputusan MK soal penghapusan RSBI baik dari dinas pendidikan provinsi maupun kabupaten/kota. “Belum ada pemberitahuan resmi tentang keputusan MK ini, sekolah ini memang terdaftar sebagai RSBI dengan SK tahun 2008, tapi kami tidak memakai RSBI karena memang belum ada dasar hukum dan kekuatan. Tetapi, Direktorat SMK sebenarnya sudah punya program namanya sekolah unggulan, sekolah model atau sekolah mandiri,” katanya. Dukung Di tempat terpisah, pemerhati pendidikan sekaligus Ketua Asosiasi Guru Agama Islam (AGPAI) Sumut Ali Nurdin MAg, menyampaikan dukungan atas penghapusan RSBI. Dia beralasan, selama ini sekolah RSBI terkesan sekolah untuk orangorang berduit saja, karena biaya yang dibayar oleh setiap siswa cukup mahal. Hal ini terkesan RSBI adalah sekolah yang membedakan antara anak kaya dan miskin. “Sebenarnya program RSBI selama ini terlalu dipaksakan, padahal di internasional karena lebih banyak mudharat daripada manfaatnya. Jika sekolah RSBI hanya diukur darsi segi kemampuan komunikasi dengan bahasa Ingggris, ini bukanlah sesuatu yangg terlalu dibanggakan. Sekolah RSBI semakin membuka dan memperlebar

jurang pemisah antara si kaya dan si miskin. Sejak dikeluarkannya Peraturan Menteri Pendidikan Nasional (Permendiknas) No.74 tahun 2009 tentang RSBI/SBI sampai sekarang belum nampak kelebihan yang luar biasa dalam hal peningkatan kualitas pendidikan dan pengajaran,” kata Nurdin. Nurdin berharap agar kedepannya DPR benar-benar selektif dan mengkaji secara mendalam sebelum memutuskan atau membuat undang-undang. Karena munculnya RSBI itu adalah implementasi dari Pasal 50 ayat 3 Undang Undang No. 20 tahun 2003 tentang Sistem Pendidikan Nasional. Sekarang, setelah MK membatalkan pasal tentang RSBI tersebut, maka partai politik di parlemen ramai-ramai menyatakan sependapat dengan putusan MK. Padahal, mereka sendiri (DPR) yangg membuat undang-undang tersebut yang mengakibatkan munculnya RSBI. “Pemerintah dalam hal ini Menteri Pendidikan harus segera memberikan ketetapan pada RSBI terkait status siswa dan sistem penanganan yang efektif. Jangan sampai keputusan ini memberikan dampak pada siswa dalambelajar.Apalagidalamwaktu dekat akan berlangsung ujian akhir sekolah sebagai sarana kelulusan siswa. Harus ada ketetapan dari pusat,” tutur Nurdin. (m37)

B6

Dirgahayu

WASPADA

KH Zulfiqar Hajar :

Usia 66 Tahun, Waspada Sangat Luar Biasa MEDAN (Waspada):Ketua Komisi Dakwah dan Pemberdayaan Masyarakat MUI Kota Medan Al-Ustadz KH Zulfiqar Hajar Lc, (foto) menilai, dalam usianya ke-66 tahun Harian Waspada sangat luar biasa. “Hingga saat ini, Harian Waspada merupakan satusatunya media massa sangat diminati masyarakat. Bahkan, sebagai rujukan berita peristiwa yang terjadi se antero dunia ini,” katanya di Medan, kemarin, dalam mengomentari keberadaan Harian Waspada di usianya ke-66 tahun yang jatuh pada 11 Januari 2013. Dia mencontohkan peristiwa-peristiwa terjadi di Timur Tengah, terutama berkaitan dengan umat Islam tidak luput dari pemberitaan Harian Waspada. Bahkan, saat Perang Teluk terjadi beberapa tahun lalu, Waspada sangat getol menyajikan berita-berita tentang umat Islam yang menjadi korban perang itu. Begitu pula kepeduliannya terhadap kalangan ustadz dan ulama, khususnya di Sumut, sambungnya, sangat besar, apalagi terhadap ustadz atau ulama yang kharismatik. “Saya pernah datang malam-malam ke kantor Waspada sekitar pukul 22.00 WIB sekitar 5 tahun lalu untuk memasukkan berita meninggal dunianya ulama terkenal Syekh Arifin Isa, langsung Waspada menerbitkan beritanya keesokan harinya. Mungkin malam itu waktu deadline koran ini sudah mendekati, tapi masih mau menerima informasi yang kita berikan,”jelas KH Zulfiqar Hajar yang juga Pimpinan Majlis Ta’lim Jabal Noor Medan. Dia melihat, masyarakat senang membawa Waspada, karena bahasa yang disajikan dalam pemberitaannya enak dibaca. Bahkan, berita-berita tentang masalah keagamaan, khususnya menyampaikan aspirasi umat Islam selalu tampil di halaman utama. Demikian pula di Waspada, ujarnya, ada Rubrik Mimbar Jumat yang menyajikan tulisan-tulisan ulama dan ustadz serta profil ulama ataupun filosofi Islam masa dahulu serta adanya jadwal khatib Jumat, tidak saja berada di wilayah Medan dan sekitarnya, tetapi juga luar Kota Medan. “Beritanya selalu aktual, dapat dipercaya, relevan serta selalu mengungkap aspirasi masyarakat bawah. Sewaktu saya berkunjung ke Aceh, banyak warga di sana saya lihat membeli dan membaca Waspada,” sebutnya. Dia berharap dengan penampilan yang sangat menarik dari Harian Waspada, di masa-masa mendatang Waspada akan “Go International”. Sedangkan masukan bagi Waspada, ulama kondang ini berharap agar berita berimbang (balance) yang disajikan tetap dipertahankan. Begitu pula dengan Rubrik Mimbar Jumat, jika perlu halamannya ditambah lagi dengan memperbanyak tulisan-tulisan ulama, ustadz dan cendekiawan muslim. Sejarah Dengan Waspada Pada bagian lain keterangannya, KH Zulfiqar Hajar memiliki sejarah dengan Harian Waspada. Hal ini berawal tahun 1973. Saat itu, atok dan pakcik kandungnya Yahya Ismail (sudah meninggal dunia) dan H Abdul Rahman bekerja di bagian percetakan Waspada. Pada tahun itu, diselenggarakan MTQ antarmedia massa yang melibatkan keluarga besar masing-masing media massa. KH Zulfiqar Hajar diajak atok dan pakcik kandungnya untuk mengikuti MTQ antarmedia itu dan disanggupinya. Ternyata, dalam MTQ itu dia berhasil meraih juara 1 tingkat remaja mewakili Waspada. “Sejak itu, saya bangga menjadi keluarga besar Harian Waspada dan dibesarkan suratkabar ini. Bahkan, sewaktu saya meraih juara 1 MTQ antarmedia itu, saya diberi hadiah oleh Ibunda Hj Ani Idrus ,”ungkapnya seraya menambahkan, setiap ada acara peringatan hari-hari besar Islam, dia selalu tampil sebagai qarinya. Perjalanan sejarahnya dengan Waspada tidak berhenti di situ. Pada tahun 1976, sewaktu hendak melanjutkan studi ke Universitas Al-Azhar Kairo, Mesir, dia sempat berpamitan dengan Ibunda Hj Ani Idrus. Di samping diberikan uang saku sebagai bekalnya selama berstudi, Ibunda Hj Ani Idrus juga menitipkan sepucuk surat untuk seorang koresponden Waspada di Kairo bernama H Abdul Muis Nasution dan bertemu di Kairo. Setelah itu, H Abdul Muis Nasution membantunya dalam urusan perkuliahan, seperti tempat tinggal. Menurut KH Zulfiqar Hajar, setelah mahasiswa Medan banyak berkuliah di Universitas Al-Azhar Kairo, H Abdul Muis Nasution menghubungi Ibunda Hj Ani Idrus agar suratkabar Waspada dapat dikirim ke Kairo sebulan sekali. Ternyata, maksud itu dikabulkan Ibunda Hj Ani Idrus. “Setelah Waspada masuk Kairo, menjadi satu-satunya suratkabar dari Pulau Sumatera yang ekspansi ke Kairo. Saya merasa bangga, karena suratkabar Medan ini bisa beredar di negeri yang jauh,” ujar ulama yang 13 tahun berada di Timur Tengah. KH Zulfiqar Hajar juga menceritakan, setiap kali Ibunda Hj Ani Idrus menunaikan ibadah haji ke Tanah Suci, dia bersama H Abdul Muis Nasution dan Dr H Sofyan Sauri dari Belanda membimbing ibunda dalam berhaji. (cwan)

Semoga Harian WASPADA tetap jaya dan semakin profesioal melaksanakan fungsinya sebagai media dengan menyajikan berita faktual,terdepan,berimbang” Dari :

H.M. IDAHAM, S.H, MSi WALIKOTA BINJAI

ZAINUDDIN PURBA, S.H KETUA DPRD KOTA BINJAI

TIMBAS TARIGAN, S.E WAKL WALIKOTA BINJAI

H. ELYUZAR SIREGAR, S.H SEKRETARIS DAERAH KOTA BINJAI

WASPADA Jumat 11 Januari 2013

Laporan Khusus

WASPADA Jumat 11 Januari 2013

B7

Mengandung Simbol Melayani

Sambung Rasa Lahirkan Kebijakan Pro Rakyat Badan Kesbangpol Linmas Pemprovsu

P

rogram Sambung Rasa Plt. Gubsu H Gatot Pujo Nugroho, ST dengan berbagai elemen organisasi kemasyarakatan (ormas) dan lembaga swadaya masyarakat (LSM) yang dilaksanakan Badan Kesatuan Bangsa, Politik dan Perlindungan Masyarakat (Kesbangpol dan Linmas) Provinsi Sumut melahirkan kebijakan yang lebih pro rakyat. Demikian salah satu kesimpulan pendapat dari berbagai pihak antara lain dari Plt Gubsu sendiri, Dekan Fakultas Psikologi USU Prof DR Hj Irmawati Psikologi dan Pengamat Sosial Politik dari FISIP USU Drs Ahmad Taufan Damanik MA, pekan ini. “Dalam kondisi masyarakat seperti ini maka resep utama agar komunikasi antara pemimpin dengan masyarakatnya terjalin harmonis maka semua akses harus dibuka seluasluasnya,” ujar Plt Gubsu H Gatot Pujo Nugroho, ST pada sejumlah kesempatan sambung rasa langsung dengan berbagai elemen ormas dan LSM. Didampingi Sekdaprovsu H Nurdin Lubis, SH MM dan Kepala Biro Keuangan Setdaprovsu H Baharuddin Siagian SH MSP, Plt Gubsu menjelaskan kegiatan ini diarahkan untuk memperkuat komitmen Pemprovsu mewujudkan pemerintahan yang tidak berjarak dengan masyarakat sebagai simbol kepemimpinan yang melayani dan merakyat Kepala Badan Kesbangpol Linmas Provinsi Sumut Drs H Eddy Syofian, MAP mengemukakan sambung rasa juga merupakan implementasi satu dari 8 Perintah Harian Gubernur Sumut (Gubsu). Pada 17 Juni 2008 lalu, sehari setelah pasangan H Syamsul Arifin , SE dan H Gatot Pujo Nugroho, ST yang dikenal sebagai pasangan Syampurno dilantik menjadi Gubsu dan Wagubsu masa bakti 2008 - 2013, pada apel perdana di Kantor Gubsu di Medan, kepemimpinan pasangan ini mengeluarkan Delapan Perintah Harian. Salah satu perintah tersebut menginstruksikan seluruh jajaran birokrasi di Sumut mulai dari tingkat pimpinan sampai jajaran terbawah, agar membangun komunikasi yang tidak berjarak dengan masyarakat. Komunikasi dimaksud dilakukan secara efektif dan berdayaguna baik langsung maupun melalui teknologi informatika sehingga berjalan lancar dan efektif. “Muaranya agar tidak ada ada simpul-simpul komunikasi yang tersumbat,” ujar Eddy Syofian didampingi Kabid Politik Dalam Negeri Ahmad Firdausi Nasution, Sekretaris Badan Kesbangpol Linmas Mahmuddin, Kabid Idiologi Zulkarnain Rangkuti, Kabid Kewaspadaan Nasional H Muhammad D dan Kasubbid Parpol Valentina Ginting. Plt Gubsu H Gatot Pujo Nugroho ST yang dalam dua terakhir ini secara de facto me-

PLT Gubsu H Gatot Pujo Nugroho, ST diabadikan bersama para pemimpin organisasi kemasyarakatan di Gubernuran, Jalan Sudirman Medan, Jumat 7 Desember 2012. megang kendali tampuk kepemimpinan Sumut memahami benar hakiki dari program sambung rasa ini. Dekan Fakultas Psikologi USU Prof DR Hj Irmawati Psikologi menilai sambung rasa dan komunikasi tidak berjarak dengan masyarakat sangat strategis dilakukan Pemprovsu mengingat Sumut merupakan daerah dinamis, terbuka dan heterogen, yang sering oleh banyak pihak diibaratkan sebagai Miniaturnya Indonesia. Irmawati maupun pengamat sosial politik FISIP USU Ahmad Taufan Damanik MA senada mengemukakan secara struktural tentu Gubsu banyak menerima masukan dari jajaran birokrasi yang dipimpinnya termasuk dari staf ahli dan para pakar. “Semua ini akan lebih efektif setelah Gubsu mendengar langsung dari masyarakat antara lain melalui sambung rasa. Perpaduan pendapat formal dan aspirasi yang langsung diterima dari masyarakat itu akan membuat Gubsu mengambil kebijakan diyakini lebih pro rakyat,” ujar Taufan Damanik. Sejumlah Ulama dan Pemuka Agama diantaranya Ustadz H Muhammad Suheiri LC saat dialog sambung rasa di Pesantren Talfiz Al Quran Mukhlisin Tanjungtiram Batubara mengemukakan masyarakat termasuk para Ulama memang senantiasa mendambakan pemimpin mau berkomunikasi dan mendatangi rakyatnya.

Konsepsional Kepala Badan Kesbangpol Linmas Provinsi Sumut Drs H Eddy Syofian, MAP juga mengaku komitmen komunikasi tidak berjarak dilaksanakan secara konsepsional oleh Syampurno hingga kepemimpinan Plt Gubsu H Gatot Pujo Nugroho dewasa ini. “Bahkan, dengan kepiawaian dan latar belakang Pak Gatot selaku seorang Ustadz, program sambung rasa ini tidak hanya dilakukannya di kantor atau di dalam ruangan dengan ormas, LSM atau forum-forum strategis masyarakat lainnya,

namun berkembang hingga ke majelis-majelis taklim, dari satu Masjid ke Masjid lainnya, bahkan dari satu Tabligh Akbar ke Tabligh Akbar lainnya,” ujar Eddy Syofian yang mantan Kadis Kominfo Sumut ini. Memang, keterampilan maupun pengalaman Gatot Pujo Nugroho berdakwah bisa dikatakan sebagai salah satu kelebihan beliau dalam memimpin Sumut. Dalam membangun komunikasi yang tidak berjarak dengan masyarakat, selain selaku seorang pemimpin pemerintahan, Gatot dalam menyampaikan pesan-pesan pembangunan dan pembinaan kemasyarakatan itu juga tampil selaku pemimpin umat melalui metode-metode dakwah yang sangat religius. Prof DR Irmawati Psikologi mengemukakan upaya-upaya yang dilakukan dalam membangun sambung rasa ini memiliki prinsip merakyat dan melayani. Pengertian melayani dalam konteks ini yaitu Plt Gubsu Gatot Pujo Nugroho sangat faham tentang karakteristik masyarakat Sumut. Intinya, masyarakat Sumut dikenal sebagai masyarakat yang multi kultural dan terbuka terhadap kebudayaan apapun. Akan tetapi, masyarakat Sumut di tengah-tengah keterbukaannya itu sangat menjunjung tinggi nilai-nilai budaya leluhur. Hal ini dapat dibuktikan dari cukup banyaknya nilai-nilai kearifan lokal yang masih berlaku dan diterapkan di tengah-tengah masyarakat, serta dijunjung tinggi oleh masyarakat Sumut. Atas dasar itulah, lanjut Eddy Syofian pemahaman dan pemaknaan tentang melayani tersebut sangat dirasakan oleh Gatot bahwa prinsip melayani itu adalah melayani masyarakat dari berbagai suku, etnik, golongan bahkan dari berbagai umat beragama, semua itu tidak boleh dibeda-bedakan. “Itulah konsep yang dikembangkan Plt Gubernur Sumut Bapak H Gatot Pujo Nugroho, bahwa setiap apa pun keberadaan etnik, suku, golongan atau umat beragama tidak boleh ada satu pun yang dipinggirkan,

apalagi diabaikan, tetapi semuanya diakomodir dalam bentuk adil yang proporsional dengan mengedepankan bahwa yang berprestasi itu adalah harus rakyat dan yang berprestasi itu berhak maju, dari golongan, etnis maupun suku apapun tidak perlu dipermasalahkan,” ujarnya. Konfigurasi ini telah diwujudkan oleh Gatot Pujo Nugroho dalam birokrasi pemerintahan Provinsi Sumatera Utara. Atas dasar konsep melayani seperti inilah mendorong partisipasi aktif masyarakat Sumut. Apalagi, masyarakat Sumut sesungguhnya sangat memahami bahwa untuk menjadi pemimpin di Sumut bukan karena etniknya, bukan karena latar belakang budayanya, tetapi lebih mengedepankan sejauh mana pemimpin itu mampu beradaptasi, sejauh mana bisa menjunjung tinggi kearifankearifan lokal dan mampu berinteraksi dengan semua komponen kemasyarakatan.

Komunikasi Produktif Program Sambung Rasat dilakukan Gatot dalam wujud berkomunikasi produktif dan tidak berjarak dengan masyarakat dalam berbagai kesempatan. Dalam hal ini, ujar Eddy Syofian yang mantan Walikota Tebingtinggi prinsip tersebut dijabarkan oleh Badan Kesbangpol Linmas Sumut melalui Program Sambung Rasa, yang intinya membuka akses Gubernur Sumut dengan berbagai elemen ormas dan LSM secara terencana dan terprogram. “Pemimpin yang berkomunikasi dengan rakyat baik langsung maupun dengan menggunakan teknologi informatika akan bisa langsung lebih konprehensif mendengar dan merasakan aspirasi maupun denyut nadi kehidupan sosial kemasyarakatan secara riel dan objektif,” tutur Eddy Syofian. Selain melakukan komunikasi langsung secara kualitatif dan kuantitatif, baik melalui Majelis Taklim, sambung rasa dengan toloh masyarakat dan kelompok strategis lainnya di Gubernuran Sumut, menerima

Waspada/Ist

PLT Gubsu H Gatot Pujo Nugroho, ST melakukan sambung rasa juga di masjid sekaligus menjadi imam shalat dan menerima curhat dan masukan ulama sebagaimana di Masjid Pesantren Talfiz Alquran Mukhlisin di Tanjungtiram Kab. Batubara.

audiensi, unjukrasa, berkunjung ke daerah-daerah dan lainnya, Plt Gubsu juga aktif berkomunikasi melalui teknologi informatika. Memang, Gatot Pujo Nugroho, dalam hal teknologi informatika dikenal cukup gemar dan aktif menggunakannya. Kemana-mana dan dalam kesempatan apa saja, perangkat informatika selalu ada di tangannya, seperti i-pad atau i-phone dan sejenisnya. Beliau juga aktif menggunakan jaringan komunikasi sosial di internet seperti melalui facebook, twitter, BBM dan sejenisnya, yang tidak hanya dapat dimanfaatkan untuk membicarakan hal-hal yang berkaitan dengan pemerintahan, pembangunan dan pembinaan kemasyarakatan, tetapi juga topik dakwah dan masalah sosial keagamaan. Kalau mengenai SMS sejak masih menjabat Wakil Gubsu selalu terbuka untuk umum, nomor handphone (HP) nya dapat diketahui masyarakat secara luas dan tidak bergantiganti nomor melainkan aktif 24 jam terutama menerima SMS dari masyarakat. “Semua itu menggambarkan, komunikasi yang dibangun Bapak Gubsu ingin selalu mendekatkan diri dengan masyarakt agar tidak berjarak,” jelas Eddy Syofian. Oleh sebab itu lanjutnya konsep sambung rasa yang dimaksudkan Bapak Gatot adalah mendorong agar seluruh jajaran pemimpin termasuk satuan kerja perangkat daerah (SKPD) Pemprovsu juga membangun komunikasi yang tidak berjarak dengan mitramitra kerjanya. Dengan terbukanya akses komunikasi maka tidak ada simpul-simpul informasi yang tersumbat sehingga fungsi koordinasi dan sinkronisasi dapat berjalan baik dan semua tugas maupun kendala atau masalah yang muncul bisa diselesaikan dengan baik.

Mulai Harmonisasi Sampai Nikah Siri Program Sambung Rasa

yang mengedepankan merakyat dan melayani adalah salah satu cara strategis dan ampuh dalam menjaga keharmonisan Sumatera Utara dalam seluruh aspek dan sosial politik kemasyarakatan. Dengan keharmonisan inilah maka Propinsi Sumatera Utara akan tetap menjadi model nasional dalam bidang kerukunan dan menjadi contoh bagi kerukunan nusantara, bangsa dan negara. “Salah satu resep paling ampuh agar Sumatera Utara tetap menjadi model kerukunan nasional adalah bagaimana pemimpinnya berpegang teguh, berkomitmen dan konsisten untuk terus membangun komunikasi yang tidak berjarak dengan masyarakat,” ujar Eddy Syofian. Khusus tentang Program Sambung Rasa yang dibidani Badan Kesbangpol Linmas Provinsi Sumut Eddy Syofian memaparkan manfaatnya cukup banyak dan strategis. Dari sejumlah kegiatan Sambung Rasa Plt Gubsu H Gatot Pujo Nugroho ST dengan berbagai komponen masyarakat, pimpinan ormas, LSM, Pemuka Agama, organisasi perempuan dab kelompok strategis masyarakat lainnya, telah terbukti dan dapat dirasakan masyarakat bahwa saat ini tidak ada lagi kekakuan, tidak ada lagi kesan seolah-olah pemimpin eksklusif, seakanakan menghindar, tidak perduli atau cuek, tidak lagi segan dan berbagai rumor lainnya yang seolah-olah mengisyaratkan ada jarak pemisah antara pemimpin dengan masyarakat. “Kini semuanya telah berjalan terbuka dan harmonis serta cukup akrab penuh kekeluargaan hubungan antara bapak Gubsu dengan masyarakat,” ujar Eddy Syofian berdasarkan hasil evaluasi sejumlah program sambung rasa yang dilaksanakan pihaknya. Pengamat Sosial Politik Ahmad Taufan Damanik juga mengemukakan saat ini masyarakat sudah tidak sungkansungkan atau segan-segan lagi menanyakan langsung kepada Plt Gubsu tentang berbagai hal. Sementara itu dalam ber-

Waspada/Ist

bagai kegiatan sambung rasa memang masyarakat tidak lagi ragu mengonfirmasikan banyak hal yang berkembang , mulai dari masalah pemerintahan, pembangunan, pembinaan sosial politik kemasyarakatan, pelayanan publik hingga pertanyaan-pertanyaan yang bersifat pribadi seperti masalah isu nikah siri. Hal ini dapat dilihat pada acara Sambung Rasa Plt Gubsu dengan fungsionaris organisasi kemasyarakatan dan tokoh di Gubernuran Sumut di Medan, Sabtu 29 Desember 2012 lalu. Didampingi Kepala Badan Kesbangpol Linmas Sumut Drs H Eddy Syofian, MAP saat itu dihadapan sejumlah legiun veteran, pimpinan ormas, organisasi perempuan, organisasi kepemudaan dan lainnya, Gatot menjawab sejumlah pertanyaan dan curhat (curahan hati) hadirin dengan ramah dan lapang dada. Berbagai hal ditanggapi Gatot dari pertanyaan para tokoh, mulai dari soal pembangunan, pembinaan kemasyarakatan hingga menyentuh pribadi Gatot diantaranya soal isu nikah siri, di mana Gatot menegaskan hingga saat ini isterinya hanya seorang yakni Hj Sutiyas Handayani. Dengan lugas Gatot juga menyampaikan dirinya komit dan konsisten mengupayakan penghentian praktek prostitusi karena dalam berbagai aspek hidup dan kehidupan dirinya tetap menjunjung tinggi nilainilai Agama dan ajaran Agama harus tetap menjadi pondasi bagi setiap pemimpin.

Saling Terbuka Manfaat lainnya dari program Sambung Rasa lanjut psikolog Prof DR Hj Irmawati kedua belah pihak yakni pemimpin Sumut dan masyarakat bisa saling terbuka. Di satu sisi masyarakat bisa langsung terbuka menyampaikan aspirasi bahkan unek-uneknya, di sisi lain pemimpin bisa menyampaikan keadaan yang ada kepada masyarakat. Hal ini juga diakui Eddy Syofian seraya mencontohkan dari sejumlah kegiatan sam-

bung rasa yang sudah dilakukan masyarakat banyak mengeluhkan soal infrastruktur yang memerlukan perbaikan misalnya, masalah pendidikan, kesejahteraan sosial dan lainnya dapat “nyambung” bagi pemerintah untuk memberikan penjelasan objektif dan rasional sehingga permasalahan tidak menjadi komoditas tertentu apalagi dipolitisasi. Plt Gubsu mengakui jaringan komunikasi di antara kelompok-kelompok strategis masyarakat termasuk organisasi kemayarakatan (ormas) di Sumut yang berlangsung cukup baik ini, Alhamdulillah menjadikan kekompakan semakin solid sehingga Sumut tetap kondusif dan harmonis “Hubungan pemerintah provinsi dengan kelompok strategis masyarakat di Sumut saya nilai cukup produktif dan harmonis. Ini harus dipertahankan,” ujarnya. Gatot mengucapkan terima kasih dan apresiasi atas dukungan masyarakat bahwa hubungan komunikasi antar sesama masyarakat di tengah perbedaan suku, etnis, budaya serta Agama cukup baik dan perlu terus dilanjutkan demi kondusivitas Sumut. “Ini merupakan modal utama dan mendasar bagi pembangunan di Sumut dapat terus berkelanjutan. Dalam hal ini perlu peran aktif tokohtokoh, pemuda dan kaum ibu untuk tetap bersinerjitas mensyosialisasikan tentang kedamaian di Sumut,” ujarnya. Dijelaskan Gatot perbedaan merupakan kekayaan di Sumut dan untuk itu mari tetap bersatu menjaga kekondusifan dengan tetap menghargai perbedaan. “Saat ini Sumut sedang giatgiatnya membangun ekonomi masyarakat dengan membangun Bandara Kualanamu sebagai pendukung Sei Semangke dan lain sebagainya,” ujarnya. Untuk itu perlu kerjasama yang baik sehingga apa yang telah diprogramkan dapat terlaksana maka Sumut akan maju, lanjutnya.

Ide Dan Masukan

Lebih lanjut Kepala Kesbangpollinmas Provsu Drs H Eddy Syofian, MAP mengemukakan dari acara sambung rasa pihaknya juga banyak menerima ide dan masukan-masukan, baik dari atasannya yakni Gubsu dan Sekdaprovsu maupun dari komunikasi yang berkembang dalam dialog antara Gubsu dengan masyarakat. Oleh sebab itu jelas bahwa Sambung rasa ini dapat meneguhkan tekad, kuatkan kepekaan, keharmonisan dalam keberagaman untuk membangun Sumut yang lebih kondusif yang pada akhirnya akan memberikan peningkatan partisipasi rakyat untuk mengisi pembangunan dan terwujudnya budaya demokrasi yang tercermin dalam perilaku yang dilandasi moral, etika berdasarkan nilai-nilai luhur bangsa. “Semuanya itu diarahkan kepada tercapainya tujuan akhir berupa terwujudnya kondisi nasional yang demokratis dan utuhnya Negara Kesatuan Republik Indonesia (NKRI),” ujarnya. Baik Prof DR Hj Irmawati maupun Ahmad Taufan Damanik MA mengemukakan bahwa sambung rasa dianggap perlu terus-menerus dilanjutkan kepada organisasi kemasyarakatan, tokoh masyarakat, tokoh pemuda untuk saling mengisi dan melihat apa-apa saja yang kurang yang harus segera diperbaiki untuk kemajuan Sumut ke depan. (*)

Waspada/Ist

PLT Gubsu H Gatot Pujo Nugroho, ST (tengah) pada acara sambung rasa dengan LSM dipandu Kaban Kesbangpol Linmas Sumut Drs H Eddy Syofian, MAP guna mendengar aspirasi dan masukan dari komunitas NGO di Sumut.

Pentas Pilkada

B8

WASPADA Jumat 11 Januari 2013

Sahuti Aspirasi Warga Desa Bandar Kumbul

Waspada/Surya Efendi

CAWAGUBSU Tengku Erry Nuradi diabadikan para penarik betor di Rumah Silaturahmi Ganteng Jl. Adam Malik Medan, Selasa (8/1).

Tengku Erry Tampung Keluh Kesah Penarik Betor MEDAN (Waspada): Seluruh posko pasangan GanTeng harus berfungsi ganda. Selain sebagai tempat menyusun strategi pemenangan dan tempat bersilaturahmi, posko pemenangan GanTeng juga berperan sebagai wadah menampung ide, saran, keluhan dan berbagai persoalan. Hal ini disebutkan Calon Wakil Gubernur Sumatera Utara (Cawagubsu) Tengku Erry Nuradi saat menerima kehadiran puluhan penarik becak bermotor (betor) di Rumah Silaturahmi GanTeng, Selasa (8/1). Dalam kesempatan tersebut, Erry mengimbau posko pasangan GanTeng di seluruh kabupaten/kota untuk membuka diri menjadi tempat bermusyawarah sekaligus membangun kebersamaan dalam mencari solusi berbagai pemasalahan di Sumut. “Saya dan Mas Gatot bisa memahami kondisi saat ini. Tidak hanya elemen, organisasi, kelompok, secara perorangan juga banyak yang datang ke posko pemenangan pasangan GanTeng. Ada yang memberikan dukungan, sumbang saran, namun tidak sedikit yang menyampaikan berbagai persoalan dihadapi Sumut,” sebut Erry. Sebagai contoh, puluhan penarik becak bermotor (betor) yang tergabung dalam Tim Relawan Betor Ganteng, datang menyampaikan keluhannya terkait pajak betor yang tidak dapat dibayarkan langsung oleh pemilik betor. Selama ini, pembayaran pajak betor melalui koperasi. “Uniknya, koperasi yang menaungi betor mengenakan biaya administrasi yang relatif besarannya. Biaya tersebut dirasaan pemilik betor sangat memberatkan ditengah penghasilan yang

tidak menentu,” papar Erry. Belum lagi STNK dan BPKB atas nama koperasi, meski telah lunas kreditnya, mengakibatkan permasalahan yang ditanggung pemilik betor menjadi kompleks. “Saya terkejut mendengar keluhan pemilik betor. Setelah kredit betor lunas, STNK dan BPKBnya tetap atas nama koperasi. Jika ingin mengurus balik nama, tentu harus mengeluarkan biaya lagi. Mengapa saat akad kredit tidak dibuat atas nama kreditur,” tambah Erry. Sementara Ketua Relawan Betor GanTeng, Tasril Jambak mengeluhkan, tingkat persaingan betor dengan taksi dalam lima tahun terakhir semakin ketat. Apalagi sejumlah taksi nekat banting harga untuk mendapatkan simpati penumpang. “Taksi jelek dengan taksi baru sekarang ini juga bersaing. Akibatnya, taksi jelek banting harga. Dampaknya juga berimbas ke penarik betor. Kadang seharian kami tidak dapat sewa. Untuk dapur saja tidak cukup apalagi setoran kredit,” keluh Tasril. Tasril berharap kelak pejabat Pemerintah Provinsi Sumatera Utara (Pemprovsu) dan Pemerintah Kota (Pemko) Medan mendapatkan solusi terkait permasalahan seputar betor. Bisa berbentuk Peraturan Daerah (Perda) yang mengatur lintasan betor dan taksi di dalam kota atau larangan bagi taksi atau angkutan kota (angkot) mencari penumpang di kawasan tertentu. “Maksudnya Perda yang berpihak kepada betor. Misalnyataksidanangkottidakbolehmasukjalantertentu. Hanya boleh becak. Semacam itulah. Biar pemilik betor tetap bisa makan,” harap Tasril.(m46)

Posko STM 28 Pemenangan Amri Tambunan Gelar Zikir Dan Doa MEDAN (Waspada): Posko STM 28 Tim Relawan Pemenangan Drs. H. Amri Tambunan di Jalan STM mengadakan zikir dan doa bersama ibu-ibu pengajian Majelis Taklim se Kota Medan, Kamis (10/1). Ketua panitia Zulkarnaen Sayuti, SE mengatakan, kegiatan ini dihadiri seribuan ibu-ibu pengajian yang tergabung dalam Majelis Taklim se Kota Medan dengan tema : Surga di bawah telapan kaki ibu. “Zikir dan doa ini dilaksanakan untuk kesehatan Bapak Amri Tambunan dalam memimpin Kabupaten Deli Serdang dan pencalonannya sebagai Calon Gubernur Sumut periode 20132018,” jelas Zulkarnaen Sayuti. Kegiatan ini, lanjutnya, merupakan yang kedua kali di Posko STM 28 Tim Relawan Pemenangan Drs. Amri Tambunan di Jalan STM.“Pertama pada 17 Desember 2012 dan kemudian hari ini. Rencananya kegiatan zikir dan doa ini akan rutin dengan peserta yang terus bertambah,” kata Zulkarnean. Sedangkan Ibu Anita Amri Tambunan yang hadirdalamkegiatantersebutmengucapkanterima kasih kepada ibu-ibu pengajian Majelis Taklim se Kota Medan yang hadir dalam zikir dan doa. Isteri Amri Tambunan ini kemudian menceritakan kalau suaminya yang berasal dari birokrat menapak karir mulai dari bawah yakni menjadi pegawai di kantor kecamatan, Camat Tg. Morawa

Analisis:

sampai menjadi Bupati Deli Serdang. “Kita bukannya ria dengan apa yang sudah kita buat di Deli Serdang karena apa yang sudah kita lakukan di dunia ini akan dimintai pertanggungjawaban di kemudian hari,” jelas Anita Amri Tambunan. Menurut Anita, sudah empat tahun suaminya bertugas di Deli Serdang, sudah banyak SD yang sebelumnya tidak layak sekarang ini dibenahi, sehingga bisa membuat nyaman para pelajar yang menuntut ilmu. “SD di Deli Serdang saat ini semuanya sudah layak pakai,” jelasnya. Tidak itu saja, sebagai Bupati Deli Serdang, Amri Tambunan juga mempunyai program menargetkan 10.000 rumah yang tidak layak huni untuk bedah rumah. “Saat ini sudah ada 2.000 rumah yang tidak layak huni dibedah dan diberikan sertifikat rumah. “Dana ini bukan diambil dari APBN tapi dari partisipasi pengusaha dan masyarakat yang dikumpulkan,” kata Anita Amri Tambunan. Kepada ibu-ibu pengajian Majelis Taklim, Anita Amri Tambunan mengharapkan agar nanti dalam Pilkada memilih calon beristiqosah dahulu untuk memilih calon terbaik yang menyayangi kita semua serta sesuai yang kita harapkan. SedangkanHj.Surtiemmewakiliibu-ibupengajian mengucapkan terima kasih kepada Posko 28 Tim Relawan Pemenangan Amri Tam-bunan yang telah mengundang mereka untuk kegiatan zikir dan doa. (m39)

Relawan GusMan Bangun Drainase Dan Perbaiki Jalan 10 Km RANTAUPRAPAT (Waspada): Relawan pasangan Calon Gubernur dan Wakil Gubernur Sumatera Utara Gus Irawan Pasaribu dan Soekirman (GusMan) menyahuti aspirasi warga perdesaan di Desa Bandar Kumbul, Kecamatan Bilah Barat, Kabupaten Labuhanbatu dengan membuat aliran drainase sepanjang lebih kurang 10 kilometer serta penimbunan jalan rusak. “Pembuatan drainase serta penimbunan jalan itu atas usulan permintaan dari warga masyarakat yang ada di Desa Bandar Kumbul, Kecamatan Bilah Barat, Kabupaten Labuhanbatu kepada tim Relawan pasangan GusMan saat melakukan sosialisasi di lapangan,” ucap Sekretaris Relawan GusMan Kabupaten Labuhanbatu Raya Pasaribu kepada wartawan, Rabu (9/1) usai memantau lokasi pengerjaan di Desa Bandar Kumbul. Menurut Raya Pasaribu, atas usulan dari warga masyarakat tersebut, tim GusMan saat

ini baru bisa memenuhi permintaan atas pembuatan Drainase serta penimbunan jalan yang rusak dengan tanah dan batu sepanjang lebih kurang 10 kilometer. “Usulan masyarakat itu baru bisa dipenuhi untuk pembuatan drainase (parit kanan kiri) sepanjang lebih kurang 10 kilometer, serta perbaikan jalan rusak yang berlubang dengan menimbun menggunakan tanah dan batu,” ujarnya. Ini merupakan aspirasi dari warga masyarakat perdesaan, dan GusMan Labuhanbatu turun tangan mengerjakan dan memperbaikinya, ujar Raya. Raya Pasaribu juga menambahkan pengerjaan pembuatan drainase serta perbaikan jalan rusak yang berlubang itu dilakukan relawan GusMan bersamasama dengan warga setempat dan diperkirakan selesai satu minggu ini. Dalam pengerjaannya, untuk mempercepat penyelesaiannya juga diturunkan satu unit beko dan dua dump truck. Sementara Kepala Desa Bandar Kumbul, Kecamatan

Bilah Barat, Kabupaten Labuhanbatu Muhammad Toha Hasibuan saat dihubungi berterimakasih kepada relawan GusMan karena masyarakat sangat senang serta menyambut dengan gembira karena telah disahuti usulan warga masyarakat Desa Bandar Kumbul untuk pembuatan drainase dan penimbunan jalan rusak. Dikatakannya, pembuatan

paksa karena hubungan kerja dan atau hubungan kolegial, terpaksa karena tidak ada pilihan lain, terpaksa karena takut oleh simpul-simpul kekuatan sosial, serta terpaksa oleh faktor faktor lainnya. Jika dalam Pilgubsu 7 Maret 2013 nanti ada warga atau rakyat menolak dengan cara tidak datang ke TPS untuk memberikan hak suara, dapat dimaklumi karena dalam sistem yang ada pemberian suara politik merupakan hak. Tidak dapat dibantah secara alamiah manusia bebas untuk menggunakan hak atau tidak menggunakan hak sama sekali. Dr.Todung Mulya Lubis LLM; Waspada, halaman A7, Jumat (4/1), menyatakan “Sedikitnya jumlah pemilih 75 persen lah sehingga legitimasinya menjadi kuat. Tatanan demokrasi dan politik di Amerika yang lebih mendekati prinsip dasar “dari rakyat, oleh rakyat, untuk rakyat” saja tingkat partisipasi pemilih hanya di bawah 50 persen. Bagaimana di Indonesia (baca: Pilgubsu) dengan tatanan demokrasi dan politik seperti sekarang ini? Wajar saja jika ada “sikap menolak” dari rakyat untuk memberikan hak suara nanti, bahkan mengamati Pilgubsu sebelumnya bahwa dalam internal Parpol saja saat realisasi di lapangan terjadi “sikap menolak” kebijakan Parpol-nya dengan Silent Operation berpartisipasi untuk calon yang bukan ditetapkan oleh Parpol-nya. Akankah realita ini berulang di Pilgubsu 2013? Jawabnya ya. Demokrasi di Indonesia, ungkap Prof Arif, mengadopsi demokrasi Barat dengan penaf-

siran keliru sehingga pada hakikatnya masyarakat Indonesia yang “dari sono-nya” sudah memiliki keteraturan demokrasi, seperti Dalihan Natolu, Pelag Gandong, Setungku Sejarangan, Sedulur Sedapur Sesumur, dan lain sebagainya menjadi rusak dan kabur “ditabrak” tatanan demokrasi dan politik yang berlaku. Artinya, dengan sistem demokrasi dan tatanan politik yang ada sesungguhnya masyarakat tidak menginginkan Pilkada karena kontra produktif dengan keteraturan yang dimiliki masyarakat. Selain mempertanyakan figur yang dicalonkan PDIP, Arif juga menyoroti sikap PAN, Partai Demokrat, Partai Golkar. “Ada parpol menetapkan calon yang tidak mendaftar, padahal Parpol itu membuat aturan pendaftaran bakal calon dengan uang pendaftaran. Ada Parpol yang bersikap kabur, memaksakan kehendak, terkesan tidak memiliki hirarki dan kepercayaan lagi dalam penetapan calon. Berpola seperti industri ‘’Kedai Sampah’’ yang kapan saja orang bisa datang berbelanja. Ini salah satu indikasi rusaknya tatanan demokrasi dan politik secara nasional,” ungkap Arif. Arif juga menyoroti pernyataan calon dari incumbent yang ingin mengurangi angka kemiskinan secara aplikatif, padahal wilayah dimiliki kabupaten/ kota, bukan pemerintahan propinsi. Dr.Choking Susilo Sakeh di Waspada, halaman B4 Opini, Kamis (3/1) menyinggung rilis FITRA (Forum Indonesia untuk Tranparansi Anggaran soal gaji dan insentif Gubsu/Wagubsu mencapai Rp.19,62 M/Rp.17, 225M dalam lima tahun ber-

sangat dibutuhkan warga masyarakat. Mudah-mudahan apabila pasangan GusMan menang dalam Pilgubsu nanti, jalan di Desa Bandar Kumbul dapat di aspal. Kami warga Desa Bandar Kumbul mendoakan orang yang telah membantu, supaya berhasil apa yang menjadi citacitanya untuk menjadi Gubernur Sumatera Utara,” tambah Toha.(m06/a18)

Waspada/Armin Nasution

RELAWAN GusMan Kabupaten Labuhanbatu bersama warga masyarakat Desa Bandar Kumbul diabadikan sebelum pengerjaan pembuatan drainase (parit) dan penimbunan jalan dengan menggunakan alat berat beko dan dump truck.

Drs Jumiran Abdi: Banyak Birokrat Bersih Belum Diberdayakan MEDAN (Waspada): Calon Wakil gubernur Sumatera Utara (cawagubsu) nomor urut 2, Drs H.Jumiran Abdi berjanji akan membenahi birokrasi di Sumatera Utara, mengingat banyak birokrat yang bersih dan bisa diandalkan membawa Sumatera Utara ke arah yang lebih baik. “Pengalaman sebagai birokrat, membuat saya optimis bisa membenahi birokrasi di Sumut,” kata Jumiran, Rabu (9/ 1) saat menggelar sarapan pagi bersama dengan sejumlah mahasiswa yang tergabung dalam

beberapa organisasi gerakan mahasiswa dan tokoh sejumlah partai politik diWarung Srikandi Jln Sei Padang Medan. Hadir dalam acara itu, anggota DPRDSU, Taufan Ginting, Ketua PAC PDIP Kota Medan Henry Jhon Hutagalung , para pengurus GAMKI, GMNI, sejumlah masyarakat dan simpatisan pasangan Drs Effendi Simbolon – Drs H.Jumiran Abdi. Acara sarapan pagi bersama cawagubsu yang diusung PDIP, PPRN, dan PDS itu digagas oleh Taufan Agung Ginting. Lebih jauh, kata Jumiran,

masih banyak orang-orang bersih yang bisa diandalkan membangun Sumut. “Ide-ide brilian yang ada pada mereka tidak bisa mereka ungkapkan karena belum diberdayakan, bahkan ada yang terpinggirkan, “ tegasnya. Menurut Jumiran penggunaan anggaran yang efektif akan memberikan kesejahteraan bagi masyarakat. Dia menegaskan pembenahan birokrasi sudah menjadi agenda prioritas pasangan Effendi-Jumiran.” Menata birokrasi memang tidak mudah, namun harus segera dimulai. Un-

Waspada/M.Ferdinan Sembiring

CAWAGUBSU Drs H. Jumiran Abdi (tengah/baju putih) diabadikan bersama para mahasiswa, tokoh partai politik, masyarakat dan simpatisan pasangan Effendi-Jumiran, usai acara sarapan pagi bersama di warung Srikandi Jln Sei Padang Medan, Rabu (9/1).

Analisis Pilgubsu: Demokrasi Otoriter 2 Januari barusan, saya genap berusia 48 tahun; masih segar dalam ingatan pelajaran Pendidikan Moral Pancasila yang disampaikan guru R.Tambunan di SMPN 2 Kisaran, era 1980-an: prinsip dasar demokrasi adalah dari rakyat, oleh rakyat, dan untuk rakyat. “Kenyataannya tidak demikian, demokrasi kita otoriter. Kita ambil contoh proses Pilgubsu. Demokrasi dari Parpol, oleh Parpol dan saya yakin hasilnya untuk Parpol. money politic membingkai dan membayangi proses penetapan calon Gubsu/ Wagubsu. Bahkan dalam sistem yang otoriter ini ada Parpol melanggar komitmennya dengan menetapkan figur yang tidak mendaftar di Parpolnya, cetus Prof.Dr.M.Arif Nasution MA Guru Besar Fisip USU Medan. Memang, oleh sistem demokrasi dan tatanan politik yang berlaku saat ini, rakyat diposisikan sebagai “konsumen sebuah warung preman”; dipaksa, terpaksa, atau menolak “hidangan” yang tersedia. Katakanlah dalam Pilgubsu, rakyat dihadapkan dengan lima pasangan calon. Mengapa dalam alinea di atas ada kata: dipaksa, terpaksa, atau menolak? Dipaksa memilih salah satu pasangan calon oleh “pemberian uang atau cindera mata”, dipaksa karena kedudukannya sebagai birokrat di mana dari lima pasangan calon ada yang masih aktif sebagai ‘penguasa’ pemerintahan, dipaksa pimpinan atau pemilik perusahaan di mana seorang warga bekerja, serta dipaksa oleh faktor faktor lainnya. Terpaksa karena kedudukan pekerjaan suami atau istri, terpaksa karena jasa masa lalu, ter-

drainase tersebut sangat dibutuhkan sekali oleh warga. “Kami mengharapkan, dengan adanya pengerjaan pembuatan drainase (parit) dan penimbunan jalan terbuka perhatian dari pemerintah terhadap Desa Bandar Kumbul, karena daerah itu cukup jauh dari Rantauprapat yang berjarak 11 km,” ucapToha. “Pembuatan drainase dan penimbunan jalan rusak itu,

kuasa dibandingkan dengan angka Rp.50M sampai Rp.100M yang harus dikeluarkan calon dalam proses Pilgubsu. Kembali kepada Todung di atas yang mensyaratkan partisipasi pemilih/legitimasi, Pilgubsu yang jujur dan Adil, juga mensyaratkan event politik Pilgubsu harus jauh dari Money Politic. Tiga syarat ini yang membuat Pilgubsu sukses. Realitasnya perhelatan Pilgubsu sudah di depan mata. Apa yang disyaratkan Todung diharapkan mampu menghasilkan pemimpin Sumut lima tahun ke depan adalah pasangan berkarakteristik mensejahterakan masyarakat, walau patut diwaspadai apa yang diwantiwanti Prof Arif yang cenderung “mempelototi” kondisi kini untuk perbaikan masa depan bangsa melalui sistem demokrasi dan tatanan politik terbaik, tidak menabrak “demokrasi adat dan keteraturan” masyarakat yang terlahir lebih dahulu. Adalah Dr Muhammad Evri MSc, putra Sumut asal AirbatuAsahan, “orangnya BJ Habibie di Iptek”, pernah menjejakkan kaki di Kutub Selatan Antartika 1996, sekarang menjabat Kepala Bidang Teknologi Akutansi Sumberdaya Alam,BPPT, patut didengar pendapatnya sebagai orang yang tidak terkait politik praktis, akan tetapi teknokrat murni. “Sistem demokrasi dan tatanan politik harus diperbaiki. Demokrasi harus berbasis masa depan, green economy,green technology, green industri untuk membuka lapangan kerja dan pertumbuhan ekonomi masyarakat yang nyata. For Job and Growth. Harus berbasis investasi di mana SDM dan SDA ter-

barukan, tidak sekadar transaksional belaka. Ini akan menguatkan daya saing bangsa kita,” ujar Evri membuka pembicaraan. Apa yang dikemukakan Evri merupakan konsep kesejahtera a n m a s y a r a k a t s e c a r a kongkrit, bukan retorika. “Black Hole (lubang hitam) demokrasi kita adalah money politics, karena memang tidak ada payung hukum yang mengaturnya. Donasi uang merupakan hutang bagi calon kepala daerah yang harus dikembalikan ketika dia menjabat. Dengan cara apa membayarnya?Ya lewat proyekproyek, mengeluarkan izin-izin yang subjektif, sehingga uang berputar-putar hanya di kelompok ini,” urai Evri. Perbaikan ke depan? Tentu saja kondisi saat ini harus meminimalisir penyimpangan tatanan untuk tujuan perbaikan ke depan. “Payung hukum yang mengatur harus jelas, pelibatan KPK, uji publik,hearing ke masyarakat, seleksi ketat bagi Parpol dan calon kepala daerah,” tambah Evri. Memang logis jika ada penseleksian secara ketat kepada Parpol, Calon Legislatif maupun kepala daerah. Faktor SDM berbasis kerja, manajemen pemerintahan, visi missi puluhan tahun ke depan yang pro kemandirian (ketimbang calo/ broker), berpihak kepada lingkungan, pertumbuhan ekonomi hijau, teknologi hijau dan lainnya yang bermuara kepada kesejahteraan rakyat berkelanjutan. “Masuk sekolah atau kuliah saja diseleksi ketat. Apalagi mau jadi pemegang amanah, harus berlipat lipat kali uji publiknya, agar rakyat mengetahui dan menggali sejauh mana kemam-

puan si calon. Kelayakan moral, integritas, serta kompetensinya harus menjadi syarat utama untuk sampai kepada tingkat calon,”ujar Evri alumni IPB Bogor, Master dari Gifu University Jepang, Pos Doctoral dari Hiroshima University Jepang ini. Integritas, menurut Evri, terkait moral, implementasi nilai nilai agama, jujur, zero corruption. “SDM Terbarukan memiliki inovasi teknologi, berorientasi kemandirian, industri, income luar biasa, dan jauh dari broker,”katanya. Agaknya tidak ada waktu yang cukup untuk mengenali lima pasangan dengan indikator yang ditawarkan Evri. Diharapkan masyarakat Sumut realistis dan mau menggunakan hak suara pada Pilgubsu 7 Maret 2013. “Saya memprediksi hanya sekitar 42 persen tingkat partisipasi pemilih dalam Pilgubsu 2013 ini. Jangan ditanya darimana angka yang saya dapatkan,”kata Prof Arif. Apapun kata Arif, Todung dan Evri, sistem telah menghidangkan lima pasangan calon dalam Pilgubsu 2013 yang diharapkan dipilih oleh masyarakat Sumatera Utara (baca: pemilih dalam DPT). Apakah DPT (Daftar Pemilih Tetap) yang diperbuat sudah benar dan mengakomodir semua warga pemilik hak suara di Sumatera Utara? Dalam tulisan mendatang kita akan kejar angka partisipasi 42 persen versi Prof.Dr.M.Arif Nasution MA apakah terkait dengan persentase error DPT Pilgubsu, atau berhubungan dengan Demokrasi Otoriter yang ditudingkan Arif. *Nurkarim Neh

tuk itu, jika masyarakat memberikan kesempatan, tentu kami lakukan yang terbaik, “ tegasnya. Menurutnya, jika birokrasi dibenahi secara profesional maka Sumut akan maju .” Pembenahan birokrasi dimulai dari sistem rekrutmen birokrasi harus profesional dan transparan. Demikian juga sistem promosi jabatan di birokrasi harus rasional dan tidak bertentangan dengan ketentuan yang berlaku,” ujarnya. Selain itu, tambah Jumiran, program lain yang menjadi prioritas adalah pembangunan infrastruktur. Bahkan, Effendi Simbolon punya mimpi yang luar biasa terhadap Danau Toba.”Ingin perhatian pusat dan dunia internasional kepada Danau Toba tidak berbeda dengan daerah wisata yang ada di negeri ini. Danau Toba aset yang luar biasa,” katanya. Pada kesempatan itu, Jumiran mengingatkan agar mahasiswa sebagai generasi penerus bangsa jangan pernah putus asa.”Tancapkan mimpimu setinggi langit dan jangan pernah

berhenti bekerja, karena kalau Allah sudah menghendaki, tidak ada yang mustahil, “ ujarnya. “Saya pun tidak pernah menyangka di usia saat ini dicalonkan menjadi cawagubsu , “ kata pensiunan Pegawai Negeri Sipil dan mantan anggota KPU Sumut itu. Paling penting, apapun pekerjaan itu, bisa bermanfaat bagi semua orang ,” ujarnya. Jumiran juga sempat mengisahkan perjalanan hidupnya dan keluarganya, karirnya dan sepak terjangnya di dunia organisasi. Di akhir sambutannya, Jumiran mengapresiasi kegiatan yang digagas Taufan Ginting. “Saya aturkan terima kasih kepada semua yang hadir dan mohon doa dan dukungannya. Sementara itu, Taufan Ginting bersama mahasiswa dan masyarakat serta simpatisan yang hadir dalam acara itu menyatakan komitmen mereka akan memenangkan pasangan Effendi-Jumiran.”Sikap kami sudah bulat, apa pun yang terjadi, tetap nomor 2,” tegas Taufan disambut setuju oleh para mahasiswa .(m49)

WASPADA, Jumat, 11 Januari 2013 Waspada Dan Intelektualisme ...

Komitmen Dan Konsistensi ... kapasitas senior itu pula kami berupaya menjaga kualitas produk (brand) berupa karya jurnalistik modern setiap harinya agar tetap diterima oleh berbagai elemen masyarakat luas, khususnya kalangan religius (umat Islam). Satu hal yang sudah menjadi komitmen WASPADA sejak awal berdiri terus berusaha menjaga komitmen dan kualitas pers sebagai pilar keempat demokrasi dengan menjalankan idealisme dan fungsi pers sebagaimana ketentuan Undang-Undang No.40/1999 dan menjunjung tinggi kode etik jurnalistik. Kami sadari hal ini memang tidak mudah, terlalu banyak godaannya, apalagi menjelang pesta demokrasi Pilgubsu 7 Maret 2013, namun begitu tekad kami bulat untuk melakukannya, konsisten menegakkan motto ‘Demi Kebenaran dan Keadilan’ karena sudah merupakan janji pendiriWASPADA yang wajib kami tunaikan walau bumi akan runtuh. Misi suci pemberitaan yang benar dan mencerdaskan, menjadi membela hak-hak kaum tertindas menjadi komitmen kami kepada masyarakat pembaca WASPADA di mana saja. Kiranya resolusi 66 tahunWASPADA tetap mendapat dukungan dari masyarakat karena tekad dan keinginan tersebut hanya mungkin terwujudbilaadatimbalbaliknyadaripembaca.Tanpapembacarasanya sulitkamibisabertahansampaisaatini.Karenaitupulakamimengucapkan banyakterimakasihkepadaseluruhpembaca,mitrabisnis/relasi/iklan, khususnya pembaca setia karena anda adalah stakeholder kami yang paling berharga di mata kami. Tanpa anda pastilah kami tidak akan bisa bertahan begitu lama. Dengan dukungan pembaca pula kami berharap bisa hidup dan terus berkembang hingga berabad-abad lagi walau tantangan ke depan demikian sulit. Terus terang bahwa perkembangan zaman dan kemajuan teknologi komunikasi dan informasi dalam satu dekade belakangan ini membuat dunia pers, khususnya cetak harus memeras otak, mengurangi waktu tidur nyenyaknya untuk berkreasi dan melakukan perubahan sebagaimana harapan dan keinginan masyarakat yang kian besar dan berkembang. Jika abai, sama artinya ‘’bunuh diri’’ dan itu kami sadari betul sehingga berbagai tahapan upaya pembenahan dan peningkatan sumber daya manusia menjadi prioritas yang tak bisa ditawar-tawar lagi. 66 Tahun berkiprah dalam dunia persuratkabaran pastilah membuatWASPADA kenyang pengalaman, penuh dinamika, kisah heroik, baik suka maupun duka. Bagaimana WASPADA bergulat melawan penjajah di awal kemerdekaan negeri ini, mengobarkan semangat nasionalisme, pantang menyerah, menyuarakan sikap menentang PKI walau berdampak pembredelan berulang-ulang. Sudah kami lewati. Di masa Orde BaruWASPADA merasakan bagaimana otoriternya pusat kekuasaan yang antikritik, mulai bergulat dengan kompetisi ketat guna merebut gelar suratkabar terbaik dengan readership terbanyak di Sumut dan Aceh. Juga sudah kami lalui. WASPADA berupaya menjadikan dirinya sebagai jembatan informasi yang dibutuhkan masyarakat profesional maupun kalangan awam di eranya masing-masing hingga bisa bertahan sampai saat ini. Kami sadari betul bahwa persaingan antarmedia cetak semakin kompetitif, bahkan kadang-kadang di luar nalar logika (akal sehat) manusia dengan beredarnya puluhan media baru, masing-masing menggunakan beragam trik untuk mendapatkan pasar (pembaca). Bisa dibayangkan, apa yang terjadi dengan adanya koran harga ‘’seribu perak’’ di tangan pembaca. Untuk biaya kertas (cetak) saja tidak cukup sehingga yang terjadi adalah ‘’saling membunuh’’ atau ‘’kanibalisme’’. Masing-masing menjajal trik bisnisnya untuk bisa ‘’survive’’. Sungguh tidak sehat sehingga jangan tanya soal isi, pada umumnya menjual isu murahan, menjadi bacaan negatif. Ini yang kami hadapi saat ini. Justru itu, kami bertekad untuk terus berkembang bersamasama masyarakat dengan berupaya melakukan perubahan, menyesuaikan diri dengan keinginan masyarakat yang kian cerdas. Komitmen dan konsistensi menjaga kualitas pers yang independen, mencerdaskan masyarakat, menjadi fokus kami saat ini. Menjaga konsistensi bukanlah perkara mudah sehingga pada banyak kasus banyak orang kehilangan fokus di saat terbuai dengan kerja rutinitas, di sini pula kami mengharapkan terjalinnya komunikasi, interaksi dua arah, maupun kritik membangun untuk menghindari segala hal yang mungkin menjadi penghambat kemajuan WASPADA ke depan. Kami percaya betul hari esok selalu cerah, penuh dengan makna dan harapan baru. Allah SWT akan selalu melindungi orang-orang yang bekerja keras, terus belajar, memotivasi diri, menebar kedamaian, selalu sabar, ikhlas, dan bersyukur dalam bekerja. ***

Sambutan Gubernur Sumatera Utara ... dikenal sebagai surat kabar yang sangat anti terhadap Belanda. Didirikan oleh tokoh pers nasional H Mohammad Said dan Hj Ani Idrus, Waspada lahir dengan tujuan awal untuk mengingatkan tokoh-tokoh pergerakan yang ada di Sumatera Utara kala itu, agar mewaspadai keberadaan Belanda di tanah air. Perjuangan berat yang dilewati Harian Waspada hingga saat ini, tidaklah dapat dipisahkan dari sejarah panjang pergulatan bangsa ini lepas dari penjajah. Waspada ikut berperan sebagai organ perjuangan melawan pemerintah kolonial Hindia Belanda. Waspada adalah wujud dari sebuah media perjuangan. Perjuangan untuk meraih kebebasan berekspresi, kebebasan menyatakan pendapat dan perjuangan meraih kemerdekaan bangsa Indonesia. Menapaki eksistensinya, Waspada telah ikut mengambil peran dalam mengantarkan bangsa ini melalui berbagai episode kesejarahan. Lahir dilatarbelakangi pengaruh penjajahan Jepang, terbit pertama kali pada era revolusi nasional. Selanjutnya Waspada terus berkarya pada masa orde lama, demokrasi terpimpin, Orde Baru hingga Era Reformasi saat ini. Masyarakat Sumut tentu bangga dengan sejarah panjang yang telah berhasil dilalui tersebut sehingga menempatkan Waspada sebagai salah satu Surat kabar tertua di Indonesia. JikaWaspada pernah membuktikan sebagai Media Perjuangan melawan kolonialisme, maka peranan Waspada pada masa mendatang tetap dinantikan masyarakat Sumut. Khususnya dalam menyadarkan dan membangkitkan semangat persatuan dan kesatuan masyarakat yang semakin dirasa penting pada era globalisasi saat ini. Pada momentum hari jadi Waspada ke-66 hari ini, Pemerintah Provinsi Sumut berterimakasih atas pernanan Waspada selama ini yang tidak hanya sebatas penyebar informasi kepada khalayak, namun lebih juga ikut mengawal penyelenggaraan pemerintahan dan pembangunan. Waspada melalui karya jurnalistiknya sangat dirasakan peranannya dalam memberi edukasi, melakukan kontrol sosial yang konstruktif dan menjadi penyalur aspirasi bagi masyarakat. Harapan saya agar Waspada ikut ambil peran meningkatkan partisipasi masyarakat agar lebih berdaya dan terlibat dalam pembangunan, melalui karya-karya jurnalistik yang mendidik dan mencerdaskan. Dirgahayu Harian Waspada. Teruslah berjaya dan tetap setia sebagai media yang menyuarakan kebenaran dan keadilan. Masyarakat Sumut selalu menantikan kiprah dan prestasi mu khususnya dalam mengawal proses pembangunan daerah mewujudkan Sumatera Utara yang maju dan sejahtera dalam bingkai harmoni keberagaman. Assalamualaikum Warahmatullahi Wabarakatuh Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho, ST

intelektualisme Islam Indonesia tidaklah dapat dikatakan kecil. Bagi IAIN SU, yang berdiri sejak tahun 1973, Waspada telah menjadi mitra dan sahabat sejati. Hubungan yang terbangun selama 40 tahun (1973-2013), cukup menjadi bukti betapa kuatnya hubungan Waspada dengan IAIN SU secara khusus dan umat Islam pada umumnya. Waspadasecara aktif terus menerus menginformasikan keberadaan IAIN SU di tengah-tengah umat. Sejak IAIN.SU berdiri, khusus pada masa-masa awal berdirinya dengan segala kesederhanaannya sampai perkembangan terkini, di saat IAIN SU bertransformasi menjadi Universitas Islam Negeri (UIN) SU, Waspada tetap aktif memberitakan dan mengkomunikasikan perkembangan yang terjadi. Bahkan, Waspada juga dalam hal-hal tertentu, ikutmemberikan kritik dan masukan buat kebaikan IAIN (UIN) SU ke depan. Hal ini tentu sangat disyukuri karena Waspada juga ikut memberikan kontrolnya terhadap IAIN SU. Menurut hemat saya, sumbangan terbesar yang diberikan WaspadaadalahmendorongdinamikaintelektualismeIslamSumatera Utara. Kolom Jumat yang disiapkanWaspada sebanyak 4 halaman penuh membuktikan besarnya perhatian koran yang didirikan oleh H.Moh.SaiddanHj.AniIdrusiniterhadapumatIslam.Tidakberlebihan jika dikatakan, Waspada ikut serta dalam proses pencerdasan umat. Waspada telah berperan aktif dalam membangun kesadaran umat Islam akan tanggungjawabnya sebagai hamba (habl min Allah) dan pada sisi lain sebagai khalifah (habl min al-nasdanhabl min al-‘alam). Tidak kalah menariknya, Waspada juga memberi ruang yang luas untuk terjadinya debat, diskusi yang terbuka dan bertanggungjawab terhadap masalah-masalah khilafiah umat Islam. Yang sangat saya syukuri, Waspada mampu menempatkan dirinya sebagai wasit yang baik. Waspada sepanjang dalam pengamatan saya tidak melakukan pemihakan kecuali kepada kebenaran dan keadilan, sesuai dengan mottonya yang sekaligus menjadi jiwa atau ruh Waspada itu sendiri. Di samping itu, selama ini Waspada juga telah menunjukkan keberpihakannya kepada umat. Waspada tidak pernah absen untuk menyuarakan kepentingan umat Islam. Bahkan dalam tingkat tertentu, Waspada juga menunjukkan keberpihakannya jika ada kepentingan umat Islam yang diganggu oleh kekuatan-kekuatan tertentu. Bukanlah mengada-ada jika dikatakan, umat Islam merasa terwakili dengan keberadaanWaspada Khusus, bagi IAIN SU, kontribusi penting Waspada dalam pengembangan intelektualisme IAIN. SU adalah tersedianya ruang yang cukup bagi intelektual-intelektual muda IAIN SU untuk mengembangkan gagasan dan pemikirannya, khususnya menyangkut persoalan keagamaan. Bahkan yang menggembirakan saya adalah, artikel-artikel keagamaan yang ditulis oleh dosendosen muda IAIN. SU kerap menjadi rujukan para khatib di berbagai daerah. Dalam konteks inilah, saya harus menyebut peran Waspada dalam penyebaran pemikiran keagamaan sangat besar. Satu hal yang perlu saya sampaikan, dalam waktu dekat IAIN SU segera bertransformasi menjadi Universitas Islam Negeri. Tidak dapat dipungkiri, muncul kekhawatiran di masyarakat bahwa IAIN SU nanti akan kehilangan jatidirinya. Ilmu agamanya akan hilang dan ilmu umumnya yang berkembang. Kekhawatiran seperti ini pernah disampaikan masyarakat melalui Waspada Saya merasa bahagia, ternyata tingkat kepeduliaan umat terhadap IAIN SU cukup tinggi. Dan sebagai rektor saya memperhatikan dengan seksama segala macam kekhawatiran yang muncul dan menjamin bahwa IAIN SU atau UIN SU tetap pada khittahnya sebagai perguruan tinggi Islam yang tetap berpegang pada Alquran dan Hadis. Tentu saja, kontrol yang diberikan Waspada menjadi penting untuk memastikan kita tetap berada pada khittah. Di hari ulang tahun Waspada yang ke-66 ini, saya mengucapkan selamat ulang tahun buat Waspada semoga tetap berpegang pada kebenaran dan memperjuangkan keadilan. Harapan saya, Waspada tetap lebih maju dan berjaya di masa depan. Hubungan yang telah terbangun selama ini semoga tetap terjaga dan dapat ditingkatkan pada masa-masa mendatang. Dirgahayu Waspada.

Gus Bawa ... demi kebenaran dan keadilan serta tentu saya harapkan ikut berperan dalam Sumut Sejahtera,” kata Gus Irawan yang diamini jajaran redaksi dan karyawan. Pertemuan itu memang istimewa. “Terimakasih untuk Gus Irawan yang berkenan singgah apalagi ini calon Gubsu yang mengucapkan langsung dan membawa kue ulang tahun,” kata Rayati. Gus kemudian berkisah bahwa tahun lalu pun sesungguhnya dia sudah mendapatkan penghargaan dari media ini. “Sebagai man of the year tahun lalu saya pasti sangat berharap media ini terus berjuang,” jelasnya. Dia mengatakan dalam berbagai kesempatan pidato, selalu saja penghargaan man of the year itu tetap diingatkannya. “Kalau berpidato di depan khalayak selalu saya katakan tahun lalu menerima penghargaan itu,” ujarnya. Saat bercerita Gus memang tidak sedikit pun mengumbar visi misi atau bercerita tentang jargon sosialisasi. Apalagi ingin berkampanye. Gus malah lebih banyak mengumbar cerita beberapa kunjungannya ke daerah yang agak unik dan lucu. Namun memang Rayati Syafrin sedikit bertanya tentang kemeja yang dipakai Gus Irawan. “Ooo… Ini bukan baju kampanye bu. Motif ini kita sebut kemeja Sumut Sejahtera. Kita tak mau ini disebut baju kampanye. Siapa pun boleh memakai ini karena tanpa ada embel-embel nama Cagubsu, Wagubsu atau GusMan sekali pun,” jelasnya. Gus menegaskan baju yang dikenakannya memang kini menebar kemana-mana. Bahkan beberapa kaum profesional, anak-anak muda mulai memakainya di kantor-kantor. “Ibu pun kalau mau pakai sudah ada yang dijual dan ada juga yang dibagikan ke relawan,” jelasnya. Gus mengungkapkan kemeja itu diharapkan bisa menjadi salah satu trend yang bisa dipakai siapa pun. “Jadi jangan dianggap kampanye. Tapi sudahlah itu. Yang penting selamat ulang tahun untuk Harian Waspada. Support pemberitaannya terhadap masyarakat tak ternilai. Kita banyak mendapat informasi dari media ini,” ujarnya. Dia menjelaskan agenda utamanya ke Harian Waspada adalah bersilaturrahmi untuk mengucapkan selamat ulang tahun. Usai berdialog Gus memang menyalami semua karyawan dan staf redaksi Harian Waspada yang ada di lantai 1. Bahkan dia pun meladeni beberapa permintaan foto bersama. Setelah itu Gus melanjutkan acaranya ke beberapa tempat yang telah menunggunya.(m06)

Gempa 6.0 SR Guncang Aceh ... kata AyuWuandari dari Stasiun BMKG Mata Ie yang dihubungi Waspada Kamis (10/1) malam. Ayu menyebutkan, guncangan gempa terasa di Meulaboh, Calang, Banda Aceh dan Pidie. PantauanWaspada, banyak warga di Banda Aceh berhamburan di jalan setelah digoyang gempa selama satu menit tersebut.Hal ini terlihat di sekitar Jl.Teuku Umar Banda Aceh.Sejumlah mobil tampak berhenti di tengah jalan, dan para penumpang keluar dan memilih jongkok pinggir jalan. Kepanikan juga terlihat di kedai kopi simpang lima, pusat kota Banda Aceh, pengunjung kedai berhamburan keluar.Beberapa gelas kopi sempat jatuh dan pecah akibat kepanikan warga. (b08)

KPU: Itu Hak Partai JAKARTA ( Waspada): Komisi Pemilihan Umum (KPU) mengakui siap menghadapi gugatan yang dilayangkan partai politik di Pengadilan Tata Usaha Negara (PTUN) dan Mahkamah Agung terkait hasil verifikasi dan penetapan partai politik peserta Pemilu 2014 . “Bagi KPU gugatan itu hal yang normal dan itu merupakan hak partai silakan aja,” kata Komisioner KPU Hadar Nafis di gedung DPR RI, Jakarta, Kamis (10/1). Ketua KPU, Husni Kamil Manik juga mengakui siap menghadapi gugatan parpol yang tak lolos verifikasi faktual. Husni menegaskan, pengaduan parpol yang dilayangkan secara resmi, akan dijawab KPU dengan bukti-bukti.

B9

Namun, diakuinya, KPU juga siap melakuakan koreksi dan evaluasi, bila ditemukan kesalahan. “Kami siap melakukan koreksi dan evaluasi bila nanti ditemukan adanya kesalahan,” paparnya Sebelumnya tujuh Komisioner KPU membahas sejumlah peraturan yang berkaitan dengan peraturan KPU. Termasuk pembuatan peraturan terkait pengangkatan pimpinan KPU Provinsi yang baru. Selain itu, rapat kerja juga membahas peraturan daerah pemilihan legislatif. “Kita juga harus menyelesaikan proses penggantian KPU di provinsi. Rombongan pertama 15 provinsi dilakukan pergantian, itu perlu adanya peraturan KPU,” terang Hadar. (aya)

Petani Berharap Pada CH-Fadly SIMALUNGUN (Waspada): Program “membangun dari desa” oleh Cagubsu-Cawagubsu Chairuman-Fadly menggugah banyak pihak, tidak terkecuali para petani di pedesaan di Sumatera Utara. Seperti halnya dengan petani desa di Kec. Pematangbandar, Kab. Simalungun. Mereka berharap pada pasangan nomor urut 3 ini. Kehadiran anggota Komisi VI DPR RI di desa mereka disambut hangat dan penuh kemeriahan. Ada pagelaran seni budaya Reog Ponorogo, ada ratusan petani yang berkumpul menanti di Negeri 1 Purwodadi Kec.Pematangbandar, Simalungun. Mereka antusias memanfaatkan pertemuan dengan Chairuman untuk berdialog. Satu per satu, perwakilan petani menyampaikan harapan mereka kepada Chairuman Harahap. Di antaranya perwakilan petani cabe, yang jumlahnya cukup besar di sana, memyampaikan harapan menyangkut pola kemitraan pada penyertaan modal. “Sebenarnya kami cukup handal dan eksis sebagai petani. Cuma saja kami terkendala di modal aja. Jadi kalau Pak Ch (Chairuman Harahap) jadi gubernur, mudah-mudahan persoalan kami didengar, karena cuma permodalan aja yang kami inginkan,” ujar Mislan petani cabai asal Nagori Purbaganda itu. Petani lainnya, Guntur dari Nagori Purwodadi mengatakan, mereka berharap mendapat dorongan perekonomian desa yang lebih optimal, agar petani tidak bergantung pada pertanian satu jenis tanaman cabai saja. “Kalau hanya bergantung pada satu jenis tanaman cabai saja, petani akan panik,Pak, kalau harga cabai mengalami kemerosotan,” ujarnya. Pihaknyaberharap pemerintah memberi pemikiran mengatasi persoalan petani cabai khususnya. Meski di daerah Pematangbandar tanaman itu jadi andalan bagi pemasok daerah lain termasuk ke Medan, tetapi tetap perlu tanaman alternatif. Hal lain yang menjadi harapan para petani kepada Chairuman adalah persoalan jalur transportasi desa seperti jalan. Karena ada jalur jalan tanah, dan bila hujan akan becek. Akibatnya distribusi hasil-hasil pertanian bisa terhambat sampai ke tempat tujuan. Sikap lugas dilontarkan Eko Simanjuntak, pemuda Nagori 1 Purwodadi yang menjelaskan mereka sangat berharap pada kemenangan Chairuman-Fadly 7 Maret 2013. (m07/rel)

B10 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Asyik Nyabu, Dua Laki-laki Paruh Baya Dibekuk TANJUNGBALAI (Waspada): Petugas Sat Narkoba Polres T.Balai menangkap laki-laki paruh baya saat asyik mengkonsumsi narkoba jenis Sabu-sabu (SS) di sebuah rumah di Jl. Karya, Lingk. I, Kel. Selatlancang, Kec. Datukbandar Timur, Kota Tanjungbalai, Kamis (9/1). Kedua lelaki itu, SEA, 56, warga Jl. Karya, Kel. Tanjungbalai Kota I, Kec. Tanjungbalai Selatan, dan Her, 44, penduduk Jl. Karya, Lingk. I, Kel. Selatlancang, Kec. Datukbandar Timur. Selain tersangka, Polisi juga menyita barang bukti satu bungkus plastik kecil transparan berisi diduga SS berat kotor 0,39 gram. Kemudian satu botol kecil transparan berisi air, tertutup dengan satu karet dot warna kuning terpasang di ujungnya. Berikutnya sebuah mancis terangkai dengan potongan pipet plastik kecil, serta lima pipet transparan. Sementara di tempat terpisah, seorang pria paruh baya KAS, 42, diduga bandar narkoba diringkus dari kediamannya di Jl. Sriwijaya/Srimelati, Kel. Pahang, Kec. Datukbandar, sekira pukul 21.00. Dari tangannya diamankan barang bukti satu bungkus plastik kecil transparan diduga berisi SS berat kotor 0,48 gram. Selain itu, satu botol berisi air tutupnya terangkai dengan dua pipet plastik transparan, satu pipetnya dipasang karet dot warna merah dan satunya lagi terbuat kaca. Selanjutnya satu timbangan elektrik warna putih merek GHL, empat mancis, tas warna hitam, tiga buah gas air gun, dan satu bungkus plastik berisi 56 butir peluru mimis (air soft gun). Kapolres Tanjungbalai AKBP Marthin L Hutagaol melalui Kasubbag Humas AKP Y Sinulingga didampingi Kasat Narkoba AKP Novie Ardhie dan juru periksa Brigadir A Sihotang membenarkan penangkapan itu. Dikatakan, ketiga tersangka masih menjalani pemeriksaan untuk mengembangkan ke arah jaringan narkoba lainnya. (a32)

Sumatera Utara

WASPADA Jumat 11 Januari 2013

DPRD Minta Selidiki Dugaan Korupsi Diskanla TANJUNGBALAI (Waspada): Komisi B DPRD meminta aparat hukum pro aktif menyelidiki dugaan tindak pidana korupsi di Dinas Perikanan dan Kelautan Kota Tanjungbalai. Dugaan tindak pidana itu meliputi dana kerambah Rp440 juta TA 2007 yang tidak disalurkan, pengaturan pemenangan tender pengadaan bantuan 2 kapal nelayan 30 GT senilai Rp2,7 miliar, dan pemotongan 30 persen dana bantuan bagi 15 Kelompok Usaha Bersama (KUB) yang masing-masing menerima Rp100 juta. “Kita sudah menerima laporan masyarakat tentang dugaan penyalahgunaan anggaran di Diskanla Tanjungbalai. Tindaklanjutnya, Komisi B akan memanggil instansi terkait untuk menelusuri kebenaran informasi itu. Dan, kita meminta aparat hukum juga harus pro aktif menelusuri dugaan kasus ini,” kata anggota Komisi B Hakim Tjoa Kian Lie kepada Waspada, Kamis (1/10). Disebutkan Hakim, dalam laporan masyarakat baik lisan maupun tertulis melalui aksi damai di DPRD, Kadiskanla Ir. Nefri Siregar diduga menerima upeti dari program anggaran KUB sebesar Rp30 juta per kelompok. Mengenai pengadaan bantuan 2 kapal, Hakim juga menuturkan keraguannya menyangkut dana Rp2,7 miliar.

Menurut Hakim, dana tersebut dianggap kemahalan dan penyalurannya tidak tepat sasaran. Pasalnya, informasi masyarakat, kapal itu diduga disalurkan kepada pengusaha perikanan, bukan nelayan. “Ini semua masih dugaan, maka itu kita perlu menelusuri untuk pembuktiannya. Kita sangat berharap, aparat hukum pro aktif,” kata Hakim. Sementara, informasi Waspada, sejumlah KUB yang telah memenuhi persyaratan administrasi, sama sekali tidak menerima dana bantuan Rp100 juta dari APBN dalam program pemberdayaan usaha mina pedesaaan. Dan, informasi dari sumber Waspada, bantuan yang seharusnya diterima nelayan tradisional, diduga diselewengkan. Dari 15 KUB penerima, ternyata 7 KUB diduga kalangan bermodal yang tergabung dalam organisasi pengusaha perikanan di Kota Tanjungbalai. Kepala Dinas Perikanan dan Kelautan Tanjungbalai Ir. Nefri Siregar dikonfirmasi Waspada mengatakan, pihaknya tidak memotong dana bantuan kepada KUB. Nefri berdalih, dana itu disalurkan Pemerintah Pusat

langsung ke rekening kelompok. “Kuasa pengguna anggarannya saja Pemerintah Pusat, bukan kita. Nggak mungkin kita potong, dananya saja langsung dikirim dari pusat ke rekening kelompok,” kata Nefri. Nefri juga berdalih, penyaluran dana bantuan sudah sesuai prosedur, termasuk para kelompok penerima bantuan. Mengenai tender pengadaan dua unit kapal, Nefri mengaku sudah mengikuti prosedur melalui LPSE. Kata Nefri, pagu anggaran Rp2,7 miliar juga sudah sesuai dan tidak ada kemahalan harga. “Sesuaikan dengan alat tangkap, bobot dan mesin kapal,” ujar Nefri. Dua kapal tersebut, lanjut Nefri, telah disalurkan kepada kelompok Pukat Apung dan Bahari Jaya. “Kedua kelompok itu nelayan, bukan pengusaha perikanan,” ujar Nefri menjawab Waspada tentang dugaan kapal disalurkan kepada pengusaha perikanan yang tergabung dalam organisasi. Sementara soal alat pengering pakan ikan yang pengadaannya pada 2007 lalu, Nefri mengungkapkan keberadaannya masih di rumah salah satu pegawai Diskanla di Jl. AMD Kota Tanjungbalai. Alasan Nefri, Balai Benih Ikan di Pasar VIII tidak memiliki tempat untuk menyimpan alat tersebut. (a14)

Unjukrasa Tuntut Usut Korupsi Diskanla TANJUNGBALAI (Waspada): Sejumlah masyarakat berunjukrasa di depan Kantor Kejaksaan dan DPRD Kota Tanjungbalai menuntut pengusutan dugaan korupsi di Dinas Perikanan dan Kelautan Kota Tanjungbalai, Kamis (10/1). “Meminta dengan tegas kepada Kajari Tanjungbalai agar tidak mempetieskan dugaan korupsi Diskanla yang saat ini diduga masih mengendap,” kata koordinator aksi. Menurut mereka, ada sejumlah dugaan korupsi di Diskanla sejak tahun 2007 sampai saat ini belum tuntas sesuai laporan hasil audit BPK RI No:18.C/LHP.XVIII.MDN/05/ 2012. Di antaranya, dana kerambah yang tidak disalurkan sebesar Rp440 juta tahun anggaran 2007 dan saat ini tidak diketahui.

Kemudian dugaan korupsi pengaturan pemenangan tender pengadaan bantuan dua kapal nelayan bobot 30 gross ton dengan pagu anggaran Rp2.700.000.000. Dan terakhir Kadis Kanla diduga menerima upeti program anggaran Kelompok Usaha Bersama (KUB) nelayan sebesar Rp 30 juta per kelompok sebanyak 15 kelompok dengan pagu anggaran Rp100 juta dari APBN. “Orang-orang dalam KUB itu bukanlah nelayan, melainkan teman dekat dan famili kepala dinas yang dengan keji menggerogoti uang negara,” kata pengunjukrasa. Beberapa saat berorasi di depan gedung DPRD, pengunjukrasa diperbolehkan masuk dan diterima Komisi B diketuai Hj Artati. Ketua juga didampingi anggota Hakim Tjoa Kian Lie,

Hj Nessy, dan Hj Dewi. Menanggapi aspirasi mahasiswa, Hakim meminta instasi hukum terkait mengusut tuntas kasus bantuan dua kapal nelayan yang dananya berasal dari pemerintah pusat dan juga dugaan lainnya. Dikatakan, pertemuan itu sudah menjadi forum resmi dan bisa dijadikan awal penyelidikan. Sementara, Hj. Artati menyatakan, pihak dewan melalui Komisi B telah melakukan investigasi dengan memanggil pihak terkait. Hasilnya, tidak ditemukan masalah dan dugaan korupsi untuk pengadaan dua boat nelayan. “Namun demikian, kami meminta supaya adik-adik dapat menghadirkan bukti lainnya agar kita dapat melakukan pemanggilan kembali,” kata Artati. (a32)

KOTAPINANG (Waspada): Terkait kasus pengeroyokan yang berujung pada tewasnya Ketua Carateker FSPTI-KSPSI PMKS PT. STA, Halomoan Siregar yang mencoba memasuki areal perusahaan di Desa Sabungan, Kec. Seikanan, Kab. Labusel, Selasa (8/1), pihak Kepolisian masih menahan dua tersangka. Kemungkinan besar jumlah tersangka tersebut akan bertambah. Hal itu diungkap Kabag Humas Polres Labuhanbatu, AKP MT Aritonang kepada Waspada, Kamis (10/1). Menurut Aritonang, berdasarkan pengembangan yang dilakukan pihaknya, kemungkinan besar akan ada penambahan jumlah tersangka. Hingga kini kata dia, Polres telah

memeriksa enam orang saksi mata. “Kemarin malam pun kita masih memeriksa saksi mata. Kemungkinan tersangka akan bertambah,” kata Aritonang. Dijelaskan, saksi yang diperiksa itu di antaranya Ketua PUK FSPTI-KSPSI PMKS PT. STA versi Musyawarah Unit Kerja (Musnik) 30 September 2012 (nonaktif) L dan Seketaris HM serta beberapa anggota pekerja bongkar muat lainnya. Sementara dua tersangka yang sudah ditahan yakni JR dan ES. Saat disinggung apa motivasi pengeroyokan tersebut, Aritonang mengaku belum dapat dipastikan. Dia juga tidak bersedia menjelaskan apakah ada kemungkinan kasus itu mengarah kepada pembunuhan

berencana. “Nanti setelah semua bahan dan keterangan sudah kita dapatkan akan segera dijelaskan.Sejauhinipenyelidikan masih berjalan,” katanya. Sementara, informasi yang berkembang menyebutkan, sebelum memasuki areal PT. STA untuk konsolidasi dan koordinasi, pihak korban sudah terlebih dahulu berkoordinasi dengan pihak Kepolisian setempat. Namun saat peristiwa itu terjadi, tidak ada pengawalan dari pihak keamanan. Diberitakan sebelumnya, Plt. KetuaFSPTI-KSPSIPMKSPT.STA, Desa Sabungan, Kec. Seikanan, Kab. Labusel, Halomoan Siregar tewasdikeroyoksejumlahpekerja bongkar muat perusahaan itu, Selasa (8/1). (c18)

Waspada/Rasudin Sihotang

DAN Patroli Satpol PP T.Balai didampingi petugas lain meminta siswa menyebutkan Pancasila.

Pelajar Terjaring Tak Hafal Pancasila TANJUNGBALAI (Waspada): Sejumlah pelajar yang terjaring razia rutin Satuan Polisi Pamong Praja Kota Tanjungbalai tidak hafal Dasar Negara Republik Indonesia, Pancasila dan Janji Siswa. Hal miris itu terungkap saat petugas mendata identitas sekaligus mengambil keterangan tujuh siswa berseragam SMA dan SMP di Kantor Sat Pol PP, Kamis (10/1). Ketujuh pelajar terpaksa dibawa karena melanggar Perda No.8 Tahun 2004 tentang Ketertiban Umum, berada di luar sekolah saat jam belajar. “Pancasila, satu Ketuhanan yang Maha Esa, dua Persatuan Indonesia, tiga Kerakyatan yang Dipimpin...,” sebut seorang anak SMA saat berusaha keras mengingat satu per satu poin asas NKRI itu. Kendati telah diberi waktu beberapa saat, namun dia tetap tidak bisa menyebutkannya dengan lengkap. Hal serupa juga terjadi dengan teman satu sekolahnya, murid berkemeja batik putih corak hijau itu terbata-bata saat diminta menyebutkan Pancasila. “Pancasila, satu Ketuhanan yang

Maha Esa, dua Kemanusiaan yang Adil dan Beradab, tiga lupa saya pak,” kata pelajar itu sambil tertunduk. Saat ditanya alasan dan penyebab tidak hafal Pancasila, siswa itu tak menjawab dan hanya tersenyum. Sementara untuk Janji Siswa, tak seorangpun dari tujuh pelajar mampu menyebutkan. Bahkan, ada yang mengaku tidak mengetahui apa itu Janji Siswa. “Kami tak tahu janji siswa pak, enggak pernah ada di sekolah,” ujar pelajar berambut ikal itu. Kepala Satpol PP Yusmada, SH didampingi Kasi Trantib dan Komandan Patroli Syahlan mengatakan ketujuh siswa dijaring dari beberapa warung internet di Jl. Sudirman. Saat diamankan, mereka asyik bermain game online seperti Point Blank, Antartika, dan jejaring sosial Facebook. Setelah dilakukan pendataan kataYusmada, pihaknya memberikan arahan dan bimbingan agar tidak mengulangi sekaligus membuat surat pernyataan. Selanjutnya dilakukan pemanggilan orang tua dan guru untuk menjemput para pelajar. (a32)

Waspada/Sapriadi

PLT Gubernur Sumut Gatot Pujo Nugroho memberikan tunggul dan piala Kecamatan terbaik 2012 kepada Camat Kisaran Timur Rahmat Hidayat Siregar.

Polisi Masih Tahan Dua Tersangka Camat Punya Tugas Berat Sukseskan Pembangunan Terkait Pembunuhan Di Sabungan

PMI Batubara Dapat Bantuan Ambulan Karyawan Inalum Donor Darah TANJUNGGADING (Waspada): Karyawan PT Inalum Kualatanjung melaksanakan donor darah berlangsung di RSU Inalum Tanjunggading, Kec. Seisuka Batubara, Kamis (10/1). Manager Humas PT Inalum Moranta Simanjuntak dalam laporannya mengatakan, donor darah dalam rangka HUT Inalum ke 37 ini diikuti 280 karyawan. “Jumlah ini dari tahun ke

tahun terus meningkat. Hal ini sebagai salah satu bentuk kepedulian perusahaan ini kepada masyarakat sekitarnya,” ujar Moranta. Hasil donor darah ini diserahkan kepada PMI Cabang Batubara Hadir. Ikut menyaksikan donor darah ini pengurus PMI Sumut dipimpin Selamat Riadi, pengur us PMI Batubara dipimpin ketuanya Dr John

Lihar Purba dan Manager RSU Inalum Dr H Attardien. Pada acara ini pengurus PMI Sumut diwakili Selamat Riady menerahkan bantuan satu unit mobil ambulan kepada PMI Cabang Batubara. Bantuan ini berupa pinjam pakai untuk kebutuhan operasional PMI Batubara. Bantuan diterima Ketua PMI Batubara John Lihar Purba. (c04)

KISARAN (Waspada): Mensukseskan pembangunan yang menitikberatkan kepada rakyat, Camat mempunyai perat dan tugas berat dalam membantu pemerintah, sehingga program berjalan dengan baik. Hal itu diungkapkan Plt Gubernur Sumatera Utara Gatot Pujo Nugroho dalam sambutannya saat acara pemberian penghargaan dan tunggul Kecamatan Terbaik di Sumut 2012 yang jatuh kepada Kec. Kisaran Timur, Kab. Asahan, di Lapangan Parasamya Kisaran, Kamis (10/1). Menurutnya, peraturan otomoni daerah, salah satu tuags yang harus dipikul oleh setiap kabupaten/kota, dan dalam hal ini untuk meningkatkan pelayanan, dan mengetahui keinginan masyarakat secara dekat adalah melalui kecamatan. Kecamatan, kata Gatot, merupakan pelaksana teknis kewilayahan yang mempunyai kekhususan dibandingkan dengan perangkat daerah lain. “Mengingat hal itu, seorang camat sebaik-

nya memenuhi syarat, seperti memiliki kemampuan intelektual yang sesuai dengan bidangnya dalam membantu pemerintah, dan juga harus memiliki sikap reaktif dan responsif,” jelas Gatot. Oleh sebab itu, untuk mendukung itu semua Pemprov Sumut melakukan anugerah Kecamatan terbaik, dan hal ini bukanlah semata sebagai perlombaan, namun sebagai sarana motivasi. Sehingga kecamatan memberikan pelayan terbaik dalam membatu pemerintah memberikan yang terbaik kepada masyarakat. Kegiatan itu dihadiri oleh Bupati Asahan Taufan Gama Simatupang, danWakilnya Surya, dan seluruh unsur Forum Koordinasi Pimpinan Daerah Kab. Asahan. Berdasarkan keputusan Gubernur Sumut No 188.44/f69/KPTS/2012, tentanag Kecamatan Terbak 2012 jatuh pada Kec. Kisaran Timur, Asahan, dengan Camat Rahmat Hidayat Siregar, dan untuk juara dua, Kec. Sunggal, Deliserdang, urutan tiga Kec. Medan Petisah, Kota Medan. (a15)

Pemilih Penyandang Cacat Pilgubsu Di Labura 397 Orang RANTAUPRAPAT ( Waspada): Jumlah pemilih dari kalangan penyandang disabilitas (cacat) untuk Pilgusu di Kab. Labuhanbatu Utara (Labura) berjumlah 307 orang. Pemilih penyandang disabilitas tak boleh terhalangi haknya untuk berpartisipasi dalam Pemilu. Ketua Panwaslu Labuhanbatu Utara (Labura) Yos Batubara, menyampaikan itu kepada Waspada via seluler saat di Medan, (Rabu 9/1) ketika dikonfirmasi hasil pengawasan mengenai daftar pemilih terutama penyandang disabilitas atau cacat. Yos menuturkan, berdasarkan ketentuan Pasal 11 ayat (3) Peraturan KPU Nomor 12 Tahun 2010 tentang Pedoman Tata Cara Pemutakhiran Data Dan Daftar Pemilih Dalam Pemilukada disebutkan, data atau daftar pemilih menggunakan formulir Model A – KWK.KPU paling sedikit meliputi nomor urut, nomor pemilih, nama lengkap, tempat/tanggal lahir dan umur, jenis kelamin, status perkawinan, alamat tempat tinggal, dan jenis cacat yang disandang.

Kalau pemilih tersebut adalah penyandang disabilitas atau cacat, maka harus disebutkan jenis cacat yang disandang oleh pemilih tersebut, ujar Yos. Berdasarkan data yang dimiliki Panwaslu Labura, ungkapnya, jumlah pemilih penyadang disabilitas sepeti tunanetra dan tunadaksa sebanyak 397 orang. Tunanetra atau buta 117 orang dan tunadaksa atau cacat tubuh 280 orang, disabilitas terbanyak yaitu di Kecamatan Kualuh Selatan 172 orang, dimana tunanetra 55 orang, demikian juga tunadaksa 117 orang. Alat bantu untuk pemilih penyandang disabilitas ini yaitu alat bantu tunanetra (braille template), meja bilik suara, ketinggian meja kotak suara, lebar bilik suara dan jalan menuju TPS. Untuk itu, untuk pemilih penyandang disabilitas, harus ada jaminan pendataan. Dengan diketahuinya jumlah pemilih disabilitas, tandasnya, akan memudahkan pengawasan pada tahapan pendistribusian logistik dan tahapan pungut hitung. (a18)

DPT Labusel Bertambah 8.042 Jiwa

Waspada/Sahril

PENGURUS PMI Sumut dan Batubara beserta perwakilan PT Inalum diabadikan bersama satu unit mobil ambulan bantuan PMI Sumut untuk PMI Batubara.

KOTAPINANG (Waspada): Komisi Pemilihan Umum (KPU) Kab. Labusel menetapkan Jumlah Daftar Pemilih Tetap (DPT) Pilkada Gubernur Sumatera Utara di Labusel sebanyak 185.792 Jiwa. Jumlah tersebut bertambah 8.042 jiwa dari Pilkada Bupati 2010 lalu. Hal itu diungkap Ketua KPU Labusel, Imran Husaini Siregar kepada Waspada, Rabu (9/1). Menurutnya,pihaknyasudahmenetepkanjumlah DPT berdasarkan sidang pleno yang digelar, Selasa (8/1) sesuai dengan keputusan No.003/BA/I/2013. “Terjadi penambahan jumlah DPT. Pilkada Gubsu ini jumlah DPT 185.792 sedangkan Pilkada Bupati

lalu 177.750 jiwa,” kata Imran. Dijelaskan, jumlah itu tersebar di lima kecamatan yakni Kec. Kampungrakyat sebanyak 35.354 jiwa yang terdiri dari 18.072 laki-laki dan 17.282 perempuan dengan jumlah TPS 99, Kec. Kotapinang 36.402 yakni 18.310 laki-laki dan 18.092 perempuang dengan jumlah TPS 100, Kec. Silangkitang 20.250 yakni 10.256 laki-laki dan 9.994 perempuan dengan TPS 64, Kec. Seikanan 30.612 yakni 15.248 laki-laki dan 15.364 perempuan dengan jumlah TPS 94, sedangkan Kec. Torgamba 63.174 yakni 30.513 laki-laki dan 63.174 perempuan dengan jumlahTPS 188. (c18)

Sumatera Utara

WASPADA Jumat 11 Januari 2013

B11

Gembong Narkoba P. Siantar Diciduk PEMATANGSIANTAR (Waspada): Tersangka gembong narkoba Kota Pematangsiantar yang merupakan mantan anggota Brimob, MGT, 37, alias Tongat, warga Jalan Maluku, Kel. Bantan, Kec. Siantar Barat, terjebak dan berhasil diringkus Sat Narkoba Polres. Penangkapan terhadap MGT dilakukan Sat Narkoba dipimpin Kasat AKP Sofyan dan KBO Ipda Resbon Gultom, SH di halaman Bank Mandiri, Jalan Jend. Sudirman, Pematangsiantar, Kamis (10/1) pukul 00:30. Saat diringkus dan dilakukan pengembangan, ditemu-

kan berbagai barang bukti dari MGT terdiri 16 gram sabu-sabu (SS) bernilai Rp16 juta terdiri 1 gramdisitasaatpenangkapandan 15 gram di dalam kamar Wisma Simarito, Jalan H. Adam Malik. Kemudian, ditemuka uang tunai diduga hasil penjualan SS Rp7.675.000, satu unit bong

berisi SS, satu unit timbangan digital, ratusan plastik klip, 12 unit kompeng, tiga lembar kartu ATM Bank Mandiri dan BRI, satu buku tabungan Bank Mandiri, satu lembar KTP, satu dompet, satu unit HP, satu tas tangan dan satu unit sepedamotor Yamaha RX King BK 2078 WAA. Kasat Narkoba saat dihubungi di ruang kerjanya menjelaskan, MGT yang dipecat sebagai anggota Brimob Kompi 2 Tanjungbalai pada 2002, karena kasus perbuatan cabul dan narkotika serta sudah pernah ditangkap dan dipenjara pada 2008 akibat kasus yang sama, sudah pernah ditangkap intel Korem 022/PT di Wisma Humanitas pada Rabu 12 Desember 2012 siang bersama seorang oknum anggota Polres Simalungun. Namun, MGT akhirnya dilepas akibat tidak cukup bukti tentang kepemilikan SS. Kemudian, imbuh Kasat Narkoba, MGT akhirnya ber-

hasil ditangkap sesudah tertangkapnya tersangka AGS, 24, warga Jalan Sentosa, Kel. Asahan, Kec. Siantar Timur, Pematangsiantar di Jalan Sentosa pada Rabu (9/1) siang. Saat ditangkap, ditemukanbarangbuktitigapaket atau 0,28 gram SS dari AGS. Menurut Kasat Narkoba, AGS ditangkap sesudah personel Sat Narkoba berhasil mendekati AGS. Sesudah tiga hari berteman, AGS dengan berani menunjukkan SS kepada personel Sat Narkoba dan personel Sat Narkoba langsung menangkapnya. Saat diinterogasi, AGS mengaku membeli SS dari MGT. Segera diatur strategi menjebak MGT dengan memerintahkan AGS memesan SS 1 gram melalui telepon seluler. MGT berhasil dihubungi dan sesudah beberapa jam kemudian, MGT menyuruh AGS datang ke Bank Mandiri Jalan Jend. Sudirman. Ternyata, MGT datang dan

masuk ke halaman Bank Mandiri dengan mengenderai sepedamotor. Kasat Narkoba bersama personelnya melakukan penyergapan. Namun, MGT melakukan perlawanan dan berusaha lari hingga kaki kiri Kasat Narkoba terluka akibat terseret saat MGT hendak lari. MGT akhirnya berhasil dilumpuhkan, namun menyangkal memilik SS. Kasat Narkoba tidak perduli dengan bantahan MGT dan segera menggeledah pakaiannya dan menemukan 1 gram SS di saku depan jaket MGT. Sesudah diinterogasi, MGT akhirnya mengakui masih ada barang bukti lain disimpan di Wisma Simarito, tempatnya menginap.Wisma itu digeledah dan ditemukan berbagai barang bukti lainnya. Menurut Kasat Narkoba, masih akan dilakukan pengembangan, karena MGT mengakui, SS berasal dari Bireuen, Aceh dan dibelinya di Kota Medan. (a30)

Drainase Di Panyabungan Segera Diperbaiki Waspada/Edoard Sinaga

BARANG bukti di antaranya 16,28 gram narkotika jenis sabusabu ditunjukkan Kasat Narkoba Polres Pematangsiantar AKP Sofyan (kiri) didampingi KBO Ipda Resbon Gultom, SH di ruang kerjanya, saat menjelaskan penangkapan terhadap tersangka gembong narkoba.

Peserta Jamkesmas Naik 20 Persen PEMATANGSIANTAR (Waspada): Peserta Jaminan Kesehatan Masyarakat (Jamkesmas) di Kota Pematangsiantar tahun ini naik 20 persen dibanding tahun lalu. Kepala Bidang (Kabid) Jamsarkes (Jaminan Sarana Kesehatan) Juniarito Pardede, Skm didampingi Sekretaris Dinas Kesehatan Pematangsiantar, H. Amar Daulay jumlah peserta untuk tahun 2013 berjumlah 64.827 jiwa sedang tahun sebelumnya 53.950 jiwa. “Untuk pelayanan bagi peserta Jamkesmas di tahun ini, kita masih menunggu pengumuman dari Menteri Kesehatan” kata Kabid Jamsarkes, Juniarito Pardede, SKM kepada Waspada di ruang kerjanya, Rabu (9/1). Setiap peserta yang mendapatkan pelayanan Jamkesmas akan menerima kartu tanda pesertaa baru. Kartu kepesertaan Jamkesmas tersebut menurut Pardede sampai Rabu belum dapat didistribusikan kepada masyarakat, karena masih ada kesalahan. “Mudah-mudahan akhir Januari nanti sudah bisa kita bagikan kepada peserta,” kata Pardede sambil menambahkan, para peserta Jamkesmas yang sebelumnya masih dapat menggunakan kartu lamanya untuk kegunaan berobat. Menjawab pertanyaan, Pardede menyebutkan, peserta yang mendapatkan Kartu Jamkesmas baru nanti berasal dari delapan kecamatan dan 53 kelurahan di Kota Pematangsiantar. Dan peserta Jamkesmas dapat menikmati pelayanan kesehatan di 19 Puskesmas serta 8 Puskesmas Pembantu (Pustu) yang ada di kota ini.(crap)

PANYABUNGAN (Waspada): Bupati Mandailing Natal (Madina) Hidayat Batubara, SE mengatakan, mengatasi seringnya terjadi luapan air, Dinas PU tahun ini akan memperbaiki drainese yang tersumbat di sepanjang jalan protokol. Bupati berharap, seluruh masyarakat sadar memelihara lingkungan demi keselamatan dan terhindarnya dari banjir serta penyakit. Demikian Bupati Madina Hidayat Batubara kepada wartawan, Selasa (8/1) di sela-sela kegiatan gotong-royong membersihkan sampah dari drainese yang selama ini berulangkali menyebabkan banjir di pasar baru Panyabungan, dan di beberapa lokasi lainnya. Bupati mengimbau masyarakat Madina umumnya, dan secara khusus yang bertempat tinggal atau berusaha

di jalan protokol Panyabungan, supaya membuang sampah pada tempat disediakan. Sikap proaktif masyarakat tersebut sangat penting, selain sebagai wujud peduli lingkungan, juga upaya mencegah tidak terjadi penyumbatan drainase yang bisa mengakibatkan banjir di musim hujan. Terlihat ikut gotongroyong Sekda Madina Daud Batubara, Kepala Badan Lingkungan Hidup, Kebersihan dan Pertamanan Drs Ahmad Ansyari Nasution, Kepala Disperindag, Koperasi UKM dan Pasar Drs Lis Mulyadi Nasution, Kepala bidang kebersihan dan pertamanan Rahmadsyah Lubis, serta rombongan bupati dari perwakilan SKPD. Kepala Badan Lingkungan Hidup Kebersihan dan Pertamanan Ahmad Ansyari Nasution didampingi Kabid Keber-

sihan dan Pertamanan kepada wartawan menyebutkan, dalam waktu dekat pihaknya akan menyediakan 10 tong sampah di pasar baru Panyabungan, tujuannya agar para pedagang tidak membuang sampah sembarangan. Usai gotongroyong, bupati dan rombongan melanjutkann kunjungan ke Pusat Pasar Baru Panyabungan untuk melihat kesibukan masyarakat di pusat pasar kebanggaan Madina. Kedatangan bupati secara tibatiba membuat pedagang kaget. “Saya ingin bersilaturahmi dengan masyarakat di pasar sekaligus meninjau pasar baru Panyabungan dan semua keluhan masyarakat terkait seringnya terjadi luapan air di depan SPBU dan pasar lama Panyabungan,” ucap Hidayat Batubara yang terlihat akrab berdialog dengan pedagang. (c14)

Pasca Bentrok Dairi, Warga Diminta Tahan Diri MEDAN (Waspada): Tokoh masyarakat Pakpak Fahruddin Kudairi mengajak warga masyarakat kedua kelompok yang bentrok di Desa Lae Nuaha, Kec. Siempatnempu Hulu, Kab. Dairi, agar menahan diri. “Ajakan ini agar tidak terjadi lagi hal-hal pertikaian yang mengambil korban baik materil maupun jiwa,” sebut Fahruddin yang berbicara lewat telpon selular, Kamis (10/1) siang. Fahruddin yang berbicara singkat kemarin juga menyesalkan peristiwa anarkis yang terjadi di daerahnya, Selasa (8/1). “Jelas pihak terkait mengetahui hal ini dan seharusnya intelijen dapat mencegah hal ini terjadi,” kata Ketua Dewan Pembina Himpunan Masyarakat Pakpak (Himpak) ini. Tokoh Pakpak yang bermukim di Kota Medan ini juga mengingatkan tokoh masyarakat di daerahnya agar menjadi tokoh yang benar-benar dapat memberi contoh teladan kepada masyarakat di sana. “Bukan sebaliknya malah menjadi pemicu pertikaian ini,” sesalnya. Khusus kepada pemerintah dan aparat kepolisian setempat, Fahruddin meminta agar lebih serius melihat kasus pertikaian dua kelompok di daerahnya. “Yang perlu adalah perkuat intelijen semua pihak guna mendeteksi secara dini pertikaian dua kubu yang tak lain masih bersaudara ini,” pintanya mengakhiri himbauannya. Seperti diwartakan sebelumnya, Marga Sagala dan Capah di Dairi terlibat bentrok hebat Selasa (8/1) malam usai pesta adat yang mereka gelar. Akibatnya, seorang warga luka parah dan satu unit rumah kepala desa dibakar. Bentrok itu disinyalir karena perebutan tanah ulayat. Pasca kejadian, pihak keamanan, baik dari Polres Dairi, maupun dari Kodim 0206/D, termasuk satu pleton personel Brimob Polda Sumut, tampak masih berjaga-jaga di lokasi kejadian, sementara tim Labfor Polda Sumut, masih melakukan olah TKP dan pengumpulan sejumlah barang bukti di puing rumah milik Kepala Desa Lae Nuaha, yang sengaja dibakar oleh orang tak dikenal (OTK). (m16)

Polres Tobasa Dan RM Al Hidayah Melakukan Sunatan Massal PORSEA (Waspada): Kepolisian Resort KabupatenToba Samosir (Polres Tobasa) dan Remaja Masjid (RM) Al Hidayah Porsea melakukan kegiatan amal sunatan massal di pelataran Masjid Raya Al Hidayah Porsea Tobasa, Selasa (8/1). Pada acara sunatan massal yang juga hasil kerjasama dengan Dinas Kesehatan Tobasa ini digelar dalam rangka menyambut peringatan Maulid Nabi Muhammad SAW 1434 H. Kapolres Tobasa melalui Kasat Binmas AKP Syafi’i dalam sambutannya mengatakan kegiatan positif seperti ini adalah sebagai bentuk bakti sosial dengan elemen masyarakat. Kegiatan ini diprakarsai sekumpulan generasi muda tergabung dalam Remaja Masjid Al Hidayah Porsea. “Begitu mendengar ada program positif seperti ini dicetuskan oleh anak-anak muda, langsung kita respon dengan sangat baik. Hal tersebut menandakan betapa kita sangat ingin menjalin hubungan erat dengan seluruh elemen masyarakat sepanjang itu adalah kegiatan yang positif,” kata Syafi’i. Ketua Panitia Pelaksana Suryadi Hamdan dalam laporannya mengatakan, seyogianya kegiatan ini dilaksanakan pada masa liburan lalu dengan target peserta jauh lebih banyak, akan tetapi persiapan yang kurang memadai menjadikan acara ini baru dapat terlaksana. Penasehat Remaja Masjid Al Hidayah Porsea Supriyadi kepada wartawan menjelaskan, dalam kegiatan ini kita juga diberikan bingkisan berupa kain sarung serta uang saku kepada seluruh peserta. Hadiah tersebut sebagai bentuk apresiasi dari Kapolres Tobasa AKBP H. Budi Suherman S.Ik. Turut hadir pada acara sunatan massal ini Kasat Sabhara AKP H.J. Berutu,Ketua BKPRMI Sophan Ahmadi Nasution S.Ag, Ketua GP.ANSOR Tobasa MHD.Ali M Pardede, Kasi Kesehatan Dasar Bernadeta Sihombing S.Km, Marihot Pardosi S.Km,Kepala Puskesmas Pintupohan Meranti dr. Rita, Kapus Habinsaran dr. Raja Ipan Sinurat, Kapus Porsea dr. Reinhart Siahaan, Kapus Ajibata dr. Asti Simanjuntak, dan sejumlah TIM medis yang menangani secara langsung acara sunatan massal ini. (a22)

Waspada/Edison Samosir

SATU unit toko kelontong di Kota Pangururan habis dilalap si jago merah.

Toko Kelontong Ludes Terbakar SAMOSIR (Waspada): Sebuah toko kelontong milik Rahel Naibaho, 45, yang terbuat dari papan di Pangururan, ludes terbakar, Kamis (10/1) pukul 10.00, namun tidak ada korban jiwa. Pantauan Waspada di lapangan, mobil pemadam kebakaran milik Pemkab Samosir berusaha memadamkan api disaksikan hampir seribuan orang. Sementara sebagian barang milik korban sempat diselamatkan, namun terdengar beberapa ledakan yang diduga berasal dari tabung gas. Arus transportasi Pangururan-Tomok mengalami kemacetan beberapa jam disebabkan ribuan masyarakat turun ke jalan menyaksikan kebakaran. Sumber api diduga berasal dari kompor

milik korban hingga merambat ke seluruh rumah. Kerugian ditaksir Rp200 juta. Salah satu pengurus ICW Kab. Samosir Edwin Simbolon mengharapkan DPRD bijak mengambil keputusan terkait pengadaan mobil pemadam kebakaran, karena sampai saat ini jumlah mobil pemadam kebakaran masih satu unit di Pangururan. Kapolres Samosir AKBP Donny Damanik melalui Kasat Reskrim Polres Samosir AKP Hady Siagian, SH Sik kepada Waspada, Kamis (10/ 1) mengatakan, pihaknya sudah mengamankan beberapa barang milik korban. Ditambahnya, pihaknya akan memintai bantuan Puslabfor Poldasu untuk melakukan penyidikan penyebab kebakaran. (c11)

Tangkap Pembunuh, Polisi Diserang GUNUNGSITOLI (Waspada): Tim Buser Sat Rekrim Polres Nias nyaris diserang massa saat hendak mengamankan salah seorang terduga pelaku pembunuhan terhadap guru SDN 076080 Sihare’o III, Kec. Mau Torotodo Waruwu. Polisi terpaksa melepaskan satu kali tembakan peringatan di udara untuk menghalau massa yang berusaha menggagalkan penangkapan tersangka AG, Rabu (9/1). Keterangan dihimpun Waspada sesuai laporan Kanit Buser Sat Reskrim Polres Nias Bripka Saat Zebua kepada Waka Polres Nias Kompol Bazawato Zebua, SH, MH di Mapolres Nias. Kanit Buser Sat Reskrim Polres Nias, dia terpaksa melepaskan tembakan peringatan di udara karena mengantisipasi warga yang berusaha mendekati timnya yang sedang menggiring AG ke atas mobil yang diparkir berjarak 100 meter dari rumah duka. “Karena situasi agak memanas dan banyaknya warga yang berusaha mendekat dengan membawa kayu dan tidak mau memberi jalan serta penjelasan petugas akibat teriakan provokasi tersangka AG, saya dengan terpaksa melepaskan sebuah tembakan peringatan di udara agar warga menjauh dan memberikan

jalan kepada kami untuk meninggalkan lokasi tersebut,” jelas Saat Zebua kepada Waka Polres Nias. Saat juga melaporkan kepada Waka Polres, menurut saksi yang saat ini identitasnya masih dirahasiakan, AG diduga keras sebagai salah seorang dari enam pelaku pembunuhan terhadap seorang guru bernama Torotodo Waruwu, Senin (10/12) yang lalu. Waka Polres Kompol Bazawato Zebua, SH, MH usai mendengar laporan Kanit Buser, kepada wartawan mengatakan, sesuai prosedur tempat tempat yang dilarang untuk dilakukannya penangkapan adalah rumah ibadah, ruang sidang pengadilan yang sedang melaksanakan sidang dan pada rapat paripurna. Mengenai tembakan peringatan yang dilakukan Kanit Buser, hal tersebut wajar dilakukan polisi ketika merasa terancam saat melaksanakan tugas, dan Waka juga mengatakan pihaknya bersama beberapa anggota lainnya akan mendatangi rumah duka untuk menjelaskan kejadian sebenarnya. Di tempat yang sama,Yunus Zandroto salah seorang keluarga korban yang ikut tim Buser saat mengamankan AG mengatakan, mereka nyaris diserang warga ketika mengamankan AG. (a25)

Rekomendasi Pansus DPRD Madina:

Cabut Izin PT. Palmaris Raya, Warga Dapat Lahan Cadangan

Waspada/Sarmin Harahap

BUPATI Madina Hidayat Batubara dan rombongan melakukan gotongroyong di jalan protokol,Panyabungan.

Sakit Hati, Bunuh Tetangga KABANJAHE (Waspada): Tim Sat Reskrim Polres Tanah Karo, Rabu (9/1) berhasil mengungkap misteri pembunuhan yang menewaskan Tami br Purba, 62, warga Desa Samura, Kabanjahe, Kab. Karo. Pembunuhan ini ternyata karena dipucu sakit hati. Polisi juga berhasil mengamankan seorang tersangka PB, 44, warga Samura yang masih bertetangga dengan korban, diduga pelaku pembunuhan yang mengakibatkan korban tewas mengenaskan di belakang rumahnya. Penemuan mayat wanita berawal dari adanya laporan warga. Info ini ditindaklanjuti dengan menerjunkan personel ke lapangan dipimpin Kasatreskrim Polres Tanah Karo AKP Harry Azhar Sik. Mayat korban dievakuasi ke RSU Kabanjahe dan membentuk tim untuk melakukan penyidikan terhadap pelaku pembunuhan yang sempat menghilang beberapa hari. Tersangka PB berhasil diamankan petugas dari rumah keluarga di Desa Samura dan langsung diboyong ke Mapolres Tanah Karo di Kabanjahe. Dari hasil pemeriksaan awal, tersangka PB mengakui kalau dia membunuh korban karena sakit hati. Dijelaskan, pagi itu, Minggu (30/12), korban mendatangi rumah tersangka dan menanyakan kalau ada sisa nasi yang bisa dijadikan untuk pakan ternak. Korban sekaligus menyuruh tersangka membuat sapu lidi dan dijanjikan akan dibayar Rp20

ribu oleh korban. Tersangka menyanggupi permintaan korban membuat sapu lidi. Setelah beberapa jam, tersangka kembali mendatangi korbanyangsaatitusedangmemberi makan ternak miliknya. Tapi saat ditagih upah yang dijanjikan, menurut tersangka, korban malah mengolok-oloknya. Dia sakit hati dan kemudian seperti gelap mata. Tersangka mengambil batu di belakang rumah dan langsung memukul kening kanan tersangka. Korban pun roboh. Tersangka kemudian mengambil palu dan memukul kepala korban hingga tewas. Melihat korban sudah tidak berdaya, tersangka menyeret korban ke dalam rumah korban. Tergiur melihat harta benda

yang ada di jari dan leher korban timbul niat tersangka mengambilnya. Tersangka melarikan diri ke Medan dengan membawa emas dan berlian milik korban. Setelah buron beberapa hari, tersangka berhasil diamankan petugas dari persembunyianya di rumah familinya tanpa ada perlawanan dan segera dibawa ke Mapolres Tanah Karo untuk proses hukum lebih lanjut. Kapolres Tanah Karo AKBP Marcelino Sampouw melalui Kasatreskrim AKP Harry Azhar Sik kepada Waspada membenarkan, kini tersangka beserta barang bukti berupa batu, palu, cincin, kalung yang terbuat dari emas dan berlian sudah diamankan. (c10)

PANYABUNGAN (Waspada): Pemkab Madina dan jajarannya diminta mencabut segala jenis perizinan PT. Palmaris Raya, kemudian memediasi dan memfasilitasi masyarakat Desa Batahan I agar dapat menguasai lahan cadangan milik Dinas Tenaga Kerja dan Trasmigrasi Sumut yang selama ini diserobot perusahaan perkebunan itu. Demikian antara lain bunyi dua point dari sebelas point keputusan DPRD Madina tentang rekomendasi terhadap PT. Palmaris Raya melalui sidang paripurna dewan dipimpinWakil Ketua Fachrizal Efendi Nasution yang dihadiri unsur Muspida, jajaran Pemkab Madina dan puluhan masyarakat Kec. Batahan yang mengaku sudah beberapa tahun dizolimi perusahaan, Rabu (3/1). Kepusan tersebut diperoleh setelah penyampaian laporan dan rekomendasi Panitia Khusus (Pansus) PT Palmaris Raya, pandangan fraksi terhadap laporan dan rekomendasi Panus PT Palmaris Raya yang disampaikan fraksi-fraksi dan persetujuan anggota DPRD Madina terhadap rekomendasi Pansus yang disampaikan dalam paripurna. Ketua Pansus DPRD Madina H Bahri Efendi Hasibuan menyampaikan, sesuai hasil investigasi, koordinasi dan konsultasi dilakukan mereka selama ini, memang terdapat beberapa kejanggalan dalam perjalanan perusahaan PT. Palmaris Raya di daerah pantai barat tersebut. Poin ketiga rekoemndasi itu dinyatakan bahwa dalam merencanakan dan mengatur prosedur kepemilikan terhadap aset lahan dan tanaman yang akan ditinggalkan oleh PT Palmaris Raya sesuai dengan peraturan yang berlaku dengan mempertimbangkan kesejahteraan rakyat dan digunakan sebagai lahan perkebunan milik daerah untuk menambah pendapatah asli daerah (PAD). Keempat, mengembalikan lahan milik warga Desa Batahan III seluas 220 hektar yang telah diserobot dan terhadap sisa lahan seluas

80 hektar agar diselesaikan kepemilikannya oleh masyarakat secara arif dan bijaksana yang difasilitasi oleh pemerintah daerah. Kelima, meminta Pemkab untuk memediasi dan memfasilitasi peruntukan lahan cadangan kepada 116 kepala keluarga sebagai pertambahan penduduk Desa Batahan III yang belum memiliki lahan.Keenam, mengembalikan hak Desa Batahan I yaitu lahan milik 93 KK sama dengan 186 hektar yang terdiri dari dua hamparan yaitu 53 hektar dan 40 hektar. Ketujuh, mengembalikan lahan Desa Pasar Batahan yang diberikan oleh ninik mamak Desa Pasar Batahan (dari kelompok jambur asli dan kelompok sakato) seluas 200 hektar kepada Desa Pasar Batahan ditambah lagi dengan lahan garapan milik pribadi masyarakat.Kedelapan, meminta pemerintah daerah agar memfasilitasi proses kepemilikan lahan warga Desa Batahan I yang sampai saat ini belum terbit sertifikatnya. Kesembilan, demi terjaminnya sinergi dan kepastian hukum yang utuh dengan mengedepankan kepentingan masyarakat selaku pemilik kedaulatan tertinggi, maka diminta kepada Polres Madina agar menarik dan tidak menempatkan kembali personel di wilayah perkebunan yang sedang dipermasalahkan antara masyarakat dengan PT Palmaris Raya. Kesepuluh, memberikan batasan waktu kepada pemerintah daerah dalam menuntaskan rekomendasi ini selama tiga bulan sejak tanggal 3 Januari sampai 03 April 2013 dan kesebelas disebutkan bahwa DPRD akan membentuk tim pengawas terhadap tindak lanjut dan penyelesaian seluruh item yang termaktub dalam rekomendasi ini. Keputusan DPRD Madina tentang rekomendasi terhadap PT Palmaris Raya itu juga mempertimbangkan adanya aspirasi masyarakat Batahan I, Batahan III dan Pasar Batahan yang disampaikan 9 April 2012 yang pada intinya menuntut pencabutan izin PT Palmaris Raya. (a28)

PLN P. Sidimpuan Hancurkan Segel Meteran 2012

Waspada/Micky Maliki

PB, tersangka diduga pelaku pembunuhan ketika menjalani pemeriksaan di ruang Reskrim Polres Tanah Karo.

P.SIDIMPUAN (Waspada): Manager Area PT PLN (Persero) Padangsidimpuan, Ir. Dwi Alfan Zuanedi MM menyaksikan penghancuran kepingan mata segel meteran listrik buatan 2012 di aula kantor itu, Kamis (10/1). Penghancuran dilakukan tim penghancur segel meteran listrik dari Area PT PLN Padangsidimpuan empat orang yaitu Asiten Manager (Asmen) Proteksi Irwan, anggotanya Asrul Laili, Hafid Ardi, Edwin Simatupang dan Risto Sihaloho. Kemudian, tim dari PT PLN Wilayah Tk I Sumut dua orang, Swardi dan Suryono, menyaksikan dan meneliti tang segel sekaligus menyaksikan penghancuran segel meteran. Sebelum-

nya, mata tang segel meteran dari seluruh kantor ranting seluruh Tapanuli Bagian Selatan (Tabagsel) wilayah kerja PT PLN Area Padangsidimpuan telah dikumpulkan tim. Asmen Proteksi menjelaskan kepada Waspada, penghancuran segel dan mata tang segel meteran listrik PLN merupakan kegiatan rutin setiap tahun guna mengurangi kejahatan di bidang kelistrikan PLN. “Penghancuran mata (cetakan) segel meteran listrik PLN buatan 2012 dengan memakai mesin gerinda sebagai kegiatan rutin setiap tahun. Hal ini untuk menghindari kejahatan di bidang kelistrikan dari tangan yang tidak bertanggungjawab,” ujarnya. (c13)

Sumatera Utara

B12 Kota

Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:34 12:47 12:35 12:42 12:41 12:38 12:35 12:30 12:37 12:37

15:58 16:10 15:58 16:05 16:04 16:03 15:59 15:54 16:01 16:00

Magrib 18:32 18:43 18:33 18:38 18:38 18:40 18:34 18:30 18:36 18:34

‘Isya

Imsak

Shubuh Syuruq

Kota

19:46 19:56 19:47 19:51 19:52 19:54 19:47 19:43 19:49 19:47

05:04 05:20 04:05 05:14 05:13 05:04 05:04 04:59 05:07 05:08

05:14 05:30 05:15 05:24 05:23 05:14 05:14 05:09 05:17 05:18

L.Seumawe L. Pakam Sei Rampah Meulaboh P.Sidimpuan P. Siantar Balige R. Prapat Sabang Pandan

06:34 06:50 06:35 06:44 06:43 06:34 06:34 06:29 06:37 06:38

Zhuhur ‘Ashar 12:40 12:33 12:32 12:44 12:32 12:32 12:32 12:29 12:47 12:34

16:03 15:57 15:56 16:07 15:56 15:56 15:57 15:54 16:09 15:58

Magrib

‘Isya

Imsak Shubuh Syuruq

Kota

18:36 18:32 18:31 18:42 18:34 18:32 18:33 18:30 18:42 18:35

19:49 19:45 19:44 19:55 19:47 19:45 19:46 19:44 19:55 19:48

05:13 05:03 05:03 05:15 04:58 05:01 05:00 04:57 05:21 05:01

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

05:23 05:13 05:13 05:25 05:08 05:11 05:10 05:07 05:31 05:11

06:43 06:33 06:32 06:45 06:28 06:31 06:30 06:27 06:51 06:31

Zhuhur ‘Ashar 12:34 12:35 12:45 12:38 12:35 12:41 12:30 12:40 12:33 12:32

15:58 15:59 16:07 16:02 15:58 16:04 15:54 16:04 15:57 15:56

WASPADA Jumat 11 Januari 2013

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:35 18:35 18:40 18:38 18:33 18:38 18:29 18:39 18:34 18:31

19:48 19:48 19:54 19:52 19:46 19:52 19:43 19:52 19:47 19:44

05:00 05:04 05:18 05:05 05:05 05:13 04:59 05:09 05:00 05:02

05:10 05:14 05:28 05:15 05:15 05:23 05:09 05:19 05:10 05:12

Panyabungan Teluk Dalam Salak Limapuluh Parapat Gunung Tua Sibuhuan Lhoksukon D.Sanggul Kotapinang Aek Kanopan

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:30 06:34 06:48 06:35 06:35 06:43 06:29 06:39 06:30 06:32

Zhuhur 12:30 12:37 12:35 12:31 12:33 12:30 12:30 12:40 12:34 12:28 12:30

‘Ashar Magrib 15:55 16:02 15:59 15:55 15:57 15:55 15:55 16:02 15:58 15:53 15:54

18:33 18:41 18:35 18:30 18:33 18:32 18:32 18:36 18:34 18:29 18:30

‘Isya

Imsak

Shubuh Syuruq

19:47 19:54 19:49 19:43 19:46 19:45 19:46 19:49 19:48 19:43 19:44

04:56 05:02 05:03 05:00 05:01 04:57 04:56 05:12 05:01 04:55 04:58

05:06 05:12 05:13 05:10 05:11 05:07 05:06 05:22 05:11 05:05 05:08

06:26 06:32 06:34 06:30 06:31 06:27 06:26 06:42 06:31 06:25 06:28

Pembangunan Pelabuhan Tidak Terealisasi MoU Sudah Lima Tahun PANGKALANSUSU (Waspada): Meski penandatanganan Memorandum of Understanding (MoU) antara Bupati Langkat dengan PT Pelindo terkait pembangunan pelabuhan umum bertaraf internasional di Pangkalansusu sudah dilakukan sejak lima tahun lalu, namun pelaksanaannya hingga kini tak kunjung terealisasi. MoU antara Pelindo dengan pemkab Langkat ditandatangani tahun 2009 lalu, namun sampai memasuki tahun 2013 ini, proses pembangunan infrastruktur pelabuhan belum ada tanda-tanda dimulai. Tidak jelas apa yang menjadi kendala sehingga rencana pembangun tidak kunjung terwujud. “Saya berharap, keseriusan Pelindo untuk membangun pelabuhan khusus Pertamina

menjadi pelabuhan umum dan tidak hanya sekedar basa basi belaka,” kata Kirana Sitepu, tokoh masyarakat Pangkalansusu dengan nada kecewa kepada Waspada, Rabu (9/1). Ia merasa yakin, jika pembangunanterealisasi,perekonomian Kab. Langkat akan meningkat. Terobosan Bupati Langkat, Ngogesa Sitepu, menurut dia, suatu langkah positif untuk memacu akslerasipembangunandidaerah

Dana ADD TA 2012 Diduga Dicairkan Tanpa Prosedur PANGKALANSUSU (Waspada): Wakil Ketua BPD, Musa Keulana, mempertanyakan Dana Alokasi Desa (ADD) yang bersumber dari APBD Langkat T.A 2012 untuk Desa Payatampak, Kec. Pangkalansusu, yang dapat dicairkan diduga tanpa memenuhi prosedur administrasi. “Saya menerima informasi dari salah seorang perangkat desa bahwa dana ADD sudah cair, namun saya tidak mengetahui berapa jumlah nominalnya. Saya heran, kenapa bendahara Pemdes bisa mencairkan dana tersebut, padahal BPD tidak ada menandatangani berita acara,” ujarnya. Ironisnya lagi, kata Keulana, 30 persen dari dana tersebut kabarnya telah digunakan dengan dalih untuk keperluan operasional perangkat desa. “Kalaulah dikatakan untuk operasional perangkat desa seharusnya dimusyawarahkan,” ujarnya. Kades Payatampak Suwarmin dikonfirmasi Waspada di ruang kerjanya, Kamis (10/1) mengakui, dana ADD telah cair sebesar Rp46 juta. Menurut dia, 30 persen dari total anggaran telah digunakan untuk operasional perangkat desa, sementara 70 persen belum digunakan untuk fisik karena belum ada BPD yang defenitif. “Sekarang ini, 70 persen dari dana ADD belum digunakan dan masih tersimpan direkening bendahara desa,” ujar Swarmin, sembari menambahkan, dana tersebut diberi bendahara Pemdes dalam bentuk giro. Kepala Dusun V Abdi, Uun Sasmita, dikonfirmasi pada hari yang sama mengaku, menolak menerima dana untuk operasional perangkat desa. Apalagi dengan dalih untuk biaya perjalanan dinas ke Pemdes. “Saya merasa tidak mengikuti perjalanan dinas ke Pemdes, makanya saya tolak,” imbuhnya. Menurut Sasmita, ada tiga orang dari lima kepala dusun yang ketika itu menolak menerima dana ADD dari Saidah, selaku bendahara desa, yakni Ismail, Jafar Sidiq Nasution dan ia sendiri.“Daripada kami berhadapan dengan hukum, lebih baik kami tolak,” tandasnya. Camat Pangkalansusu, Sukhyar Mulyamin, dihubungi secara terpisah menegaskan, ia tidak mengetahui kalau dana ADD telah dicairkan.“Memang informasi tentang pencairan itu ada saya dengar, tapi apakah benar atau tidak saya belum tahu,” tukasnya. (a02)

Sikat Sepedamotor Teman Satu Diringkus Polisi BINJAI (Waspada): Sepedamotor milik Lilik Wahyudi, 36, penduduk jalan Sukadamai Kelurahan Sukaramai, Kec. Binjai Barat, Sabtu (5/1) sore disikat temannya dengan cara dibawa kabur oleh teman sekampungnya sendiri yang berintial K, 37, dan N, 28, serta A, 30. Akibat pencurian tersebut, korban mengalami kerugian sebesar Rp10 juta. Karena ditunggu tunggu tak kembali, akhirnya korban melaporkan kejadian tersebut ke Polrek Binjai Barat dan pihak Polsek Binjai Barat begitu mendapat pengaduan dari korban langsung mengembangkan kasus tersebut. Senin (7/1) pagi tersangka K berhasil diringkus anggota Serse Polsek Binjai Barat tidak jauh dari rumahnya, sedangkan N dan A, yang juga pelaku pencurian tersebut, kini masih dalam buronan. K, saat ditemui wartawan di Polsek Binjai Barat ketika diperiksa oleh pihak kepolisian, mengakui hanya menerima Rp300 ribu dari hasil penjualan sepedamotor milik Lilik Wahyudi. Dan dikatakannya pula, sepedamotor milik korban dijual oleh N dan A dengan harga Rp1,2 juta. Kapolsek Binjai Barat AKP M Purba ketika dikonfirmasi Rabu (9/1), membenarkan dan kini pihaknya masih mengejar dua lagi pelakunya. (a05)

Warga P. Manis Keluhkan Debu P. BRANDAN (Waspada): Di sekitar perbaikan jalan Raya Medan – Aceh, persisnya Desa Paluh Manis, Kec. Gebang Langkat, pada lokasi jalan yang saat ini masih diperbaiki pelebaran jalan dengan pengorekan badan jalan di kiri dan kanan, menimbulkan debu akibat terlambatnya kenderaan penyiraman di sekitar jalan itu, Kamis (10/1). Pengamatan Waspada, PT AK yang mengerjakan proyek jalan itu, kemungkinan alat kenderaan pengangkut air hanya memiliki sebuah tanki, sehingga memiliki keterbatasan. Debu yang berterbangan itu, bisa membahayakan pengguna jalan, karena terbatasnya pandangan ke depan, serta bisa mengakibatkan terjadinya kecelakaan. (c01)

ini, namun sayangnya Pelindo masih setengah hati. Padahal, kata Sitepu, dengan beroperasinya pelabuhan umum bertaraf internasional, otomatis dinamika perekonomian masyarakat akan semakin maju dan berkembang. Mantan anggota Komisi I DPRD Langkat itu yakin, perubahan status pelabuhan khusus PT Pertamina (Persero) menjadi pelabuhan umum akan membawa dampak positif yang sangat luar biasa. Karenanya, ia berharap, rencana Pelindo untuk membuka pelabuhan

umum tak hanya sekedar konsep di atas kertas. Dia juga menekankan kepada Pemkab Langkat agar proaktif menggalang negoisasi dengan pejabat pusat dan jangan pasif menunggu ketidak pastian dari PT Pelindo. “Usaha dan kerja keras Pemkab sangat dibutuhkan demi terwujudnya pembangunan pelabuhan umum di daerah ini,” tandasnya. Menurut Sekretaris DPC PDI Perjuangan Kab. Langkat itu, Pangkalansusu sudah saatnya dibangun pelabuhan umum bertaraf internasional meng-

ingat letaknya sangat strategis. Di samping itu, pembangunan pelabuhan umum di daerah ini dapat dijadikan alternatif untuk mengatasi kepadatan mobiltas di pelabuhan Belawan yang saat ini sudah sangat padat dan tidak memungkinkan lagi untuk dikembangkan. Rencana mengaktifkan kembali pelabuhan khusus milik PT Pertamina (Persero) menjadi pelabuhan umum sudah mengemuka sejak lama.Tapi yang disesalkanwargaLangkat,pemerintah Pusat terkesan tidak serius membuat kebijakan untuk pemerataan pembangunan. (a02)

Truk Tubruk Betor, Seorang Pelajar Kritis, Tiga Luka LUBUKPAKAM (Waspada): Truk tronton BK 8432 NC menubruk becak bermotor di Jalan Lintas Sumatera (Jalinsum) Km 27-28, tepatnya di depan Gereja RK Kelurahan Cemara, Kec. Lubukpakam, Kamis (10/11). Akibatnya, seorang pelajar kritis, tiga lainnya luka ringan. Informasi Waspada himpun kemarin, laka lantas terjadi sekira pukul 07.30 itu, bermula saat truk yang dikemudikan Suhardi dari arah Tebingtinggi menuju Medan. Setiba di Tempat Kejadian Perkara (TKP) diduga rem blong pengemudi dan truk tak dapat menguasai truknya yang oleng langsung menabrak bagian belakang

betor yang berada di depannya. Truk kemudian oleng ke kiri secara beruntun menubruk pejalan kaki dan akhirnya terhenti setelah menubruk tangga jembatan penyeberangan. Akibatnya, seorang pejalan kaki yang juga pelajar kelas 1 SMP Katolik AdvenLubukpakamRezaSiringoringo menderita luka berat alias kritis, sehingga warga Desa Pagar Jati Lubukpakam ini dilarikan ke RS Adam Malik Medan. Sedangkan tiga orang lainnya mengalami luka ringan, di antaranya Dicky Gayatri Sitorus, 12, siswa kelas 1 SMPN 1 Lubukpakam, Glen Ardi, 12, siswa kelas 6 SD dan Rolas alfredo, 9, Kelas 4 SD, keduanya pelajar di Ya-

yasan Katolik Advent Lubukpakam. Ketiganya kini di rawat di RS Sari Mutiara Lubukpakam. Ketiga pelajar ini merupakan penumpang betor yang dikemudikan Hotbin Hasibuan, 40, wargaPagarJatiLubukpakambersama dua rekan pelajar lainnya. Camat Lubukpakam Citra Efendi Cappah, bersama Lurah Cemara pasca kejadian di lokasi langsung menyurati pihak terkait agar segera melakukan perbaikan terhadap tangga penyeberangan yang telah rusak akibat laka lantas tersebut. Kini kasus laka lantas tersebut beserta barangbukti telah diamankan pihak Satlantas Polres Deliserdang. (m16)

Waspada/Ist

Truk yang menubruk betor dan pejalan kaki terhenti setelah menabrak tangga penyeberangan.

ICMI Sergai Bantu Perlengkapan Sekolah SEIRAMPAH (Waspada): Sebagai bentuk kepedulian terhadap kelancaran proses belajar dalam pendidikan, ICMI Serdang Bedagai (Sergai) memberikan bantuan perlengkapan sekolah kepada para siswa sekaligus mendukung program Pemkab Sergai wajib belajar 12 tahun. Penyerahan bantuan berupa alat tulis diserahkan Ketua ICMI Sergai Drs. H. Haris Fadillah, M.Si didampingiWakil Ketua Drs. Joni Walker Manik MM, Bendahara H. Gustian SE.Ak, MM dan Kabag Humas Drs. H. Mariyono SP. Bantuan perlengkapan sekolah ini ditujukan kepada

siswa/siswi di Pondok Pesantren (Ponpes) Zakiyyun Najah Desa Firdaus, Kec. Sei Rampah, Yayasan Al Jami’iyatulWashliyah MTs Alwasliyah 16, Kelurahan Batang Terap, Kec. Perbaungan, dan Yayasan Al Jami’iyatul Washliyah Desa Nagur, Kec. Tanjung Beringin, Rabu (9/1). Dalam sambutannya, Ketua ICMI Sergai H. Haris Fadillah mengatakan, kemakmuran dan keberhasilan suatu daerah yang dicita-citakan dapat dilihat dari peningkatan sumber daya manusia yang didasari oleh ilmu pengetahuan. Dan ilmu pengetahuan didapatkan dari lembaga-lembaga pendidikan seperti

sekolah, pesantren dan majelis taqlim. Untuk itu Haris Fadillah berpesan kepada anak-anak yang hadir untuk rajin belajar agar tercapainya cita-cita di masa depan serta selalu berdoa supaya memiliki masa depan yang cerah dan jalan-jalannya dipermudah, harap Haris. Saat menerima bantuan dari ketua ICMI Sergai, Ketua Ponpes Zakiyyun Najah Marlutan Siregar sebagai wali dari siswa/siswi Ponpes mengungkapkan terima kasih atas bantuan yang diberikan. Dia berharap agar silaturahmi ini terus terjalin di masa mendatang. (a08)

Tarif Parkir Di Bukit Lawang Di Luar Ketentuan Perda STABAT (Waspada): Tingginya tarif parkir selama ini di lokasi wisata Bukit Lawang Kab. Langkat yang di luar ketentuan peraturan daerah, akhirnya disepakati masyarakat tiga desa di sana berlaku mulai Januari 2013. “Biaya parkir roda dua Rp10.000 dengan rincian Rp2.000 untuk Dishub Langkat, Rp5.000 untuk pemilik lahan parkir, Rp2.000 untuk kas tiga desa di sana dan Rp1.000 untuk petugas jaga,” kata Kadis Perhubungan Langkat Alder Syam, Kamis (9/1). Sementara untuk kendaraan roda empat disepakati Rp20.000 dengan rincian Rp4.000 untuk Dishub Langkat, Rp10.000 untuk pemilik lahan dan Rp6.000 untuk juru parkir bersangkutan serta masuk ke kas desa. (a01/a03)

Waspada/Edi Gultom

KETUA ICMI Sergai Drs. H. Haris Fadillah, M.Si menyerahkan bantuan perlengkapan sekolah kepada siswa/siswiPonpes Zakiyyun Najah.

Waspada/Edi Gultom

BUPATI Sergai Ir. HT Erry Nuradi, M.Si didampingi Wabup Ir. H. Soekirman, Pelaksana Kepala BPBD Drs. Joni Walker Manik, MM dan Camat Sei Rampah Drs. Fajar Simbolon menyerahkan bantuan paket sembako kepada warga.

Pasca Banjir, Bupati Sergai Serahkan 2.026 Paket Sembako SEIRAMPAH (Waspada): Sebagai bentuk kepedulian dan meringankan beban masyarakat pasca musibah banjir beberapa waktu lalu, Pemkab Sergai melalui Badan Penangulangan Bencana Daerah (BPBD) Sergai kembali menyalurkan bantuan berupa paket sembako bagi masyarakat Kec. Sei Rampah, korban banjir paling banyak. Bantuan diserahkan Bupati Ir. HT Erry Nuradi, M.Si didampingi Wabup Ir. H. Soekirman, di halaman Kantor Camat Sei Rampah Desa Firdaus, Selasa (8/1). Hadir Pelaksana Kepala BPBD Sergai Drs. Joni Walker Manik, MM, Kepala Badan Pemberdayaan Masyarakat dan Pemerintahan Desa (BPMPD) H. Ifdal, S.Sos, M.AP, Camat Sei Rampah Drs. Fajar Simbolon, Sekcam Sei Rampah Drs. Andi Ma’arif, para Kades dan masyarakat penerima bantuan. Penyerahan bantuan untuk Kec. Sei Rampah berupa 2.026 paket sembako untuk 6 desa, yakni Desa Sei Rampah 1.356 KK, Pematang Ganjang 226 KK, Cempedak Lobang 260 KK, Sei Rejo 108 KK, Silau Rakyat 36 KK dan Desa Firdaus 40 KK. Setiap paket bantuan berisi 10 kg beras, 4 kg gula pasir dan 4 liter minyak goreng kemasan. Bupati Erry Nuradi menjelaskan, ada lima tindakan yang dilakukan pemerintah menangani musibah banjir, yakni SAR (Search and Rescue) atau dicari dan selamatkan dulu korban, kemudian tanggap darurat dengan menyediakan dapur umum, air bersih, selimut dan tenda serta pemberian obat-obatan/ pemeriksaan kesehatan gratis. Tindakan ke tiga adalah rehabilitasi dengan mempercepat perbaikan sarana dan prasarana yang rusak. Ke empat rekonstruksi (membangun kembali) sarana dan prasarana yang rusak. “Ke lima counselling dengan memberi penguatan berupa bimbingan dan penyuluhan bagi korban, agar tegar menjalani kehidupan secara normal di masyarakat,” papar Bupati Erry

Nuradi. Lebih lanjut Bupati Sergai Erry Nuradi mengungkapkan khusus bencana banjir yang menimpa beberapa rumah penduduk bahwa tindakan SAR sudah dilakukan Pemkab Sergai bersama oleh jajaran TNI dan Kepolisian dibantu masyarakat setempat. Demikian juga halnya dengan tindakan tanggap darurat, sejak peristiwa banjir Pemkab Sergai dan beberapa yayasan sosial maupun warga masyarakat yang peduli telah memberikan bantuan berupa makanan, air bersih layak konsumsi, pendirian tenda-tenda tempat penampungan sementara korban. Untuk tindakan rehabilitasi bagi sarana maupun prasarana yang rusak menurutnya, sedikit memakan waktu dalam pencegahan musibah banjir datang kembali dintaranya tindakan normalisasi Sungai Sei Rampah berupa pelebaran sungai, peninggian tebing dan memperdalam sungai (pengerukan), jelas Bupati Erry Nuradi. Selain itu Bupati Erry Nuradi menghimbau kepada warga untuk tidak melupakan budaya gotong-royong, bekerja bakti membersihkan lingkungan termasuk membersihkan saluran air dari sampah ketika menghadapi musim penghujan. Kegiatan gotong-royong menurut Bupati Erry Nuradi memang sifatnya sederhana tetapi manfaatnya luar biasa, sesuai visi Kecamatan Sei Rampah Bersih dapat terwujud, ungkap Bupati Erry Nuradi. Sebelumnya Pelaksana Kaban BPBD Sergai Drs. JoniWalker Manik menjelaskan, penyerahan kembali bantuan pasca banjir merupakan program pemerintah pusat terhadap pemulihan daerah yang dilanda bencana alam. Di sela-sela acara penyerahan bantuan, Bupati HT Erry Nuradi didampingi Wabup Ir. H. Soekirman menandatangani prasasti program PNPM-MPd tahun anggaran 2012, berupa kegiatan perkerasan jalan telford di Desa Silau Rakyat, Sei Rampah.(a08)

Pelaku Bisnis MMTC Resah PERCUTSEITUAN (Waspada): Sejumlah pelaku bisnis di pusat bisnis Medan Mega Trade Centre (MMTC) Jl. Willem Iskander, Medan Estate, Kec. Percut Seituan, Kab. Deliserdang, resah. Pelaku bisnis yang telah membeli rumah dengan harga miliaran rupiah di lokasi itu, mengaku dibatasi melakukan usaha. Kepada Waspada, Kamis (10/1), Winston yang mengelola Wins Motor di kawasan itu, menjelaskan, usaha doorsmeernya disuruh tutup secara paksa oleh oknum security, setelah sebelumnya mendapat perintah secara tertulis dari PT Pancing Business Centre ditandatangani Estate Manager M. Hamdani. “Saya heran, saya sudah mengelola usaha ini sembilan bulan, saat sudah mulai berkembang, kok, malah dilarang. Kenapa tidak dari dulu kalau memang tidak boleh. Saya juga heran, kami kan sudah membeli rumah ini dan kami mau membeli dengan harga lebih mahal karena posisinya di pinggir jalan. Ini kan pusat bisnis, kok, dibatasi orang melakukan bisnis,” ujar Winston Sejumlah pelaku bisnis di MMTC juga telah membuat pernyataan tertulis menyatakan keberatan terhadap kebijakan pihak developer. Bahkan, ada di antara mereka mengaku diintimidasi. “Kami merasa, mereka bukan memberi kenyamanan kepada kami, tapi justru meresahkan. Kami sering didatangi orang yang patut diduga sebagai upaya menakutnakuti bergaya premanisme,” ujar salah seorang pelaku bisnis. Dijelaskan juga, penutupan usaha doorsmeer sepedamotor dinilai tak beralasan, karena toh tetangga di kiri-kanan usaha ini tak ada menyatakan keberatan. Apalagi, sejumlah usaha di kompleks MMTC (khususnya yang menghadap ke Jalan Pasar V) telah membuat kawasan ini menjadi hidup sebagai pusat bisnis. Ada minimarket, usaha kuliner, elektronik, otomotif dan lain-lain. “Padahal, pihak developer, waktu kami membeli rumah ini, tidak sedikit pun membatasi usaha,” ujar pelaku bisnis. Dikatakan, keresahan pelaku bisnis di Kompleks MMTC makin menjadi-jadi, karena mereka dituntut memenuhi keinginan pihak developer seperti membayar iuran maintenance, tapi tidak serta-merta mendapat layanan yang baik. “Buktinya, kalaulah iuran maintenance itu untuk pelayanan kebersihan dan keamanan, kenyataannya kawasan ini baru saja dipasang tong sampah, sedangkan pelayanan keamanan sangat mengecewakan,” ujarnya.

Dijelaskan, beberapa pelaku bisnis telah mengalami hal tidak diinginkan seperti pembobolan mobil saat parkir di depan rumah, sepedamotor hilang, bahkan berkali-kali pencuri masuk ke rumah mengambil sejumlah barang berharga. “Yang paling ironis, ada kabel listrik Blok N melintang di Jalan Pasar V yang sangat-sangat meresahkan. Sudah berkali-kali ditabrak container dan jatuh ke badan jalan, bahkan pernah hampir mencederai pengguna jalan. Kami sudah berkali-kali menyampaikan keluhan ini ke pihak developer, tapi seakan-akan tidak peduli dengan keresahan kami dan keresahan pengguna jalan,“ kata pelaku bisnis. Mereka juga mengungkapkan kebijakan yang mereka nilai kebijakan sangat aneh dan memberatkan, karena setiap rumah yang akan melakukan rehab diwajibkan membayar deposit Rp3 juta, yang katanya akan dikembalikan semuanya setelah rumah selesai direhab. “Tapi kenyataannya, kami dibohongi. Uang Rp3 juta ternyata dipotong dengan dalih untuk membayar maintenance rumah walaupun saat itu belum ditempati,” katanya. Pelaku bisnis di Kompleks MMTC mohon kepada pimpinan tertinggi di managemen pengelolaan MMTC agar melakukan pengecekan langsung di lapangan. Mereka berharap, pengelolaan MMTC lebih ditingkatkan sehingga tidak terus mengecewakan. Pernyataan itu ditandatangani Winston (Wins Motor) yang tinggal di Blok N-17, Yong Tek Hen (N-20), Albert Halim (N-25), Bresman (N-32), Johing (N-21), Anton (N-9), Santoso (P44), Ir Haji J. Eddy (N-35), Didi (N-33), Titin Net (N-30), Mie Aceh (N-56), Menara Abadi (N-16), Golden Travel (N-8), Akbar 3 (N-31). Ketika dikonfirmasi melalui sambungan telpon, Estate Manager PT Pancing Business Centre M Hamdani, membantah.“Itu tidak betul. Kita tidak mematikan bisnis. Usaha perbengkelan tetap kita izinkan, yang kita larang doorsmeer karena mengakibatkan genangan air dan becek,” ujarnya. Sedangkan kabel telefon yang dikeluhkan karena melintang di jalan dan dikhawatirkan mencederai warga dan pengguna jalan, dikatakannya sudah ditangani PLN. “Intinya, kita tidak mematikan bisnis di situ,” ujar M Hamdani. Ketika ditanyakan tentang keluhan warga yang mengaku pernah disuruh mempertanyakan kebijakan ini kepada managemen bernama Hari, dia tak bisa memberi komentar lebih lanjut. “Koordinasinya ke saya, karena saya juga makan gaji di sini,” ujarnya tanpa merinci apa maksudnya. (ihn)

Aceh

WASPADA Jumat 11 Januari 2013

Sofyan Dawood Pimpin Para Eks GAM

Kapal Pesiar Berbendera Bahamas Singgah Di Pulau Rubiah SABANG (Waspada): Kapal pesiar MV. Clipper Odyssey berbendera Bahamas singgah di Pulau Rubiah, Sabang, Kamis, 10/1). Kapal pesiar yang panjangnya 102,96 meter itu membawa penumpang 135 orang yang berasal dari berbagai negara. Kapal mewah itu baru saja tiba dari Belawan dan singgah di Sabang untuk menikmati keindahan taman laut Pulau Rubiah. Kapal pesiar itu tiba di Teluk Sabang sekira pukul 05:30 dan langsung berlabuh di sekitar Pulau Rubiah dan Pulau Selako. Dengan menggunakan sekoci, tamu mancanegara ini bermainmain di laut sambil menyelam, kata M Ali Taufik, Kepala Bidang Pemasaran Dinas Kebudayaan dan Pariwisata Sabang. Kata dia, pihak Pemko Sabang menyambut tamu asing di awal tahun 2013 ini dengan tarian tradisional Aceh di pantai Iboih, ketika mereka mendarat di pantai pasir putih tepi laye Iboih. Awal datangnya turis mancanegara ke kawasan wisata Sabang di tahun 2013 merupakan salah satu kegiatan Visit Aceh Years 2013. Hotel apung yang mempunyai kru 69 orang itu hanya 6 jam berada di sekitar taman laut Pulau Rubiah selanjutnya akan berlayar kembali menuju ke negara lain. (b31)

Prapid Honorer Puskesmas Gugur LHOKSUKON (Waspada): Permohonan praperadilan terhadap Polres Aceh Utara, yang diajukan Mirza Mauliza, honorer Puskesmas Langkahan, Aceh Utara, diputuskan gugur oleh Hakim Pengadilan Negeri Lhoksukon, Kamis (10/1). “Hakim tunggal T Almadyan menyatakan permohonan praperadilan kita gugur dengan pertimbangan perkara pokoknya sudah diperiksa. Padahal, menurut kami, perkara pokoknya belum bisa dikategorikan sudah diperiksa,” kata pengacara Mirza, Helman Madewa, seusai sidang kemarin siang. Menyikapi putusan tersebut, Helman menyatakan akan segera melaporkan sekaligus mengirimkan semua dokumen dan data terkait kasus itu ke sejumlah pihak terkait, termasuk kepada KetuaMahkamahAgung,KetuaKomisiYudisial,Kompolnas,Kapolri, Komnas HAM dan Komisi III DPR RI di Jakarta. Mirza Mauliza, 30, honorer Puskesmas Langkahan, Aceh Utara, ditangkap aparat Polres Aceh Utara, 5 Desember 2012, atas tuduhan menggelapkan sepedamotor dinas milik Puskesmas Langkahan. Pihak Mirza merasa tak melakukan tindak pidana itu, lalu mem-praperadilankan Polres Aceh Utara, ke PN Lhoksukon, 26 Desember 2012. (b19)

Selama Libur, Khitan Rasul Meningkat BANDA ACEH (Waspada) : Selama berlangsungnya libur sekolah, permintaan khitan rasul terutama sunat missal meningkat pesat di Aceh terutama di Banda Aceh dan Aceh Besar. Hal itu diungkapkan Direktur Klinik Khansa, Kajhu Baiturrahman, Aceh Besar, dr Teuku Yusriadi melalui press release-nya yang disampaikan ke Waspada, Kamis (10/1). Ia menyebutkan, dari data harian di Klinik Khansa Kajhu, jumlah permintaan khitan rasul berkisar 10 hingga 12 orang per hari. Disebutkan dr Teuku Yusriadi, pasien yang datang minta dikhitan itu berasal dari 3 kecamatan sekitar Klinik Khansa yaitu Kec. Baitussalam, Masjid Raya, dan Darussalam. Mereka yang minta dikhitan itu rata-rata berusia 9 hingga 13 tahun, jelas Yusriadi. Sedangkan Jasa tindakan yang diambil bervariasi antara Rp.300.000 hingga Rp.500.000 per pasien, sesuai alat khitan yang digunakan. Alat yang digunakan biasa disebut teknik laser. “Teknik ini mengurangi risiko pendarahan dan mempercepat penyembuhan luka operasi. Tiga hari setelah khitan, pasien dapat beraktivitas kembali, “kata Yusriadi. (b09)

Lipmaga Akan Merekomendasikan Kurikulum Pendidikan Aceh LHOKSEUMAWE (Waspada): Lembaga Independen Pemberdayaan Masyarakat Gampong (Lipmaga) Aceh mengadakan diskusi soal kurikulum pendidikan di Aceh bersama mahasiswa, LSM, pemuda, tokoh masyarakat dan Akademisi di gedung Hasby Ash-Shiddiqy, Mon Geudong, Lhokseumawe, Kamis (10/1). Kata Project Direktor Lipmaga Aceh, Kamaruddin Hasan kemarin, hasil diskusi ini akan dikirim ke sejumlah perguruan tinggi dan juga dikti serta Pemkab Aceh Utara untuk menjadi masukan kepada lembaga pendidikan di Aceh. “Tujuan kita adakan orasi ilmiah ini untuk memberikan pencerahan tentang bagaiamana seharusnya kurikulum pendidikan mulai SD sampai perguruan tinggi. Karena selama ini kurikulum pendidikan hanya mementingkan prestasi sedangkan soal moral, dan kepekaan soal tidak penting,” ujarnya. Selain itu, lanjut Kamaruddin, nilai-nilai kearifan lokal seperti sejarah samudera pasai dalam sejarah selama ini tidak menjadi materi pembelajaran, seharusnya sejarah Aceh juga menjadi salah satu meteri. “Diskusi ini juga untuk memberi motivasi kepada peserta termasuk mahasiswa penerima beasiswa dari Exxon Mobil,” katanya. (cmk)

Pencuri Motor Babak Belur Diamuk Massa BANDA ACEH (Waspada): Seorang tersangka pencuri sepeda motor berinisial SR, 28, warga Balai Simpang Tiga, Kabupaten Bener Meriah, babak belur dihajar massa karena kedapatan mencuri sebuah sepedamotor di kawasan Pasar Lambaro, Ingin Jaya, Aceh Besar, Kamis (10/1). Kapolsek Ingin Jaya, AKP Ibrahim Prades, menyebutkan, sekira pukul 10:00, pelaku yang menjalankan aksinya sendiri ini menggasak satu unit sepedamotor Kawasaki Blitz dengan nomor polisi BL 5548 AS, diparkiran di kawasan Pasar Lambaro. Namun, naas bagi tersangka karena saat hendak membawa kabur sepeda motor hasil jarahannya diketahui oleh sang pemilik. Pemilik langsung meneriaki minta tolong kepada warga lain dan mengejarnya. “Teriakan pemilik langsung didengar oleh masyarakat yang ada di pasar Lambaro dan mengejarnya,” kata Ibrahim Prades. Tersangka yang hendak membawa kabur sepedamotor hasil curiannya itu, kata kapolsek, ditangkap oleh warga setelah terjatuh karena tersenggol dengan sebuah mobil yang sedang melintas di jalan nasional Banda Aceh-Medan. Warga yang mengejarnya langsung menangkap dan menghadiahi beberapa bogem mentah ke wajah pelaku. “Warga kemudian melaporkan kejadian ini kepada saya, dan selang beberapa menit petugas tiba di TKP untuk mengamankan pelaku dari amukan massa,” terang Kapolsek. Untuk proses penyelidikan lebih lanjut, pelaku yang sempat berpura-pura gila di hadapan petugas polisi ini beserta barang bukti hasil curiannya telah diamankan di Mapolresta Banda Aceh. (cb01)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

14:30

C1 BANDA ACEH (Waspada) : Sofyan Dawood didaulat sebagai pimpinan baru para Kombatan eks GAM di Aceh. Keputusan itu dilakukan dalam satu rapat tertutup para mantan Panglima GAM di Banda Aceh, Kamis (10/1) siang Selain para mantan Panglima GAM, seperti Irwansyah alias Tgk Muksalmina, Panglima Abrar Muda, Muharam Idris, Abubakar Abe Pase, Linggadinsyah, Izil Azhar, Nurdin Ramli, Ramdana, Tgk Duta, juga hadir mantan Gubernur Aceh, IrwandiYusuf yang dikalangan GAM digelar Tgk Agam. “Keputusan para panglima, Sofyan Dawoodlah yang memimpin,” kata Irwansyah alias Tgk Muksalmina. Penunjukan Sofyan dilakukan secara demokrasi karena mantan Panglima Pasee dan mantan Jubir KPA Pusat dinilai memiliki

Waspada/Jaka Rasyid

SEJUMLAH mantan Panglima GAM memberikan pernyataan tentang kondisi demokrasi di Aceh dan persiapan pemenangan Partai Nasional Aceh (PNA) dalam Pemilu 2014 mendatang, Kamis (10/1).Tampak Sofyan Dawood, Irwansyah, Izil Merin, Muharam dan Irwandi Yusuf.

Waspada Diminta Hanya Berpihak Kepada Kebenaran Dan keadilan BANDA ACEH (Waspada): Ucapan selamat Harian Waspada, genap berusia 66, Jumat (11/ 1), hari ini terus mengalir dari berbagai elemen. Mereka berharap Waspada semakin eksis dengan mengedepankan indepedensi, objektif, profesional dan terus berpihak hanya kepada kebenaran dan keadilan. Dirjen Pemberdayaan Masyarakat Desa (PMD) Depdagri, Ir H Tarmizi Karim, MSc menyatakan, peranan Waspada begitu besar dalam pembangunan bangsa ini khusus pula di Aceh. Waspada, kata mantan Pejabat Gubernur Aceh ini, telah memberi edukasi kepada masyarakat lewat informasi dinamika pembangunan, kemasyarakatan dan pemerintahan yang selalu hadir tepat waktu ketika mereka membutuhkannya. “Sifat pemberitaan Waspada yang berimbang telah mengajarkan publik menjadi pres minded. Selamat jaya waspada,” pesan Tarmizi lewat SMS, kemarin. Sementara, Panglima Kodam Iskandar Muda, Mayjen TNI Zahari Siregar, minta Was-

pada untuk terus meningkatkan kualitas pemberitaan yang up to date. Lalu, Sekda Aceh, Setia Budi, memberi ucapan semoga dalam memberitaan Waspada tetap objektif dan mengedepankan hanya kebenaran dan keadilan. Kajati Aceh, TM Syahrizal,SH, mendoakan, Insya Allah Waspada tetap jaya sukses dan dicintai masyarakat.Mantan Dirut PT Bank Aceh, Islamuddin mengucapkan, semoga Waspada terus bertambah maju dan tetap menjaga profesionalisme sebagai media yang independen seperti selama ini. Anggota DPRRI Komisi VIII FPKS, HM Nasir Djamil, SAg, minta Harian Waspada, terus menyampaikan dakwah lewat berbagai informasi yang bermanfaat kepada masyarakat luas. Waspada juga dikenal banyak menyampaikan informasi tentang dunia Islam. Bagi masyarakat Aceh yang religius, harian ini lebih bisa meningkatkan kualitas keimanan dan keislaman bagi rakyat. Ucapan serupa disampaikan berbagai elemen masyara-

kat Aceh, seperti, Bupati Pidie Jaya, Grs HM Gade Salam, Bupati Gayo Lues, Ibnu Hasyim, Sekretaris Partai Demokrat Aceh, Ir Miriadi Amir dan para tokoh dan masyarakat lainnya yang disampaikan melalui handphone, BBM, maupun pesan singkat (SMS). Waspada sendiri, menyampaikan terimakasih kepada semua pihak yang telah memberi kontribusi, sumbang saran dan pemikiran, sehingga sampai kini koran yg hadir pertama di Aceh ini tetap eksis dalam memberi beragam informasi pembangunan, politik, hukum, hiburan, olahraga dan lainnya. ‘’Semoga kerjasama yang terjalin baik selama ini tetap terus terpelihara dengan baik dan kami membuka diri untuk kritik dan saran untuk perbaikan kualitas, kontens berita, tulisan, tajuk dan pelayanan sebagai media tertua di Sumatera ini bisa memberi kontribusi untuk kemajuan bangsa dan pembangunan khususnya di Provinsi Aceh,’’ sebut Kepala Biro Perwakilan Waspada di Aceh, Aldin Nl. (cb01/b01)

Pembangunan Terminal Gas Arun Terancam Gagal LHOKSEUMAWE ( Waspada): Meskipun tender proyek pembangunan Kilang Gas Arun telah dimenangkan oleh PT Rekayasa Indonesia, pekerjaan tidak dapat dilakukan, karena harga gas dari BP Tangguh belum jelas. Jika harga gas lebih dari 8 dolar per mmbtu, maka PT PIM tidak akan sanggup membeli bahan baku pupuk itu. Kondisi tersebut dapat mengancam kelangsungan hidup PT PIM dan industri berbahan baku gas lainnya di Aceh. Sekarang ini, pemerintah telah memberikan 12 kargo gas untuk PT PLN, namun sampai kini harga gas belum konkrit dan masih menjadi perdebatan alot. Agar persoalan itu tidak berkepanjangan, harusnya Pemerintah Indonesia menyerahkan gas ke Pertamina. Nantinya, PT Pertamina yang akan membagi-bagikan kepada industri yang membutuhkan salah satunya PT PIM. “Gas sudah dijual kepada PLN, tetapi belum jelas harganya karena belum adanya negosiasi. Kalau harga gas tidak bisa 8 dolar, maka PT. PIM akan kesulitan untuk menghidupkan pabrik lebih lanjut. Sementara stok gas PT PIM akan habis pada akhir Februari 2013,” kata Marzuki

Daud, Tim Pemantau Otsus Aceh-Papua dan Anggota Komisi VI DPR RI itu, Kamis (10/ 1) siang via telepon. Menurut Marzuki, terjadi kelangkaan gas di Indonesia adalah sesuatu yang ironi dan menggelikan. Pasalnya, Aceh merupakan salah satu provinsi yang menjadi lumbung gas. Lucunya, lumbung gas tidak dapat memberikan gas kepada pabrik pupuk yang notabene sebagai kebutuhan para petani. Agar persoalan gas tidak menjadi dilema di Indonesia, pemerintah melakukan pembubaran BPMigas, karena BP-Migas dinilai terlalu memihak kepada asing. Pasalnya, harga gas yang dijual untuk pihak asing hanya 4-5 dolar per mmbtu dengan asalan mereka telah berinvestasi. Kata Marzuki, persoalan investasi tidak masalah namun harus ada batasan-batasan dengan cara membatasi harga. “Ini yang saya katakan lucu. Jika gas diekspor harganya murah sekali, tapi harga gas di dalam negeri mahalnya minta ampun. Karena itu, BP-Migas kita bubarkan. Sekarang ini penentuan harga gas menjadi kewenangan ESDM. Pembangunan Terminal Gas Arun tidak boleh gagal dan kita meminta pemerintah su-

dah harus mengalokasikan gas dan sudah harus ada kepastian harga pada tahun 2014 dengan harga 8 dolar per mmbtu. Harga 8 dolar sudah sesuai dengan kemapuan PT PIM. Sehingga PT. PIM dapat menghidupkan ke dua pabrik pupuk,” kata wakil rakyat dari Aceh itu. Harusnya kata Marzuki, PLN tidak membandrol gas dengan harga yang tinggi, karena dapat memperbesar subsidi. Pemberian gas kepada PLN merupakan keputusan tidak tepat. Seharusnya pemerintah menyerahkan gas kepada PT Pertamina dengan harga yang terjangkau. Jika kepastian harga gas belum ada, maka Pertamina belum dapat melakukan tandatangan kontrak dengan PT Rekayasa Indonesia, sehingga Rekin belum dapat melakukan pekerjaannya di lapangan. “Persoalan harga harus dapat dituntaskan pada Januari ini juga,kalau tidak dapat menghambat pembangunan Terminal Gas Arun. Sampai detik ini saya belum melihat adanya indikasi upaya untuk menghambat `pembangunan proyek. Kami berharap ESDM dapat menyelesaikan persoalan itu. Pembangunan Terminal Gas Arun tidak boleh gagal,” katanya. (b18)

Meubiler Sekolah Yang Rusak Akibat Banjir Harus Segera Diganti BIREUEN (Waspada): Meubiler sejumlah sekolah di Bireuen yang rusak dihantam banjir belum lama ini, harus segera diganti. Karena dalam waktu dekat ini para siswa akan sekolah kembali pasca libur ujian dan khusunyasiswakelastiga me-reka sedang mempersiapkan diri untuk ikut Ujian Nasional (UN). Demikian Kadis Pendidikan Bireuen, Nasrul Yuliansyah, Kamis (10/1). “Selain meubiler untuk siswa, meubiler untuk kantor sekolah serta pelaratan di la-

boratorium, pagar sekolah, komputer juga harus diganti dengan waktu segera mengingat ke depan siswa khususnya kelas III akan menghadapi ujian nasional,” katanya. Menurutnya, pasca tergenang lumpur saat terjadi banjir bandang melanda beberapa kecamatan wilayah barat Kota Bireuen, belum lama ini, kerusakan mobiler dan peralatan pendukung, belum tergantikan termasuk rapor siswa yang rusak. “Total kerugian dialami sejum-

lah sekolah, pasca bencana banjir bandang itu, kurang lebih Rp 2,7 miliar dan 10 unit komputer sudah diserahkan ke sekolah yang mengalami kerusakan fasilitasnya akibat banjir tersebut. Sementara itu, Nasrul Yuliansyah, menyebutkan, 90 persen sekolah yang berimbas banjir belum lama ini sudah dibersihkan dan pada hari pertema sekolah setelah libur smester ini anak-anak didik sudah bisa belajar sebegaimana mestinya. (cb02)

LHOKSEUMAWE (Waspada): Selepas penandatanganan imbauan larangan duduk mengangkang bagi kaum hawa oleh Wali Kota Lhokseumawe, Suaidi Yahya, Senin lalu, sejumlah pemilik akun twitter maupun facebook beramai-ramai menuliskan perihal itu. Sejumlah pemilik akun mengutarakan komentar yang tidak setuju dengan seruan itu, mereka semarak menuliskan berbagai pendapat, baik secara

bijak, sindiran maupun olokan. Ada di antara mereka yang memelesetkan dari Oppa Gangnam Style menjadi Oppa Ngangkang Style. Sekalipun tak seheboh Gangnam Style milik penyanyi Korea, PSY yang mencapai satu miliar di Youtube, larangan Ngankang Style juga tak mau kalah membooming di situs jejaring sosial. Apalagi sebelumnya media internasional seperti

BBC, CNN, Daily Mail, dan sejumlah media besar lain yang ikut memberitakan. Tidak hanya membatasi ruang gerak kaum hawa, peraturan itu juga telah dianggap membikin galau para waria. “Waria sih belum ngangkang saja sudah digantung,” tulis sebuah akun di twitter yang memprotes seruan yang direncanakan akan berubah menjadi aturan daerah itu. (b14)

Ngangkang Style Ramai Di Jejaring Sosial

kemampuan dibidang politik, “karena ini Perang politik dialah yang tepat,” kata Irwansyah. Selain penunjukan Sofyan, para panglima GAM juga membahas rencana pemenangan Partai Nasional Aceh (PNA) pada Pemilu 2014 mendatang. PNA adalah Partai Lokal di Aceh yang dibentuk IrwandiYusuf dan eks kombatan GAM. Partai Nasional Aceh telah lulus verifikasi KIP Aceh bersama PDA dan PA dan Partai Nasional lain beberapa waktu lalu. Ketua DPP PNA, Irwansyah menyebut berharap proses demokrasi di Aceh berjalan aman terutama saat diselenggarakannya pemilu April 2014 mendatang.“Kita mau proses demokrasinya berjalan baik dan aman,” kata Irwansyah. (b08)

Pemilihan Dekan FKIP Unsyiah Ricuh BANDA ACEH (Waspada): Sebuah kejadian yang tak lazim di dunia akademisi terjadi di lingkungan Universitas Syiah Kuala, Kamis (10/1). Ya, pemilihan dekan Fakultas Keguruan dan Ilmu Pendidikan (FKIP) berlangsung ricuh. Akibatnya, pemilihan dekan yang dilaksanakan di Lantai II ruang Auditorium FKIP Unsyiah ditunda. “Pemilihan akan ditunda. Kita akan keluarkan surat edaran baru, tentang tata cara pemilihan,” kata Rektor Unsyiah, Prof Samsul Rizal kepada wartawan. Penundaan itu dilakukan setelah terjadinya kerusuhan dalam ruang pemilihan yang diwarnai aksi saling dorong kursi dan lempar bangku yang dilakukan sejumlah dosen yang juga anggota senat fakultas. Informasi yang dikumpulkan Waspada menyebutkan, pemilihan Dekan FKIP Unsyiah dimulai pukul 09:00 dengan sistem tertutup. Yang berhak memilih adalah anggota Senat yang terdiri dari para guru besar dan perwakilan Kepala Prodi yang ada di fakultas itu. Setelah pembukaan, 30 menit kemudian, terjadi silang pendapat di antara dua kubu yang berujung pada kerusuhan. Pemicunya terjadi karena Senat menolak melakukan pemilihan Dekan, sesuai dengan Surat Edaran Rektor. “Kerusuhan terjadi karena ada kelompok

yang menolak pemilihan dilakukan secara tertutup tanpa melibatkan seluruh dosen,” ujar sebuah sumber. “Menurut surat edaran rektor pemilihan dilakukan secara luar.” tambahnya. Rektor Unsyiah Samsul Rizal yang turun hadir pada acara itu ikut menenangkan suasana dan mengambil kesimpulan pemilihan Dekan FKIP Unsyiah ditunda sampai batas waktu yang belum ditentukan. Menurut dia, kerusuhan yang terjadi dalam pemilihan Dekan FKIP hanya perbedaan pendapat. “Itu biasa terjadi, sebelumnya juga sudah ada perbedaan pendapat,” kata Samsul. Dia menyebutkan, akan menampung aspirasi dari para dosen dan para anggota Senat FKIP Unsyiah untuk kebaikan bersama. Sementara mantan Rektor Unsyiah Darni M Daud yang juga berada dalam ruang acara hadir sebagai salah seorang anggota senat FKIP Unsyiah. “Pemilihannya ditunda, saya belum tahu sampai kapan itu,” ujar Darni. Pemilihan Dekan FIKIP rencananya akan memilih pengganti Prof Dr M Yusuf Aziz, MPd. Ada tiga calon dekan yang maju dalam pemilihan yakni Pembantu Dekan III FKIP Unsyiah Jufri, Dosen Jurusan Olahraga FKIP Unsyiah Nyak Amir, dan Dosen Jurusan Bahasa Inggris, Sofyan Abdulgani. (b07)

Waspada/Munawardi Ismail

PULUHAN mahasiswa yang menamakan diri Aliansi Mahasiswa Peduli Kampus (AMPK) menggelar aksi demo saat pemilihan Dekan Fakultas Keguruan dan Ilmu Pendidikan (FKIP) Unsyiah, Kamis pagi (10/1). Akhirnya pemilihan pun berakhir ricuh.

Mahasiswa Tuntut Pemilihan Dekan Transparan BANDA ACEH (Waspada): Puluhan mahasiswa yang menamakan diri Aliansi Mahasiswa Peduli Kampus (AMPK) melakukan aksi demo saat pemilihan Dekan Fakultas Keguruan dan Ilmu Pendidikan (FKIP) Unsyiah, Kamis pagi (10/1) di lantai II aula fakultas. Koordinator aksi, Nopri Haryadi mengatakan, aksi mereka tak lain bentuk protes terhadap pemilihan dekan yang tidak transparan. “Dekan yang dipilih seharusnya bisa transparan dan dapat dilihat oleh seluruh mahasiswa dan dosen di FKIP Unsyiah,’’ paparnya. Menurut dia, pemilihan Dekan FKIP Unsyiah kali ini, digelar di ruangan tertutup serta

tidak transparan. “Cuma sebagian dosen saja yang dapat mengikuti acara pemilihan dekan tersebut,” ujar dia. Nopri menyebutkan, seharusnya pemilihan dekan belangsung secara terbuka dan semua dosen di fakultas itu dapat memilih dekan. “Akibat pemilihan dilakukan tertutup, membuat sebagian dosen tidak setuju,’’ tambah dia. Dikatakan, hal itulah yang menyebabkan terjadinya aksi protes puluhan mahasiswa pada pemilihan dekan FKIP. Karena itu, dia berharap,“pemilihan berlangsung dengan baik. Dengan mempertimbangkan aspirasi dari seluruh dosen yang ada di lingkungan FKIP Unsyiah,” turut Nopri. (b07)

Dosen Dan Guru Harus Kuasai Karakter Anak Didik BANDA ACEH (Waspada): Dosen dan guru yang mengajar di kampus atau sekolah harus memiliki kemampuan dalam mendiaknosa kesulitan belajar anak didiknya. Pun begitu, dia juga harus paham karakter masing-masing pelajar. Hal itu dilontarkan, Rektor IAIN Ar-Raniry Prof Dr H Farid Wajdi Ibrahim, MA dalam sambutan yang dibacakan Pembantu Rektor I Prof. Drs. Amirul Hadi, MA, pada pembukaan Seminar Nasional dan Workshop Diaknostik Kesulitan Belajar (10/1) di Auditorium Prof. Ali Hasjmy IAIN Ar-Raniry. Kata dia, pentingnya seorang pendidik mampu mendiaknosa, karena setiap peserta didik baik mahasiswa maupun siswa memiliki karakter yang berbeda dalam belajar. “Dengan diaknosa, diharapkan akan diperoleh cara belajar yang tepat bagi peserta didik, terutama bagi yang berkebutuhan khusus,” ujarnya. Dengan demikian, lanjut Amirul, prestasi belajar dapat ditingkatkan secara optimal. Ke depan diharapkan kegiatan seperti itu dapat dilaksanakan lebih banyak lagi, menyongsong

diberlakukannya kurikulum baru 2013. “Makin banyak kesempatan dosen dan guru tenaga pendidik untuk dilatih cara memahami diaknostik terhadap kesulitan belajar mengajar di kelas, akan lebih baik lagi,” kata Amirul Hadi. Ketua Pelaksana Kamarullah, MPd menyebutkan, seminar dan workshop ini diikuti oleh 460 peserta, yang terdiri dari dosen PTN/PTs Aceh, guru dari MI/SD sampai MA/SMA yang ada di Banda Aceh dan Aceh Besar, mahasiswa S1 dan Pascasarjana IAIN Ar-Raniry. Disebutnya, kegiatan itu dibagi dua bagian yaitu seminar nasional dan worksop. Pada seminar menghadirkan pemateri, Prof Kumaidi, Phd, pakar diaknostik pembelajaran dari Unmuha Surakarta, Drs Salasi R, M. Pd, PD I FKIP Unsyah, dan Drs M Duskri, M. Kes, Kajur. Matematika Tarbiyah Ar-Raniry. “Selanjutnya pada workshop dikhususkan untuk dosen-dosen di Banda Aceh dan sekitarnya serta bagi guru pemandu matematika yang ada di sekolah, ini akan difasilitasi oleh Prof Kumaidi dan Drs M Duskri,” tutup Kamrullah. (b07)

PKS Kumpulkan 1.000 Kantong Darah Untuk Aceh LHOKSEUMAWE (Waspada): Guna merespon kebutuhan masyarakat, Partai Keadilan Sejahtera (PKS) gelar kegiatan donor darah secara serentak di saeluruh Aceh. PKS menargetkan dapat mengumpulkan 1.000 kantong darah untuk disumbangkan kepada masyarakat Aceh yang membutuhkan. Hal itu disampaikan Dicky Saputra, Wakil Ketua DPD PKS Kota Lhokseumawe, Rabu (9/ 1) siang. Kata dia, PKS Lhokseumawe melaksanakan kegiatan donor darah di Taman Riyatdhah. Lokasi dipilih karena sangat mudah dijangkau oleh siapapun. Sehingga para pengguna

jalan yang berkeinginan untuk mendonorkan darah mereka dapat singgah di tempat itu. “Donor darah ini kita gelar dalam rangka Safari Dakwah III PKSWilayah Sumatera. Kegiatan ini kita lakukan secara serentak di seluruh Aceh. Mudah-mudahan dalam acara ini kita mampu menyumbang 1.000-an kantong darah. Di Lhokseumawe kita targetkan 100-an kantong,” sebut Dicky. Darah yang berhasil dikumpulkan nantinya langsung diserahkan ke PMI Aceh Utara untuk disumbangkan kepada masyarakat yang membutuhkan. (b18)

Aceh

C2 Semua Gampong Dan RT Wajib Ada Pengajian

Pelajar Dan Mahasiswa Dilarang Berkeliaran Pukul 22:00 LANGSA (Waspada): Kepala Dinas Syariat Islam Kota Langsa Drs H Ibrahim Latif, MM mengatakan, semua gampong dan rumah tangga wajib ada pengajian bakda Magrib. Sementara bagi pelajar dan mahasiswa dilarang berkeliaran pada malam hari pukul 22:00. Hal itu disampaikan, Ibrahim Latif di ruang kerjanya, Kamis (10/1). Dikatakan, pihaknya telah menyampaikan instruksi Wali Kota Langsa ini kepada semua keuchik dari 66 gampong yang ada di Kota Langsa. Untuk terlaksanya program wajib mengaji bakda magrib ini, untuk tahap awal di tahun 2013 Dinas Syariat Islam melalui dana otsus memplotkan dana sekira Rp4,5 juta per gampong sebagai jerih payah untuk teungku seumeubeut (guru pengajian) untuk memberikan pengajian kepada anak-anak di setiap gampong. Ibrahim Latif meminta para keuchik, imam dan Tuha Peut

gampong untuk menghidupkan pengajian bakda magrib di setiap gampong, masjid, meunasah dan rumah tangga. Ini adalah instruksi wali kota yang telah disampaikan ke semua gampong. Pelajar dan mahasiswa dilarang berkeliaran pada malam hari. “Kita mohon dukungan orang tua, supaya mengarahkan anak-anaknya yang masih usia pelajar dan mahasiswa untuk mengikuti pengajian baik yang diselenggarakan di masjid, meunasah atau rumah tangga dan para orang tua juga dapat mendukung kebijakan instruksi wali kota agar anak-anak usia pelajar dan mahasiswa supaya tidak berkeliaran pada malam hari. Mari sama-sama kita mengawasi anak-anak kita masingmasing,” katanya. Dijelaskan Ibrahim lagi, pihaknya akan mengawal instruksi wali kota ini, Dinas Syariat Islam, Polisi Wilayatul Hisbah (WH) akan menangkap dan menindak tegas anak-anak yang berkeliaran sampai pukul 22:00. Bila masih ada yang berkeluyuran di jalan, pihaknya akan

menangkapnya, dan orangtuanya dipanggil. Kalau pengajian sudah hidup di setiap masjid, meunasah dan rumah tangga dipastikan anak keluar rumah lagi, setelah mengaji mereka belajar pelajaran sekolah dan mengerjakan PR, dan sebagainya. “Selama ini di warnet-warnet cukup banyak anak usia sekolah sampai larut malam masih main game. Mulai hari ini kita harapkan para orang tua supaya lebih ekstra lagi dalam menjaga anak-anak kita masing-masing. Kita juga telah memperingatkan para pengusaha warnet untuk kita bersama menjaga anak-anak bangsa,” pungkasnya. Sidak Pakaian Ketat Di RSUD Langsa Sementara itu, atas perintah Wali Kota Langsa, Dinas Syariat Islam Kamis pagi (10/1) melakukan sidak pakaian ketat, sekaligus membuat pertemuan dengan para dokter, tenaga medis, PNS, karyawan/ti di lingkungan Rumah Sakit Umum Daerah (RSUD) Langsa. Kedatangan Kepala Dinas

Syariat Islam bersama Polisi Wilayahtul Hisbah (WH) mendapat perhatian dari kalangan karyawan RSU dan masyarakat yang hendak berobat. Ibrahim Latif disambut langsung diterima Direktur RSU Langsa, dr Herman dan mempersilahkan mengecek pakaian karyawan di RSUD. Ibrahim Latif mengatakan, para dokter, dan tenaga medis, dan para PNS lainnya yang menjadi pelayan masyarakat di sini, hendaknya dapat berpakaian yang lebih islami dan menjadi contoh bagi masyarakat yang setiap saat berkunjung ke RSU ini. Apalagi, setiap Kamis dan Jumat, pegawai Pemko Langsa pada umumnya memakai pakaian bebas, karena bebas, maka banyak para PNS di itu memakai celana jeans atau pakaian ketat. Maka Wali Kota Langsa memerintahkan untuk menertibkannya, bukan saja di rumah sakit, tetapi di seluruh instansi pemerintah, lembaga pendidikan, instansi swasta, BUMN dan BUMD juga akan diadakan penertiban pada hari itu. (m43)

WASPADA Jumat 11 Januari2013

Bangunan RKB SDN 3 Langsa Dinilai Asal Jadi LANGSA (Waspada): Pembangunan ruang kelas baru (RKB) sekolah dasar (SD) Negeri 3 Kota Langsa yang menggunakan dana Dana Alokasi Khusus (DAK) 2011 senilai Rp491. 500.000 yang dikerjakan CV PM, dinilai asal jadi. Pasalnya, gedung yang dibangun 3 ruang itu sepertinya tidak sesuai RAB, selain itu juga lantai dasar yang terbuat dari semen sudah terkelupas, kaca jendela sudah pada pecah dan kunci pintu antar ruang kelas juga tidak ada. Kepala SD Negeri 3 Kota Langsa, Afrida, Ama,Pd ketika dikonfirmasi, Kamis (10/1) membenarkan. Menurutnya, hal ini sudah melapor ke Dinas Pendidikan Kota Langsa. “Masa dalam proses pembangunan sejak September hingga selesai 9 Desember lalu bangunan sudah pada rusak, pada hal belum lagi diresmikan dan digunakan. Mulai dari besi jerejak ventilasi besi lokal lama hilang 13 buah, kaca jendela sudah pecah, lantai retak-retak, kunci pintu

batasan antar kelas pun tidak ada dan bangunan yang dibuat pun tidak rapi, terkesan asal jadi,” katanya. Dikatakan Afrida lagi, pembangunan ruang kelas baru menggunakan dana DAK dari Banda Aceh TA 2011yang pengerjaannya di tahun 2012 ini senilai Rp491.500.000 dikerjakan CV PM. “Mulai dari proses pembangunan sampai selesai, kami pihak sekolah tidak pernah diberi tahu pemborong maupun kontraktor. Soalnya dengan uang senilai Rp491.500.000 seharusnya sudah menghasilkan bangunan yang bagus dan lantainya pun menggunakan keramik. Ini hanya semen biasa, itupun sudah pada retak dan pecah-pecah. Belum lagi bangunannya dibuat asal jadi dan kualitasnya sangat jelek dan tidak rapi,” katanya. PPTK DAK 2011, Sudarto, SPd ketika dikonfirmasi via telepon selularnya mengaku sudah memanggil pihak rekanan dan konsultan. Tetapi hingga saat

ini mereka,kata Sudarto, belum mau datang. Sudarto juga mengakui ada kerusakan di SDN 3 Langsa.’’Masih ada masa pe-

meliharaan 6 bulan, kami akan perintahkan rekanan untuk memperbaikinya,’’ katanya (m43)

Waspada/dede

SALAH SATU satu jendela SDN 3 Langsa yang baru dibangun menggunakan dana DAK 2011 sudah pecah. Foto direkam, Kamis (10/1).

Dua Tersangka Curanmor Diduga Kuat Anggota Komplotan BIREUEN (Waspada): Hasil penyelidikan sementara pihak kepolisian, dua pria yang diamankan Polsek Kota Juang, Bireuen, belum lama ini, setelah bonyok dihajar massa karena diduga hendak melakukan curanmor di tempat pesta perkawinan di Desa Cot Trieng, Kuala, Bireuen, diduga kuat termasuk anggota kelompok komplotan curanmor antar kabupaten di Aceh. “Setelah kita selidiki dan kembangkan serta hasil penyelidikan sementara, kedua ter-

sangka diduga kuat adalah anggota komplotan curanmor yang sering beraksi dibeberapa kabupaten di Aceh,” kata Kapolres Bireuen AKBP Yuri Karsono,SIK melalui Kapolsek Kota Juang Iptu Syamsul, SH, Rabu (9/1). Dikatakan, berdasarkan penyelidikan, yang dilakukan pihaknya tersangka A adalah sebagai pemetik sedangkan tersangka I adalah jokinya. “Pada saat kita amankan hari itu dari kantong baju tersangka A kita temukan satu unit kunci T, setelah kita diamankan darinya RX

King BL 4877 ZF serta Astrea Grand BL 4628 NE karena tidak bisa memperlihatkan surat lengkap kendaraannya itu,” katanya. Menurutnya, kasus itu akan terus dikembangkan untuk mengungkapkan jaringannya selama ini dan untuk sementara ini tersangka juga telah mengaku pernah mencuri sepedamotor warga Kec.Kuala, Peusangan, Jeumpa, Juli. “Tersangka juga mengaku selama ini sering beraksi di tempat pesta perkawinan. Keduanya terancam

dijerat dengan pasal 363 KUHPidana dengan ancaman hukuman 7 tahun penjara,” tegas Syamsul. Sebagaimana diberitakan sebelumnya, dua pria berinisial I,35, warga Kecamatan Juli, kabupaten setempat dan A,44, warga Kecamatan Kuala, kabupaten yang sama yang diduga hendak melakukan pencurian sepedamotor di sekitar acara pesta perkawinan Desa Cot Trieng, Kec. Kuala, Bireuen, Sabtu (5/1) menjelang sore, bonyok dihajar massa. (cb02)

Kecewa Dengan DPD Aceh, DPC Aceh Utara Surati DPP PDI Perjuangan LHOKSUKON (Waspada): Merasa kecewa dengan kebijakan Dewan Pengurus Daerah (DPD) Aceh, menyebabkan Dewan Pengurus Cabang (DPC) PDI Perjuangan Aceh Utara, menyurati pengurus DPP PDI Perjuangan di Jakarta. Musa, TA (foto), selaku ketua DPC PDI Perjuangan (PDIP) Aceh Utara, hasil pemilihan, Sabtu (5/1) pekan lalu, mengaku korban rekayasa ketua bersama unsur pengurus DPD PDI-P Provinsi Aceh, sehingga berkesimpulan via surat resmi, melaporkan tingkah polah internal

partai ke pihak atasan. “Saya sudah dua kali korban akal-akalan oknum ketua berikut unsur pengurus DPD PDI-P Aceh. Pertama ketika dipilih menjadi pengganti sekretaris awal tahun 2012, berikutnya ketika terpilih menjadi Ketua DPC PDI-P Aceh Utara, pada pemilihan Sabtu, 5 Januari 2013 baru lalu,” ungkap Musa, TA (ketua DPC PDI-P Aceh Utara) kepada Waspada di Lhoksukon, Aceh Utara, Rabu (9/1). “Pasca terpilih selaku sekretaris DPC Aceh Utara, tahun lalu status saya tidak diproses dan

Masyarakat Sinyalir Pabrik Pengolahan Aspal Di Paya Beunyot Cemari Lingkungan BANDA BAROE (Waspada): Masyarakat Desa Paya Paya Beunyot, Banda Baroe, Aceh Utara mensinyalir perusahaan pengolahan aspal di desa setempat telah mencemari lingkungan. “Sejak pabrik yang memproduksi aspal atau yang dikenal Asphal Mixxer Pland (AMP) itu beroperasi tahun 2009, tidak pernah sekali pun memikirkan tentang efek lingkungan yang ditimbulkan,” ungkap Razali,37, salah seorang warga setempat, Kamis (10/1). Dia dan sejumlah penduduk yang ada di seputaran pabrik selalu terkena imbas asap hitam yang berasal dari cerobong pabrik itu. Selain asap, warga yang berada di dekat pabrik juga terganggu dengan suara bising, dan debu-debu yang selalu berterbangan. Polusi itu juga berdampak pada sumber air di sumur yang menjadi tercemar, rumput-rumput dan dedaunan pun berubah menjadi warna hitam.“Kalau keadaan seperti itu, jangan manusia, lembu peliharaan kami pun akan sakit,” sela warga lainnya. Warga di sana berharap mereka bisa terbebas dari pencemaran udara, suara bising, dan kerusakan lingkungan. “Semoga saja Pemerintahan Kabupaten Aceh Utara bisa menyelesaiakan kasus ini, sehingga kami tetap merasa nyaman tinggal dan bekerja di ladang,” imbuhnya. Kepala Kantor Lingkungan Hidup (KLH) Aceh Utara, Nuraina gagal dikonfirmasi. Telepon selularnya dalam keadaan tidak aktif dan tidak pula membalas pesan singkat yang dikirimkan. (b14)

Satpol PP-WH Tingkatkan Pengawasan Di Tempat Wisata NAGAN RAYA (Waspada) : Pelanggaran Syariat masih kerap terjadi di Nagan Raya. Untuk menekan angka terjadinya pelanggaran tersebut, Kepala Kantor Satpol PP-WH Drs Muhajir Hasbalah menyatakan pihaknya akan meningkatkan pengawasan. Namun, diakuinya sebelum melakukan pengawasan secara intensif dengan menempatkan petugas di lapangan, pihaknya juga terlebih dahulu akan melakukan pembenahan secara internal kepada seluruh petugas yang nantinya akan diturunkan untuk melakukan pengawasan dilapangan. “Disiplin untuk itu sangat penting, karena itu terlebih dahulu kita membenahi diri secara internal,” ujarnya. Terkait adanya wacana untuk dilakukannya pengawasan di warung berpondok yang ada di Kecamatan Kuala Pesisir karena berpelung terjadi tindakan pelanggaran hukum syariat pihaknya mengaku tidak merasa keberatan dengan hal itu. Termasuk penempatan anggota untuk melakukan pengawasan. “Memang sudah menjadi tujuan utama untuk menekan terjadinya tindakan pelanggaran. Disamping itu, tidak menutup kemungkinan juga akan dilakukan pembinaan terhadap pengelola tempat, sehingga kedepan harapan kita tentang syariat Islam di Aceh berjalan maksimal,” akunya ketika ditemui Kamis (10/ 1). (cda)

tidak dikukuhkan. Berikut, kali ini setelah terpilih menjadi ketua, juga tidak diakui. Saya menduga, karena bukan dari kelompok atau kroninya,” tegas Musa, TA yang terkenal politisi partai berlambang kepala banteng di Aceh Utara itu. Terhadap ungkapan maupun laporan Musa, TA ke DPP PDI-P di Jakarta, pihak ketua DPD PDI-P Aceh, Karimun Usman, membantah, dia bukan mempertahankan kroninya yang tidak unggul dalam pemilihan. “Kendati telah terpilih sebagai ketua DPC PDI-P Aceh Utara, kami tak akui dia (Musa, TA), karena sosok yang tidak

loyal terhadap partai,” tandas ketua DPD PDI P Aceh, via telepon selular kepada Waspada, Rabu (9/1) malam. Bayangkan, kata dia, saat Komisi Independen Pemilihan (KIP) Aceh Utara, memverifikasi faktual organisasi, copy KTP pendukung yang sudah tersedia sebanyak 959 lembar, tidak sedia ditambah oleh Musa TA. “Malah copy KTP dia sendiri dan keluarganya, tidak sedia diberikan. Berdasarkan hal itu, kami tetap tak akui dia, walau sudah terpilih menjadi Ketua DPC PDI-P di Aceh Utara,” tegas Karimun Usman. (b13)

Dinas Kesehatan Aceh Tenggara Mengucapkan:

Semoga WASPADA tetap jaya dan terus berpihak membela Kebenaran demi Keadilan Ttd.

dr. Ramulia, SpOG Kepala Dinas

Ekonomi & Bisnis

WASPADA Jumat, 11 Januari 2013

C3

Shaikh Mohammad Umumkan Dubai Ibukota Ekonomi Islam

Nelayan Aceh Masih Gunakan Peralatan Sederhana

DUBAI, Uni Emirat Arab (Waspada): Pada satu konferensi yang bertajuk Dubai: Ibukota Ekonomi Islam, Shaikh Mohammad Bin Rashid Al Maktoum, Wakil Presiden dan PM Uni Emirat Arab dan Penguasa Dubai, mengumumkan satu kelompok berinisiatif untuk membentuk satu landasan komprehensif tentang produk ekonomi dan pelayanan yang Islami. Inisiatif itu bertujuan mengintegrasikan ekonomi Islam sebagai bagian dari ekonomi Dubai secara keseluruhan. Landasan itu termasuk instrumen keuangan yang Islami, asuransi yang Islami, arbitarsi kontrak yang Islami, industri makanan yang Islami dan standar perdagangan (makanan Halal) dan standar kualitas manajemen yang Islami. Shaikh Mohammad mengatakan bahwa kerangka kerja baru untuk mempromosikan ekonomi Islam itu akan lebih memperkuat pendekatan dan integrasi terbuka Dubai untuk melakukan bisnis. Langkah itu diharapkan akan said that new framework for promoting Islamic economy will further strengthen the open and integrated approach of Dubai in doing business. Hal ini diharapkan akan memberikan momentum lebih lanjut untuk diversifikasi perekonomian Dubai yang lebih baik, yang berada pada jalur pertumbuhan yang ambisius didorong oleh kinerja yang kuat dari sektor inti termasuk perdagangan, ritel, pariwisata, penerbangan, perhotelan, jasa keuangan dan logistik pada tahun 2012. (m10)

BANDA ACEH (Waspada) : Para nelayan tradisional di kawasan Pantai Kota Banda Aceh dan kabupaten Aceh Besar masih menggunakan peralatan sederhana untuk menangkap ikan. Yakni hanya dengan menggunakan jaring, kail dan perahu kecil untuk melaut. Sejumlah nelayan di Kec. Syah Kuala, Kamis (10/1), mengatakan karena peralatan mereka masih sederhana, hasil tangkapan juga minim. Sekali melaut, mereka hanya mampu mendapatkan hasil antara Rp50.000-Rp100.000. Malah ada kalanya nelayan kembali dengan tangan kosong. Itu terjadi bila jaring rusak dihantam kayu atau cuaca buruk. Para nelayan tradisional biasanya berangkat ke laut pada pukul 05:00 dan kembali ke darat menjelang tengah hari. Setiap perahu hanya bisa diisi dua hingga empat orang. Seorang nelayan Sulaiman,45, mengatakan kalau ada ikan hasil tangkapan, mereka jual kepada pedagang pengumpul yang sering menunggu nelayan di tepi pantai. Jarang hasil tangkapan mereka dihargai tinggi. Bahkan ketika harga ikan di pasar melambung, harga jual kepada pedagang pengumpul tetap tidak meningkat.(b09).

Petani Aceh Utara Kembangkan Vanili

Layanan Transfer Pulsa AXIS Dapat Diakses Sepanjang Hari JAKARTA (Waspada): AXIS, penyedia layanan internet terdepan di Indonesia, telah meningkatkan layanan ‘Transfer Pulsa’ untuk memberikan lebih banyak kenyamanan bagi pelanggan. Kini, pelanggan dapat mengirimkan pulsa ke keluarga atau kerabatnya dengan nilai maksimum hingga Rp500.000 atau 5x transaksi per hari dengan nilai transfer antara Rp50.000 hingga Rp200.000 per transaksi. Layanan ini dapat diakses sepanjang hari, setiap hari. Daniel Horan, Chief Marketing Officer AXIS mengatakan, “AXIS telah memperkenalkan layanan ‘Transfer Pulsa’ sekitar setahun lalu dan telah menerima respon positif dari pelanggannya. Hari ini, dengan bangga kami mengumumkan bahwa AXIS telah menyempurnakan layanan ini dengan menambahkan berbagai kenyamanan untuk pelanggan. ” Daniel melanjutkan, “Dengan penyempurnaan layanan ‘Transfer Pulsa’, pelanggan AXIS dapat mengirimkan pulsa ke keluarga dan kerabatnya hingga Rp500.000 atau maksimal 5x transaksi per hari. Dengan jumlah transfer antara Rp5.000 hingga Rp200.000 per transaksi, proses transfer pulsa jadi lebih mudah dan lebih cepat.” Dengan layanan Transfer Pulsa yang telah lebih disempurnakan, pelanggan AXIS dapat mengirimkan atau menerima pulsa ke/ dari keluarga dan kerabatnya saat mereka membutuhkan dengan nilai transfer minimum Rp5.000 dan maksimal Rp500.000 atau maksimal 5x transaksi per hari. Nilai transfer adalah antara Rp5.000 – Rp200.000 per transaksi. Pulsa transfer yang diterima Perpanjangan Masa Aktif Rp5.000 – Rp 9.000 5 hari Rp10.000 – Rp 19.000 10 hari Rp20.000 – Rp 49.000 15 hari Rp50.000 – Rp 200.000 25 hari Semua pelanggan pra-bayar AXIS dapat menggunakan layanan ini, namun sisa pulsa minimal Rp10.000 setelah melakukan transfer. Pelanggan dapat memeriksa jumlah pulsa mereka melalui *888#. Layanan ini tidak berlaku bagi pelanggan ‘Nomor Cantik’. Informasi lebih lanjut tentang AXIS dan penawaran-penawaran terbaiknya dapat diakses melalui www.axisworld.co.id. (rel)

Kebutuhan Pokok Melambung TEBINGTINGGI (Waspada): Sejumlah bahan kebutuhan pokok di pasar kota Tebingtinggi melambung. Banyak konsumen merasa terkejut dengan kenaikan harga-harga kebutuhan pokok itu. Pantauan di sejumlah pasar, Kamis (10/1), dalam beberapa hari belakangan harga bahan pokok bersifat fluktuatif. Misalnya beras ramos mencapai Rp93.000 per 10 kg, sedangkan beras Siempat Rp85.000. Sejumlah bahan pokok yang naik drastis, terdeteksi yakni daging sapi, dari Rp80.000 per kg menjadi Rp85.000 per kg. Harga daging ayam juga naik dari Rp17.000 per kg, menjadi Rp21.000 per kg. Beberapa sayur mayur juga mengalami kenaikan harga signifikan. Wortel dari Rp5.000 per kg, naik menjadi Rp7.000 per kg. Juga dari Rp5.000 per kg, menjadi Rp8.000 per kg. Beberapa pedagang menginformasikan, kenaikan harga-harga bahan tertentu terkait dengan pasokan yang tersendat. “Maklum saja lah, natal dan tahun baru, mereka (petani) tak ke lading. Jadi pasokan berkurang,” ujar Br. Nainggolan, di Pasar Iskandar Muda. Pedagang daging mangakui, kenaikan harga daging sapi terjadi akibat terhentinya pasokan sapi ekspor. Sedangkan harga daging ayam yang melambung dikarenakan terganggunya pasokan karena pengaruh cuaca. (a09)

Daftar Harga Bahan Pokok Di Medan, Kamis (10/1) Beras Ramos 1 Beras Ramos 2 Beras KKB 1 Beras KKB 2 Beras Arias Beras Jongkong IR 64 Beras Jongkong Kasar Beras Jongkong IR 64/Kw3 Gula Pasir Minyak Goreng Bimoli (620 cc) Minyak Goreng Curah Kuning Daging Sapi Murni Daging Ayam Broiler Daging Ayam Kampung Telur Ayam Broiler Telur Ayam Kampung Garam Kasar Garam Halus Terigu Segi Tiga Biru Cabai Merah Cabai Rawit Cabai Hijau Bawang Merah Bawang Putih Tomat Kol Kentang Ikan Asin Teri (no.2) Kacang Hijau Kacang Tanah Kacang Kedelai Minyak Tanah Susu KM Bendera 357 gr Susu KM Indomilk 390 gr Susu Bubuk Bendera 400 gr Susu Bubuk Indomilk 400 gr

: Rp9.200 per kg : Rp9.000 per kg : Rp9.600 per kg : Rp9.400 per kg : Rp9.000 per kg : Rp8.800 per kg : Rp8.200 per kg : Rp8.200 per kg : Rp13.000 per kg : Rp10.000 : Rp9.500 per kg : Rp85.000 per kg : Rp26.000 per kg : Rp55.000 per kg : Rp900 per butir : Rp1.500 per butir : Rp1.200 per kg : Rp2.000 per kg : Rp7.000 per kg : Rp15.000 per kg : Rp28.000 per kg : Rp10.000 per kg : Rp20.000 per kg : Rp18.000 per kg : Rp5.000 per kg : Rp3.000 per kg : Rp5.000 per kg : Rp75.000 per kg : Rp12.000 per kg : Rp23.000 per kg : Rp8.000 per kg : Rp9.000 per liter : Rp7.600 per kaleng : Rp8.200 per kaleng : Rp25.500 per kotak : Rp27.200 per kotak (m41)

Harga Emas London Murni (LM)

526.000

Perhiasan (97%)

511.000

Emas Perhiasan (70%)

368.000

Emas Putih (75%)

368.000

Suasa

263.000

(50 %)

Waspada / Rusli Ismail

SIAP-SIAP MELAUT : Sejumlah nelayan tradisional di kawasan Pantai Alue Naga, Kec.Syiah Kuala, Kota Banda Aceh sedang membetulkan jaring di perahu kecil mereka untuk bersiap-siap melaut, Rabu (9/1).

Pemerintah Tingkatkan Penanggulangan Kemiskinan JAKARTA (Antara): Pemerintah akan meningkatkan penanggulangan dengan koordinasi antarKementerian Lembaga dalam pelaksanaan program penanggulangan kemiskinan. Selama ini koordinasi itu dirasakan belum efektif untuk menekan angka kemiskinan. Menteri Koordinator bidang Perekonomian Hatta Rajasa, mengatakan itu seusai rapat koordinasi di Jakarta, Kamis (10/ 1). Menurutnya, pemerintah akan fokus mengefekstifkan dana-dana kementerian untuk mengurangi kemiskinan. ‘’Sehingga pencapaian penurunan kemiskinan kita cukup signifikan pada 2013,” ujarnya. Hatta, menjelaskan efekti-

vitas pelaksanaan program tersebut akan diaplikasikan dalam agenda aksi antarKementerian Lembaga, agar percepatan kesejahteraan di daerah tertinggal dapat lebih mudah terealisasi. Selain itu, pemerintah juga akan meningkatkan lapangan pekerjaan, untuk mengatasi tingkat pengangguran, hingga netto sebesar 750.000-1 juta orang dengan menjaga iklim berusaha dan meningkatkan koordinasi dengan kalangan pengusaha. “Kita akan mempertahankan sektor industri dan menjaga supaya tidak ada PHK, apabila ada masalah yang menganggu kita akan melakukan pendekatan,” katanya. Program tersebut, lanjut Hatta, akan digabung dengan program kewirausahaan dan beasiswa para pelajar, agar proses penyerapan tenaga kerja tidak terhambat dan penciptaan lapangan kerja dapat berlangsung maksimal. Ke depan, menurutnya elastisitas pertumbuhan terhadap lapangan kerja itu tidak seperti

jaman dulu, dimana industri lebih kepada didominasi oleh labor intensif. Kalau sekarang capital intensif mulai meningkat. Hatta, juga memastikan pemerintah akan mendorong percepatan proyek investasi yang tercantum dalam Masterplan Percepatan dan Perluasan Pembangunan Ekonomi Indonesia (MP3EI) ataupun tidak, untuk mempercepat realisasi pembangunan. Menteri Perencanaan Pembangunan Nasional/Kepala Bappenas Armida Alisjahbana, menambahkan percepatan agenda aksi Kementerian Lembaga akan dilakukan di beberapa kecamatan yang berada dalam koridor Masterplan Percepatan dan Perluasan Pengurangan Kemiskinan Indonesia (MP3KI). Katanya, ada sekitar delapan atau 10 kecamatan yang kurang lebih merepresentasikan koridor ekonomi di Jawa, Sumatera, Kalimantan, Papua. Ini sedang disiapkan lebih lanjut, dan akhir triwulan I atau

triwulan II akan di launching. Menurut Armida, pelaksanaan program untuk mengentaskan kemiskinan ini dapat mengurangi kesenjangan dan akan terus dievaluasi untuk meningkatkan kualitas sumber daya manusia di daerah tertinggal. ‘’Kita betul-betul fokus di 2013 dan 2014. Mungkin tahun 2013 semacam pilot project, nanti apa yang berhasil dan apa kurangnya di 2014 agak lebih diskill up lebih luas dan lebih banyak,’’ ujarnya. Pemerintah menargetkan angka kemiskinan pada 2013 sebesar 9,5 persen-10,5 persen. Sedangkan pada September 2012, angka kemiskinan tercatat mencapai 11,66 persen atau belum mencapai target indikator 10,5 persen-11,5 persen. Sementara, dalam APBN 2013 pemerintah menganggarkan dana sebesar Rp63,4 triliun untuk bantuan sosial dalam bidang pendidikan, kesehatan, perlindungan sosial dan pemberdayaan masyarakat, yang bertujuan menekan angka kemiskinan.

Pelemahan Rupiah, Rontokkan IHSG MEDAN (Waspada): Rupiah yang diperdagangkan di kisaran level Rp9.890-an menjadi sentimen negatif bagi perdagangan saham di lantai bursa. Bahkan pelemahan nilai tukar Rupiah terhadap Dolar AS tersebut merontokkan Indeks Harga Saham Gabungan (IHSG). “Sejauh ini, IHSG terus turun di bawah level resisten 4.375. Pelemahan Rupiah yang seharusnya mampu mendongkrak harga saham sektor komoditas seperti sawit dan batubara, justru saham di sektor tersebut mengalami penurunan pada perdagangan hari ini (Kamisred),” kata analis pasar modal salah satu BUMN Gunawan Benjamin, Kamis (10/1). Gunawan menyebutkan, saham perkebunan yang sempat terdongkrak naik akibat sudah terlewatinya musim panen dan naik di hari pertama perdagangan di bursa pada saat ini kembali berbalik turun. Diperkriakan tren harga saham

perkebunan di tahun 2013 ini akan bergerak mendatar dengan memiliki volaitilitas yang sempit. Sementara itu, harga saham sektor farmasi juga mengalami tekanan yang tidak terlalu berbeda mengingat sektor farmasi juga memiliki komponen barang impor yang tidak sedikit. Hanya saham sektor infrastruktur yang masih mampu bertahan dengan mencatatkan kenaikan. “Dengan pelemahan Rupiah saat ini, Indonesia tengah menghadapi ancaman defisit transaksi berjalan dan memunculkan anggapan bahwa pemerintah hanya akan memiliki opsi menaikkan harga bahan bakar minyak (BBM) dibandingkan dengan rencana pembatasannya,” ujar Gunawan. Menurutnya, pelemahan Rupiah akan membuat kebutuhan Dolar AS Pertamina untuk mengimpor semakin tinggi. Di tengah meningkatnya arus barang dari luar ditambah

permintaan Dolar AS yang signifikan dari Pertamina ditambah ketidakpastian kebijakan ekonomi AS, maka dalam jangka pendek Rupiah berpeluang tertekan hingga Rp10.000 per Dolar AS. Transaksi NDF (non delivery forward) yang harganya jauh lebih tinggi dari harga Spot Rupiah-US$, ini juga akan menggiring persepsi pelaku pasar bahwa Rupiah memiliki kecenderungan untuk melemah. Walaupun ini belum merupakan gambaran Rupiah untuk tahun 2013 ini, namun sejauh ini, BI belum memberikan arahan maupun langkah guna mengantispasi pelemahan Rupiah saat ini. “Sehingga pasar berasumsi bahwa BI lebih cenderung untuk membiarkan Rupiah melemah dan dibiarkan sesuai dengan mekanisme pasar. Melakukan intervensi agar Rupiah menguat juga tidak akan banyak membantu mengurangi

masalah pasar keuangan di Indonesia. Opsi intervensi juga berpeluang menciptakan persepsi bahwa Rupiah berpeluang terkoreksi lebih dalam lagi,” kata Gunawan yang juga pengamat dari IAIN Sumut ini. Dia menyebutkan, BI harus berhati-hati dengan pelemahan Rupiah saat ini, meskipun pelemahan Rupiah juga baik untuk transaksi berjalan, namun membiarkan Rupiah melemah sama saja menekan pertumbuhan ekonomi Indonesia itu sendiri. “Kontraksi ekonomi dari negara luar, hari ini sudah kian terasa mengguncang perekonomian Indonesia. Konsumsi yang merupakan basis pertumbuhan ekonomi kita saat ini juga tengah terancam dengan tingginya inflasi akibat pelemahan Rupiah,” ujarnya, seraya mengatakan, pelemahan Rupiah saat ini seharusnya menjadi lampu kuning bagi pemerintah untuk bertindak. (m41)

BANDAR BARO (Waspada): Puluhan petani anggota Koperasi Tajul Hayat Kec. Bandar Baro, Aceh Utara mengembangkan tanaman vanili di kawasan hutan Krueng Tuan, Nisam Antara. Tanaman vanili dapat ditanaman di kawasan hutan lindung karena tidak merusak pohon kayu. Pembina Koperasi Tajul Hayat Usman Berdan, usai Rapat Anggota Tahunan (RAT), beberapa waktu lalu menjelaskan budidaya vanili di Aceh Utara ikut dibantu mahasiswa dari Institut Pertanian Bogor (IPB). Para petani, menurutnya, sengaja memilih tanaman vanili karena tidak menganggu hutan. “Lahan yang kita buka di kawasan hutan Krueng Tuan, tidak perlu menebang pohon,” jelas Usman yang didampingi Ketua Koperasi, Safruddin. Selain itu, tambah dia, tanaman vanili melekat pada batang pohon besar sehingga tidak mudah diganggung binatang hutan. Biasanya kalau tanaman sawit sering diganggu gajah, tapi tanaman vanili tidak akan diganggu karena menyatu dengan pohon kayu hutan. Sementara itu Saifruddin, menjelaskan pihaknya sedang mengembangkan sekitar 200 bibit vanili. Para petani setempat sebelumnya telah mendapat pendidikan cara menanam dari ahli pertanian IPB. Kegiatan penanaman vanili juga mendapat dukungan dari lembaga pemerhati lingkungan hidup, karena mengembangkan tanaman yang tidak merusak hutan.(b15)

PAD Gayo Lues Meningkat BLANGKEJEREN (Waspada): Pendapatan Asli Daerah (PAD) Kab. Gayo Lues mengalami peningkatan, meski beberapa SKPK ada yang belum mencapai target. Demikian dikatakan Kepala Dinas Pengelola Keuangan Daerah (DPKD) Gayo Lues, H. Talib, Rabu (10/1). Disebutkannya, secara keseluruhan PAD Gayo Lues sudah memenuhi target. Kalau pada tahun tahun 2011 perolehan PAD masih di bawah 90 persen, maka pada 2012, PAD yang dihasilkan mencapai 103 persen. ‘’Walaupun kita akui belum semua SKPD memenuhi target PAD nya,’’ katanya. Menurut Kadis Keuangan, beberapa SKPD yang belum memenuhi target adalah Dinas Pertanian, Dinas Pekerjaan Umum, Camat Blangpegayon, dan Camat Tripe Jaya. Sedangkan Rumah Sakit Umum Daerah melebihi target. Thalib, merinci kegiatan pembangunan infrastruktur Kab. Gayo Lues juga bertujuan untuk meningkatkan prekonomian masyarakat. Selain itu bantuan sosial, bantuan pertanian serta bantuan alat-alat pengolah pertanian yang sebagian di gratiskan. “Mudah-mudahan di tahun 2013 ini, prekonomian masyarakat bisa lebih baik dari tahun sebelumnya, dan harapan kita bertujuan untuk mengurangi angka kemiskinan di daerah ini,” ucapnya.(cjs)

Kelompok Tani Binter Panen Lele LHOKSEUMAWE (Waspada): Kelompok Tani Binter, Desa Blang Weu Baroh, Blang Mangat, Lhokseumawe, Kamis (10/ 1) melakukan panen lele dumbo yang akan dijadikan contoh bagi petani lain. Panen lele itu dihadiri Kepala Dinas Kelautan Perikanan dan Pertanian (DKPP) Lhokseumawe Rizal, Deputi Kepala Perwakilan Bank Indonesia (BI) Cabang Lhokseumawe Ahmad Subarkah, dan Ketua KTNA Lhokseumawe H. Z. Rusli MS. Dalam satu kolam ukuran 12 x 30 meter dengan masa tiga bulan pemeliharaan bisa menghasilkan 1 ton lele. Sedangkan harga jual Rp12.500 per kg. “Berarti dalam satu kolam bisa menghasilkan Rp12,5 juta,” kata Ketua Kelompok Tani Binter Zulfikar. Pembudidayaan ikan lele di desa itu merupakan program bantuan CSR tahun 2012 bekerja sama dengan DKPP, memberikan bantuan kepada sepuluh petani. Bantuan berupa bibit lele dumbo sangkuriang sebanyak 100 ribu ekor. Selain itu juga pakan, jaring, mesin pembuat pelet, dan pamper (mesin air). Progaram BI melalui CSR ini untuk membantu masyarakat. Tujuan utama untuk memakmurkan masyarakat dalam peningkatan ekonomi. “Lhokseumawe dipilih karena melihat peluang pasar yang sangat potensial,” kata Deputi Kepala Perwakilan BI Cabang Lhokseumawe Ahmad Subarkah. Pada masa mendatang, Subarkah, berharap petani di daerah ini dapat mengolah lele sale dan bakso lele. Besar kemungkinan di daerah ini bisa dibuka warung-warung pecal lele yang menjadi daya tarik dan minat orang untuk menikmati. Sebelumnya BI juga sudah memberikan bantuan 80 ekor sapi bagi sejumlah petani di Ujong Pacu dan 20 ekor untuk para petani di Batuphat. Kedua daerah itu dalam wilayah Kec. Muara Satu. “Ke depan BI tetap akan memperhatikan bantuan agar terus berlanjut,” kata Ahmad Subarkah.(b14)

Bank Dunia Minta Lintas Meulaboh-Calang Dituntaskan Pemkab Aceh Utara BANDA ACEH (Antara): Perwakilan Bank Dunia di Indonesia meminta pemerintah provinsi Aceh segera menuntaskan pengerjaan fisik badan jalan sepanjang empat kilometer di lintas Meulaboh-Calang. “Harapan kami, Pemprov Aceh komit dengan janji sebelumnya untuk menuntaskan pengerjaan fisik sekitar empat kilometer lagi. Artinya tahun depan jalur itu sudah masuk

dalam agenda anggaran 2013,” kata Operasional Officer Word Bank di Indonesia Agus Samsudin, di Meulaboh, Kamis (10/ 1). Kata Agus, tuntasnya jalan lintas Meulaboh-Calang sepanjang 50 kilometer merupakan paket terakhir dari proyek Bank Dunia dan Multi Donor Found (MDF) dalam program hibah Aceh-Nias. Ia menyebutkan, proyek jalan yang menghubungkan

lintas pantai barat Aceh dengan jalan nasional sudah tuntas sesuai target, dan sudah memenuhi mutu serta kapasitas sesuai standar jalan nasional di Indonesia. “Hanya saja lebar bahu badan jalan yang ada di sepanjang empat kilometer itu yang belum rampung. Namun mutu dan kapasitas jalan ini sudah sesuai standar jalan nasional,” imbuhnya. Agus, menyatakan bila di-

bandingkan dengan daerah lain, pengerjaan proyek di Provinsi Aceh jauh lebih mudah dan cepat tanpa ada kendala berarti, meskipun daerah itu pernah didera konflik. Sejak dilakukan pembebasan 2.100 persil lahan masyarakat hanya membutuhkan waktu 1,5 tahun. Sementara di luar Aceh, untuk pembebasan lahan 500-1.000 persil butuh waktu hingga 10 tahun dan masih lagi berbenturan.

Harga Minyak Di Perdagangan Asia Naik SINGAPURA (Antara/AFP): Harga minyak naik di perdagangan Asia Kamis (10/1), setelah lonjakan surplus perdagangan China. Itu memicu harapan besar bagi ekonomi terbesar ke dua dan pengguna energi terbesar dunia itu mulai mengalami pertumbuhan ekonomi yang lebih baik. Angka-angka perdagangan terbaru dalam serangkaian data dalam beberapa bulan terakhir mengindikasikan China akhirnya kembali berbalik setelah mengalami pertumbuhan yang

lambat dalam tujuh bulan berturut-turut, kata para analis. Kontrak utama New York, minyak mentah light sweet untuk pengiriman Februari naik 41 sen menjadi 93,51 dolar AS per barel dalam perdagangan pagi hari dan minyak mentah Brent North Sea untuk penyerahan Februari naik 16 sen ke posisi 111,92 dolar AS. “Setelah mengalami pertumbuhan yang lambat tahun lalu, mesin ekonomi Asia yang dipimpin oleh China, kembali bersemangat lagi,” kata raksasa

perbankan dunia HSBC dalam sebuah komentar pasar. Surplus perdagangan China melonjak 48,1 persen menjadi 231,1 miliar dolar pada 2012, meskipun total volume perdagangan tumbuh pada kecepatan yang lebih lambat sehubungan dengan pelemahan ekonomi yang terjadi baik di dalam maupun luar negeri, data resmi menunjukkan Kamis. Ekspor negara itu naik 7,9 persen menjadi 2,05 triliun dolar dari tahun sebelumnya, sedangkan impor naik 4,3 persen

menjadi 1,82 triliun dolar, menurut kantor kepabeanan negara itu. Volume perdagangan China, atau total ekspor dan impor, tumbuh 6,2 persen pada 2012, jauh di bawah target pemerintah sekitar 10 persen. “Kami melihat berbagai aset di seluruh papan membaik, setelah didorong oleh data dengan angka perdagangan China yang lebih baik dari pada yang diperkirakan,” kata Jason Hughes, kepala manajemen klien premium pada IG Markets di Singapura.

Bangun Tambak Bandeng

JAMBOE AYE (Waspada): Untuk meningkatkan ekspor ikan bandeng ke luar negeri, Pemkab Aceh Utara membangun tambak percontohan seluas 21, 5 hektare. Tempatnya di Kec. Tanah Jamboe Aye. Kadis Kelautan dan Perikanan Utara Saiful Bahri, mengatakan tujuan pembukaan tambak percontohan tersebut adalah dalam rangka mewujudkan visi dan misi pemberdayaan masyarakat petani miskin sepanjang pesisir. Lokasi tambak adalah di Desa Meunasah Dayah. Dengan adanya tambak percontohan, diharapkan ke depan bisa terjadi peningkatan jumlah produksi ekspor ikan bandeng ke luar negeri. Namun terkait situasi dan kondisi program kerja itu, lanjutnya, kini masih dalam tahap penyelesaian dan hampir selesai dibangun. Bila sudah rampung dan produktif, maka nantinya tambak percontohan itu juga akan difungsikan sebagai tempat penyuluhan untuk petani tambak yang sesuai dengan program pengolahannya. Apalagi dalam pelaksanaannya juga ikut melibatkan tim ahli dari Universitas Syiah Kuala sebagai tenaga penyuluh yang sudah pernah melakukan study banding di Kota Semarang, yang terkenal dalam bidang budidaya ikan bandeng presto. Pasca pelaksanaan program tersebut, tentu pengetahuan yang diterima petani tambak akan menjadi bekal untuk bisa meningkatkan jumlah produksi ikan bandeng. Semua hasil panen petani tambak akan diekspor ke Jepang dan negara lainnya, sesuai wacana Pemkab Aceh Utara yang sudah menjalin hubungan kerjasama dengan investor asal Jakarta. Saiful, mengaku masih sulit memenuhi tawaran eskpor ikan bandeng keluarga negeri melalui investor di Jakarta, lantaran terkendala fasilitas dan pola budidaya ikan bandeng yang tidak mencukupi permintaan yang mencapai sebanyak 36 ton setiap minggunya.(b16)

Opini

C4 TAJUK RENCANA

WASPADA – Pembaca Saling Membutuhkan

H

arian Waspada kemarin membuat headline dengan letter capital ‘Pilgubsu Mulai Panas’ dengan melakukan liputan ke lapangan terkait aktivitas kelima pasangan Cagubsudi berbagai kabupaten-kota semakin masiv. Artinya,Waspada punya kepedulian untuk menyukseskan jalannya pesta demokrasi pada 7 Maret mendatang. Mengapa kami peduli dengan Pilgubsu?Yang pasti karena kepentingan publiknya demikian besar sehingga apapun yang terjadi redaksi akan menurunkan timnya meliput kegiatan kelima pasangan calon yang kini aktif menebar senyum guna meningkatkan kualitas dan kuantitas pencitraannya di tengah-tengah masyarakat luas (33 kabupaten-kota). Tidak itu saja, kami juga mengupayakan sebanyak mungkin berita yang berisi informasi terkait kelima pasangan calon: Gus Irawan Pasaribu –Soekirman, Effendi Simbolon – Jumiran Abdi, Chairuman Harahap – Fadly Nurzal, Amri Tambunan – RE Nainggolan, dan Gatot Pujo Nugroho – HT Erry Nuradi. Sebisa mungkin dalam batas normatif kami mengupayakan liputan terkait track record atau visi dan misi, serta kepedulian kelima pasangan kandidat pada berbagai kegiatan sosial kemasyarakatan dalam tiga bulan belakangan ini. Justru itu, setiap harinya dibuka halaman khusus Pilkada. Halaman yang diberi nama Pentas Pilkada inilah menjadi sarana bagi kelima pasangan calon dan masyarakat berkomunikasi atau berpantun mengungkapkan harapan dan keinginannya yang beragam. Masyarakat diberi peluang seluas mungkin untuk mengungkapkan tipe atau kapasitas calon Gubsu yang bagaimana paling tepat memimpin Sumut, dan program-program apa saja yang dibutuhkan warga Sumut dewasa ini di kota maupun desa. Begitu pula kelima pasangan Cagubsudiberiruangseluas-luasnyauntukmemanfaatkanhalamanyangnilainyabisamencapai puluhan juta rupiah bila diisi pariwara sekali terbit. Tapi sudah menjadi komitmenWaspada sebagai koran politik – nasional – religius untuk memberikan pendidikan politik kepada warga masyarakat yang tingkat pemahaman dan pendidikannya berbeda-beda. Hemat kita, walaupun Waspada membuka halaman Pilkada tetap saja mengacu pada‘’news value’’ sehingga standar liputan tetap terjaga. Intisari Berbagai kegiatan maupun berita-berita yang dibuat warga masyarakat dan juga pasangan tetap harus mengikuti standar jurnalistik Dengan slogan simbiosis Cagubsu baku. Dengan demikian bermanfaat bagi mutualisme Waspada - masyarakat, khususnya pembaca Waspada, pada hari-H nanti mereka bisa masyarakat (pembaca) sehingga menentukan pilihannya dengan tepat tanpa dan intimidasi. siap bersinergi selamanya tekanan Terus terang, tidak mudah untuk mengupas track record dari masing-masing pasangan Cagubsu karena itu kami menganut asas praduga takbersalahsehinggayangnamanya‘’blackcampaign’’tidakbakallolos.Setidaknyakeseimbangan berita tetap harus terjaga dengan melakukan konfirmasi kepada pihak-pihak terkait. Justru itu pilihan yang lebih aman, yaitu menyertakan satu wartawan ke masing-masing kandidat Cagubsu/Cawagubsu. Dengan ‘’embedded journalist’’ ini tentu si reporter harus memahami aturan main perundangan terkait Pilkada, bisa menjaga jarak dengan sang tokoh, serta mampu melakukan liputan komprehensif. Semua pasangan dipersilakan membuat sebanyak mungkin kegiatan yang bersinggungan dengan masyarakat, bagi-bagi sembako, makan bersama, bernyanyi dll dan kami sebagai media siap menyiarkannya dengan mengikuti kaidah jurnalistik. Artinya, jika nilai beritanya tinggi akan diprioritaskan ketimbang berita cuap-cuap atau seremonial belaka. Sebenarnya, liputan terkait janji dan program kerja pasangan Cagubsu sangat baik. Sebab, kalau mereka terpilih nanti rakyat tinggal menuntut agar janji-janjinya ditepati. Rakyat pun bisa mengkritik, bahkan mendesak pemimpinnya mundur jika abai – berbohong dengan janji-janjinya. Dalam kaitan HUT ke-66 Waspada, Jumat 11 Januari 2013 harus kami sadari tuntutan masyarakat pembaca kian besar terhadap pers yang berkualitas, sementara pers masih harus berjuang mendapatkan kebebasannya. Berjuang meningkatkan sumber daya manusia sehingga tidak dipungkiri masih banyak media massa yang belum menjalankan fungsi persnya, termasuk dalam liputan Pilgubsu. Bahkan, masih banyak media massa yang sebenarnya tidak layak disebut pers karena isinya tidak mencerminkan produk pers, tidak mendidik, tidak mencerdaskan, malah mengeksploitasi hal-hal tertentu untuk kepentingan bisnis pribadi/kelompoknya semata. Tak pelak lagi, masyarakat harus diberi informasi yang benar bahwa tidak semua media massa itu baik (positif), ada juga media yang tidak baik (negatif). Media yang positif harus didukung bersama agar semakin tumbuh dan berkembang, sementara media yang negatif harus dilawan bersama masyarakat agar tidak merusak citra, sampah, dan merusak citra wartawan. Kami menyadari masih banyak kekurangan, namun sudah menjadi tekadWaspada sebagai media positif untuk terus belajar, meningkatkan kualitas dan profesionalitas. Perubahan itulah kata kunci yang kami serap dari masyarakat. Di mata kami pembaca adalah raja. Kepada rajalah kami berterima kasih. Sebagai wujud kerjasama saling membutuhkan (simbiosis mutualisme) selama 66 tahun.+

APA KOMENTAR ANDA SMS 081362240523

Faks 061 4510025

Facebook Smswaspada

+6281263191734 Tausyiah Kehidupan buat kita umat Islam yang kesehariannya beraktivitas kerja baik ringan maupun berat, - Ketika wajah lelah memikirkan dunia “Berwudhuklah”. - Ketika pundak terasa berat memikul amanah, “Bersujudlah”. - Tunduk disaat yang lain “Angkuh”. - Teguh disaat yang lain “Runtuh”. - Ikhlaskan semua dan Tawakal Kepada Nya. Semoga Allah selalu membimbing kita di jalan Nya. Amin +6285260103051 Dalam situasi apapun dakwah tetap harus diteruskan. Misi besar kehidupan adalah SUKSES DUNIA AKHIRAT. Cita2 termulia adalah mendirikan BALAI PENGAJIAN dan KEMAUAN di situ ADA JALAN. Kata orientalis, where there is a will there is a way. Ungkapan IKLAN, berawal dari hal SEDERHANA kita dapat MENGUBAH DUNIA. Siapa yg berusaha sungguh2 maka akan mendapatkan. Di dalam kesungguhan ada keajaiban. Beranilah bermimpi. Semua berawal dari impian. Allah bersama kita. Selamat BERIKHTIAR! Kepada Yth. Pimpinan PDAM Tirtanadi Kami warga di Komplek Perumahan Ray Pondok Platinum 2, Jl. Perhubungan/ Meteorologi desa laut Dendang, Kec Percut Sei-tuan. Menyampaikan keluhan atas ketersediaan air PDAM di komplek RPP2 yg sudah sekitar 2 bulan ini debit airnya kecil,bahkan sering mati. Mohon kepada pihak yang berwenang untuk segera menindaklanjuti masalah ini. Terimakasih atas perhatian dan kerjasamanya. +6281264974076 Terang cahaya si matahari, berlayar kapal sampai ke hulu. Gatot terpercaya bertuah Erry Nuradi, siapa yang menang belumlah tahu. +6282362141308 Zaman semakin parah, buat cari sesuap nasi pun makin meriah, tak tau apa yg terasa. Mencari kerja semakin susah. Kapan pemerintah mulai mementingkan nasib rakyat dan perekonomiannya. +6281294198801 Setahu saya Indonesia dan Arab Saudi sama2 negara anggota OPEC, tapi kenapa harga minyak berbeda jauh, di Arab Saudi harga 1 liter bensin hanya 1/2 rial alias Rp.1300/ liter ? Padahal rakyatnya jauh lebih makmur disana. Apakah rakyat Indonesia harus terus dibohongi dengan kalkulasi biaya pengolahan yang tidak realistis ? Mohon minyak tidak dipersulit dan tidak dinaikkan harganya.. +6282160425987 Kalau ada jarum yang patah, jangan di simpan dalam peti, kalau pengen SUMUT berubah, pilih pasangan GATOT & TENGKU NURADI. +628261751702 Kalau ada Ustadz yang menjadi calon Gubsu, wajib bagi kita ummat Islam memilihnya. +6287813209627 Kpd yth Harian Waspada Tolong dimuat Keluh kesah Pegawai Dinas Syariat Islam Aceh Utara dapat kami sampaikan kepada Bupati Aceh Utara melalui Harian Waspada. Negeri beliau melaksakan Tugas, orang2 yang dekat dengan dia akan mendapat nilai tambah dan akan diberikan tugas2 yang bisa mengambilkan uang program kantor kepada kroni2nya dan kami sarankan kepada Bapak Bupati Aceh Utara supaya dana2 yang dipergunakan dalam Dinas SI Aceh Utara perlu diperiksa kemana dia pergunakan dan yakinlah di Dinas SI Aceh Utara banyak dipergunaan Belanja kantor bukan pada tempatnya diselewengkan dengan cara2 yang haram supaya dana itu bisa ditarik untuk kelompok mereka Bapak Amir Mahmud Cs & banyak Pegawai Negeri yang bertugas di DSI Aceh Utara yang tidak pro kepada kolompok mereka Tunjangan TPK dipotong sesuka hatinya. Wslm.

WASPADA Jumat 11 Januari 2013

Waspada Dibredel Belanda Oleh Muhammad TWH Waspada mengalami kesulitan kertas. Surat kabar ini tidak mau menerima jatah kertas dari Belanda.

K

etika kesulitan kertas,Waspada tidak mau menerima jatah kertasdariBelanda.Pemerintah Keresidenan Aceh, melalui“NV permai” Cabang Pulau Penang mengirim kertas dengan boat ke Tanjungba1ai, kesulitan kertas Waspada teratasi. Waspada tidak lahir di tengah taman bungadengansemerbaknyaharumbunga mawar dan wanginya kembang melati. Tetapiwaspadalahirditengahkancahperjuangan kemerdekaan.Waspada menjadi salah satu senjata penjuangan yang melepaskan“peluru-peluru” komunikasi menyebabkan NICA Belanda kewalahan. Pembalasan yang dilakukan Belanda, tidak—kurun waktu 3 tahun, tidak kurang 5 kali harian Waspada dibredel. Setelah Inggris menduduki Medan 9Oktober1945yangdiboncengiolehNICA Belanda., dalam kota Medan terjadi pertempuransiangmalam.Karenaitubanyak penduduk Medan mengungsi.Waktu itu penduduk sekitar 300.000 orang—rumah, gedung mentereng banyak ditinggalkan penghuninya.Rumput-rumputpekarangan rumah meninggi, suasana menyeramkan.HanyaKamp.Poloniakelihatansedikit ramai. Jejeran toko yang dihuni orang Tionghoa dilindungi serdadu Belanda dan juga oleh Poh An Tui. Mohd. Said yang menerbitkan “Pewarta Deli, di awal kemerdekaan. Karena koraninimenghantamsekutumenyebabkansekutubertindakmerusakmesincetak “SyarikatTapanuli” hingga surat kabar itu tidak bisa terbit lagi.KemudianMohd.Said memimpin Kantor Berita “Antara” dan tetap bertahan dalam kota Medan. Mohd. Said melihat betapa kalang kabutnya tentara Inggris dan Belanda karena para pejuang memotong pipa air bersih di Sibolangit menyebabkan air tidak mengalir ke kota Medan. Tentara asing ini terpaksa menggali sumur yang keruh. Medan Area Dalam masa perang kemerdekaan baik di tingkat pusat maupun daerah, perundinganselaludilakukanmembicarakan berbagai hal termasuk gencatan senjata. Dalam perundingan Belanda menuntut 25 Km2 Medan Area harus bersih dari pasukanRepublik.Termasuk25km-MedanBelawan karena jalun ini selalu diserang oleh Pasukan Republik. Bahkan pasukan Republik pernah menyerang Kota Bangun danberhasilmerebutdanmendudukikota tersebut sehingga supply beras dan makanan kaleng yang didatangkan melalui Belawan terhalang.Tapi kota Bangun direbut kembali oleh Belanda dengan cara menjepit pasukan Republik dengan serangan dari Medan dari Belawan. Belanda mengangkut bahan makanan dari Bela-

wan ke Medan dengan menggunakan konvoi. Menjelang tahun baru 1947 pembicaraan mengenai 25O km2 sudah matang. Kebetulan bersamaan dengan itu Menteri Pertahanan Amir Syarifuddin datang ke Medan. Kedatangannya itu memberi penegasan 25O km2 (persegi) harus bersih dari kekuasaan pasukan bersenjata kita. Alasannya Indonesia akan mendapat posisi yang ingin dipertahankan oleh delegasi kita dalam perundingan dengan Belanda, hal ini berkaitan dengan perkembangan militer di Jawa. Setelah Medan Area ditimbang terimakanolehInggriskepada Belanda,bulan November 1946, makin bergelora nafsu Belanda memperluas kekuasaannya. Keputusan 25O km2 Medan Area sangat mengecewakan para pejuang karena sebelumnyaInggrisdanBelandasangatterjepit dalam kota Medan. Tetapi kemudian Belanda yang telah menerima timbang tenima Medan Area mendapat kelonggaran dan kesempatan untuk memperluaskekuasaannya apalagi Inggris meninggalkan begitu banyak senjata untuk Belanda. Selain pejuang, Mohd. Said insan pers terkemuka di Medan Area lebih kecewa lagi, karena beliau menilai para pemimpin kita baik di daerah maupun di pusat, tidak“Waspada” bahwa keputusan 25O km2 persegi yangdisetujuiituberarti kita masuk perangkap Belanda. Sebagai kenyataandarikekecewaannya itu, Mohd. Said mengambil keputusan menggunakankata“Waspada”untuksurat kabar yang akan diterbitkan waktu itu. Mohd. Said menyadari benar pentingnya surat kabar yang membawa suara Republikein terbit di Kota Medan. Apalagi waktu itu telah terbit surat kabar yang membawa suara Belanda“Kelewang” dan membawa suara Negara SumateraTimur “Mestika”. Tekad Mohd. Said telah bulat untuk menerbitkan surat kabar Republikein di daerah pendudukan Belanda. Nama telah adayaitu“Waspada”Pembicaraandengan Rahmat Nasution pimpinan percetakan “SyarikatTapanuli” telah rampung. Malah dia berpendapat pada saat ini sangat penting untuk mengumandangkan suara Republik di luar daerah Republik. Dikatakan lagi oleh Rahmat Nasution, betapapun hebatnya suara dikeluarkan di daerah Republik belum ada artinya sebab siapapun bisa melakukannya.Tapi yang paling penting adalah menghantam lawan di kan-

dangnya sendiri. Mohd. Said telah menjumpai beberapa pengecer koran, mereka sanggup membayar koran berapa yang dipesan dengan syarat “cas en delevery”. Jumlah yang dipesan oleh empat orang pengecer 70O eksemplar. Para pengecer bersedia bayartunaididepanmesincetak.Sesudah ituMohd.Saidsegeramenghubungirekanrekanwartawanyangsedang.termenungmenung karena tidak bekerja. Didatangi Penguasa Belanda Sungguh tidak disangka, ketika Mohd. Said sedang membicarakan penerbitan harian“Waspada” tiba-tiba telah muncul penguasa Belanda, Dr Van De Velde di Moskee Straat (sekarang Jalan Masjid) bersama Letnan KNIL M. Manik. Dalam berbincang-bincangdenganMohSaid M.Manik mengatakan : “Adalah janggal kalau kota dibakar musuh, sedangkan kita pemiliknyamembiarkansaja.Ada1ahjanggal kalau surat kabar Republik di daerah Belanda dibiarkan menghantam Belanda.” Van DeVelde hampir termakan ucapan M.Manik itu.Tetapi Mohd. Said segera mengemukakan dari segi juridis. “Sekarang antaraIndonesiadanBelanda dalam suasana gencatan senjata. De fakto RI atas seluruh wilayah Jawa dan Maduradiakuiolehsekutu sejak November 1945 ditimbangterimakan kepada Belanda dalam keadaan status quojuga.RencanapenerbitanWaspada dalam wilayah pendudukan Belanda status quo juga. NampaknyaVan de Velde tergoda dan sedikit bingung mendengar dalil“adpokadtery” Mohd. Said yang kemudian bertanya: “Apakah Belanda yang menguasai Medan membawa sistem ke-Nazian atau demokrasi?” Sebelum menjawab,Van deVelde melihat kepada Letnan M. Manik dan berkata: “Hukum pers Hindia Belanda juga berlaku sekarang dengan UndangUndang Daruratnya. Kita tidak boleh melarang orang menerbitkan kabar.Tapi kita berwenang melarang terbit dan ini bengantung dari isi surat kabar yang disiarkan. Van de Velde dan M.Manik pulang dengan tidak mengatakan tidak melarang terbit. Mohd. Said pun tidak meminta izin terbit. Aceh Bantu Kesulitan Kertas Setelah berusia sekitar 7 bulan, harian Waspada telah berkantor di Pusat Pasar No 126. Sejak terbit dikenal sebagai surat kabar Republikein dengan segala

resiko. Karena para pejuang sangat haus terhadap perkembangan dan tingkat perjuangan di masa itu. Waspada juga masuk ke Aceh yang dibawa kurir-kurir pejuang. Melalui kurir ini A.Hasjmy dan A.G.Mutyara yang menjadi pimpinan surat kabar “Semangat Merdeka” yang terbit di Kutaraja (Banda Aceh) mengetahui Waspada mengalami kesulitan kertas. Surat kabar ini tidak mau menerima jatah kertas dari Belanda seperti surat kabar “Kelewang” dan surat kabar “Mestika”. Apa yang dialami oleh surat kabar perjuanganWaspada oleh A.Hasjmy dan A.G.Mutyara disampaikan kepada Pemerintah Keresidenan Aceh. Melalui“NV Permai” Cabang Pulau Pinang (Malaya) Pemerintah Keresidenan membantu kertas itu dikirim dengan boat yang masuk ke Tanjungba1ai menerobos blokade Belanda. Dan kertas itu dibeli oleh Mohd. Said di Tanjungbalai dan lancarlah terbit harian Waspada. Dibredel Belanda Sebagai surat kabar Republikein yang terbit di daerah pendudukan Belanda, sudah jelas mengalami pukulan-pukulan dari Belanda. Pukulan itu adalah pembredelan (pemberangusan) selama lima kali. Kalau kita menggunakan istilah Pak Said hal itu merupakan “resiko Van het bedrijf”. Pembredelan pertama tanggal 1 Agustus 1947 karena memuat berita“Serdadu Belanda membakar rumah penduduk di Jawa Barat”. Pembredelan kedua tanggal 22 Juli 1948 karenaWaspada memuat barita“Penguburan mayat Serdadu Belanda dianggap gerakan Militer.” Pembredelan ketiga tanggal 19 Agustus 1948 karena membuat berita “Berikan perkebunan kepada orang Indonesia asal laba tetap terjamin.” Pembredelan keempat, berhubung Belanda melancarkan agresinya yang ke dua selain Waspada juga dibredel harian “Mimbar Umum”. Pimpinan Arif Lubis dan majalah “Waktu” pimpinan Zahari. Sedangkan pembredelan kelima karena harian Waspada memblack-out berita-berita “Konverensi Sumatera” yang diprakarasi oleh Negara Sumatera Timur. Pembredelan itu dilakukan tanggal 2 April 1949 selama satu bulan. Sebagai seorang jurnalis di masa awal kemerdekaan Mohd. Said berkesempatan melakukan peninjauan dan melakukan kampanye kemerdekaan ke daerah-daerah di Sumatera dan di pulau Jawa. Sebagai kesimpulan dari peninjauauan itu Mohd. Said mengatakan, dalam masa perjuangan kemerdekaan 50 persen alat revolusi perjuangan adalah pers. Karena itu alat tersebut harus dibagi tiga yaitu“peluru”,“diplomasi” dan“pers”. Penulis adalah Veteran Pejuang Kemerdekaan, Wartawan Senior, Pemerhati Sejarah.

Pengkrimpingan Parpol (Positif) Oleh Sofyan Harahap Pro dan kontra selalu terjadi,itu hal biasa,apalagi dalam panggung politik. Putusan KPU mengerimping parpol hingga tinggal 10 saja merupakan kemajuan dan positif bagi perkembangan dan pembelajaran demokrasi

K

ita beri apresiasi buat Komisi Pemilihan Umum (KPU) karena kukuh pada pendiriannya, menetapkan hanya 10 partai politik saya yang lolos menjadi peserta pemilihan umum dan bakal menjadi perahunya para Capres 2014. Mudah-mudahanke-10parpolbenarbenar menjalankan fungsinya untuk kepentingan masyarakat, bangsa dan negara sehingga cita-cita mewujudkan keadilan bagi seluruh rakyat bisa terlihat lebih signifikan. Mampu mengangkat citra parpol yang terpuruk selama ini terkaitnya banyaknya kasus korupsi yang melibatkan orang-orang terhormat di legislatif. Saat ini, walau bangsa ini sudah merdeka selama 67 tahun, namun yang namanya keadilan dan kemakmuran itu hanya milik sebagian orang saja. Yang mampu dekat dengan elite politik dan kekuasaan di eksekutif, legislatif dan judikatif. Merekalah yang merdeka menikmati kekayaan negara. Hidupnya semakin kaya, melimpah ruah berkat hasil KKN, sementara mayoritas rakyat hidup sulit, belum mampu keluar dari lembah kemiskinan absolut. KitamenyadaritidakmudahbagiKPU memutuskan hanya 10 partai yang lolos seleksi. Artinya, terdapat 24 parpol yang tidaklolosverifikasimenjadipesertaPemilu 2014 dengan beragam kekurangannya. Ada yang jauh dari lengkap, ada yang lumayan lengkap, dan ada juga parpol yang hanya memiliki kekurangan sedikit. Andai saja pengurusnya lebih selektif, tidak anggap enteng, rasanya mereka layak lolos verifikasi, seperti Partai Bulan Bintang, Partai Demokrasi Pembaharuan, Partai Kedaulatan Bangsa Indonesia Baru dan Partai Damai Sejahtera. Berdasarkan UU Pemilu Pasal 8 ayat (2) UU Nomor 8/2012 partai politik harus memenuhi sembilan persyaratan administrasi,sepertiberbadanhukum,memiliki pengurus di 100 persen provinsi, 75 persen kabupaten/kota, dan 50 persen kecamatan, memiliki anggota 1.000 atau 1/1.000 jumlahpendudukkabupaten/kota.Inijelas tidak mudah sehingga memerlukan keseriusan dari pengurus parpol lama maupun baru. Kalau semangat juangnya rendahdapatdipastikantidakmampumemenuhi persyaratan yang diminta KPU dan itu terbukti. Apalagi KPU sekarang jauh

lebih tegas dan berani mengambil risiko meskipun bakal digugat lewat Bawaslu maupun PTUN. Positif Sebenarnya kita melihat adanya niat baik dan upaya mencerdaskan bangsa lewat penguatan peran parpol ini. Penjelasan UU Nomor 8/2012 dimaksudkan agar semua partai serius dan berkualitas, sehingga kita bisa bilang selamat tinggal tinggalerapartaiabal-abalyangikutpemilu tapi ujung-ujungnya memalukan masyarakat, mencederai demokrasi. Rakyat hanya dijadikan korban pembodohan. Pengalaman pemilu lalu, siapa saja bisa dijadikan caleg dan pengurus parpol asalkan bersedia membayar. Banyak yang tergiur,mencoba peruntungan, tapi umumnya gagal. Artinya, masyarakat sudahsemakincerdasdalammemilihparpol dan kualitas calegnya. Sama halnya ketika reformasi lalu, pers memperoleh kebebasan. Siapa saja bisa membuat koran, bisa menyandang pemred, redaktur, wartawan,namundengansemakincerdasnya masyarakat, orang-orang yang mendompleng kebebasan pers semakin terpinggirkan, tidak laku lagi di pasar. Justruitu,momentumpengkrimpingan parpol yang sudah dimulai KPU kemarin hendaknya disahuti masyarakat dengan cerdas pula dengan selektif memilih memilih anggota dewan di pusat dan daerahnyasehinggakualitasDPR/DPRDmeningkat. Tidak seperti selama ini DPR/ DPRD dianggap bagaikan sarang korupsi karena diisi banyak politikus busuk. Upaya mencerdaskan bangsa lewat pengkrimpingan parpol sudah menampakkanwujudnyadenganhanya10parpol sajayanglolosbertarungpadaPemilu2014. Selama Pemilu di Indonesia sudah terlalu lama kita mengenal sistem multipartai. Hasilnya gonjang-ganjing politik. Kemudian dikerucutkan di masa Orde Baru dengan terbentuknya tiga partai: PDI dan PPP plus Golkar. Hasilnya juga mengecewakan karena dominasi Golkar. Masa Reformasi berubah lagi multipartai. Sempat48partai,kemudianberkurang24partai (2004), tapi membengkak lagi 39 partai (2009). Hasilnya kembali terjadi kekambuhanpolitikmodelsandera-menyandera. Tampaknyaseleksialamiahbakalterjadi sehingga momentum pemilu 2014 akan

memperlihatkan pada masyarakat mana parpol yang masih dicintai rakyat dan parpol yang mengabaikan aspirasi rakyatnya. Jika proses rekrutmen dilakukan selektif, para kader dibina dengan baik parpol itu bakal memenangkan Pemilu. Tapi, tidak seperti model Demokrat yang terkesan hanya bersandar pada sosok Susilo Bambang Yudhoyono (SBY). Persaingan seru Dengan putusan KPU hanya meloloskan 10 parpol saja maka persaingan antarparpol semakin seru pada Pemilu dan Pilpres 2014. Semua parpol lama yang lolos dan satu parpol baru (Nasdem) harus berpacumembuatstrategimenghadapiPemilu yang tak sampai dua tahun lagi. Jikamerekagagalmendapatkanwakilwakilrakyatyangberkualitasakanberdampak besar pada perolehan partai. Sebab, masih ada seleksi berikutnya, yakni dalam pemilu nanti masih akan terjadi proses penyederhanaanlagimelaluijumlahketerwakilan sebuah parpol di parlemen yang disebut sebagai parliamentary threshold. Bagi parpol yang tidak memenuhi 3,5 persen suara secara nasional, maka ia tidak akan memiliki kursi di parlemen. Partai ini bagaikan kerakap tumbuh di batu, mati segan hidup pun tak mau. Pada akhirnya bakallenyapsebagaiparpolpesertapemilu, seperti PBB, PDS dll. Kini pilihan tinggal dua bagi ke-24 parpol yang gagal lolos verifikasi. Walau masih mungkin berjuang lewat jalur hukum.Pertama,bertahansebagaicikalbakal parpol untuk pemilu berikutnya (2019) dengan mengubah kegiatan sebagai organisasikemasyarakat(ormas)ataupilihan kedua menggabungkan diri, membaur dengan parpol yang lolos dengan posisi tawar rendah. Opsi pertama sangat berat karena diperlukan dedikasi dan loyalitas tinggi plus dana tidak kecil untuk tetap bisa eksis selama lima tahun di tengah-tengah masyarakat, jika memilih menjadi ormas. Lebihberatlagikarenamerekayangduduk di dalam mayoritas ingin menjadi politisi, bukansebagaipekerjasosialkemasyarakatan, sehingga bakalan banyak kader yang mundur setelah mengetahui partainya tak lolos sebagai peserta pemilu. Opsi kedua sangat mungkin walau posisi tawar rendah, kecuali bagi tokohtokoh yang sudah punya pengalaman dan nama di masyarakat. Hampir pasti mereka akan membaur ke 10 Parpol. Bagi orang politik segalanya bisa berubah, gagal di satu partai bisa melompat ke parpol lainnya.Yangpentingkeinginandantujuannya tercapai. Penutup Pro dan kontra selalu terjadi, itu hal

biasa, apalagi dalam panggung politik. Putusan KPU mengerimping parpol hingga tinggal 10 saja merupakan kemajuan dan positif bagi perkembangan dan pembelajaran demokrasidandiyakiniberdampak positif pula bagi kemajuan bangsa dan negara tercinta. Sudah saatnya kita beralih dari sistem multipartaikesedikitpartaitapiberkualitas, sepertidiAmerikaSerikat.Hanyaduapartai yangmengendalikannegerasebesarAmerika, yaitu Demokrat dan Republik. Idealnya Indonesia pun seperti itu, tapi pasti membutuhkan waktu panjang menuju ke sana. Dengan 10 partai jauh lebih efektif dan efisien. Jadi, langkah pengkrimpingan parpol harus dilihat dari sisi positifnya yang jauh lebih besar, bukan dari sisi subjektibnya seakan untuk membungkam suara rakyat.Iniyangperludisosialisasikanpasca putusan KPU yang tergolong spektakuler itu.*** Penulis adalah Wapenjab Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun. Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * 11 Januari 2013 Harian Waspada 66 tahun - Makin berminyak awak! * Pilgubsu, Golkar siap menang, siap kalah - Iyalah, kalau tak menang ya kalah * Masyarakat Sergai siap menangkan Amri-RE - Bikin kepala berdenyut saja, he...he...he

oel

D Wak

WASPADA Jumat 11 Januari 2013

Dirgahayu

WASPADA

AKBP Muhajir, S.Ik, MM

‘Waspada Perlu Selamatkan Umat’ SAJIAN demi sajian dalam menginformasikan berbagai peristiwa di lapangan dinilai telah sesuai. Singkat, padat, jelas dan akurat merupakan ruhnya Harian Waspada. Alhasil, pembaca tidak pernah bosan dan lebih cepat memahami isi kandungan pemberitaannya. Demikian antara lain disampaikan AKBP Muhajir, S.Ik, MM (foto) selaku Kapolres Aceh Timur dalam sebuah kesem-patan menyahuti Dirgahayu Harian Waspada Ke-66 bertepatan dengan 11 Januari 1947 - 11 Januari 2013. Menurutnya, Harian Waspada yang sudah sangat dewasa ini perlu memperbanyak informasi berbagai sosialisasi dengan tujuan menyelamatkan umat, khususnya generasi muda yang sangat rentan dengan berbagai pengaruh dari luar. AKBP Muhajir menilai, informasi yang disajikan terkait dengan sosialisasi antara lain pencegahan narkoba dan bahayanya dan sosialisasi keamanan dan ketertiban masyarakat (Kamtibmas), sehingga kedamaian dan persatuan umat tetap terjaga. “Artinya, dalam setiap pemberitaan itu lebih banyak sajian mengajak ataupun menerangkan berbagai bahaya dan efek kedepan dari narkoba itu sendiri, sehingga masyarakat bisa menjauhkan narkoba dengan kesadaran tanpa paksaan,” katanya seraya mengucapkan Dirgahayu Harian Waspada Ke 66, semoga Waspada tetap jaya dan terus memikat dihati pembacanya. � Muhammad H. Ishak

Waspada Koran Perjuangan

Tak Lekang Dipanas Tak Lapuk Dihujan KELAHIRAN Waspada di masa revolusi agresi Belanda 1947-1948 telah memberi andil besar dalam perjuangan memper-tahankan bangsa dan negara dari rongrongan penjajah Belanda Peranan pers sejak masa perjuangan cukup penting dan menentukan bahkan pena pers lebih tajam dari peluru. Demikian Ketua DPRK Bireuen Ridwan Muhammad,SE (foto) dalam memberikan komentarnya menyambut peringatan Hari Ulang Tahun ke-66 Waspada 11 Januari 2013. Dikatakan, koran yang dilahirkan oleh pendirinya dua tokoh pers pejuang H Mohd Said dan Hj Ani Idrus dalam kancah desingan peluru sangat pantas disebut sebagai koran perjuangan. Memasuki usinya 66 tahun telah melalui berbagai suka duka. Diantara suka duka yang dialami Waspada, pernah dibredel Belanda dilarang terbit lantaran menyajikan berita perjuangan membakar semangat perjuangan rakyat yang semakin menyudutkan Belanda. Pembredelan itu tidak mematahkan semangat tokoh pers pejuang H Mohd Said dan Hj Ani Idrus (suami istri) bersama beberapa pers lainnya secara sembunyi-sembunyi sekalipun terus menerbitkan Waspada beredar ditengah-tengah masyarakat meski dalam kondisi genting sekalipun. Berbagai suka duka hingga memasuki usinya 66 tahun telah dilalui dengan semangat pantang menyerah, “Waspada tak lekang dipanas dan tak lapuk dihujan” sangat perlu diwarisi oleh generasi penerusnya. Sejarah telah membuktikan dimasa perjuangan pers sangat memegang peranan penting dalam mempertahankan Republik Indonesia dari rongrongan penjajah. Di masa sekarang ini pers sangat memegang peranan penting dalam menunjang pembangunan di berbagai bidang. Konon lagi saat ini Waspada mengemban misi Syariat Road To Dakwah (RTD) ke beberapa Kabupaten/kota di Sumut dan Aceh merupakan misi yang sangat mulia untuk menegakkan Syariat Islam sangat menyentuh bagi ummat Islam umumnya terutama di Aceh sebagai daerah Syariat Islam. Bagi masyarakat Aceh sejak zaman dulu sampai sekarang sangat fanatic sebagai pembaca setia Waspada. Bagi saya Waspada sudah jadi sarapan pagi membaca berita-berita di halaman Aceh. Ke depan disarankan, halaman Aceh Waspada sebaiknya ditambah agar beritaberita dari Aceh dapat disajikan secara maksimal. (b12)

Semoga WASPADA tetap jaya dan terus berpihak membela Kebenaran demi Keadilan. Dari:

DPD I HISWANA MIGAS SUMBAGUT RAJA P. SIRAIT Ketua

ERI RANGKUTI Sekretaris

C5

Dirgahayu

C6

Ketua KNPI: Iskandar Usman Al Farlaky, S.Hi

‘Bersama Majukan Pemuda’ TIDAK hanya kalangan santri, ulama dan para politisi serta para tokoh yang menyahuti serta mengapresiasi seraya memberikan saran, namun kalangan pemuda juga ikut menyumbangkan buah pikirannya demi kemajuan Media Nasional Harian Waspada di Hari Ulang Tahun (HUT) Ke 66 bertepatan 11 Januari 2013. “Harian Waspada tidak hanya media yang ditunggu para pejabat negeri ini, tapi Waspada juga diidamkan masyarakat kecil dan kalangan kepemudaan, sebab selama ini Waspada telah mampu mempertahankan diri dengan memberitakan keluh kesah kaum duafa dan kalangan yang membutuhkan pertolongan,” sebut Ketua Komite Nasional Pemuda Nasional (KNPI) Aceh Timur, Iskandar Usman Al Farlaky, S.Hi. Iskandar (foto) mengatakan, dari penyajian dan penampilan Waspada dianggap sudah sangat maksimal. Sesuai dengan misi dan visinya Demi Kebenaran dan Keadilan Waspada dinilai sudah baik dalam menginformasikan ke publik sebagai kontrol sosial. Tetap disisi lain dia mengharapkan Waspada bisa menambah halaman menjadi 6 sampai 8 halaman setap hari, tetapi tidak juga mengurangi halaman lain. Da berharap, Waspada bisa terus berkarya untuk bangsa dengan tetap mengedepan indepedensi media sebagaimana tercantum dalam UU Pers. Pasalnya, rakyat masih menantikan karya-karya para jurnalistik yang lebih besar di masa yang akan datang, khususnya di Harian Waspada. “Dirgahayu Waspada Ke 66, semoga Waspada tetap jaya dan terus terdepan di nusantara. � Muhammad H. Ishak

Nek Pon: Pembaca Setia SejakTahun 1975

‘Media Terlengkap’

TIDAK terbayang sebelumnya, ternyata Tgk Saiful Anwar yang akrap disapa Nek Pon di Gampong Baro Idi Cut, Kab. Aceh Timur ternyata sudah berlangganan dengan Waspada sejak tahun 1975. Kala itu, Nek Pon mengaku tertarik membaca harian pagi itu ketika bekerja di Medan, Sumatera Utara. Saiful Anwar yang lahir di Idi Cut 8 Januari 1951 telah membaca Harian Waspada genap 37 tahun lamanya. Usia yang kini sudah mencapai 62 tahun itu dan berulang tahun bertepatan 8 Januari 2013 (Selasa—kemarin) saat ditemui Muhammad H. Ishak (Wartawan Waspada) mengaku sama sekali belum bosan membaca Harian Waspada, karena menurutnya Harian Waspada adalah media nasional yang lengkap dalam penyajian berita dan sama sekali tidak membosankan saat dibaca. “Sajian pemberitaan yang lengkap dan tepat serta berimbang menjadi hal saya tertarik dengan Waspada, bahkan setelah lama di Medan dan kembali ke Aceh tahun 1982 tetap berlangganan dengan Waspada yang agen tunggalnya di kawasan Idi yakni di Toko Dona Salima. Dan sekarang sudah berlangganan dengan Agency IDA di Idi Cut,” papar Nek Pon. Dia juga mengaku sangat memikat dengan sejumlah berita keagamaan. Ketiadaan gambar yang sadis dan selalu memuat berita yang menyejukkan Aceh menjadi salah satu nilai Harian Waspada sangat menghargai dan menginginkan Aceh tetap damai. “Saya membaca Waspada habis seluruhnya, mulai halaman depan dan selanjutnya ke olahraga dan kemudian membaca berita di halaman Aceh dan seterusnya hingga habis seluruhnya,” kata Nek Pon seraya mengucapkan Dirgahayu Waspada Ke 66 tahun bertepatan dengan 11 Januari 22013, semoga tetap jaya dan semakin dewasa. � Muhammad H. Ishak

Sejak Kelas V SD Hingga Jadi PengacaraTetap Baca Waspada “HASANSYAH...udah baca waspada belum hari ini. Kalau belum, korannya ada di kios, ambil saja.” KALIMAT itu diucapkan oleh pemilik kios Abadi di Matangkuli, Aceh Utara. Itu terjadi saat T. Hasansyah masih duduk dibangku kelas V Sekolah Dasar (SD) pada tahun 1979. Pemilik kios Abadi sengaja memanggil Hasansyah karena setiap pulang sekolah pelajar kelas V SD itu selalu menyempatkan dirinya untuk mencari berbagai informasi baik di dalam maupun di luar negeri surat kabar Waspada. Pada waktu itu, kata Hasansyah, dia paling doyan membaca cerita pandek dan olah raga. Lama kelamaan Hasanyah semakin menyukai semua tulisan yang ada di koran ini. Seiring bertambahnya usia, Hasanyah terus mengikuti berbagai informasi politik luar negeri, dan kini kata Hasanyah paling doyan mengikuti tulisan-tulisan yang ada di rubrik opini. Pasalnya, tulisan-tulisan opini yang disajikan Waspada sangat ilmiah, karena ditulis oleh orang-orang yang profesional yang berasal dari Universitas Sumatera Utara (USU). Dengan membaca tulisan opini di Waspada telah menambah ilmu pengetahuan saya, apa lagi jika membaca rubrik mimbar jum’at. Tulisan-tulisan di rubrik tersebut telah membuat pemahaman ilmu agamanya makin bertambah. Karena sajian informasi yang cukup akurat, membuat Waspada menjadi koran yang merakyat, apa lagi Waspada merupakan koran lokal yang menasional. Sekarang ini Waspada telah berusia mencapai 66 tahun. Usia tersebut sudah cukup tua. Kalau manusia telah memiliki cicit. Dengan usia yang sudah sangat tua, kata Hasansyah, tentunya Waspada sangat piawai dalam menyajikan informasi yang dibutuhkan rakyat. Karena itu, Waspada menjadi pedoman bagi masyarakat. Tentunya, hal itu terjadi karena Sumber Daya Manusia (SDM) yang dimiliki Waspada terampil dan profesional. “Dari SD sampai jadi pengacara saya tetap membaca Waspada. Satu hari tidak membaca Waspada, rasanya belum lengkap, meskipun saya sudah mendapat informasi dari berbagai media cetak lainnya,” kata pengacara yang juga ayah dari tiga putra dan putri itu. Agar Waspada semakin erat hubungannya dengan masyarakat Aceh, sebaiknya Waspada memberikan porsi halaman yang lebih banyak lagi. Perlu diketehui kata pria 43 tahun itu, dulu Waspada baru dapat dibaca setelah diterbitkan dua hari, karena Waspada baru sampai di Aceh setelah dua hari dicetak karena transportasi yang masuk ke Aceh sangat sulit akibat jalan yang rusak parah. Tapi sekarang, Waspada sudah dapat dibaca di Aceh setelah shalat subuh. “Banyak pecinta setia Waspada yang terus menunggu sajian berita hangat Waspada,” katanya. (Maimun Asnawi).

WASPADA

WASPADA Jumat 11 Januari 2013

Dirgahayu

WASPADA Jumat 11 Januari 2013

Keluarga Besar

Madrasah Aliyah Negeri 2 Model Medan Mengucapkan:

Semoga WASPADA semakin jaya dan tetap eksis dalam mengemban misinya. Dari:

Drs. H. Amarullah, SH, MPd Kepala MAN 2 Model Medan

Drs H Abd Rahim, M.Hum

Semoga Tetap Jadi Pilihan

MEDAN (Waspada) : Kepala Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara, Drs H Abd Rahim M.Hum mengharapkan Harian Waspada di HUT nya ke 66 ini tetap jadi pilihan masyarakat di Sumatera Utara khususnya dan Indonesia pada umumnya. Hal ini dikatakannya, Rabu (9/1) saat dimintai pendapatnya tentang HUT Harian Waspada. “Sebagai masyarakat Sumatera Utara, tentu saja saya merasa bangga dengan Harian Waspada yang sudah memberikan kontribusi positif kepada masyarakat dengan pemberitaan tentang pendidikan, politik, ekonomi, agama dan berita lainnya yang memberikan pencerahan kepada masyarakat. “Saya mengucapkan selamat HUT Waspada ke 66, semoga tetap menjadi koran pilihan masyarakat dan tetap setia memberitakan agama Islam sehingga mampu memberikan pencerahan kepada masyarakat dalam rangka meningkatkan wawasan ilmu agamanya. Saya berharap dengan kesungguhan Waspada memberikan ruang pemberitaan keagamaan menjadi ciri khas tersendiri sebagai koran pilihan ummat. Selain itu sesuai mottonya demi kebenaran dan keadilan,diharapkan mampu membela kepentingan rakyat”ujar Abd Rahim. (m37)

H Iwan Zulhami, SH, MAP

Semoga Tetap Eksis MEDAN (Waspada) : Kepala Kantor Kementerian Agama Kota Medan, H Iwan Zulhami SH,MAP memberikan dukungan penuh kepada Harian Waspada yang kini berusia 66 tahun. “Saya menilai Harian Waspada masih eksis di tengah masyarakat dan menjadi koran yang dibaca berbagai kalangan,”kata Iwan Zulhami di kantornya Jalan Sei Batugingging Kamis (10/1). Dia yakin, sebagai koran yang mempunyai motto demi kebenaran dan keadilan, Harian Waspada akan mampu meraih simpati kalangan pembaca setiap generasi. “Harian Waspada dibaca secara estafet. Dari orang tua, anak sampai cucu, karena itu saya yakin akan keberadannya sepanjang masa dan diharapkan tetap eksis di tengah derasnya kehadiran koran baru,”kata Iwan. Dia berharap, Waspada akan tetap menjadi bacaan yang dinantikan pembaca dan tetap jaya pada masa akan datang. Selain itu, pemenuhan pemberitaan agama di dalamnya hendaknya dapat menjadi refrensi bagi pembaca untuk menambah wawasan dan pengetahuan. “Inilah kelebihan Harian Waspada yang memberikan ruang pada pemberitaan keagamaan secara khusus dan menerbitkan nama khatib untuk shalat jumat sehingga memudahkan jamaah untuk mengetahui siapa imam dan khatib saat mereka akan shalat jumat,”ujarnya. (m37)

WASPADA

C7

C8

Dirgahayu

WASPADA

WASPADA Jumat 11 Januari 2013

Waspada/Muhammad H. Ishak

LOPER: H Jamaluddin, 73, loper koran Harian Waspada membaca Harian Waspada sambil menunggu pelanggan di tokonya di Kota Idi, Aceh Timur, Rabu (9/1).

H Jamaluddin, Loper Waspada Terlama Di Aceh

PAGI-pagi Tgk H Jamaluddin sibuk di tokonya—Dona Salima—di Kota Idi, Kabupaten Aceh Timur. Pensiunan guru ini mengaku sudah menjadi loper (agen—red) koran Harian Waspada sejak tahun 1975. Pada tahun 1980-an dia mengaku sempat menjual 200-an eksemplar per hari. H Jamaluddin dengan sepeda dayungnya dia tetap setiap mengantar Waspada ke sejumlah pelanggannya di Kota Idi dan sekitarnya. Bahkan, di era tahun 1980-an dia pernah mengantar ke pelanggan yang berdomisi di Idi Cut dan Julok serta Peudawa—10 kilometer ke arah timur dan barat Kota Idi. “Saya asal Pidie. Gubernur Aceh dr Zaini Abdullah itu teman saya saat Sekolah Guru Agama (SGA) di Banda Aceh, tapi beliau ke SMA,” katanya. Jamaluddin yang kini masih menjadi loper koran di Kota Idi—Pusat Pemkab Aceh Timur—mengaku masih terus menjadi loper, karena Waspada tetap diincar dan dicari oleh pelanggan setianya. “Sekarang saya tidak antar lagi koran Waspada ke rumah-rumah atau kantor, karena pelanggan mencari sendiri ke toko,” paparnya seraya mengharapkan, pada HUT Waspada ke-66 bertepatan 11 Januari 2013 diharapkan Waspada tetap membela masyarakat demi kebenaran dan keadilan, sehingga tetap dicintai pembaca setianya. “Dirgahayu Waspada ke-66, Semoga Waspada tetap jaya dan terus profesional dalam penyajiian,” katanya. � Muhammad H. Ishak

SELURUH JAJARAN CAMAT SE-KABUPATEN ACEH TIMUR Mengucapkan:

Semoga WASPADA tetap jaya dan terus berpihak membela Kebenaran demi Keadilan.

Tertanda: -

Safaruddin, SH:

Waspada Harus Cetak Di Banda Aceh JUJUR saja, meskipun tibanya terlambat di Banda Aceh—pukul 10:00—namun terasa belum lengkap sebelum membaca Media Harian Waspada yang terbit setiap hari. Secara umum, para pakar hukum dan lembaga di Banda Aceh tetap mencari berbagai informasi yang disajikan Harian Waspada setiap hari. “Sebelum membaca Harian Waspada terasa belum lengkap, meski sudah beraktifitas. Sehingga walaupun siang hari tiba di Banda Aceh, saya pribadi tetap mencari Harian Waspada,” ujar Direktur Eksekutif Yayasan Advokasi Rakyat Aceh (YARA) Safaruddin, SH (foto). Menurut pakar hukum asal Aceh Timur, Harian Pagi Nasional Waspada harus cetak jarak jauh yaitu di Kantor Perwakilan Aceh di Banda Aceh. Safaruddin yang juga Ketua Tim Pengacara Muslim (TPM) Aceh, Harian Waspada sudah menjiwai di masyarakat Aceh, termasuk para tokoh dan aparatur pemerintahan. Sebab Harian Waspada memiliki sejarah khusus dengan Aceh, termasuk Buku Aceh Sepanjang Abad yang dikarang oleh Mohammad Said— Pendiri Harian Waspada—juga memiliki kharisma tersendiri dengan tokoh masyarakat Aceh serta pejabat tinggi di Banda Aceh pada saat itu, sehingga masyarakat tetap berlangganan dengan Waspada, baik di Ibukota Provinsi Aceh ataupun di kabupaten/kota. “Untuk bisa tetap dijadikan No 1 di masyarakat Aceh, maka harapan kita Waspada bisa cetak jarak jauh yakni di Banda Aceh, sehingga Harian Waspada bisa masuk pagi pantai barat dan selatan (Meulaboh dan Takengen),” sebut Safaruddin seraya menandaskan, apresiasi yang tinggi terhadap Waspada yang terus menyajikan berita-berita membela kaum lemah khususnya di Aceh seperti pemberitaan masyarakat yang butuh bantuan kesehatan. Safaruddin yang sibuk dengan segala aktifitas di Banda Aceh dan di daerah-daerah mengaku tiap hari membaca Harian Waspada. Bahkan, untuk mengetahui lebih cepat informasi yang disajikan Waspada, Safaruddin mengatakan lebih dahulu membuka di situs e-paper melalui internet atau meminta perwakilan lembaganya di daerah. “Usia Harian Waspada sudah mencapai 66 tahun bertepatan dengan 11 Januari 2013 nanti diharapkan Waspada semakin dewasa, sehingga Waspada tetap terdepan di hati pembacanya. � Muhammad H. Ishak

Sekum RASSA : Tgk. HM Iqbal Hanafiah, B.Th, MA

Sajian Waspada Singkat Dan Padat’ PEMBERITAAN dan sajian informasi di Harian Waspada dinilai lebih cepat dan data yang ada didalamnya juga akurat dengan tidak mengabaikan keseimbangan dalam sebuah tulisan. Sehingga semua kalangan termasuk para santri di dayahdayah ketagihan ketika membaca berita Waspada. “Berita di Harian Waspada lebih singkat, tapi padat dan akurat serta dapat dipercaya, sehingga profesionalitas sebuah perusahaan besar seperti Harian Waspada tetap terjaga,” kata Sekretaris Umum Rabithah Silaturrahmi Santri se Aceh (RASSA), Tgk H Muhammad Iqbal Hanafiah, B.Th, MA (foto) kepada Waspada Rabu (9/1). Kendati halaman yang banyak, kata Iqbal Hanafiah, namun halaman demi halaman menampilkan rubrik masing-masing yang semuanya adalah disajikan dengan cepat sebagaimana perkembangan zaman dan datanya begitu akurat, sehingga perkembangan di luar Aceh juga bisa diketahui oleh masyarakat Aceh, termasuk memuat kegiatan para siswa atau santri di dayah terpadu di luar Aceh seperti Al Azhar. “Akuratnya data membuat kita yang membaca mengetahui informasi yang sempurna. Itu semua terjadi tidak terlepas dari profesionalitas wartawan yang tersebar di seluruh Aceh,” katanya sembari menandaskan, baginya Waspada adalah salah satu media nasional yang cepat dalam penyajian berita dilengkapi datanya yang akurat. “Kita harap, seiring usianya sudah 66 tahun bertepatan 11 Januari 2013, Harian Waspada tetap jaya dan semakin dicintai umat. � Muhammad H. Ishak

Drs. Zulbahri, M.AP (Camat Ranto Peureulak). Rusamin, SE (Camat Madat). Iswandi, S.Sos (Camat Pante Bidari). Lukman, SP (Camat Simpang Ulim). Adami BA (Camat Indra Makmur). Zainuddin, S.Sos.I (Camat Nurussalam). M Nasir, SP (Camat Darul Aman). Zulkhaidir, SH (Camat Idi Rayeuk). Sulaiman, S.Ag (Camat Idi Tunong). Drs. Hamdani (Camat Banda Alam). Saiful Anwar, SE (Camat Darul Ihsan). Drs. Mukhtaruddin (Camat Idi Timur).

-

Drs. Tarmizi (Camat Darul Falah). Usman, S.IP (Camat Peudawa). Drs. Ahmad (Camat Simpang Jernih). Drs. Faisal (Camat Peureulak Kota). Jaman, S.Pd (Camat Peunarun). Kamaruddin, S.Pd (Camat Serbajadi). Drs. M. Yasin (Camat Peureulak Timur). Drs. Idris (Camat Sungai Raya). Abdul Aziz, SE (Camat Ranto Selamat). Murdani, S.STP, M.AP (Camat Birem Bayeun). Zainuddin, SE (Camat Julok). Nadhif, S.STP, M.AP (Camat Peureulak Barat).

SELURUH JAJARAN KANTOR KEMENTERIAN AGAMA (KEMENAG) KABUPATEN ACEH TIMUR

PERSATUAN GURU REPUBLIK INDONESIA (PGRI) KABUPATEN ACEH TIMUR

Mengucapkan:

Mengucapkan:

Semoga WASPADA tetap jaya dan terus membela Kebenaran dan Keadilan demi Bangsa dan Agama.

Tertanda

DRS. TGK. H. FAISAL HASAN KEPALA

SELURUH JAJARAN

Semoga WASPADAtetap jaya dan terus membela dunia pendidikan dalam mencerdaskan anak bangsa sebagai calon pemimpin masa mendatang dan menjadi guru yang profesional di seluruh Indonesia, khusunya Aceh Timur. Tertanda

H. AGUSSALIM, SH, MH KETUA PGRI

WASPADA Jumat 11 Januari 2013

Daftar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Matsum II Ar-Rahim Ranting Halat Kota Matsum Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Mukhlishin Jl. Sutrisno Gg. Sehati No. 8 Al-Manar Jl. Laksana No. 47 Al-Makmur Gg. Langgar/Bahagia No. 25 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Hidayatul Islamiyah Jl. Gajah No. 39 Istiqlal Jl. Halat No. 36 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Khalid Ibnul Walid Jl. Rahmadsyah No. 366 Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Gedung Arca No. 3 Muslimin Jl. Dr. Sun Yat Sen No. 71 Nurul Huda Jl. Denai Gg. Pinang No. 12 Tegal Sari-I Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Syekh Hasan Maksum Jl. Puri Gg. Madrasah No. 181 Silaturrahim Jl. Emas No. 10 Taqwa Jl. Bromo Gg. Aman No. 23 Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. A.R. Hakim Gg. Langgar No.8-A. Tegal Sari III Taqwa Lalang Jl. Gedung Arca Gg. Sehat No. 8

Mhd. Khawari Sutikno Drs. H. Abdullah Sani Sinaga Zulkifli Drs. H. Syahruddin Nasri Hsb. Drs. H.M. Hafiz Ismail H. Ali Amran Zakaria, Lc Drs. H. Azhar Rozak Lubis Muhammad Imran, S.Ag Dr. H.M. Roihan Nasution, MA Drs. Syahfrizal, S.Pd.I H. Abd. Latief Khan, S.Ag Ahmad Syafi’i Harahap, S.Ag H.M. Dien Angkasah, Lc H. Nurdin Muhammad, BA Burhanuddin, SE Drs. H. Kemal Fauzi Drs. H. Muniruddin, M.Ag Drs. Ahmad Azizi Syahril Basyrah, S.HI, S.Pd.I Drs. Ali Batubara Drs. Suramin Hadi Drs. H. Ulumuddin Siraj Drs. H. Sokon Saragih, MA Drs. Tanwir Siagian Rafdinal, S.Sos, M.AP Drs. H. Masyaluddin Chan Prof. DR. Nawir Yuslem, MA

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Harjosari II Al-Hidayah Mapolda Sumut Jl.S.M.Raja Km.10,5 No.60 Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Hikmah Jl. Garu II |B Kel. Harjosari I Al-Muslimin Jl. Pangilar No. 35-A Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Jami’Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Jamik Jl. Panglima Denai No. 23 Kampus UNIVA Jl. S.M. Raja No. 10 Kompl. UNIVA Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Nurul Tuvail Khatijah Jl. Garu IV No. 140 Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Bali Ramadhan Jl. Garu VI Kel. Harjosari I Salman Jl. STM Kel. Sitirejo II Taqwa Jl. S.M. Raja Gg. Pulau Harahapan No. 1-B

Drs. Adam Sakiman DR. H. Azhari AkmalTarigan, MA Anwar Saleh, S.Pd.I Drs. H. Syahroni Husin H. Ismail Nasution Mu’ammar Lubis, S.Pd.I Badrin Rizaldi, S.Pd.I M. Ismail Budiman SQ, S.Pd.I Rahmat Hidayat, MA Drs. H. Usman Suhair M. Tholib Harahap, S.Ag, MA H. Abudurrahim, SH Drs. Pangeran Harahap, MA Mex Jenis Chan Drs. Saifuddin, SH Drs. H. Abd. Halim Ibrahim, SH, MH Gunawan, MA

MEDAN BARU Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Al-Ikhlas Jl. Sei Padang No. 129 Muslimin Jl. Sei Batang Serangan No. 93 Nurul Muslimin Jl. DR. Pardede No. 42

Muhammad Rahim, S.Ag Asmuri Lubis M. Nasir, S.Pd.I Muhyidin Nasution Drs. Anshari Ahmad

MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 19 Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Musaabiqiin Jl. Kapten Maulana Lubis Al-Massawa Jl. Temenggung (Arab) No. 2-4-6 Baitusy Syifa Jl. Putri Hijau No. 15 Jami’ Jl. Merdeka No. 3 P. Brayan Kota Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan Maraset Jl. Sei Deli No. 139 Kel. Silalas Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6 Syuhada Jl. Danau Toba No. 2 Kel. Sei Agul

Febry Lesmana Rajudin Sagala, S.Kom DR. H. Amar Adli, MA Drs. Mulkan Daulay Prof. Dr. Asmuni, MA Drs. Abdul Majid Drs. H. Akhiruddin Muhid Rahmad Lubis, S.Sos.I Drs. Irwansyah, MA Drs. Mukhsin Yahya

MEDAN BELAWAN As-Sa’adah Kel. Belawan Bahagia Taqwa Jl. Veteran Belawan Raya Taqwa Belawan

Ismail Harun, S.HI Drs. Burhanuddin, M.Ag DR. Amiur Nuruddin, MA

MEDAN DELI Amaliyah Jl. Pancing Pasar IV Amalyatul Huda Jl. Nusa Indah No. 22-A Kel. Tg. Mulia Ar-Rahim Jl. Simpang Tanjung No. 1-A Abu Qosyim Jl. Mangaan VIII Lingk. I Mabar Hilir Al-Amin Jl. R.P. Hewan Lingk. III Kel. Mabar Hilir Al-Bakakuda Jl. Alumunium Raya Tg. Mulia Al-Ikhlas Jl. Alumunium III Lingk. XII Kel. Tg. Mulia Al-Munawwarah Jl. Pulau Batam No. 1 Al-Syarifah Jl. Metal Gg. Rukun No. 06 Lingk. XVIII Darussalam Jl. Suasa Selatan Lingk.IX Kel. Mabar Hilir Jamik Jl. K.L. Yos Sudarso Km. 6,2 Tg. Mulia Jam’iyyatush Shoolihiin Kel. Tg. Mulia Nurul Iman Lingk. 27 Tg. Mulia Nurul Ikhsan Jl. Mangaan I Lingk. VIII Mabar

Irwanto Susilo, S.Pd Drs. Zakaria H. As’ad Marlan, M.Ag Suef Mustofa, S.Pd.I Nur Tua Tanjung, S.Ag Iqrar Anshori, S.Pd H. Darma Bakti, S.Ag K.H. Hasan Basri Edy Susanto, S.Pd.I Ristanto Drs. Muhammad Drs. H. As’ad M., M.Ag Nurhadi Saiful Bahri, MA

MEDAN DENAI Arafah Jl. Pertiwi No. 22 Kel. Binjai Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Al-Falah Jl. Rawa Ujung No. 298 Lingk. XIII Tegal Sari Al-Hidayah Jl. Bromo Gg.Masjid Al-Hidayah Kel. Binjai Al-Hasanah Perumnas Mandala Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahim Jl. Pelajar Timur Gg. Darno No. 5 Darul Ilmi Murni Jl. Terusan Dalam/Simp. Jl. Tapanuli Nurul Islam Jl. M. Nawi Harahap Nur Hidayah Jl. Datuk Kabu No.17BGg.Masjid No.11-C Nurul Hidayah Jl. Tangguk Bongkar 2 Rahmatullah Jl. Kramat Indah Gg. Trenggeno II Taqwa Jl. Jermal III No. 10 Taqwa Jl. Pancasila Gg. Masjid No.1 Kel.T.S.Mandala III Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Seksama Gg. Rela No. 10

H. Darwin Zainuddin, MA Isa Ansari, S.Pd.I Syekh H. Aspil Al-Qaadiry, Lc Drs. H. Manaon Batubara Drs. Ibrahim Arbi Drs. H. Mar’ie Batubara Drs. Muchtar Amin Indra Khoiruzzaman, S.HI, S.Pd.I Khoiruzzaman, S.HI, S.Pd.I Ibrahim Yunan, S.Pd.I Andi Syahputra H.M. Silahuddin P., S.Pd.I Drs. Usman Batubara Drs. Zulfahmi Hutasuhut Abdul Azis, S.Pd.I Drs. Asrad Efendi Samosir, MA Samidi Yasma, M.Pd. Drs. Satiman Drs. M. Zainuddin

MEDAN HELVETIA Ar-Raudhah Jl. Persatuan No. 22 Helvetia Timur As-Syarifah Jl. Pembangunan Kompl. Pondok Surya Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Al-Hasanah Jl. Setia No. 41 Tg. Gusta Al-Ikhlas Jl. Bakti Luhur No. 13 Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Al-Ikhlas Jl. Jongkong Kompl. Dolog SU Lingk.I, II, III Al-Mustaqim Jl. Kapten Muslim No. 226 Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Bahrul Ulum P4TK Jl. Setia Budi No. 75 Darussalam Jl. Asrama No. 11 Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Shilaturrahmi Jl. Perkutut Lingk. XXII Kel. Helv. Tengah Tjut Nyak Dhien Jl. Gatoat Subroto/Jl. Rasmi No. 28 Taqwa Jl. Kamboja Raya No.319 Blok 4 Perum. Helvetia Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadono Taqwa Jl. Setia No. 30 Tanjung Gusta Taqwa Jl. Kapten Sumarsono Gg. Safar Pasar II Taqwa Jl. Kapten Muslim Gg.Jawa Lr. Muhammadiyah

Drs. H. Sudarso H. Ridwan Hisda Drs. Syamsuri Abd. Halim Dalimunthe, S.Ag Drs. H. Syarifuddin Siagian Amiruddin Munthe, S.HI Ahmad Muttaqin, S.Ag M. Nasrun H.M. Nadzrul Fahkri Hamyar Drs. Maimon Elba Asril Pohan, Lc Drs. Ahmad Nasir Hakimuddin Saragih, S.Ag Adi Suryanto, S.Pd Zulfikar Ahmad Supriyadi, MA Drs. H. Budiman Drs. H. Syamsuddin Amin Nuzli Rahmendra Khairul Shaleh, S.Sos.I Drs. Suprapto

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Ar-Raudhah Kompl. Rispa I Blok V Kel. Gedung Johor Assyafi’iyah Jl. STM - Suka Tari No. 9 Kel. Suka Maju Al-Amin Jl. Eka Surya Gg.Kencana Lingk. XI Kel.Gd.J. Al-Badaar Jl. Karya Dharma No.19 Kel. Pangk. Masyhur Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Al-Huda Jl. Eka Surya Psr. V Gg. Sidodadi Ged. Johor Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Al-Hidayah Jl. Karya Jaya Kel. Gedung Johor Al-Ikhlas Jl. STM Suka Ikhlas Kel. Gedung Johor

A. Supriadi, S.Ag Ahmad Fauzi, S.Ag Drs. Khuwailid Daulay, S.Pd.I, MA Drs. Sulthoni, MA Drs. Sangkot Nasution Drs. Fahruddin Rustam Harahap, S.Pd.I Ahmad Faisal Nasution, MA Asmu’i Lubis, S.HI Alang Sidek, S.HI, MA Drs. Ngadimin Drs. H. Irfan Batubara Drs. Sariman Al-Faruqi

Al-Ikhlas Jl. Eka Suka Raya No. 18-A Kel. Ged. Johor Al-Ikhlas Jl. Karya Tani Lingk. VII Kel. Pkl. Masyhur Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Mahmudiyah Jl. Brigjen Hamid Km 6,5 Kel. T.Kuning Al-Mukhlishin Jl. Karya Sehati No. 14 Kel.Pkl. Masyhur Baitussholihin Jl. Karya Bakti No. 71 Kel. P. Masyhur Daurun Nur Jl. Suka Eka No.221 Lingk.XI Kel. S.Maju Fajar Ramadhan Perumahan Johor Indah Permai II Graha Deli Permai Jl. Sidodadi Pasar IV Kel. Gd. Johor Muslimin Jl. Karya Jaya, Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Falah Jl. Eka Rasmi No. 42 Kel. Gedung Johor Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Kel. V Kel. P. Masyhur Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Nurul Ikhwan Jl. Karya Taqwa Jl. Brigjen Zein Hamid Gg. Sado Titi Kuning

H. Arso, SH, M.Ag K.H. Khaidir Abdul Wahab, Lc, MA Drs. Zulham Effendy BB, MBA Drs. Ali Imron Sinaga Mhd. Arifin Jahari, Lc, MA M. Ghozali, S.Pd.I Drs. Jalil, S.Ag DR. H. Zamahsyari, MA Baharuddin, S.Pd Drs. H.M. Suib Saragih Drs. H.P. Simamora Prof. Dr. Ir. H. Basyarudin, MS Sugeng Wanto, MA Irwansyah, S.Ag Drs. H. Syamsuddin Hasan H. Chairuddin Efendy Harahap H. Abd. Rahim, Lc, S.Pd.I Asrul Siregar

MEDAN KOTA An-Nazhafah Jl. Rumah Sumbul No. 4 Lingk. I Al-Hidayah Jl. Saudara Kel. Sudirejo II Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Al-Ikhlas Jl. Salak No. 9 Al-Muttaqin Jl. Amaliun/Paduan Tenaga Gg. Tengah Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Jami’ Teladan Jl. Gembira No. 2 Teladan Barat Mu’allimin Jl. S.M. Raja Kp. Keluarga No. 33 Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Pahlawan Muslimin Jl. Pencak Raya Pusat Pasar Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Setia Amal Jl. Sakti Lubis Gg. Pegawai No. 87-C Taqwa Jl. Demak No. 3 Taqwa Jl. Turi Gg. Sepakat No. 5 Kel. Teladan Timur Thawalib Jl. S.M. Raja Gg. Thawalib No. 11 Yayasan Zending Islam Indonesia Jl.S.M.Raja No. 11

Drs. H. Akhdar Bunayya Drs. H. Usman Batubara Drs. Adam Amin Drs. Irwansyah Putra, MA Drs. Suid Alam Dr. H. Zulheddy, MA Drs. H. Abd. Razak Dr. Faizar Ananda Arfa, MA DR. H. Hasan Mansur, MA Drs. Dahul, MA Drs. H. Harmein Tanjung Drs. Maulana Siregar, MA Mar’i Muhammad, S.HI Drs. Ibrahim Nur, S.Pd. Dr. H. Sudirman, MA Drs. M. Yunus Daulay, MA Ilham Syah Putra, S.HI, S.Pd.I M. Ramadhan Lubis, S.HI

MEDAN LABUHAN Al-Istiqomah Blok IV Griya Martubung Kel. Besar Al-Mukarramah Kampung Besar Darat Kel. Martubung Nurul Hidayah Jl. Veteran Lr. Sukoharjo No.27-A Psr. V Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal

Drs. M. Syarif Sirait, SH, MH H. Herman Yusuf, B.Sc Drs. Fahry Halim Muhammad Syahri

MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Al-Mukhlish Jl. Bahagia No. 14 Kel. Sukaraja Al-Mujtahidin Gg. Lori Kampung Baru Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Nurul Huda Jl. Birgjen Katamso Gg. Netral Nurul Muslimin Jl. Juanda (Bundaran) Kel. Jati Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208

Junaidi Arsyad, MA Parlaungan Nasution, S.HI Juladi, S.Pd.I Ruslan Idris Batubara, S.Pd.I Syekh Abu Ismail Hariyanto, M.S. Indra Budiman, S.Pd.I Drs. Z. Arifin Gunawan, MA

MEDAN MARELAN Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Muslimin Jl. Masjid Pasar V Marelan Jami’atul Khairiyah Jl. Marelan VII Kel. Tanah 600 Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Kampung Tengah Terjun Taqwa Marelan

Drs. H. Tukiman, MA Zulkarnain Drs. Abdul Hafiz Hasibuan Drs. M. Hamim R, S.Pd.I M. Iqbal, S.Pd.I Drs. Faisal Lubis, M.Ag

MEDAN PERJUANGAN Amal Jl. Ngalengko Lr. Saudara No. 11 Ar-Ramlah Jl. Sejati No. 16 Kel. Sidorame Barat Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 03 Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Al-Huda Jl. Malaka No. 117 Al-Hidayah Jl. Pahlawan Gg. Anom No. 12 Lingk. III Al-Hikmah Jl. Malaka Gg. Saudara Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Al-Muslimin Jl. Gerilya No. 1 Al-Mukhlishin Jl. G.B. Josua No. 8 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Ikhwaniyah Jl. M. Yacub No. 3 Istiqomah Jl. Bambu Runcing/Pahlawan Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat I

Drs. Azhari Musa Purba Drs. H. Makmur Situmorang Drs. H. Effendi Rambe Drs. Musa Yahya H. Bustami H.A., S.Ag Drs. Zulfahmi Huta Suhut, M.Ag Drs. Humala Harahap Drs. Ngadimin, K.R. Drs. Abdul Kadir Jailani Iryuha Tantawi, MA Mahmuddin, M.Ag Mukhlis Muaz, S.HI Drs. H. Aswan Lubis Ir. H. Sahrul Fauzi, S.MSc Drs. Mhd. Rais, M.Pd.MSi Drs. H.M. Yamin Lubis Prof. DR. H. Hasan Bakti Nst., MA Drs. H. Ngadimin Hadikr

MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. SPT II Annas Jl. Ibus Raya/Jl. Rotan Kompleks Diskes Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Mukarram Jl. Sikambing Gg. Patimura No. 9 Al-Yasamin Jl. PWS Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Petisah Tengah Tagarrub Jl. Darussalam No. 24 Ubudiyah Jl. KebunBunga Kel. Petisah Tengah

Drs. M. Idris Ritonga, M.Pd DR. M. Jamil H. Jamaluddin Batubara, Lc Drs. Nazaruddin Hafiz Drs. H. Irwan Sulaiman Lubis M. Halim Harahap, S.Pd.I Dr. H. Ansari Yamamah, MA Drs. H. Dahron Hasibuan H. Aslam Umar, S.Ag Drs. Ibrahim Nasution Drs. DR. H. NawirYuslem, MA H. Arif Erde, MA H.M. Yusril Indra, Lc

MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Al-Hidayah Jl. Starban Kel. Polonia Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel. Sari Rejo Al-Ikhlas Jl. Sejati No. 08 Kel. Sari Rejo Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Sabilillah Komp. TNI-AU Karang Sari-I Kel. Sari Rejo Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D

H. Iman Muhdi H. Herman Syahputra Drs. H. Julnaidi Tanjung Drs. H.M. Efendi Daud Drs. H. Poniman Drs. Ishaq Ibrahim Isa Drs. Badaruddin

MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Al-Furqon Jl. Setiabudi Pasar I Tanjung Sari Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Al-Ikhlas Pasar V Tg. Sari Al-Ikhlas Pasar 7, Padang Bulan Al-Istiqomah Jl. Sei Asahan Gg. Masjid No. 3 Jami’ Jl. Pasar I Lingk. VIII Tg. Sari Muslimin Jl. Setia Budi Kel. Tg. Sari Nabawi Jl. Bunga Mawar XIV Nurussalam Jl. Bunga Cempaka Pasar III Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Nurul Iman Jl. Penerbangan No.77 Komp.Perhuungan Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. P. Bulan Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Taqwa Jl. Bunga Wijaya Kesuma Gg. Masjid No. 1 Taqwa Jl. Abdu Hakim No. 2 Pasar I Tg. Sari

Drs. H. Ansari P., M.Ag H. Muslim Maksum Yusuf, Lc Rizkil Asri, S.Pd.I H. Komaruddin, S. Khaidir, S.Ag Drs. Mahyuddin Daulay Drs. H. Arifinsyah Sugeng Raharjo, S.Pd.I Zulfahmi, S.Ag Drs. Hasanul Arifin Drs. H. Basyaruddin Dja’far H.M. Rajab A. Masweil Nst., Lc Drs. H. Ibrahim Isa Yusman Nasution, S.Ag Azizon, SH, M.Hum H.M. Yahyah Drs. Agus Taher Nasution

MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei. S. Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Badar Jl. Binjai Km. 6,8 Al-Falah Jl. Murni No. 27 Tg. Rejo Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Ikhlas Jl. Binjai Km. 16,5 Dusun I Aman Damai Al-Islamiah Jl. Binjai Km. 14,5 Gg.Gembira DS. V Diski Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Istimomah Dusun I Desa Pujimulio Al-Irma Jl. Rajawali Sei Sikambing-B Al-Jihad Jl. Sunggal No. 129 Al-Muttaqin Jl. Hanura No. 10 Tanjung Rejo Al-Mujahirin BBLKI Medan Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Istiqamah Jl. Perwira Utama No. 20 Kampung Lalang Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg Rejo Jami’ Jl. Masjid No. 6 Tg. Rejo No. 6 Jamik Jl. Pinang Baris No. 19 Kel. Lalang

M. Hudawi, SH, S.Pd.I H. Syair Syam Drs. Agus Suhaedi Drs. Hadi Syam Haris Drs. Lukman Hakim Hsb., M.Ag Drs. H. Zainal Arifin, MA Zainuddin, S.Ag Drs. Misnan, MA H. Amaluddin, S.Ag Drs. Syafi’i Zaini Drs. Bahren Manik, S.Pd.I Drs. H. Syarifuddin, D. Saiful Asro Dalimunte, M.Ag Drs. Ruhiyat Drs. Suhendri, MA Drs. Asman Ali Nur Harahap Hasnan, S.Ag Drs. H. Marajaksa Harahap Drs. M. Thohiruddin Drs. H.M. Yazid Mufti Lubis

Lama Raudhatussuffah Jl. TB. Simatupang (P. Baris) Jamik M. Jayak Jl. Jend. Gatot Subroto Km.5,5 No.184 Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Ikhsan Jl. Kelambir Lima No. 53-B Kel. Lalang Silaturrahim Jl. Perintis Kemerdekaan Km.13,7 P.Besar Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Garuda Masjid Taqwa Sei Sikambing-B

C9 Muksin, BA Drs. H. Syaiful Aziz Lubis Asmawi, S.Ag, S.Pd.I Khomaini, S.Pd.I Drs. H. Muchtar Djaya Madini, S.Pd.I Drs. H. Sunaryo Drs. Asyroruddin Dr. Ali Imran Sinaga, M.Ag

MEDAN TIMUR Arrahim Jl. Purwosari Gg. Masjid/Puskesmas P.Brayan Amaliyah Jl. Perwira II Pulo Brayan Bengkel Al-Barkah Jl. Setia Jadi Kel. Glugur Darat I Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Hidayah Jl. Karantina Gg. Pasaman No. 2 Kel.Durian Al-Iman Jl. Sidang Raya, Kompl. DPRD Tk.I P.B.Bengkel Al-Ikhlas Jl. Muara Sipongi Kel. Gaharu Al-Ikhlas Jl. Madiosantoto No. 197 Lingk. 14 P.B. Darat Al-Ikhwan Jl. Prajurit No. 28 Lingk. XI Gg. Bali Al-Ittihad Pulo Brayan Bengkel Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Baiturrahman Jl. Simpang 6 P. Brayan Bengkel Bustanul Huda Jl. Perwira I Lingk. VII P.B. Bengkel Baitul Mukminin Lingk. VIII Pulo Brayan Darat I Daarul Ma’arief Jl. Damar Raya No. 8 Sidorukun Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Syuhada Jl. Budi Pengabdian No. 2 P. Brayan Kota Taqwa Jl. Bilal Gg.Keluarga No.74 Kel. P.Brayan Darat I Taqwa Ubudiyah Jl. Bambu III Kel. Durian

Drs. H. Juliardi Drs. Ahmad Dairobi Butar-butar Drs. Suparian Drs. Ishaq Ibrahim Bukhori Muslim, S.Ag Drs. Amrul Fuad Drs. Ali Suti Ahmadd Mulyono Drs. H. Amhar Nasuation, MA Sayuti, S.Ag Ismail Malik Mardian Idris, M.Ag Drs. H. Zakaria Batubara K.H. Nazaruddin Lubis H.M. Thohir Ritonga, Lc Drs. Syahrin Pane H.M. Syafiar, Lc Drs. Bahari Ahmad Panjaitan H. Nano Wahyudi, MA DR. H.Sarbaini Tanjung Drs. Faisal Lubis Drs. H. Dalail Ahmad, MA

MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metereologi Raya Gg.Karya No.1 Hasan Ma’sum, MA Ar-Rahman Jl. Durung Gg. Aspin H. Da’ijuntak, S.Ag Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Drs. H. Abdurrahman Kasbi At-Tawwabin Jl. Pimpinan No. 1 Drs. H. Amhar Nasuation, MA Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Drs. H. Ahmd Bangun Nst., MA Al-Falah Jl. Perbatasan Bdr. Khalipah-Bdr. Setia Drs. Supardi Lubis Al-Falah Jl. Kemenangan 151 Kel. Indra Kasih Drs. Syamsul Bahri Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Drs. H. Amir Saleh Nasution Al-Ikhlas Jl. Mandala By Pass Gg. Tengah Lingk. II Drs. H. Abubakar Siregar, MA Al-Ishlah Jl. Bustamam Dusun X/XI Bandar Khalipah Khairul Anwar Lubis, MA Al-Ishlah Jl. Pukat V Kel. Bantan Timur Drs. Ngadiman KR. S.Pd.I, S.Ag Al-Ijtima’iyah Jl. Letda Sujono No. 152 Kel. Tembung Nazaruddin Nasution Al-Muslimun Jl. Pertiwi No. 94-C Ke. Bantan Drs. Joko Santoso Al-Mubiin Dusun VII/Selasih Desa Bandar Khalipah Suheri, S.Pd.I Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Zulkifli Nasution, S.Pd.I Baiturrahman Kampus UNIMED Jl. Williem Iskandar Dr. Zainal Arifin, Lc, MA Babussalam Jl. Bersama Ujung No. 260 Kel. Bantan Drs. Usman Harahap Darul Amin Jl. Letda Sujono Ujung No. 1 H. Muslim Nasution Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo Drs. Rijaluddin Jamik Al-Ikhlas Jl. Pengabdian Dusun I Desa Bdr. Setia Drs. Abdul Halim Ombak Jamik Al-Jihad Jl. Besar Tembung Dusun I No. 17 H. Bustami, Lc Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Khaidir, S.Ag Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Drs. H.M. Nur Hasibuan Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Drs. Zulkarnain Lubis, MA Taqwa Jl. Pimpinan Gg. Delima No.11 Sei Kerah Hilir Drs. Mustafa G.H. Harahap MEDAN TUNTUNGAN Al-Amin Jl. Pala Raya Perumnas Simalingkar Al-Hidayah Jl. Seroja Raya Lingk. VI Kel. Tg. Selamat Al-Ikhlas Jl. Bunga Kardiol Kel. Baru Ladang Bambu Al-Muhajirin Perumnas Simalingkar Al-Muhtadin Jl. Kemiri Raya No. 1 Blok-G Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami 2 Perumnas Simalingkar Iklab Jl. Letjen. Jamin Ginting Km. 12,7 Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Taqwa Jl. Sawit Raya, Perumnas Simalingkar

H. Agus Rizal, S.HI M. Iqbal, SE Alimin Lubis, S.Pd.I Drs. Hasran Rawi Junindra Banurea, M.Ag Drs. Toharuddin Harahap Drs. H. Romsil Harahap Ali Imran Nasution, S.Ag Drs. Amrin Yus Muhammad Al Farabi, MA Drs. H. Muchsin H. Qosim Nurseha, Lc, MA M. Arief, MA

DELISERDANG Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Ash-Sholah Jl. Roso Marindal 1 At-Taubah Blok Gading Kelambir Lima Kebun H. Perak Al-Hidayah Jl. Pembangunan Desa Sekip Lubuk Pakam Al-Hafiz Hamparan Perak Kec. Hamparan Perak Al-Ikhlas Jl. Delitua Km. 8,5 Dusun Desa Suka Makmur Al-Ikhlash Lingk. XIII Dusun Durian Kec. Sei Tuan Al-Issyah Hakim Jl. Karya Jaya Kel./Kec. Deli Tua Al-Muhajirin Perumah. Pond. Nusantara Ds Marindal A-Muttaqien Jl. Besar Deli Tua Gg. Kolam Al-Mukhlisin Jl. Terusan Dusun II Bandar Setia Baitussalam Dagang Kerawan Tanjung Morawa Baitur Rohim Jl. Purwo Desa Suka Makmur Graha Deli Permai Jl. Sidodadi Istikmal Jl. K.E. Tandean Lingk. III Bandar Sakti Jami’ Asysyakirin Deli Tua Jami’ Kel. Galang Kota Jami’ Al-Hisan Desa Silemak Kec. Hampran Perak Jami’ Lubuk Pakam Khairul Fatihin Dusun II Kec. Tg. Morawa Misbahul Munir Jl. P. Siantar No. 1 Desa Pagar Jati Nurul Ikhwan Jl. H.A. Dahlan No. 38 Tg. Morawa Nurul Hikmah Balai Penelitian Sungai Putih Nursa’adah Jl. Raya Medan- Tanjung Morawa Km. 12 Nurul Burhanuddin Jl. Cempaka Dusun V Ds K.Durian Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Raya Syuhada Kec. Galang Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam Taqwa Lubuk Pakam

H. AhmadTaufik Lubis, S.Pd.I Jurianto, S.Ag Drs. Syafrindo Dadang Drs. Ghazali Umar H. A. Sugianto, Lc Parlin Bancin, Lc Azhman, SH Hasby, S.Ag Masnun Syafi’i, AMa Herman, S.Ag H. Azanul Shauti, S.HI Ahmad Fuad Sinaga, S.HI Baharuddin, SP. Ngadiono, S.HI Drs. Basyaruddin Lubis M. Syafri Zas, S.Pd.I Baharuddin Afwan Helmi, MA Drs. Harmaini Margolang Drs. H.M. Sakti Rangkuti, MA Awaluddin, S.Pd., S.S. H. Abd. Wahab Drs. H. Khaidir Tanjung Drs. H. Yusuf Adi, MA H.M. Rusli Ismail, S.Ag Sumarmen, S.Ag, S.Pd.I Muhammad Nur, S.Ag Drs. Tenerman

LANGKAT Ar-Raudhah Dusun VII Desa Kebun Balok

Salman

INDRAPURA Jami’ Indrapura

H.M. Amin, E.H., Lc

BATUBARA Jami’ Al-Mukhlisin PT. Moeis Kec. Sungai Suka Deras Nurul Huda Desa Tanah Tinggi Kec. Air Putih Nurul Iman Desa Perkotaan Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih

H. Mawarmin Lubis Hasan Basri H. Zulkarnain H.M. Ghazali Syafi’i

PEMATANGSIANTAR Al-Furqon Jl. Tekuku No. 2 Kel. Sipinggol-ponggol Al-Falah Jl. Pane No. 1 Kel. Karo Al-Huda Jl. Medan Km. 7,5 Kel. Tambun Nabolon Al-Hidayah Jl. Bazoka No. 6 Kel. Bukit Sofa Al-Hidayah Jl. MelanthonSiregar No. 36 Al-Hilal Jl. Melanthon Melanthon Siregar No. 218 Al-Hanif Jl. Ade Irma Suryani Nasution No. 28 Al-Ikhlas Jl. Mawar Karang Sari Permai Al-Ikhlas Jl. Tangki Kel. Nagapita Al-Ikhlas Jl. Ampi No. 17 Kel. Bantan Al-Ikhlas Jl. Bakung No. 44 Kel. Simarito Al-Ikhlas Jl.Sibatu-batu Bukit Makmur Blok II Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba Al-Jihad Jl. Tongkol No. 86 Kel. Pardomuan Al-Khairiyah Jl. Jorlang Hataran No. 1 Kel. Simarito Al-Khoirot Tambun Timur Kel. Tambun Nabolon Baiturrahmah Jl. Tanah Jawa Kel. Melayu Bhakti Jl. Serdang Kel. Martoba Nurul Huda Jl. Sibatu-batu Blok III Kel. Bah Sorma Nurul Iman Tambun Timur Kel. Tambun Nabolon Nurul Ihsan Jl. Nagahuta Gg. Mesjid Kel. Setianegara Dakwah Jl. Jawa No. 23 Kel. Bantan Mujahidin Jl. Kabu-kabu No. 22 Kel. Kahean Rahmat Jl. Madura Bawah Kel. Bantan Taqwa Jl. K.H. Ahmad Dahlan No. 18 Kel. Bukit Sofa Taqwa Jl. Merdeka No. 271 Kel. Dwikora Taqwa Jl. Perak No. 16 Kel. Baru

Muzayyin, BA Suhemi, S.Ag Drs. Umar Hamid Nasrianto Nasution Samantio Sinaga, S.Pd.I Mhd. Arifin Siregar H.M. Rafii Nasir, BA Zulhamri Siregar, S.HI H. Hasan Basri Siregar, MA Abdussalam Lubis, S.Ag Ridwansyah Drs. H. Mhd. Asli Drs. H. Rasyid Nasution H.M. Thamrin Nasution Drs. Badaruddin Dalimunthe Mhd. Arifin Siregar Drs. H. Ammar Lubis Mhd. Zein, S.Pd.I Mhd. Syamsul Bahri, BMQ Sarman Siregar Drs. H. Syarwan Lubis H. Ahmad Syuthury, S.Ag Abdul Manap, S.Pd.I Drs. Tajussalim Muslimin Akbar, M.H. Zulfahri Nasution Zikri B.S, S.Pd.I

Mimbar Jumat

C10

WASPADA Jumat 11 Januari 2013

Salahuddin Al Ayubi Pahlawan Besar Islam Di siang hari Salahuddin Al Ayubi bak singa yang siap menerkam musuhnya. Tapi di malam hari ia hanyalah seorang hamba yang penuh kekhusukan bersimpuh di hadapan Allah SWT.

Benteng Salahuddin Al Ayubi di Mesir Salahuddin Al Ayubi lahir di Tikrit, tepi sungai Tigris di Irak pada tahun 1137 masehi atau 532 hijriyah. Nama aslinya adalah Salah alDinYusuf bin Ayub. Ayahnya, Najm ad-Din masih keturunan Kurdi dan menjadi pengelola kastil bersama adiknya, Shirkuh. Kemudian keluarga Salahuddin pergi ke Mosul. Di Mosul, mereka bertemu dan membantu Zangi, seorang pemimpin Arab yang mencoba menyatukan wilayah Islam yang tercerai-berai dalam beberapa wilayah kerajaan kecil seperti Suriah, Antiokhia, Aleppo, Tripoli, Horns, Yerusalem dan Damaskus. Zangi yang beraliran sunni berhasil menjadi penguasa di seluruh Suriah dan bersiap menghadapi serbuan tentara salib dari Eropa yang saat itu sudah mulai memasuki tanah Palestina. Zangi meninggal tahun 1146 setelah menundukkan Edessa, sebuah propinsi pendukung Eropa dan kemudian digantikan oleh Nuruddin. Di bawah bimbingan Zangi dan Nuruddin, pelan-pelan Salahuddin yang bertubuh kecil, rendah hati, santun, penuh belas kasih namun juga cerdas ini menemukan jalan hidupnya. Pada tahun 1163, Nuruddin mengutus Shirkuh untuk menundukkan Mesir yang dipimpin kekhalifahan Fatimah yang beraliran syi’ah. Shirkuh berhasil menundukkan Mesir tanggal 8 Januari 1189. Namun dua bulan kemudian Shirkuh meninggal dunia. Nuruddin kemudian mengangkat Salahuddin menggantikan Shirkuh. Salahuddin dianggap masih seba-

gai bocah yang lembek dan lemah sehingga mudah dikontrol. Nurruddin tentu tidak mempunyai pesaing kuat yang mempunyai kekuasaan besar di Kairo. Namun prediksi Nuruddin ternyata salah. Salahuddin segera mengorganisir pasukan dengan mengembangkan perekonomian untuk menghadapi serbuan tentara salib yang ingin merebut Mesir. Dalam kurun waktu 1169 hingga 1174 itu, Mesir di bawah pimpinan Salahuddin menjelma menjadi kerajaan yang malah membuat Nuruddin khawatir. Hubungan keduanya memburuk dan pada tahun 1174, Nuruddin mengirim pasukan untuk menundukkan Mesir. Saat armadanya dalam perjalanan, Nuruddin meninggal dunia pada tanggal 15 Mei 1174. Kekuasaan diserahkan pada putranya yang baru berusia 11 tahun. Pertempuran urung terjadi. Bahkan Salahuddin berangkat menuju Damaskus untuk menyampaikan belasungkawa. Kedatangannya dielu-elukan dan diharapkan rakyat. Namun Salahuddin yang santun malah berniat menyerahkan kekuasaan pada raja yang masih belia namun sah. Raja yang masih belia tersebut tiba-tiba juga sakit dan meninggal dunia, mau tak mau Salahuddin diangkat menjadi sultan bagi kekhalifahan Suriah dan Mesir, pada tahun 1175. Pada waktu Salahuddin berkuasa, perang salib telah memasuki fase kedua.Walaupun tentara salib berhasil menguasai kola suci Yerusalem (perang salib fase pertama), namun mereka tidak berhasil menaklukkan Damaskus dan Kairo. Kekuatan muslim sedang menuju jalan kemenangan

dengan menguasai Mesir,Syria dan Palestina. Ketika dinobatkan menjadi sultan, Salahuddin berujar, “ Saat Tuhan memberiku Mesir, aku yakin Dia juga akan memberiku Palesti-na! Namun saat itu antara Salahud-din dan Raja Yerusalem, Guy de Lusignan mengadakan gencatan senjata. Fase kedua perang salib dipicu penyerangan rombongan peziarah dari Kairo yang hendak menuju Damaskus oleh Reginald de Chattillon, penguasa kastil di Kerak yang juga merupakan bagian dari kerajaanYerusalem. Kafilah yang hendak menunaikan haji ini juga membawa saudara perempuan Salahuddin. Pengawal kafilah dibantai dan anggota rombongan ditahan, termasuk saudara perempuan Salahuddin. Reginald juga mengancam akan menyerang dua kota suci umat Islam, Mekah dan Madinah. Dengan demikian, gencatan senjata berakhir dan Salahuddin sangat murka. Pada Maret 1187, setelah bulan suci Ramadhan, Salahuddin menyerukan jihad. Satu konsep dan budaya yang dihasilkan pahlawan perang ini adalah lahirnya peringatan hari lahir Nabi Muhammad Saw atau yang disebut dengan maulid Nabi. Peringatan maulid Nabi Muhammad Saw digunakan Salahuddin untuk menumbuhkan kembali semangat jihad pasukan muslim. Pasukan muslim mulai bergerak, menaklukkan satu persatu benteng-benteng pasukan Kristen. Puncak kegemilangan Salahuddin terjadi pada pertempuran di kawasan Hattin. Tanggal 13 Juli yang kering, 25.000 tentara muslim mengepung

tentara Kristen yang berjumlah lebih besar, di daerah pegunungan Hattin yang menyerupai tanduk. Pasukan muslim terdiri dari 12.000 pasukan kavaleri dan sisanya infanteri. Kavaleri merupakan pasukan utama yang menunggang kuda Yaman yang gesit. Dengan dibagi dalam skadron-skadron kecil, mereka menggunakan taktik hit and run. Salahuddin menang dalam pertempuran dan pahlawan besar Islam ini bisa membebaskan Yerusalem dari pasukan salib. Yerusalem Dari Hattin, Salahuddin bergerak membebaskan kota-kota Acre, Beirut dan Sidon di utara. Dia juga bergerak membebaskan Jaffa, Caesarea, Arsuf hingga Ascalon di selatan. Sekarang saatnya membebaskan kota Yerusalem. Dalam membebaskan kota-kota tersebut, Salahuddin senantiasa mengedepankan jalan diplomasi, yaitu penyerahan kota secara sukarela, daripada pasukannya menyerbu kota. Pasukan Salahuddin mulai mengepungYerusalem pada 26 September 1187. Saat itu pasukan salib di Yerusalem dipimpin oleh Balian dari Obelin dan mempertahankan kota dengan gigih. Namun pada tanggal 30 September 1187, Salahuddin menerima tawaran perdamaian Balian. Yerusalem diserahkan dan orang Kristen dibebaskan dengan tebusan tertentu. Fragmen ini pernah difilmkan Hollywood dengan judul Kingdom of Heaven. Sebagaimana diketahui berkat perjanjian yang ditandatangai oleh Khalifah Umar bin Khattab ra dan Uskup Sophoronius menyusul jatuhnya Antiokh, Damaskus dan Yerusalem pada tahun 636 masehi, orang-orangn Islam, Yahudi dan Nasrani hidup rukun dan damai di Suriah dan Palestina. Setiap warga negara bebas dan aman menjalankan ajaran agama masing-masing di Yerusalem. Namun kerukunan beragama yang telah berlangsung selama lebih 460 tahun ini di Yerusalem kemudian porak poranda akibat hasutan seorang patriach bernama Ermite. Provokator ini berhasil menghasut Paus Urbanus

yang mengirim ratusan ribu tentara ke Timur Tengah untuk melakukan perang salib. Setelah mengalahkan pasukan salib, Salahuddin menunda masuk ke kota suci selama dua hari, menunggu hingga tanggal 2 Oktober 1187 atau bertepatan dengan tanggal 27 Rajab 583 H. Tanggal itu merupakan saat Nabi Muhammad SAW melakukan mikraj dari masjid Al-Aqsa yang terdapat di Yerusalem. Di kota ini, Salahuddin lagi-lagi menampilkan sikap yang adil dan bijaksana. Masjid Al-Aqsa dan Kubah Batu (Dome of Rock) yang sempat dijadikan markas Ordo Templar dan gereja Kristen dibersihkan. Namun demikian, gereja Makam Suci tetap dibuka dan ia tetap mempersilahkan umat Kristen untuk melakukan ibadah dan aktifitas di situ. Demikian juga kaum Yahudi bebas melakukan ibadah mereka di Yerusalem. Kebijakan ini sempat ditentang pendukung-pendukungnya. Namun Salahuddin berujar, “muslim yang baik harus memuliakan tempat ibadah agama lain!” Salahuddin sendiri tidak tinggal di istana megah. Ia justru tinggal di masjid kecil bernama Al-Khanagah di Via (jalan Do-lorossa, dekat gereja Makam Suci). Kantornya terdiri dari dua ruangan berpenerangan minim yang luasnya nyaris tak mampu menampung 6 orang yang duduk berkeliling. Salahuddin sangat menghindari korupsi yang banyak menghinggapi para raja pemenang perang. Setelah Salahuddin kembali menguasaiYerusalem, maka kota suci tiga agama samawi ini tidak berpindah tangan dari penguasa muslim hingga abad ke-20. Setelah perang dunia I, ketika daerah Palestina dikuasai Inggris dan akhirnya diserahkan pada kaum Yahudi untuk mendirikan negara Israel. Salahuddin juga berhasil mempertahankan Yerusalem dari serbuan prajurit Kristen pimpinan Richard “Si Hati Singa”. Richard mengepung Yerusalem dua kali, yaitu bulan Desember 1191 dan bulan Juni 1192. Namun Salahuddin mampu membuat Richard frustasi dan akhirnya kem-

bali ke Eropa tanpa pernah menyentuh tanah Yerusalem. Salahuddin meninggal pada 4 Maret 1193 di Damaskus. Para pengurus jenazahnya sempat terperangah karena ternyata Salahuddin tidak mempunyai harta. Ia hanya mempunyai selembar kain kafan lusuh yang selalu dibawanya dalam setiap perjalanan dan uang senilai 66 dirham Nasirian (mata uang Suriah waktu itu) di dalam kotak besinya. Ada dua kesan yang menyebabkan Salahuddin Al Ayubi dipandang sebagai kesatria sejati, baik oleh kawan maupun lawan. Pertama adalah soal kepiawaiannya dalam taktik pertempuran. Kedua tentang kesalehan dan sifat murah hati. Bulan Juli 1192, pasukan muslim menggerebek 12 tenda prajurit Kristen dalam perang salib, termasuk tenda Raja Richard I di luar benteng kota Jaffa. Richard yang terusik segera bangun dan bersiap bertempur. Richard berjalan kaki mengikuti pasukannya menyongsong musuh. Salahuddin yang melihatnya, berguman dengan tenang pada sau-ranya, Al-Malik al-Adil, “Bagaimana mungkin seorang raja berjalan kaki bersama prajuritnya? Pergilah, ambil dua kuda Arab dan berikan padanya. Katakan padanya, aku yang mengirimkan untuknya. Seorang laki-laki sehebat dia tidak seharusnya berada di tempat ini dengan berjalan kaki.” Fragmen di atas dicatat sejarahwan Kristen dan muslim sebagai salah satu pencapaian tertinggi Salahuddin Al Ayubi sebagai seorang ksatria. Walau berada di atas angin, dia tetap menginginkan pertempuran yang adil bagi setiap musuhnya. Ketinggian budi pekerti Salahuddin seringkali menimbulkan rasa hormat para musuh terhadapnya. Salahuddin tidak membunuh musuh yang sudah tidak berdaya. Bahkan Salahuddin mengirimkan tim dokter muslim dan obat-obatan kepada Richard The Lion Heart ketika panglima perang itu terluka dalam pertempuran . Sikap ksatria terhadap panglima Lion Heart yang sudah terkapar di

Salahuddin Al Ayubi hadapannya mampu mencerminkan moralitas Islam yang sangat tinggi dalam diri seorang panglima muslim sejati. Salahuddin juga pantang berkhianat terhadap perjanjian genjatan senjata. Suatu hal yang sangat berlawanan dengan tradisi perang kaum salib Eropa. Ketika mereka berhasil merebut kota Yerusalem pada perang salib pertama pada tahun 1099. Ribuan orang Islam dibunuh dengan kejam dan biadab. Sebagai seorang panglima muslim yang ideal, di siang hari Salahuddin Al Ayubi bak singa yang siap menerkam musuhnya. Tapi di malam hari ia hanyalah seorang hamba yang penuh kekhusukan bersimpuh di hadapan Allah SWT. Berkat komando yang dipegang Salahuddin, dunia Arab dan Islam nyatanya pernah bersatu. Persatuan terbukti mampu mendatangkan kegemilangan dan musuh Islam kalah. Namun yang menjadi pertanyaan, mungkinkah akan muncul Salahuddin-Salahuddin lainnya di dunia Arab dan Islam yang mampu membangkitkan kejayaan Islam kembali, mempersatukan umat Islam dan memerangi musuh Islam yang selalu ingin menghancurkan agama yang mulia ini. Berakhirnya masa kolonialisme barat pada awal abad ke 20 sampai sekarang dunia Arab dan Islam terpecah belah. Kalau pahlawan besar Islam dan tokoh pemersatu bangsa Arab ini masih hidup, ia sangat sedih melihat kondisi umat Islam seperti sekarang ini. Nurhayati Baheramsyah/dari berbagai sumber

Memaknai Pergantian Tahun

Sunnah Lawan Bid’ah, Tauhid Lawan Syirik

Oleh Drs. H. As’ad Marlan, M.Ag

Oleh dr Arifin S. Siregar

Guru MAL IAIN SU dan Dosen Fak Tarbiyah IAIN SU

Dokter Spesialis Kulit dan Kelamin

P

S

eredaran waktu terus bergulir, dari hari ke hari, minggu ke minggu, dan bulan ke bulan, tanpa terasa kita telah sampai pada satu putaran penuh, bulan Januari dan bersamaan dengan bulan Safar yang merupakan bulan kedua dari putaran bulan Hijriah tahun ini. Banyak saudara kita yang menjadikan bulan Masehi ini sebagai momentum, sehingga merayakan pergantian tahun merupakan suatu hal yang menjadi keharusan bahkan terkadang sampai keluar dari syariat Islam, mereka begadang semalam suntuk, pesta pora dengan maksiat dan lain sebagainya. Padahal Rasulullah SAW dan para sahabatnya serta para ulama terdahulu tidak pernah melakukan hal tersebut. Semestinya, dengan datangnya tahun baru ini kita banyak “bertafakur” untuk “bermuhasabah” atas bertambahnya umur berarti hakekatnya berkurang kesempatan untuk hidup dibumi Allah ini. Beruntunglah bagi kita yang diberi umur panjang oleh Allah dan dengan umur yang panjang itu dipergunakan untuk berbuat kebajikan demi kebahagiaan hidup di alam baqa kelak, Rasulullah SAW bersabda : “Sebaik-baik manusia ialah orang yang panjang umurnya dan baik amalnya”. (HR. At-Tirmizi). Jatah hidup kita belum tentu masih panjang dibanding umur yang telah kita lalui, mungkin tinggal sepuluh tahun lagi, atau mungkin lima tahun lagi atau bahkan tinggal satu tahun lagi atau satu bulan lagi, kita tidak tahu persis, semuanya itu hanya Allah yang Maha Mengetahui. Untuk itu dengan jatah hidup yang masih kita nikmati ini, marilah kita pergunakan untuk dapat menambah amal kebajikan demi meningkatkan kualiatas keimanan dan ketakwaan kepada Allah SWT. Allah menciptakan kita hidup di muka bumi ini bukan untuk sia-sia. Tanpa tujuan yang jelas. Sebagaimana kita tahu bersama bahwa Allah menciptakan makhluk bernama manusia tiada lain hanya untuk beribadah kepada-Nya. Allah SWT berfirman : “Dan Aku tidak menciptakan jin dan manusia melainkan supaya mereka menyembahKu (beribadah kepadaKu)”. (QS. Az-Dzariyat: 56) Hidup di dunia ini sementara bukan kehidupan yang abadi atau kekal, dan dunia ini hanya merupakan persinggahan, yang tujuannya adalah kehidupan yang kekal abadi yaitu kehidupan akhirat. Allah SWT berfirman: “Sedangkan kehidupan akhirat adalah lebih baik dan lebih kekal”. (QS. Al-A’la : 17). Berbahagialah kita, karena kita masih memperoleh kesempatan untuk memasuki tahun yang baru ini. Namun kita tidak boleh lengah dan lupa bahwa suatu saat Allah akan mengambil nyawa kita. Tahun baru ini hendaknya menjadi ajang koreksi bagi kita, merenung kembali amal usaha kita pada tahun lalu. Jika amalan kita jelek, maka kita harus bertekad bulat untuk memperbaiki amalan itu pada tahun ini. Jika pada tahun lalu amalan kita sudah baik, maka pada tahun yang baru ini kita harus berusaha untuk meningkatkan amalan kita menuju tingkat yang lebih baik. Dalam hal koreksi

diri ini Umar bin Khattab pernah berpesan: “Hisablah (koreksilah) dirimu sebelum kamu dikoreksi kelak oleh Allah SWT”. Banyak hal yang bisa kita lakukan dalam memaknai datangnya tahun baru ini diantaranya: Pertama, memperbanyak taubat kepada Allah. Adapun yang dimaksud dengan taubat disini bukan hanya sekedar diucapkan di lisan saja, tidak membekas di dalam hati sama sekali, bahkan tidak berpengaruh dalam perbuatan anggota badan. Tetapi yang dimaksud dengan taubat adalah seperti yang dijelaskan oleh ar-Raghib al-Asfahani yaitu “Meminta ampun dengan disertai ucapan dan perbuatan dan bukan sekedar lisan semata”. Selanjutnya ar-Raghib mengatakan, taubat itu ialah meninggalkan dosa karena keburukannya, menyesali dosa yang telah dilakukan, berkeinginan kuat untuk tidak mengulanginya dan berusaha melakukan apa yang lebih baik sebagai ganti. Jika keempat hal itu telah dipenuhi berarti syarat taubatnya telah sempurna. Sedangkan menurut Imam Nawawi, bertaubat dari segala dosa hukumnya adalah wajib. Jika dosa itu antara hamba dengan Allah, yang tidak ada sangkut pautnya dengan hak manusia maka harus memenuhi tiga syarat. Pertama, orang yang bertaubat harus menjauhi maksiat. Kedua, ia harus menyesal perbuatan maksiatnya. Ketiga, dia berjanji kepada Allah tidak akan mengulanginya lagi. Jika salah satu syarat taubat tersebut tidak terpenuhi, maka taubatnya tidak sah. Jika taubatnya berkaitan dengan hak manusia maka syaratnya ada empat, yaitu ketiga syarat di atas ditambah satu, yaitu hendaknya ia memenuhi hak orang lain. Jika berupa harta benda maka ia harus mengembalikan, jika berupa had (hukuman) maka ia mesti memberikan kesempatan untuk membalas atau meminta maaf kepadanya dan jika berupa ghibah atau menggunjing, maka ia harus meminta maaf. Dalam hal taubat ini, Allah SWT berfirman: “Wahai orang-orang yang beriman bertaubatlah kepada Allah dengan taubat yang semurni-murninya”. (QS. At-Tahrim : 8). Kedua, Muraqabah. Kita seharusnya melakukan pendekatan diri kepada Allah SWT, dan selalu mengingat-Nya dalam setiap saat, sehingga tumbuh suatu keyakinan dalam diri sendiri, Allah senantiasa mengawasinya, melindunginya, memenuhi segala keperluannya, membimbing dan memberikan petunjuk. Keyakinan ini menumbuhkan dalam dirinya akan kebesaran, kekuasaan dan kemurahan Allah terhadap hamba-hambaNya. Allah SWT berfirman: “Dan Dia bersamamu dimana saja kamu berada. Dan Allah melihat apa yang kamu kerjakan”. (QS. Al-Hadid : 4) Maksud ayat tersebut, bahwa Allah mengawasi dan menyaksikan perbuatan kita kapan saja dan dimana saja kita berada. Di darat maupun dilaut, pada waktu malam maupun siang. Dirumah kediaman kita, di tempat kerja kita, diruang tertutup maupun diruang terbuka. Allah Maha Mengetahui apa yang kamu sembunyikan serta apa yang kamu pikirkan. Wallahu A’lam Bishshawab.

Jatah hidup kita belum tentu masih lebih panjang dibanding umur yang telah kita lalui,..

unnah adalah lawan dari bid’ah. Tauhid lawan dari syirik. Bila dikatakan Sunnah berarti itu amalan yang benar. Bila dikatakan Tauhid berarti itu keyakinan yang benar didalam rangka meng-Esakan Allah SWT. Kemudian bila dikatakan bid’ah itu berarti amalan sesat (Hadist). Bila dikatakan syirik berarti itu keyakinan penyekutuan Allah SWT (kafir). Kalau sudah dikatakan syirik apakah masih bisa dikatakan ada syirik yang hasanah ? Begitu juga bila sudah dikatakan Bid’ah adalah sesat, bagaimana bisa dikatakan ada bid’ah yang hasanah ? Pada hal Nabi SAW telah menetapkan (memproklamirkan): “Seburukburuknya perbuatan adalah bid’ah dan setiap bid’ah adalah sesat dan di neraka”. Anda mengatakan ada bid’ah hasanah, berarti anda tidak jujur atas kaidahkaidah atau ketetapan diatas yang sudah disepakati ulama. Kalaupun ada argumentasi, anda kemukakan sebagai dalil untuk menyatakan ada bid’ah yang hasanah, untuk itu dapat dibantah yaitu : Pertama : Ucapan Umar bin Khattab RA yang menyatakan: “membuat shalat taraweh menjadi jemaah itu, itu adalah bid’ah hasanah”. Adapun ucapan Umar RA itu bukan mengandung arti syariat (hukum), tapi hanya arti kamus, lugot (pemanis kata). Alasannya, dimana dimasa Nabi SAW sudah pernah ada shalat taraweh (shalat malam) berjemaah. Jadi berjemaah shalat taraweh yang dibuat Umar RA itu, bukan cara ibadah yang baru. Kedua : Mendokumentasikan Alquran pada kertas yang berbentuk kitab, itu bukan pekerjaan ibadah, tapi mashlahat murshalah (hal-hal masaalah dunia demi kepentingan umat = masaalah dunia = muamalah, bukan ibadah). Yang ibadah adalah membaca dan mempedomani Alquran, dimana terikat pada apa yang difirmankan Allah SWT. Kalaupun ada yang bersikeras, menulis Alquran itu ibadah, ketahuilah pada masa Nabi SAW juga “firman Allah” SWT telah ditulis di dinding, kulit onta, tulangtulang, dsb. Kemudian dizaman Nabi SAW, juga sudah pernah Nabi SAW memerintahkan sahabat menuliskan Alquran. Ketiga: Sunnah syaiyah, Sunnah hasanah.

Kalaupun ada Hadis yang didalamnya ada berbunyi : “Sunnah hasanah” dan “Sunnah saiyiyah” arti sunnah disini diartikan “cara” (bukan Sunnah arti syariat). Karena bila “Sunnah” diartikan dalam arti syariat, apakah ada Sunnah yang buruk ? Jadi kata “sunnah hasanah” disini tidak bisa dihubungkan menjadi ada bid’ah hasanah. Keempat : Kata “kullu” pada Hadis : Kullu bid’atin dholalah, wakulla dholalatin finnar. Bila kata kullu diartikan “sebagian” maka berarti hadis itu akan berbunyi : “sebagian bid’ah itu sesat dan sebagian yang sesat di neraka”. Maka ditanya yang sebagian lagi yang sesat dimana ? Apa di syorga ? Jadi argumentasi yang anda kemukakan itu batal untuk menegakkan adanya bid’ah hasanah. Sasaran Bid’ah : Mereka mengatakan syalawat pakai “syaidina” atau “shalat qabliyah Jum’at” itu bid’ah hasanah. Kalau begitu mana contoh bid’ah dholalah ? Anda mengatakan bid’ah dholalah adalah misalnya : membuat subuh jadi 3 rakaat atau shalat fardhu jadi 6 waktu. Imam Asy-Syathibi dalam kitabnya : Al-I’tisham mengutarakan dalam pembahasannya : Membuat shalat subuh menjadi 3 rakaat atau shalat fardhu menjadi 6 waktu, itu bukan perbuatan bid’ah, tapi itu sudah terjerumus pada perbuatan haram atau maksiat, karena telah melanggar hukum (kaifiyat atau rukun) yang sudah jelas ada ditetapkan oleh Nabi SAW pada shalat subuh adalah 2 rakaat atau shalat fardhu 5 waktu. Dan perbuatan membuat shalat subuh 3 rakaat, bukan lagi perbuatan mengada-ada, (perbuatan yang dianggap bagus, menambah pahala, syiar), tapi sudah disadari perbuatan salah melanggar syariat, rukun dan kaipiyat shalat Subuh. Sehingga tidak akan mau ulama atau alangkah bodohnya ulama, kalau-kalau mau berbuat demikian. Adalah yang dikhawatirkan Nabi SAW terjadi pada ulama, adalah mereka akan mengada-ada (merobah, menambahnambah) pada Aqidah dan Ibadah hal-hal yang dianggap mendatangkan nilai kebaikan, syiar, memuja, menambah pahala, dsb, yang sebatas dianggapnya tidak melanggar syarat, wajib, rukun atau kaifiyat atas ibadah

Kita tidak mengecilkan, atau kita menghormati ulama yang membagi bid’ah atas 2 bagian, 3 bagian, 5 bagian. Tapi kita kita harus berpikir jujur, rasional, argumentative.. yang hukumnya telah ada ditetapkan. Maka oleh karena itu penam-bahan atau mengobahobah (bid’ah) ini terjadi hanya pada Ibadah yang bersifat sunat. Misalnya: menambah “syaidina” pada syalawat, meletakkan azan pada pemakaman mayat, tahlilan dikematian, shalat qabliyah Jum’at, dsb. Pada Ibadah yang sifatnya wajib, tidak mungkin berani ulama lakukan, karena disadari sudah melanggar hukum atau kaifiyat yang sudah jelas. Penyebabnya atay pendorongnya adalah karena ingin beribadah berlebih-lebihan berlandaskan nafsu (ghulwun). Inilah cikal bakal terjadinya bid’ah. Sehingga ada ulama Imam Syofyan Atsauri berkata: Begitu tergelincirnya atau mudah terpengaruhnya ulama berbuat bid’ah seperti yang diutarakan Imam Syofyan Atsauri: Syetan menangis datang melapor pada iblis karena gagal mengajak atau merayu ulama berbuat maksiat (mencuri, berzina, berjudi, dsb), tapi syetan datang tertawa seraya melapor pada iblis karena berhasil mengajak “ulama” membuat shalat qabliyah Jum’at, syaidina dalam syalawat, dsb. Karena dalam berbuat bid’ah, ulama merasa tidak melanggar rukun atau kaifiyat Ibadah. Untuk itu berakibat terjadilah bid’ah lebih buruk dari maksiat, karena seorang yang maksiat satu waktu ia akan tobat, karena ia sadar perbuatannya itu salah (haram), tapi seorang bid’ah tidak akan pernah tobat, karena dianggapnya perbuatannya itu baik sehingga dosanya terbawanya ke liang kubur. Hal ini diutarakan oleh Imam Syofyan Atsauri. (lihat kitab: “BAHAYA BID’AH DALAM ISLAM”, oleh: Syeikh Ali Mahfuzd). Ada yang berpendapat sebagai contoh “shalat qabliyah Jum’at” atau “syaidina” jangan dipermasaalahkan atau diperdebatkan, karena perbedaan pendapat itu masaalah furu’iyah atau khilafiyah. Bagaimana kita menganggap re-

meh, bila kita pedomani H.R Muslim : “Sesungguhnya bila seorang mengamalkan amalan yang tidak ada dalam ajaran kami (petunjuk kami), maka amalan itu tertolak. Ketahuilah bahwa “shalat qabliyah Jum’at” tidak ada dalam Sunnah (tidak ada petunjuk), maka ia tertolak (karena bid’ah atau sesat). Apakah ancaman Nabi SAW ini dianggap angin lalu saja ? Dimana Ibadah setiap hari dikerjakan. Berarti setiap hari kita menumpuk dosa/sesat seandainya itu ditakdirkan Allah SWT sesat. Apakah hal ini masih bernilai furu’iyah atau khilafiyah ? Dianggap sepele ? Ada yang menganggap “berdo’a berjemaah dengan suara keras selesai shalat fardhu” atau “shalat qabliyah jum’at” tidak bid’ah (sesat), karena bardo’a berjemaah atau shalat qabliyah itu ada hukum asal (adalah Sunnah berdo’a berjemaah, atau shalat qabliyah). Tapi untuk itu, disini ada lagi hukum yang membatalkan “hukum asal” yaitu hukum “harus ada contoh” atau “petunjuk” yaitu sesuai bunyi Hadis: “shalatlah kamu seperti kamu melihat aku shalat” atau Hadis : “Sesungguhnya seseorang yang mengamalkan amalan (Ibadah yang tidak ada petunjuk Agama (Nabi SAW ), maka amalan itu tertolak”. Jadi penambahan do’a berjemaah pada Ibadah shalat fardhu yang tanpa contoh/petunjuk Nabi SAW, menjadilah bid’ah atau tertolak dan sesat. Kita tidak mengecilkan, atau kita menghormati ulama yang membagi bid’ah atas 2 bagian, 3 bagian, 5 bagian. Tapi kita kita harus berpikir jujur, rasional, argumentatif. Kita dapat membanding, mempertimbangkan mana pendapat-pendapat mujtahid itu yang benar sesuai kehendak Alquran, Sunnah dan rasional. Sifat taqlid harus dibuang, untuk memilih pendapat mana diantara mereka yang benar.

Mimbar Jumat

WASPADA Jumat 11 Januari 2013

Pemimpin Dalam Bingkai Alquran Dalam Sunnah Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Alwashliyah.

I

slam memberikan dasar-dasar normatif dan filosofis tentang kepemimpinan yang bersifat komprehensip dan universal. Tidak hanya untuk umat Islam tapi juga untuk seluruh umat manusia. Prinsip-prinsip kepemimpinan dalam Islam adalah hikmah bijaksana, qudwah (teladan), musyawarah, adil, lemah lembut, sinergi membangun kebersamaan. Beberapa term yang digunakan Alquran terkait tentang kepemimpinan, yaitu al-imam, al-khilafah, ulil amri, dan al-malik. Disamping perbedaan penggunaan term itu, semua ulama sepakat bahwa pemerintahan merupakan kewajiban agama yang besar dengan argumentasi fundamental dan esensial yang dinukilkan langsung dari nash Alquran, Hadis, dan kaidah-kaidah. Kewajiban agama tidak mungkin diterapkan secara komprehensip dan simultan tanpa adaya pranatapranata yang konkrit seperti kepemimpinan ini. Prinsip dasar pemimpin yang digariskan dalam Alquran dan Sunnah, dalam perkembangannya mengalami perluasan arti dan pemahaman, bahkan tidak jarang mengalami pembiasan yang jauh dari prinsip dasar sesungguhnya. Hal ini tak lepas dari hiruk pikuk kepentingan politik kelompok atau golongan. Konsekuensinya berpengaruh pada penentuan syarat pemimpin. Kepemimpinan yang sempurna hanya ada pada diri Nabi dan Rasul, karena mereka adalah hamba pilihan Allah. Adalah wajar bila umat menjadikan para Nabi dan Rasul itu sebagai rujukan dan teladan dalam kepemimpinan. Salah satu caranya adalah menghidupkan kembali nilai-nilai universal kepemimpinan mereka. Kriteria pemimpin dalam konsep Islam telah menjadi materi pembicaraan sejak Islam awal, seperti AlMawardi, Ibn Hisyam, Al-Ghazali, Ibn Khaldun, Al-Baqillani, dan dari haluan sekuler seperti Ali Abdul Raziq. Mengamati ragam pendapat mereka, bila dikaji lebih mendalam menunjukkan bahwa persyaratanpersyaratan tersebut sangat ditentukan oleh situasi dan kondisi politik dimana para ulama dan fuqaha berada serta sejauhmana kedekatan ulama dan penguasa pada saat itu.

Sehingga fatwa yang disampaikan sangat diwarnai oleh kondisi politik yang mengitarinya. Meski begitu, ada beberapa kriteria universal dalam bingkai Alquran dan Sunnah yang menjadi karakteristik pemimpin yang ideal. Pertama, beriman kepada Allah dan beramal saleh. Manifestasinya dapat dilihat dari kehidupan keseharian mereka. Iman merupakan basis fundamental dan sebagai barometer kesehatan jiwa, karena mukmin

saan mereka sebelumnya merupakan cerminan masa depan. Ketiga, berpegang pada hukum Allah. Pada hakikatnya Allah menghendaki kemaslahatan atas tiap maklukNya. Pemimpin yang Islami adalah pemimpin yang bisa menggali kehendak Allah dalam kitab suciNya dalam menata kehidupan rakyatnya. Seorang pemimpin harus paham maksud Allah dan menerapkannya dalam bentuk kebijakan yang membawa maslahat. Sebab itulah maka

Keadilan para pemimpin adalah salah satu diantara pilar kebangkitan bangsa disamping pilar lainnya yaitu ilmu para ulama, kedermawanan kaum kaya, dan doanya fakir miskin. sejati tidak gemar berkata dusta, menyia-nyiakan amanat, menyembunyikan kebenaran karena takut kepentingannya tersisihkan. Hal ini adalah karena adanya kesadaran pertanggungjawaban di hadapan Allah Yang Mahamengawasi. Hasilnya adalah konsistensi berbuat baik serta terjaga dari keburukan meski tidak seorang manusiapun berada di sekitarnya. Kualitas iman seseorang dapat dilihat dari amal praktisnya. Amal praktis ini dapat dilihat oleh mata kepala. Dengan demikian, muslim yang akan memilih pemimpin lazimnya memperhatikan karakter yang pertama ini. Kedua, niat yang lurus. Setiap calon pemimpin memiliki motivasi. Namun prinsipnya, niat yang lurus berasal dari qalbu yang sehat, sementara qalbu yang sakit berimplikasi pada niat yang tidak tulus. Oleh karena itu niat sangat terkait dengan keimanan seseorang. Mungkin umat terbiasa dengan janji-janji calon pejabat dan sering dibuat jera pasca terlantik menjadi pejabat. Untuk memudahkan umat melihat niat tulus para calon pemimpinnya, ada baiknya mempertimbangkan rekam jejak mereka sebelumnya. Apakah mereka tergolong orang yang gemar berdusta, hipokrit, suka memanipulasi, berkata sia-sia, atau tidak peka dengan kondisi masyarakat miskin dan lemah. Karena kebia-

sesungguhnya seorang pemimpin bertanggung jawab kepada Allah, bukan hanya kepada rakyatnya saja. Calon pemimpin impian umat adalah orang yang cerdas agamanya dan teguh pendirian. Karena pengetahuan agama saja tidak cukup bila ia tidak bisa mewarnai rakyatnya dalam kemaslahatan yang dikehendaki Allah. Keempat, berlaku adil. Barometer adil ini sangat abstrak dan multi persepsi. Oleh karena itu kombinasi peran akal dan qalbu menjadi se-suatu yang urgen bagi seorang pemimpin dimana ia menjadi salah satu alat vital dalam menetapkan kebijakan yang adil, tidak diskriminatif, sesuai dengan proporsi kemaslahatan. Sudah selayaknya kita mem-perhatikan kesehatan akal dan qalbu para calon pemimpin ini agar masa depan rakyat dalam keadilan, jauh dari kezaliman yang dapat menyengsarakan kehidupan di dunia dan akhirat. Kelima, suka menasehati rakyatnya. Rasul Saw bersabda: “Tidaklah seorang pemimpin yang memegang urusan kaum Muslimin lalu ia tidak bersungguh-sungguh dan tidak menasehati mereka, kecuali pemimpin itu tidak akan masuk surga bersama mereka (rakyatnya).” Ini berarti bahwa pemimpin itu harus berwibawa di hadapan rakyatnya, disenangi dan dicintai oleh mereka. Apabila seorang pemimpin tidak berwibawa maka

ucapannya justru sering dijadikan bahan olokan. Mencari pemimpin yang gemar menasehati rakyat adalah tuntutan berdasarkan sunnah karena ada keterkaitan dengan masa depan dirinya dan rakyatnya di akhirat. Keenam, tegas. Ini merupakan sikap seorang pemimpin yang selalu di idam-idamkan oleh rakyatnya. Tegas bukan berarti otoriter, tapi tegas maksudnya adalah berani mengatakan yang benar atau salah karena menjaga tanggung jawabnya di hadapan Allah. Ketujuh, lemah lembut. Suatu kali Rasul pernah berdoa: “Ya Allah, barangsiapa mengurus satu perkara umatku lalu ia mempersulitnya, maka persulitlah ia. Dan barang siapa yang mengurus satu perkara umatku lalu ia berlemah lembut kepada mereka, maka berlemah lembutlah kepadanya.” Ketampanan dan senyuman tidak bisa dijadikan ukuran mutlak, namun ia bisa dijadikan sebagai salah satu indikator sifat lemah lembut seseorang. Pantaslah kiranya kebiasaan calon pemimpin mema-sang wajah senyum demi memikat calon pemilihnya. Namun, kelemah-lembutan yang berangkat dari hati yang sehat hanya diketahui oleh Allah, dirinya sendiri dan orang terdekatnya. Kejayaan sebuah bangsa sangat ditentukan oleh kualitas dan kapasitas para pemimpinnya. Sebaliknya, bangsa yang besar dan beradab bisa hancur sebab keserakahan dan buruknya mental para pemimpinnya. Keadilan para pemimpin adalah salah satu diantara pilar kebangkitan bangsa disamping pilar lainnya yaitu ilmu para ulama, kedermawanan kaum kaya, dan doanya fakir miskin. Menyoroti program calon pemimpin dalam peningkatan pilar ini adalah keniscayaan bagi kita sebagai pemilih, karena stabilitas hubungan antara unsur kemasyarakatan ini akan berdampak pada beragam masalah sosial lainnya, seperti ekonomi, politik, dan hukum. Tiap pilar penentu kebangkitan ini harus ditata dengan baik. Sedangkan kekuatan yang paling berpengaruh adalah pemimpin yang tegas dan adil yang mempunyai visi dan misi menjaga kesejahteraan rakyatnya untuk kehidupan dunianya dan akhiratnya. Wallahua’lam bil ash-shawab.

Eksistensi Kematian Sebagai Suatu I’tibar Oleh Mhd. Yusuf Sinaga, Lc, MA Dirut Cv Toko Buku Darusalam, Penulis & Penterjemah singapura-Malaysia Mahasiswa Program Doktor UK-Malaysia, Alumni PPMDH TPI Medan

D

alam mengarungi samudera kehidupan yang penuh dangan cobaan, sering kali seseorang mengalami cobaan dan penderitaan, keputusasaan dan lain sebagainya. Biasanya, di saat seperti itu tanpa disadari orang tersebut berkata, “…dari pada hidup seperti ini, lebih baik aku mati…”. Allah SWT telah menjelaskan dalam salah satu firmannya, “…tidak akan Allah bebani sesuatu kepada jiwa seseorang kecuali ia masih mampu menang-gungnya..”. Janganlah sekali-kali mengeluh dengan apa yang diberikan oleh Allah SWT kepada-

mu wahai saudaraku seiman. Ia yang Maha Pemurah tidak akan membebani sesuatu kepadamu kecuali engkau mampu memikulnya, dan janganlah sekali-kali engkau mengharap kematian guna menyelesaikan kesengsaraan dan cobaan yang menimpamu. Rasulullah Saw bersabda, “Janganlah sekali-kali salah seorang dari kalian mengharap kematian karena kesengsaraan yang menimpanya, dan apabila harus berharap maka berdoalah, “Ya Allah, hidupkanlah aku jika kehidupan adalah yang terbaik bagiku, dan mati-

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Al-Ustadz, Dalam surat Maryam ayat 71-72 disebut Allah: “ Dan tidak ada seorangpun darimu, melainkan mendatangi neraka itu. Hal itu bagi Tuhanmu adalah suatu kemestian yang sudah ditetapkan. Kemudian Kami akan menyelamatkan orang-orang yang bertaqwa dan membiarkan orang-orang yang zalim di dalam neraka dalam keadaan berlutut”. Jadi seluruh manusia baik mukmin dan kafir akan masuk neraka. Bagimana menurut ustadz. Mohon penjelasan. Dari Supriono di Deli Serdang . Jawab : Terima Kasih atas pertanyaannya. Memang masalah ini adalah masalah khilaf. Tafsir Ibnu Katsir memaparkan tiga pendapat dalam masalah ini, yaitu: 1. Memang semua manusia masuk ke dalam neraka baik muslim yang taat maupun kafir. Pendapat ini didasarkan atas arti kata” wariduha” diatas dengan makna “memasukinya” yang itu berarti bahwa semua orang baik muslim maupun kafir akan masuk neraka, tentu saja manusia muslim masuk ke naraka dalam waktu singkat dan tidak merasakan kepedihan naraka. 2. Yang masuk neraka hanyalah mereka yang zalim dan berdosa, hal ini didasarkan adanya bacaan ayat “wa in min kum” menjadi “wa in min hum” yang berarti “dan diantara mereka”. Meraka disini dimaknakan dengan orang zalim. Bacaan ini diriwayatkan oleh Ibnu Abbas. Menurut Quraisy Shihab pendapat kedua ini juga didasarkan bahwa mitra bicara ayat ini bukan ditujukan kepada seluruh manusia, tetapi hanya kepada orang kafir. 3. Kata wariduha tidak diartikan memasuki tetapi mendatangi atau melewati. Hal ini berarti bahwa semua manusia baik muslim maupun akan melawati neraka, inilah peristiwa meniti shirat. Semua orang wajib melawati shirat ini yang dibawahnya ada neraka, jadi arti ayat ini adalah “Dan tidak ada seorangpun darimu, melainkan melewati neraka...”. Pendapat ini dipilih oleh Quraish Syihab. Wallahu A’lam Al-ustadz H. Ismail Hasyim. MA.

Musibah yang paling besar dari itu semua adalah kelalaian akan kematian itu sendiri, keengganan untuk mengingat dan merenungi .. kanlah aku apabila kematian adalah yang terbaik bagiku….”. Dalam riwayat lain Anas bin Malik ra meriwayatkan bahwa Baginda Saw bersabda, “Janganlah sekali-kali salah seorang dari kalian mengharap kematian, kalau ia seorang yang baik, boleh jadi bertambah kebaikannya, dan jika ia seorang yang jahat, boleh jadi dia bertaubat.” Ketahuilah, kematian adalah sebuah musi-bah yang amat sangat besar. Para ulama berkata, “Allah SWT menjadikan kematian sebagai musibah besar.” Begitu juga dalam firman Allah SWT dalam surat Al-Maidah, “Dulu kamu ditimpa musibah (bahaya) kematian. Sebab kematian adalah pergantian dari suatu keadaan ke keadaan lain, perpindahan dari suatu tempat tinggal ke tempat tinggal yang lain”. Kematian adalah musibah dan bencana yang besar, namun musibah yang paling besar dari itu semua adalah kelalaian akan kematian itu sendiri, keengganan untuk mengingat dan merenungi dan pengabaian terhadap perbuatan amal shalih. Para ulama sepakat, bahwa kematian adalah sebuah pelajaran bagi mereka yang menjadikan sebagai pelajaran dan merupakan sebuah perenungan bagi mereka yang mau memikirkannya. Oleh karena itu, jika seorang hamba yang disibukkan dengan renungan kematian, niscaya ia tidak akan terperangkap dalam perbuatan dosa. Dari penjelasan di atas dapat kita pahami bahwa kematian terbagi menjadi dua keadaan, bagi orang yang beriman, maka kematian adalah yang terbaik, karena disitu terjadi pertemuan antara kekasih dengan yang dikasihi sebagaimana diriwayatkan di saat malaikat maut hendak mencabut nyawa Nabi Ibrahim As, Ibrahim berkata, “Pernahkah eng-

kau melihat kekasih mencabut nyawa kekasihnya?”. Malaikat maut kembali kepada Yang Maha Kuasa, dan Allah pun berkata, “Pernahkah engkau melihat kekasih tidak senang bertemu dengan kekasihnya?” Setelah pesan itu disampaikan kepada Nabi Ibrahim As, ia berkata kepada malaikat maut, “Cabutlah nyawaku sekarang!”. Dan kematian bagi orang yang lalai dan ahli maksiat, maka itu adalah sebuah malapetaka. Sebenarnya, tanpa meminta kematian kepada Allah SWT hal tersebut sudah pasti akan datang, Allah SWT berfirman, “Setiap jiwa pasti akan mati”. Kematian datang sesuai dengan kehendak Yang Maha Kuasa. Diriwayatkan bahwa ketika salah seorang pembantu dari India menemui Nabi Sulaiman, datang malaikat maut yang menyerupai manusia bersilaturahmi melihat kekasih Allah SWT, Sulaiman As. Sepulang malaikat maut , pembantu tersebut bertanya kepada Nabi Sulaiman, “Siapkah dia?”. Nabi Sulaiman menjawabnya, “Ia adalah malaikat maut”. Mendengar jawaban Nabi Sulaiman, pembantu itu ketakutan dan memohon kepada Nabi Sulaiman agar mengembalikannya ke negri India dengan angin, dan Nabi Sulaiman pun mengabulkannya. Tak lama kemudian malaikat maut menjumpai Nabi Sulaiman dan ia berkata, “Tadinya aku merasa heran, Allah SWT memerintahkanku untuk mencabut nyawa pembantu anda setelah kepulanganku dari tempatmu tadi, dan Ia Yang Maha Kuasa memerintahkanku untuk mencabut nyawa pembantumu di India, sedangkan aku mengetahui bahwa pembantu tersebut ada bersamamu. Namun, ketika aku sampai di India kudapatkan pembantu tersebut berada di sana, sungguh Maha Kuasa Rabbuna JallaWa’alla.Wallahu A’lam Bi Shawab.

C11

Jurus Jitu Tolak Bencana Dengan Perbanyak Sedekah (1) Dalam banyak hadits, Rasulullah SAW menegaskan pentingnya sedekah sebagai tameng penolak bala. Kita tidak hanya harus tahu teorinya saja tapi juga dalam implementasi serta tataran melaksanakannya sedapat mungkin mencontoh apaapa yang dilakukan Nabi SAW. Dalam suasana suka maupun dua hendaklah kita selalu bersyukur, terutama sekali saat memperoleh kesenangan. Tapi, saat datang bencana jangan menyalahkan Allah tidak sayang. Berpikirlah positif, maka itu perbanyak sabar dan ikhlas menerimanya karena di balik bencana biasanya akan ada hikmah. Nabi Junjungan kita semasa mudanya saudagar kaya, menikah dengan istri yang lebih kaya raya, namun semua hartanya diberikannya dengan ikhlas untuk perjuangan dan kejayaan umat Islam.Namun begitu, banyak saja orang yang tidak sadar sehingga berlaku pelit bahkan kikir dengan orang-orang di sekitar kita. Sulit sekali keluar uang untuk orang miskin, bahkan untuk dirinya sendiri saja pelit karena ingin berhemat. Sementara untuk hal-hal yang sifatnya duniawi mereka ‘’jorjoran’’seperti mengikuti pergantian malam tahun baru 2013. Untuk hidup hemat memang baik, namun jangan pelit untuk memberikan bersedekah. Dalam situasi apapun juga sebaiknya kita tidak lupa bersedekah, berinfak di jalan Allah SWT. Tidak mengapa kecil asal rutin dan itu lebih baik ketimbang hanya sesekali tapi besar. Dan Allah SWT lebih senang melihat hamba-Nya yang rajin bersedekah, berinfak walau jumlahnya sedikit tapi sering dalam setiap bulannya, ketimbang orang-orang kaya yang menolak atau hanya melakukannya sesekali saja meskipun jumlahnya lebih besar dibandingkan orang biasa. Lantas, apa manfaat sedekah? Dalam sejumlah hadis shahih disebutkan, “Sungguh, sedekah dapat memadamkan panasnya kubur orang yang bersedekah, dan sungguh orang mukmin akan bernaung pada hari kiamat dengan payungan se dekahnya”. (HR. Thabrani). (Dikutip dari berbagai sumber buku hadis sahih)

Nilai Kekuasaan Dan Harta Dalam Islam Oleh Fachrurrozy Pulungan Ketua Forum Komunikasi Lembaga Dakwah (FKLD) Sumut.

“J

anganlah begitu ! Sungguh manusia benarbenar melampaui batas, karena melihat dirinya serba cukup “. Qur’an surah al Alaq ayat 6-7. Ayat di atas mengimformasikan tentang potensi negatif yang dimiliki manusia, ketika ia merasa dirinya berkecukupan/istaghna, ia pun melampaui batas. Kata istaghna terambil dari akar kata ghaniya yang makna umumnya, merasa memiliki segalanya baik harta, maupun kekuasaan sehingga ia tidak butuh apa pun dari orang lain. Bahkan tak perlu beriman atau mematuhi aturan, baik hukum maupun nilai-nilai budaya atau adat. Ayat di atas turun berkenaan dengan Abu Jahal yang merasa memiliki segalanya, kekuasaan, harta dan pengikut. Ia mengatakan, “ Apakah Muhammad pernah meletakkan wajahnya ke tanah (bersujud) dihadapan kalian?”. Dijawab oleh pengikut-pengikutnya, “ pernah”. Kemudian Abu Jahal berkata, “Demi lataa dan uzza, jika aku melihatnya begitu, akan kuinjak lehernya dan kubenamkan mukanya ke tanah”. Lontaran kata yang diucapkan Abu Jahal adalah ungkapan kata yang menunjukkan bahwa dirinya memiliki kekuatan dan kekuasaan, sehingga ia merasa mampu berbuat sekendak hatinya. Dan katakata seperti itu sering kita dengar dari orangorang yang merasa berkecukupan. Merasa diri punya kekuasaan dan harta, maka apa pun bisa dilakukan. Tak perduli apakah tindakannya salah atau benar. Memecat orang lain dari jabatannya dengan sesuka hati, kemudian menggantinya dengan orang lain yang tidak sesuai, ia tidak perduli. Atau menghentikan penyidikan atas kasus-kasus pelanggaran hukum yang melibatkan dirinya atau keluarganya, semua bisa dilakukan karena kekuasaan dan harta yang melimpah. Dari perlakuan Abu Jahal tersebut, kemudian Allah menghibur Nabi Muhammad SAW dengan ucapan, “ Inna ila robbika al ruj’a/sesungguhnya hanya kepada Tuhanmulah kem-bali mu”. Ayat ini menyatakan agar Nabi SAW tidak berkecil hati terhadap perlakuan Abu Jahal. Karena Allah lah yang memiliki semua makhluk Nya, semua akan kembali kepada Nya. Dan ketika manusia keluar dari kehidupannya, ia akan mempertanggung jawabkan semua perbuatan, perkataanya, serta segala apa yang dia peroleh semasa hidupnya, dari mana asalnya, kemana dipergunakannya, seperti diungkapkan Alqur’an dalam surah Ibrahim ayat 42-43, “ Dan janganlah sekali-kali kamu (Muhammad) mengira bahwa Allah lalai dari apa yang diperbuat oleh orang-orang yang zalim. Sesungguhnya Allah memberi tangguh kepada mereka sampai hari yang pada waktu itu mata mereka terbelalak. Mereka datang tergesa-gesa memenuhi panggilan dengan mengangkat kepalanya sedang mata mereka tidak berkedip dan hati mereka kosong”. Sejalan dengan berkembangnya kemampuan manusia untuk mengelola alam dan bertambahnya kekayaan serta penguasaan terhadap alat-alat produksi, bertambah dan berkembang pula potensi manusia dalam bentuk keinginan dan godaan untuk berlaku sewenangwenang, atau mengeksploitir sesamannya dan alam lingkungannya. Namun kesewenang-wenangan dapat juga terjadi walau dari seseorang yang tidak memiliki kekayaan dan kekuasaan, tetapi merasa diri tidak membutuhkan orang lain. Dan sikap seperti ini bertentangan dengan nilai-nilai kemanusiaan. Karena itu Alqur’an menggarisbawahi hal itu sebagai potensi negatif manusia yang harus dicegah dengan mengingatkanya, bahwa ia pasti akan kembali berhadapan dengan Penguasa alam dan langit yang tidak ada pengausa lain selain daripada Nya, yakni Allah SWT. Diceritakan bahwa, seorang sufi besar yang bernama Syaqiq al Balakhi yang tinggal di Makkah berkunjung ke Baghdad. Karena kemasyhuran Syaqiq sebagai seorang sufi yang terkenal, membuat Khalifah Harun al Rasyid mengundangnya ke istana. Sampainya Syaqiq ke istana, Khalifah Harun sempat terperangah melihat keadaan sang sufi yang sangat bersahaja. Syaqiq tidak menunjukkan tanda-tanda dirinya sebagai seorang ulama kebanyakan, yang berpenampilan unik dan berbeda

dengan orang lain. Syaqiq adalah seorang sufi yang penampilannya tidak berbeda dengan masyarakat pada umumnya. Pakaiannya tidak memakai pernak pernik (asesoris) atau pakaian yang biasa dipakai oleh para sufi. Itu sebabnya kemudian Khalifah Harun bertanya, “ Engkaukah ini wahai Syaqiq?”. Syaqiq membenarkan, dan setelah terjadi beberapa dialog, kemudian Khalifah meminta sang ulama sufi ini memberinya nasehat. Kata Syaqiq, “ Sekiranya tuan mengadakan perjalanan di padang pasir yang tandus dan terik, kemudian ditengah perjalanan, tuan kehabisan bekal dan kehausan, yang membuat tuan dalam keadaan sekarat. Namun, tuan menemukan satu bejana air yang dimiliki seseorang. Berapa tuan sanggup membayar satu bejana air itu”. Khalifah menjawab, “ Berapa pun harganya akan saya bayar?”. “Kalau sipemilik air tidak mau menjualnya, kecuali ditukar dengan separoh kekuasan dan separoh harta kekayaan tuan, apakah tuan akan membelinya?”. Tanpa pikir, Harun al Rasyid menjawab, “ Benar, akan saya penuhi permintaannya itu”. Kemudian Syaqiq melanjutkan, “Setelah tuan meminum air tersebut, yang menghilangkan dahaga tuan yang hampir mereng-gut nyawa, tetapi bela-kangan air tersebut ti-dak bisa keluar dari tu-buh tuan (tidak bisa buang air kecil), sehing-ga maut pun mengan-cam diri tuan. Namun ada seseorang yang memiliki kemampuan dapat menyembuhkan penyakit tuan, dengan syarat ditukar dengan separoh kekuasaan tuan yang tinggal dan separoh kekayaan tuan yang tersisa. Apakah tuan bersedia menukarnya?”. Khalifah Harun menjawab, “ Akan aku penuhi permintaannya”. Ulama yang wara dan tawadhu itu melanjutkan, “Kalau begitu, apa yang tuan banggakan dengan kekuasaan dan kekayaan tuan yang besar ini? Kenyataannya, nilai kekuasaan dan harta tuan yang luar biasa ini sama nilainya dengan satu bejana air yang tuan minum dan tidak bisa keluar lagi!” Mendengar penuturan yang sangat menyentuh itu, Khalifah Harun menangis dan memeluk Syaqiq. Sang khalifah kemudian memberikan perbekalan yang banyak kepada Syaqiq untuk melanjutkan perjalannya. Tetapi ulama itu menolaknya, karena baginya memberi nasehat agama kepada siapa pun adalah keharusan, agar manusia tidak tersesat, apa lagi kepada penguasa, sehingga para penguasa tidak berlaku sewenang-wenang dengan kekuasaannya. Terjadinya pergeseran nilai dewasa ini disebabkan pandangan hidup manusia yang mengutamakan kehidupan dunia sebagai kehidupan modern yang mengglobal, menempatkan kekuasan dan harta sebagai eksistensi (keberadaan) seseorang. Belum dianggap sebuah kesuksesan jika seseorang belum memiliki kekuasaan dan harta yang berlimpah. Gaya hidup masyarakat global yang rasional dan sekuler, mengasumsikan agama secara terpisah dari kegiatan ekonomi dan politik, yang pada gilirannya agama menjadi terasing dari kehidupan sosial, dan akhirnya mengalami apa yang umum disebut sebagai krisis relevansi. Kehidupan seperti inilah yang diagung-agungkan oleh Amerika dan sekutu-sekutunya. Krisis relevansi adalah ungkapan tentang posisi agama berada di luar kehidupan sosial serta tidak adanya konsep yang diberikannya dalam menyelesaikan permasalahan kemanusiaan. Agama terpenjara dalam pikiran, pasif, karena tidak teraktualisasikan dalam kehidupan nyata. Perbaikan nilai sebuah kekuasan dan harta kekayaan dalam Islam sangat tergantung dari aspek tauhid, yaitu aspek kebertuhanan dan iman yang sangat mendasar. Karena itu, kesadaran dan tanggung jawab tauhid yang sesungguhnya menjadi ukuran/nilai bagi setiap manusia yang beriman. Pemahaman tauhid yang berdimensikan kemanusiaan, menyiapkan manusia untuk senantiasa tunduk di bawah kehendak Allah SWT dalam segala aspeknya, seperti kekuasaan, kekayaan, cara berpikir, ketidak sukaan, membenci, mencintai, menginginkan sesuatu dan lainnya. Wallahu a’lam.

Agama terpenjara dalam pikiran, pasif, karena tidak teraktualisasikan dalam kehidupan nyata.

Mimbar Jumat C12 Hanya Allah Tempat Meminta Pertolongan

WASPADA Jumat 11 Januari 2013

Gatot - Erry Larut Dalam Lautan Zikir

H. Amir Syarifuddin

TAUSYIAH: Ustadz Maulana dengan gaya eksentrik memberikan tausyiah di atas kursi. Gaya dakwahnya yang jenaka dan bernas membuat Gatot dan Tengku Erry terpingkal-pingkal.

H. Amir Syarifuddin

TABLIGH AKBAR: H.Gatot Pujo Nugroho dan Tengku Erry disalami masyarakat usai menghadiri tabligh akbar di Perbaungan. Tabligh akbar yang diikuti 15 ribu orang digelar di halaman replica istana Sultan Serdang, Perbaungan, Kabupaten Serdangbedagai.

“Mintalah kepada Allah, karena hanya Dia sebaik-baiknya penolong. Sampaikanlah permohonan kepada Allah, lewat sholat, doa dan kesabaran,” ujar Ustadz Maulana di depan ribuan jamaah di Perbaungan, Kabupaten Serdangbedagai, Senin (7/1). Ajakan untuk selalu meminta pertolongan kepada Allah SWT ini diungkapkan Ustadz Maulana dalam Tabligh Akbar yang digelar bertepatan dengan HUT ke-9 Kabupaten Serdangbedagai. Us-tadz yang ngetop dipanggil “Ustadz Jamaah” itu dalam tausyiahnya memotivasi seluruh yang hadir untuk tak segan memanjatkan

doa. Meminta pertolongan dan bantuan hanyalah kepada Allah SWT. Dengan kemampuan dakwahnya ustadz dari Makassar ini memimpin doa dan zikir yang membuat hampir seluruh jamaah sesunggukan menangis. Tak terkecuali, Pelaksana Tugas Gubernur Sumatera Utara (Plt.Gubsu) H.Gatot Pujo Nugroho, ST dan Bupati Sergai Tengku

Erry Nuradi menundukkan kepala. Larut dalam doa dan zikir yang menggema dari lapangan replica Istana Sultan Serdang. Dipandu Ustadz Maulana, belasan ribu warga, tokoh masyarakat dan para pemimpin yang hadir saling mendoakan. “Ya Allah berikan pemimpin kami kekuatan dan kemampuan untuk memimpin dengan adil dan menyejahterakan umat,” kata Ustad Maulana. Doa bersama Ustadz Maulana ini membuat lautan massa yang hadir terpekur dalam tangis haru. Kegiatan yang akan ditayangkan salah satu stasiun TV swasta nasional dalam program Islam Itu Indah sangat kental nuansa kebersamaan dan religiusitasnya.

Dakwah: Mempertemukan Fitrah Dengan Wahyu Oleh Dr H. Abdullah, M.Si aka hadapkanlah wajahmu dengan lurus kepada agama Allah; (tetaplah atas) fitrah Allah yang telah menciptakan manusia menurut fitrah itu. Tidak ada perubahan pada fitrah Allah. (Itulah) agama yang lurus; tetapi kebanyakan manusia tidak mengetahui (Ar-Rum:30). Kata fitrah yang disebutkan 20 kali dalam Alquran dan kata ini memiliki dua makna yaitu ciptaan dan belah. Dalam surah ar-Rum ayat 30 seperti tersebut di atas, fitrah Allah maksudnya ciptaan Allah. Pada hakekatnya, manusia diciptakan Allah SWT mempunyai naluri beragama yaitu agama tauhid (Islam) dan memiliki kecenderungan kepada kabaikan dan kebenaran. Hal ini merupakan gambaran asas dan psikis manusia. Kalau ada manusia tidak beragama tauhid, maka hal itu tidaklah wajar. Hal itu merupakan pengaruh lingkungan atau faktor eksternal. Dalam konteks tersebut bahwa telah terjadi perjanjian primordial antara manusia dengan Allah SWT di alam azali. Hal itu dapat dipahami dari surah al-A’raf ayat 172: “Dan (ingatlah), ketika Tuhanmu mengeluarkan keturunan anak-anak Adam dari sulbi mereka dan Allah mengambil kesaksian terhadap jiwa mereka (seraya berfirman): “Bukankah aku ini Tuhanmu?” mereka menjawab: “Betul (Engkau Tuban kami), Kami menjadi saksi”, (kami lakukan yang demikian itu) agar di hari kiamat kamu tidak mengatakan: “Sesungguhnya Kami (Bani Adam) adalah orang-orang yang lengah terhadap ini (keesaan Tuhan)”. Konfigurasi makna fitrah dalam Alquran dan hadis mencakup tujuh hal. Pertama, fitrah berarti suci (al-Thuhr). Makna ini didukung oleh beberapa hadis nabi, baik dalam arti suci fisik, suci harta dan hari yang suci. Kedua, fitrah berati potensi beragama (ber-Islam). Kehidupan seorang muslim berada dalam suasana fitrah jika mengaktualisasi ajaran Islam dalam kehidupannya. Ber-Islam berarti penyerahan diri dan ketundukan manusia kepada hukum dan aturan Allah SWT. Ketiga, fitrah berarti mengakui ke-Esaan Allah SWT Manusia secara fitriah memiliki watak dan rasa bertauhid, sejak dalam alam ruh (Q.S. Al-A’raf: 172). Keempat, fitrah berarti istiqamah pada jalam kebenaran dan keselamatan. Kelima, fitrah berarti perasaan yang tulus atau ikhlas. Manusia lahir dengan membawa sifat-sifat yang baik, dan diantara sifat tersebut adalah ketulusan dalam menjalani kehidupan. Keenam, fitrah berarti kesanggupan untuk menerima dan menjalankan kebenaran. Secara fitri manusia cenderung mencari kebenaran, namun karena pengaruh faktor eksternal kadangkala meninggalkan kebenaran yang diyakininya. Ketujuh, fitrah berarti keinginan mendekatkan diri atau beribadah

H. Amir Syarifuddin

MINTA KEPADA ALLAH: Dalam sambutanya di Stabat, Kabupaten Langkat, Gatot dan Erry berpesan agar masyarakat selalu mengingat Allah SWT. Selalu memohon pertolongan kepada Sang Khalik, karena hanya Allah yang punya kuasa untuk mengubah nasib manusia.

Pelaksanaan Hukuman Mati Di Indonesia Analisis Kajian Keislaman Terhadap Hukuman Tembak Oleh Imam Pratomo, S.HI Staf Pengajar PPMDH TPI Medan, Pegiat Kajian Hukum Islam & Ke-Islaman Mahasiswa S-2 Hukum Islam IAIN-SU

Dekan Fakultas Dakwah IAIN-SU

M

Doa bersama yang diwarnai isak tangis tersebut merupakan kegiatan penutup tausyiah satu jam Ustadz Maulana. Padahal sepanjang ceramahnya, Maulana dengan gayanya yang kocak dan jenaka kerap membuat warga yang hadir tertawa. Gatot Pujo Nugroho juga mendukung seruan Ustadz Maulana. Menurutnya setiap umat muslim wajib memohon pertolongan, memanjatkan doa, hanya kepada Sang Khalik Allah SWT. Menurutnya hal ini sesuai hadist Rasulullah. “Bila engkau meminta sesuatu, mintalah kepada Allah, dan bila engkau meminta pertolongan, mintalah pertolongan kepada Allah. Itu hadist riwayat Tirmidzi,” kata Gatot .(m28)

kepada kepada Allah SWT. Pada sisi lain ada wahyu, yaitu kalamullah, yang berfungsi sebagai petunjuk kehidupan (hudan). Islam sebagai agama risalah dan dakwah bertugas mempertemukan fitrah dengan wahyu. Tugas ini telah dilaksanakan oleh para nabi dan da‘i sepanjang sejarah dakwah Islam. Seperti disebutkan oleh M.Natsir (19081993), bahwa wahyu memanggil fitrah dan fitrah berhajatkan kepada wahyu. Fitrah adalah ciptaan Ilahi, sedangkan wahyu merupakan tuntunan-Nya untuk keamanan, kemajuan dan keselamatan pertumbuhan fitrah dan kehidupan manusia. Dengan demikian, aktivitas dakwah satu arah dengan fitrah manusia sebagai makhluk ciptaan Allah SWT. Manusia memiliki berbagai potensi, yaitu hati (qalb), diri (al-nafs), jiwa (ruh) dan akal. Potensi tersebut harus berkembang dan difungsikan dengan baik di bawah kendali wahyu, sehingga manusia sebagai makhluk yang paling sempurna bentuk ciptaannya dapat melaksanakan tugas sebagai khalifah di muka bumi. Berfungsinya potensi tersebut secara baik dapat membawa pada pola kehidupan manusia yang seimbang, yaitu seimbang antara dunia dengan akhirat, jasad dengan jiwa, pikir dengan zikir dan doa dengan ikhtiar. Potensi tersebut dapat bekerja dengan baik dan dikembangkan berdasarkan petunjuk wahyu, maka manusia sebagai makhluk yang sempurna bentuk penciptaannya akan mulia di sisi Allah SWT Sebaliknya, nilai kemanusiaan dapat menurun dan sejajar dengan binatang. Bahkan, lebih rendah dari derajat binatang (Q.S. al-Tîn: 5). Hal itu apabila potensi manusia tidak seiring dengan wahyu, khususnya jika nafsu tidak sesuai kehendak wahyu dan fitrah. Oleh karena itu, agar potensi manusia sesuai dengan kehendak wahyu dan fitrah, maka aktivitas dakwah selalu dibutuhkan untuk memberi peringatan, membimbing dan mengarahkan. Memberikan kabar gembira dan peringatan merupakan dua sisi penting dari aktivitas dakwah sebaimana disebutkan dalam Q.S. Saba’: 28: “Dan Kami tidak mengutus kamu, melainkan kepada umat manusia seluruhnya sebagai pembawa berita gembira dan sebagai pemberi peringatan, tetapi kebanyakan manusia tiada mengetahui”. Berdasarkan hal tersebut posisi dakwah dalam Islam adalah penting. Melalui kegiatan dakwah dapat mengontrol tegaknya amar makruf nahi mungkar dan untuk tegaknya kebenaran sehingga menjadi nilai yang dianut secara bersama.Tegasnya dakwah merupakan mata rantai yang menghubungkan antara wahyu dengan fitrah. Oleh sebab itu, manusia membutuhkan dakwah untuk menumbuhkan potensi fitrah beragama.

Manusia sebagai makhluk yang sempurna bentuk penciptaannya akan mulia di sisi Allah SWT Sebaliknya, nilai kemanusiaan dapat menurun dan sejajar dengan binatang, bahkan lebih rendah dari derajat binatang.

D

alam Kitab Undang-Undang Hukum Pidana di Indonesia, hukuman pidana terdiri dari dua bagian yaitu Pidana pokok dan Pidana tambahan. Dalam judul ini penulis ingin mengkhususkan Pidana Mati yang merupakan bagian dari pidana pokok dalam KUHP di Indonesia. Di sebagian Negara-negara lain, pidana mati telah dihapuskan, akan tetap di Indonesia masih tetap berlaku. Pidana mati ini dengan kata lain mengakhiri hidup seorang pelaku kejahatan sesuai dengan kadar kejahatan yang dilakukannya. Pidana mati sering dijatuhkan kepada pelaku kejahatan pembunuhan secara berencana, kejahatan yang berhubungan dengan penyalahgunaan narkotika dan terorisme. Salah satu kasus yang pelakunya dijatuhi hukuman mati adalah peristiwa pemboman salah satu cafe di pulau Bali yang dikenal dengan istilah “Bom Bali”, yang menggetarkan seantaro dunia karena banyak korbannya adalah warga negara asing, terutama Australia. Amrozi Cs setelah menjalani persidangan atas kejahatan yang mereka lakukan dipidana majelis hakim dengan hukuman mati dan pidana ini tetap terus dikukuhkan hingga ke tingkat kasasi Mahkamah Agung. Segala upaya hukum mereka lakukan agar pidana mati tidak dijalankan termasuk permohonan grasi kepada Presiden, namun pemerintah dan pengadilan di Indonesia tetap bersikukuh pidana mati tetap harus dijalankan kepada keempat gembong kejahatan “bom Bali” tersebut. Apa yang ingin dikaji dalam tulisan ini adalah proses eksekusi pidana mati yang akan dijalankan Amrozi cs berdasarkan analisis kajian keislaman. Sebagaimana dimaklumi, mereka (Amrozi cs sebagai terpidana) menolak proses pelaksanaan pidana mati dengan menggunakan hukuman tembak karena hal ini tidak ada dalam Islam, yang ada adalah hukuman pancung. Jadi mereka menolak bukan karena hukuman pidana mati yang mereka terima, karena bagi mereka ini adalah mati syahid di jalan Allah SWT karena berjuang atas nama agama, namun proses eksekusi matinyalah yang mereka tolak. Bagi mereka hukuman tembak tidak sesuai dengan hukum Allah SWT (Islam) dan mereka akan mendapatkan dosa apabila menyetujuinya. Mereka

meminta eksekusi mati dengan cara dipancung atau dipenggal kepala, karena menurut mereka proses inilah yang sesuai dengan Islam. Pidana Mati di dalam Islam Di dalam Islam ada istilah Qishash yang artinya membuat sesuatu perbuatan yang sebanding dengan perbuatan yang dilakukan terhadapnya. Dalam arti lain kejahatan dibalas dengan kejahatan serupa. Jadi di sini berlaku sistem balas dendam darah dibalas darah, pembunuhan dibalas dengan pembunuhan dan pelukaan terhadap tangan di balas juga dengan pelukaan terhadap tangan dan berbagai contoh lainnya. Dalam Islam qishash ini diwajibkan. “al-Baqarah ayat 178”. Qishash itu tidak dilakukan, bila yang membunuh mendapat kema’afan dari ahli waris yang terbunuh Yaitu dengan membayar diat (ganti rugi) yang wajar. pembayaran diat diminta dengan baik, umpa-manya dengan tidak mendesak yang membunuh, dan yang membunuh hendaklah membayarnya dengan baik, umpamanya tidak menangguh-nangguhkannya. bila ahli waris si korban sesudah Tuhan menjelaskan hukum-hukum ini, membunuh yang bukan si pembunuh, atau membunuh si pembunuh setelah menerima diat, Maka terhadapnya di dunia diambil qishaash dan di akhirat Dia mendapat siksa yang pedih. Pelaksanaan Hukuman Mati Dalam sejarah, dikenal beberapa cara pelaksanaan hukuman mati di berbagai negara: di antaranya adalah: 1). pancung kepala: Saudi Arabia dan Iran, 2). sengatan listrik: Amerika Serikat, 3). digantung: Mesir, Irak, Iran, Jepang, Yordania, Pakistan, Singapura, 4. suntik mati: Tiongkok,Guatemala,Thailand,AS, 5). tembak: Tiongkok, Somalia, Taiwan dan Indonesia, 6). rajam: Afghanistan dan juga Iran. Di dalam Islam ada beberapa cara dalam pelaksanaan (eksekusi) hukuman mati. Di antaranya adalah dengan cara di rajam (dilempar dengan batu dengan terlebih dahulu tubuh ditanam ke dalam tanah hingga batas leher, dibunuh dan disalib bagi pelaku bughot yang merampas harta korbannya dan juga membunuh mereka, dan dengan cara dipancung yakni memisahkan kepala dengan pedang seperti yang sekarang ini dipraktekkan oleh ne-

Mereka (Amrozi cs sebagai terpidana) menolak proses pelaksanaan pidana mati dengan menggunakan hukuman tembak karena hal ini tidak ada dalam Islam. gara Arab Saudi. Hukuman ini dilakukan pada qishash orang yang membunuh orang lain tanpa adanya syarat syar’i yang dibenarkan. Hukuman pancung ini, pertama sekali dipraktekkan oleh nabi dan para sahabatnya di saat peristiwa fath al-Makkah di mana ada 17 orang pemberontak yang dijatuhi hukuman mati. Sebagian mengajukan pengampunan dan diampuni, 5 orang tidak mengajukan ampunan dan dihukum mati. Di antara mereka yang dihukum pancung adalah Abdullah bin Khatal, Fartana dan Huwairits bin Nafidz bin Wahab dengan menggunakan pedang. Nah karena hukuman pancung pernah dipraktekkan di dalam Islam oleh Rasulullah saw dan para sahabat, maka hukuman inilah yang sesuai dengan ajaran Islam menurut sebagian kaum muslimin, termasuk Amrozi cs. Kajian Keislaman Terhadap Hukuman Tembak Penetapan Presiden Nomor 2/ PNPS/1964 tentang Tata Cara Pelaksanaan Pidana Mati adalah dengan cara ditembak. Bagi Amrozi, Ali Ghufron dan Imam samudera, hukuman mati dengan cara dipancung sesuai dengan syariat agama dan membawa berkah. Trio bom Bali 2002 tersebut siap menerima hukuman mati, namun dengan pilihan dipancung dan bukan ditembak. Argumen yang diajukan antara lain, hukuman mati dengan cara dipancung tidak menimbulkan rasa sakit dan mati seketika pada saat kepala terputus dari badan. Sedangkan hukuman tembak masih menyisakan rasa sakit. Hukuman tembak biasanya dilakukan oleh beberapa penembak jitu dengan jumlah bisa mencapai 12 penembak (tiga sampai separuhnya benar-benar diisi peluru tajam) dan jarak tembak sekitar 5 meter. Sekilas memang tampak mematikan saat korban diberondong peluru. Dapat dipastikan peluru akan mengenai titik-titik mematikan seperti, jantung, kepala, perut, dada, kening, wajah, dan lain-

lain. Apabila meleset dari titik mematikan, komandan regu tembak akan ambil bagian dalam eksekusi tesebut. Korban akan terlempar ke belakang dan jatuh seketika. Tetapi apakah tubuh korban akan langsung diam tak bergerak? Tampaknya tidak demikian. Setidaknya ada saat dimana tubuh yang terkapar itu bergerak-gerak sebelum akhirnya diam membeku. Durasi gerakan bisa saja hanya sekian detik saja. Gerakan tersebut bisa saja diasumsikan sebagai saat sakaratul maut, atau detik-detik menjelang ruh lepas dari tubuh. Asumsi inilah yang tampaknya diyakini bahwa korban masih merasakan sakit, meski sesaat saja sebelum benar-benar dinyatakan meninggal. Sedangkan Hukuman Pancung ini dilakukan oleh seorang algojo yang ditunjuk pengadilan dan dilaksanakan di depan khalayak ramai sebagai pelajaran dan shock therapy bagi yang lain untuk tidak melakukan kejahatan serupa. Caranya adalah dengan memenggal kepala sampai putus dan terpisah dari badan. Cara ini dianggap yang paling efektif karena membuat sang terpidana mati dengan segera. Pro kontra antara eksekusi mati dengan cara dipancung dan ditembak muncul karena eksekusi dengan cara ditembak dianggap oleh Trio pejuang bom bali, dan juga didukung oleh Tim Pembela Pengacara Muslim, lebih menyakitkan daripada dipancung. Pandangan penulis, hukuman mati dengan cara ditembak mempunyai substansi yang sama dengan hukuman pancung, yakni menyegerakan seorang terpidana untuk mati dengan seketika, dan senjata adalah alat yang paling cepat dan efektif yang ada pada saat ini untuk menyegerakan seorang meninggal dunia. Jika hukuman pancung dibenarkan di dalam Islam maka tentu hukuman mati dengan cara ditembak juga dapat diterima di dalam Islam. Wallahu a’lam.


Waspada, Jumat 11 Januari 2013