Page 1

Shalat Jumat Di Mana? Masjid Raya Medan

Lihat hal. C4 Dan C5

Demi Kebenaran Dan Keadilan


Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

JUMAT, Wage, 10 Januari 2014/8 Rabiul Awal 1435 H

No: 24456 Tahun Ke-67

Terbit 28 Halaman (A1-12, B1-8, C1-8)

Harga Eceran: Rp2.500,Waspada/Dickson Pelawi

SALAH satu mata air yang muncul di perladangan warga di Kabanjahe, Kamis (9/1).

Air Terjun Niagara Beku AIR Terjun Niagara tampak membisu. Air tak lagi sepenuhnya mengalir deras ke permukaan sungai. Pesona wisata dunia itu berubah menjadi es, membeku untuk sementara. Musim dingin membuat Niagara berhenti mengucur, tapi bukan berarti kecantikannya memudar. Pemandangan yang luar biasa ini merupakan momentum penting bagi para wisatawan. Mereka mengabadikan kejadian yang begitu langka. Niagara terakhir kali membeku seperti ini pada 1848, kemudian catatan dipecahkan pada 8 Januari 2014. Air terjun raksasa itu kembali membeku di bawah suhu -16 derajat Celsius. Lalu dikombinasikan dengan hembusan angin, membawa para pengunjung seperti hidup mengarungi suhu -28 derajat Celsius.

Lanjut ke hal A2 kol. 2

6 Mata Air Muncul Di Kabanjahe


KABANJAHE (Waspada): Enam titik mata air mendadak muncul di dekat pemukiman warga di Jl. Samura,Kompleks Madrasah Kabanjahe. Ada dugaan, munculnya mata air tersebut akibat pengaruh erupsi Gunung Sinabung. Menurut warga kepada Waspada di Kabanjahe Kamis(9/1), munculnya mata air tersebut sudah berlangsung sebulan terakhir. Hal ini baru pertama kali terjadi dan berada di perladangan yang sudah lama dikelola. Pantauan Waspada, salah satu mata air membanjiri lahan pertanian warga. Tanaman cabe yang berada di areal tersebut tampak membusuk.

PEMANDANGAN air terjun Niagara, AS, Kamis (9/1) tampak membeku ketika suhu udara mencapai -18 derajat Celcius hingga- 28 derajat Celcius. Rencananya pemerintah AS akan memindahkan 240 juta penduduk di sekitar lokasi pada pertengahan Januari mendatang.

Lanjut ke hal A2 kol. 1

TNI Dan Polri Harus Netral Presiden Tolak Pemberian Gelar Jenderal Besar Dan TNI JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono (SBY)kembali menegaskan pentingnya netralitas Tentara Nasional Indonesia (TNI) dan Polri dalam pemilu 2014. “Saya sudah sering menegaskan dan saya akan mengatakan kembali, netralitas TNI/

Polri itu bukan hanya harapan selaku Kepala Pemerintahan/ Negara tetapi juga para elit politik

dan juga rakyat Indonesia,” kata PresidenYudhoyono saat memberikan pembekalan kepada para petinggi TNI dan Polri yang melaksanakan rapat pimpinan di Jakarta, Kamis (9/1). Rapim TNI dan Polri kali ini bertema, TNI dan Polri siap amankan pemilu 2014. Dalam

kesempatan itu, selain para pimpinan TNI dan Polri tampak pula sejumlah menteri, di antaranya Menteri Koordinator Politik, Hukum dan Keamanan Djoko Suyanto, Menteri Dalam Negeri Gamawan Fauzi, Menteri Luar Negeri Marty Natalegawa, Menteri Koordinator Ekonomi

Hatta Rajasa, Menteri Koordinator Kesejahteraan Rakyat Agung Laksono dan Jaksa Agung Basrief Arief. Presiden mengatakan, pemilu 2004 dan 2009 telah berhasil dilaksanakan dengan sukses. TNI dan Polri juga sukses dalam menjaga netralitasnya. Untuk

itu, Presiden mengapresiasi hal itu, dan berharap pada 2014 dapat kembali dipertahankan. Presiden menambahkan, tugas dan kewajiban TNI dan Polri adalah memastikan agar pemilu dapat berlangsung tertib dan aman sehingga pemilu dapat berjalan sukses yaitu pemilu

yang demokratis, jujur dan adil. Presiden dalam kesempatan itu juga mengimbau masyarakat turut menjaga agar pemilu berlangsung aman dan tertib. Presiden meminta segala masalah dalam pemilu dapat diselesaikan melalui jalur hukum yang telah disediakan dan menghindarkan

diri dari tindakan anarkis. Presiden juga menyeru kepada para elit politik untuk mengendalikan emosi dirinya, maupun para pendukungnya sehingga menghindarkan aksiaksi kekerasan yang mungkin terjadi. Lanjut ke hal A2 kol. 6

311 Kepala Daerah Tersandung Korupsi MEDAN (Waspada): Sebanyak 311 kepala daerah di Indonesia tersandung kasus dugaan korupsi. Dari 311 tersebut, 302 merupakan hasil laporan dari BPK yang dilanjutkan ke Komisi Pemberantasan Korupsi (KPK), selebihnya Operasi Tangkap Tangan (OTT). Anggota Badan Pemeriksa Keuangan (BPK) Pusat Ali Masykur Musa kepada wartawan di Medan, Kamis (9/1) menga-

Waspada/David Swayana

LAHAR dingin yang membawa batang pepohonan meluncur dari puncak Gunung Sinabung. Hujan yang mengguyur kawasan Gunung Sinabung, Kamis (9/1) membuat volume lahar dingin meningkat. Lokasi tersebut berada dalam radius 1 - 1,5 km di kaki Gunung Sinabung.

Kaban Meninggal Diduga Lahar Dingin Kaget Erupsi Sinabung Meluncur KABANJAHE (Waspada): Benteng Kaban, 50, warga Desa Beganding, Kec.Simpang Empat, Kab.Karo, tewas diduga kaget mengetahui Gunung Sinabung mengalami erupsi. Kaban mengembuskan nafas terakhirnya di tepi Jl. Katepul Kabanjahe, tak jauh dari SMK Imanuel Kabanjahe. Informasi Waspada himpun, mayat korban diketahui warga Kamis (9/1) siang, kemudian dilaporkan ke Polres Karo. Jasad korban dievakuasi ke RSU Kabanjahe. Hasil pemeriksaan dokter, tidak ditemukan tanda-tanda kekerasan fisik di tubuh korban. Seorang keluarga korban mengaku Br Kaban mengatakan, Benteng Kaban sudah sejak dua hari lalu berada di Kabanjahe. Korban mengungsi di rumahnya karena tidak tahan dengan debu vulkanik yang menghujani desanya. “Dia sempat berobat ke dokter disini. Setelah berobat, dia langsung tinggal dirumah saya. Dia trauma melihat Sinabung meletus,” katanya dan menambahkan, Kaban sebelum meninggal dunia sempat memperhatikan kondisi gunung yang tengah meletus.Saat itu dia bermaksud menuju salah satu warung kopi di sekitar rumahnya. (a36)

KABANJAHE (Waspada): Material vulkanik yang terbawa arus lahar dingin yang meluncur dari puncak Gunung Sinabung, Kamis (9/1), memutuskan jalan dua desa, yakni Desa Suka Meriah dan Desa Bekerah. Luncuran lahar dingin mengikuti jalur lahar sebelumnya. Pantauan Waspada di lapangan, turunnya lahar dingin diawali hujan yang mengguyur kawasan tersebut. Tetapi, akibat luncuran lahar dingin tersebut, akses jalan yang menghubungkan Desa Suka Meriah, Kec. Simpang Empat dengan Desa Bekerah, Lanjut ke hal A2 kol. 4

takan, korupsi yang dilakukan kepala daerah tersebut 65 persen dilakukan dengan mark up belanja barang. “Jenis korupsi yang sering dilakukan kepala daerah yakni mark up belanja barang yang persentasenya mencapai 65 persen. Selain itu ada juga bantuan sosial (Bansos) fiktif dengan persentase 15 persen,” ujar Ali Masykur. Lanjut ke hal A2 kol. 1

Sopir Indomaret Dirampok Rp80 Juta Raib LUBUKPAKAM (Waspada): Modus baru. Sekawanan penjahat berjumlah 4 orang berhasil melarikan uang Rp 80 juta milik PT Indomarco Pristama Indomaret setelah menghentikan mobil box perusahaan waralaba itu dan menuduh sopirnya menyerempet mobil kawanan tersebut di Jl.Sudirman, Kel.Paluh Kemiri, Lubukpakam, Kamis (9/1) dinihari. Informasi Waspada peroleh, malam itu usai membagi barang dari Lubukpakam, sopir mobil box milik Indomaret Feri Gunawan, 28, warga Jl. Bakti, Desa Sekip, Kec. Lubukpakam, Deliserdang akan kembali ke kantornya di Tanjungmorawa. Setibanya di Jl. Sudirman, tak jauh dari Rumah Makan Tobasa, mobil box BK 8996 MN yang dikemudikan korban dipepet kemudian dihadang oleh mobil minibus warna hitam. Korban terpaksa mengerem mendadak mobilnya. Dari dalam mobil minibus tersebut, 2 pria bertubuh tegap berambut pendek dan membawa pistol mendatanginya sambil marah-marah. Salah seorangnya mengacungacungkan pistol dan menyuruh korban keluar dari dalam mobil box nya. Kawanan itu menuduh mobil yang dikemudikan korban menyerempet bodi samping kanan mobil minibus yang dikenderai mereka.

Lanjut ke hal A2 kol. 1

Sekjen DPR Akbar: Memilih Pemimpin Dicecar Soal Tanggungjawab Rakyat MEDAN (Waspada): Tokoh orang pemimpin masih harus eksponen Angkatan ‘66 Akbar memikirkan kepentingan diri Gaji Akil mengatakan, memilih pemim- dan kelompok, dia tidak akan JAKARTA (Waspada): Sekretaris Jenderal Dewan Perwakilan Rakyat, Winantuningtyastiti mengaku diperiksa oleh penyidik Komisi Pemberantasan Korupsi seputar Akil Mochtar ketika menjabat sebagai anggota DPR RI. “Mengenai pengangkatan, pemberhentian, slip gaji penghasilan,” ujar Winantuningtyastiti, usai menjalani pemeriksaan, Kamis (9/1). Winantuningtyastiti menuturkan, telah memberikan Lanjut ke hal A2 kol. 7

pin adalah tanggungjawab seluruh rakyat Indonesia. ‘’ Pemimpin itu harus sudah selesai dengan kepentingan pribadi dan golongannya sehingga waktu dan tenaganya dapat dipergunakan untuk kepentingan bangsa,’’ kata Akbar pada acara Dialog Nasional memperingati 48 tahun Tri Tura Keluarga Besar Angkatan’66 Sumatera Utara dalam Mencari Pemimpin Berkarakter Pancasila di Hotel Madani Jl.SM Raja Medan, Kamis(9/1). Menurut Akbar, kalau se-

Anak Pengungsi Bermain Sambil Menunggu Giliran Belajar

Al Bayan

Mengenal Allah Oleh Tgk. H. Ameer Hamzah Dengan nama Allah Yang Maha Pengasih lagi Maha Penyayang. Segala puji bagi Allah Tuhan Pencipta semesta alam. Yang Maha Pengasih lagi Maha Penyayang. Raja Yang Menguasai hari Kemudian (QS. Alfatihah: 1 –3). Aku naik saksi, tidak ada tuhan selain Allah, dan Muhammad adalah rasul Allah(Makna Syahadatain). ALLAH Subhanahu wa Ta’ala pengcipta alam semesta (2:117). Tujuh lapis langit dan tujuh lapis bumi serta isi di antara keduanya.(2:284). Tidak ada tuhan selain Allah, Dia yang Maha Esa, tempat makhluk berharap, tidak beranak dan diperanakkan, tidak ada yang serupa denganNya. Dia Khaliq (pencipta) selain-Nya adalah makhluk (yang diciptakan). Lanjut ke hal A2 kol. 6 Waspada Daily


RAPIM TNI DAN POLRI: Presiden Susilo Bambang Yudhoyono berfoto bersama Panglima TNI Jenderal TNI Moeldoko (ketiga kanan), Kapolri Jenderal Polisi Sutarman (kedua kanan), KSAD Jenderal TNI Budiman (kanan), Menko Polhukam Joko Suyanto (ketiga kiri), Menko Perekonomian Hatta Rajsa (kedua kiri), Menko Kesra Agung Laksono (kiri) dan sejumlah perwira tinggi seusai memberikan pengarahan dalam Rapim TNI Polri di Auditorium Perguruan Tinggi Ilmu Kepolisian Jakarta, Kamis (9/1).


Waspada/David Swayana

SEJUMLAH bocah laki-laki bermain di lokasi penampungan pengungsi Masjid Agung Kabanjahe, Kamis (9/1)

MENDUNG menyelimuti Kota Kabanjahe, Kamis (9/1) pagi. Warga yang bermukim di daerah berhawa sejuk ini terlihat sibuk dengan aktivitas masing-masing. Umumnya mereka bekerja di instansi pemerintah dan swasta dan tidak sedikit yang berprofesi sebagai pedagang. Namun kesibukan nyaris tidak terlihat di tempat penampungan pengungsi Masjid Agung Kabanjahe. Sebagian pengungsi hanya duduk di lantai aula lantai 1 masjid tersebut. Pengungsi lainnya terlihat sibuk memasak untuk bersantap siang. Kepasrahan terlihat jelas dari raut wajah mereka. Mereka masih terus menanti di tempat penampungan hingga Gunung Sinabung tidak ‘batuk’ lagi. Pemandangan berbeda terlihat di kalangan anak-anak pengungsi. Puluhan bocah yang masih duduk di bangku Sekolah Dasar (SD) itu, asyik bermain. Seakan tidak ada beban dalam hidup mereka. Padahal rumah milik orangtua mereka yang berada di sekitar kaki Gunung Sinabung, sewaktu-waktu dapat luluh lantak diterjang awan panas atau guguran lava pijar dan lontaran batu. Ketika Waspada menghampiri mereka, seorang bocah pengungsi yang duduk di bangku Kelas IV SD menceritakan tentang kesibukan anak-anak pengungsi setiap hari di tempat penampungan. Lanjut ke hal A2 kol. 3

pernah bisa maksimal memikirkan kepentingan bangsa. Untuk itu, kata Akbar, rakyat Indonesia harus memlih pemimpin yang benar karena itu merupakan tanggungjawab kita bersama. Sementara Ryamizad Ryacudu yang juga pembicara dalam acara tersebut menitik beratkan sosok pemimpin itu harus bisa mengutamakan kepentingan nasional di antara kepentingan persahabatan dengan negara lain. Lanjut ke hal A2 kol. 3

Ada-ada Saja Tantangan Makan Kaktus UNTUK membuktikan dirinya sebagai seorang penggila tantangan, pria ini melakukan aksi gila dengan memakan tumbuhan kaktus. Menamakan dirinya LA Beast, ia nekad makan kaktus Lanjut ke hal A2 kol. 2

Serampang - Jangan deking sana-sini ya... - He...he...he...

Harga Eceran Rp2.500

Air Terjun Niagara Beku

Demi Kebenaran Dan Keadilan


AIR Terjun Niagara tampak membisu. Air tak lagi sepenuhnya mengalir deras ke permukaan sungai. Pesona wisata dunia itu berubah menjadi es, membeku untuk sementara. Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) Musim dingin membuat Niagara berhenti mengucur, ISSN: 0215-3017 tapi bukan berarti kecantikannya memudar. Pemandangan yang luar biasa ini merupakan momentum penJUMAT, Wage, 10 Januari 2014/8 Rabiul Awal 1435 H No: 24456 * Tahun Ke-68 Terbit 28 Halaman ting bagi para wisatawan. Mereka mengabadikan kejadian yang begitu langka. Niagara terakhir kali membeku seperti ini pada 1848, kemudian catatan dipecahkan pada 8 Januari 2014. Air terjun raksasa itu kembali membeku di bawah suhu -16 derajat celsius. Lalu dikombinasikan dengan hembusan angin, membawa para pengunjung seperti hidup mengarungi suhu -28 derajat celsius. Seperti dilansir laman Daily Mail, cuaca ini mempengaruhi keseharian 240 jiwa yang tinggal di Amerika Serikat dan Kanada, kedua negara yang dibelah oleh Air Terjun Niagara. Dengan suhu sedingin itu, orang berpikir bahwa wisatawan tak akan betah dan beranjak pergi. Tapi dugaan itu salah. Mereka justru bertahan mengabadikan lanskap yang luar biasa. Tidak semua bagian Niagara membeku. Masih ada kerumunan air yang mengantre untuk jatuh ke sungai. Tapi mereka tertahan es sehingga harus turun perlahan-lahan. Untungnya prediksi cuaca mengatakan, suhu yang tak wajar itu diperkirakan mereda minggu ini. Es-es akan mencair lagi. Wisatawan tak lagi harus menggigil untuk melihat Reuters g a g a h n y a A i r Te r j u n NIAGARA MEMBEKU : Pemandangan curah air terjun Niagara, AS, Kamis (9/1) tampak membeku ketika suhu udara mencapai -18 derjat celcius hingga Niagara. (vn/m09) - 28 derjat celcius. Rencananya pemerintah AS akan memindahkan 240 juta penduduk di sekitar lokasi pada pertengahan Januari mendatang.

Waspada/David Swayana

LAHAR dingin yang membawa batang pepohonan meluncur dari puncak Gunung Sinabung. Hujan yang mengguyur kawasan Gunung Sinabung, Kamis (9/1) membuat volume lahar dingin meningkat. Lokasi tersebut berada dalam radius 1 - 1,5 km di kaki Gunung Sinabung.

Lahar Dingin Putus Jalan Dua Desa KABANJAHE (Waspada): Material vulkanik yang terbawa arus lahar dingin yang meluncur dari puncak Gunung Sinabung, Kamis (9/1), memutuskan jalan dua desa, yakni Desa Suka Meriah dan Desa Bekerah.Luncuran lahar dingin meluncur mengikuti jalur lahar sebelumnya. Pantauan Waspada di lapangan, turunnya lahar dingin diawali hujan yang mengguyur kawasan tersebut. Namun, volume lahar dingin ini lebih kecil dibanding sebelumnya. Tetapi, akibat luncuran lahar dingin tersebut, akses jalan yang menghubungkan Desa Suka Meriah, Kec. Simpang Empat dengan Desa Bekerah, Kec. Namanteran, terputus. Lahar dingin berwarna kecoklatan dan lumpur berwarna kehitaman yang membawa puluhan batang kayu dan material vulkanik lainnya mengalir dengan ketinggian hingga satu meter dari permukaan badan jalan dan menerjang areal pertanian yang berada di kawasan tersebut hingga rusak parah. Tim Waspada yang berada di lokasi dalam radius berkisar 1 - 1,5 kilometer, sempat mendengar beberapa kali dentuman yang menggelegar dari puncak Sinabung. Namun hujan disertai kabut tebal membuat turunnya material vulkanik dari kawah gunung tidak terlihat. Sementara itu, ratusan rumah di Desa Bekerah dan Desa Suka Nalu yang berada tidak jauh dari lokasi lahar terlihat kosong karena ditinggal penghuninya untuk mengungsi. Hanya beberapa ekor anjing terlihat di perkampungan itu. Seorang warga Desa Bekerah bermarga Tarigan yang saat itu sedang melihat ladangnya di sana mengatakan, luncuran lahar dingin meluluhlantakkan areal pertanian milik warga. Lanjut ke hal A2 kol 2

TNI/Polri Harus Netral JAKARTA (Antara): Presi-den Susilo Bambang Yudho-yono kembali menegaskan pentingnya netralitas Tentara Nasional Indonesia (TNI) dan Polri dalam pemilu 2014. “Saya sudah sering mene-gaskan dan saya akan mengatakan kembali, netralitas TNI/Polri itu bukan hanya harapan

selaku Kepala Pemerintahan/ Negara tetapi juga para elit politik dan juga rakyat Indonesia,” kata Presiden Yudhoyono saat memberikan pembekalan kepada para petinggi TNI dan Polri yang melaksa-

nakan rapat pimpinan di Jakarta, Kamis (9/1). Rapim TNI dan Polri kali ini bertema, TNI dan Polri siap amankan pemilu 2014. Dalam kesempatan itu, selain para pimpinan TNI dan Polri tam-

pak pula sejumlah menteri, di antaranya Menteri Koordinator Politik, Hukum dan Keamanan Djoko Suyanto, Menteri Dalam Negeri Gamawan Fauzi, Menteri Luar Negeri Marty Natalegawa, Menteri

Koordinator Ekonomi Hatta Rajasa, Menteri Koordinator Kesejahteraan Rakyat Agung Laksono dan Jaksa Agung Basrief Arief. Presiden mengatakan, pemilu 2004 dan 2009 telah

berhasil dilaksanakan dengan sukses. TNI dan Polri juga sukses dalam menjaga netralitasnya. Untuk itu, Presiden mengapresiasi hal itu, dan berharap pada 2014 dapat kembali dipertahankan.

Presiden menambahkan, tugas dan kewajiban TNI dan Polri adalah memastikan agar pemilu dapat berlangsung tertib dan aman sehingga Lanjut ke hal A2 kol 1

Pernyataan Panglima TNI Soal Australia Dipertanyakan JAKARTA (Antara): Pernyataan Panglima TNI Jenderal Moeldoko bahwa ia memahami langkah-langkah taktis kebijakan Australia yang mengembalikan kapal pencari suaka ke Indonesia dipertanyakan Guru Besar Hukum Internasional FH UI Hikmahanto Juwana. “Pernyataan Panglima ini aneh dan tidak berpihak pada kepentingan Indonesia,” kata Hikmahanto dalam pertanyataan tertulisnya, di Jakarta, Kamis (9/1). Pertama, kata Hikmahanto, para pencari suaka sehaAntara

ATM BANK MANDIRI DIBOM: Seorang petugas Gegana melakukan penyisiran Tempat Kejadian Perkara (TKP) ledakan di ATM Bank Mandiri Karangploso, Malang, Jawa Timur, Kamis (9/ 1). Radius ledakan yang diperkirakan mencapai 15 meter tersebut diduga akibat bom.

Tindak Kriminalitas Di RSUD Djasamen Saragih Sering Terjadi P E M ATA N G S I A N TA R (Waspada): Tindak kriminalitas terhadap pasien di ruang rawat inap, khususnya di paviliun RSUD Dr. Djasamen Saragih, Jl. Sutomo, Pematangsiantar, sudah sering terjadi, namun pengamanan di rumah sakit itu tetap belum memadai. Tindak kriminilitas tersebut yakni penodongan terhadap pasien. Informasi Waspada peroleh seringnya terjadi peno-

dongan di rumah sakit pemerintah itu terungkap, setelah seorang pasien rawat inap, Widiany Harahap, 27, yang juga ajudan Kajari Pematangsiantar melaporkan penodongan terhadapnya ke Polres setempat. Korban yang mengalami demam tinggi dirawat di satu ruang paviliun B, menyebutkan pelaku seorang pria bertubuh tinggi, kurus dan memiliki alis tebal serta memakai

Al Bayan

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 6

Indonesia Tiru Bandara Heathrow JAKARTA (Antara): Keterlambatan jadual penerbangan di Indonesia sudah mengkhawatirkan dan pemerintah menyatakan memberi perhatian serius soal itu, termasuk fasilitas di Bandar Udara Internasional Soekarno-Hatta, Banten. Wakil Presiden, Boediono, mengatakan, keluhan masyarakat soal itu menjadi perhatian penuh pemerintah untuk segera membenahi pengelolaan dan fasilitas Bandara Soekarno-Hatta. “Untuk itu pemerintah mengelar rapat membahas secara rinci, mengenai perbaikan dan kelancaran Bandara Soekarno-Hatta,” kata

Boediono, di Jakarta, Kamis (9/1). Boediono memimpin rapat evaluasi infrastruktur perhubungan udara tentang perbaikan dan manajemen pengelolaan bandara. Rapat di Kantor Wakil Presiden, Jalan Medan Merdeka Selatan, Jakarta Pusat, dihadiri Menteri Perhubungan, EE Mangindaan, Menteri BUMN, Dahlan Iskan, dan pemegang otoritas terkait. Boediono membandingkan keadaan di London, yang memiliki empat bandar udara, dan terbesar adalah Bandar Udara Internasional Heathtrow. Lanjut ke hal A2 kol 4


RAPIM TNI DAN POLRI: Presiden Susilo Bambang Yudhoyono (tengah) berfoto bersama Panglima TNI Jenderal TNI Moeldoko (ketiga kanan), Kapolri Jenderal Polisi Sutarman (kedua kanan), KSAD Jenderal TNI Budiman (kanan), Menko Polhukam Joko Suyanto (ketiga kiri), Menko Perekonomian Hatta Rajsa (kedua kiri), Menko Kesra Agung Laksono (kiri) dan sejumlah perwira tinggi seusai memberikan pengarahan dalam Rapim TNI Polri di Auditorium Perguruan Tinggi Ilmu Kepolisian (PTIK) Jakarta, Kamis (9/1). Rapim tersebut mengambil tema TNI dan Polri siap mengamankan Pemilu tahun 2014.

Sebulan Bersembunyi Di Gunung, Tersangka Pembantai Gadis Ditangkap TAPAKTUAN(Waspada): Setelah sebulan lebih melarikan diri dan bersembunyi di kawasan pegunungan, tersangka pembantai gadis Levi, 19,warga Gampong Jambo Dalem, Kec.Trumon Timur, Aceh Selatan, Kamis (9/1) siang, berhasil ditangkap. Penangkapan M.Amin,35, warga setempat berlangsung dramatis. Ia terkepung ratusan personil tim gabungan TNI, Polri, Satpol PP dan masya-

rakat yang melakukan penyisiran kawasan pegunungan. Setelah sebilah golok terhunus berhasil direbut di tangannya, ia bisa ditangkap dan dibawa turun ke perkampungan. Pasca penangkapan, orang tua dan keluarga korban Levi, sempat mengamuk begitu melihat tersangka dan berusaha menerobos pengawalan aparat guna menyerang tersangka hingga membuat suasan menjadi panas. Kondisi

Sinabung Erupsi, Mata Air Muncul Di Kabanjahe

Mengenal Allah Oleh: H. Ameer Hamzah Dengan nama Allah Yang Maha Pengasih lagi Maha Penyayang. Segala puji bagi Allah Tuhan Pencipta semesta alam. Yang Maha Pengasih lagi Maha Penyayang. Raja Yang Menguasai hari Kemudian (QS. Alfatihah: 1 –3). Aku naik saksi, tidak ada tuhan selain Allah, dan Muhammad adalah rasul Allah (Makna Syahadatain). ALLAH Subhanahu wa Ta’ala pengcipta alam semesta (2:117). Tujuh lapis langit dan tujuh lapis bumi serta isi di antara keduanya.(2:284) Tidak ada tuhan selain Allah, Dia yang Maha Esa, tempat makhluk berharap, tidak beranak dan diperanakkan, tidak ada yang serupa dengannya. Dia Khaliq (pencipta) selain-Nya adalah makhluk (yang diciptakan).

Lanjut ke hal A2 kol 2 Waspada Daily

masker.Dia ditodong dengan obeng besar Rabu (8/1) pukul 04:00. Pelaku mengancam akan membunuhnya bila berteriak dan minta korban menyerahkan harta bendanya. Korban yang ketakutan menyerahkan dompetnya berisi sejumlah uang, kartu ATM, KTP dan kartu pegawai. Setelah pelaku kabur,

rusnya dihormati hak-haknya sebagai pengungsi. Mereka ingin sampai ke Australia dengan selamat. Oleh karenanya tidaklah tepat bila otoritas Australia harus menghalau mereka ke Indonesia. Kedua, Australia adalah negara peserta Konvensi tentang Pengungsi 1951. Berdasarkan Konvensi ini maka Australia wajib menyaring di wilayahnya apakah seseorang pantas disebut sebagai pengungsi, pencari suaka atau imigran gelap (illegal immigrant).


K A B A N J A H E ( Waspada): Di tengah erupsi Gunung Sinabung, sedikitnya enam titik mata air mendadak muncul di dekat pemukiman warga di Jalan Samura Komplek Madrasah Kabanjahe. Kondisi ini sudah berlangsung sebulan terakhir. Warga khawatir lantaran hal ini baru pertama kali terjadi dan berada di perladangan yang sudah lama dikelola. Pantauan Waspada, salah satu mata air membanjiri lahan pertanian warga. Tanaman cabe yang berada di areal tersebut juga tampak membusuk. Dari lubang berbentuk lingkaran yang menganga dengan diameter sekitar 10-15 cm ini keluar air

Waspada/Dickson Pelawi

SALAH satu mata air yang muncul di perladangan warga di Kabanjahe,Kamis (9/1).

yang saat disentuh terasa dingin. Sementara, mata air lainnya justru mengalir ke kamar mandi umum Desa Katepul Kabanjahe. Warga di desa tersebut khawatir lantaran air tersebut biasa digunakan warga, termasuk dikonsumsi seharihari. Kepala Dinas Pertambangan dan Energi (Distamben) Kabupaten Karo, saat dikonfirmasi Waspada mengaku sudah menurunkan tim pemeriksa ke lokasi tersebut. Namun, ia belum mendapatkan laporannya. “Tadi sudah diturunkan tim ke lokasi untuk memeriksa kadar air tersebut. Tapi, sekarang Lanjut ke hal A2 kol 1

itu berakhir setelah aparat kepolisian melepaskan tembakan peringatan udara. “Tersangka yang diduga mengalami gangguan jiwa itu, tampak sehat dan badannya sedikit kurus. Ia terpaksa diboyong ke Tapaktuan guna mengantisipasi berbagai kemungkinan terburuk,”kata Bupati Aceh Selatan, melalui Asisten Ekonomi Pembanguanan Lanjut ke hal A2 kol 3

Ada-ada Saja

Tantangan Makan Kaktus UNTUK membuktikan dirinya sebagai seorang penggila tantangan, pria ini melakukan aksi gila dengan memakan tumbuhan kaktus. Menamakan dirinya LA Beast, ia nekad makan kaktus setelah melihat seorang Lanjut ke hal A2 kol 5

Serampang - Jangan deking sana-sini ya .... - He.... he....he....

Berita Utama


WASPADA Jumat 10 Januari 2014

Anak-anak Pengungsi Bermain Sambil Menunggu Giliran Belajar MENDUNG menyelimuti Kota Kabanjahe, Kamis (9/1) pagi. Warga yang bermukim di daerah berhawa sejuk ini terlihat sibuk dengan aktivitas masing-masing. Umumnya mereka bekerja di instansi pemerintah dan swasta dan tidak sedikit yang berprofesi sebagai pedagang. Namun kesibukan nyaris tidak terlihat di tempat penampungan pengungsi Masjid Agung Kabanjahe. Sebagian pengungsi hanya duduk di lantai aula lantai 1 masjid tersebut. Pengungsi lainnya terlihat sibuk memasak untuk bersantap siang. Kepasrahan terlihat jelas dari raut wajah mereka. Mereka masih terus menanti di tempat penampungan hingga Gu n u n g Si n a b u n g t i d a k ‘batuk’ lagi. Pemandangan berbeda terlihat di kalangan anak-anak pengungsi. Puluhan bocah yang masih duduk di bangku Sekolah Dasar (SD) itu, asyik bermain. Seakan tidak ada beban dalam hidup mereka. Padahal rumah milik orangtua mereka yang berada di sekitar kaki Gunung Sinabung, se-

waktu-waktu dapat luluh lantak diterjang awan panas atau guguran lava pijar dan lontaran batu. Ketika Waspada menghampiri mereka, seorang bocah pengungsi yang duduk di bangku Kelas IV SD menceritakan tentang kesibukan anak-anak pengungsi setiap hari di tempat penampungan. “Setiap hari kami hanya bermain. Kalau sekolah masuk siang, pukul 14:00 dan pulangnya pukul 15:00. Kami terpaksa menumpang belajar di sekolah lain agar tidak ketinggalan mata pelajaran. Karena menumpang di sekolah itu, kami harus menunggu giliran belajar. Kalau pagi, sekolah itu dipakai siswa lain. Setelah itu, giliran kami yang belajar di situ,” kata Minal, 12, warga Desa Sukanalu yang mengaku sudah dua bulan tinggal di pengungsian. Minal mengatakan, kisah pilu itu bukan saja masalah tempat tinggalnya di pengungsian,melainkan sekolahnya juga harus berpindahpindah. “Pertama sekolah saya di SD Sukanalu,karena meng-

ungsi terpaksa pindah ke SD III Kabanjahe.Sekarang di SD Sumbul Kabanjahe. Beginilah nasib kami selama hampir tiga bulan ini. Mau belajar pun susah,jadi kami hanya berdoa agar secepatnya tuntas soal Sinabung ini. Kalau memang meletus, ya sekarang inilah biar kami bisa cepat kembali ke kampung halaman kami,” katanya. Anak pasangan Ilham Panggabean dan Lina beru Ginting ini mengaku sejak mengungsi di masjid tersebut kegiatan proses belajarnya drastis menurun. Kalau belajar malam sudah pasti tidak bisa karena lokasi pengungsi sempit. “Jadi kalau mau belajar harus siang hari sebelum berangkat sekolah. Begitulah kami rasakan anak-anak yang disini yang sudah hampir tiga bulan ini,” ujarnya. Demikian juga dirasakan Vivi warga Sukanalu yang saat ini duduk di SMP Negeri 1 Namanteran, Kecamatan Namanteran,Kabupaten Karo. “Dengan terpaksa pindah sekolah akibat erupsi Gunung Sinabung ke SMP Negeri II Kabanjahe. Sudah hampir tiga

bulan disini sekolah. Kalau untuk makanan tidak ada masalah,namun kalau untuk belajar sangat susah. Kalau mau belajar pada malam hari tidak bisa karena tempatnya sempit,jadi harus curi waktu siang hari. Beginilah nasib kami sampai Sinabung aman,” katanya dengan mata berkacakaca. Ketika ditanya apakah dia masih per nah pulang ke kampung halamannya,gadis belia ini mengaku tidak pernah. “Kalau saya enggak pernah pulang ke rumah bang, paling yang pulang kadangkadang orangtua saja melihat tanam-tanaman yang masih hidup. Tapi kalau malam hari tetap pulang ke pengungsian ini. Kami mohon kepastian sampai kapan hidup seperti ini,” katanya. Sementara itu, Ikbal warga Desa Gurukinayan, Kec. Payung kelas II SD II Gurukinayan juga mengalami nasib yang sama dengan kedua pelajar tersebut. “Sudah dua bulan lebih saya pindah sekolah kesini karena mengungsi,” katanya. (m50/c10/m25)

Sinabung Erupsi ....

6 Hakim Dilapor Ke KPK

saya belum mendapatkan laporannya,” katanya. Sementara, Petugas Posko Pengamatan Gunung Api Sinabung PVMBG, Rahmad, mengatakan bahwa munculnya mata air tersebut tidak berhubungan dengan erupsi Gunung Sinabung. “Kalau airnya dingin tidak ada kaitannya,” katanya. (a36)

TNI/Polri .... pemilu dapat berjalan sukses yaitu pemilu yang demokratis, jujur dan adil. Presiden dalam kesempatan itu juga mengimbau masyarakat turut menjaga agar pemilu berlangsung aman dan tertib. Presiden meminta segala masalah dalam pemilu dapat diselesaikan melalui jalur hukum yang telah disediakan dan menghindarkan diri dari tindakan anarkis. Presiden juga menyeru kapada para elit politik untuk mengendalikan emosi dirinya, maupun para pendukungnya sehingga menghindarkan aksiaksi kekerasan yang mungkin terjadi. Semenrtara Kapolri Jenderal Sutarman dalam sambutannya mengatakan, Rapim TNI dan Polri saat ini dihadiri 336 pucuk pimpinan kedua lembaga. Sebanyak 168 dari Polri dan 168 dari TNI. Kapolri mengatakan, pihaknya siap untuk mengamankan pemilu 2014 agar berjalan lancar, tertib dan sukses. Hal yang sama juga diungkapkan oleh Panglima TNI Moeldoko. Moeldoko siap kapanpun dan dimanapun untuk membantu aparat kepolisian dalam mengamankan pemilu.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Md8+, Mf8. 2. Gxh7+, RxG. 3. MxM. Jawaban TTS: TTS

Mimbar Jumat

Waspada/Dickson Pelawi

MATA air membanjiri tanaman warga, Kamis (9/1).

8 7 9 4 3 2 6 5 1

3 6 2 1 5 7 9 4 8

4 5 1 8 6 9 2 7 3

6 9 4 2 1 8 5 3 7

5 1 7 3 9 4 8 6 2

2 8 3 6 7 5 4 1 9

1 2 6 5 8 3 7 9 4

9 4 5 7 2 1 3 8 6

7 3 8 9 4 6 1 2 5

JAKARTA (Antara): Komisioner Komisi Yudisial Eman Suparman melaporkan enam orang hakim ke Komisi Pemberantasan Korupsi (KPK) terkait kasus suap dalam pengurusan banding perkara korupsi dana bantuan sosial pemerintah Kota Bandung. ”Saya laporkan bersama surat dari terpidana, ada enam orang hakim, mohon maaf saya tidak boleh menyampaikan karena itu harus saya jaga baik sebelum dinyatakan bersalah oleh pengadilan,”

Wamenkumham Resmi Laporkan Loyalis Anas Ke Mabes Polri JAKARTA (Waspada): Wakil Menteri Hukum dan HAM Denny Indrayana akhirnya resmi melaporkan dua loyalitas Anas Urbaningrum, Juru Bicara Perhimpunan Pergerakan Indonesia (PPI) Ma’mun Murod dan Tri Dianto ke Bareskrim, Mabes Polri, Kamis (9/1). Didampingi pengacaranya, Denny membawa buktibukti fitnah Ma’mun dan Tri berupa kliping pemberitaan online dan koran. “Saya melaporkan saudara Murod dan Tri terkait fitnah di KPK Selasa lalu. Saya sudah beri kesempatan 1x24

Lahar Dingin .... “Semua tanaman kami hancur. Tidak tahu apa yang harus kami buat, sedangkan anak-anak kami butuh biaya. Saya takut ke kampung ini,tapi karena desakan ekonomi maka memberanikan diri ke sini pada siang hari. Kalau malam hari tetap di pengungsian di Kabanjahe,” katanya. Hancurnya tanaman warga bukan saja akibat lahar tetapi juga akibat debu vulkanik. Tanaman warga seperti padi dan cabe menjadi rusak setelah berulangkali dihujani debu vulkanik. Jadi warga sekitar kawasan tersebut tidak bisa berbuat apa-apa. “Kami hanya bisa pasrah dan menunggu keajaiban. Kalau mau pulang dari pengungsian takut, tapi kami sudah tidak tahan lagi di pengungsian. Kita bukan butuh makan saja, tapi butuh uang juga,” katanya. (m50/m25)

Al Bayan ....

Jawaban Sudoku:

Waspada/David Swayana

SEJUMLAH bocah laki-laki bermain di lokasi penampungan pengungsi Masjid Agung Kabanjahe, Kamis (9/1). Mereka menunggu giliran belajar di salah satu sekolah di Kabanjahe. Pemerintah setempat telah mengambil kebijakan untuk menempatkan anak-anak pengungsi tersebut di sekolah yang berada di Kabanjahe agar tidak ketinggalan mata pelajaran.

Dia yang mengciptakan manusia dari tanah, dari air mani yang hina. Dia yang menghidupkan dan mematikan. Dia yang membangkitkan manusia dalam kubur, dia yang menyusun tulang-belulang kembali dan jasad yang telah hancur. Dia yang menghamparkan bumi dan membentangkan langit, dan nanti (kiamat) Dia juga yang menggulung langit, menghancurkan planet-planet, matahari dan bulan bertabrakan, bintang-bintang menjadi debu. Gunung-gunung rata dengan tanah, air laut kering. Dan kiamatpun tiba. Allah pemilik surga yang penuh nikmat dan neraka yang sangat azab. Dua tempat itu penuh dengan manusia. Manusia yang baik dimasukkan dalam surga, dan yang buruk dlemparkan ke neraka. Allah Yang Maha pengasih dan penyayang kepada semua

jam untuk meminta maaf, tapi tidak digunakan dengan baik,” jelas Denny kepada pers, di Mabes Polri, Kamis (9/1). Menurut Denny, langkah hukum yang dilakukannya ini agar menjadi pelajaran. Tudingan Ma’mun soal pertemuan Denny, Bambang Widjojanto di Cikeas merupakan fitnah. “Jadi untuk pembelajaran dengan semuanya dan agar tidak menjadi preseden dan upaya pemeriksaan korupsi digunakan cara seperti ini,” terang Denny. Denny datang ke Mabes

Sebulan ....

Polri dengan menggunakan mobil dinasnya Toyota Camry. Menggunakan batik merah, Denny didampingi beberapa pengacara antara lain M Luthfi dan Mochtar Ali. Sebelumnya, sikap Denny menempuh langkah hukum mendapat dukungan dari berbagai kalangan. Atasannya, Menteri Hukum dan HAM Amir Syamsuddin, misalnya. “Agar masyarakat jangan mudah menciptakan cerita bohong,” ujar Amir kepada pers di sela-sela acara Rapat Pimpinan Polri dan TNI di Gedung PTIK, Jakarta. Amir menyatakan, la-

poran Denny adalah hak pribadi. Dia mendukung sepenuhnya dan yakin tudingan yang disampaikan Ma’mun Murod dan Tri Dianto tentang kunjungan ke Cikeas bersama komisioner KPK Bambang Widjojanto tidak benar. “Mana mungkin jam 2 dinihari,” kata Amir. Amir mengatakan, langkah ini sekaligus mendidik anggota masyarakat agar jangan mudah menyampaikan berita bohong yang men-cederai kredibilitas orang lain. “Langkah itu sudah benar,” jelasnya.(j02)

Indonesia Tiru ....

mendarat ataupun lepas landas. Sementara Bandara Udara Internasional Soekarno-Hatta, yang juga memiliki dua landasan secara maksimal cuma mampu menangani 64 pergerakan pesawat perjam, selisih 36 pergerakan perjam alias 56,25 detik perpergerakan pesawat terbang. Menurut Wapres, jika Indonesia bisa mengelola bandara sebaik Bandar Udara Internasional Heathrow maka kapasitasnya bisa meningkat. Satu “jurus” lain menuju ke sana adalah membangun landasan ketiga, namun agaknya akan ditunda karena memerlukan biaya sangat besar, Rp40 triliun.

Setdakab, Said Azhar. Pembantaian terhadap gadis Levi terjadi Minggu, (1/12/2013). Korban tewas seketika akibat dibacok tersangka di bagian leher, tetapi tersangka gagal memperkosanya karena keburu dihalau warga. Bahkan orang tua korban yang datang ke TKP beberapa saat kemudian, mau mengambil jenazah anaknya, sempat dikejar tersangka, namun selamat setelah massa datang ke TKP. Selanjutnya tersangka kabur dan bersembunyi di pegunungan. Para warga menjadi resah dan takut ke ladang karena tersangka dikenal galak dan brutal. Warga bersama Unsur Muspikanya, pernah menyisir pegunungan, tetapi gagal menemukannya, sehingga Bupati T Sama Indra akhirnya meminta bantuan TNI/Polri membur unya secara gabungan. (b30)

“Rapat memutuskan kita mengacu standar di beberapa bandar udara internasional, dan salah satu yang jadi acuan adalah Bandara Heathrow di London,” katanya. Menurut SkyTrax, Bandar Udara Internasional Heathrow ada di posisi ke-10 bandar udara terbaik di dunia, sementara peringkat wahid ditempati Bandar Udara Internasional Changi, Singapura. Ada beberapa hal yang bisa dipelajari di Heathrow bagi pemerintah Indonesia, di antaranya kapasitas pergerakan pesawat terbang dan kelancaran proses penerbangan di sana. Bandara Heathrow di London mampu menangani 100 pergerakan pesawat perjam dengan dua landasan pada saat cuaca baik. Kecepatan pelayanan dan tata kelola itu setara dengan 36 detik perpergerakan pesawat terbang! Baik

makhluk, tetapi di hari akhirat Allah hanya member perlindungan kepada hamba-hamba yang beriman, sedangkan yang kafir akan menerima siksaan dalam neraka. Allah Subhanahu wa Ta’ala telah menciptakan jin dan manusia. Manusia wajib menyembah Allah SWT sesuai dengan petunjuk para rasul di masanya masing-masing. Zaman sekarang hanya Islam petunjuk dari Muhammad SAW. selainnya telah dimensukhkan (dibatalkan). Meski begitu jelas dan terang, namun banyak manusia yang masih beragama dan berkeyakinan dengan agama yang telah dimensukhkan oleh Allah. Sebuah pertanyaan timbul. Mengapa Allah SWT membiarkan para kafir menguasai bumi? Ekonomi dan tehnologi mere k a l e b i h m a j u d a r i ekonomi dan tehnologi Kaum Muslimin? Masalah itu Cuma masa yang bergulir. Zaman

dulu kala, kaum ‘Ad dan Tsmaud yang palinrjaya. Setelah dua bangsa itu mundur, muncul Mesir Kuno, lalu Persia dan Romawi. Bangsa-bangsa itupun ada batasnya, kemudian giliran Islam menguasai dunia, sejak Daulah Umayyah smpai Turki Usmani, lebih kurang depalan ratus tahun. Kini giliran bangsa Barat, Amerika, Jepang dan Korea. Allah gilirkan hari-hari (masa) di antara manusia. Meski umat Islam saat ini dalam keterbelakangan, namun di sisi Allah umat Islam tetap yang lebih baik, sebab mereka tidak mempersekutukan Allah. Allah mengutus rasul-Nya (Muhammad SAW) membawa risalahNya (Agama Islam) dan kitab suci yang masih murni (Alquranul Karim). Rabb yang sebenarnya itulah Allah, selainnya adalah tuhantuhan palsu ciptaan dan rekaan manusia. Sesungguhnya Allah beserta kaum beriman.

Ada-ada Saja .... remaja melakukan hal itu di internet. Tak tanggung-tanggung, ia melahap dua buah kaktus, meski ribuan duri menusuk tangan, pipi, dan mulutnya. Pria asal Amerika Serikat itu menyelesaikan tantangan makan kaktus kurang dari enam menit dan mengunggah rekaman aksinya di situs Youtube yang kini mendapat lebih dari setengah juta hits. “Saya bukan orang pintar tapi saya tidak akan pernah makan kaktus,” tulis sebuah komentar di situs itu. LA Beast sebelumnya terkenal setelah menghabiskan 150 nugget ayam dalam sebuah tantangan, dan pernah mengikuti lomba makan sambal terpedas di dunia serta makan 36 telur mentah lengkap dengan cangkangnya. (net/rzl)

kata Eman, yang menjabat Ketua Bidang Pengawasan Hakim dan Investigasi Komisi Yudisial, di gedung KPK Jakarta, Kamis. Eman bertemu dengan Ketua KPK Abraham Samad dan Deputi Penindakan KPK Warih Sadono karena menerima laporan dari mantan Ketua Pengadilan Negeri Bandung Setyabudi Tejocahyono, yang divonis 12 tahun penjara karena menerima suap dalam penanganan banding perkara dana bantuan sosial Pemerintah Kota Bandung. “Komisi Yudisial menerima laporan dari terpidana yang mantan hakim, dia katakan bersedia menjadi justice collaborator, dan karena ini menyangkut masalah tindak pidana yang dilakukan beberapa hakim yang dilaporkan dalam kasus itu, maka tindak pidananya adalah kewenangan KPK,” kata dia. Menurut Eman, KPK akan segera menindaklanjuti la-

poran yang merupakan laporan Setyabudi itu.”Dia akan segera dibawa ke majelis kehormatan hakim atas usulan Mahkamah Agung, jadi kami tinggal menunggu penetapan dari Ketua Mahkamah Agung,” ungkap Eman. Eman menolak menyebutkan nama enam orang hakim yang dilaporkan dan hanya mengatakan bahwa di antaranya ada yang sudah pensiun. “Termasuk yang sudah pensiun, termasuk mantan ketua PT (Pengadilan Tinggi),” jelasnya. Komisi Yudisial sudah tidak memiliki kewenangan terhadap hakim yang sudah pensiun, tapi KPK masih bisa menangani tindak pidananya. “Tidak ada halangan bagi KPK untuk menindaklanjuti siapa pun selagi masih warga Indonesia dan masih hidup, itu intinya karena sesungguhnya KPK sendiri sedang berjalan, dan ditambah lagi informasi dari kami, yang jelas kalau KY

hanya berwenang terhadap hakim yang masih aktif,” tambah Eman. Guru Besar Hukum Perdata tersebut mengatakan bahwa pengusutan kasus tersebut di KPK sudah sampai ke tahap penyelidikan. “Kalau yang saya dengar begitu, tapi saya tidak tanya lebih jauh tentang progress-nya, sedangkan proses untuk enam hakim di KY saat ini sudah berjalan dan sudah didalami juga,” ungkap dia. Dalam kasus ini, KPK antara lain sudah pernah memeriksa Ketua Pengadilan Negeri Bandung Singgih Budi Prakoso, Hakim Pengadilan Tinggi Jawa Barat Wiwik Widjiastuti, dan mantan Ketua Pengadilan Tinggi Jawa Barat Sareh Wiyono. KPK juga sudah memeriksa hakim Pengadilan Tinggi Jawa Barat CH Kristi Purnamiwulan serta dua rekan Setyabudi saat menangani perkara bantuan sosial yaitu Ramlan Comel dan Djodjo Djauhari.

311 KDh Tersandung Korupsi MEDAN (Waspada): Sebanyak 311 kepala daerah (Kdh) di Indonesia tersandung kasus dugaan korupsi. Dari 311 tersebut, 302 merupakan hasil laporan dari BPK yang dilanjutkan ke Komisi Pemberantasan Korupsi (KPK), selebihnya Operasi Tangkap Tangan (OTT). Anggota Badan Pemeriksa Keuangan (BPK) Pusat Ali Masykur Musa kepada wartawan di Medan, Kamis (9/1) mengatakan, korupsi yang dilakukan kepala daerah ter-

sebut 65 persen dilakukan dengan mark up belanja barang. “Jenis korupsi yang sering dilakukan kepala daerah yakni mark up belanja barang yang persentasenya mencapai 65 persen. Selain itu ada juga bantuan sosial (Bansos) fiktif dengan persentase 15 persen,” ujar Ali Masykur. Dia mengatakan, untuk penyelewengan dana Bansos itu umumnya dilakukan kepala daerah menjelang Pilkada. Korupsi yang dilakukan

kepala daerah tersebut, lanjutnya, jelas merugikan negara yang mencapai Rp36,7 triliun pada 2012 dari total ABPN Rp1.760 triliun. Ali Masykur,juga calon presiden Konvensi Partai Demokrat itu menyebutkan, di Sumut ada 6-7 kepala daerah yang tersandung dugaan korupsi berdasar catatan 3 tahun terakhir. Berdasarkan ur u t a n p r ov i n s i , Su m u t merupakan urutan ketiga terkorup setelah Provinsi Papua dan Maluku. (m41)

Kaget Sinabung, Kaban Tewas KABANJAHE (Waspada): Benteng Kaban, 50, warga Desa Beganding, Kec.Simpang Empat, Kab.Karo, tewas diduga kaget mengetahui Gunung Sinabung mengalami erupsi. Kaban mengembuskan nafas terakhirnya di tepi Jl. Katepul Kabanjahe, tak jauh dari SMK Imanuel Kabanjahe.

Informasi Waspada himpun, mayat korban diketahui warga Kamis (9/1) siang, kemudian dilaporkan ke Polres Karo. Jasad korban dievakuasi ke RSU Kabanjahe.Hasil pemeriksaan dokter, tidak ditemukan tanda-tanda kekerasan fisik di tubuh korban.

Seorang keluarga korban mengaku Br Kaban mengatakan, Benteng Kaban sudah sejak dua hari lalu berada di Kabanjahe. Korban mengungsi di rumahnya karena tidak tahan dengan debu vulkanik yang menghujani desanya. (a36)

Tindak Kriminal ....

ku diduga masuk dari kamar yang melintang di depan Paviliun B yang tembus ke kantor PMI persis di pinggir jalan. Humas RSUD Dr. Djasamen Saragih Dr. Andi Rangkuti kepada wartawan mengaku terkejut mendengar penodongan sudah sering terjadi di Paviliun B. Menurut Rangkuti, pihaknya akan meningkatkan jumlah petugas keamanan di seluruh ruangan

rumah sakit dan lebih serius berjaga. Kapolres Pematangsiantar AKBP Slamet Loesiono, SIK saat dikonfirmasi melalui Kasubbag Humas AKP Nuriaman Ray Rangkuti dan Kasat Reskrim AKP H. Sinambela, SH, Kamis (9/1) sore menyebutkan, ia telah menerima laporan tentang dugaan penodongan itu, dan sudah menindaklanjutinya. (a30)

cari suaka kepentingan Indonesia sedang berhadap-hadapan dengan kepentingan Australia. Bila Panglima TNI berposisi sebagai Panglima Angkatan Perang Australia maka kedaulatan NKRI sudah pasti runtuh. Keempat, Panglima TNI merujuk pada Deklarasi PBB terkait dengan kedaulatan. Padahal Deklarasi PBB dalam hukum internasional tidak masuk dalam sumber hukum internasional. “Lalu pengutipan Deklarasi PBB untuk apa? Pengutipan tersebut justru memperlemah posisi Indonesia dihadapan Australia dalam penanganan masalah pencari suaka,” katanya. Hikmahanto mempertanyakan mengapa Panglima

TNI tidak mengutip sumber hukum internasional yang jelas yaitu Konvensi tentang Pengungsi. Konvensi yang jelasjelas membebankan kepada negara pesertanya, termasuk Australia, untuk memberi perlindungan bagi para pengungsi dan pencari suaka. Terakhir, kebijakan menghalau kapal pencari suaka PM Abbott sehar usnya tidak dihargai oleh Panglima TNI. Hal ini karena sebagaimana diungkap oleh media Australia mengandung kekerasan dan pelanggaran HAM. Dari cerita para pencari suaka ternyata mereka diperlakukan kasar oleh otoritas Australia. Apalagi tindak kekerasan ini bisa jadi terjadi di wilayah laut ter itorial Indonesia.

korban berteriak minta tolong dan memanggil perawat yang sedang berjaga. Namun, ketika korban menceritakan peristiwa yang dialaminya, sang perawat justru mengatakan, kejadian seperti itu sudah sering di Paviliun B. Satpam RSUD yang menerima laporan segera memeriksa sekitar paviliun B, namun pelakunya sudah tak ada. Pela-

Pernyataan .... Pemerintah Australia tidak seharusnya menolak para pencari suaka ini ke Indonesia. Pemerintah Australia licik karena mereka tidak mau melakukan penyaringan dengan cara menghalau para pencari suaka sebelum sampai ke wilayah kedaulatan Australia. Ketiga, kata-kata Panglima TNI yang mengatakan “bila tugas menghalau kapal pencari suaka diproyeksikan ke saya, saya juga akan melakukan hal yang sama.” Pernyataan ini sama sekali tidak mencerminkan kepentingan Indonesia. Panglima TNI tidak seharusnya mengandaikan dirinya sebagai Panglima Angkatan Perang Australia. Dalam penanganan pen-

Berita Utama

A2 Ajudan Kajari P. Siantar Ditodong Di RSUD Djasamen Saragih PEMATANGSIANTAR (Waspada): Tindak kriminalitas terhadap pasien di ruang rawat inap, khususnya di paviliun RSUD Dr. Djasamen Saragih, Jl. Sutomo, Pematangsiantar, sudah sering terjadi, namun pengamanan di rumah sakit itu tetap belum memadai. Tindak kriminilitas tersebut yakni penodongan terhadap pasien. Informasi Waspada peroleh seringnya terjadi penodongan di rumah sakit pemerintah itu terungkap, setelah seorang pasien rawat inap, Widiany Harahap, 27, yang juga ajudan Kajari Pematangsiantar melaporkan penodongan terhadapnya ke Polres setempat. Korban yang mengalami demam tinggi dirawat di satu ruang paviliun B, menyebutkan pelaku seorang pria bertubuh tinggi, kurus dan memiliki alis tebal serta memakai masker. Dia ditodong dengan obeng besar Rabu (8/1) pukul 04:00. Pelaku mengancam akan membunuhnya bila berteriak dan minta korban menyerahkan harta bendanya. Korban yang ketakutan menyerahkan dompetnya berisi sejumlah uang, kartu ATM, KTP dan kartu pegawai. Setelah pelaku kabur, korban berteriak minta tolong dan memanggil perawat yang sedang berjaga. Namun, ketika korban menceritakan peristiwa yang dialaminya, sang perawat justru mengatakan, kejadian seperti itu sudah sering di Paviliun B. Satpam RSUD yang menerima laporan segera memeriksa sekitar paviliun B, namun pelakunya sudah tak ada. Pelaku diduga masuk dari kamar yang melintang di depan Paviliun B yang tembus ke kantor PMI persis di pinggir jalan. Humas RSUD Dr. Djasamen Saragih Dr. Andi Rangkuti kepada wartawan mengaku terkejut mendengar penodongan sudah sering terjadi di Paviliun B. Menurut Rangkuti, pihaknya akan meningkatkan jumlah petugas keamanan di seluruh ruangan rumah sakit dan lebih serius berjaga. Kapolres Pematangsiantar AKBP Slamet Loesiono, SIK saat dikonfirmasi melalui Kasubbag Humas AKP Nuriaman Ray Rangkuti dan Kasat Reskrim AKP H. Sinambela, SH, Kamis (9/1) sore menyebutkan, ia telah menerima laporan tentang dugaan penodongan itu, dan sudah menindaklanjutinya. (a30)

Sopir Indomaret ... Setelah turun, korban dianiaya dan dimasukkan ke dalam minibus. Didalam minibus,dua pelaku yang sudah menunggu ikut menganiaya korban. Sedangkan, dua pelaku lagi yang berada diluar langsung masuk ke dalam mobil box dan mengambil alih kemudi. Selanjutnya, korban bersama mobil box dibawa ke areal perkebunan sawit milik PTPN II di Desa Perdamean, Kec. Tanjungmorawa. Di situ korban diikat dan ke empat pelaku kabur meninggalkan korban bersama mobil boxnya. Uang yang dilarikan adalah milik perusahaan. Warga yang kebetulan melintas mendengar teriakan minta tolong korban, dan langsung melaporkan kejadian itu ke Mapolres Deliserdang. Humas PT Indomarco Pristama “Indomaret”, Yekieli Lase membenarkan kejadian tersebut. Bahkan peristiwa itu adalah kali kedua yang pernah dialami perusahaan itu. “Kejadian pertama di Sergai, tepatnya di dekat Jembatan Sungai Ular sekitar dua bulan lalu. Saat itu sopir mobil box dirampok sebesar Rp. 62 juta. Namun hingga kini pelakunya pun belum tertangkap,” ujar Yekieli Lase. Terpisah, Kapolres AKBP Dicky Patrianegara, SH, SIK melalui Kasat Reskrim AKP Arfin Fachreza, SH, SIK membenarkan dan mengatakan masih melakukan pemeriksaan terhadap korban. (c02/a07)

311 Kepada Daerah Tersandung ... Dia mengatakan, untuk penyelewengan dana Bansos itu umumnya dilakukan kepala daerah menjelang Pilkada. Korupsi yang dilakukan kepala daerah tersebut, lanjutnya, jelas merugikan negara yang mencapai Rp36,7 triliun pada 2012 dari total ABPN Rp1.760 triliun. Ali Masykur,juga calon presiden Konvensi Partai Demokrat itu menyebutkan, di Sumut ada 6-7 kepala daerah yang tersandung dugaan korupsi berdasar catatan 3 tahun terakhir. Berdasarkan urutan provinsi, Sumut merupakan urutan ketiga terkorup setelah Provinsi Papua dan Maluku. (m41)

6 Mata Air Muncul ... Dari lubang berbentuk lingkaran yang menganga dengan diameter sekitar 10-15 cm ini keluar air yang saat disentuh terasa dingin. Sementara, mata air lainnya justru mengalir ke kamar mandi umum Desa Katepul Kabanjahe. Warga di desa tersebut khawatir karena air tersebut biasa digunakan warga, termasuk dikonsumsi sehari-hari. Kepala Dinas Pertambangan dan Energi (Distamben) Kab. Karo, yang dikonfirmasi Waspada mengaku sudah menurunkan tim pemeriksa ke lokasi tersebut. Namun, ia belum mendapatkan laporannya. “Tadi sudah diturunkan tim ke lokasi untuk memeriksa kadar air tersebut. Tapi, sekarang saya belum mendapatkan laporannya,” katanya. Namun,petugas Posko Pengamatan Gunung Api Sinabung PVMBG, Rahmad, mengatakan munculnya mata air tersebut tidak berhubungan dengan erupsi Gunung Sinabung. “KaJawaban Problem Catur, lau airnya dingin tidak ada kaitannya,” kata Rahmad. (a36) TTS Dan Sudoku

Dari Halaman Sport.

Air Terjun Niagara ...

Jawaban Problem Catur: 1. Md8+, Mf8. 2. Gxh7+, RxG. 3. MxM. Jawaban TTS: TTS

Mimbar Jumat

Seperti dilansir laman Daily Mail, cuaca ini mempengaruhi keseharianwarga yang tinggal di Amerika Serikat dan Kanada, kedua negara yang dibelah oleh Air Terjun Niagara. Dengan suhu sedingin itu, orang berpikir bahwa wisatawan tak akan betah dan beranjak pergi. Tapi dugaan itu salah. Mereka justru bertahan mengabadikan lanskap yang luar biasa. Tidak semua bagian Niagara membeku. Masih ada kerumunan air yang mengantre untuk jatuh ke sungai. Tapi mereka tertahan es sehingga harus turun perlahan-lahan. Untungnya prediksi cuaca mengatakan, suhu yang tak wajar itu diperkirakan mereda minggu ini. Es-es akan mencair lagi. Wisatawan tak lagi harus menggigil untuk melihat gagahnya Air Terjun Niagara. (vn/m09)

Ada-ada Saja ...

Jawaban Sudoku:

8 7 9 4 3 2 6 5 1

3 6 2 1 5 7 9 4 8

4 5 1 8 6 9 2 7 3

6 9 4 2 1 8 5 3 7

5 1 7 3 9 4 8 6 2

2 8 3 6 7 5 4 1 9

1 2 6 5 8 3 7 9 4

9 4 5 7 2 1 3 8 6

7 3 8 9 4 6 1 2 5

setelah melihat seorang remaja melakukan hal itu di internet. Tak tanggung-tanggung, ia melahap dua buah kaktus, meski ribuan duri menusuk tangan, pipi, dan mulutnya. Pria asal Amerika Serikat itu menyelesaikan tantangan makan kaktus kurang dari enam menit dan mengunggah rekaman aksinya di situs Youtube yang kini mendapat lebih dari setengah juta hits. “Saya bukan orang pintar tapi saya tidak akan pernah makan kaktus,” tulis sebuah komentar di situs itu. LA Beast sebelumnya terkenal setelah menghabiskan 150 nugget ayam dalam sebuah tantangan, dan pernah mengikuti lomba makan sambal terpedas di dunia serta makan 36 telur mentah lengkap dengan cangkangnya. (net/rzl)

WASPADA Jumat 10 Januari 2014

Denny Resmi Laporkan Loyalis Anas Ke Mabes Polri


WAGUBSU HT Erry Nuradi dan sejumlah tokoh seperti Akbar Tanjung, Jenderal TNI (Purn) Ryamizard Ryiakudu, Laksamana TNI Slamet Subianto menghadiri dialog nasional mencari pemimpin berkarakter Pancasila di Hotel Madani Medan, Kamis (9/1).

Akbar: Memilih ... “Pemimpin Indonesia harus bisa mengeluarkan bangsa ini dari ketergantungan dengan negara luar. Bila bangsa kita susah, kitalah yang harus mengeluarkan dari kesusahan itu,” tegasnya. Sebelumnya, Wagubsu HT Erry Nuradi, berpendapat, sudah saatnya Indonesia memilih pemimpin yang berkarakter Pancasila. ‘’ Pemimpin yang berkarakter Pancasila sangat tepat bagi mewujudkan Indonesia yang maju dan sejahtera,’’ kata Erry pada acara yang dihadiri Eksponen Angkatan 66 Akbar Tanjung, Jenderal TNI (purn) Ryamizard Ryakudu, tokoh pendidikan Prof Usman Pelly, Laksamana TNI Slamet Subianto, Sekda Kota Medan Syaiful Bahri, tokoh sejarah, pelajar dan mahasiswa serta ratu-

san peserta. Wagubsu mengatakan, untuk melahirkan pemimpin tersebut, masyarakat harus cerdas dalam menentukan pilihannya. Mengingat tahun 2014 merupakan tahun politik, di mana akan dilaksanakan pemilihan anggota legislatif, presiden dan wakil presiden, Wagubsu mengimbau seluruh masyarakat untuk aktif, cerdas dan bijak menggunakan hak pilihnya. “Pelajarilah seorang calon wakil rakyat dan calon pemimpin, cari tahu lebih banyak tentang sosok yang akan dipilih sehingga diharapkan akan lahir pemimpin yang terbaik,” tegasnya. Wagubsu mengingatkan, Indonesia sedang dilanda krisis kepemimpinan. “Peminpin itu banyak, namun yang benar benar berkarakter Pancasila itu masih sedikit dan boleh jadi tidak seterkenal calon lain, nah disitulah

tugas kita bersama untuk memilih sebaik baiknya,” tukasnya. Kepala Kesbangpollinmas Provsu H Eddy Syofian, MAP mengatakan, sosok pemimpin ke depan tidak sekedar hanya bisa memenuhi kepentingan masyarakat, namun juga bersifat visioner jauh ke depan. Untuk itu, Eddy mengimbau seluruh masyarakat Indonesia khususnya Sumatera Utara agar menggunakan hak pilihnya dengan baik, gunakanlah hak pilih masing-masing karena bila pemimpin tidak dipilih atau dipilih asal asalan, akan lahirlah pemimpin yang asal asalan juga. Dialog tersebut diwarnai penyematan PIN kepada sejumlah tokoh Sumatera Utara di antaranya Wagubsu ,Sekda Kota Medan Syaiful Bahri, Prof Usman Pelly, H Marzuki, H Kamaluddin, SH, Anwar Congo dan Raja Kamal. (m28)

Mendagri: Hambit Bintih Tetap Dilantik JAKARTA (Antara): Menteri Dalam Negeri Gamawan Fauzi mengatakan, Bupati terpilih Gunung Mas, Hambit Bintih, tetap akan dilantik dalam status hukumnya sebagai terdakwa suap terhadap mantan Ketua Mahkamah Agung, Akil Mochtar. Bintih kini dalam tahanan Komisi Pemberantasan Korupsi setelah tertangkap tangan pada kasus itu, beberapa waktu lalu. Langkah Kementerian Dalam Negeri tetap melantik Bintih sebagai bupati itu, kata Fauzi di Jakarta, Kamis (9/1). “Pelantikan itu menjadi pintu masuk untuk menonaktifkan bupati Gunung Mas. Bagaimana kami menonaktifkan, jika belum dilantik.” Dalam UU Nomor 32/2001

tentang Pemerintahan Daerah, kepala daerah dan wakil kepala daerah, yang terbukti secara inkraacht melakukan pidana kasus hukum, dapat diberhentikan langsung oleh presiden tanpa melalui usul DPRD. Bintih sudah menjalani sidang pembacaan dakwaan di Pengadilan Tindak Pidana Korupsi (Tipikor), bersama dengan Cornelis Nalau, Rabu (8/1). Bintih didakwa pasal 6 ayat 1 huruf a atau pasal 13 UU Nomor 31/1999 tentang Pemberantasan Tindak Pidana Korupsi sebagaimana telah diubah dengan UU Nomor 20/2001 jo pasal 55 ayat 1 ke-1 KUHP. Dalam pasal-pasal itu diatur mengenai orang yang memberikan sesuatu kepada hakim

Kamis, Gunung Marapi Alami Lima Kali Letusan BUKITTINGGI (Antara): Gunung Marapi yang berada antara Kabupaten Tanah Datar dan Kabupaten Agam, Sumatera Barat (Sumbar), tercatat telah mengalami sebanyak lima kali letusan pada Kamis (9/1) pagi. Petugas Vulkanologi dan Mitigasi Bencana Geologi (PVMBG) Kota Bukittinggi, Hartanto di Bukittinggi, Kamis mengatakan, sebanyak lima kali letusan itu tercatat dari pukul 05:34 WIB sampai pukul 07:14 WIB. Letusan terakhir terjadi pukul 07:14 WIB dengan menyemburkan abu vulkanik setinggi 250 meter dari atas puncak gunung, kata dia. Selain letusan, lanjutnya, gunung juga terpantau menghembuskan asap putih tebal setinggi 200 meter dari puncak pada pukul 08:07 WIB. Dia merinci, letusan berturut-turut terjadi pada pukul 05:34, 05:53, 05:59, 06.12 dan pukul 07:14 WIB serta hembusan pada pukul 08:07 WIB. Saat ini status Gunung Marapi masih waspada level-II. Masyarakat di sekitar gunung

Anak Pengungsi ... “Setiap hari kami hanya bermain. Kalau sekolah masuk siang, pukul 14:00 dan pulangnya pukul 15:00. Kami terpaksa menumpang belajar di sekolah lain agar tidak ketinggalan mata pelajaran. Karena menumpang di sekolah itu, kami harus menunggu giliran belajar. Kalau pagi, sekolah itu dipakai siswa lain. Setelah itu, giliran kami yang belajar di situ,” kata Minal, 12, warga Desa Sukanalu yang mengaku sudah dua bulan tinggal di pengungsian. Minal mengatakan, kisah pilu itu bukan saja masalah tempat tinggalnya di pengungsian,melainkan sekolahnya juga harus berpindah-pindah. “Pertama sekolah saya di SD Sukanalu,karena mengungsi terpaksa pindah ke SD III Kabanjahe.Sekarang di SD Sumbul Kabanjahe. Beginilah nasib kami selama hampir tiga bulan ini. Mau belajar pun susah,jadi kami hanya berdoa agar sece-

serta para pendaki diminta untuk tidak mendaki pada radius tiga kilometer dari pusat letusan atau kawah gunung.

untuk mempengaruhi putusan perkara dengan ancaman penjara 3-15 tahun dan denda Rp150 juta - Rp750 juta. Bintih dan wakilnya, Arton S Dohong, ditetapkan menjadi bupati dan wakil bupati terpilih di Kabupaten Gunung Mas, Provinsi Kalimantan Tengah, setelah memenangi perkara sengketa pilkada di Mahkamah Konstitusi.

Baku Tembak TNI Vs GPK Satu Tewas JAYAPURA (Antara): Aparat TNI terlibat baku tembak dengan kelompok Gerakan Pengacau Keamanan (GPK) di Timika, Papua, Kamis (9/1) petang. Baku tembak yang terjadi sekitar pukul 18.00 WIT di kawasan Tanggul Timur Timika itu menewaskan seorang anggota GPK. TNI juga menyita satu pucuk senjata M16 dari anggota GPK, demikian dilaporkan dari Jayapura.

Lahar Dingin Meluncur ... Kec. Namanteran, terputus. Lahar dingin berwarna kecoklatan dan lumpur berwarna kehitaman yang membawa puluhan batang kayu dan material vulkanik lainnya mengalir dengan ketinggian hingga satu meter dari permukaan badan jalan dan menerjang areal pertanian yang berada di kawasan tersebut hingga rusak parah. Tim Waspada yang berada di lokasi dalam radius berkisar 1 - 1,5 kilometer, sempat mendengar beberapa kali dentuman yang menggelegar dari puncak Sinabung. Namun hujan disertai kabut tebal membuat turunnya material vulkanik dari kawah gunung tidak terlihat. Sementara itu, ratusan rumah di Desa Bekerah dan Desa Suka Nalu yang berada tidak jauh dari lokasi lahar terlihat kosong karena ditinggal penghuninya untuk mengungsi. Hanya beberapa ekor anjing terlihat di perkampungan itu. Seorang warga Desa Bekerah bermarga Tarigan yang saat itu sedang melihat ladangnya di sana mengatakan, luncuran lahar dingin meluluhlantakkan areal pertanian milik warga. “Semua tanaman kami hancur. Tidak tahu apa yang harus kami buat, sedangkan anak-anak kami butuh biaya. Saya takut ke kampung ini,tapi karena desakan ekonomi maka memberanikan diri ke sini pada siang hari. Kalau malam hari tetap di pengungsian di Kabanjahe,” katanya. Hancurnya tanaman warga bukan saja akibat lahar tetapi juga akibat debu vulkanik. Tanaman warga seperti padi dan cabe menjadi rusak setelah berulangkali dihujani debu vulkanik. Jadi warga sekitar kawasan tersebut tidak bisa berbuat apa-apa. “Kami hanya bisa pasrah dan menunggu keajaiban. Kalau mau pulang dari pengungsian takut, tapi kami sudah tidak tahan lagi di pengungsian. Kita bukan butuh makan saja, tapi butuh uang juga,” katanya.(m50/m25) patnya tuntas soal Sinabung ini. Kalau memang meletus, ya sekarang inilah biar kami bisa cepat kembali ke kampung halaman kami,” katanya. Anak pasangan Ilham Panggabean dan Lina beru Ginting ini mengaku sejak mengungsi di masjid tersebut kegiatan proses belajarnya drastis menurun. Kalau belajar malam sudah pasti tidak bisa karena lokasi pengungsi sempit. “Jadi kalau mau belajar harus siang hari sebelum berangkat sekolah. Begitulah kami rasakan anak-anak yang disini yang sudah hampir tiga bulan ini,” ujarnya. Demikian juga dirasakan Vivi warga Sukanalu yang saat ini duduk di SMP Negeri 1 Namanteran, Kecamatan Namanteran,Kabupaten Karo. “Dengan terpaksa pindah sekolah akibat erupsi Gunung Sinabung ke SMP Negeri II Kabanjahe. Sudah hampir tiga bulan disini sekolah. Kalau untuk makanan tidak ada masalah,

namun kalau untuk belajar sangat susah. Kalau mau belajar pada malam hari tidak bisa karena tempatnya sempit,jadi harus curi waktu siang hari. Beginilah nasib kami sampai Sinabung aman,” katanya dengan mata berkaca-kaca. Ketika ditanya apakah dia masih pernah pulang ke kampung halamannya,gadis belia ini mengaku tidak pernah. “Kalau saya enggak pernah pulang ke rumah bang, paling yang pulang kadang-kadang orangtua saja melihat tanam-tanaman yang masih hidup. Tapi kalau malam hari tetap pulang ke pengungsian ini. Kami mohon kepastian sampai kapan hidup seperti ini,” katanya. Sementara itu, Ikbal warga Desa Gurukinayan, Kec. Payung kelas II SD II Gurukinayan juga mengalami nasib yang sama dengan kedua pelajar tersebut. “Sudah dua bulan lebih saya pindah sekolah kesini karena mengungsi,” katanya. (m50/c10/m25)

JAKARTA (Waspada) : Wakil Menteri Hukum dan HAM Denny Indrayana resmi melaporkan dua loyalitas Anas Urbaningrum, Juru Bicara Perhimpunan Pergerakan Indonesia (PPI) Ma’mun Murod dan Tri Dianto ke Bareskrim, Mabes Polri, Kamis (9/1). Didampingi pengacaranya, Denny membawa bukti-bukti fitnah Ma’mun dan Tri berupa kliping pemberitaan online dan koran. “Saya melaporkan saudara Murod dan Tri terkait fitnah di KPK Selasa lalu. Saya sudah beri kesempatan 1x24 jam untuk meminta maaf, tapi tidak digunakan dengan baik,” jelas Denny kepada pers, di Mabes Polri, Kamis (9/1). Menurut Denny, langkah

hukum yang dilakukannya ini agar menjadi pelajaran. Tudingan Ma’mun soal pertemuan Denny, BambangWidjojanto di Cikeas merupakan fitnah. “Jadi untuk pembelajaran dengan semuanya dan agar tidak menjadi preseden dan upaya pemeriksaan korupsi digunakan cara seperti ini,” terang Denny. Denny datang ke Mabes Polri dengan menggunakan mobil dinasnya Toyota Camry. Menggunakan batik merah, Denny didampingi beberapa pengacara antara lain M Luthfi dan Mochtar Ali. Sikap Denny menempuh langkah hukum mendapat dukungan dari berbagai kalangan. Atasannya, Menteri Hukum dan HAM Amir Syamsuddin, misalnya.

“Agar masyarakat jangan mudah menciptakan cerita bohong,” ujar Amir kepada pers di sela-sela acara Rapat Pimpinan Polri dan TNI di Gedung PTIK, Jakarta. Amir menyatakan, laporan Denny adalah hak pribadi. Dia mendukung sepenuhnya dan yakin tudingan yang disampaikan Ma’mun Murod dan Tri Dianto tentang kunjungan ke Cikeas bersama komisioner KPK Bambang Widjojanto tidak benar. “Mana mungkin jam 2 dinihari,” kata Amir. Amir mengatakan, langkah ini sekaligus mendidik anggota masyarakat agar jangan mudah menyampaikan berita bohong yang mencederai kredibilitas orang lain. “Langkah itu sudah benar,” jelasnya. (j02)

Bandara Soetta Didorong Mampu Gerakkan 72 Penerbangan Pesawat/Jam JAKARTA (Antara): Rapat tentang perkembangan bandar udara yang dipimpin Wakil Presiden (Wapres) Boediono memutuskan untuk mendorong Bandar Udara Soekarno Hatta (Bandara Soetta) Jakarta agar pada Juni 2014 mampu menangani pergerakan 72 penerbangan pesawat per jam. Namun dibanding rata-rata saat ini yang hanya mampu menangani 64 pergerakan per jam. “Serangkaian pembenahan manajemen dan fasilitas akan dilakukan untuk meningkatkan kapasitas Bandara Soetta. Perbaikan ini mencakup perubahan tata letak bandara, konfigurasi pergerakan pesawat (runway, taxiway), sistem dan pola pemanduan lalu lintas penerbangan, dan perbaikan lainnya. Targetnya, pada Juni 2014 Bandara Soetta harus mampu menangani 72 pergerakan pesawat perjamdanpadaJuni2015mampu menangani 86 pergerakan pesawat per jam,” kata Wapres Boediono dalam konperensi pers seusai rapat perkembangan bandara di kantor Wapres, Jakarta, Kamis (9/1) pagi. Wapres mengemukakan, belakangan ini, banyak keluhan masyarakat mengenai buruknya pelayanan penerbangan di tanah air. Pesawat yang hendak tinggal landas antre mengular di bandara. Di udara, pesawat harus berputar-putar menunggu giliran mendarat. Merespon berbagai keluhan ini,Wapres yang memimpin rapat evaluasi infrastruktur perhubungan udara mengajak para peserta rapat untuk mengevaluasi bersama apa yang belum dan yang sudah diselesaikan, sebagai bentuk pertanggungjawaban kepada masyarakat.” Menteri BUMN Dahlan Iskan dalam rapat tersebut me-

minta Angkasa Pura II sebagai pengelola Bandar Udara Soekarno Hatta belajar dari manajemen Bandara Heathrow di London yang mampu menangani 100 pergerakan pesawat per jam dengan dua landasan pada saat cuaca baik. Sementara Bandara Soetta yang juga memiliki dua landasan sejauh ini maksimal hanya mampu menangani 64 pergerakan pesawat per jam. “Jika kita mampu mengelola Soetta sebaik Heathrow, kapasitasnya bisa meningkat dan kebutuhan membangun landasan

TNI Dan Polri ...

Presiden terhadap rencana pemberian gelar jenderal besar itu mengatakan, Presiden mengapresiasi rencana itu namun tidak bisa menerima penganugerahan gelar tersebut. “Terus terang beliau menolak dalam hal ini, tapi kita mengapresiasi apa yang disampaikan Panglima TNI tadi,” kata Sudi Silalahi kepada wartawan di Kantor Presiden, Istana Kepresidenan, Jakarta, Kamis (9/1). Sebelumnya, Moeldoko mengatakan Presiden pantas dianugerahkan pangkat jenderal besar atas kontribusinya dalam memajukan TNI. “Semangat yang kuat dari Bapak SBY untuk membangun TNI yang handal, kami TNI tidak salah kiranya kalau Jenderal Purnawirawan Presiden SBY mendapatkan anugerah jenderal besar. Saya kira sangat tepat kita berikan kepada Presiden,” kata Moeldoko. Sedangkan,Mensesneg Sudi Silalahi menjelaskan, sudah sewajarnya apabila Presiden mengeluarkan sejumlah kebijakan untuk meningkatkan kinerja dan profesionalitas TNI. Salah satunya yakni kebijakan modernisasi alat utama sistem persenjataan (alutsista) TNI. Siapapun presidennya, lanjut Sudi, pasti akan menerbitkan kebijakan untuk memajukan institusi TNI. Oleh karena-

Semenrtara Kapolri Jenderal Sutarman dalam sambutannya mengatakan, Rapim TNI dan Polri saat ini dihadiri 336 pucuk pimpinan kedua lembaga. Sebanyak 168 dari Polri dan 168 dari TNI. Kapolri mengatakan, pihaknya siap untuk mengamankan pemilu 2014 agar berjalan lancar, tertib dan sukses. Hal yang sama juga diungkapkan oleh Panglima TNI Moeldoko. Moeldoko siap kapanpun dan dimanapun untuk membantu aparat kepolisian dalam mengamankan pemilu. Tolak Pemberian Gelar Jenderal Besar Presiden Susilo Bambang Yudhoyono menolak rencana pemberian gelar jenderal besar dari keluarga besar TNI sebagaimana disampaikan Panglima TNI Jenderal Moeldoko pada acara penutupan rapat pimpinan TNI/Polri di Jakarta, Kamis (9/1) siang. Presiden merasa penghargaan tersebut tidak perlu karena apa yang dilakukan selama ini merupakan bagian dari tugas dan tanggung jawab sebagai Kepala Negara dan Kepala Pemerintahan. Menteri Sekretaris Negara (Mensesneg) Sudi Silalahi yang menyampaikan penolakan

ketiga di Bandara Soetta bisa kita tunda karena investasinya sangat besar, Rp 40 triliun. Belum lagi masalah sosial untuk pembebasan tanah dan sebagainya yang tidak mudah pemecahannya,” tutur Dahlan. Rapat memutuskan, Perum Lembaga Penyelenggara Pelayanan Navigasi Penerbangan Indonesia (LPPNPI) yang dikenal dengan sebutan Airnav akan menjadi komandan lapangan untuk perbaikan pengelolaan lalu lintas udara ini. “Minggu depan akan kita buat kesepakatan bersama,” tutur Dahlan.

Sekjen DPR ... sejumlah dokumen pendukung kepada KPK, termasuk kegiatan Akil selama menjabat sebagai anggota DPR. “Ya beliau (Akil) kan dua periode, banyaklah kegiatan yang diikuti dia sebagai anggota komisi III,” sambungnya. Ketika ditanya mengenai gaji Akil ketika menjadi anggota DPR, Winantuningtyastiti mengatakan bahwa gaji pokok Akil sama dengan gaji pokok anggota DPR lainnya. “Gajinya sesuai dengan gaji pokoknya Rp4,2 juta periode kedua. Periode pertama Rp3,1 juta yah.Yang lain-lainnya banyak, tunjangan istri, tunjangan anak, tunjangan beras,” imbuhnya. Akil sudah tidak menerima pensiun sebagai anggota DPR. Karena terakhir, Akil tercatat sebagai Ketua Mahkamah Konstitusi. Akil menjabat sebagai anggota DPR RI selama dua periode, yakni 1999-2004 dan 2004-2009. Saat masih menjadi anggota dewan, Akil pernah menjabat sebagai wakil ketua komisi hukum DPR. Tahun 2008, Akil akhirnya mendaftar sebagai hakim konstitusi. Dan pada pertengahan tahun 2013, Akil Mochtar terpilih menjadi ketua MK menggantikan Mahfud MD. Saat berada di puncak karir, Akil ditangkap KPK atas dugaan menerima suap terkait penanganan dua perkara pilkada yang ditangani MK, yakni di Gunung Mas (Kalimantan Tengah) dan Lebak (Banten). Akil diduga menerima total Rp4 miliar. Dari pilkada Gunung Mas, Akil diduga menerima uang sekitar Rp3 miliar dari pengusaha Cornelis Nalau. Dalam kasus ini, KPK juga menangkap anggota DPR Chairun Nisa dan Hamid Bintih. Dari pilkada Lebak, Akil diduga menerima Rp1 miliar dari pengusaha Tubagus Chaeri Wardhana. Suap ini diduga akan diserahkan ke Akil melalui pengacara Susi Tur Andayani. Dalam perkembangannya, Akil Mochtar juga ditetapkan sebagai tersangka tindak pidana pencucian uang. (vvn)

Al Bayan ... Dia yang mengciptakan manusia dari tanah, dari air mani yang hina. Dia yang menghidupkan dan mematikan. Dia yang membangkitkan manusia dalam kubur, dia yang menyusun tulang-belulang kembali dan jasad yang telah hancur. Dia yang menghamparkan bumi dan membentangkan langit, dan nanti (kiamat). Dia juga yang menggulung langit, menghancurkan planet-planet, matahari dan bulan bertabrakan, bintang-bintang menjadi debu. Gununggunung rata dengan tanah, air laut kering. Dan kiamatpun tiba. Allah pemilik surga yang penuh nikmat dan neraka yang sangat azab. Dua tempat itu penuh dengan manusia. Manusia yang baik dimasukkan dalam surga, dan yang buruk dilemparkan ke neraka. AllahYang Maha pengasih dan penyayang kepada semua makhluk, tetapi di hari akhirat Allah hanya memberi perlindungan kepada hamba-hamba yang beriman, sedangkan yang kafir akan menerima siksaan dalam neraka. Allah Subhanahu wa Ta’ala telah menciptakan jin dan manusia. Manusia wajib menyembah Allah SWT sesuai dengan petunjuk para rasul di masanya masing-masing. Zaman sekarang hanya Islam petunjuk dari Muhammad

nya, Presiden SBY menilai penghargaan jenderal besar tidak perlu diberikan kepadanya. Jenderal besar adalah pangkat tertinggi bagi prajurit TNI Angkatan Darat (AD). Gelar kehormatan ini diberikan kepada prajurit tinggi TNI AD yang memiliki jasa besar bagi negara. Hingga saat ini, TNI baru menganugerahkan gelar atau penghargaan jenderal bintang lima kepada tiga orang, yaitu mantan Presiden Soeharto, Abdul Harris Nasution, dan Sudirman. Gelar ini diberikan dalam waktu yang berdekatan pada Oktober 1997. Petinggi TNI-Polri saat itu memberikan langsung gelar tersebut pada Soeharto dan AH Nasution pada 1 Oktober di kediaman masing-masing. Para petinggi itu adalah Panglima TNI Jenderal Feisal Tanjung, Kepala Staf Angkatan Darat Jenderal TNI Wiranto, Kepala Staf Angkatan Laut Laksamana TNI Arief Nurhayadi, Kepala Staf Angkatan Udara Marsekal Satria Tubagus dan Kepala Kepolisian Jenderal Dibyo Widodo. Sedangkan gelar bagi Sudirman disampaikan kepada keluarganya di Yogyakarta oleh Kepala Pusat Penerangan TNI Brigadir Jenderal Abdul Wahab Mokodongan pada 2 Oktober 1997.

SAW. selainnya telah dimensukhkan (dibatalkan). Meski begitu jelas dan terang, namun banyak manusia yang masih beragama dan berkeyakinan dengan agama yang telah dimensukhkan oleh Allah. Sebuah pertanyaan timbul. Mengapa Allah SWT membiarkan para kafir menguasai bumi? Ekonomi dan tehnologi mereka lebih maju dari ekonomi dan tehnologi Kaum Muslimin? Masalah itu cuma masa yang bergulir. Zaman dulu kala, kaum ‘Ad dan Tsmaud yang paling jaya. Setelah dua bangsa itu mundur, muncul Mesir Kuno, lalu Persia dan Romawi. Bangsa-bangsa itupun ada batasnya, kemudian giliran Islam menguasai dunia, sejak Daulah Umayyah smpaiTurki Usmani, lebih kurang delapan ratus tahun. Kini giliran bangsa Barat, Amerika, Jepang dan Korea. Allah gilirkan hari-hari (masa) di antara manusia. Meski umat Islam saat ini dalam keterbelakangan, namun di sisi Allah umat Islam tetap yang lebih baik, sebab mereka tidak mempersekutukan Allah. Allah mengutus rasul-Nya (Muhammad SAW) membawa risalah-Nya (Agama Islam) dan kitab suci yang masih murni (Alquranul Karim). Rabb yang sebenarnya itulah Allah, selainnya adalah tuhan-tuhan palsu ciptaan dan rekaan manusia. Sesungguhnya Allah beserta kaum beriman.

WASPADA Jumat 10 Januari 2014

Medan Metropolitan

Polsek Sunggal Bakar 6 Kg Ganja

Penggerebekan Tiga Hari

Polisi Masih Periksa 23 Diduga Pemakai Narkoba MEDAN (Waspada): Sat Reserse Narkoba Polresta Medan masih melakukan pemeriksaan terhadap 23 orang diduga pemakai narkoba yang ditangkap dalam penggerebekan tiga hari ini. “Dari 24 orang yang kita amankan 1 orang dipulangkan karena tidak terbukti. Sedangkan 23 orang lagi masih menjalani pemeriksaan sampai hari ini,” kata Kasat Reserse Narkoba Kompol Dony Alexander, Kamis (9/1). Menurut Dony, penyidik masih melakukan pendalaman dan pemeriksaan terhadap 23 orang yang diamankan dari berbagai lokasi. Kata dia, mereka yang diamankan yakni 9 orang dari kawa-san Jln. Letda Sujono Gang Pancasila Tembung, 12 orang dari kawasan Kampung Kubur, dan 2 orang dari Jln. PWS Medan masih ditahan di Sat Res Narkoba Polresta Medan. “Semuanya masih kita tahan, cuma 1 yang dari kampung kubur sudah kita pulangkan karena berdasarkan hasil pemeriksaan tidak terbukti,” sebutnya. Dijelaskannya, saat ini pihaknya akan terus ‘berlari’ bahkan harus berlari lebih kencang untuk penanggulangan peredaran narkoba di Kota Medan. Diketahui sebelumnya, dalam tiga hari Satuan Reserse Narkoba Polresta Medan telah melakukan tiga penggerebekan di kawasan hukum Polresta Medan. Penggerebekan di Kampung Kubur petugas mengamankan 13 orang dan berbagai barang bukti. Selanjutnya petugas melakukan penggerebekan di kawasan Jln. Letda Sujono Gang Pancasila Tembung. Di lokasi ini petugas mengamankan 9 orang pria dan barang bukti 14 gram sabu-sabu, serta yang terakhir petugas menggerebek sebuah rumah di Jln. PWS Medan, yang dijadikan tempat home industry pembuatan narkoba jenis ekstasi dan sabu, dalam penangkapan ini petugas mengamankan 2 orang dari lokasi penggerebekan. (m39)


Waspada/Ismanto Ismail

PANIT I Reskrim Polsek Sunggal Ipda Nur Istiono SIK, SH, membakar barang bukti 6 kg ganja di halaman Mapolsek Sunggal disaksikan kedua tersangka dalam penjagaan Panit II Reskrim Ipda Herman Smbiring SH.

MEDAN (Waspada): Polsek Sunggal membakar 6 kg ganja yang disita dari dua tersangka narkoba, di halaman Mapolsek Sunggal, Kamis (9/1) sore. Pembakaran dilakukan Kapolsek Medan Sunggal Kompol Eko Hartanto SIK, diwakili Panit I Reskrim Ipda Nur Istiono SIK, SH, dan Panit II Reskrim Ipda Herman Sembiring SH, disaksikan kedua tersangka Azh, 28, penduduk Jln. Kenari Kota Blang, Kec. Bauda Sakti, Lokseumawe, MD, 33, penduduk Dusun Matang Aron Gampong Alue Capli, Kec. Seunuddu, Kab. Aceh Utara, dan pengacaranya James Simanjuntak SH, petugas juper Briptu MS Lubis SH, serta intansi lainnya. Panit I Reskrim Polsek Sunggal Ipda Nur Istiono SH mengatakan, pembakaran barang bukti itu karena sudah ada kesepakatan bersama antara penyidik Polsek Sunggal, pengacara tersangka, dan pihak kejaksaan. Menurut dia, barang bukti ganja dibakar karena Berita Acara Pemeriksaan (BAP) tersangka sudah dinyatakan P-21 (Sempurna). Kedua tersangka ditangkap pada 10 September 2013 di kawasan Desa Sei Mencirim, Kec.

Sunggal, Deliserdang. Keduanya datang ke Medan, untuk menjual 6 kg ganja kepada M, warga Kampung Lalang Medan. Ketika ditanya kedua tersangka sudah berapa kali men-

jual ganja, Nur Istiono mengatakan, sesuai pengakuan kedua tersangka, mereka sudah yang kedua kalinya dan pertama membawa ganja 5 kg dan laku dijual kepada M. (m36)


Medan Metropolitan

WASPADA Jumat 10 Januari 2014

Penjaga Toko Elektronik Tewas Ditikam Perampok BELAWAN (Waspada): Seorang penjaga toko elektronik dan perabot rumah tangga “Solusi” bernama Sunarto, 50, ditemukan tewas dalam posisi terlungkup di atas tilam pada ruang depan tempat kerjanya di Jln. Veteran, Pasar 7, Kec. Medan Marelan, Kamis (9/1). Diduga korban, warga Gang Telo, Desa Manungga, Kec. Labuhan Deli, diduga dibunuh pelaku perampokan terhadap toko tersebut. Sedangkan mayat korban ditemukan pertama kali

oleh pemilik toko saat akan membuka tokonya, Kamis pagi. Ditubuh korban ditemukan satu liang luka tikaman pada bagian punggung belakangnya dan luka-luka bekas penganiayaan. Sementara kondisi toko tidak berantakan dan pintu tidak ada yang rusak. Namun, dalam kejadian itu diperkirakan delapan unit TV merek LG dan sepedamotor korban hilang dari dalam toko. Usai melakukan olah Tempat Kejadian Perkara (TKP), petugas kepolisian membawa janazah korban ke RSU Pirngadi

Medan untuk diotopsi. Sepupu korban bernama Suarsih kepada Waspada di TKP mengatakan, semasa hidupnya korban terkenal pendiam atau tidak banyak bicara. Korban telah bekerja di toko menjual barang elektronik dan perabot rumah tangga itu sekitar 8 bulan, setelah berhenti dari pabrik karet. “Diperkirakan dia dibunuh tadi malam dan diketahui tadi pagi sekitar pukul 09.00. Kami menduga pelaku mengenal korban,” katanya. Sementara itu, Kapolres Pelabuhan Belawan AKBP Aswin Sipayung didampingi Kapolsek

Waspada/Rustam Effendi

WARGA dan keluarga korban menyaksikan jenazah Sunarto, penjaga toko yang ditemukan tewas di tempat kerjanya di Jln. Veteran, Pasar 7, Kec. Medan Marelan, Kamis (9/1).

Medan Labuhan Kompol Reza Pahlevi, dan Kanit Reskrim AKP Kusnadi mengatakan, pihaknya masih melakukan penyelidikan atas kasus pembunuhan itu dan besar kemungkinan pelaku lebih dari satu orang yang kenal dengan korban.“Kita masih melakukan penyelidikan dan barang bukti yang telah disita berupa tikar, tilam, dan pakaian yang berlumuran darah,” sebut Aswin. Disinggung tentang motif pembunuhan itu, Aswin menduga perampokan yang dilakukan orang yang dikenal korban. “Kita sudah memeriksa 3 orang saksi,” katanya. Aswin memberi target kepada anggotanya selama satu minggu untuk mengungkap kasus tersebut. “Kita targetkan anggota sudah bisa mengungkap kasus ini selama satu minggu ke depan,” tuturnya. Hasil pemeriksaan Di RSUD dr. Pirngadi Medan (RSPM), korban Sunarto diduga tewas akibat kehabisan darah. Pasalnya, pensiunan industri karet ini mengalami luka tusukan di punggung kanan, tulang rusuk patah, pipi kanan memar, dan kening koyak akibat benturan benda tajam dan tumpul. Anak korban, David Indra, 24, menuturkan, sebelum peristiwa naas itu, ayahnya meminta salah satu anaknya untuk menemaninya menjaga toko elektronik tersebut. Namun, lantaran sang adik yang biasa menemaninya mengikuti PKL dari seko-

lah pada pagi hari, ajakan itu ditolaknya. “Ayah juga malam itu bilang minta dikawani, tapi adik saya nggak bisa karena besok paginya harus PKL. Ayah juga bilang, kalau enggak ada yang menemaninya, kalau dia ada apa-apa bagaimana,” sebut David. Sunarto sudah delapan bulan bekerja sebagai penjaga malam di toko elektronik dan perkakas rumah tersebut, sejak pensiun. “Ayah selain jaga malam di toko itu juga membantu mengantar perabot atau elektronik ke rumah pembeli dan kadang juga memasangkan lemari,” katanya. Sebelum kejadian, ayahnya pulang ke rumah yang berjarak sekitar 300 meter dari tempat kerja, untuk minta dipijat sama istrinya Suratmi. “Ayah memang biasa pulang ke rumah sekitar jam 19:00 atau 21:00 minta dikusuk sama ibu dan kembali ke toko ditemani adik saya,” tutur David. David menduga, malam itu mungkin ada orang yang mengetuk pintu toko, lalu dibuka ayahnya. “Sepertinya pintu tokonya digedor orang dan dibuka sama ayah. Pagi tadi pekerja di toko datang dan melihat pintunya sudah terbuka dan melihat ayah sudah tergeletak di dalam. Tapi ada yang mengatakan melihat malam itu ada mobil berhenti di depan ruko,” ujarnya sembari berharap, kepolisian menangkap pembunuh ayahnya. (h03/h02)

Kinerja Dua SKPD Pemko Lemah MEDAN (Waspada): Badan Pemeriksaan Keuangan (BPK) RI Perwakilan Sumut menyerahkan Laporan Hasil Pemeriksaan Pajak, Hotel, Restoran, dan Reklame Pemko Medan tahun 2012 dan semester I tahun 2013 kepada Plt Wali Kota Medan Dzulmi Eldin di kantor BPK RI Perwakilan Sumut, Rabu (8/1). Dari hasil pemeriksaan dua Satuan Kerja Perangkat Daerah (SKPD) yakni Dinas Pertamanan dan Dinas Pendapatan Kota Medan, masih banyak ditemukan kekurangan dari sistem kinerja yang telah dilakukan. “Dibilang buruk nggak, kita tidak bisa bilang begitu. Sebab, dari kekurangan itu ada juga kebaikan, hasil pemeriksaan ini kan tidak mengurangi keberhasilan yang telah dicapai, tidak semuanya jelek. Tapi, ada halhal yang harus dibenahi,” kata

Kepala BPK RI Perwakilan Sumut Muktini, Rabu (8/1). Dijelaskan Muktini, dari hasil pemeriksaan yang telah dilakukan tim BPK RI Perwakilan Sumut, ditemukan masih adanya pengelolaan sistem kinerja yang tidak dilengkapi dengan Standar Operasional Prosedur (SOP), databasenya yang belum lengkap, penyetoran pajak yang dalam aturannya seharusnya dilaporkan setiap hari itu belum dilakukan. “Dari dua dinas yang berwenang menangani pajak hotel restoran dan reklame ini memang masih ada kelemahan,” sebutnya. Secara rinci disebutkannya, di Dinas Pertamanan sistem database masih manual. Begitu juga masih ditemukan pajak reklame yang liar, yakni reklame yang dipasang tapi tidak dikenakan pajak. Ke depan juga di-


harapkan adanya evaluasi kembali wewenang pemberian pajak reklame kepada Dinas Pertamanan agar ke depan bisa dikembalikan kepada fungsi pajak yang sebenarnya. “Di sini kita bukan melihat temuan kecurangan pajak, tapi hanya pemeriksaan kinerja, efektifitas kerja dari sisi pengelolaannya, bukan melihat kecurangan kalau itu dibutuhkan pemeriksaan dengan tujuan lainnya,” tutur Muktini. Sementara, untuk Dinas Pendapatan Medan, kata Muktini, juga ditemukan masalah database yang tidak dimutakhirkan hingga sistem kinerja yang belum dilengkapi dengan SOP. Selain itu, urusan pajak dipungut dari masyarakat, makanya Muktini menilai sosialisasi ke masyarakat ini masih kurang. “Masyarakat banyak yang belum mengerti pajak hotel dan restoran juga pajak reklame. Seharusnya lebih dilakukan sosialisasi, selain itu untuk restoran yang mikro kadang masih eng-

gan menerapkan pajak restoran karena mengakibatkan harga makanannya mahal,” katanya. Menurut Muktini, pemeriksaan tersebut dilakukan pihaknya serentak di seluruh Indonesia. Untuk Sumut diambil Kota Medan karena Medan memenuhi kriteria dari segi hotel ada juga restorannya besar-besar. PltWali Kota Medan Dzulmi Eldin setelah menerima laporan hasil pemeriksaan itu mengatakan, pemungutan pajak daerah harus bisa dioptimalkan lagi dengan prosedurnya yang lebih baik agar tidak ada peluang yang bisa merugikan negara ataupun kas daerah. “Tadi ada temuan BPK yang harus kita tindaklanjuti untuk pembenahan kinerja ke depan. Hasil LHP ini kita harus melakukan pembinaan agar bisa mengoptimalkan peningkatan pajak daerah lagi, sehingga semuanya harus didukung dengan administrasi yang jelas,” tutur Eldin. Kepala Dinas Pertamanan

Zulkifli Sitepu mengakui kalau di Medan memang masih banyak reklame yang liar. “Iya itu memang kita akui dan memang harus kita tingkatkan lagi dari segi pengawasannya. Faktanya memang banyak reklame liar seperti di Jln. Pulau Penang, Jln. Gagak Hitam dan disamping PJKA,” ujarnya. Kepala Dispenda Medan H Muhammad Husni juga mengakui kalau sistem kinerja di instansinya masih banyak kekurangan. “Kita berterima kasih dengan adanya audit ini tujuannya untuk perbaikan kinerja dan sistem pengelolaan. Dispenda akan membuat action plan dalam rangka upaya tindak lanjut dari beberapa temuan kinerja BPK ini. kita akan berupaya mengoptimalkan up dating data, membuat SOP untuk masing-masing fungsi pajak hingga penataan pelayanan, action plannya dalam tahun ini sudah kita mulai pelaksanaannya,” sebutnya. (m50)

Semakin Nikmat Beribadah

BC Musnahkan 14 Kontainer Pakan Ternak

SOSOK H Zaharuddin MA yang dikenal sebagai pengurus Badan Kenaziran Masjid Agung Kota Binjai dan tercatat sebagai Kabid Penerangan Agama Islam Zakat dan Wakaf di Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara, termasuk seorang khatib yang tidak pernah absen menyampaikan khutbah setiap Jumatnya. “Alhamdulillah, saya dapat melaksanakan tugas sebagai khatib sejak tahun 1979 silam,” kata Zaharuddin alumni Pondok Pesantren Al Jamiyatul Alwasliyah Purbaganal Sosopan Paluta, Kamis (9/1). Hari ini, dia akan berkhutbah di Masjid Agung Kota Binjai, dengan pokok bahasan terkait memakmurkan masjid dan memilih pemimpin yang amanah. Tahun ini, kata dia, adalah tahun memilih calon pemimpin bangsa. Karenanya perlu mengingatkan jamaah terkait calon yang dipilih haruslah yang amanah. Agama Islam mengingatkan bahwa memilih pemimpin yang amanah adalah kewajiban, karena itu harus mengetahui bagaimana calon pemimpin yang akan dipilihnya, serta memakmurkan masjid termasuk perbuatan jihad. “Materi khutbah selalu saya sesuaikan dengan situasi dan kondisi yang berlangsung di masyarakat. Itulah sebabnya, saya terus meningkatkan wawasan dan refrensi keagamaan agar bisa menyampaikan materi khutbah yang sesuai dengan situasi dan kondisi yang ada. Kebetulan saya bertugas di bidang penerangan agama Islam, hal ini mendorong saya untuk lebih memperkaya pengetahuan dari berbagai aspek,” ujarnya. Saat ditanya apa yang dia dapatkan selama puluhan tahun menjadi khatib, suami dari Dian Maharani Rumondang yang tinggal di Jln. Ismail No 15 Kota Binjai ini mengakui jika secara finansial tidak bisa dijabarkan. Tetapi secara batiniah, dia merasa cukup bahagia dan merasakan nikmat yang tiada tara dan tak pernah henti diberikan Allah SWT. “Menjadi khatib dan juru dakwah itu adalah kewajiban sebagai seorang muslim sekaligus melahirkan rasa kenikmatan beribadah. Apalagi setiap hari Jumat, berkesempatan menyampaikan ajaran agama kepada jamaah shalat Jumat. Apa yang kita sampaikan mereka dengarkan secara khusyuk, karena mendengarkan khutbah Jumat itu bagian dari ibadah. Setiap Jumat bertemu dengan jamaah yang berbeda dan shalat di masjid yang berbeda pula. Tentunya hal ini membuat saya semakin khusyuk beribadah,” katanya yang mengaku dengan profesinya inipula, banyak rezeki yang tak terduga dia rasakan, di antaranya menjadi petugas pembimbing ibadah haji ke Tanah Suci beberapa kali. Ayah dari Mahardiani Putri Nauli dan Isnaini Mawaddah ini meningingkan generasi muslim semakin banyak yang menjadi juru dakwah. Apalagi, di tengah derasnya arus informasi dan kemudahan berkomunikasi saat ini, sehingga lebih mempermudah untuk menyampaikan dakwah dengan cara yang cepat. (m37)

BELAWAN ( Waspada): Sebanyak 14 kontainer ukuran 20 feet pakan ternak asal Cina dimusnahkan petugas Kantor Pengawasan dan Pelayanan Bea dan Cukai Tipe Madya Pabean (KPPBC TMP) Belawan, di lahan lapangantembakTNIAL,Seruwe, Lingkungan 1, Kel. Sei Mati, Kec. Medan Labuhan, Kamis (9/1). Hadir pada acara pemusnahan itu Kepala KPPBC TMP BelawanWidhi Hartono, Kasat Reskrim Polres Pelabuhan Belawan AKP Rony Bonik, Perwakilan Badan Pengendalian Dampak Lingkungan Daerah (Bapapelda) Deliserdang, Balai Besar Karantina Pertanian Belawan, Kejaksaan Negeri Belawan, Belawan International Container

Terminal (BICT). Kepala KPPBC TMP Belawan Widhi Hartono mengatakan, pakan ternak yang dimusnahkan itu adalah Barang Milik Negara (BMN) yang sebelumnya dimpor oleh PT Jui Shin Indonesia berupa pakan ternak berbentuk tepung kasar dari daging dan sisanya (Meat Bone Meal) sebanyak 6.693 karung atau 328.914 Kg (nett). Barang tersebut ditetapkan sebagai BMN pada tanggal 13 Juni 2007 dan telah mendapatkan persetujuan untuk dimusnahkan sesuai dengan surat Menteri Keuangan nomor: S-79/MK.6/ 2010 tanggal 30 Maret 2010. “Pemusnahan barang dilakukan dengan cara dikubur se-

suai teknis yang ditetapkan dan untuk mencegah dampak lingkungan dari pemusnahan ini, kita sebelumnya telah berkoordinasi dengan Bapapelda Deliserdang,” kata Widhi. Pakaian Bekas Ketika disinggung tentang rencana pemusnahan puluhan bal pakaian bekas asal luar negeri yang saat ini menumpuk di demaga dan gudang BC Belawan,Widhi mengatakan, pihaknya sudah mengajukan permohonan dan pihaknya juga mengalami kesulitan mencari tempat yang cocok untuk pemusnahannya. “Sampai sekarang kita belum dapat tempat yang layak dan kita masih memikirkannya,” sebutnya. (h03)

Waspada/Andi Aria Tirtayasa

USTADZ KH Zulkarnain (tengah) didampingi Ketua TPM Mahmud Irsad Lubis SH (kiri) saat memberikan keterangan kepada sejumlah wartawan terkait penganiayaan terhadap dirinya yang dilakukan oleh sejumlah oknum Polisi/Brimob, di kantor TPM Medan.

TPM Minta Kapolri Tindak Oknum Polisi Aniaya Warga MEDAN (Waspada): Tim Pengacara Muslim (TPM) Medan meminta Kapolri agar menindak sejumlah oknum Polisi/ Brimob yang diduga melakukan penganiayaan terhadap sejumlah warga Kelompok Tani Batangkilat, Kel. Sei Mati, Kec. Medan Labuhan, yang sedang berdoa dan melaksanakan zikir bersama. “Tindakan yang dilakukan sejumlah oknum Polisi/Brimob jelas-jelas telah melanggar hak azasi manusia dan mengandung unsur SARA karena telah menganiaya sejumlah warga Kelompok Tani Batangkilat yang sedang melaksanakan doa dan zikir bersama di lahan sengketa,” ujar Ketua Tim Pengacara Muslim (TPM) Mahmud Irsad Lubis SH, di Medan, Rabu (8/ 1), usai menerima pengaduan dari Ustadz KH Zulkarnain, 61, dan anaknya Zakwan, 26, warga Lingkungan I Kampung Bahari, Kel. Martubung, Kec. Medan Labuhan, mewakili seratusan warga Gabungan Kelompok Tani Forum Perjuangan Tanah Rakyat Asli Batangkilat. Menurut Irsad, dugaan aksi penganiayaan yang dilakukan oleh sejumlah oknum Polisi/Brimob tersebut terjadi pada Rabu 18 Desember 2013 lalu, di lahan seluas 315 hektar di Lingkungan II, Kel. Sei Mati, Kec. Medan Labuhan. Lahan tersebut dikelola secaraturuntemurunolehwarga. Pagi itu, di salah satu rumah warga Gapoktan Batangkilat,

diadakan pertemuan yang juga dihadiri oleh Kapolres Pelabuhan Belawan AKBP Aswin Sipayung, Kapolsek Medan Labuhan, dan Camat Medan Labuhan. Dalam pertermuan tersebut, kata Irsad, disepakati kesimpulan BPN dikawal petugas kepolisian dibenarkan untuk masuk ke lokasi lahan dan mencari tapal batas dan masyarakat ikut membantu, namun BPN tidak diizinkan untuk mengukur atau mematok lahan masyarakat. Namun, sejumlah petugas Polisi/Brimob yang bersenjatakan lengkap masuk ke lahan sehingga mendapat protes dari warga. Ustadz KH Zulkarnain segera mendatangi sejumlah personel bersenjata lengkap itu untuk mempertanyakan maksud dan tujuan masuk ke lahan masyarakat. Ternyata, keberadaan Ustadz KH Zulkarnain tidak digubris oleh aparat kepolisian, bahkan menuding ustadz itu telah menghalang-halangi aparat. Selanjutnya, Ustadz Zulkarnain mengajak warga Gapoktan untuk melaksanakan pembacaan doa dan zikir bersama di lahan garapan. “Saat warga sedang berzikir dan berdoa, petugas keamanan mengusir orangorang yang sedang berdoa dan berzikir sehingga warga terlihat histeris bahkan banyak anakanak yang terinjak-injak. Banyak juga warga yang dianiaya oleh

oknum Polisi/Brimob tersebut,” sebut Irsad. Begitu mengetahui banyak warga yang menjerit ketakutan dan dianiaya, Ustadz KH Zulkarnain mendatangi aparat keamanan tersebut, namun ustadz tersebut ditarik paksa dan tubuhnya diangkat paksa oleh oknum Polisi/Brimob tersebut. Tak hanya itu, Ustadz KH Zulkarnain juga diinjak-injak dan diseret sejauh 10 meter dari lokasi kejadian,. Kata Irsad, tindakan oknum Polisi/Brimob tersebut dinilai telah melanggar HAM dan kebebasan beragama. “Jadi, kami mendesak Kapolri agar mengusut tuntas kasus penganiayaan dan pelanggaran HAM yang diduga dilakukan oleh oknum Polisi dan Brimob terhadap warga Gapoktan dan Ustadz KH Zulkarnain. Kapolri harus selidiki keberadaan PT MML yang diduga sebagai provokator dan badan hukum yang memiliki kepentingan dalam kasus tersebut,” tuturnya. Irsad menjelaskan, pihaknya juga sudah membuat pengaduan tertulis kepada Presiden RI, Kapolri, Komnas HAM, Kompolnas, MUI Pusat, Ombudsman, dan BPN Pusat. Sementara itu, Ustadz KH Zulkarnain menuturkan, tindakan oknum Polisi/Brimob yang telah menganiaya dan menyeret-nyeret dirinya merupakan tindakan sadis dan tidak berprikemanusiaan. (h04)

Polisi Gerebek Judi Bola 12 Ranmor Diduga Hasil Kejahatan Diamankan MEDAN (Waspada): Satu gudang berkedok warung kopi diduga sebagai markas judi bola dan peredaran narkoba yang berada di Jln. Rakyat Ujung, Kel. Tegalrejo, Kec. Medan Perjuangan, digerebek petugas Reskrim Polsek Medan Timur, Selasa (7/1) dinihari. Hasil penggerebekan itu, 9 pria diamankan dan 12 unit sepedamotor diduga hasil tindak kejahatan disita sebagai barang bukti. Selain itu, polisi juga menemukan 1 amplop kecil ganja, 1 paket sabu beserta alat hisapnya, dan sepucuk senjata tajam. Informasi yang diperoleh di kepolisian, Rabu (8/1), penggerebekan itu bermula dari informasi diterima kepolisian maraknya aktifitas judi bola, penggunaan narkoba, dan penyimpanan sepedamotor diduga hasil kejahatan di warkop tersebut. Berdasarkan informasi tersebut, polisi langsung melakukan penggerebekan sekaligus mengamankan sembilan pria yakni berinisial HS, Iq, BS, FS, JS, Mo, Dar, DS dan CM, yang

saat itu sedang bermain kartu domino di bagian depan gudang yang digerebek itu. Polisi yang melakukan penggeledahan ke setiap sudut gudang termasuk terhadap 9 pria itu, menemukan 12 unit sepedamotor diduga hasil curian yang disembunyikan di bagain belakang dan depan gudang tersebut. Begitu juga dengan 1 paket sabu dan 1 amplop ganja dari salah satu sepedamotor BK 6747 DU milik JS. Bahkan, senjata tajam juga ditemukan dari kantong jaket yang dikenakan Iq. Kanit Reskrim Polsek Medan Timur AKP Paul E Simamora menjelaskan, dari tersangka JS dan HS ditemukan satu paket sabu-sabu yang akan dikonsumsi. “Alat hisap sabu ditemukan di tempat itu sehingga memperkuat kalau tempat itu sering dijadikan tempat untuk mengkonsumsi narkoba. Selain menangkap JS, polisi juga menahan tersangka HS karena berdasarkan keterangan JS, narkoba itu dibeli berdasarkan perintah dan menggunakan

uang HS sebesar Rp100 ribu, “ sebutnya. Simamora menyebutkan, pihaknya sudah menetapkan tiga orang tersangka atas kasus itu. Ketiga tersangka dijerat pasal berbeda yaitu tersangka JS dijerat pasal 112 subs 114 UURI Nomor 35 Tahun 2009, tersangka HS dijerat pasal 132 UU RI Nomor 35 Tahun 2009, dan tersangka Iq dijerat UU Darurat Nomor 12 dan 51. Sementara untuk 12 unit sepedamotor diduga hasil curian itu, masih menunggu hasil pemeriksaan Unit Regident Ditlantas Polda Sumut karena sejauh ini belum ada bukti yang menguatkan kalau 12 unit sepedamotor itu merupakan hasil gadaian. Pantauan Waspada di gudang yang digerebek itu, Rabu (8/1) siang, terlihat suasana sepi. Sejumlah warga sekitar yang ditemui mengaku tempat itu diketahui sebagai warung kopi saja. Begitu juga dengan penghuni rumah Br Sitanggang mengaku rumahnya itu hanya beraktifitas sebagai warung kopi.(h04)

Jadwal Pelaksanaan Mukota IV Kadin Medan Dipercepat

Waspada/Rustam Effendi

KEPALA KPPBC TMP Belawan Widhi Hartono mengambil sebahagian pakan ternak yang akan dimusnahkan secara ditanam di lahan Lapangan Tembak TNI AL, Seruwe, Kel. Sei Mati, Kec. Medan Labuhan.

MEDAN (Waspada): Panitia Musyawarah Kota (Mukota) IV Kamar Dagang dan Industri (Kadin) Medan sepakat akan mempercepat jadwal pelaksanaan pada Rabu 15 Januari 2014 di Hotel Polonia Medan. Seharusnya Mukota IV dilaksanakan pada Sabtu (18/1) dimajukan menjadi Rabu (15/ 1), mengingat Sabtu akhir pekan, banyak pejabat tugas ke luar kota, bahkan ke luar negeri. “Panitia sudah sepakat akan mempercepat dari jadwal dan acaranya akan dibukaWali Kota Medan H Dzulmi Eldin,” kata Ketua Panitia Pelaksana Mukota IV Kadin Medan Drs Imam Herianto menjawab wartawan disekretariat panitia Jln. Palang Merah Medan, Kamis (9/1).

Imam yang didampingi unsur panitia pelaksana di antaranya Putrama Alkhairi, Ir Rudi Zulham Hasibuan, dan Sulaji, berkeyakinan Mukota IV Kadin Medan lebih ramai dari acara sebelumnya, mengingat pelaku ekonomi dari BUMN, BUMD dan koperasi, diundang pada acara tersebut. “Lebih kurang 200 hingga 250 peserta Mukota diundang untuk membicarakan pogram usaha dan agenda kerja Kadin Medan ke depan sesuai dengan Anggaran Dasar dan Anggaran Rumah Tangga (AD/ART) Kadin Medan,” tambah Rudi. Sementara itu, Putrama Alkhairi mengatakan, sejalan dengan tema “Memperkuat peran dunia usaha yang berdaya saing

untuk kemajuan kota Medan,” semua persiapan sudah mantap termasuk akomodasi, konsumsi, persiapan undangan kalangan pejabat dan dunia usaha, tinggal hari H pelaksana acara yang berlangsung lima tahun sekali. Menyinggung kandidat Ketua Kadin Medan ke depan, Imam Herianto dan Rudi Zulham menyebutkan, calonnya dari kalangan pengurus Kadin Medan tergolong lumayan, rata-rata mampu memajukan dunia usaha kedepan. “Namun terserah kepada peserta Mukota IV Kadin Medan yang memilih salah seorang ketua yang terbaik di antara yang baik,” sebut Imam. (m32)

Medan Metropolitan

WASPADA Jumat 10 Januari 2014

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-278 11 Banda Aceh GA-142 12 Banda Aceh GA-280 14 Palembang GA-266 15. Palembang GA-268 16. Batam GA-270 17. Batam GA-272 18. Padang GA-260 19. Penang GA-804 20. Pekanbaru GA-276 21. Tanjungkarang GA-270

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.30 07.15 09.40 17.10 06.00 17.40 09.30 14.20 10.35 10.55 06.00 12.35

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Palembang Palembang Batam Batam Padang Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-279 GA-143 GA-281 GA-267 GA-269 GA-271 GA-273 GA-261 GA-805 GA-277 GA-271

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 09.50 12.35 19.45 09.55 21.35 12.50 20.45 16.25 13.20 08.45 20.10

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru 14 Singapura 15 Singapura

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981 QZ-8022 QZ-8028 QZ-664 QZ-668

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10 11.00 07.00 09.20 18.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru Singapura Singapura

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029 QZ-665 QZ-669

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30 12.35 21.15

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Tiba Dari



Jadwal Perjalanan Kereta Api No KA

Nama KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A









RANTAU P 07.47 RANTAU P 10.17 RANTAU P 15.44 RANTAU P 23.03 MEDAN 07.52 MEDAN 14.58 MEDAN 17.18 MEDAN 23.13 MEDAN 08.08 SIANTAR 14.30 MEDAN 07.50 TANJUNG 06.49 MEDAN 13.06 TANJUNG B 13.11 MEDAN 19.36 TANJUNG B 17.33 MEDAN 05.42 TEBING TINGGI 18.44 MEDAN 05.46 BINJAI 05.02 MEDAN 07.14 BINJAI 06.30 MEDAN 09.15 BINJAI 08.30 MEDAN 12.18 BINJAI 10.00 MEDAN 13.53 BINJAI 13.09 MEDAN 16.49 BINJAI 14.37 MEDAN 19.00 BINJAI 18.16 MEDAN 21.40 BINJAI 20.56

13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA



Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)


Musnahkan Narkoba Sebelum Merusak Anak Bangsa MEDAN (Waspada): Kapolresta Medan Kombes Pol Nico Afinta Karokaro SIK, SH, MH menegaskan, narkoba harus dimusnahkan sebelum merusak semua anak bangsa. “Narkoba sudah meracuni hingga ke bawah, jadi narkoba harus dimusnahkan sebelum merusak semua anak bangsa dan generasi muda,” kata Kapolresta diwakili Waka Polresta AKBP Hondawan Naibaho, Kamis (9/1). Penegasan ini disampaikan Wakapolresta AKBP Yusuf Hondawan Naibaho didampingi KasatNarkobaKompolDonyAlexander dalam acara perte-muan

dengan mantan pecandu narkoba yang telah direhab di gedung Bhayangkara Polresta Medan. Dijelaskannya, narkoba tidak pandang bulu. Mulai kalangan bawah hingga berpangkat, pasti akan diserang oleh narkoba. Dapat dicontohkan, nelayan saja sekarang sudah pakai narkoba, alasannya supaya tidak mengantuk ketika di laut. “Ini kan semakin terlihat bahwa narkoba sudah meracuni hingga ke bawah. Jadi narkoba harus dimusnahkan sebelum merusak semua anak bangsa,” sebutnya. Menurut dia, pengguna adalah korban dan selain membuat pengguna rusak, narkoba

juga dapat mengakibatkan penyakit seperti AIDS. Karena ratarata pengguna narkoba sering melakukan aksi kriminal. Jadi, narkoba sangat berbahaya bagi siapapun. Menurut Hondawan, siapapun pecandu narkoba yang ingin berubah dapat dibantu dengan cara direhab. Karena mereka adalah korban dan undang-undang rehab sudah ada diatur, jadi kami (Polisi) hanya menjalankan saja. Sementaraitu,KasatNarkoba Kompol Dony Alexander menambahkan, sejak tahun 2013 hingga awal 2014 sudah 38 orang melakukanrehabdiSatresNarko-

Rumah Penjual Bensin Eceran Terbakar MEDAN (Waspada): Rumah semi permanen di Jln. Garu III No. 32GangPuskesmas,Kel.Harjosari I, Kec. Medan Amplas, musnah terbakar, Kamis (9/1) siang. Saksi mata menyebutkan, api berasal dari dapur rumah yang menjual bensin eceran. Kemudian menyambar ruang tengah hingga merembet ke seluruh bagian rumah. Kata warga, rumah tersebut disewa Wak Udin, 50. “Dia menjual bensin eceran, ada dugaan bensin yang dijual itu dioplos,” katanya. Namun tetangga Wak Udin yang rumahnya persis disamping kebakaran mengaku tidak mengetahui asal api. “Saya tidak tahu persis seperti apa kejadiannya, karena saat keluar rumah tiba-tiba api sudah membesar. Saya juga tahu kebakaran dari

warga yang berteriak-teriak,” ujarnya menyebutkan sempat terjadi dua kali ledakan, tetapi tidak tahu sumber ledakan itu. Suriani Pinem, salah seorang penghuni rumah mengatakan, api berasal dari dagian dapur kemudian merembet ke bagian lainnya. “Asal apinya dari dapur,” sebut wanita berusia sekira 48 itu saat ditanya petugas kepolisian. Mengenai kerugian akibat kebakaran tersebut, Suriani mengaku mencapai ratusan juta rupiah. “Tidak ada lagi barangbarang kami yang tersisa pak, tinggal baju yang kami pakai ini. Satu sepedamotor, tiga televisi, 10 gram emas, dan lainnya hangus terbakar pak,” tuturnya. Kepala Lingkungan III Kel. Harjosari I Medan Amplas M Husein mengatakan, tidak

mengetahui rumah tersebut dijadikan tempat mengoplos minyak. “Kalau itu saya tidak tahu, coba saja tanya ke pihak kepolisian,” katanya. Kanit Reskrim Polsek Patumbak AKP Hatopan Silitonga belum berani menyimpulkan sumber api yang membakar rumah tersebut. “Belum tahu sumber apinya dari mana, sampai saat ini masih kita selidiki,” ujarnya. Pantauan di lapangan, api dapat dipadamkan setengah jam kemudian, setelah belasan unit mobil pemadam kebarakan diturunkan. Tidak ada korban jiwa dalam kejadian tersebut. Sedangkan petugas kepolisian yang turun ke lokasi telah memasang garis polisi untuk menyelidiki penyebab pasti kebakaran.(m27)

ba Medan, di antaranya polisi. “Dalam memberantas narkoba, kami tidak pandang bulu. Ada 5 orang polisi yang sudah direhab. Meskipun mereka polisi, namun tetap kita lakukan rehab bukan kita lepas begitu saja, karena mereka adalah korban,” katanya. Sementara itu, Koordinator After Care Nurdin Wijaya mengatakan, bahwa tingkat korban pengguna narkoba di Sumut sudah tinggi dan rata-rata didominasi oleh kaum muda. ”Dari data rehab di Lido dan di Makasar, korban narkoba dari Sumut sudahmencapai70persen.Untuk itu, saya membentuk After Care ini yang berguna untuk menampung dan memberikan arahan bagi mantan pecandu narkoba yang sudah di rehab,” tuturnya. Menurut dia, After Care adalah perpanjangan dari BNN. Jadi, setelah direhab, dapat bergabung dengan kami. Namun, mantan pecandu juga tidak dapat begitu saja menjadi anggota kami, harus melalui peraturan yang ada sama kami yaitu tes urine. ”Jadi, meskipun sudah keluar rehab bukan berarti bisa langsung bergabung sama kami. Bila ternyata urinenya positif, kami tidak menerimanya,” katanya. (m39)


JAMAAH zikir Az Zikra bersama pengurus foto bersama usai zikir akbar di Masjid Agung Medan.

Az Zikra Gelar Zikir Akbar MEDAN (Waspada): Majelis Zikir Az Zikra Sumatera Utara menggelar zikir akbar bersama di Masjid Agung Jln. P. Diponegoro Medan, Minggu (4/1). Acara diawali dengan pembacaan Alquran oleh Ir H Khairi Lubis, dan sari tilawah oleh Mariati Harjo Arifin, dilanjutkan shalat tasbih, tahlil, tahmid, dan lantunan selawat Nabi, serta berdoa munajad kepada Allah SWT. Sedangkan membaca istighfar dipandu oleh Ketua Harian Az Zikra Ustadz Drs Irwanto SHI, SPdI. Sementara tausiyah disampaikan Ustadz DR Muzakkir MA. Menurut dia, ada tiga pesan Nabi SAW kepada para sahabatnya. Pertama, beramal saleh yaitu selalu benar dan berbuat baik menjadi teladan dikeluarga juga di tengah-tengah masyarakat menjadi orang yang terbaik. Kedua, tingkatkan ubudiyah kepada Allah, dengan menjaga shalat lima waktu, usahakan tepat waktu ditambah dengan shalatshalat sunat dan puasa-puasa sunat. Ketiga, hidup sehari-hari berakhlakul karimah, berpakaian yang sopan. Ber bicara lemah-lembut, bergaul dengan orangorang yang shaleh karena ridha Allah itu akan hampir kepada orang yang berbuat baik. (cwan)



1 CM Rp. 13.200 1,5 CM Rp. 19.800

2 CM 3 CM


AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

CHEVROLET BLAZER MONTERA Thn 2005 New. Air Bag, Hitam, BK Mdn, Rp. 70Jt. Hub 0853 7089 9893 CHEVROLET AVEO LT Thn 2005. W. Hitam, BK Asli Mdn, (1 tgn), Mbl Jarang pakai (Km. Rendah). Lkp : Ac, Tp, Cd, Vr, Br, Ps, Pw, Em, Cl, Remote, Jok Kulit, siap pakai, sehat, Terawat, mulus skl. Hrg 82Jt Nego. Hub 0852 1080 4566 DAIHATSU XENIA Li 1.0 Family Thn 2011. Silver, BK Mdn, Rp. 110Jt. Hub : 0853 6161 5977 DAIHATSU GRAND MAX PICK UP 1.5 cc Over Kredit Th 2012. Ac Dingin, P. Steering, Sudah Dibayar 17x sisa 31x 2.668.000. Balik DP 30Jt Nego. Hub 0812 6281 6585

DAIHATSU ESPASS Pick Up Thn 2004. Hitam, BK Medan, siap pakai, Hrg 40Juta/Damai. HP 0812 6545 1974

DAIHATSU TERIOS TX Thn 2011. Warna Hitam Met, STNK An : CV, Harga 162Jt Nego. Hub 0812 9605 3737 HONDA SUPRA X 125 Thn 2006. Hitam/Silver, Mulus, Rp. 7,2Jt. Hub 0813 6131 4188 HONDA ACCORD CIELO Thn 94. W. Merah Met, BK Asli Mdn, Mbl Cantik, Interior rapi, Bersih, sehat, terawat & Mulus skl, Lkp : Ac, Tp, Cd (Pwr + Subwoofer), Vr, Br, Ps, Pw, Em, Cl, Remote, Jok Kulit, siap pakai. Hrg 53Jt Nego. Hub 0853 6082 8533

HONDA JAZZ IDSI MATIC Thn 2006. Abu Met, BK Mdn, Rp. 112Jt. Hub 0852 7538 3218 HYUNDAI ATOZ 1.1 M/T Thn 2005. Hitam, BK Mdn, Rp. 70Jt. HUb : 91327433 BRIO JAZZ FREED CR-V

DP 30 Jtan DP 40 Jtan DP 40 Jtan DP 80 Jtan

READY STOCK BRIO S AT YA ! Te r i m a Tu k a r Tambah 081 370 999 998, 0617738 8133 / 287E9500

HYUNDAI ACCENT 2000 Merah, Mobil Baik. Hub 0813 7645 8528 / 0852 6241 1545

Rp. 26.400 Rp. 39.600

4 CM 5 CM

Rp. 52.800 Rp. 71.500

ISUZU PANTHER MINIBUS LDX ABU - ABU MET Th 91 Orisinil, Mulus, Vr, Br, Ps, Dvd, Ac Double, Hrg 42Jt Nego. Hub 0812 6063 7823

NISSAN TERRANO SPIRIT S-2 Thn 2005. W. Hitam, BK Asli Mdn, Lkp : Ac, Tp, Cd (Pwr + Subwoofer), Vr, Br (4 Baru), Ps, Pw, Em, Cl, Remote, Jok Kulit, Mbl Mulus Skl, Sehat, Terawat, siap pakai. Hrg 105Jt Nego. Hub 0852 0687 0211 NISSAN GRAND LIVINA XV M/T Thn 2007. Abu Met, BK Mdn, Rp. 115Jt. HUb : 0812 6594 2789

SUZUKI JIMNY LONG 4X4 Pick Up/Kanvas 4 Bangku Th 91, Pengapian 900 Watt, CDI, Ban Cangkul Comodo MT, Velg Nikel, Bumfer ARB, Full Sound Pake TV Bisa Karaoke. Hub : PRUM Suka Maju Indah Blok EE 24 Rumah Dr. Yasmin Samping Mesjid Masuk Dari Samping PDAM Tirtanadi Sunggal, Mobil Benar - Benar Dibangun Jadi SUZUKI APV Silver Type X, Ac Double, Thn 2005. Mobil Orisinil, Satu Nama Dr Baru. Murah & Gaya. Hub 0853 6132 4294 SUZUKI CARRY PICK Up Thn 2006. Hitam, BK Medan, 1 tgn, Terawat, siap pakai. Hub 0812 6332 0389 SUZUKI KATANA GX Thn 1995. Merah Met, BK Medan, Mulus dan terawat. Hub : 0812 6332 0389

6 CM 7 CM

Rp. 85.800 Rp. 100.100

DIJUAL 1 (SATU) Unit mobil TOYOTA INNOVA TYPE V Thn 2007. Warna Biru Gelap, Bensin, BK Medan Asli, Satu Tangan Pemilik, Ban 95 % Baru, Sangat Mulus sekali dan tidak kecewa, Harga Rp. 170Juta/Nego. Hubungi PASCAL HP 0821-6765-1001 TOYOTA COROLLA Thn 75. Vr, Jok Kulit, Merah, Mulus Luar dalam, Pajak Bln 2. Rp. 16.500.000 Nego. Hub 0852 0616 8084

MOBIL DICARI OVER KREDIT AVANZA/INNOVA/ FORTUNER/YARIS /APV/PAJERO/CRV/JAZZ/ Kontan Pun Ok!. H. IPUL 0812 6038 5555 / 0821 6767 7000 / TELP/SMS TOYOTA KIJANG LGX 1.8 Efi Thn 2003 Akhir. W. Cream Silver, Pjk Baru Lengkap, SUZUKI APV 1,5 cc Thn 2005. W. Hijau Metalik, Lengkap, dua - duanya mulus original, Dijual Salah Satu B.U. Hub HP 0 8 2 1 6 1 7 7 6 0 8 6 Mdn

TOYOTA KIJANG G LONG 1.5 Thn 94. Abu - Abu, BK Mdn Asli Lengkap, siap pakai, Hrg Rp. 60Juta/Nego. HP 0813 6103 2042 TOYOTA STARLET CAPSUL Hitam Met Th 91. Model Sudah Jumbo, Vr, Br, Ps, Pw, Cl, Ac Dingin, Hrg 43Jt Nego Abis. Hub 0823 6432 0052

# DEALER TOYOTA # Tahun Baru & Mobil Baru, Dapatkan Info dan Penawaran Menarik Untuk Toyota Anda. Hub Annuar Damanik 0823 7088 0815 TOYOTA KIJANG KAPSUL DIESEL Model LGX Thn 1999. Silver Met, Ac Double, Mulus dan Terawat, Bisa Bantu Kredit. Hub 0852 6216 5198

TOYOTA CAMRY V A/T Thn 2011. Htm Met, Body Mulus, STNK Baru, Panjang, an : CV, Harga 340Jt Nego. Hub 0878 6755 0988 TOYOTA KIJANG KRISTA SILVER 2002. BK Mdn (Baru), Interior Coklat, Rp. 140Jt. Serius Peminat Hub 0812 6945 0458 , 0812 6575 3527

TOYOTA COROLLA GREAT 94 AKHIR. BK Asli Medan, Warna Merah, Rawatan Auto, 2000. Hub 0821 6399 3022

BUTUH DANA GEBYAR DANAI TUNAI Proses 3 jam Cair, Tanpa Usaha dan Surat Terjamin. Jaminan : SHM, HGB, SK Camat, BPKB Mobil, Truk, Spd Mtr, Mobil yg masih kredit/over leasing/Bantu Pelunasan BPKB. Hub Family Finance SDR Jaya (0813 7044 6668 - 0813 7044 6633) TUTUP KARTU KREDIT / KTA Hanya Byr 20 % dari total Tagihan Terakhir, Hutang Lunas 100 % LEGAL. Rizal 0812 8853 6428

SUDAH PUNYA USAHA MASIH BUTUH MODAL Hub. 0853 7372 2365 Proses Cepat

BUTUH DANA 1 Hari Clear Khusus Surat Tanah, Tanpa Izin Usaha/Syarat Gampang. Hub : 0812 6078 7230 F D




Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

8 CM Rp. 114.400 9 CM Rp. 138.000


DIBUTUHKAN SEGERA 1). Sekretaris & 2). Bagian Administrasi Untuk Kantor Leveransir & Kontraktor S y a r a t : Wa n i t a M u s l i m Berpenampilan Menarik, Menguasai Computer & Pembukuan, Pendidikan SMA / Sederajat, Foto Copy Ijazah, KTP, KK, Pas photo 4x6 = 2 Lbr Warna, Surat Lamaran. No HP, Usia 19 s/d 27 Thn, Belum Menikah. Kirim Ke : Warung HJ. Hayati Jl. Panglima Denai No. 3, Sebelah Jl. Jermal 15 Depan I n d o m a re t ( A d a Te m p a t Tinggal). HP : 0812 6505 0888, 0823 6943 8432. PIN : 280375FF Perusahaan yang sedang berkembang membutuhkan : TENAGA KERJA (SPG) - Tamatan semua jurusan - Gaji + uang transport + insentif + bonus - Mampu bekerja secara individual atau team Lamaran diantar langsung ke JL. Pimpinan No. 14 Medan Perjuangan


3 orang Tukang Pangkas yang berpengalaman dan bersedia untuk diuji/disekelsi. Untuk ditempatkan di Baganbatu Riau, Pangkas AC MARIKENA, yang sudah terkenal sejak tujuh tahun yang lalu. Tempat tinggal anggota tersedia dan hasil memuaskan. Berminat Hub. 0821 7049 9207 / 0812 6861 6068

DICARI SEGERA Perusahaan jasa tenaga pengamanan sedang membutuhkan : Satuan Tenaga Pengamanan (SATPAM) 65 Orang untuk ditempatkan dikota Medan. Syarat : 1. Tinggi min 165 cm 2. Minimal SMA atau Sederajat 3. Jujur, Berwawasan, Mampu bekerjasama dengan TIM 4. Memiliki Ijazah asli 5. Mempersiapkan Pakaian sendiri Kirim Lamaran : PT. NAGA HARI UTAMA Jl. Wahidin No. 81 E/197 (Apotik Jaya Wijaya) atau SMS biodata ke 0819 7224 466 (Hanya SMS)


5 Asistant Salon Khusus Wanita Dibidang : Pangkas / Cowok, Cewek, Many Pedi, Creambath. Uang Makan + Gaji + Persen. Bagi yg luar Kota Disediakan tempat tinggal. Minat Hub 0813 7046 4074


2 Orang Teknisi Perakitan Panel, Distribusi dan Otomatis PLN - Genset. Lamaran diantar di Jl. Aksara No. 139 Depan Bank BRI. Hub 0811 652 608 DIBUTUHKAN Tk. Pangkas Pria Berpengalaman, Khusus Pria. Hub 081 2621 8209 LOWONGAN KERJA Taman Penitipan Anak berskala Nasional membutuhkan tenaga pengasuh untuk dikantor Cabang Medan : Pengasuh Day Care Syarat : - Muslimah berjilbab - Tamatan SMU/Madrasah - Memiliki kompetensi di bidang membaca Alquran, story telling - Menyukai & sayang anak, kreatif, ceria - Jujur, sabar, loyal, mau belajar, ulet, gigih, fleksibel Segera kirimkan lamaran lengkap & pasphoto ke TAMAN PENITIPAN ANAK KHALIFAH DAYCARE & LEARNING CENTRE Cabang Medan Jl. Masdulhak No. 25 Medan 20152 Tlp. 087868226080 / 081264820311


- P/W, Lulusan SMA, D3 dan S1 - Usia 18 s/d 35 tahun - Untuk Posisi : Staff Admin, gudang, supervisor, Manager, Marketing executive, Operator. PAKET TRAINING FREE LULUS LANGSUNG BERKARIR Lamaran Ditujukan Ke : PT. UNI MEDAN CAB. SUMATERA UTARA - ACEH Alamat : Jln. Kelambir V No. 3 Medan Hubungi Ibu ASTRID Hp : 082370601768 Pak Benny Hp : 08126377258 Lamaran di Mulai tanggal : 13 s/d 20 Januari 2014

10 CM Rp. 154.000 11 CM Rp. 181.000

Jumat, 10 Januari 2014



Mekanik Sepeda Motor Berpengalaman (Usia 25-35 Thn). Hub 0822 7623 3700 DIBUTUHKAN SEGERA BAGIAN TICKETING Persyaratan : 1. Wanita 2. Usia Maks 35 tahun 3. Pendidikan Min SMA 4. Pandai Mengoperasikan Komputer 5. Mampu Menguasai Ticket Domestic & International 6. Berpengalaman & Banyak Relasi 7. Berpenampilan Menarik, Rapi, dan Sopan 8. Mampu Berkomunikasi Dengan Baik, Rajin, Jujur, Disiplin, Bertanggung Jawab, Tegas serta Loyal pada perusahaan. Lamaran & CV diantar langsung ke

Info Pemesanan Iklan Hub. PIN BB 26 247F5E HP. 0877 17844035 - 0811 6046 90


12 CM Rp. 198.000 6x6,6 kolom Rp. 132.000




HP. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

PT. TAIBAH Tours & Travel Umroh & Haji Plus Jl. Brigjend Zein Hamid Komplek Katamso Indah Blok A No. 24. (Simpang 4 Lampu Merah Titi Kuning) Atau Hubungi di 082354633976 / 087868930018. Lamaran di Antar Paling lama Akhir Januari


STUK. BK 8315 CV. No uji : AB.01.029791. A/N : CV. Anugrah Alam Abadi. Alamat : Jl. B. Katamso. Merk : Toyota


STUK. BK 9729 CU. No uji : AB.01605889. A/N : Tulus Prabowo .Alamat : Jl. Pancing 1 Medan Mabar. Merk : Mitsubishi


STUK. BK 8089 CP. No uji : AB.01.017184. A/N : Karya Agung Sejati. Alamat : Jl. Karakatau Medan. Merk : Mitsubishi

300 Tours & Travel Haji Umroh Izin Kemenag : D/397 Office: Jl. Brigjend Zein Hamid No. 24 (Simpang Empat Titi Kuning) Telp/Fax. 061 7881431 e-mail: Call Center : 0812 9155 1500, +966502569048 (Saudi

STUK. BK 1149 GJ. No uji : MDN 59037. A/N : PT. RMC. Alamat : Jl. Letjen J. Ginting 215 Mdn. Merk : Daihatsu


STUK. BK 8267 CF. No uji : AB. 01.001155. A/N : Omama Opapa Food Industri. Alamat : Jl. Toyai No. 14 Medan. Merk : Mitsubishi


No 1


1 BPKB MITSUBISHI FE 349 BA 9913 VJ. a.n YATMA NOVELIZA. Alamat : KM 1 Sei Dareh Kec. PL Punyung Prov. Sumatera Barat


STUK. BK 9496 LU. No uji : PY 2590. A/N : Yulastri. Alamat : Jl. Sidomulyo No. 78. Merk :Mitsubishi


STUK. BK 8910 LO. No uji :MDN 07141 C, Yung. A/N : Muhammad Taufan. Alamat : Jl. Jl. Deli Tua No. 17 B Medan. Merk :Mitsubishi

TERCECER Pada Bln September 2013 Disekitar Kota Siantar Yaitu Asli Sertifikat Hak Guna Bangunan No. 28 Tgl 25 Februari 1970. Terdaftar An. Badarun Siregar TERCECER

STUK. B. 9492 SU. A/N : Pieter Kawi. Alamat : Jl. Suka Jaya No. 7 RT 6/1 Jakbar. Merk : Mitsubishi


Telah Tercecer BPKB dan STNK Spd Motor Honda Vario dgn No Polisi BK 2836 ADB. A/N : RIRIS MAGDALENA SIANTURI. Bagi yg Menemukan Harap Hub 77195649 TERCECER Sebuah dompet berisi : 1) STNK Sepeda Motor, No Pol BK 3115 UK 2) KTP, KTM Unimed, ATM Mandiri, SIM C, a/n ILHAM RAHMANSYAH SIREGAR. yang menemukan harap mengembalikan ke JL. Murai I No. 60 Perumnas Mandala Medan. Tdk akan dituntut & diberikan hadiah sepantasnya

TERCECER 1( Satu) Buah Surat Tanah SK Camat Desa Tanjung Gusta Kabupaten Deli Serdang, atas nama Antonius Panjaitan. Tercecer sekitar Jalan Gaperta Ujung, Bagi yang menemukan antar ke alamat Jln. Periuk No. 81 Medan

TERCECER 1.Akte Pengoperan dan Penyerahan Hak Dengan Ganti Rugi, Tanggal 22 September 1990 No. 122 2.Akte Pengoperan dan Penyerahan Hak Dengan Ganti Rugi, Tanggal 25 Agustus 1990 No. 124. Keduanya dibuat dihadapan Drs. Ade Rachman Maksudi, SH pada waktu itu Notaris di Medan




Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA Dibuka sampai pukul 22.00


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000


Ekonomi Arbain & VIP Paket Hotel 9 Hari Mukhtar Alami 15 Hari Safaro

Harga $ 1850

Al-Haram Grand Zam-zam

$ 2350

9 Hari

$ 2100

* Note: Paket & Arbain by OMAN Air / Setaraf Paket VIP by SQ/MH * Nb. Harga Sewaktu Waktu Dapat Berubah

Contact Person:

Ahmad Alfan (0823 5463 3976)



Kelas Ekonomi Arbain Ekonomi



STNK/BPKB - B.9492 SU. A/N : Pieter Kawi. Alamat : Jl. Suka jaya 1 No. 7 RT 6/1 Jakbar. Merk : Mitsubishi

STUK. BK 8316 CU. No uji : AB. 01.029792. A/N : Cv. Anugrah Alam Abadi. Alamat : Jl. B. Katamso. Merk : Toyota




LOWONGAN KERJA Dibutuhkan 1 (satu) orang Sarjana Komputer (Laki laki) untuk dipekerjakan sebagai Guru Di SMK Negeri 9 Medan, Jl. Patriot No. 20 A Medan. Lamaran diantar Langsung



Berpengalaman, Muslim, Umur max 30 Lamaran di SMS ke No 0813 7535 6353 BURSA


Informasi Pembaca Bursa Property G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

DIJUAL 1 Unit Rumah Ukuran Tanah 14,5 x 13 Meter, Luas Bangunan = 130 M2, SHM, Di Jln Garu II-B Gg. Pribadi No. 91 G. Hubungi: SOFYAN HARUN 081 2608 8206


1 Unit Rumah Ukuran 5x12, 1 1/2 LT, SHM. Di Jl. Eka Rasmi Prum Town House No. C3, Harga Rp. 450Jt Bisa Nego. Hub 0822 7317 2488 DIJUAL RUMAH

Rumah 6 Petak (4.5 x 15), Jl. Sepakat Gg. Saudara No. 7 (Dekat Kampus Swadaya), Air PAM, Listrik, SHM, Harga 200Jt/Petak. HP 0813 7095 6597. Cocok Untuk Investasi RUMAH BARU DIJUAL Perumahan Great Land Jl. Bunga Rente Blok F-3 Simp. Selayang - Setia Budi. Lt 6x12, 2 K. Tidur. Harga 265Jt. HP : 0823 6083 7100 JUAL CEPAT

Rumah Jl. Puri Gg. Sederhana I No. 16. LT : 10x20, 5 KT, 2 KM, Bertingkat Permanen, Full Keramik, siap pakai, SHM. Hub 0 8 1 2 8 8 6 1 3 4 3 4 TP. Harga Nego


Rumah Sewa 6 Pintu / Bln 400.000,- Ditembung Psr 7 Bringin. Uk Tanah 10,70x19. H : 340Jt /Nego. Hub 0852 6688 9870, 0853 7190 1971 DIJUAL RUMAH Type Minimalis Di Perum. Garu Mas Jl. Garu 6 No.18 Simp. Marindal Mdn. Type 80/78, Type 75/72 ,Type 68/72, Type 54/78, Type 48/72, Special Promo di awal Jan 2014. Hub 0813 6142 4972

RUMAH DIJUAL CEPAT Aman & Nyaman LT +/400 m2, 3 KM Tidur + KM. Mandi, Teras, R. Tamu, Dapur, Halaman Luas, Lokasi Jl. Asahan Dsn VIII Medan Km 0 Sei Mencirim Sunggal. Hub 0852 0661 3833 0878 6994 1072

H. Rudi Fahmi (0812 1850 2628)


Umroh & Haji Tour & Travel

MO P R O 14 0 2


KHUSUS PROMO S/D JANUARI 2014 Hanya 15,5 Juta bisa Umroh Hubungi Segera:

AL-BAROKAH Tour & Travel Jl. Gatot Subroto No. 6 A Medan (Depan Yayasan Panca Budi) Telp. 061-663 553 6 - 0813 6146 1117 “Keamanan, Kenyamanan, Ketepatan Waktu & Kekhusyu’an Ibadah” Adalah Motto Kami

TERAPI UAP OZON DAN OBAT HERBAL -Stroke, Kanker, Hepatitis -Diabetes, Prostat, Maag -Rematik, Asam Urat, L. Syawat -Osteoporosis, Radang Sendi -Pengapuran, Sakit Pinggang Saraf Terjepit, dll


Jl. Pasundan No. 32-B (Dekat Medan Plaza) Medan Petisah Telp: 061-4550362 HP. 0852 7044 4718 Buka Jam 9.00 - 18.00 KLINIK TERAPY/ ALAT VITAL

MAK EROT YANG TERUJI DAN TERBUKTI Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 62 A MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 -




Rmh Tempat Tinggal, L. 138, 3 KT, Listrik, SHM, Di Jl. Psr. V Gg. Saudara (Tembung), Siap Huni, Harga 325Jt, HP 0813 7095 6597


Rumah Tempat Tinggal, L. 123 M2, Listrik, SHM, KT 3, KM 2, Kramik, PAM, Jl. Selamat No. 24B Bromo Ujung. HP 0813 7095 6597

RUMAH DAN TANAH DIJUAL 10X20 Dan 12x15 Berdampingan. Jl. Sidorukun/Ridho No. 22 Medan. Telp 0812 6080 3095 TANAH DIJUAL TANAH

LT. 2800 m2 (7 rate) 30Jt/rate. Lokasi 50m dari Perumahan Griya Sakinah. 4 Desa Sukarejo Langsa Timur Hub. 0823 6030 5784



MENJUAL SEGALA JENIS BIBIT TANAMAN Bibit Gaharu, Kelapa Pandan Wangi Dari Thailand, Mangga Rusia, Jeruk Siam Madu, Manggis, Pala, Cengkeh, Kemiri, Durian, Pokat, Saoh, Jabon, Kecambah Sawit, Karet Sertifikat, Ingul, Vinus, Dll. Partai Kecil & Besar. Hub: Pak Jamal 0813 7091 2113

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda BURSA


Medan Metropolitan PT Askes Tidak Siap Jalankan Program BPJS WASPADA


Jumat 10 Januari 2014

Fraksi PAN: Tinjau Ulang MEDAN (Waspada): Ratusan masyarakat berunjukrasa ke kantor DPRD Medan, Kamis (9/1). Mereka meminta anggota dewan mendesak pemerintah pusat meninjau ulang pemberlakuan program BPJS yang tidak memiliki rasa empati kepada masyarakat. Togar Simanjuntak mengeluhkan PT Askes Jln. Karya Medan, tidak siap menjalankan program BPJS. Selain kurang sosialisasi, PT Askes juga tidak siap

mengantisipasi membludaknya masyarakat yang akan mendaftar menjadi peserta BPJS. “Pelayanannya sangat buruk. Kami sudah mengantre sejak pukul 06:00 pagi hingga pukul 15:00 tidak terlayani, bahkan oleh petugas sekuriti kami dimintai uang Rp25.000 per kepala baru bisa masuk. Kalau ingin mendaftar dikatakan formulirnya habis,” kata Togar yang menyayangkan program BPJS ini tidak sebagus dan tidak semudah seperti iklan di televisi yang diperankanatletbinaragaAdeRai. Sementara itu, Arita Lubis

mengatakan dirinya mendapat perlakuan kasar dari Kepala Pelayanan BPJS Tabor Sitompul yang menolak pendafataran melalui kelompok (wadah) dengan alasan pegawai BPJS tidak mampu melayani. Sedangkan Tri Susanto mengatakan, mendaftarkan diri menjadi peserta BPJS pada kelas 1 dengan biaya Rp59.500 setiap bulannya. Dirinya dipaksa oleh petugas BPJS untuk memilih fasilitas kesehatan (Faskes) di Puskesmas dan pada saat akan menggunakan kartu BPJS untuk berobat di Puskesmas yang

ditunjuk, dirinya ditolak dengan alasan pihak Puskesmas tidak ada menjalin kerjasama dengan BPJS. Tinjau Ulang Menanggapi keluhan masyarakat itu, Ketua Fraksi PAN DPRD Medan Ahmad Arif menegaskan, program BPJS harus ditinjau ulang. Banyaknya keluhan masyarakat terkait tidak manusiawinya pelayanan PT Askes yang telah bertransformasi menjadi BPJS menjadi indikator kalau program BPJS ini harus ditinjau ulang. “Kejadiannya tidak hanya di Medan, di beberapa kota besar seperti Surbaya, Jakarta, dan Palembang, masyarakatnya juga mengeluhkan hal yang sama tentang pelayanan,” sebutnya. Seharusnya, kata Arif, pendaftaran peserta BPJS baik melalui perorangan dan kelompok (wadah) dibolehkan. Hal ini mengingat keterbatasan waktu, kemacatan lalulintas dan mahalnya ongkos transportasi. “Jadi harus fleksibel lah,” ujarnya menambahkan pendaftaran melalui kelompok lebih efektif karena akan mengurangi beban kemacatan dan keterbatasan area parkir.

Harus dipahami PT Askes, jumlah penduduk Kota Medan hampir 3 juta jiwa pada siang hari, penduduk dengan ekonomi menengah sekitar 5000 jiwa, bagaimana mungkin PT Askes mampu meladeni masyarakat dengan jumlah SDM-nya yang terbatas dan kurang berkualitas. Solusi lain, menurut dia, harusnya BPJS membagi lokasi pendaftaran per wilayah kecamatan atau setiap rumah sakit/ puskesmas pemerintah atau dinas kesehatan dengan memperbanyak outlet dan lokat-loket pendaftaran. “Jangan lokasi pendaftaran disatukan menjadi satu tempat di PT. Askes Jln. Karya yang area parkirnya sempit, tenaga sumber daya manusia (SDM-nya) juga terbatas,” tutur Arif. Tidak hanya itu, kata dia, pegawai BPJS yang menghadapi calon pendaftar harusnya ditraining terlebih dahulu agar mampu menjawab pertanyaan calon peserta dengan baik. Apalagi seorang Kepala Pelayanan BPJS tidak etis kalau dirinya memarahi warga, bahkan menolak warga yang membutuhkan informasi untuk mendaftar. (m30)

Wakil Ketua DPW JBMI Sumut

Waspada Peduli Agama Dan Pendidikan

Waspada/Rudi Arman

KANIT Turjawali Sat Lantas Polresta Medan AKP Rosmawaty didampingi anggota melakukan penindakan terhadap sopir Angkot di Jln. Brigjen Katamso Medan, Rabu (8/1).

Sat Lantas Polresta Tilang 10 Angkot MEDAN (Waspada): Razia rutinyangdilaksanakanSatLantas PolrestadikawasanAvrosJln.Brigjen Katamso, menilang 10 angkutan kota (Angkot) dan 2 becak bermotor (Betor), Rabu (8/1). Razia dipimpin Kanit Turjawali AKP Rosmawaty dan anggota dimulai pukul 10:30 dan berakhir pukul 12:00 dengan sasaran semua kendaraan. Kasat Lantas Polresta Medan Kompol M Budi Hendrawan didampingi Kanit Turjawali AKP Rosmawaty dan Iptu Aspan kepada wartawan mengatakan, razia rutin tetap dilaksanakan agar para pengendara di Kota Medan bisa terus tertib berlalulintas. “Kita berharap dengan adanya razia rutin yang setiap hari

dilaksanakan ini bisa menertibkan dan menyadarkan para pengendara tentang tertib lalulintas,” ujar Budi. Menurut dia, kalau kesadaran pengendara sudah cukup baik, diharapkan bisa menurunkan angka kecelakaan lalulintas di wilayah hukum Polresta Medan. Dalam kegiatan razia rutin ini, kata Budi, semua kendaraan distop dan dilakukan pemeriksaan surat dan kelengkapan kendaraan.“Kalau sopir atau pengendara tidak bisa memperlihatkan surat kendaraan ditilang,” sebutnya. Dijelaskannya, banyak angkot yang terjaring razia. “Angkot yang ditilang karena surat-surat tidak ada, kalau betor juga surat-

suratnya tidak ada,” katanya. Selain ditilang, sopir yang tidak bisa menunjukkan kelengkapan surat-surat, Angkotnya ditahan di Sat Lantas Polresta Medan dan sebagian lagi di pergudangan kayu putih. Razia khusus Angkot tersebut untuk mengantisipasi sopir menyerapkan kepada sopir serap. “Selain itu menertibkan Angkot yang ngetem di tempat yang dilarang menaikkan dan menurunkan penumpang agar lalulintas tetap lancar,” ujar Budi. Dalam kesempatan itu, Budi menegaskan, razia rutin yang dilaksanakan Sat Lantas Polresta Medan akan dilaksanakan setiap hari dengan lokasi yang berpindah-pindah di Kota Medan. (m39)

MEDAN (Waspada): Harian Waspada tidak hanya mementingkan bisnis semata, tapi juga peduli terhadap agama, pendidikan, budaya, sosial, politik, dan lainnya. Demikian diungkapkan Wakil Ketua DPW Jam’iyah Batak Muslim Indonesia (JBMI) Sumut H Salamuddin Simatupang (foto), di kediamannya Jln. Tombak No.27, Kec. Medan Tembung, Kamis (9/1), mengomentari peran Harian Waspada yang berulang tahun Ke-67 pada 11 Januari 2014. Menurut dia, 11 Januari merupakan hari keramat dan bersejarah bagi Waspada setiap tahunnya. Seperti halaman agama termasuk number one (No.1) karena menyajikan empat halaman tiap hari Jumat. Ini membuktikan Harian Waspada yang kini dipimpin oleh intelektualitas putra-putri Alm. Bapak H Mohd Said dan almarhumah Bunda Hj Ani Idrus sangat religius. “Dan secara langsung telah melakukan syiar agama Islam,” kata Salamuddin yang juga Caleg DPRD Sumut Dapil Sumut 12 Binjai, Langkat, dari Partai Bulan Bintang. Salamuddin mengakui, dirinya sebagai pembaca setia Harian Waspada yang berlangganan sejak tahun 60-an ketika masih duduk dibangku SD hingga SMEP Negeri di P. Brandan bersama orangtuanya Alm Batara Simatupang membeli surat kabar Waspada melalui agen terkenal yaitu H Ismail (alm) di Jln. Kartini P. Brandan. Hingga melanjutkan ke SMA Negeri di Kota Medan dan hijrah ke Kota Medan sampai mendapat pekerjaan tetap berlangganan Waspada hingga sekarang. “Harian Waspada sudah menjadi kebutuhan sampai sekarang dan sebelum sarapan pagi, saya lebih dulu baca Waspada yang diantar loper setiap pukul 07:00 pagi. Setelah membaca Waspada barulah saya sarapan kemudian berangkat ke kantor,” sebut Salamuddin yang juga Wakil Ketua Parsadaan Simatupang Muslim dohot Berena Kota Medan. Saking cintanya terhadapWaspada, Bapak dari dua anak Emma Novirsari dan Enny Febrisari ini sangat rajin mengkliping berbagai artikel maupun tulisan atau tajuk Waspada, antara lain Al Bayan, halaman opini dan lain-lain. Salamuddin pernah menerima Buku Peristiwa 60 Tahun WASPADA yang disusun Pemimpin Redaksi H Prabudi Said berisi tentang kejadian sejak tahun 1945 hingga 2006. (m24)

Empat Daerah Di Sumut Terancam Longsor MEDAN (Waspada): Menurut BMKG Wilayah I, ke depan atau Januari 2014 ini potensi longsor di daerah pergunungan masih mengancam masyarakat. “Masyarakat harus meningkatkan kewaspadaan terhadap ancaman longsor ini, terutama masyarakat Tapanuli Utara, Toba Samosir, Tapanuli Tengah, dan Simalungun,” kata Kasi Data dan informasi Badan Meteorologi Klimatologi dan Geofisika (BMKG) Wilayah I Stasiun Bandara Kualanamu Mega Sirait SP (foto), saat dikonfirmasi, Rabu (8/1). Sedangkan kawasan Kota Medan, menurut dia, pada Januari ini sudah berkurang curah hujan. Namun, khusus di daerah pegunungan dan pantai barat seperti Tapteng dan Sibolga, hujan masih sering terjadi hingga pertengahan Januari 2014. Intensitas curah hujan sedang hingga lebat. Kata Mega, secara umum curah hujan di wilayah Medan dan Sumatera Utara pada bulan Januari ini sudah berkurang dibandingkan bulan Desember 2013. Hal ini diakibatkan pola sirkulasi udara yang memang pada Januari pergerakan udara menuju ke selatan, sehingga massa udara dari utara bergerak ke selatan, akibatnya hujan lebih banyak terjadi di selatan Indonesia seperti di Pulau Jawa dan sekitarnya. “Begitupun hujan masih tetap terjadi di Sumatera Utara, hanya saja hujannya tidak banyak dan intensitasnya ringan hingga sedang. Hujan umumnya terjadi pada pagi dan siang hari yang kecenderungannya cukup merata dan durasinya lama bahkan mencapai lebih dari 1 jam, tetapi hujannya tidak begitu deras,” tutur Mega. Sementara di daerah pegunungan dan pantai barat hujan masih sering terjadi hingga pertengahan Januari dengan intensitas sedang hingga lebat. “ Dengan demikian potensi longsor di daerah tersebut masih perlu diwaspadai seperti di kawasan daerah Tobasa, Taput, Tapteng, dan bahkan Simalungun,|” kata Megat. (m32)

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru Kompol Nasrun Pasaribu SH, SIK, MH (kiri) didampingi Kanit Reskrim Iptu Alexander P SH, menginterogasi tersangka Kh DPO Polresta Denpasar Bali.

DPO Polresta Denpasar Bali Ditangkap Di Medan MEDAN (Waspada): Tim Khusus Polsek Medan Baru menangkap seorang buronan Polresta Denpasar Bali, dalam kasus penggelapan uang Rp40 juta, sepedamotor, dan laptop pada penyergapan di Jln. Polonia Gang A, Kampung Anggrung, Kec. Medan Polonia. “Tersangka Kh ditangkap karena dia buronan Polresta Denpasar Bali, bahkan sudah masuk Daftar Pencarian Orang (DPO) yakni, DPO/96/ XII/2013 tertanggal 27 Desember 2013 yang ditandatangani Kasat Reskrim Polresta Denpasar Bali Kompol Beny Murjayanto SIK, MH,” kata Kapolsek Medan Baru Kompol Nasrun Pasaribu SH, SIK, MH, Rabu (8/1) sore. Nasrun didampingi Kanit Reskrim Iptu Alexander P SH mengatakan, tersangka Kh yang bekerja di kantor PT Paras Jln. Tunjangsari, Depa-

sar Bali, disuruh atasannya menyetorkan uang Rp40 juta, namun uang itu dilarikan tersangka bersama sepedamotor Yamaha Zupiter MX nomor polisi DK 6136 SL dan laptop milik perusahan property tersebut. Selanjutnya, tersangka Kh kabur ke Medan, sedangkan sepedamotor ditinggalkannya di parkiran Bandara Ngurah Rai, Denpasar Bali. Dalam kasus itu, korban I Made Sumiada Putra mengadukan tersangka dalam kasus penipuan dan pengelapan ke Polresta Denpasar Bali sesuai No. LP:/1243/XII/2013/Bali/Resta Ops tanggal 20 Desember 2013. Ketika ditanya kapan personel Poresta Denpasar Bali menjemput tersangka Kh, Nasrun mengatakan belum mengetahui, apakah personel kita yang mengantar tersangka atau sebaliknya. (m36)

Jaksa KPK Tuntut Hidayat Delapan Tahun Penjara MEDAN (Waspada): Dinilai telah menerima uang dari kontraktor Surung Panjaitan, Jaksa Komisi Pemberantasan Korupsi (KPK) menuntut Bupati Madina non aktif Hidayat Batubara delapan tahun penjara. Jaksa KPK Supardi dan Fitroh Rohcahyanto dalam persidangan Tindak Pidana Korupsi (Tipikor) Pengadilan Negeri (PN) Medan, Rabu (8/1) menyatakan, terdakwa terbukti menerima uang dari Surung Panjaitan sebesar Rp1 miliar yang diberikan melalui Kadis PU Madina Khairul Anwar. “Setelah uang tersebut diterima maka Khairul Anwar langsung menyerahkan kepada Bupati Madina non aktif Hidayat Batubara di rumahnya Jln. Sei Asahan. Hal ini jaksa menilai terdakwa telah menerima uang dan terancam dengan pasal 12 huruf a UU No.31 tahun 1999 jo UU No.20 tahun 2001 tentang pemberantasan korupsi jo pasal 55 ayat (1) ke-1 KUHP,” ujarnya. Hal-hal yang memberatkan, kata JPU, bahwa terdakwa tidak mendukung program pemerintah dalam memberantas tindak pidana korupsi. “Sedangkan yang meringankan adalah bahwa terdakwa mengakui kesalahannya, sopan didalam persidangan,” sebutnya. Selain menuntut delapan tahun penjara, JPU juga meminta kepada majelis hakim Agus Setiawan untuk menjatuhkan pidana tambahan berupa membayar denda Rp300 juta subsidair 5 bulan kurungan. Dihari yang sama, Jaksa penuntut umum

(JPU) dari Komisi Pemberantasan Korupsi (KPK) menuntut Plt Kadis PU Mandailing Natal (Madina) Khairil Anwar Daulay dengan hukuman 6 tahun penjara. JPU juga meminta majelis hakim yang diketuai Lebanus Sinurat, agar menghukum terdakwa Khairul Anwar Daulay membayar denda Rp300 juta subsider 5 bulan kurungan. Dalam pertimbangan, kedua terdakwa terbukti menerima hadiah sehubungan dalam pengerjaan proyek. Setelah mendengar tuntutan JPU, kedua terdakwa melalui kuasa hukumnya menyatakan akan menyampaikan pledoi. Pembelaan akan disampaikan pada lanjutan sidang yang akan digelar pada Rabu (15/1) mendatang. Khairul ditangkap bersama Surung Panjaitan, yang merupakan Dirut PT Sige Sinar Gemilang, di dekat rumah Bupati Madina M Hidayat Batubara di Jln. Sei Asahan-Medan, pada pertengahan Mei 2013. Keduanya ditengarai mengantarkan uang suap. Dari rumah bupati dan tangan Khairul Anwar ditemukan barang bukti Rp1 miliar yang berasal dari Surung yang telah dijatuhi hukuman 2 tahun 6 bulan penjara. Pemberian uang itu diduga terkait upaya Surung untuk mendapatkan pekerjaan proyek pembangunan RSUD Panyabungan di Kabupaten Madina yang bersumber dari dana Bantuan Daerah Bawahan (BDB) Pemprov Sumut pada 2013. (m38)

Pulmed Persiapkan Mahasiswanya Jadi Wirausahawan Muda MEDAN (Waspada): Politeknik Unggul LP3M Medan (Pulmed) yang dikenal dengan nama the Smart Polytecnics memiliki pelayanan unggul dan kurikulum yang terpadu, bertujuan untuk mempersiapkan para mahasiswanya dengan keahlian dalam dua hal yaitu siap untuk menjadi pegawai dan wirausahawan (entrepreneurship) muda. Untuk meningkatkan kapasitas sumber daya manusia (SDM) di bidang entrepreneurship, Pulmed terus menggalakkan program pelatihan dan praktik kewirausahaan. Kegiatan ini terproyeksi pada UKM Marketing Club Pulmed. Para mahasiswa Pulmed yang tergabung dalam Marketing Club melakukan kegiatan bazar di Pulmed, baru-baru ini, yang bertujuan untuk memberi pengalaman dan pelatihan salesmanship dan entrepreneurship. Dalam aktifitas tersebut, para peserta bazar

sangat antusias dan kegiatan yang serupa terus berkesinambungan, karena mereka didukung penuh oleh pihak kampus dalam mengembangkan keilmuan dan skill yang mereka dapatkan di bangku kuliah. Direktur Pulmed Sudarsono SE, MM, selalu mengatakan kepada para mahasiswa, bahwa keberhasilan usaha seseorang sangat ditentukan oleh tinggi dan rendahnya kapasitas orang tersebut dalam menjalankan usahanya. Menurut dia, faktor pendidikan dan pengalaman akan menentukan langkah dan strategi usaha, sehingga semakin tinggi pengalamannya, maka akan semakin luas pula pengetahuannya. “Jatuh bangunnya seorang usahawan dalam menjalankan bisnisnya, tentu akan memberikan dampak bagi penambahan pengalamannya, dibanding seorang pengusaha yang baru pertama kali mencoba,” tutur Sudarsono. (cwan)


MAHASISWI Politeknik Unggul LP3M Medan yang tergabung dalam Marketing Club melakukan kegiatan bazaar di kampus Pulmed.



WASPADA Jumat 10 Januari 2014

JELANG PILEG DAN PILPRES 2014 Capres Konvensi Partai Demokrat

Banyak Pencapain Pemerintah Terdahulu, Namun Masih Banyak Juga Kekurangannya JAKARTA ( Waspada): Calon presiden (capres) peserta konvensi Partai Demokrat Marzuki Alie mengakui banyak pencapaian yang telah dilakukan oleh para pemimpinpemimpin terdahulu, namun banyak juga kekurangannya yang hingga saat ini masih dirasakan oleh masyarakat. Semua persoalan masyarakat yang belum bisa diselesaikan oleh pemeintahan sebelumnya, menurutnya tidak bisa diselesaikan secara parsial, tapi harus menyeluruh atau holistik. “Masih banyak persoalan yang dialami masyarakat negeri ini, seperti biaya hidup yang makin mahal, transportasi, pendistribusian energi, pelayanan pendidikan dan kesehatan yang belum semua masyarakat bisa mendapatkan akses, dan persoalan korupsi yang menjadi masalah krusial, tidak bisa diselesaikan secara parsial tapi harus menyeluruh,” ujar Marzuki yangmemilikisloganIndonesiabermartabat,dalam paparannya di kantor panitia konvensi calon presiden Partai Demokrat, Kamis (9/1) di Jakarta. Marzuki menegaskan, pemimpin mendatang harus mampu menjawab berbagai persoalan bangsa. Karena itu dibutuhkan seorang pemimpin bukan hanya menjadi teladan, tapi mampu menyelesaikan masalah, membangun kesadaran bersama, mencari solusi atas persoalan bangsa, mengkoordinasikan kekuatan, berpikir dan bertindak secara dinamis, responsif tapi sistematis. Marzuki pun berjanji, kalau dirinya diberikan

amanah oleh rakyat, maka dia akan bekerja keras mewujudkan bangsa ini berdaulat di bidang pangan dan energi. Bangsa ini juga harus berdaulat mengelola semua potensi untuk kemajuan ekonomi. Selain kedaulatan ekonomi yang harus ditegakkan, menurut Ketua DPR ini, kedaulatan wilayah juga harus ditegakkan yang meliputi keamanan dalam negeri dan pemberantasan korupsi. Marzuki pun akan mencanangkan tiga prinsip pembangunan, yaitu tinggalkan programprogram yang tidak memberikan manfaat, sehatkan program yang baik namun tidak berjalan baik, dan ketiga tumbuhkan gagasan-gagasan besar untuk bangsa ini. “Saya akan memberikan dan menyiapkan diri saya untuk menerima gagasan-gagasan besar untuk Indonesia,saya akan memberikan ruang kepada calon-calon pemimpin muda yang potensial,” tegasnya. Pada sisi lain Marzuki Alie menegaskan kesiapannya berkompetisi dengan para capres partai politik lainnya, jika dirinya nanti terpilih sebagai Capres Partai Demokrat, termasuk bersaing dengan Joko Widodo (Jokowi), jika nanti dimajukan PDI Perjuangan. “Saya siap berkompetisi sehat untuk membangun Indonesia bermartabat. Saya bukan orang yang harus dihadap-hadapkan. Tapi kalau waktunya sudah tiba, saya akan berkompetisi secara berkualitas,” tandasnya. (aya)

Laoly Siap Berkompetisi Di Dapil Sumut II JAKARTA (Waspada): Ketua Fraksi Partai Demokrasi Indonesia Perjuangan (PDI P) di MPR RI, yang juga anggota Komisi II DPR RI, DR Yasonna Hamonangan Laoly, SH, M.Sc (foto) menegaskan kesiapannya untuk berkompetisi sebagai calon legislatif pada Pemilu 2014 mendatang di daerah pemilihan Sumut II. Laloy pun akan bekerja keras meyakinkan kembali rakyat pemilih di Dapil Sumut II, dengan memaparan kinerja yang dilakukannya selama ini di DPR sebagai wakil rakyat dari dapil Sumut II. “ Penempatan kembali sebagai caleg di Sumut II merupakan kepercayaan partai yang besar dan bagi saya merupakan tantangan yang berat. Saya maju menjadi wakil rakyat dengan modal ketulusan hati, dan ingin memperjuangkan aspirasi rakyat Sumut, khususnya wilayah yang termasuk dapil Sumut II. Wakil rakyat bukan tuan, tetapi pelayan rakyat.” tegas Laoly, Kamis (9/1) di Jakarta. Yasonna H Laoly mengakui pesaingnya dari parpol lain cukup berat. Namun, dengan modal sosial yang selama ini dilakukan dengan cara

rutin ke daerah pemilihan mengunjungi konstituennya, serta mesin politik yang terus berjalan Laoly siap berkompetisi secara fair dan beretika pada Pemilu 2014 mendatang. Wakil Ketua Badan Anggaran DPRRI ini mengakui akan menerapkan strategi khusus untuk mendapatkan suara dari pemilih pemula yang jumlahnya cukup signifikan. “Meski persaingan ketat akan terjadi, secara pribadi saya siap bersaing. Yang penting persaingannya secara sehat,”tukasnya. Diakuinya dalam kondisi dan perkembangan politik sekarang ini, memang tidak sedikit yang demi popularitas dan meningkatkan elektabilitas seorang caleg menggunakan jasa konsultan politik. Namun dia yakin, rakyat pemilih di Dapil Sumut II adalah rakyat yang cerdas, dan akan memilih wakilnya yang berkualitas dan bukan terjebak dengan politik uang. Sebagaimana diketahui pada Pemilu 2009 lalu, dari 10 kursi di Dapil Sumut II , PDI Pberhasil mendapatkan 2 kursi atas nama Trimedya Panjaitan danYasonna Hamonangan Laoly. (aya)

Survei: Jika Tak Calonkan Jokowi, Elektabilitas PDIP Anjlok JAKARTA (Waspada): Hasil survei terbaru Indo Barometer yang dirilis Kamis (9/1), menunjukkan elektabilitas Partai Demokrasi Indonesia Perjuangan (PDI-P) meningkat tajam menjadi 35,8 persen apabila mencalonkan Gubernur DKI Joko Widodo (foto) sebagai presiden pada Pemilu 2014. Di bawah PDIP, Partai Golkar mengantongi elektabilitas 15,8 persen, Partai Gerindra 7,9 persen, dan Partai Demokrat 4,6 persen. Namun apabila PDIP tidak mencalonkan Jokowi sebagai presiden, perolehan suaranya turun dan posisinya akan berbalik dengan Golkar. “PDIP akan jadi di bawah Golkar,” kata Direktur Eksekutif Indo Barometer, Muhammad Qodari, dalam konferensi pers di Jakarta. Berdasarkan survei Indo Barometer, jika Jokowi tak jadi capres, elektabilitas PDIP turun drastis menjadi hanya 19,6 persen, di bawah Golkar yang elektabilitasnya naik jadi 20,8 persen. Urutan ketiga di bawah PDIP diisi PKB dengan elektabilitas 9,6 persen, Gerindra 7,5 persen, dan Demokrat 5,8 persen.

Qodari mengatakan, partai selain PDIP yang sudah berani mewacanakan mendukung Jokowi adalah Partai Amanat Nasional (PAN). Namun dalam konteks Jokowi disandingkan sebagai cawapres dari capres Ketua Umum PAN Hatta Rajasa. Jika PAN mencalonkan Jokowi sebagai presiden, maka elektabilitas partai itu juga akan naik, dari 4 persen jadi 7,5 persen. “Jika PAN tidak mencalonkan Jokowi, maka elektabilitasnya turun menjadi 2,9 persen,” kata Qodari. Survei nasional bertajuk ‘Efek Jokowi dan Kinerja Parpol 3 Bulan Jelang Pemilu Legislatif 2014’ ini digelar 4-15 Desember 2013. Survei di 34 provinsi dengan jumlah responden 1.200 orang. Margin of error dalam survei ini 3 persen pada tingkat kepercayaan 95 persen. Responden dipilih dengan metode multistage random sampling, dan mewakili seluruh populasi publik dewasa Indonesia, yakni berusia 17 tahun atau lebih atau sudah menikah ketika survei dilakukan. Sementara pengumpulan data dilakukan dengan wawancara tatap muka secara langsung menggunakan kuesioner. (vvn)

Sisa Anggaran Tak Terserap Rawan Dimanfaatkan Untuk Pilkada JAKARTA (Waspada): Diduga ada pimpinan daerah menikmati bunga bank yang berasal dari anggaran pembangunan daerah yang tidak terserap. Caranya, anggaran diparkir di Bank Pembangunan Daerah (BPD) yang menghasilkan bunga dan secara formal masuk ke pos lainlain di Pendapatan Asli Daerah (PAD). “Hal ini disebabkan kurangnya kemampuan birokrasi dalam mengelola anggaran. Alih-alih mengonversinya menjadi program pembangunan, anggaran justru banyak ditabung di BPD,” ungkap Direktur Eksekutif Komite Pemantauan Pelaksanaan Otonomi Daerah (KPPOD) Robert Endi Jaweng di Jakarta, kemarin. BPD pun, sambung Endi, umumnya tidak mau repot-repot menyalurkan anggaran tersebut menjadi kredit produktif untuk usaha mikro, kecil dan menengah. BPD lebih suka membeli Sertifikat Bank Indonesia (SBI) agar mendapatkan bunga. Bunga ini secara formal akan masuk mata anggaran lain-lain dalam PAD. Di berbagai daerah, lanjut Endi, hasil bunga tersebut kemungkinan tidak masuk ke PAD, tetapi masuk ke kantong kepala daerah dan kroninya. Dalam modus ini, anggaran sengaja diinvestasikan untuk kepentingan pribadi. ”Singkatnya, ini adalah cara malas mengelola uang. Di samping faktor birokrasi yang kurang mampu, ada juga faktor pemda yang sengaja ingin mendapatkan PAD tanpa susah-susah. Juga ada kecurigaan sebagai modus untuk keuntungan pribadi,” jelas Endi. Dalam keterangan pers Sekretaris Direktorat Jenderal Perimbangan Keuangan (DJPK) Heru

Subiyantoro mengatakan, total anggaran pemerintah provinsi dan kabupaten/kota yang mengendap pada bank umum nasional semakin menggelembung mencapai rekor tertinggi, yakni Rp 109 triliun per 31 Desember 2013. Heru menyatakan, anggaran Rp109 triliun itu adalah total anggaran belanja daerah tahun 2013 yang tidak terserap sampai 31 Desember 2013. Dana itu tersimpan di berbagai tempat di antaranyaadalahdibankumumnasionaldanBPD. Dana mengendap sebesar Rp 109 triliun itu menjadi rekor terbesar, jika dibandingkan dana mengendap per akhir tahun 2002 senilai Rp 22,18 triliun, maka nilainya sudah hampir lima kali lipat. Dana mengendap ini mulai menggelembung sejak tahun 2009, yakni sebesar Rp 59,81 triliun. Di tahun 2011 nilainya naik menjadi Rp 80,4 triliun, dengan rincian Rp 13,12 triliun di simpanan berjangka, Rp 45,77 triliun di rekening giro yang bunganya kecil, dan Rp 919 miliar di tabungan. Sementara pada akhir tahun 2012, nilainya mencapai Rp 99,24 triliun. Sementara Sekretaris Jenderal Forum Indonesia untuk Transparansi Anggaran (Fitra)Yenny Sucipto berpendapat, sisa anggaran tak terserap di daerah rawan dimanfaatkan untuk pemilihan umum kepala daerah. Setidaknya modus tersebut sudah terungkap di Kabupaten Situbondo, Jawa Timur. Mendagri Gamawan Fauzi mengakui, selama ini banyak daerah yang tingkat serapan anggarannya masih di bawah 60 persen. Karena itu pemerintah mencoba menerapkan pola laporan keuangan berbasis aktual atau peristiwa. (j03)

Waspada/David Swayana

LONGSOR yang terjadi di kawasan Kecamatan Namanteran nyaris memutus akses dari Kota Kabanjahe dan pemukiman penduduk di sekitar kaki Gunung Sinabung. Hingga Kamis (9/1), belum terlihat ada upaya pemerintah memperbaiki ruas jalan yang nyaris putus tersebut.

Presiden Serukan Sanksi Moral Bagi Penyebar Fitnah JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono menyerukan kepada masyarakat Indonesia untuk memberikan sanksi moral dan sosial kepada mereka yang gemar memfitnah pihak lain.

“Fitnah itu tidak mencerdaskan kehidupan bangsa, tetapi merusak. Oleh karena itu saya menyerukan kepada seluruh rakyat Indonesia marilah kita berikan sanksi moral dan sanksi sosial bagi pihak yang gemar dan mudah memfitnah pihak

Marzuki Alie: Kebebasan Pers Harus Dipertahankan JAKARTA ( Waspada): Calon presiden Partai Demokrat, yang juga Ketua DPRRI Marzuki Alie menegaskan, kebebasan pers seperti yang dimiliki Indonesia saat ini harus dipertahankan. Tetapi, kebebasan pers itu harus diikuti tanggungjawab para insan pers itu sendiri, sehingga pers tidak hanya dikuasai oleh kepentingan para pemilik modal. “Tanpa kontrol, pers bisa menjadi bias, tapi pers yang dikuasai oleh kepentingan dan bisa diintervensi oleh kepentingan itu juga bisa menjadi bias. Untuk menjaga kebebasan pers, maka independensi pers harus ditegakkan. Banyaknya titipan-titipan pemilik modal justru akan menghancurkan pers itu sendiri,” ujar Marzuki menjawab pertanyaan panelis di acara meet the press capres Partai Demokrat, Kamis (9/1). Jka dirinya menjadi presiden, Marzuki berjanji akan bersamasama dengan insan pers membangun independensi pers yang tidak bisa diintervensi oleh kepentingan pemilik modal, maupun pemilik media itu sendiri. “ Kita akan ajak insan pers menciptakan harmoni. Kode etik pers dan independensi pers harus ditegakkan,” tandasnya. Pembangunan Berkelanjutan Pada bagian lain, Marzuki Alie berjanji akan meneruskan seluruh program yang baik dari pemerintahan terdahulu jika dirinya terpilih dan mendapatkan amanah rakyat Indonesia menjadi presiden. “Bangsa yang besar adalah bangsa yang menghormati para pemimpinnya. Masyarakat Indonesia yang beragama, dianjurkan untuk selalu mendoakan para pemimpinnya. Jika jadi presiden maka apa yang baik akan saya teruskan tanpa harus membuat program baru,” ujar Marzuki. Selama ini dirinya melihat banyak pemimpin besar yang memiliki impian besar tentang Indonesia, namun program-program itu tidak lagi berjalan begitu pemimpin lama digantikan pemimpin baru. “Bung Karno memiliki Trisakti, Pak Harto memiliki Trilogi Pembangunan. Namun Trisakti itu tidak dilanjutkan oleh Pak Harto ketika dia menggantikan Bung Karno.(aya)

lain,” kata Presiden Yudhoyono pada Rapim TNI dan Polri di Jakarta, Kamis (9/1). Presiden juga mengharapkan pers memberitakan secara akurat dan objektif serta bersama-sama mencegah fitnah. Menurut Presiden Yudhoyono, pemberian pengarahan dalam rapat pimpinan TNI dan Polri kali ini secara terbuka, dan diliput oleh pers juga menghindarkan diri dari kecurigaan

yang seringkali dihembuskan, apalagi mendekati pemilu. “Ini sekaligus sebuah transparansi dan akuntabilitas yang ingin saya tunjukkan sebagai pemimpin pemerintahan. Kita tentu mengharapkan pemberitaan pers yang objektif dan akurat, kita juga berharap bisa bersamasama mencegah fitnah,” kata Presiden. Presiden meminta para

pemimpin dan tokoh-tokoh politik mesti turut menjaga ketertiban dan keamanan Pemilu 2014. “Saya berharap pada para pemimpin dan tokoh politik untuk menjadi contoh demokrasi yang tertib dan damai, mampu mengendalikan emosinya dan mampu mengendalikan emosi para pendukungnya, dan tidak menjadi provokasi,” kata Presiden.

Komisi VII DPR Minta Audit Pertamina Tidak Berbau Politis JAKARTA (Waspada): Anggota Komisi VII DPR RI FPDIP Effendi Simbolon meminta audit Badan Pemeriksa Keuangan (BPK) atas Pertamina dilakukan transparan dan jangan sampai berbau politis menjelang pemilu 2014. Hal ini dilontarkan Effendi sebab dia merasa heran terhadap audit BPK atas Pertamina yang menyebutkan kerugian sampai Rp 22,2 triliun dalam 6 tahun, hingga membuat Pertamina harus menaikkan harga LPG 12 Kg menjadi Rp 118 ribu dari sebelumnya hanya Rp 75 ribu, atau naik sekitar 68 persen. “Masak tiba-tiba Pertamina merugi, mana auditnya? Audit keuangan, atau hanya kinerja? Dari neraca Migas saja tidak ada. Kilang minyak senilai 3,8 juta dolar AS pun terus dibangun oleh Singapura, agar Indonesia ketergantungan pada Singapura sampai kiamat,” tandas Effendi Simbolon dalam diskusi ’Gas alam untuk rakyat’ di

Gedung DPR RI Jakarta, Kamis (9/1). Dia pun heran dalam kasus kenaikan LPG 12 Kg banyak yang berkomentar, meski bukan bidangnya, sementara Komisi VII DPR yang memang membidangienergidiam-damsaja.“Kita heran Komisi VII yang membidangi energi diam saja kok Demokrat langsung menolak. Padahal, sebelumnya baik Meneg BUMN, Menko Perekonomian Hatta Rajasa maupun Presiden sendiri, menyatakan tidak bisa intervensi Pertamina. Tapi, dua hari kemudian pemerintah terbukti bisa intervensi. “Ini ada apa sebenarnya? Harusnya semua terbuka, termasuk hasil audit BPK itu,” ujarnya. Effendi juga mebeberkan bahwa Pertamina itu merupakan pelaku tunggal dalam dan mendapat keuntungan besar dari PSO (public service obligation) sebanyak 48 juta kilo liter BBM per tahun selama ini. “PSO itu diberikan kepada Pertamina,

lalu rencana bangun tower 99 tingkat itu, apakah masih rugi? PLN pun demikian. Dengan fakta ini, menurut Effendi, rakyat bisa melakukan class action-gugat ke Mahkamah Konstitusi (MK) karena ketidaktransparanan dan bahkan melanggar konstitusi. Tulus Abadi dari YLKI mengatakan, energi sebagai kebutuhan dasar rakyat, tidak dibangun dengan visi kebangsaan yang jelas, sehingga akan terus merugikan rakyat. Sementara kebutuhan gas Singapura 100 persen dari Indonesia, demikian pula transportasi China. Harusnya kebutuhan gas itu untuk dalam negeri, tapi malah diekspor. Karena itu, mahalnya harga BBM selama ini, akibat banyak mafia Migas. “Maka membangun kilang minyak pun, agar tak tergantung Singapura ditolak oleh mafia. Ini yang mesti dibereskan agar bisa memenuhi kebutuhan rakyat,” ungkapnya. (aya)

Jakarta Diramal Macat Total Tahun Ini Tiap Hari 38 Juta Lebih Kendaraan Berebut Aspal JAKARTA (Waspada): Pernyataan Direktur Eksekutif Indonesia Effort for Environment, Ahmad Safrudin tahun lalu yang memperkirakan lalu lintas Jakarta bakal mengalami kemacetan total atau akan stuck pada 2014, bisa jadi kenyataan. Pasalnya pertumbuhan populasi kendaraan di Jakarta benar-benar tidak terkendali. Riset Indonesia Effort for Environment mencatat 2013 pertumbuhan kendaraan mencapai 1.600-2.400 unit per hari pada 2013 dengan rincian 16,5 persen pertambahan mobil, sisanya motor, bus, dan truk. Pada tahun itu pula, jumlah kendaraan di Jabodetabek yang beroperasi di Jakarta mencapai 38,7 juta unit, terdiri atas 26,1 juta unit sepeda motor, 5,3 juta unit mobil, 1,3 juta unit bus, dan 6,1 juta unit. Dia juga menilai kecepatan kendaraan pun akan semakin menurun. Dia mencatat pada 2008 kendaraan masih mampu melaju rata-rata di atas 20 kilometer per jam. Namun pada 2012 kecepatannya anjlok menjadi 16 kilometer per jam.“Akhirnya pada 2014, semua kendaraan di Jakarta akan stuck,” ungkapnya ketika itu di Jakarta. Akibat pertumbuhan kendaraan yang sangat pesat itu menyebabkan 57,8 persen warga Jakarta menderita sakit yang berhubungan dengan pencemaran udara. Ada 1,2 juta warga Jakarta menderita asma, 153 ribu orang terkena broncho-

pneunomia, 2,4 juta warga mengalami infeksi saluran pernapasan akut (ISPA). Melihat kerugian yang disebabkan oleh pertumbuhan kendaraan yang begitu pesat, dia mendesak pemerintah untuk menghentikan penjualan kendaraan pribadi baru. Dia juga menghimbau agar moratorium pengembangan jalan tol harus dilakukan dan pembenahan sarana transportasi serta perbaikan pengaturan parkir di Jakarta. Komite Penghapusan Bensin Bertimbal (KPBB) mengatakan banyak faktor yang menyebabkan pertumbuhan kemdaran terus merangkak naik. Selain pengembangan kendaraan umum yang belum maksimal, juga lantaran kondisi kendaraan umum di Jakarta masih sangat jauh dari standar memadai. Adanya penawaran mengenai Low Cost Green Car (LCGC) yang memunculkan mobil murah dan ramah lingkungan yang diklaim rendah emisi dan hemat BBM, ke pasaran kian menggiurkan masyarakat untuk membeli kendaraan pribadi dengan harga lebih murah yang dapat mengurangi masalah global warming. Hal senada juga disampaikan Kasubdit Registrasi dan Identifikasi Kendaraan (Regident) Direktorat Lalu Lintas Polda Metro Jaya AKBP Latif Usman. Menurutnya peningkatan jumlah kendaraan dari


Beginilah kondisi kemacetan lalu lintas Jakarta yang kian parah di awal 2014. tahun ke tahun memang dipengaruhi banyak faktor. Di samping daya beli masyarakat yang semakin tinggi, juga membaiknya faktor ekonomi dan politik. Namun Latif belum memastikan prosentase kenaikan jumlah kendaraan di tahun 2014 ini. Dia memperkirakan tidak terlalu jauh dari prosentase kenaikan dari tahun 2012 ke 2013 yang mencapai 9,8 persen. Perkiraannya itu didasari data Subdit Regident Ditlantas Polda Metro Jaya yang mencatat jumlah kendaraan di Jakarta dan sekitarnya pada 2012 ada 14.618.313 unit. Kemudian ber-

tambah mencapai 16.043.689 unit pada 2013 dengan rincian 3.003.499 mobil, 11.929.103 motor, 360.022 bus, 617.635 mobil barang, dan 133.430 kendaraan khusus. Dari total kendaraan yang mencapai 16.043.689 itu, Latif mengatakan tidak semuanya beroperasi di jalanan, ada yang mungkin sudah rusak tidak dipakai lagi dan lainnya. Melihat fakta diatas, wajar kalau warga Jakarta mendesak Pemprov DKI Jakarta untuk terus merevitalisasi layanan transportasi angkutan umum di Jakarta. Pengamat transportasi

sekaligus Ketua Dewan Transportasi Kota Jakarta, Azas Tigor Nainggolan dalam tulisannya pernah memberikan solusi untuk mengurangi kemacetan di Jakarta. Menurutnya peningkatkan biaya penggunaan kendaraan pribadi itu antara lain penerapan Kebijakan Parkir Mahal Berdasarkan Zonasi, Jalan Berbayar (Electronic Road Pricing/ERP, dan mencabut subsidi BBM. Tulis dia, dari pendapatan yang diperoleh dari peningkatan biaya penggunaan kendaraan bermotor pribadi itu dapat digunakan untuk mensubsidi angkutan umum. (adji k.)

Luar Negeri

WASPADA Jumat 10 Januari 2014


Massa Anti-Pemerintah Thai Bersiap Untuk Duduki Bangkok

The Associated Press

PEMROTES anti-pemerintah berbaris menyeberangi jembatan Buddhayodfah dalam satu pawai pemanasan untuk melumpuhkan Bangkok, Thailand, Kamis (9/1). Ribuan pemrotes ikut ambil bagian dalam pawai itu yang bertujuan menggulingkan pemerintah PM Yingluck Shinawatra.

Perdamaian Syria Menjauh Lagi

Koalisi Nasional Syria (SNC), kelompokpayungoposisi berpusat di Istanbul,Turki, akan membuat keputusan akhirnya mengenai konferensitersebutpada17Januari, hanya beberapa hari sebelum dimulai,katabeberapasumberdekat dengan koalisi tersebut.

Sebaliknya Pemerintah Syria menyampaikan keinginannya untuk membuat konferensi itu berhasil dan menekankan tak boleh ada prasyarat bagi setiap pihak untuk memulai perundingan ke arah perdamaian. Meskipun Pemerintah Syria

memperlihatkan sikap yang tak berubah, berbagai faksi koalisi terpecah mengenai masalah tersebut, terutama setelah lebih dari 40anggotanyakeluarsehubungan denganpertikaiandidalamkoalisi. Beberapabataliongerilyawan belum lama ini telah berbalik memerangi apa yang disebut Negara Islam Irak dan Levant (ISIL) — yang baru-baru ini telah mengumumkan berdirinya ‘Keamiran Islam’ di Provinsi Fallujah, Irak. KonflikSyriatelahmemilikiimbas ke negara tetangganya. Banyak pengamat percaya sebagian kelompok gerilyawan

PBB: Situasi Kemanusiaan Di Anbar, Irak, Kritis BAGHDAD, Irak (Waspada): PBB memperingatkan situasi kemanusiaan kritis di Provinsi Anbar, Irak, yang telah menyaksikan bentrokan sengit beberapa hari belakangan. “Berbagai lembaga PBB sedangberusahamengidentifikasi kebutuhan rakyat dan mempersiapkanpasokanmedis,makanan serta barang non-makanan untuk dibagikan jika jalan aman dapat diperoleh,” kata Nickolay Mladenov, Wakil Khusus Sekretaris jenderal PBB untuk Irak, di dalam satu pernyataan Rabu. Situasi di Fallujah sangat kritis sebabsimpananmakanan,airdan obat penyemat nyawa miliknya mulai tipis, kata Mladenov. Dia menambahkan penilaian awal memperlihatkan lebih dari 5.000 keluarga telah mengungsi di Provinsi Karbala, Salahuddin, Baghdad dan tempat lain yang berdekatan. Dia mengatakan PBB bekerjasama secara erat dengan Pemerintah Regional dan Nasional Irak

serta mitra kemanusiaan guna memastikanjalanamanbagibantuan untuk keluarga yang terjebak di dan mengungsi dari Anbar. Seorang pejabat dari Bulan Sabit Merah Irak memberitahu wartawansebanyak13.000keluarga telahmelarikandariFallujahselama beberapa hari belakangan akibat pertempuran sengit yang berkcemauk setelah polisi Irak melucuti lokasi protes anti-pemerintah di luarRamadi,IbuKotaProvinsiitu, pada akhir Desember. Namun tampaknya kehidupannormalmulaiberangsurpulih diFallujahpadaRabu,saatbanyak pegawai pemerintah kembali ke tempat kerja mereka dan polisi lalu lintas bekerja di jalan, kata satusumberpolisikepadaXinhua Kamis (9/1). Beberapapriabersenjatayang bertopengdarisukusetempatterlihat di beberapa bagian kota tersebut,terutamadijembatandanpintu masuk kota, kata sumber itu. Rakyat Fallujah menyaksikan kestabilan yang mencekam pada

Selasamalam,ketikaanggotasuku mengusir sebagian petempur al Qaida dari kota tersebut dan beberapalaporanmengatakanmiliter takkan menyerang anggota suku, tambah sumber itu. Pada Rabu, PM Irak Nuri AlMaliki mengkonfirmasi tentaranya takkan menyerang Fallujah selama anggota suku memerangi gerilyawan al Qaida. “Kamitakinginkotaini(Fallujah) menderita lagi, sebab kota tersebut juga cukup menghadapi perang dan kerusakan,” katanya. Dia merujuk kepada dua pertempuran besar antara warga kota itu dan tentara AS pada 2004 — yang mengakibatkan kerusakan parah dan pembunuhan massal. Kelompok bersenjata Rabu menyerang lokasi militer di utara Baghdad, yang menewaskan 12 prajurit dan mencederai empat orang, kata polisi dan dokter. Militan menyerbu sebuah bangunan di lokasi itu di daerah Al-Adhim dankemudianmembomnya.(bbc/ m10)

Dua Tewas, Satu Hilang Dalam Kecelakaan Helikopter VIRGINIA, AS (AP): Helikopter Angkatan Laut AS bersema lim awaknya jatuh ke laut di lepas pantaiVirginia ketika melakukan misi latihan rutin, yang menewaskanduaawakdandualainnya cedera dan kini berada di rumah sakit, demikian kata AL Amerika Serikat. Tim pertolongan mencari sampai Rabu (8/1) larut malam untukmenemukanpelautkelima. Kedua orang yang tewas termasukdiantaraempatawakyang diangkat dari laut oleh helikopter

AL dan langsung dibawa ke rumah sakit, kata AL dalam pernyataannya.Duapelautyangselamat menjalaniperawatandiRSUSentaraNorfolk.Seorangdiantaranya berada dalam kondisi kritis, yang lainnyatelahberangsurpulih,kata AL dalam siaran persnya. “Hariinimerupakanhari berat bagi kita semua,” kata Kapt.Todd Flannery, komandan Helicopter Sea CombatWing Atlantic, dalam satutemupers.Pencariananggota krukelima“terusdilanjutkan,”kata

Pangkalan Udara Angkatan Laut Atlantik dalam satu pernyataan. Helikopter AL MH - 53E Sea Dragon jatuh di lepas pantai Norfolk sekitar pukul 11:30 waktu setempat selama pelatihan rutin, menurut para pejabat. Para awak, bagiandariSkuadronEmpatbelas PenanggulanganRanjauHelikopter (HM-14) berbasis di Nor-folk NavalStationChambersField,terbang pada latihan rutin penanggulanganranjauketikakecelakaan itu terjadi.(m10)

sung hampir satu bulan. Walau sudah memutuskan menggelar pemilihan umum (pemilu), tantangan tak berujung dari kelompokanti-pemerintahtelahmenjadi pangkal permasalahan tidak kondusifnya keamanan di negeri itu. KepolisianBangkokpuntelah menyiapkan sekira 15.000 anggota polisi yang ditujukan untuk mengamankan demo besar tersebut. Pihak kepolisian bertekad untuk mencegah segala bentuk kekerasan dan kericuhan. Sementara itu, dua organisasi media Thailand Rabu meminta polisi dan para pengunjuk rasa anti-pemerintah agar memastikankeamananmediaselamarencana operasi untuk melumpuhkan ibukota Bangkok 13 Januari. Perwakilan dari AsosiasiWartawan Broadcast Thailand dan

Persatuan Jurnalis Thailand mengajukanpermintaanitusaatbertemu secara terpisah dengan Kepala Kepolisian Adul Saengsingkaew dan Sekjen Komite Reformasi Demokratis Rakyat (PDRC) Suthep Thaugsuban. Dalam pernyataan bersama, kedua asosiasi meminta PDRC untuk menyediakan zona aman bagiwartawandisetiapsitusunjuk rasa dan memastikan demonstrasi dapat disiarkan secara langsung oleh stasiun-stasiun televisi. Pernyataan itu juga meminta untuktidakadapenyumbatankendaraan pengirim surat kabar dan unit-unitpenyiaranbergerak.Para ketuamemimpinunjukrasa selama operasi pelumpuhan Bangkok didesak untuk tidak menyerang mediaagartidakmenimbulkankesalahpahamanantarademonstran dan wartawan. (bbc/vn/m10)

Ledakan Di Pabrik Kimia Di Jepang Cederai 17 Orang TOKYO, Jepang (CNN): Satu ledakan dan kebakaran di pabrik kimia Materi Mitsubishi di bagian tengah Jepang Kamis (9/1) sore menciderai sedikitnya 17 orang, kata pihak berwenang. Lima orang di antara korban cidera dalam kondisi kritis, menurut Departemen Pemadam KebakaranYokkaichi. Insiden tersebut terjadi ketika berlangsung operasi perawatan dan pembersihan di pabrik itu, kata Departemen Kepolisian Prefektuf Mie. Kebakaran akibat ledakan itu berlangsung selama 10 menit, kata polisi.Yokkaichi terletak 320 km sebelah barat-baratdaya Tokyo.(m23)

VMY 2014 Bikin Kagum Semua Benua

Oposisi Ragukan Konferensi Jenewa II DAMASKUS, Syria (Waspada): Kelompok oposisi utama di Syria menunda pengambilan keputusan apakah ikut atau tidak dalam Konferensi Perdamaian Jenewa II, sementara kelompok radikal terlibat pertempuran di antara mereka selain perlawanan mereka terhadap Pemerintah Syria.

BANGKOK,Thailand(Waspada): Massa anti-Pemerintah Thailand mempersiapkan diri untuk mengambil alih Bangkok Senin (13/1) depan. Mereka terus mencari dukungan untuk aksi yang ditujukan untuk melumpuhkan Bangkok tersebut. Para pemrotes anti-pemerintahmerencanakanuntukmemulai aksi mereka 13 Januari, dengan menduduki Bangkok. Kelompok ‘Kaus Kuning’ turut menegaskan, demo akan terus mereka helat sampai pemerintahan PMYingluck Shinawatra berhasil mereka lengserkan. Dalam aksi demo terbaru ini, demonstranmerencanakanakan menghalangi pegawai negeri sipil Thaiberkerjadanmemutusaliran energi dan air di seluruh kantor Pemerintahan Thailand. Kelompok anti-pemerintah ini berupaya keras untuk melengserkan PMYingluck. Mereka menolakrencanaYingluckuntukmengadakanpemilupada2Februari 2014. “Saya sudah tentu akan hadir dalam protes tersebut. Saya siap dan akan turut serta memberikan dukungan hinggaYingluck mundur,” ujar seorang aktivis Kamis (9/1). “Kami akan tetap melakukan aksi hingga reformasi tercapai,” lanjutnya. Krisis Thailand telah berlang-

berpaling memerangi ISIL karena banyakwilayahbelumlamainitelah direbutnyadiSyriaUtara,demikian laporanXinhuaKamis(9/1).Selain itu,merekajugainginmemperbaiki citramerekadanmemperlihatkan mereka“moderat”sebelumKonferensi Jenewa II. PegiatoposisiRabumengatakan 20 gerilyawan ISIL tewas selama konflik dengan kelompok lain bersenjata di Kota KeciL Hraitan, Aleppo, di tengah laporan ISIL kehilangan pusat komandonyadikotadiSuriahUtaratersebut dan memperkokoh posisinya di Provinsi Ar-Raqqa.

Menurut laporan media setempat, 385 gerilyawan tewas sejak meletusnya pertempuran antar-mereka Jumat lalu. Ditambahkannya, pertempuran antara ISIL dan kelompok lain juga telah meluas sampai ke pinggiran Damaskus, ibukota Syria. Kantor berita The Associated Press melaporkan Kamis, media pemerintahSyriadansatupemerhatioposisimengatakansatubom mobilmeledakdekatsatusekolah di provinsi SyriaTengah, yang menewaskan sekurang-kurangnya 16 orang dan mencederai puluhan lainnya.(m10)

Cuaca Buruk Sebabkan Penundaan Sidang Moursi KAIRO, Mesir (AP): Satu pengadilan Mesir menunda sidang peradilan bagi presiden terguling Mohamed Moursi sampai 1 Februari, dengan alasan ‘kondisi cuaca’ mencegah pengangkutan tokoh Islamis itu ke pengadilan dari penjara. HariRabu(8/1)dijadwalkanbagisidangkeduaperadilanMoursi, setelah satu penampilan singkatnya di pengadilan November lalu di mana dia mengecam peradilannya dan menyatakan dia masih menjabat presiden Mesir.Moursi digulingkan militer Juli 2013. Hakim yang memimpin sidang, Ahmed SabryYoussef, mengatakan Moursi tidak bisa dihadirkan ke pengadilan karena cuaca buruk. Namun terdakwa lain juga disidang, Essam El-Erian, mengatakan Moursi tidak akan bersedia hadir di pengadilan ilegal. (m10)

Malaysia Perkenalkan Kartu Khusus Bagi Pekerja Asing KUALA LUMPUR, Malaysia (AP): Menteri Dalam Negeri Ahmad Zahid Hamidi meluncurkan i-Kad — kartu khusus bagi para pekerja asing — di Putrajaya, Malaysia, Kamis (9/1). Kartu identitas tersebut berteknologi tinggi dengan fitur keselamatan canggih yang akan diwajibkan bagi setiap tenaga kerja asing di Malaysia. Kepastian tersebut disampaikan Menteri Dalam Negeri Ahmad Zahid Hamidi ketika meluncurkan kartu identitas yang disebut dengan nama i-Kad. I-Kad memiliki berbagai fitur keselamatan seperti sidik jari biometrikdanchip.Inidilakukansebagaisalahsatuupayamengatasi imigran gelap di Malaysia. Seluruh pekerja asing yang resmi, sekitar 2,3 juta orang, harus memiliki kartu tersebut sebelum akhir tahun. Biaya pengurusan kartu sebesar 110 ringgit Malaysia atau setara dengan Rp400.000 akan dibebankan kepada pekerja atau majikan. MenurutAhmadZahidHamidi,kartuitujugaakandilengkapidengan kodebatangyangmemungkinkanpenegakhukummemindaikartu cukup dengan menggunakan telepon genggam guna mengakses data pekerja asing.(m10)

Catatan Armin Nasution Dari Kuala Lumpur, Malaysia PESTA kembang api seperti pergantian tahun menghiasilangitKualaLumpur,Sabtu(4/1)malam lalu. Sekitar 10.000 pengunjung yang sudah mengikuti prosesi dari awal merasa terpukai atas berbagai atraksi yang disajikan. Tentu saja acara itu juga sudah dinanti para jurnalisdari26negaraundangan.Diantarabarisan pengunjung itu saya kemudian menyelinap untuk mencoba mencari tahu seperti apa respon tamutamu negara Malaysia yang mengikuti peluncuran Visit Malaysia Year (VMY) 2014 itu. DansayabertemudenganBartTeulings.Warga negara Belanda. Berkepala plontos dia kemudian menunjukkan kekagumannya. “Saya baru pertamakali ke sini dan ini sungguh luar biasa. Saya tidak menyangka acaranya semeriah ini,” kata Bart yang mengaku pernah berpacaran selama empat tahun dengan perempuan asal Indonesia. “SayabelumpernahkeMalaysia,belumpernah ke Indonesia. Tapi jika memang seperti ini yang disajikan kita pasti sangat tertarik,” katanya. Bart adalah jurnalis dari Belanda yang mengusung tulisan-tulisannya di blog. “Nanti acara ini akan tampil di blog yang biasa saya tulis,” tuturnya. Menurut dia, apa yang disuguhkan Malaysia dalamVMY menjadikan gambaran tentang potret keramahan tuan rumah menyambut tamu. “Kita sama-sama menginap di Grand Millennium Bukit Bintang. Jadi bisa merasakan langsung bagaimana denyut kota ini,” ujarnya. Menurut dia, ada banyak faktor yang membuat pengunjung nyaman. “Pertamatentusajasoalcaramerekamenyambut.Waktukitabarutibadibandarasudahlangsung adasuguhanselamatdatang.Ramahdanbersahabat. Kedua,pastisoalkenyamanan.WalauBukitBintang misalnya padat tapi kita masih nyaman,” jelasnya. Tapi dia sedikit merasa ada gangguan karena saatinisedangterjadipembangunanbeberapafasilitas dikawasanBukitBintang.“Namunbesoksayaakan ke Melaka. Saya fikir akan lebih eksotis,” tuturnya. Daya tarik lain tentu saja soal transportasi yang memadai. “Ada stasiun kereta api dalam kota yang menghubungkanbeberapawilayahsehinggamudah dijangkau di Kuala Lumpur,” ungkapnya. Hal senada diungkapkan Marry, wartawan asal Amerika. “Senang bisa datang ke sini. Senang melihat Asia dari dekat. Keramahan dan sambu-

tan yang luar biasa,” tuturnya. Dia mengaku baru tinggal tiga hari di Malaysia sudah merasa ada tempat berlibur yang sangat mempesona. “Baru melihat Kuala Lumpur saja dengan beberapa jenis hiburan yang ditampilkan tapi sudah cukup menarik,” ungkapnya. Bukan hanya mereka, tapi para wartawan dari Jepang yang ikut ke Saloma saat makan malam sebelum peluncuranVMY terlihat sangat senang. Mereka memang naik ke panggung untuk belajar tari Melayu dan berbaur dengan yang lain-lain. Memang Malaysia pandai mengambil hati para wisatawan.PertamasaatMenteriPariwisatadanBudaya Malaysia Mohammed Nazri Bin Abdul Aziz di acara makanmalambersamajurnalisdanparaundangan. Diamemanggilsatu-satunamanegaradanmenyerahkansertifikatkepadapesertayanghadir.Saatdelegasi dipanggil, dia langsung melambaikan tangan. Misalnya “from Japan” lalu anggota delegasi akanberdiridanmelambaikantangan.Mohammed Nazri pun membalas lambaian tangan itu. Semua negara dipanggil, tidak ada yang tertinggal. Lalu event kedua adalah saat peluncuranVMY 2014. Di forum besar itu nama-nama negara berikut anggota delegasinya dipanggil. Saat nama Indonesia disebutpembawacaraterdengarpunteriakan horas. Karena di antara delegasi Indonesia berbaur antara utusanJakarta,Medan,Batam.Katahoraspunsempat dikumandangkan anak-anak Medan tersebut. UsaipeluncuranVMY,lengkapsudahagendayang disiapkan Malaysia Tourism. Sebenarnya agenda selanjutnya adalah ke Sunway Lagoon. Kawasan ini sebenarnya merupakan tempat wisata yang sudah lama ada. Menurut pengelolanya Sunway banyak kedatangan tamu dari Singapura danTimurTengah. Apalagikawasanitudilengkapipusatperbelanjaan. Jadilokasinyasepertidistrikkhususwisatadanbelanja. Namun saat Malaysia baru meluncurkanVMY 2014 dengan segala keramahannya ada sedikit hal yang menggangu delegasi dari Medan yang masuk ke kawasan ini. Tak terlalu bagus untuk mengeksplotasi seperti apa kejadiannya. Setidaknya Malaysia telah berusaha memikat hati pendatang seperti yang disebut timbalan perdana menteri dari supir taksi, polisi sampai pejabat negara harus merespek tamu yang datang. Kalau masih ada yang kurang pas, tidaklah ada yang bisa sempurna. Dan tidak pula gara-gara nila setitik rusak susu sebelanga.(habis)

Jepang Daftar 280 Kepulauan Terpencil Sebagai Aset Nasional TOKYO, Jepang (Reuters): Jepang akan mengumumkan kepemilikan 280 pulau terpencil di dalam kawasan perairannya dan mendaftarkan pulau-pulau tersebut sebagai asset nasional, tindakan yang bisa membuat China dan Korea Selatan gusar, yang saat ini terkait perebutan kawasan dengan Tokyo. Tindakan pemerintah untuk melakukan survey terhadap pulaupulau tersebut dan mengklaim pulau yang belum ada pemiliknya diumumkan minggu ini dan melanjutkan rencana yang pertama kali dimulai lima tahun lalu, kata seorang pejabat di Sekretariat Masalah Kawasan dan Kebijakan Kelautan. Sejak rencana itu diusulkan, Jepang telah menasionalisasi 99 pulau terpencil yang tidak ada pemiliknya.(m23)

Waspada/Armin Nasution

BERBAGAI etnis dan golongan di Malaysia menyiapkan diri menyambut kunjungan wisatawan yang akan terus melonjak hingga 2020 nanti.



WASPADA Jumat 10 Januari 2014

Pujian Trigol Negredo LONDON (Waspada): Alvaro Negredo mencetak trigol pertamanya di Inggris, Rabu (Kamis WIB), saat Manchester City menggunduli West Ham United 6-0 pada leg pertama semifinal Piala Liga Inggris.


BINTANG Barca Lionel Messi tak kuasa dihadang pemain Getafe Pedro Leon dan Juan Rodriguez (kiri) di Camp Nou, Kamis (9/1) dinihari WIB.

Kisah Sempurna Si Kutu MADRID (Waspada): Lionel Messi turun sebagai pemain pengganti, Rabu (Kamis WIB), tetapi mampu mencetak dua gol untuk memastikan Barcelona menang telak 4-0 atas tamunya Getafe di Camp Nou. Gelandang Cesc Fabregas juga menyarangkan dua gol pada laga leg pertama babak 16 besar Copa Del Rey tersebut. La Pulga alias Si Kutu, julukan Messi, mendapat sambutan meriah dari para pendukung tuan rumah ketika menggantikan Andres Iniesta menit 64. Itu penampilan perdananya sejak mengalami cedera otot paha, November silam. Meski telah dua bulan tak merumput, Si Kutu tetap tak canggung mengolah si kulit bundar. “Saya rasa kisah Messi layak dibuat film. Ini akan menjadi film dengan kisah sempurna,” puji Gerardo ‘Tata’ Martino, entrenador El Barca asal Argentina. “Secara keseluruhan, kami mengontrol jalannya laga dan

kami memang layak meraih kemenangan,” tambah Tata, seperti dikutip dari Reuters, Kamis (9/1). Mengistirahatkan sejumlah pemain pilarnya sebagai persiapan tandang ke Atletico Madrid besok malam di La Liga, Barca telah unggul dua gol saat Si Kutu masuk lapangan. Tandukan Fabregas membuka keunggulan tuan rumah menit kedelapan. Mantan kapten Arsenal itu menambahi golnya dengan penalti menit -63. Messi terlihat bugar dan tajam selama 30 menit berada di lapangan. Gol pertamanya tercipta menit 89 ketika dia mendapatkan bola di kotak penalti dan menyarangkannya ke sudut gawang dari jarak dekat. Gol keduanya pada masa tambahan waktu tercipta melalui laju khasnya di sayap kanan. La Pulga mengecoh para bek Getafe sebelum mencungkil bola menuju gawang tim tamu. Terdapat nuansa kegembiraan, kendati stadion raksasa itu hanya diisi oleh setengah

Leg I Perempatfinal Piala Raja Spanyol Hasil Rabu (Kamis WIB) Alcorcon v Espanyol Real Betis v Bilbao Barcelona v Getafe Santander v Almeria Hasil Selasa (Rabu WIB) Valencia v Atl Madrid

1-0 1-0 4-0 1-1 1-1

kapasitas penonton. Kegembiraan kian lengkap, karena mantan pelatih Barca Tito Vilanova ikut menyaksikan laga, setelah perjuangannya melawan kanker memaksa dia mengundurkan diri akhir musim lalu. “Sudah jelas bahwa dia (Messi) tidak lupa bagaimana caranya bermain sepakbola. Dia telah berlatih dengan sangat baik,” kata kapten Barca Carles Puyol kepada televisi Spanyol, Antenna 3. “Seperti Anda lihat, gol-gol semacam itu hanya dapat diciptakan para pemain terbaik. Terdapat jalan panjang untuk kami lalui, mari lihat apa yang dapat kami lakukan dan hal terpenting sekarang adalah pulih dengan cepat,” pungkas Puyol. (m15/ant/rtr/afp)

The City secara efektif telah mengunci tempat mereka untuk final di Wembley, berkat demonstrasi permainan berat sebelah. Edin Dzeko mencetak dua gol, Yaya Toure menambahkan satu gol lagi. “Alvaro Negdredo menjalani pertandingan hebat, dia menjadi penghubung antara para penyerang dan gelandang,” puji Manuel Pellegrini, manajer City asal Chile, seperti dilansir Reuters, Kamis (9/1). Sejak didatangkan dari Sevilla pada bursa transfer musim panas lalu dengan nilai transfer 20 juta pounds, Negredo total telah mencetak 18 gol bagi Citizens. Perannya kian vital, setelah stiker Sergio Aguero mengalami cedera. “Dia bermain sangat sempurna. Tidak hanya karena mencetak tiga gol, tapi karena hubungannya dengan para pemain tengah. Bagi saya, itu bukan kejutan, sebab saya tahu cara dia bermain di Spanyol,” papar Pellegrini. “Namun Edin Dzeko juga hebat. Mereka tidak sering main bersama, namun mereka membaik seiring berjalannya waktu,” tambah mantan pelatih Malaga, Real Madrid dan Villarreal tersebut. Dzeko juga ikut memuji Negredo, yang membobol ga-

MADRID ( Wa s p a d a ) : Gelandang Atletico Madrid, Jorge ‘Koke’ Resurrecion, mengaku tak sabar untuk menjamu Barcelona besok malam di Vicente Calderon Stadium. “Saya rasa kami telah siap untuk duel ini. Benar, kami telah menjalani beberapa partai sulit baru-baru ini, termasuk saat malawan Malaga dan Valencia, tapi mereka (Barca) juga,” kata Koke, seperti dilansir

Tembus Perempatfinal hanan Chievo. Namun menurut kapten Borja Valero, timnya tetap sangat merindukan Giuseppe Rossi, bomber Italia andalan La Viola yang sedang cedera. “Selalu sulit melakukannya tanpa pemain dengan level Giuseppe. Karena itu kami sangat merindukan dia, tapi untungnya kami memiliki juara lain di skuad dan mereka membuktikannya,” ucap Valero lewat RAI Sport, Kamis (9/1). “Sisi positifnya, kami memiliki opsi berbeda dan dapat mengambil banyak sistem taktik berbeda. Chievo memulainya dengan baik, tapi setelah gol pertama kami mengontrol duel,” klaim gelandang asal Spanyol tersebut. Bagi Fiorentina asuhan allenatore Vincenzo Montella, ini laga pertama sejak Rossi di-

PSSI Janji Benahi Suporter JAKARTA (Waspada): PSSI berjanji membenahi perilaku suporter sepakbola di tanah air. Salah satu caranya dengan bekerjasama panitia pelaksana pertandingan dalam setiap laga, baik itu kompetisi reguler maupun laga internasional. Pada kesempatan itu, para pendukung kesebelasan diminta Antara tidak menyalakan kembang api atau melakukan pelemparan botol air mineral ke lapangan. Sebab kejadian seperti itu dipastikan dapat menganggu jalannya pertandingan. “PSSI akan menindak tegas komunitas suporter bila terjadi kericuhan dalam sebuah pertandingan. Kami ingin para penonton secara bertahap memahami pentingnya menjaga ketertiban dan kenyaman penonton,” kata Sekjen PSSI, Joko Driyono, Kamis (9/1). Rencananya, PSSI akan berkomunikasi dengan Panpel, dimulai dari kompetisi ISL, setelah itu ke Divisi Utama dan strata di bawahnya. Menurut Joko, sosialisasi seperti itu sangat penting untuk mengurangi dampak gangguan keamanan dalam setiap pertandingan. “Kami akan bertemu klub-klub ISL untuk mengomunikasikan hal ini. Kami juga akan mengkonsepkan solusi masalah pelanggaran kembang api, petasan dan lainnya,” beber Joko yang kembali dinobatkan sebagai CEO PT Liga Indonesia. Pembenahan perilaku suporter dilakukan agar laga di stadion dapat dinikmati secara nyaman. Apalagi, Indonesia pernah dihukum AFC dua kali laga timnas senior tanpa penonton akibat perilaku negatif tersebut. Bahkan, PSSI juga dikenai hukuman denda berupa uang. Kondisi semacam itu ternyata tidak mampu mengubah sikap penonton. Saat pertandingan Kualifikasi Piala Asia U19 antara Indonesia dan Korea Selatan, kembang api kembali menyala. Akibatnya, Desember lalu AFC menjatuhkan denda Rp60 juta bagi Indonesia. “Sosialisasi ini penting dilakukan karena ke depan timnas akan menghadapi rangkaian ujicoba internasional, khususnya Timnas U-19. Kami berharap para penonton bisa tertib saat menyaksikan laga,” tandas Joko. (yuslan)


hentikan mereka. Namun karena kualitas dan kemampuannya, mereka tidak dapat mendekati mereka (City),” katanya menambahkan. (m15/ant/rtr/sky)

Semifinal Piala Liga Hasil Rabu (Kamis WIB) Man City v West Ham Hasil Selasa (Rabu WIB) Sunderland v Man United

6-0 2-1

Atletico Tak Sabar Jamu Barca

La Viola Tetap Rindukan Rossi R O M A (Waspada): Fiorentina gabung Juventus menembus perempatfinal Piala Italia, Rabu (Kamis WIB), setelah memukul tamunya Chievo Verona 2-0 di Artemio Franchi, Florence. Winger veteran Spanyol, Joaquin Sanchez, membuka kemenangan tuan rumah dengan golnya menit 29. Tandukan penyerang asal Kroasia, Ante Rebic, memantapkan keunggulan La Viola menjelang turun minum. Joaquin cs selanjutnya akan menghadapi pemenang laga Catania kontra Siena untuk memperebutkan satu tempat di semifinal. Ante Rebic bermain cantik dan terus merepotkan perta-

wang The Hammers menit 12, 26 dan 49. “Gol pertama memang selalu penting, tapi gol pertama Negredo spektakuler,” beber bomber BosniaHerzegovina tersebut. Mantan mesin gol VfL Wolfsburg itu melengkapi pesta tuan rumah dengan golnya menit 60 dan 89. Sedangkan Yaya Toure menyarangkan gol ketiga City menit 40. “Tidak mudah untuk bisa menang dengan skor mencolok 6-0 di kandang saat melawan sesama tim Liga Premier. Kami akan tetap bermain tandang dan kemenangan ini memberikan kepercayaan diri kepada tim,” klaim Dzeko melalui Sky Sports. Hasil ini otomatis menambah tekanan terhadap pelatih Sam Allardyce, mengingat West Ham juga sedang terpuruk di peringkat 19 klasemen Liga Premier. Apalagi, Hammers pekan lalu juga dipermalukan Nottingham Forest 5-0 pada laga babak ketiga Piala FA. “Tim terbaik kami hanya tidak cukup bagus saat menghadapi Manchester City. Anda harus selalu memberi mereka kredit atas betapa bagusnya tim yang mereka miliki,” dalih Allardyce. “Para pemain kami berlari untuk berusaha dan meng-


KOKE (kanan) dan Diego Costa, ancaman nyata bagi Barca. Soccerway, Kamis (9/1). Namun bintang muda Spanyol berusia 22 tahun itu menegaskan, laga jornada 19 La Liga Primera nanti bukan penentuan perebutan gelar. Los Rojiblancos dan Los Cules kini memimpin klasemen, sama-sama mengoleksi nilai 49, unggul lima poin di atas Real Madrid. “Siapapun yang teratas di paruh musim tak menjamin akan terus bertahan hingga akhir musim. Paruh musim ke-

dua masih panjang. Jika kami menang Sabtu nanti, itu belum berarti apa-apa,” klaim Koke. Menurut pencetak gol tunggal kemenangan 1-0 Atletico atas Malaga pekan lalu tersebut, perlu strategi efektif untuk meredam El Blaugrana. Apalagi, Barca binaan entrenador Gerardo ‘Tata’ Martino, sudah bisa memainkan mesin golnya Lionel Messi. “Saya tidak tahu Messi main atau tidak. Yang jelas kami tahu dia pemain terbaik di

dunia. Barca punya beberapa pemain terbaik di dunia macam Neymar, Messi dan yang lainnya,” tegas Koke. Kiper Thibaut Courtois juga mengklaim, timnya mesti punya strategi jitu serta bermain total untuk menjinakkan Xavi Hernandez cs. “Anda mesti melakoni setiap laga seperti partai final. Anda juga harus bermain seolah ini akan menjadi laga terakhir Anda,” jelasnya. “Kami tahu apa yang menanti kami di Calderon akhir pekan nanti. Semoga kami dapat meraih kemenangan,” pungkas Courtois, penjaga gawang ‘buangan’ Chelsea asal Belgia. Di kubu tim tamu, Messi mengaku sangat berhasrat menjajal Atletico asuhan Diego Simeone. Bomber mungil Argentina merasa kondisinya sudah jauh lebih prima pasca pulih dari cedera hamstring. “Jika saya dimainkan melawan Atletico, saya akan melakukannya. Saya akan bicara

STRIKER City Alvaro Negredo bergaya merayakan golnya ke g a w a n g k i p e r We s t H a m Adrian Del Castillo di Etihad Stadium, Manchester, Kamis (9/1) dinihari WIB.

Jumat, 10 Januari (GMT) Granada v Valladolid


Sabtu, 11 Januari (GMT) Ath Bilbao v Almeria (1500) Celta Vigo v Valencia (1700) *RCTI live pkl 00:00 WIB Atl Madrid v Barcelona (1900) *RCTI live pkl 02:00 WIB Elche v Sevilla (2100)

Minggu, 12 Januar (GMT) Getafe v Vallecano (1100) Real Betis v Osasuna (1600) Espanyol v Real Madrid (1800) *RCTI live pkl 01:00 WIB Levante v Malaga (2000)

Senin, 13 Januari (GMT) Villarreal v Sociedad


dengan Tata dan dokter,” tekad Messi, yang menyumbang dua gol bagi Barca ketika menggunduli Getafe 4-0 pada leg pertama babak 16 besar Copa Del Rey. “Saya selalu berpikir tentang klub, saya selalu memiliki keinginan yang sama dengan klub,” tegas Messi. (m15/okz/sw/mrc)

Hitzlsperger Akui Homo AP

ANTE Rebic rayakan golnya dengan Massimo Ambrosini dan Joaquin Sanchez (kanan). vonis absen enam pekan akibat cedera dan akan terbang ke Colorado untuk menemui spesialis. Parahnya lagi, La Viola juga telah kehilangan striker Jerman Mario Gomez akibat masalah yang sama. “Dalam waktu dekat saya bakal mengadakan rapat dengan tim manajemen. Kami segera memutuskan segala

kebijakan terkait dengan permasalahan yang terjadi di Fiorentina,” papar Montella. “Banyak ide yang sudah terbayang. Kami tentu harus memahami untuk menambah kualitas tim jika ingin menggapai sesuatu. Kami bakal segera memutuskan dan bukan kehendak khalayak,” ujarnya lagi. (m15/vvn/rai)

BERLIN (Waspada): Mantan gelandang Aston Villa, Thomas Hitzlsperger, buka-bukaan dengan statusnya sebagai seorang gay alias homoseksual. “Saya mengungkapkan bahwa saya homo, karena saya ingin diskusi mengenai homoseksualitas di kalangan olahragawan profesional,” ungkapnya kepada koran Jerman, Die Zeit, yang dikutip Kamis (9/1). Berita ini sangat mengejutkan, sebab Hitzlsperger sempat bermesraan dengan Inga Totzauer (foto), yang cukup lama menjadi teman wanitanya. Hitzlsperger menyatakan gantung sepatu, September lalu, setelah mengalami serangkaian cedera. Dia kemudian mengaku bahwa “dalam beberapa tahun ke depan lebih suka menjadi orang lain”. “Saya tidak merasa malu dengan jalan hidup saya ini,” tambahnya. Pria berusia 31 tahun itu 52 kali membela Timnas Jerman. Dia juga pernah berkostum West Ham dan Everton. Pernyataan homo itu dia sebut sebagai “sesuatu hal yang sudah saatnya” diungkapkan secara terang benderang kepada publik. Ditambahkan, pembicaraan mengenai homoseksualitas di ruang ganti pemain menjadi hal tabu. “Bayangkan saja, bila ada 20 pria yang duduk bersama sambil minum-minum, maka sebagian dari mereka akan mengejek seraya mencemooh homoseksualitas,” tutur Hitzlsperger. Perdana Menteri (PM) Inggris, David Cameron, memuji sikap dan pengakuan Hitzlsperger. Namun pejabat kelahiran 9 Oktober 1966 itu langsung menuai banyak kecaman lewat jejaring sosial. (m15/ant/dz/bbc)



WASPADA Jumat 10 Januari 2014

Sosok Peduli Olahraga, Seni REAKSI Part II Tribute To Opunk Ladon MEDAN (Waspada): Rasa kehilangan sosok almarhum Drs H Zulhifzi Lubis atau akrab disapa Opunk Ladon, hingga kini masih terus dirasakan para sahabat. Bahkan, pribadi Opunk yang penuh semangat serta kreatif, menjadi teladan orang-orang terdekatnya. “Opunk itu orangnya keras, teguh pada pendirian dan kreatif. Meski style dan ucapannya sering sesuka hati, tak pernah dia menyakiti perasaan orang. Gayanya pun mulai Waspada/ist diikuti para sahabatnya,” ujar sahabat almarhum Opunk Ladon, Drs Hendra DS (foto), Kamis (9/1). Dikatakan, dengan gaya khasnya memimpin KONI Medan, Opunk mampu membangkitkan semangat olahraga di kota ini. Program KONI Medan berjalan dengan baik dan banyak terobosan dibuat dan membuahkan hasil. “Kita bisa lihat, program-program pembinaan baik jangka pendek maupun panjang dibuat Opunk. Bahkan, Pengcab Olahraga yang dulu lesu darah kembali bangkit dan bergairah melakukan pembinaan atlet,” kata Ketua SSB Patriot itu. Hendra juga memuji almarhum Opunk Ladon yang mengggas Pekan Olahraga Kota (Porkot). Kegiatan itu mampu mencuri perhatian banyak pihak. Sejumlah 21 kecamatan se Kota Medan tampil dengan atributnya masing-masin, sehingga semangat olahraga di tengah masyarakat semakin membahana. “Saya kenal almarhum Opunk sejak 1980, namun mulai akrab pada 1985. Waktu itu, status kami masih lajang, Opunk memiliki pemikiran-pemikiran maju dan positif. Berbeda dengan anak muda lainnya dan itu membuat saya semakin akrab dengan Opunk,” ucap Hendra yang juga Caleg DPRD Kota Medan dari Partai Hanura. Dikatakan, sejak 1989, dia bersama Opunk mulai membuat beberapa event baik itu musik maupun olahraga. Perjalanan Opunk di dunia hiburan dan olahraga hingga akhir hayatnya tak ada kendala, karena didukung semua pihak. Menurut Hendra, Opunk itu orangnya tak suka ribut-ribut yang berakhir dengan perkelahian, walau gaya dan bahasanya terkesan ceplas-ceplos. Malah dia lebih suka menjadi penengah saat ada cekcok sesama teman. “Jadi, saya pribadi sangat mendukung event REAKSI Part II Tribute to Opunk Ladon yang dikemas EO SAPULIDI di pelataran Stadion Teladan Medan pada 19 Januari nanti. Apalagi kegiatan ini dimaksudkan untuk mengenang Opunk Ladon,” pungkas Hendra. (m42)


Harapan Tinggal Nitya/Greysia SEOUL (Waspada): Nitya Krishinda Maheswari/ Greysia Polii menjadi satu-satunya wakil Indonesia yang bertahan di Korea Terbuka Super Series. Melawan sesama pasukan Merah Putih, Aprilsasi Putri Lejarsar Variella/Vita Marissa, Kamis (9/1), mereka menang 20-22, 21-8, 21-13. Berasal dari negara yang sama, membuat pertandingan berjalan alot, meski diakui Ni-

tya, ia dan Greysia lebih dalam kondisi prima di lapangan. Terlebih keempat pebulutangkis tersebut, mengetahui gaya bermain masing-masing lawannya. “Kami lebih unggul dari kondisi, saya dan Greysia saat

ini lebih prima di lapangan. Walaupun melawan sesama pemain Indonesia, pertandingan berlangsung alot karena kami sudah sama-sama tahu kelebihan dan kekurangan masing-masing. Kami juga banyak dapat pelajaran dari Mbak Vita yang lebih senior,” ujar. Sayangnya, keberhasilan Nitya/Greysia lolos ke perempatfinal tidak diikuti wakil-wakil Indonesia lainnya. Di ganda

PS Kwarta Butuh Pemain Cerdas MEDAN (Waspada): Menyongsong bergulirnya kompetisi Divisi Utama Liga Indonesia musim ini, manajemen PS Kwarta mulai mempersiapkan tim dengan menggelar seleksi pemain lokal selama dua hari di Lapangan Kelambir V, 13-14 Januari pagi. Pelatih PS Kwarta, Slamet Riyadi, mengatakan seleksi berlangsung dua hari karena hanya sebatas menambah kuota pemain lokal. Untuk kriteria yang dicari, Kwarta menginginkan pemain cerdas. “Pemain lama juga akan mengikuti seleksi agar kami bisa melihat stamina dan ke-

mampuannya sejauh mana. Untuk seleksi pemain asing, kami masih harus membicarakannya dengan manajemen terlebih dahulu. Jika manajemen tidak berminat dengan pemain asing, maka tim akan tampil murni pemain lokal,” ujar Slamat, Kamis (9/1). Sebelumnya, Slamet mengatakan jika saat ini skuad Burung Sumatera membutuhkan setidaknya enam pemain untuk memenuhi kebutuhan tim, yakni empat pemain lokal dan dua pemain asing. Asisten Pelatih PS Kwarta, Reswandi, menambahkan jika seleksi yang akan digelar sifat-

nya terbuka. Siapa saja yang ingin mengikuti seleksi kali ini dipersilakan. Namun yang pasti PS Kwarta hanya akan merekrut pemain terbaik dan sesuai kebutuhan tim. “Tidak ada ketentuan usia dan kami berharap dapat menemukan pemain yang memiliki fisik bagus, energik serta cerdas dalam memanfaatkan situasi dan kondisi di lapangan,” ujar Reswandi . (cat)

putri, Suci Rizky Andini/Tiara Rosalia Nuraidah dikalahkan Jin Ma-Yuanting Tang (China) 17-21, 21-11, 13-21. Di tunggal putra, pengembalian yang gagal dilakukan Dionysius Hayom Rumbaka memastikan Boonsak Ponsana (Thailand) meraih tiket ke babak delapan besar. Hayom pun harus mengakui keunggulan Ponsana 13-21, 15-21. “Saya terbawa tipe permainan lawan yang reli, ini cukup menyulitkan buat saya. Sebetulnya saya ada kesempatan untuk menyerang, tetapi dengan kondisi saya sedang kurang fit, saya agak kesulitan juga,” ungkap Hayom. Nasib sial juga menimpa ganda putra. Bila Ricky Karanda Suwardi/Berry Angriawan takluk dari Liu Xiaolong/Qiu Zihan (China) 23-21, 16-21, 1821, maka Wahyu Nayaka Arya Pankaryanira/Ade Yusuf menyerah di tangan Hiroyuki Endo/Kenichi Hayakawa (Jepang) 15-21, 13-21. (m33/tsw)

Waspada/Helmy Has

SEJUMLAH anggota WBC Tanjungtiram diabadikan bersama seusai bersepeda.

Waspada Bicycle Club Terbentuk TANJUNGTIRAM (Waspada): Belasan pecinta olahraga sepeda di Tanjungtiram, Kabupaten Batubara, mendirikan satu komunitas atau klub dengan nama Waspada Bicycle Club (WBC). Klub ini akan diresmikan bertepatan dengan HUT ke67 Harian Waspada, Sabtu (11/1). Pengurus WBC, Yusuf, Kamis (9/1), mengatakan WBC didirikan sebagai wadah berkumpulnya para pecinta olahraga sepeda di Tanjungtiram sekitarnya. Klub ini bermarkas di Warkop Waspada, Jl Merdeka Tanjungtiram. Dikatakan, saat ini WBC beranggotakan belasan orang. “Kami bersepeda setiap sore dan Minggu pagi atau hari libur. Rute yang kami lalui adalah Jalan Lintas Pantai TanjungtiramPerupuk- Tanjungtiram-Sei Balai-Ujungkubu-Limalaras,” katanya. “Kami sengaja memilih nama Waspada Bicycle Club, karena kecintaan warga Tanjungtiram membaca harian Waspada. Semoga motto Demi Kebenaran dan Keadilan dapat terus diaplikasikan harian Waspada,” ujar Yusuf, mengucapkan selamat HUT Waspada. (a12)

PSMS Segera Umumkan Pelatih MEDAN (Waspada): Manajemen PSMS Medan segera mengumumkan tim pelatih klub Ayam Kinantan ke masyarakat Kota Medan, setelah sebelumnya melakukan uji kelayakan atas beberapa sosok calon pelatih. “Kalau tidak ada halangan, besok (Jumat 10/1), di Universitas Panca Budi Medan, kami akan umumkan sosok pelatih yang telah ditentukan oleh manajemen,” kata Sekretaris Umum PSMS Medan, Julius Raja, Kamis (9/1). Ketika ditanya sosok yang dipilih untuk menangani tim PSMS, Julius Raja masih enggan membeberkannya dengan alasan sudah ada tim tertentu yang mendapat tugas mengumumkan kepada masyarakat. Sebelumnya, ada empat nama yang mencuat dan mengikuti proses seleksi oleh tim manajemen, yakni Liestiadi, M Khaidir, Edy Syahputra, dan Suharto AD yang semuanya memiliki track record berbedabeda. Keempatnya juga sudah memaparkan program yang akan dilakukan jika dipilih menukangi PSMS dalam mengarungi kompetisi Divisi Utama 2014-2015, agar ke depan bisa lolos dan berlaga di kompetisi kasta tertinggi di Indonesia. “Yang jelas, pengalaman dan latar belakang keempatnya menjadi nilai tambah untuk terplih sebagi pelatih kepala dan asisten pelatih,” katanya. (m42/ant)

Problem Catur


Putih melangkah, memaksa lawannya mengorbankan Mf6.

Jawaban di halaman A2. 8

















Sudoku MENDATAR 1. Ayat pertama QS Al Baqarah dan Ali Imran, hanya Allah yang tahu artinya (tiga suku kata, tulis tanpa spasi). 6. Huruf ke-3 Arab. 8. Denda dalam ibadah haji atau umrah. 10. Perbuatan keji menurut QS An Nisa ayat 15. 11. Perbuatan menghapus amal-amal kebajikan. 12. Huruf ke-18 Arab. 13. Salah satu zakat. 15. Keluar dari Islam. 16. Yang tidak bersujud kepada Adam sebagaimana disebut dalam QS Al Baqarah ayat 34. 18. Tidak boleh durhaka kepadanya. 19. Sembahan yang tidak dapat menolong pada hari kiamat menurut ayat 94 QS Al An’am 21. Produk lebah, obat penyakit menurut QS An-Nahl ayat 65-69. 23. Nama nabi. 25. “Jadilah, lalu jadilah ia”. 26. Cahaya kemerahan di kaki langit menjelang matahari terbit. “Salaamun hiya hattaa mathla’il _____,” ayat terakhir Al Qadr. 28. Nabi khalifah menurut QS Al Baqarah. 29. Surat Al Quran yang sebagian

ayat ke 286nya sering diucapkan dalam doa seusai shalat.

MENURUN 1. Al-____ (Bukit-bukit Pasir) surat ke-46 Al Quran, memerintah agar anak memuliakan kedua orangtuanya. 2. Lembaga Pendidikan Islam Informal. 3. Ajal; Maut. 4. Sekolah agama Islam. 5. Shalat fardu malam. 7. Negeri terbaik bagi orang-orang bertaqwa kata Al An’am ayat 32. 9. Kota tujuan haji. 10. Bulan Tasyriq. 13. Orang yang menyekutukan Allah; Memuja berhala. 14. Laskar Pembela Islam. 15. Nabi yang disebut dalam QS Al Baqarah tentang penyembelihan sapi betina. 17. ____ bin Rabi’ah binJa’far al-’Amri, penyair terkenal sahabat Rasulullah. 20. Wanita; Surat Al Quran. 21. Kota yang dimaksud dengan Ummul Quraa dalam ayat 92 QS Al An’am. 22. Kafarah. 24. Sahabat Rasulullah. 27. Radliyallahu ‘anhu.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat sulit (*****), bisa diselesaikan kurang dari 20 menit. Jawabannya di halaman A2 kolom 1.

3 4 1 8 2 4 1 7 9 7 9 2 8 6 2 7 5 7 1 8 4 7 3 6 4 6 *****27



WASPADA Jumat 10 Januari 2014

PENGUMUMAN KERJASAMA INVESTASI Nomor : 159/PK/LPKTM/PDPKM/1/2014 Perusahaan Daerah Pembangunan Kota Medan akan mengadakan Kerjasama Investasi Pengembangan Kawasan Pergudangan Kota Tanjung Mulia (PKTM) menjadi Kawasan Pergudangan Modern. I.

INVESTASI Nama Investasi

: Kerjasama Pembangunan Pergudangan Modern Nama Objek : Pergudangan Alamat Objek : Jl. Kayu Putih No. 4 Medan (+/- 13 Ha) Pemilik Objek : Perusahaan Daerah Pembangunan Kota Medan Bentuk Kerjasama : Kerjasama Operasional (KSO) II. Pendaftaran & Pengambilan Dokumen Kerjasama Investasi Tanggal : 10 Januari s/d 16 Januari 2014 Waktu : Pukul 09.00 s/d 13.00 WIB Tempat : Kantor Direksi PD. Pembangunan Kota Medan. Alamat : Jl. Sutomo No. 4 Medan III. Untuk keterangan lebih lanjut hubungi alamat di atas. Medan, 9 Januari 2014

Direksi : Perusahaan Daerah Pembangunan Kota Medan

Panitia Pengadaan Barang & Jasa





Direktur Pengembangan


Nets Akhiri Rentetan Kemenangan Warriors NEW YORK, AS (Waspada): Rentetan kemenangan tandang Golden State Warriors di kompetisi basket NBA akhirnya terhenti juga. Adalah Brooklyn Nets menjadi tim pertama yang mengalahkan Warriors dalam laga di New York, Kamis (9/1), setelah melewati enam kemenangan tandang secara beruntun. Dipimpin oleh pemainnya, Joe Johnson yang mencetak 27 poin,Netsmencatatkemenangan keempat secara beruntun setelah mengalahkan Warriors 102-98, sekaligus menggagalkan Steph Curry dan kawan-kawan meraih tujuh kemenangan tandang beruntun dalam sejarah NBA. Kevin Garnett yang mencetak total 13 poin, memperlihatkan salah satu performa terbaiknya saat berkostum Nets. Pebasket veteran itu mencuri bola dari tangan Curry pada akhir pertandingan. Warriros yang saat itu hanya tertinggal tiga poin, berpeluang untuk menyamakan kedudukan. “Warriors datang dan bermain gemilang di kuarter pertama. Saya rasa kami mampu mempertahankan ritme per-

mainan dan membalasnya.Warriors adalah sebuah tim yang bagus yang kami hadapi malam ini dan tim bagus yang kami kalahkan,” kata Garnett, diberitakan ESPN. Curry bermain sangat baik dengan menyumbang 34 poin, angka tertinggi untuk Warriors di pertandingan ini. David Lee menambah dengan 20 poin. Pelatih Warriors, Mark Jackson kecewa dengan kekalahan itu. “Ini kekalahan yang mengecewakan. Kami tidak mampu mengakhirinya. Kami memuji permainan Nets, tapi kami tidak mau menghilangkan fakta kami telah mencetak rekor enam kali menang dan satu kali kalah saat tandang,” sesal Jackson. Dalam laga lain di Houston, Dwight Howard meraih kemenangan perdananya atas Los Angeles Lakers saat timnya Houston Rockets mengatasi tamunya itu 113-99. Howard yang bekerjasama dengan James Harden semakin membenamkan posisi Lakers di klasemenWilayah Barat. Harden menjadi top skor Rockets dalam pertandingan ini. Dia memimpin rekan-rekannya dengan mencetak 38 poin. Sementara itu, Howard membuktikan kapasitasnya sebagai pemain tangguh kepada mantan tim-

nya, Lakers dengan membuat 20 poin dan 12 rebound. Lakers yang mengalami badai cedera pada musim ini, tidak mampu mengimbangi permainan Rockets. Pelatih Mike D’Antoni masih tanpa kehadiran Kobe Bryant, Steve Nash, Steve Blake dan Jordan Farmar karena mengalami ce-

dera parah. Nick Young bermain cukup baik dengan menyumbang 25 poin untuk Lakers. Pau Gasol bermain tak kalah cemerlang lewat torehan 21 poin dan 12 rebound, sementara itu, Jodie Meeks menambah dengan 21 poin. Beralih ke Wilayah Timur. Indiana Pacers tidak berdaya

menghadapi permainan tuan rumah Atlanta Hawks. Paul George dkk takluk di Philips Arena, dengan skor 97-87. Kyle Korver memimpin perolehan Hawks dengan menyumbang 17 poin. Bukan hanya itu, Korver juga selalu mencetak lemparan tiga angka sebanyak 105 pertandingan beruntun. (esp/m47)


PEMAIN Brooklyn Nets Joe Johnson, kanan, beruapay menghadang laju pemain Golden State Warriors, David Lee (10) di laga lanjutan kompetisi basket NBA di New York, AS, Kamis (9/1). Nets menang 102-98

Nadal, Serena Unggulan Pertama Australian MELBOURNE, Australia (Waspada): Turnamen tenis Grand Slam Australian Open 2014 akan bergulir mulai Senin (13/1/), di mana daftar unggulan para petenis sudah dirilis pihak Panitia Penyelenggara. Seperti sudah diprediksi, Rafael Nadal masih menjadi unggulan pertama di nomor tunggal putra diikuti petenis Serbia, Novak Djokovic. Demikian seperti dilansir ESPN. Unggulan ketiga ditempati petenis Spanyol, David Ferrer sementara juara Wimbledon tahun lalu, Andy Murray, harus puas menjadi unggulan keempat. Petenis Argentina, Juan Martin del Potro sebagai unggulan kelima dan peraih 17 titel Grand Slam, Roger Federer, unggulan keenam. Di nomor tunggal putri, unggulan pertama ditempati petenis Amerika Serikat, Serena Williams diikuti juara bertahan Australian Open, Victoria Azarenka. Unggulan ketiga hingga keenam masing-masing ditempati Maria Sharapova, Li Na, Agnieszka Radwanska dan Petra Kvitova. Australian Open merupa-

Pasang Iklan Telp. 4528431 HP. 081370328259 Email:

kan turnamen Grand Slam perdana di tahun 2014 yang akan dimulai 13 hingga 26 Januari mendatang. (esp/m47)

PENGUMUMAN LELANG ULANG EKSEKUSI HAK TANGGUNGAN Menunjuk Pelaksanaan Lelang Eksekusi Tanggungan pada tanggal 21 November 2013 dan pengumuman lelang Tanggal 07 November 2013 pada surat kabar harian Waspada. PT. Bank BNI Syariah Melalui Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Medan akan melaksanakan Lelang Eksekusi Hak Tanggungan berdasarkan pasal 6 UUHT No.4 Th. 1996, terhadap Debitur sebagai berikut : 1. PT. Era Husada a. Sebidang tanah seluas 2.550 m2 berikut rumah tempat tinggal Desa Paya Bakung, Kec. Hamparan Perak, Kab. Deli Serdang, Sertifikat Hak Milik No. 360 an. Haji Ahmad Husein, SE (limit Rp. 880.000.000,- ; Jaminan Rp.176.000.000,-). b. Sebidang tanah seluas 9.748 m2 berikut rumah tempat tinggal Jl. Letjend Jamin Ginting, Kel. Pujidadi, Kec. Binjai Selatan, Kota Binjai. Sertifikat Hak Milik No. 670 an. H. Ahmad Husein (limit Rp. 1.650.000.000,- ; Jaminan Rp. 330.000.000,-). c. Sebidang tanah seluas 79 m2 berikut rumah toko Jl. Nibung-II No. 86, Kel. Petisah Tengah, Kec. Medan Petisah, Kota Medan, Sertifikat Hak Guna Bangunan No. 2007 an. Haji Ahmad Husein, Sarjana Ekonomi (Berdiri diatas Hak Pengelolaan No. 1) (limit Rp.1.430.000.000,- ; Jaminan Rp. 286.000.000,-). Pelaksanaan lelang : Jumat, 17 Januari 2014 Pk.14.00 WIB - Selesai Tempat :Kantor Bank BNI Syariah Cabang Medan Jl.Kapt. Maulana Lubis No. 12 Medan Syarat-syarat lelang : 1. Peserta lelang diwajibkan menyetor uang jaminan ke Rekening KPKNL di PT. Bank BTN (Persero) Cabang Medan No A/C 00003-01-30-000846-3 an. Rek Penampungan Lelang KPKNL Medan yang sudah efektif selambat-lambatnya 1 (satu) hari sebelum pelaksanaan lelang. 2. 1 (satu) penyetoran uang jaminan penawaran lelang hanya berlaku untuk 1 (satu) barang atau paket barang ditawar. 3. Setiap peserta lelang wajib melakukan penawaran dan penawaran tersebut paling sedikit sama dengan Nilai Limit. Dalam hal peserta lelang tidak hadir atau hadir namun tidak melakukan penawaran sebagaimana dimaksud, dikenakan sanksi tidak diperboleh mengikuti lelang selama 3 (tiga) bulan di wilayah kerja Kantor Wilayah DJKN Sumatera Utara. 4. Pemenang lelang diwajibkan membayar pelunasan harga lelang dalam waktu 5 (Lima) hari kerja setelah ditunjuk sebagai pemenang lelang. 5. Apabila pemenang lelang tidak melunasi kewajibannya maka dinyatakan wanprestasi dan uang jaminan akan disetorkan ke Kas Negara sebagai pendapatan jasa lainnya serta peserta lelang akan dimasukkan dalam DAFTAR HITAM LELANG. 6. Peserta lelang diwajibkan melihat, mengetahui dan menyetujui aspek legal dari objek yang dilelang sesuai apa adanya (kondisi as is). 7. Objek yang akan dilelang dapat ditunda/dibatalkan sebelum pelaksanaan lelang apabila ada penyelesaian debitur atau dalam rangka penundaaan sesuai ketentuan. 8. Pada saat lelang, peserta lelang wajib membawa kartu identitas diri yang berlaku (fotokopy KTP), Asli NPWP, Slip (resi) Setoran Uang Jaminan lelang dan Materai Rp. 6000,- sebanyak 4 (empat) lembar. 9. “Keterangan lebih lanjut hubungi Bank BNI Syariah Medan, Telepon 061-4559520, Sdr M. Yusuf 081375363964 dan KPKNL Medan, Jl. P. Diponegoro No. 30A Medan, Telepon 061-4513612. “ Demikian Surat Pengumuman ini dibuat dengan sebenarnya untuk dapat dipergunakan sebagaimana mestinya.

Medan, 10 Januari 2014 ttd

PT. Bank BNI Syariah Cabang Medan




Rockets Buat Lakers Terbenam HOUSTON, AS (Waspada): Houston Rockets membantu Dwight Howard meraih kemenangan perdananya atas LA Lakers dalam lanjutan kompetisi NBA, Kamis (9/1). Didukung James Harden, Howard semakin membenamkan Lakers di posisi 13 klasemen Wilayah Barat. Harden menjadi top skor Rockets sekaligus memimpin rekan-rekannya dengan mencetak 38 poin. Sementara itu, Howard membuktikan kapasitasnya sebagai pemain tangguh terhadap mantan timnya dengan mendulang 20 angka 12 rebound. Dilanda badai cedera musim ini, Lakers pun tidak mampu mengimbangi permainan Rockets. Pelatih Mike D’Antoni masih harus melatih Lakers tanpa kehadiran Kobe Bryant, Steve Nash, Steve Blake, dan Jordan Farmar akibat cedera parah. Nick Young bermain cukup baik dengan menyumbang 25 poin dan Pau Gasol menoreh 21 angka 12 rebound. “Pertahanan kami membaik di dua kuarter penutup. Selain performa gemilang Howard dan Harden, saya kira itulah perbedaan utama dalam pertandingan tadi,� ungkap Pelatih Rockets, Kevin McHale. Beralih ke Wilayah Timur. Indiana Pacers tidak berdaya

menghadapi tuan rumah Atlanta Hawks. Paul George cs takluk di Philips Arena dengan skor 97-87. Kyle Korver memimpin Hawks dengan menyumbang 17 poin, sedangkan George tetap menjadi top skor Pacers kala mencetak 28 angka 12 rebound. Di laga lain, Portland Trail Blazers mempertahankan rekor tak pernah kalah lebih dari dua kali beruntun musim ini. Melawan Orlando Magic, Blazers unggul 110-94 berkat kontribusi 36 poin dari LaMarcus Aldridge dan Nicholas Batum yang menambah 14 angka 10 rebound, dan 14 assist. Kemenangan ini makin mengukuhkan Blazers sebagai salah satu tim terkuat musim ini. Mereka berada di urutan tiga klasemen Wilayah Barat, hasil 26 kali menang dan sembilan kali kalah. Catatan ini hanya kalah dari San Antonio Spurs dan Oklahoma City Thunder. (m33/ap)

Hasil Kamis (9/1) San Antonio v Dallas Toronto v Detroit Atlanta v Indiana Brooklyn v Golden State Washington vs New Orleans Houston v LA Lakers Phoenix vs Minnesota Portland v Orlando LA Clippers v Boston

112-90 112-91 97-87 102-98 102-96 113-99 104-103 110-94 111-105


Vettel Bingung Pilih Nomor PARIS (Waspada): Menjelang musim Formula One (F1) 2014, Federasi Otomotif Internasional (FIA) menentukan nomor yang akan digunakan para peserta balapan di musim baru nanti. Nomor permanen itu akan digunakan selama satu musim penuh. Sesuai dengan regulasi FIA, jika ada pebalap yang memiliki pilihan yang sama, maka pebalap yang berhak memenangkan pilihannya adalah mereka yang finish di urutan tertinggi musim lalu. Juara bertahan dan jagoan Red Bull, Sebastian Vettel (foto), sendiri ternyata belum memiliki pilihan untuk nomor kendaraan yang akan digunakannya. Begitu juga Daniel Ricciardo yang akan menjadi pasangan barunya menggantikan Mark Webber. Di lain pihak, duet pebalap Ferrari sudah menetapkan pilihannya. Driver Ferrari asal Spanyol, Fernando Alonso, memilih angka 14 dan Kimi Raikkonen memutuskan untuk memakai angka 7. Pebalap Lotus, Romain Grosjean, berharap kembali menggunakan nomor 8 yang menjadi pilihannya musim lalu. Tetapi, Grosjean telah menyiapkan dua alternatif pilihan yaitu nomor 29 dan 11. Dari Mercedes, Lewis Hamilton bernasib sama dengan Vettel dengan belum memberi keputusan. Sebaliknya, Nico Rosberg bingung memilih antara nomor 6, 5 atau 9. Pebalap lain yang sudah menetapkan pilihan, di antaranya Sergio Perez (Force India/11), Kevin

Magnussen (McLaren/20), dan Felipe Massa (Williams/19). (m33/auto)

KOKOHNYA defense Dwight Howard (12) menyulitkan usaha Jordan Hill (kiri) mencetak poin bagi LA Lakers yang akhirnya kalah dari Houston Rockets di Toyota Center, Houston, Kamis (9/1). -AP-

WASPADA Jumat 10 Januari 2014

Sumatera Utara

WASPADA Jumat 10 Januari 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:34 12:47 12:34 12:41 12:41 12:38 12:34 12:30 12:37 12:36

‘Ashar 15:57 16:09 15:58 16:04 16:04 16:02 15:58 15:54 16:00 15:59

Magrib 18:32 18:42 18:33 18:37 18:37 18:40 18:33 18:29 18:35 18:33



Shubuh Syuruq


19:45 19:56 19:46 19:51 19:51 19:53 19:47 19:43 19:49 19:47

05:03 05:20 05:04 05:14 05:12 05:04 05:03 04:59 05:06 05:08

05:13 05:30 05:14 05:24 05:22 05:14 05:13 05:09 05:16 05:18

L.Seumawe 12:40 L. Pakam 12:33 Sei Rampah12:32 Meulaboh 12:44 P.Sidimpuan12:31 P. Siantar 12:32 Balige 12:32 R. Prapat 12:29 Sabang 12:47 Pandan 12:33

06:34 06:50 06:34 06:44 06:43 06:34 06:33 06:29 06:36 06:38

Zhuhur ‘Ashar 16:02 15:56 15:55 16:07 15:56 15:56 15:56 15:53 16:09 15:58





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:35 18:31 18:30 18:41 18:33 18:31 18:32 18:30 18:41 18:34

19:49 19:45 19:44 19:55 19:47 19:45 19:46 19:43 19:55 19:48

05:12 05:03 05:02 05:14 04:57 05:01 05:00 04:56 05:20 05:00

05:22 05:13 05:12 05:24 05:07 05:11 05:10 05:06 05:30 05:10

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:33 12:34 12:44 12:37 12:34 12:41 12:29 12:39 12:32 12:32

18:34 18:34 18:40 18:38 18:32 18:38 18:29 18:38 18:33 18:30

19:48 19:48 19:53 19:51 19:46 19:51 19:42 19:52 19:47 19:44

05:00 05:03 05:17 05:05 05:04 05:12 04:58 05:09 05:00 05:01

05:10 05:13 05:27 05:15 05:14 05:22 05:08 05:19 05:10 05:11

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:30 12:37 12:35 12:30 12:32 12:30 12:29 12:39 12:33 12:28 12:29

15:55 16:02 15:59 15:54 15:56 15:54 15:54 16:02 15:57 15:52 15:54

18:33 18:40 18:35 18:29 18:32 18:31 18:32 18:35 18:34 18:29 18:30

19:46 19:54 19:48 19:43 19:46 19:45 19:45 19:49 19:47 19:42 19:43

04:55 05:02 05:03 05:00 05:01 04:56 04:55 05:11 05:01 04:55 04:58

05:05 05:12 05:13 05:10 05:11 05:06 05:05 05:21 05:11 05:05 05:08

06:42 06:33 06:32 06:44 06:28 06:31 06:30 06:26 06:50 06:30

15:57 15:58 16:07 16:01 15:58 16:04 15:53 16:03 15:57 15:55

06:30 06:33 06:47 06:35 06:34 06:42 06:28 06:39 06:30 06:31

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:25 06:32 06:33 06:30 06:31 06:26 06:25 06:41 06:31 06:25 06:28

Warga Protes

Acin Tersangka Perambah Mangrove Menghilang STABAT (Waspada): Puluhan warga tergabung dalam Lembaga Penyelamat Hutan Mangrove Jalur Hijau Indonesia, berunjukrasa ke Kantor Bupati Langkat, Kamis (9/1), memprotes menghilangnya tersangka Acin, perambah lahan mangrove. Irwansyah dan Budi Syahputra selaku kordinator pengunjukrasa, dalam orasinya di pintu gerbang Kantor Bupati minta Pemkabmenindaktegasoknumoknum yang tergabung dalam PT. Makmur Abadi Raya (MAR) karena membinasakan ratusan hektar mangrove, dan menutup paluh-paluh sehingga menyulitkan nelayan tradisional mencari nafkah. Harapan lain massa minta

aparatur Pemkab Langkat menyaksikan mereka membongkar sejumlah paluh yang ditutup pengusaha pada 13 Januari mendatang, untuk menghindari bentrok dengan kubu perusahaan. Dalam unjukrasa, massa membawa sejumlah poster kecaman terhadap pengelola PT. MAR yang sembarangan membabathutanseakankebalhukum. Salah satu poster bertuliskan, “Tangkap Acin perusak hutan di

Pulau Sembilang”. Beberapa perwakilan massa diterima Plt. Sekda Langkat Indra Salahuddin. Indra berjanji menyurati Direktur PT. MAR untuk membuka paluh-paluh yang selama ini ditutup.Tuntutan lain, kata Indra, akan disampaikan kepada Bupati Langkat. SelainberunjukrasadiKantor Bupati, puluhan warga juga berorasi di DPRD dan Mapolres Langkat dengan tuntutan serupa. Kasus perambah ratusan hektar mangrove di Desa Pulau Sembilan Kec. P. Susu tersebut sudah ditangani Polres Langkat sejakbeberapabulanlalu,bahkan penyidik kejaksaan telah menghapus dari register Kejari

Stabat demi kepastian hukum, karena empat bulan lebih menunggu tapi berkas tak juga dilengkapi polisi. Dalam kasus tersebut Direktur PT. MAR, BS alias Acin sebagai tersangka, namun kini keberadaannya tidak diketahui pasca penangguhan penahanan yang dilakukan Polres Langkat sehari setelah yang bersangkutan ditahan, tepatnya 14 April 2013. Kapolres Langkat melalui Kasat Reskrim AKP Rosyid Hartanto, Kamis (9/1) siang menuturkan, pihaknya masih terus melengkapi berkas sesuai permintaan kejaksaan. Dia yakin suatu saat kasus tersebut akan lanjut ke pengadilan.(a03)

Dugaan Korupsi Rp27 M

Wakil Ketua DPRD Langkat Diperiksa STABAT (Waspada): Wakil Ketua DPRD Langkat Surialam bersama tiga anggota dewan lainnya diperiksa penyidik Kejari Stabat sebagai saksi dalam kasus dugaan korupsi perjalanan dinas senilai Rp27 miliar tahun 2012. Pantauan Waspada, Kamis (9/1), keempatnya diperiksa di Ruang Pidsus dan Ruang Intelijen

Kejari sejak pukul 10:00 hingga siang. Beberapa di antara terperiksa didampingi stafnya menggunakan mobil dinas. Selain Surialam, anggota dewan yang diperiksa yakni M. Jamil (PBB), Rehani (Hanura) dan Samin Sihotang (Golkar). Menurut penyidik, pemeriksaan tetap terkait perjalanan

dinas fiktif untuk mengetahui apakah ada yang terlibat. Usai diperiksa, M. Jamil kepada Waspada menuturkan, dia ditanya banyak hal tentang perjalanan dinas, salah satunya apakah pernah tidak ikut dalam kunjungan kerja sementara memiliki jadwal turutserta. “Apa yang kita laksanakan itu kita

jelaskan, yang jelas saya tidak pernah terlibat dalam perjalanan dinas fiktif,” katanya. Terlepas dari itu, hingga kini belum diketahui jadwal pemanggilan Ketua DPRD Langkat, Rudi Hartono Bangun meski semula dijadwalkan penyidik 6 Januari dan dalam minggu pertama Januari.(a03)

Pengusaha Galian C Ilegal Patumbak ‘Membandel’ PATUMBAK (Waspada): Pasca blokir jalan dan menghadang truk galian C ilegal yang melintas di Jalan Pertahanan, Kec. Patumbak, Deliserdang, aktivitas galian C, Rabu (8/1), masih berlanjut sehingga terkesan membandel. PantauanWaspada,sejumlah dump truk pengangkut material galianCmencobauntukmelintas

dari Jalan Pertahanan. Namun, saat tiba di Desa Patumbak Kampung,tepatnyadepanKantor Camat, truk distop polisi dan disuruh memutar arah. Sejumlah personil Polsek Patumbak bersama warga bersiaga di pos penindakan yang didirikan dekat Kantor Camat. Informasi Waspada peroleh,

sekira pukul 14:00, sejumlah warga yang pro terhadap aktivitas galian C ilegal mendatangi pos memprotes larangan dump truk melintas.Beberapasaatkericuhan sempat terjadi antara warga yang pro dan yang kontra. Kapolsek Patumbak Kompol Andiko yang saat itu berada di lokasi langsung mengambil alih

situasi dan memaksa warga pro galian C meninggalkan pos penindakan. Camat Patumbak, Zainal Abidin Hutagalung via selular mengatakan kesiapannya menyetop aktivitas galian C ilegal. “KitateruskordinasidenganSatpol PP dan polisi untuk penindakan galian C,” akunya.(c02)

48 Persen Warga Miskin Akan Nikmati Jamyankes TEBINGTINGGI (Waspada): Mulai Januari 2014, jaminan pelayanan kesehatan (Jamyankes) tahap awal akan dinikmati sekitar 48 persen warga kepesertaan Jamkesmas dan Jamkesda untuk rakyatmiskindiKotaTebingtinggi. Hal itu disampaikanWalikota

Tebingtinggi Ir H. Umar Zunaidi Hasibuan, MM pada Sosialisasi Badan Penyelenggara Jaminan Sosial (BPJS) Ketenagakerjaan PekerjaHarianLepas(PHL)Dinas KebersihandanPertamananKota Tebingtinggi,Rabu(8/1),dihalaman kantor DKP Jalan Gunung Leuser

Kota Tebingtinggi. MenurutWalikota, kehadiran BPJS bidang ketenagakerjaan dan kesehatanmerupakanbagiandari sistemjaminansosialnasionalsecara lebihmerata,adildanmanfaatnya bisa dirasakan secara nyata oleh seluruh rakyat Indonesia.

“Saya tidak ingin mendengar adapekerjayangtidakterlindungi, dan saya juga tidak mau mendengar laporan ada masyarakat kurang mampu yang ditolak oleh rumahsakitdantidakbisaberobat karena alasan biaya,” tegas Umar Zunaidi Hasibuan.(a09/rel)

Bertengkar Dengan Pacar, Janda Terbakar TEBINGTINGGI (Waspada): Gara-gara terbakar api cemburu, sekujur tubuh seorang janda terbakar ketika terjadi pertengkaran di dalam rumah sang pacar di Jalan Gunung Martimbang 2, Lk. IV, Kel. Lalang, Kec. Rambutan, Tebingtinggi, Senin (6/1) dinihari. Korban, Nona Dedi Alfrida br Panjaitan, 40, warga Jalan Gunung Martimbang 2, Lk. 4, Kel. Lalang, Kec. Rambutan, Tebingtinggi, kini dirawat di RSUD dr. Kumpulan Pane Kota Tebingtinggi. Tersangka Suwondo, 45, warga yang sama kini diamankan petugas di Polres Tebingtinggi. Pengakuan korban kepada petugas, Rabu (8/1), kejadian tersebut dipicu ketika korban di rumah pacarnya yang juga duda, membuka SMS Hp Suwondo. Dia membaca beberapa SMS mesra dari wanita lain. Karena cemburu, korban marah hingga terjadi pertengkaran. Puncaknya Suwondo pergi ke dapur mengambil minyak tanah dari kompor. Selanjutnya menyiramkannya ke tubuh korban. Setelah itu tubuh korban terbakar. Sementara Suwondo, mengaku tidak membakar korban, melainkan korban sendiri yang membakar tubuhnya dengan minyak tanah yang diambil dari kompor. Dari olahTKP, di rumah berdinding papan itu ditemukan pakaian dan sepatu korban terbakar. Di belakang rumah ditemukan bra merah jambu milik korban yang juga terbakar, diduga sengaja dibuang Suwondo.(a11)


PESERTA bimbingan bersama Ka. Kemenag Deliserdang, Kepala Seksi Pendidikan Madrasah Kemenag Deliserdang.

Guru MTs Dan MA PAB Ikuti Bimtek Kurikulum MEDAN (Waspada): Drs. H. Fauzi Sunara, MA, Kepala Madrasah Tsanawiyah dan Aliyah PAB Helvetia memberikan mandat kepada Drs. H. Zakaria Batubara, H. Sarwoedi Harahap, S.Ag, SatriaWiraprana, S.pd, (masing masing MadrasahTsanawiyah dan Aliyah PAB Helvetia), mengikuti Bimbingan Teknis Pelaksanaan Kurikulum, beberapa waktu lalu di Griya Hotel Medan. Kegiatan diikuti kepala sekolah, perwakilan guru, masing-masing sekolah Ibtidaiyah, Tsanawiyah, Aliyah baik negeri mau pun swasta di lingkungan Kementerian Agama Kab. Deliserdang. M. Fauzi mengatakan, kegiatan ini sangat besar manfaatnya untuk pengembangan dan kemajuan sekolah MTs PAB-1 dan MA PAB-2 Helvetia, dan sekolah-sekolah lain baik negeri maupun swasta khususnya di bawah naungan Kementerian Agama Kabupaten Deliserdang.(ihn)

Kementerian Pertanian Kucurkan Rp9,7 M Untuk PUAP Samosir


KORBAN diduga dibakar pacarnya karena cemburu.

SAMOSIR (Waspada): Sebanyak 97 desa dari 134 desa/kelurahan se Kabupaten Samosir sudah menerima dana Program Usaha Agribisnis Pedesaan (PUAP) Rp100 juta per desa dari anggaran Kementerian Pertanian RI sejak digulirnya dana PUAP 2006. Hal ini dikatakan Kepala Badan Ketahanan Pangan Samosir Jaingot Banjarnahor, SP menjawab Waspada di kantornya, Kamis (9/1). Disebutkan, peruntukan dana PUAP adalah dalam rangka pengelolaan Agribisnis Pedesaan misalkan usaha mikro kecil, usaha tani yang seluruhnya dikelola melalui Gapoktan. Rincian jumlah desa per kecamatan yang sudah menerima dana PUAP untuk 9 kecamatan, yakni Kec. Onan Runggu 11 desa, Kec. Pangururan 16 desa, Kec. Simanindo 10 desa, Kec. Palipi 13 desa, Ronggur Ni Huta 8 desa, Kec. Sitio-tio 7 desa , Kec. Sianjur MulaMula 8 desa, Kec. Harian 11 desa, dan Kec. Nainggolan 12 desa. Jumlah keseluruhan desa penerima PUAP 97, Gapoktan 126 dan kelompok tani 881, papar mantan Camat Sianjur Mula-mula. (c11)

Waspada/Abdul Hakim

PULUHAN warga didominasi nelayan tradisional berunjukrasa minta Pemkab Langkat dan Kapolres memproses tersangka perambah mangrove.

Bupati Langkat Pada HUT ke-67 Harian Waspada

Pemberitaan Waspada Mendorong Publik Berkreasi, Kritis Dan Peduli Assalammu’alaikum wr. wb. DENGAN memanjatkan puji dan syukur kehadirat Allah SWT, Pemerintah Kabupaten Langkat mengucapkan selamat hari ulang tahun ke-67 surat kabar Harian Umum Nasional Waspada. Sebagai media bacaan favorit masyarakat di Sumatera Utara, Wa s p a d a m e n g e m b a n tanggungjawab besar dalam hal perkembanganSumutdiberbagai bidang dan aspek kehidupan. Sehingga harian ini tampil lebih baik dalam menyampaikan informasi kepada publik. Jadikanlah milad ini bermakna dengan harapan tidak terlena dengan kebesaran dan ketenaran yang sudah dicapai. Pada kesempatan ini saya mengucapkan terimakasih dan penghargaan kepada Harian Waspada, yang telah membantu penyampaian informasi kepada masyarakat, utamanya tentang program-program Pemerintah Kabupaten Langkat ke seluruh pelosok pedesaan, sehingga masyarakat mengetahui rencanarencana pelaksanaan pembangunan itu sendiri yang pada akhirnya

dapat mendorong partisipasi masyarakat dalam mewujudkan visi dan misi Kabupaten Langkat. Sebagaimana diketahui, untuk lima tahun ke depan semasa kepemimpinan saya sebagai Bupati Langkat priode kedua (20142019), visi dan misi sudah jelas guna mewujudkan masyarakat yang lebih maju, dinamis, sejahtera dan mandiri berlandaskan aspek relijius, kultural dan berwawasan lingkungan. Karenanya berbagai perubahan pada lingkungan kita telah terjadi, sehingga realitas pemberitaan melalui Harian Waspada, mendorong tumbuhnya keberanian publik untuk berkreasi, bersikap kritis dan mendorong masyarakat lebih peduli kepada lingkungannya karena informasi yang disajikan menyentuh hati sanubari rakyat itu sendiri, agar lebih aktif meningkatkan taraf kehidupannya. Yang tidak kalah penting, usaha dan pemberitaan Surat Kabar seperti Harian Waspada, mampu memberi dorongan bagi masyarakat guna meningkatkan ilmu pengetahuan, karena masyarakat yang memiliki ilmu adalah yang punya kemampuan daya baca yang baik. Semakin banyak jumlah masyarakat gemar membaca dengan sendirinya banyak pula masyarakat mencari informasi melalui surat kabar Harian Waspada tercinta ini. Demikian yang dapat saya sampaikan, akhirnya atas nama Pemerintah Kabupaten Langkat mengucapkan terimakasih serta penghargaan setinggi-tingginya atas kerjasama yang baik selama ini. Bersatu Sekata, Berpadu Berjaya.****


Sumatera Utara Polisi Lumpuhkan Perampok WASPADA

Jumat 10 Januari 2014

WASPADA Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Baru Tiga Parpol Lengkapi Laporan Dana Kampanye RANTAUPRAPAT (Waspada): Dari 12 Partai Politik (Parpol) peserta Pemilu Legislatif di Kab. Labuhanbatu, baru tiga yang melengkapi dokumen terkait laporan dana kampanyenya. Ketua KPU setempat Hj. Ira Wirtati, Rabu (8/1) menerangkan, ketiga Parpol tersebut yakni, PDI-Perjuangan, Golkar dan PAN. “Baru itu yang sudah mengisi dan menyerahkan formulir DK-1 dan DK-13,” katanya. Akhir penyerahan dokumen itu masih terbilang lama yakni tanggal 2 Maret mendatang, mungkin dasar itulah masih banyak Parpol yang belum melengkapinya persyaratan seperti melampirkan bukti pendukung ujar Ira. Sementara Partai NasDem DK-1 dan DK-13 formulirnya tidak diisi, PKB DK-13 parpolnya hanya tiga orang caleg yang mengisi, Gerindra DK-13 parpol belum direkaf ke DK-1, Demokrat hanya baru menyerahkan rekening partai, PPP DK-13 parpol belum direkaf ke DK-1, Hanura dokumen pendukung DK-1, PKS DK-13 belum direkaf serta DK-1 tidak sesuai dan DK-13 belum lengkap. Selanjutnya, PKPI DK-13 parpol belum direkap ke DK-1 serta PBB DK-13 parpol belu direkap ke DK-1 serta DK-1 nya tidak sesuai. “Laporan itu terdiri dari dana kampanye masing-masing caleg dilengkapi dengan pendukung seperti kwitansi pembelian alat peraga serta rekapitulasi dana sumbangan caleg yang dirangkum di formulir DK-1,” kata Ira Wirtati. Lebih jauh diutarakan Ketua KPU Kab. Labuhanbatu itu, dari rekapmerekadiketahui,NasDemmendapatdanasumbangansebesar Rp63.985.000, PKB Rp8.676.845, PKS Rp363.484.000, PDI-P Rp558.270.000, Golkar Rp429.746.000, Gerindra Rp2.297.000.000, Demokrat Rp50.000.000, PAN Rp86.211.000, PPP Rp190.334.750, Hanura Rp1.057.000.608.000, PKPI Rp274.050.000 serta PBB Rp328.696.000. (c07)

KISARAN (Waspada): Pelaku perampok dan penodong terhadap wanita, diamankan Sat Reskrim Polres Asahan. Karena berusaha kabur, salah seorang tersangka dilumpuhkan dengan timah panas, Rabu (8/1) malam, sekitar pukul 23:00. Informasi dihimpun Waspada, tersangka KP,23, warga Seibeluru, Kec Meranti, diamankan petugasdiwilayahJalinsum,Desa Seibeluru,karenaberusahakabur, petugas polisi yang dipimpin Kanit Resum Ipda Irianto, memberi tembakan peringatan, namunperingatanitutidakdiindahkan, sehingga terpaksa melumpuhkannyadengandengantimah panah di kedua kakinya. Dari tangan tersangka diamankan sebuahpisau,yangdigunakannya untuk melakukan tindak kejahatan. Sebelum penangkapannya, terlebih dahulu diamankan rekannya di wilayah Pabrik Benang,WS, alias Udin,25, warga Kelurahan Sidomukti. Mereka harus berhadapan dengan hukum karena melakukan tidak kriminal dengan merampok menggunakan senjata tajam,

terhadap korbannya Ria Arfiana, 23, warga Desa Sukadamai, Kec. Pulobandring,saatberangkatkerja mengendarai sepeda motor Honda jenis matik BK 5842 VAT. Saat melalui wilayah sawitan dan agak sunyi tepatnya di Pasiran/Pembibitan Sawit, Afdeling III Gurah Batu, PT BSP, Desa Sukai Damai, Kec Pulobandring, dengan mengambil sepeda motornya, dan tas berisi dompet serta telepon genggam, pada 18 Desember 2013. “Berkat kerja keras, dan informasi dari masyarakat, dua tersangkaitudapatkamiringkus,” jelas Kasat Reskrim Polres Asahan AKP Hendra Eko Triyulianto, melalui Kanit Resum Ipda Rianto, saat ditemui Waspada di RSUD Kisaran, Kamis (9/1) dini hari, saat membawa tersangka untuk perawatan medis. Irianto mengatakan, hasil

pemeriksaan sementara, dua tersangkainitelahmelakukantiga kali melakukan hal yang sama di wilayah Asahan dan Simalungun. Saat penangkapan WS, tidak melawan dan memberikan detail informasi, sedangkan KP, memberontakdanberusahamelawan, sehingga terpaksa dilumpuhkan. Dan daerah tangan tersangka diamankan sebilah pisau, dua buah kartu ATM, sebuah telepon genggam. “Demi kenyamanan masyarakat,kitaakanmemburutersangka, dan bila melawan akan kami lumpuhkan dengan tembakan. Sehingga ketertiban masyarakat bisa tercipta,” jelas Rianto. Sementara tersangka KP, mengakui bahwa tindakan kriminalinisebanyaktigakali,baik itu wilayah Simalungun dan Asahan, dengan tersangka adalah perempuan yang naik sepeda motor sendiri, dengan modus purapura bertanya dan langsung menodongkan pisau untuk mengambil paska milik korbannya. “Ini terpaksa kami lakukan karena pengaruh ekonomi,” alasan tersangka. (a15)


KANIT Resum Ipda Rianto, bersama anggotanya Diky Siringoringo, menunjukkan sebilah pisau sebagai barang bukti, saat memeriksa salah satu seorang tersangka perampokan KP di RSUD Kisaran.

Penyerahan Sistem Aplikasi Basis KPU L. Batu Pastikan Data PBB-P2 Ke Pemkab L. Batu Pakai Bilik Suara Lama RANTAUPRAPAT (Waspada):KantorPelayananPajak(KPP) Pratama Rantauprapat telah menyerahkan Sistem Aplikasi, Basis Data PBB-P2 kepada Pemkab Labuhanbatu yang ditandai dengan penandatanganan berita acara serah terima bernomor BA01/WPJ.26/KP.03/2014 dan ditandatangani oleh Kepala Kantor PelayananPajakPratamaRantauprapat Muhammad Primbang Apriliyanto, SE, MM dengan Plt. Sekdakab Labuhanbatu H Ali Usman Harahap, SH, Rabu (8/ 1)diRuangDatadanKaryaKantor Bupati Labuhanbatu. Dalam lampiran Berita Acara tersebut, daftar system aplikasi dan basis data PBB-P2 yang diserahkan itu antara lain, Source Code Sismiop PBB-P2, Installer Sismiop PBB-P2, Dokumentasi Teknis dan User Manual Sismiop PBB-P2, Source Smart Map 1.2, Installer Smart Map 1.2, User ManualSmartMap1.2danBasisData PBB-P2 (Per 30 November 2012). Plt. Sekdakab Labuhanbatu H. Ali Usman Harahap, SH dalam kesempatanmengatakan,bahwa Pajak Bumi dan Bangunan khususnya sektor Pedesaan dan Perkotaan selambat-lambatnya 1 Januari 2014 akan menjadi Pajak Daerah sama dengan Pajak Daerah lainnya. Hal ini diamanatkan dalam Undang undang Nomor 28 Tahun 2009 tentang Pajak Daerah dan Retribusi Daerah. Peralihan Pajak tersebut dimaksudkan dalam rangka penyelenggaraanotonomidaerah yangluas,nyatadanbertanggungjawab, maka Pemerintah Daerah harus mampu menggali sumber-

RANTAUPRAPAT (Waspada): Komisi Pemilihan Umum (KPU) Kab. Labuhanbatu memastikan akan menggunakan bilik suara lama pada Pemilu Legislatif yang akan digelar 9 April 2014 mendatang. Menurut Ketua KPU setempat Hj. IraWirtati, hal itu disebabkan bilik suara milik mereka masih layakuntukdigunakandanjumlahnyarelatifmencukupi. “Mungkin berlebihpun, karena dulunya punya kita dipakai KPU Labura dan Labusel dan itu sudah kita tarik semua,” katanya, Rabu (8/1). Nantiya, kata Ira Wirtati, pihaknya akan menyediakan sebanyak 4.860 bilik suara dengan rincian masing-masing per TPS disediakan empat bilik suara yang tersebar di antara 98 desa dan kelurahan. “Karena setiap pemilih akan memasukkan surat suara sebanyak empat suaranya,” ujarnya sembari menambahkan pihaknya telah

Waspada/Budi Surya Hasibuan

PLT Sekdakab Labuhanbatu H Ali Usman Harahap, SH ( kanan) menerima berita acara Sistem Aplikasi dan Basis Data PBB-P2 dari Kepala KPP Pratama Rantauprapat Muhammad Primbang Apriliyanto, SE, MM. sumber pendapatannya sendiri. Apriliyanto, SE, MM pada kesem“Sehingga dapat menyediakan patan yang sama mengatakan, sumber-sumber pembiayaan terkait dengan pengalihan PBBuntukpenyelenggaraanpemerin- P2 yang dilaksanakan ini adalah tahan, pembangunan dan kema- merupakan tonggak sejarah bagi syarakatan, yang salah satu sum- Pemkab Labuhanbatu, dengan bernya diharapkan dari Penda- harapan kiranya Pemkab mampatanAsliDaerah(PAD)termasuk pu menggali keunggulan pajak Pajak Bumi dan Bangunan Pede- daerah melampaui target yang saan dan Perkotaan (PBB-P2) ini,” telah ditentukan. Kepala Dinas PPKAD Kab. terang Ali Usman. Plt. Sekdakab meminta kepa- Labuhanbatu Ahmad Muflih, SH da para camat agar benar-benar dalam laporannya menjelaskan, memahami segala peraturan dan bahwa acara serah terima pengeketentuanyangberkaitandengan lolaanPBB-P2inibertujuanuntuk pajak ini, sehingga dalam pelak- memberikan kewenangan yang sanaan tugas-tugas dilapangan luaskepadaPemkabdalammengnantinyatidakmengalamikenda- gali potensi objek Pajak Bumi dan la dan hambatan yang berarti. Bangunan sebagai Pajak Daerah Kepala KPP Pratama Rantau- serta menambah sumber peneprapat Muhammad Primbang rimaan baru bagi PAD. (c07)

Pulau Salahnama Dikembangkan Jadi Mina Wisata TGTIRAM (Waspada): Pulau Salahnama yang berada di perairan Kec. Tanjungtiram, Kab. Batubaradikembangkanmenjadi MinaWisata memanfaatkan kawasan wisata dengan pengembanganproduksiperikanandalam upaya menggembangkan dan membangkitkan perekonomian masyarakat/nelayandidesapesisir. Bupati Batubara H OK Arya Zulkarnain,SH,MMmengatakan hal itu kepada Waspada terkait pengembanganPulauSalahnama belakangan ini, Rabu (8/1). Awalnya pembangunan pulau bersumber dari APBD, sehingga turunnya bantuan dari Provsu maupun Pemerintah PusatmelaluiproyekMinaWisata. Pulau katanya di poles secara apik, tidak saja membangun pos

berkempoten berupa kantor BPBD, Dishub, Disbudpora, DKP dansaranakesehatanberupaPustu. Namun membangun jalan setapak menghubungkan antar pos satu dengan yang lain di atas bebatuan mengitari pulau tanpa mengusik lingkungan sekitar. ‘’Ruasjalaninitidaksematadiperuntukan dan dilalui petugas atau penjaga, namun dapat dimanfaatkan pengunjung maupun nelayan sewaktu-waktu bersandar di pulau dalam melepaskan penat/kelelahan saat beraktivitas menangkap ikan di laut, ‘’ujar pak OK akrab di sapa. Pekerjaan pembangunan tersebut memasuki rampung bersamaan menghias sisi jalan dengan membangun pot bunga dan tanaman bunga/pelindung

menambahsuasanaindahbeserta pemasangan lampu penerangan di sudut-sudut tertentu dan ruas jalan ditargetkan sepanjang 254 meter.‘’Jalan setapak ini terus dilanjutkan ke arah goa yang terdapat di Pulau Salahnama mempunyai nilai sejarah yang harus dilestarikan dalam upaya memajukan sektor wisata,’’ ujarnya. Disampingditargetkanmenjadi Mina Wisata, di mana di sisi pulau dibangun jeti apung dan keramba jaring apung untuk budidaya perikanan air laut yang sedang dikembangkan. ‘’Melalui kegiatan masyarakat di motori PemkabBatubarainikegiatanwisata keramba apung nantinya dapat menjadi pilihan wisata baik lokal maupun wisatawan yang datang berkunjung,’’ ujarnya. (a13)

menerima logistik pemilu berupa sampul. Selain itu, KPU Kab. Labuhanbatu berharap kepada KPU Provinsi Sumut agar mensegerakan pengiriman Formulir C6 atau undangan memilih. Pasalnya, hal itu akan dapat melancarkan pelaksanaan Pemilu Legislatif mendatang. “Kalau bisa paling lama kita terima Formulir C6 akhir Februari2014mendatangagarpadaminggukedua bulan Maret sudah kita distribusikan kepada masing-masing PPK untuk disalurkan kepada PPS,” terangnya. Permintaan tersebut, kata Ira Wirtati, juga bahagian dari menjaga hak pemilih dalam menggunakan suaranya. Selain itu, jika pihak KPU Provinsi Sumut dapat merealisasikan itu masingmasing KPU Kabupaten/Kota tidak akan kekurangan waktu dalam pendistribusiannya. “Lebih cepat kan lebih baik,’ ujarnya. (c07)

Inalum Rayakan HUT Dengan 135 Anak Yatim KUALATANJUNG (Waspada): Sejak 1 dan uang saku. Anak yatim yang berasal dari 20 November 2013, PT. Inalum telah menjadi Badan desa dan kelurahan yang tersebar di empat Usaha Milik Negara (BUMN) untuk itu kami kecamatan di Kab. Batubara. mengharapkan hubungan dan kerjasama serta “Kami menyadari bahwa jumlah anak - anak doa restu agar Inalum dapat beroprasi dengan yatimdanbantuaninitidakterlalubesar.Walaupun lancar. demikian kami berharap agar bantuan ini dapat Demikian disampaikan Deputy General memberikan manfaat, meringankan beban Manager IGH Moh. Rozak H dalam acara kehidupan anak - anak kami, juga sebagai upaya penyerahan bantuan sosial kepada anak - anak mengikat tali kasih antara perusahaan dengan yatimdisekitarperusahaan,Selasa(7/1)diGedung masyarakat sekitar,” kata Rozak. (c05) MPH Tanjunggading. “Dengan lancarnya operasi perusahaan tentunya akanmendapatkankeuntungan, sehingga mampu berbuat lebih banyak lagi bagi kepentingan semua pihak dimasa yangakandatang,”kataRozak. Hadir dalam kesempatan itu, Kadis Sosial Pemkab BatubaraIskandar,kepaladesa, tokoh masyarakat dan 135 anak yatim di sekitar perusahaan. Sebelumnya seluruh anak yatim ini dijemput dari rumah masing -masing denganmenggunakanbusPT. Inalum untuk mengunjungi pabrik peleburan di Kuala Tanjung. Selanjutnya, mereka meWaspada/Agusdiansyah Hasibuan nerimataliasihdariPT.Inalum DEPUTY GM IGH PT. Inalum Moh Rozak H menyerahkan berupa tas, voucher belanja tali asih bagi 135 anak yatim disekitar perusahaan.

Terlapor Penipuan Rp1,5 Miliar Mangkir TANJUNGBALAI ( Waspada): Oknum Sekretaris DPD Partai Golkar Kota Tanjungbalai inisial FF yang menjadi terlapor atas dugaan penipuan janji proyek senilai Rp1,5 miliar mangkir dari panggilan petugas Polres Tanjungbalai. “Kami tunggu sampai sore tidak datang juga. Pemberitahuan pun tidak ada,” kata Kapolres Tanjungbalai AKBP ML Hutagaol melalui Kasubbag Humas AKPY Sinulingga didampingi Kasat Reskrim AKP Aris Wibowo dan KBO Iptu Darsono, Kamis (9/1). Darsono mengatakan pemanggilan itu sifatnya memintai klarifikasi dari FF terkait kebenaran laporan Yusni Ali, kontraktor asal Kisaran. Dikatakan, pihaknya akan kembali mengagendakan pemanggilan FF pada Senin pekan depan. JikaFFtidakdatangjugapadapanggilankedua kata Darsono, pihaknya akan langsung menggelar kasus dan membuat kesimpulan sendiri. Di dalam gelar perkara tersebut ungkapnya, akan diambil keputusan apakah kasus itu dinaikkan statusnya menjadi sidik atau tidak. “JikaFFtakpenuhipanggilanpadapenyidikan

nanti, maka bisa dijemput paksa. Sebenarnya kalau dia (FF) mau membersihkan dirinya, ya datang saja,” pungkas Darsono. Sementara Husni Rusli, saksi yang melihat penyerahanuangdariYusniAlikepadaFFmeminta agar terlapor segera ditangkap. Supaya memberikan efek jera bagi FF dan tidak mengulangi perbuatannya. “Sudah banyak korbannya bang, Yusni Ali ini hanya sebagian kecil,” tutur Husni Rusli. Sementara diperoleh informasi bahwa FF sedang berada di luar kota. Tidak diketahui kepentingannya keluar kota, untuk menghindari panggilan polisi atau urusan lain. “Mungkin gak bisadatangbangkarenadiadiMedan,”katasumber yang dapat dipercaya. FF dilaporkan pemborong asal KisaranYusni Ali ke PolresTanjungbalai karena merasa menjadi korban penipuan dengan iming-iming proyek senilai Rp15 miliar. Yusni Ali mengatakan sudah menyetor uang sebesar Rp1,5 miliar Tahun 2012, namun janji tersebut tak kunjung ditepati, dan uang tak dikembalikan, hingga akhirnya dibawa ke ranah hukum. (a32)

Pedagang Kopi Nyambi Jurtul KIM

Waspada/Iwan Has

SALAH satu ruas jalan setapak yang dibangun sebagai sarana penghubung antar pos yang dapat dimanfaatkan pengunjung di Pulau Salahnama baik untuk memancing.

TANJUNGBALAI (Waspada): Seorang pedagang minuman kopi RHL mengaku menjadi juru tulis (jurtul) judi jenis KIM karena hasil jualannya dirasa tidak mencukupi. “Jualan kopi tak cukup buat sehari-hari, ya terpaksalah cari tambahan nulis,” kata Kapolres Tanjungbalai AKBP ML Hutagaol melalui KasubbagHumasAKPYSinulinggamenirukanperkataan tersangka saat interogasi, Kamis (9/1). Priaberusia33tahuninidiringkussaatmenulis pesanan di salahsatu rumah makan di JlVeteran dekat Kantor Sat Pol Air Polres Tanjungbalai. Awalnya,tersangkatidakmengakusebagaipenulis, namun setelah ditunggu beberapa saat, masuk pesan singkat di telepon genggam miliknya berisi

pasanan angka tebakan. “Saat itu tersangka tidak bisa mengelak lagi dan langsung kita boyong ke Mapolres,” ungkap Sinulingga. Dari tangan penduduk Jl Juanda Gg Daulay Kel. Bungatanjung, Kec. Datukbandar Timur petugas mengamankan satu unit telepon genggam merek Cross warna putih. Kemudian dua lembar kertas bertuliskan angka pesananan KIM, serta uang tuniai Rp2.645.000. Sementaraayahduaanakinikepadawartawan mengaku baru sebulan menjalani bisnis haram itu. Omset per hari katanya bervariasi mulai dari Rp300 sampai Rp500 ribu. “Uangnya disetor ke Medan,”ungkapnya. (a32)

Sumatera Utara

WASPADA Jumat 10 Januari 2014


Oknum Guru Perkosa Pembantu Istri Bantu Lakukan Aborsi P. SIDIMPUAN (Waspada): Seorang oknum guru salahsatu SMPN di Panyabungan, Kab. Mandailing Natal (Madina) diduga memperkosa pembantunya LN, 22, hingga hamil. Sedangkan istri sang guru dikabarkan ikut membantu melakukan oborsi (pengguguran kandungan). ‘’Kita mendampingi LN dan melaporkan ASN dan KN ke BupatiMadinadanPolresMadina pada 7 Januari 2014, agar dugaan tindak pidana tersebut diproses sesuai hukum yang berlaku, dan jika terbukti agar ASN dan KN dihukum,’’ sebut Marwan Rangkuti dari Penasehat Hukum Ridwan Rangkuti, SH, MH kepada Waspada di Padangsidimpuan, Rabu (8/1). Dijelaskan, setelah LN hamil, terjadi percobaan aborsi dipaksa oknum guru ini.‘’Diduga keras

ASNtelahmemperkosapembantunya LN warga Desa SBT hingga hamil, dan memaksa LN untuk menggugurkan kandungannya dengan membawa LN ke rumah EI di Desa Gunungtua,’’ ujar Marwan Rangkuti. Sebelumnya, kata Marwan, ASN dan istrinya KN sudah memanggil dua dukun beranak TB dan UB, hingga perut LN mengalami bengkak-bengkak dan terpaksa berobat ke dokter di RSU Panyabungan. Kemudian, ungkap Marwan,

Saut Hasibuan Kasi Pidsus Kejari P. Sidimpuan P. SIDIMPUAN (Waspada): Saut Maruli Hasibuan SH, putra Sipirok, Kab. Tapanuli Selatan, yang sebelumnya bertugas di Kejari Muara Tebo, Prov. Jambi, menduduki jabatan baru sebagai Kasi Pidana Khusus (Pidsus) Kejaksaan Negeri Padangsidimpuan. Saut Hasibuan mengantikan Sapta Putra SH, yang bulan lalu menempati jabatan baru di Kejaksaan Agung (Kejagung). Kepala Pemeriksaan(Kariksa)jugaditempatipejabatbaru,GunawanSipayung SH, dari Kejari Takengon, Kab. Aceh Tengah, Prov. Aceh. “Gunawan menggantikan pejabat lama, H Simanjorang SH, yang kini menempati jabatan baru sebagai Kepala Seksi (Kasi) Intel Kejari Sibolga,” kata Kepala Kejaksaan Negeri Padangsidimpuan, Nadda Lubis SH.MH, didampingi Kasi Pidum, Edward, SH, di ruang kerjanya, Rabu (8/1). Kepada Saut dan Gunawan, Kajari Padangsidimpuan minta segera menyesuaikan diri dengan tugas dan lingkungan kerja baru. Tugas ke depan cukup banyak, posisi Kasi Pidsus dan Kariksa merupakanbagianintidanmemilikitanggungjawabberatdikejaksaan. Selain itu jaksa perempuan yang pertama kali memimpin Kejari Padangsidimpuan ini berharap, seluruh jajaran menjaga kekompakan. Laksanakan tugas yang telah terprogram dan tuntaskan kasus-kasus yang belum terselesaikan. Kasi Pidsus baru, Saut Maruli Hasibuan SH, kepada wartawan mengatakan, jabatan merupakan amanah pimpinan. “Kebetulan daerah ini kampung halaman saya. Tapi saya akan tetap berupaya maksimal menjalankan tugas penegak hukum,” terangnya. (a27)

ASN yang merupakan oknum guruPNSdibantuistrinyaKNyang juga oknum guru PNS di salahsatu SMKN di Panyabungan sudah mencoba beberapa kali menggugurkan kandungan LN, namun tak berhasil. ‘’Tak tahan derita yang dialaminya, LN mendatangi kami. Kami sudah melaporkan ASN dan istrinya KN ke Polres dan BupatiMadina,denganpengaduan dugaan pemerkosaan dan percobaan aborsi,’’ ujar Marwan. Sedangkan korban LN, kata Marwan, menderita kesakitan di bagian perut saat rejadi pe-

maksaan percobaan menggugurkan janin dalam rahimnya. Menurut pengakuan LN kepada kuasa hukumnya ini, dia diperkosa ASN di kamar LN yang juga rumahkediamanASN17Juli2013. Belakangan, istrioknumguru mengetahui tindakan bejat suaminya, yang ternyata mengakibatkan LN hamil. Tentu saja, mendengar ini, sang istri ibarat disambar petir. Kemudian, pada Agustus2013,lanjutdia,KNmembawa LN ke rumah EI di Desa Gunungtua. ‘’Di rumah itu sudah ada dua dukun beranak yang siap mela-

kukan pengguguran kandungan. LN dipaksa dikusuk dan diberi jamu, perutnya diinjak-injak istri pelaku untuk mencoba menggugurkan janin di dalam rahim LN,’’ ujarnya Setelah itu, ungkap Marwan, besoknyamasihdirumahEIyang disebut menyediakan sarana percobaan menggugurkan janin dalam kandungan LN, hingga KN membawa LN ke kamar mandi danmengancamLN.Disinikembali dilakukan upaya pengguguran kandungan secara paksa, tapi tetap tak berhasil. Saat ini, LN hamil enam bulan. (c13)

Sejumlah Fraksi Tekankan Peningkatan Kinerja SKPD SIBUHUAN (Waspada): sejumlah fraksi menekankan peningkatan kualitas kinerja Satuan Kerja Perangkat Daerah (SKPD), termasuk dalam hal penyusunan Rancangan Anggaran Pendapatan dan Belanja Daerah (RAPBD) maupun dalam pelaksanaan kegiatan masing-masing SKPD. Demikian disampaikan sejumlah fraksi DPRD kabupaten Padanglawas dalam pandangan umum fraksi terhadap nota perhitungan keuangan RAPBD Tahun Anggaran (TA) 2014 yang disampaikan Bupati Padang Lawas, H. Ali Sutan Harahap, Rabu (8/1) malam pada rapat paripurna penyampaian nota perhitungan RAPBD TA 2014. Termasuk Fraksi Partai Demokrat, Fraksi Partai Golkar, Fraksi PKPB, Fraksi Partai Persatuan Pembangunan, Fraksi Partai Nasional Bersatu, Fraksi Partai Palas Bersatu lebih menekankan pada kinerja masing-masing

SKPD dalam pelaksanaan APBD, utamanya menyangkut kegiatan pelaksanaan proyek fisik yang terkesan amburadul. Sebagaimana disampaikan sekretaris Fraksi Demokrat, Nur Asiyah Jamil Harahap, H. Amir Husin Hasibuan dari fraksi Golkar, Bakharuddin daulay dari F PKPB, H. M. Yunan hasibuan dari F PPP, H. Fahmi Anwar Nasution dari fraksi Nasiona Bersatu, dan Ali Gusnar Hasibuan dari Fraksi Palas Bersatu, dimana pelaksanaan kegiatan fisik di masing-masing SKPD, seperti Dinas PU dan Pertamben dinilai tidak maksimal, bahkan tidak ada relevansi antara penganggaran dan perencanaan, begitu juga pengawasan dan pengendalian yang terlihat tidak berjalan baik. Apalagi sesuai dengan RAPBD yangdisampaikanbahwa direncanakan belanja daerah Kabupaten PadanglawasTA 2014 mencapaiRp602,2miliar.Dimana belanja tidak langsung Rp300, 8

miliar,yangdidalamnyatermasuk belanja pegawai, belanja hibah, belanja bantuan sosial, belanja tidak terduga. Sedang belanja langsung mencapai Rp301,4 miliar, yang rencananya akan dialokasikan belanja pegawai, belanja barang/jasa, belanja modal serta pengeluaran pembiayaan yang dianggarkan sebesar Rp135,8 miliar. Sebelumnya Bupati Padanglawas, H. Ali Sutan Harahap menyampaikan bahwa RAPBD TA 2014 diperkirakan mencapai Rp602,2 miliar. Sekalipun ditemui masih ada kejanggalan di sanasini terkait pelaksanaan proyek pembangunan infrastruktur. Selain menyangkut kualitas dalam pelaksanaan proyek fisik dan program kegiatan non fisik akan terus diupayakan untuk peningkatan, sehingga memberi manfaat bagi meningkatkan kesejahteraan masyarakat masyarakat. (a33)

PT Andema Tak Bayar Pesangon Pekerja Ancam Mogok Massal Di PLTU PANGKALANSUSU (Waspada): Upaya mediasi yang sudah empat kali dilakukan Disnakertrans Kab. Langkat untuk menyelesaikan masalahan buruh di PT Andema, yakni salahsatu kontaktor penyedia jasa tenaga kerja di PLTU 2x200 MW Tanjungpasir, Kec. Pangkalansusu, Kamis (9/ 1),kembalimenemuijalanbuntu. Perwakilan manajemen PT Andema, Muhktar, dalam pertemuan yang dihadiri buruh korban PHK, Kadis Nakertrans Kab. Langkat, konsersium PT Bagus Karya,GuandongPowerEngineering Corp (GPEC) dan PT PLN menegaskan, perusahaan tidak akan memberikan pesangon terhadap pekerja yang di-PHK. Ia menyatakan, PT Andema tidak ada melakukan pemecatan, tapi perusahaan dari user atau

sub kontarktor yang meminta sebagain karyawan tidak dipekerjakan lagi berhubung pekerjaan sudah selesai. “Sebenarnya tidak ada PHK, tapi volume kerja sudah selesai,” ujarnya. Menanggapi hal ini, Kadis Nakertrans Kab. Langkat, Syaiful Abdi, berharap adanya win win solution. “Harus ada jalan keluar yang menguntungan semua pihakdanjangansampaimasalah iniberlanjutkePengadilanHubungan Industrial (PHI). Pemufakatan adalah solusi yang terbaik untuk menyelesaikan masalah,” ujanya. Kuasa para pekerja, Eldin Rusuli menyatakan, dalam UU No: 13 Tahun 2003 Pasal 156 sangat jelas diatur masalah pesangon,tapiPTAndematampaknya tidak mematuhi amanat UU. “Ini

persoalan kemanusiaan, sebab menyangkut hajat hidup orang banyak,” pungkasnya. Dia menambahkan, manajemen PT Andema telah memakan hak pekerja khususnya dalam pemotongan gaji 2% untuk Jamsostek. “Kami punya bukti pekerjaatasnama,AhmadSayuti, dipotong gajinya untuk iuran Jamsostek, tapi setelah dicek, ternyata PT Jamsostek tidak ada menerima setoran,” tandasnya. Rusli mengultimatum, jika persolan ini tidak diselesaikan, maka pihaknya akan melakukan upaya hukum. Selain itu, lanjutnya, apabila pihak manajemen tetap juga mengabaikan hak-hak pekerja, maka dalam waktu dekat ini para buruh akan melakukan aksi mogok massal. PerwakilankonseriumGPEC,

Tong Ping Hua, selaku pemberi kerja kepada PT Andema tidak dapat memberikan penjelasan, sebab ia tak mengusai Bahasa Indonesia.Sementara,perwakilan PT Bagus Karya, A.Butar-butar mengatakan, pihaknya telah menyampaikan aturan perundanganyangberlakudiIndonesia kepadaGPECuntukmenjadicontohdiperusahanyangadadiPLTU. Kasi Hubungan Induterial Disnakertrans Langkat, Pardi, menutarakan, dalam kontrak, PT Andema tidak ada mencantumkan masalah pesangon. Perusahaan ini, lanjutnya, juga tidak mencatatkan masalah kontrak kerja ke Disnakertrans. Namun begitu, ia berharap ada solusi sehingga tidak ada pihak yang dirugikan. Kemudian, katanya, dalam

kontrak kerja yang menggunaha bahasa China harus diterjemahkan ke dalam Bahasa Indonesia. “Kontrak kerja dalam bahasa asing wajib diterjemahkan ke Bahasan Indonesia, sebab ini perintahUU,”pungkasnyaseraya menekankan GPEC harus memahami UU RI. Karena menemui jalan buntu, Kadis Nakertrans, Sayaful Abdi, memberi waktu 10 hari, jika tidak juga ada solusi, maka pihaknyaakanmembuatanjuran ke PHI. Ia juga meminta kepada pihak PT PLN agar melakukan pengawasanterhadapkontraktor. Deputi Manajer Hukum PT PLN Unit Induk Sumut, Nilawaty, SHmenyatakan,PLNmempunyai ikatan kontrak dengan GPEC, namundalammasalahtenagakerja bukantanggungjawabPLN.(a02)

PN P. Sidimpuan Tangani 930 Kasus Pidana P.SIDIMPUAN (Waspada): Sejak Januari hingga Desember 2013, Pengadilan Negeri Padangsidimpuan menangani 930 perkara tindak pidana. Sebanyak 737 kasus di antaranya berhasil diselesaikan atau divonis, dan sisanya akan diselesaikan di 2014. PN Padangsidimpuan merupakan lembaga penegak hukum yang wilayah kerjanya paling luas se Prov. Sumatera Utara. Membawahi Kota Padangsidimpuan, Kab. Tapanuli Selatan, Padanglawas Utara, dan Padanglawas. “Tahun ini, paling banyak tindak pidana pencurian, 179 kasus. Disusul narkotika, 157, dan perjudian 152 kasus,” kata Ketua PN Padangsidimpuan, Morgan Simanjuntak SH.MH, melalui Panitera Muda Pidana, Bahari Siregar SH, Kamis (9/1). Dibanding 2012, pada tahun 2013 kemarin terjadi peningkatan cukup signifikan pada kasus

TindakPidanaPerlindunganAnak ( TP2A). Seperti pelecehan seksual, kekerasan dalam rumah tangga (KDRT), dan perkelahian antar anak. “TP2A sebanyak 53 perkara, dengan rincian 7 kasus sisa tahun 2012 dan 46 lagi terjadi di 2013. Paling mencengangkan, 46 kasus itu terjadi di Kota Padangsidimpuan dan seluruh terdakwanya adalah pria,” ujarnya. Dilihat dari segi golongan usia, jumlah anak-anak (usia di bawah 18 tahun) yang menjadi pelaku tindak kriminal sebanyak 43 orang. Paling banyak kasus pencurian dengan 27 terdakwa. Disusul perkelahian mengakibatkan kematian/luka sebanyak lima orang. Jika dilihat dari jenis kelamin terdakwa dewasa, tahun 2013 PN Padangsidimpuan menangani 800 orang pria pelaku kejahatan dan57orangperempuan.Dimana

Satpam Di P. Siantar Peringati HUT Ke-33 PEMATANGSIANTAR (Waspada): Satuan Pengamanan (Satpam) dari berbagai perusahaan dan instansi di Kota Pematangsiantar memperingati hari ulang tahun (HUT) ke-33 secara sederhana di lapangan upacara Mapolres, Rabu (8/1) dipimpinWali Kota Hulman Sitorus, SE selaku inspektur upacara. Wali Kota selaku inspektur upacara juga membacakan amanat Kapolri Jenderal Polisi Sutarman dan menyerahkan piagam penghargaan kepada Satpam yang berhasil keluar sebagai juara dalam berbagai perlombaan yang dilakukan berupa lomba peraturan baris berbaris (PBB) dalam menyambut HUT Satpam. Kasubbag Humas Polres Pematangsiantar AKP Nuriaman Ray Rangkuti menyebutkan piagam penghargaan diberikan kepada juara I Satpam PT STTC, juara II Satpam PDAM Tirtauli dan juara III Satpam Water Park Siantarmas Residence. Rangkuti menambahkan, dalam menyambut HUT Satpam itu, paraSatpamjugaberpartisipasimenjagakebersihandiPematangsiantar dengan melakukan bakti sosial berupa gotongroyong membersihkan sampah di sekitar pusat kota. Hadir dalam peringatan antaralain Kapolres AKBP Slamet Loesiono, SIK, Waka Polres Kompol Daulat Aruan, para pejabat dan personil Polres, para pejabat Pemko di antaranya Kabag Humas dan Protokoler Drs. Daniel H Siregar, para pimpinan perusahaan dan instansi lainnya. (a30)

dua dari 57 perempuan itu adalah pelaku ilegal loging atau tindak pidana kehutanan. Dilihat dari jumlah perkara setiap bulannya, PN Padangsidimpuan paling banyak menanganiperkarapadaJuli2013,yakni 377 kasus. Disusul bulan Juni dengan 375 kasus, Agustus (327), September (285), dan paling sedikit bulan November (180). Darisemuaperkaraditangani

PNPadangsidimpuantahun2013, terdapat beberapa kasus langka dibanding tahun sebelumnya. Yakni, 8 kejahatan terhadap asal usul perkawinan, 17 kejahatan terhadap penguasa umum, 2 pemalsuansurat,dan40kejahatan terhadapkemerdekaanoranglain. “Selama2013,kitatangani930 perkara umum dan 726 sudah selesai di tingkat Pengadilan Negeri. Namun dari 726 itu, 48

diantaranyamengajukanbanding dan 5 kasasi. Sedangkan Pra Peradilan, tahun lalu kita tangani 2 perkara,” jelas Bahari Siregar. Khusus untuk perkara tindak pidanalalulintas,PNPadangsidimpuan menangani 16.176 kasus. Semuanya telah diselesaikan dan berkekuatan hukum tetap. Perkara lalulintas ini berasal dari Polres Tapsel dan Polres Padangsidimpuan. (a27)

Polres Tapsel Siap Dikritik P. SIDIMPUAN (Waspada) : KapolresTapanuliSelatan(Tapsel) AKBP Abdul Rizal A Engahu SIK MSi menuturkan, pihaknya siap dikritik serta bekerjasama dengan Persatuan Wartawan Indonesia (PWI) PWI Tapanuli Bagian Selatan (Tabagsel). “Polres Tapsel siap dikritik dan sebaliknya PWI juga harus bisa memberikan informasi dan masukan-masukan yang konstruktif dan membangun, “ kata KapolresTapsel AKBP. Abdul Rizal A Engahu SIK MSi saat menerima audiensi pengurus dan anggota PWI Tabagsel di aula PPKO Mapolres Tapsel, Jalan SM Raja Kota Padangsidimpuan, Rabu (8/1). Di kesempatan itu, Kapolres

didampingiWaka Polres Kompol Soni Marisi NugrohoT, SIk, Kabag Sumda Kompol Drs Tongku Bosar Pane, Kabag Ops. Kompol MSimajuntak,KabagRenKompol H Sarluman Siregar SH, Kabag Humas Kompol A Pakpahan, Kasat Intelkam AKP Romulus Sihotang, Kasat Binmas AKP H. Sutan Abidin Siregar,SH. Sementara Pengurus dan anggota PWI Tabagsel masing masing, Ketua Hairul Iman Hasibuan SHi, Penasehat PWI Ismail Muda Pohan,Wakil Ketua Kodir Pohan, Sekretaris Mohot Lubis, WakilSekretarisIkhwanNasution, Bendahara Akhmad Cerem MehaST, WakilBendaharaRiswandy dan Bendahara Koperasi PWI

Laidin Pohan. “Peran media sangat kami harapkan sehingga wilayah kita lebih kondusif. Wartawan juga janganhanyamenyajikanpemberitaan kriminalitas saja, tetap banyak hal positif yang telah dilakukan jajaran PolresTapsel dan kiranya dapat diberitakan wartawan khususnya yang tergabung dalam PWITabagsel,“ ujar Kapolres. Sementara Ketua PWITabagsel, Hairul Iman Hasibuan mengatakan, silaturahmi ini untuk memperkenalkanpengurusyang baru terbentuk. Diharapkan melalui audiensi ini terbangun hubunganyanglebihbaiklagiantara kepolisiandaninsanpersdimasamasa yang akan datang. (c13)


KAPOLRES Tapsel, AKBP Abdul Rizal A Engahu SIK Msi (7 dari kanan) bersama jajaran Polres Tapsel dan pengurus PWI Tabagsel diabadikan usai silaturahmi di Mapolres.

Waspada/Sukri Falah Harahap

BUNDA PAUD Tapsel, Ny. Syaufia Syahrul, memperhatikan karya anak usia dini yang menjadi peserta lomba mewarnai tingkat PAUD se Tapsel.

Lomba Mewarnai Tingkatkan Kreativitas Anak Usia Dini P. SIDIMPUAN (Waspada): Dalam rangka mengembangkankemampuananakusiadibawah lima tahun, Dinas Pendidikan dan Kebudayaan Pemkab Tapanuli Selatan menggelar lomba mewarnaidanberceritaantarlembagaPendidikan Anak Usia Dini (PAUD). Kegiatan pengembangan pendidikan anak usia dini itu diselenggarakan di aula kantor Camat AngkolaTimur, Selasa (7/1). Dibuka Bunda PAUD Tapsel, Ny. Syaufialina Syahrul M Pasaribu, dan dihadiri Kadis Dikbud, Mohd. Ikhsan Lubis. Kepada wartawan, Bunda PAUD Tapsel mengatakan, lomba mewarnai dan bercerita anak PAUD ini diyakini mampu mengasah bakat, minat, dan kreativitas anak. Kemudian dapat mengasah serta mengembangkan otak kiri anakanak. “Kegiatan lomba ini sejalan dengan program Pemkab Tapsel dalam meningkatkan sumber daya manusia (SDM) masyarakat. Sehingga terwujudlahTapanuli Selatan yang lebih baik lagi kedepan,” kata Ny. Syaufialina Syahrul. Bunda PAUD juga berharap agar anak-anak Tapanuli Selatan ke depan lebih cerdas. Punya rasa percaya diri dan berdisiplin tinggi. Karena merekalah generasi harapan yang akan membangundaerahinidikemudianhari.Kegiatan berthema‘Aku Bangga Jadi AnakTapanuli Selatan’ ini turut dihadiri pengurus Tim Penggerak PKK Tapsel, Ny. Aswan Hasibuan, Ny. Mulia Nasution,

Ketua TP PKK Angkola Timur, Ny. Darwin Dalimunhe, para Penilik Disdik Tapsel, pimpinan lembagaPendidikanLuarSekolah(PLS),danKetua IGTKI, Azam Marpaung. Lomba diikuti 150 guru dan peserta didik dari 50 PAUD di 14 kecamatan se Tapsel. Dimana masing-masing PAUD mengutus satu orang guru dan dua anak didik. Lomba ini dilangsungkan seharianpenuh.Adapunjuarauntukkategorilomba mewarnai antara lain, Keysa dari PAUD Al Hijrah Kec.BatangAngkola(I),SalsabiladariPAUDSalsabila Kec. Angkola Barat (II), dan Nayla Putri Aritha dari PAUD Bina Insani Kec. Angkola Barat (III). Sedangkan juara lomba bercerita antara lain, Mara Ikhlas Mubarok dari PAUD Karya Pardomuan Kec. Marancar (I), Reva Nadila Siregar dari PAUD PMP Parsalakan Kec. Angkola Barat (II), dan Widia Nusyfitri dari PAUD ABA Kec. Batang Toru (III). Kepada yang juara diberikan hadiah berupa trophy,sertifikat,danuangpembinaan.Diserahkan Ketua Forum PAUDTapsel, Ny. Syaufialina Syahrul M Pasaribu SHMSP, dan Kadis Dikbud Tapsel, Drs. Mohd. Ikhsan Lubis MM. Usai penyerahan hadiah, Amirul Hakim Hutasuhut, ayah dari salah seorang peserta lomba mengatakan, kegiatan ini memiliki makna yang sangatbesarbagianakusiadini.Diaberterimakasih kepada Dinas Pendidikan dan Bunda PAUDTapsel yang telah menggagas serta menggelar kegiatan ini. (a27)

Kwarcab Pramuka Padanglawas Adakan Muscab SIBUHUAN (Waspada): Kwartir Cabang (Kwarcab) Pramuka Padanglawas, Rabu (8/1), menggelar Musyawarah Cabang (Muscab) tahun 2013, yang berlangsung di aula Hotel Barumun. Muscab berjalan tertib dan dihadiri 11 kwartir ranting se Kabupaten Padanglawas. Bupati Padanglawas dalam kesempatan itu mengatakan,bahwaMuscabitumerupakansuatu wujud untuk mengevaluasi hasil-hasil yang telah dilaksanakan selama ini dan merumuskan program yang akan dilaksanakan lima tahun ke depan. Dikatakan,kegiatankepramukaanmerupakan suatu proses pendidikan dalam bentuk kegiatan yang menyenangkan bagi generasi muda, dilaksanakan di alam terbuka, di luar lingkungan pendidikankeluargadenganmenggunakanprinsip dasar metode kepramukaan.

Kegiatan kepramukaan ini juga bertujuan untuk mendidik anak-anak generasi muda dalam upaya membentuk kepribadian dan budi pekerti yang positif, yang pelaksanaannya disesuaikan dengan keadaan, sesuai kepentingan dan perkembangan bangsa dalam upaya pembentukan watak dan karakter generasi muda. Maka dalam mengtaasi hal itu, di antaranya dapatdilakukandenganmelibatkangenerasimuda melalui wadah gerakan pramuka. Karena di dalam perjalannya,gerakanpramukalabihmengedepankan pada suasana kejiwaan, tidak ada namanya gelar-gelar pangkat dan sebagainya, yang ada hanyasuasanakekeluargaandantolongmenolong. Setelah melalui proses Muscab, di puncak acara akhirnyaH.AliSutanharahap(TSO)terpilihsebagai Ketua umum kwartir cabang Pramuka Kabupaten Padanglawas periode 2013-2018. (a33)

Anggota DPRDSU H. Maratua Siregar Meninggal Dunia Di RSUD Pandan TAPTENG (Waspada): Anggota DPRDSU H. Maratua Siregar yang juga anggota Komisi B dari F.PAN, Kamis (9/1) sekira pukul 12:30 mengembuskan nafas terakhir di ruang Unit Gawat Darurat Rumah Sakit Umum Daerah Pandan. Kabar meninggalnya H. Maratua Siregar juga Ketua DPD PAN Tapteng dan mantan Ketua DPRDTapteng periode 2004-2009 ini merasa banyak tidak percaya. Pasalnya, sehari sebelum meninggal, almarhum masih tampak sehat dan bertemu dengan banyak orang di Kota Sibolga maupun di Tapteng. Waspada/Ist Setelah ada kepastian dari JENAZAH almarhum H.Maratua Siregar anggota DPRDSU pihak RSUD Pandan menya- saat disemayamkan di rumah duka Jalan Padangsidimpuan takan H. Maratua Siregar tidak Kel. Hajoran Kec. Pandan, Kamis (9/1). dapat tertolong lagi, maka pihak keluarga membawanya ke rumah duka pihaknya berusaha memberikan pertolongan di Jalan Padangsidimpuam Kel. Hajoran memakai mobil pribadinya untuk dilarikan ke Kecamatan Pandan, untuk disemayamkan. RSUD Pandan. Kuat dugaan, selama dalam Informasi Waspada peroleh, akan dikebumikan perjalan, dia sudah tidak bernyawa lagi, sehingga hari ini Jumat (10/1) di pekuburan umum Kel. segala upaya dilakukan agar dapat pulih tidak berarti lagi. H.Maratua Siregar dengan tenang Hajoran. Sekretaris DPD PAN Tapteng, Hariman menghembuksan nafas terakhir menghadap Sang Tanjung kepada wartawan, Kamis (9/1) Ilahi, terang Hariman Tanjung. Karir politik almarhun sebelum menjadi angmenjelaskan, sebelum meninggal dunia, H. Maratua Siregar tampak ceria ketika berbincang- gota DPRD Provinsi Sumatera Utara diawali dari bincang dengan kader serta caleg PAN di Kantor dasar mulai jabatan kepala desa Hajoran pada DPD PAN Tapteng Kel. Kalangan Kec. Pandan. 1984-1999, kemudian 1999-2004 menjadi wakil Tidak ada tanda-tanda keluhan kesakitan bahkan ketua DPRDTapteng, kemudian 2004-2009 terpilih sering tertawa lepas di hadapan kader PAN yang menjadi Ketua DPRD Tapteng dan 2009 -2014 sebagai anggota DPRD SU kemudian karir poliada di kantor tersebut. “Tidak ada tanda-tanda yang mengarah tiknyamenjadiKetuaDPDPANTapteng2010-2015. H.Maratua Siregar, lahir di Hajoran 18 Februari keluhan, bahkan kami masih bercanda sambil ketawa-ketawariang.HanyasajausaiituH.Maratua 1958 dengan mempersunting Hj. Yuwar Lisma mengeluhkan perutnya terasa kembung. Simanjuntak serta dikaruniai enam anak dua “Kembung perutku, mungkin aku masuk angin,” putra 4 putri. Putra H.Maratua Siregar , Marzuki Siregar dan Martanto Siregar sedangkan putri kata almarhum ditirukan Hariman. Tidak berselang setelah merasakan kembung, , Sartika Br Regar, Marini Ulfa Regar,Yusra Manda tiba-tiba mereka melihat sudah rebah di meja Sari Siregar dan Selli Marcelina Siregar . Terlihat di rumah duka banyak kalangan yang dan timbul suara ngorok dan pihaknya berusaha membangunkan, namun tidak bangun bahkan datang mulai dari pejabat, tokoh masyarakat, ketua partai dan masyarakat lainnya tanda ikut lemas. Melihat kondisi yang sudah gawat itu, berduka cita. (a24)

Sumatera Utara


WASPADA Jumat 10 Januari 2014

Sambutan Bupati Simalungun DR.JR. Saragih, SH, MM Pada HUT Ke-67 Surat Kabar Harian Waspada KAMI merasa gembira dan berbangga dengan suratkabar Harian Waspada yang telah memasuki usia ke-67, diharapkan semakin eksis memberikan kontribusi informasi yang aktual dalam perjalanan pembangunan di bidang pemerintahan dan kemasyarakatan di Kab. Simalungun khususnya dan Sumatera Utara umumnya. Kab. Simalungun sebagai salahsatu kabupaten yang selalu berinovasi dalam menjaga perubahan ke arah terbaik untuk kemakmuran masyarakat khususnya di Kab. Simalungun, sangat terbantu dengan kehadiran suratkabar Harian Waspada. Atas nama pemerintah dan masyarakat Kab. Simalungun, saya menyampaikan apreasiasi yang tinggi kepada Suratkabar Harian Waspada sebagai sarana pencerdasan kepada masyarakat dalam menyampaikan informasi pembangunan, sekaligus sebagai sosial kontrol kepada Pemerintah Kabupaten Simalungun. Kepada penerus Harian Waspada, saya harapkan agar tetap semangat, motivasi dan dedikasi yang tinggi serta tetap komit menjaga eksistensi dan garis perjuangan Waspada di masa-masa yang akan datang. Dirgahayu Harian Waspada…………. Waspada tetap Jaya…………. Bupati Simalungun DR. JR. Saragih, SH, MM

Ketua Yayasan: Hisarma Saragih Rektor USI Waspada/Dede Basri Hasibuan

AKIBAT tebalnya debu vulkanik yang ke luar dari kepudan Gunungapi Sinabung berada di Kec. Namanteran Kab. Karo Sumut. Membuat satu unit rumah yang telah dikosongkan warga karena mengungsi roboh di Desa Sibintun Kec. Simpang Empat seperti terkam kamera Selasa (7/1).

Gas LPG ‘Tabung Melon’ Laris Manis Di Simalungun SIMALUNGUN (Waspada): Gas LPG ‘tabung melon’ isi 3 kg di sejumlah daerah di Kab. Simalungun, tiga hari terakhir ini terjual secara laris manis, setelah gas elpiji tabung isi 12 kg yang harganya melonjak secara tidak merata di daerah itu.

Harga Gas LPG 12 Kg Di Sidikalang Mulai Turun SIDIKALANG(Waspada): Harga gas elpiji nonsubsidi 12 kilogram yang sempat naik 60 persen per 1 Januari 2014, yang kemudian harga diturunkan dan ditetapkan oleh pemerintah kenaikan harga Rp1.000 per kilogram menyebabkan sejumlah penyalur gas merugi. Salah satunya adalah Hong Huat pemilik UD Logam di Sidikalang, Kab. Dairi yang menyebutkan,Rp27 juta uangnya untuk pembayaran gas Elpiji 12 kg harus tertahan ke pihak PT Sebagai Agen. Pimpinan UD Logam itu mengatakan kepada Waspada, Kamis (9/1), sebelum revisi kenaikan harga penjualan gas non subsidi 12 Kg yang sempat naik mencapai harga Rp142 ribu, sebelumnya Rp92.000, namun saat ini sudah turun menjadi Rp105 ribu per tabung. Hong Huat mengatakan, pihaknya mengorder gas LPG 12 kg dari salahsatu PT. yaitu PT.Indah Sentosa di Medan dan di Sidikalang dijual Rp110 ribu kepada konsumen sudah termasuk biaya antar. “Kalau kami yang mengantar langsung kepada konsumen harganya Rp110 ribu, jika pengecer yang mengambil dari kami harganya Rp105 ribu,” ungkap Hong. Sementara, Kadis Koperasi, Perindustrian dan Perdagangan Dairi melalui Kasi Pengawasan dan peredaran barang Pentus Simanjuntak dikonfirmasi Waspada di ruang kerjanya menyebutkan, setelah dicek di pasaran, harga gas elpiji 12 kg masih di batas harga normal sesuai harga yang ditentukan Pertamina. Dikatakannya, berdasarkan harga yang ditetapkan di Medan saja sudah Rp90.700 per tabung dengan radius 60 km ditambah biaya angkut dari Medan-Sidikalang dan ditambah kenaikan yang ditetapkan pemerintah Rp1.000 per tabung, maka harga elpiji di pasaran di Kota Sidikalang sudah sesuai karena sudah termasuk biaya angkut, katanya. (ckm)

“Lumayanlah, pembeli gas elpiji 3 kg setiap harinya cukup banyak di daerah ini, “ kata salahseorang pengecer gas elpiji di Kec. Tiga Dolok, Simalungun, Amir Sinaga, 45, kepada Waspada di kedainya, Kamis (9/1). Menurutnya, selama ini pelanggannya lebih suka menggunakangaselpiji12kgkarenatahan

lama untuk dipakai.Namun karena harga jual gas elpiji tabung besar itu dirasakan terlalu mahal, yaitu kisarannya antara Rp127 ribu sampai Rp135 ribu per tabung, masyarakat akhirnya kembali memakai gas elpiji tabung isi 3 kg yang harga jualnya di daerahitu antaraRp20ribusampai Rp25 ribu per tabung.

Pengecer gas elpiji di Simalungun mengaku, harga jual gas elpiji tabung melon yang sebelumnya seharga Rp17 ribu sampai Rp19 ribu per tabung itu, beberapahariiniterpaksadinaikkan, karena pengecer adakalanya harus membelinya secara langsung kepada agen di Kota Pematangsiantar dengan menggunakan kendaraan sendiri. (c16)

Gorong-gorong Pecah Di Jalan Laras - Bahgunung SIMALUNGUN (Waspada): Gorong-gorong (bubusan) yang terdapat di ruas jalan menghubungkan nagori (desa) Laras Bahgunung,Kec.BandarHuluan, Kab. Simalungun rusak atau pecah hingga menimbulkan lubang besar. Kondisi itu membuat arus transportasi angkutan menjadi terganggu. Pengamatan Waspada, Rabu (8/1), gorong-gorong yang pecah itu persis berdekatan dengan Pos Polisi Laras. Untuk menghindari bahaya, masyarakat menancapkan pelepah daun kelapa sawit, sebagaitandaagarparapengguna jalan dapat menghindari lubang di tengah badan dimaksud. Sesuai keterangan masyarakat setempat, pecahnya goronggorong itu sudah berlangsung sejak Desember 2013 lalu, seiring dengan meningkatnya volume kendaraan berbadan besar yang melintas dari jalan itu, menyusul amblasnya jembatan plat beton di jalur alternatif di Simpang

Serapuh, Kec. Gunung Malela. “Sudahhampirsatubulankeadaan gorong-gorong yang pecahinidibiarkan,sehinggakerusakannya semakin hari semakin meluas,”ujarPurba,wargasetempat. Warga mengaku sangat kecewa lambannya perbaikan dilakukan oleh pemerintah. Padahal ruas jalan itu sangat vital dan

kaki, 52 net volly dan 4 unit hand tractor. Jadi keseluruhan sekolah yang akan menerima CSR 26 sekolah dengan total anggaran sekira Rp347.837.816. Hal ini diungkapkan Asisten Ekbang dan Kesos Setkab Samosir Drs Kampu Manik, MM kepada Waspada, Kamis (9/1). Hal yang sama juga diutarakan Pemimpin Cabang Bank Sumut Jansen Manurung kepada Waspada. Dikatakan, program CSR Bank Sumut kali ini dilakukan untuk yang pertama

PT ALN Bangun PKS Di Madina MEDAN (Waspada): PT Agro Lintas Nusantara (ALN) pada tahun ini menargetkan membangun satu pabrik kelapa sawit (PKS) di Kec. Muara Batang Gadis, Kab. Mandailing Natal (Madina). Pembangungan PKS sebagai tindak lanjut penanaman perdana sawit plasma di empat desa, masing-masing Desa Tabuyung, Manuncang, Suka Makmur dan Desa Singkuang II, Muara Batang Gadis Desember 2013. “Target kita di tahun 2014 menanam 2.000 hektare sawit, setelah itu berlanjut sampai selesai tanam seluruhnya seluas 7.620 hektare dalam tiga tahun. Kemudian juga membangun satu unit PKS,” kata Estate Manajer PT ALN Kebun Mandailing Natal Halwan di Medan, Kamis (9/1). Dalam tanam perdana itu, kata Halwan, PT ALN bekerjasama dengan tiga koperasi produsen dan satu Koperasi Unit Desa (KUD). Mereka memiliki izin seluas 7.620 Ha dengan rincian 5.385 Ha inti dan 1.972 Ha plasma di empat desa. Empat koperasi itu, Koperasi Produsen Rizky Tabuyung Mandiri, Koperasi Produsen Al Syukri, Koperasi Produsen Rezeki Bersama dan KUD Pelita Andesma. “Seluas 1.972 hektar plasma sawit tersebut akan diberikan kepada 986 kepala keluarga, masing-masing KK mendapat 2 hektar. Kemudian per desa diberikan 5 hektare untuk kas desa,” sebutnya. Dengan penanaman perdana itu, Halwan berharap memberi berkah bagi warga empat desa dengan meningkatnya kesejahteraan masyarakat. Sementara bagi masyarakat empat desa, tanam perdana itumenjadiharapanbarugunapeningkatankesejahteraanmasyarakat. “Kami berterima kasih kepada PT ALN, dan berharap kerjasama ini terus berlanjut,” kata tokoh masyarakat Perak Nas Amir mewakili masyarakat. Dia dan tokoh masyarakat lainnya mengatakan, masuknya investor agribisnis perkebunan kelapa sawit seperti PT ALN sangat diharapkan. (m27)

sehari-hari dilalui ratusan kendaraan angkutan berat. Sedangkan Camat dan Pangulu, meski sudah mengetahuinya, tidak segera melakukan tindakan. “ Kita khawatir, jika kondisiinidibiarkanterus,goronggorong rusak itu akan mengambil korban, terutama saat malam hari,” tambah Purba. (a29)

Waspada/Hasuna Damanik

Gorong-gorong menghubungkan Laras - Bahgunung yang rusak diberi tanda daun kelapa sawit agar pengguna jalan tidak masuk lubang.

di Samosir, dimana program ini merupakan deviden/laba tahun buku 2012. Program CSR Bank Sumut Pangururan yang akan diadakan Januari ini juga sudah meminta izin Prinsip dari Pimpinan Bank Sumut di Medan dimana diharapkan segala bantuan CSR BankSumut ini bermanfaat dan barang-barang yang digunakan benar- benar berkualitas. Bank Sumut dalam pelaksanaan ini hanya melihat prosedur pelaksanaan apakah sudah sesuai SOP sedangkan untuk eksekusinya dilakukan Pemkab Samosir. (c11)

Semoga Harian WASPADA tetap menjadi Media Rakyat guna kebenaran dan keadilan. Dari :

Majlis Ulama Indonesia (MUI) Kota Binjai DR. HM Jamil, MA Ketua Umum

Jafar Sidiq, SAg Sekertaris Umum

Komite Olahraga Nasional Indonesia (KONI) Kota Binjai H. Juli Sawitma Nst, SH, MH Ketua Umum

Panco Harimona Sekertaris Umum

Lembaga Pengembangan Tilawatil Quran (LPTQ) Kota Binjai Drs. H. Amir Hamzah, MAP Ketua

Drs. Marthal Sekretaris

Kwartir Cabang Pramuka Kota Binjai Timbas Tarigan, SE Ketua

Yayasan USI sejak diberhentikan. Damanik menjelaskan Prof Dr. Amrin Saragih, MA, sebelumnya salah satu pelamar bakal calon rektor USI saat akan dilaksanakan pemilihan rektor tahun 2012 dan ternyata Amrin Saragih tidak dapat memenuhi persyaratan sesuai Statuta USI 2012, Pasal 54 butir h yang berbunyi: bakal calon rektor USI yang bukan dosen tetap, harus mendapat persetujuan dan ijin bebas tugas tertulis dari pimpinan perguruan tinggi asalnya. Kemudian, imbuh Damanik, dalam Surat Edaran Dirjen Dikti Kemendikbud RI nomor 2705/D/T/1998 tanggal 2 September 1998 juga menyatakan persyaratan pimpinan perguruan tinggi swasta (PTS) harus memenuhi persyaratan terdiri pertimbangan Senat PTS, persetujuan dari atasan instansi yang bersangkutan bagi calon yang tidak berstatus dosen tetap PTS itu, berdomisili di kotaPTSyangakandipimpindansanggupbertugas penuhwaktusebagaipimpinandantidakmerangkap sebagai pengurus Badan Penyelenggara (BP) PTS yang bersangkutan.“Ternyata, Amrin Saragih tidak dapat memenuhi persyaratan itu.” Selain itu, sebut Damanik, surat Kopertis Wilayah I Aceh-Sumut nomor 097/K.1.2.1/PS/ 2013 tanggal 13 Maret 2013 perihal prosedur pengangkatan pimpinan PTS, antara lain diisyaratkan statusdosentetapdanaktif sertabagidosendengan status PNS di tempat lain, tidak dapat diangkat menjadi pimpinan PTS. “Berdasarkan surat Kopertis itu, Amrin Saragih juga tidak memenuhi syarat sebagai rektor USI.” (a30)

Karya Bakti TNI Di Simalungun

Dunia Pendidikan Di Samosir Akan Nikmati CSR Dari Bank Sumut SAMOSIR (Waspada) : Masyarakat Samosir akan menikmati program orporate social responsibility (CSR) yang diberikan Bank Sumut Cabang Pangurururan kepada dunia pendidikan di Samosir. Melalui Program CSR, Bank Sumut akan memberikan bantuan berupa infokus untuk 14 SMA dan SMK, laptop 9 unit unuk SMP dan SMA yang sudah mengikuti pelatihan gasing Matematika, paket alat-alat olahraga 1 paket di antaranya 52 buah bolavolly 52 buah bola

PEMATANGSIANTAR (Waspada): Ketua PengurusYayasan Universitas Simalungun (USI) menegaskan Drs. Hisarma Saragih, M.Hum merupakan Rektor USI periode 2012-2016 dan menyatakan tidak ada pelantikan Rektor USI 11 Januari 2014. “Pada 21 Desember 2012, Masdin Saragih danHerawatyGirsangsebagaiketuadansekretaris YayasanUSItelahdiberhentikanPembinaYayasan USI dengan Surat Keputusan nomor: 91/I-YUSI/2012,” tegas Ketua Pengurus Yayasan USI SB. Damanik, SH di Biro Rektor USI, Jalan Sisingamangaraja, Kota Pematangsiantar, Sabtu (4/1) sehubungan Masdin Saragih dan Herawaty Girsang masih mengaku sebagai ketua dan sekretarisYayasan USI dan dikabarkan akan dilakukan pelantikan rektor USI pada 11 Januari 2014. Selain itu, tegas Damanik, Masdin Saragih telah diberhentikan sebagai dosen tetapYayasan USI pada 12 Agustus 2013 dengan SK nomor: 1116/I-Y-USI/2013. “Akibat pemberhentian itu, Masdin Saragih telah mengajukan gugatan dalam bentuk permohonan ke Pengadilan Negeri Pematangsiantar dengan nomor perkara 1599/ Perdata/P/2012/PN.PMS dengan putusan antara lain dalam provisi menolak tuntutan provisi dari pemohon dalam pokok perkara dan menyatakan permohonan pemohon-pemohon tidak dapat diterima dan saat ini perkara itu masih dalam pemeriksaan kasasi di Mahkamah Agung.” Karena itu, tegas Damanik, segala tindakan Masdin Saragih Cs, tidak ada kaitannya dengan

Drs. T. Syarifuddin, MPd Sekretaris

Direktur RSUD dr. Djoelham Binjai

Kepala Dinas Perhubungan Kota Binjai

Dr. T. Amri Fadly

H. Fadlan, SH, MH

Kadis Pariwisata, Pemuda Dan Olahraga Kota Binjai

Kadis Tarukim Kota Binjai

Drs. Eka Dwi Sahputra

M. Mahfullah P Daulay, SSTP, MAP

Kabag Umum Setdako Binjai

Kabag Humas Setdako Binjai

Irwansyah Nst, S.Sos.

Zulfikar, S.Sos

SIMALUNGUN (Waspada): Bupati Simalungun, DR JR Saragih SH MM, bersama Danrem 022/PT Kol. Inf. Teguh Arif Indratmoko, Dandim 0207Simalungun,LetkolInfParluhutanMarpaung, Sekda Drs Gidion Purba MSi bersama beberapa pimpinanunitkerjadijajaranPemkabSimalungun meninjau lokasi sebagai sasaran pelaksanaan Karya Bakti TNI Kodim 0207 Simalungun tahun anggaran 2014, Kamis (9/1). Dalam meninjau lokasi sasaran pelaksanaan karya bakti tersebut, para pejabat sipil dan militer itu menggunakan sepedamotor agar lebih mudah dan cepat sampai ke lokasi. Dandim 0207 Simalungun, Letkol Inf Parluhutan Marpaung, sasaran kegiatan karya bakti tahun anggaran 2014 berupa rehabilitasi jalan 28 kilometer, mulai dari Simpang Pangalbuan Kec. Raya menuju Huta Parapat Huluan Nagori Simanabun Kec. Silou Kahean. “Pekerjaan yang akan dilakukan antara lain pelebaran dan pengerasan jalan dengan menggunakan telford dan beton (siklop). Siklop sepanjang 3.700 meter dan lebar 3 meter, pembuatan jembatan di 4 titik, gorong-gorong di 8 titik, bronjong 5 titik dengan panjang 120

meter, tembok penahan 800 meter, parit pasangan 6.000 meter dan direncanakan waktu pengerjaan selesai6bulandimulaiJanuaris/djuni2014dengan melibatkan personil dari TNI 40 orang, perangkat nagori 10 orang dan 60 orang masyarakat,” jelas Parluhutan yang belum sebulan bertugas sebagai Dandim Simalungun itu. Selain itu, menurut Dandim, dalam kegiatan Karya Bakti TNI Kodim 0207 Simalungun juga melaksanakan kegiatan non fisik diantaranya penyuluhuan tetang wawasan kebangsaan, bela negara, hukum, narkoba dan pertanian serta perkebunan. Bupati Simalungun, JR Saragih, berharap dengan dilaksanakannya karya bakti TNI, perekonomian masyarakat dapat meningkat karenaaksesjalandariSilouKaheanmenujuibukota kabupaten sudah semakin dekat. Dikatakan, kegiatan Karya Bakti TNI Kodim 0207 Simalungun dirancanakan dari Simpang Pangalbuan menuju Nagori Bongguran Kariahan akan diperlebar menjadi 8 - 10 meter dari ukuran sekarang (4 meter) agar mempermudahkan arus lalulintas dari Silou Kahean menuju Raya dan sebaliknya. (a29)

WASPADA Jumat, 10 Januari 2014

Ekonomi & Bisnis


Tekan Harga Di Tingkat Pengecer Pertamina Tambah Pasokan Elpiji

KPID Sumut Tanggapi Iklan ‘Wani Piro’

MEDAN (Waspada): Guna menekan tingginya harga elpiji di tingkat pengecer, Pertamina menambah pasokan elpiji baik tabung 3 kg maupun 12 kg ke masyarakat sebesar 10 persen. Hal tersebut dikatakan Senior Eksternal Manager Public Relation Pertamina Region I Sumatera Bagian Utara (Sumbagut) Fitri Erika, Kamis (9/1), menanggapi keluhan masyarakat tingginya harga elpiji 3 kg, karena banyaknya masyarakat yang beralih dari elpiji 12 kg ke elpiji tabung hijau. Fitri Erika mengatakan, Pertamina tidak memiliki kewenangan untuk menindak pengecer yang menjual harga elpiji melebihi harga eceran tertinggi (HET), karena pedagang pengecer di luar lembaga resmi Pertamina. “Namun untuk menekan harga di tingkat pengecer, Pertamina menambah pasokan 10 persen serta menjadikan SPBU sebagai outlet penjualan,” ujar Erika. Terkait jumlah pasokan elpiji ke masyarakat, Erika mengatakan, untuk penyaluran di Kota Medan elpiji non subsidi 12 kg dan 50 kg sebanyak 4.800 tabung per hari. Sedangkan untuk elpiji bersubsidi 3 kg, penyalurannya mencapai 61.000 tabung setiap harinya. “Untuk Sumut elpiji non subsidi mencapai 13.000 tabung per hari dan elpiji bersubsidi 204.000 tabung per hari,” papar Erika. Sebelumnya, Netty, warga Jalan Air Bersih Medan mengaku keberatan dengan naiknya harga elpiji tabung 3 kg di daerahnya. “Sejak harga elpiji 12 kg mengalami kenaikan, harga elpiji 3 kg juga juga ikut naik, padahal tidak ada kenaikan dari pemerintah,” katanya. Harga elpiji 3 kg yang biasanya Rp14.000-Rp16.000 per tabung tersebut, mengalami kenaikan mencapai Rp19.000 per tabung. “Harusnya ada tindakan terhadap kenaikan harga elpiji di atas HET dan penjualnya juga harus ditindak,” ujarnya. (m41)

MEDAN (Waspada): Wakil Ketua DPRD Sumut Sigit Pramono Asri, mengapresiasi sikap Ketua Komisi Penyiaran Indonesia Daerah (KPID) Sumut. Pengaduannya tentang tayangan iklan ‘’wani piro’’ di beberapa stasiun televisi, ditanggapi dengan baik. Berbicara di gedung DPRD Sumut, Kamis (9/1), Sigit Pramono Asri, mengaku puas dengan sikap KPID Sumut. Walau hanya dengan pengaduan lisan, lembaga ini telah menanggapi keresahan masyarakat tentang tayangan iklan salah salu merek rokok tersebut. Sigit Pramono Asri, mengaku mendapat salinan surat KPID Sumut tertanggal 20 Desember 2013 yang ditandatangani Ketua KPID H.Abdul Haris Nasution. Surat tersebut ditujukan kepada kantor salah satu stasiun televisi di Jakarta yang selama ini menayangkan iklan rokok. KPID Sumut menilai terdapat pelanggaran penghormatan terhadap nilai-nilai kesukuan, agama, dan antargolongan dalam iklan itu. Di mana, dalam tayangan iklan tersebut, ada seorang memakai pakaian Jawa dan memakai belangkon sambil berkata ‘’wani piro’’. Hal itu melecehkan. |Seolah-olah suku Jawa itu mata duitan. Menurut KPID Sumut, tayangan iklan tersebut telah melanggar Pedoman Prilaku Penyiaran (P3) tahun 2012. Karenanya, stasiun televisi itu diimbau, tidak lagi menyiarkan acara tersebut. Sigit Pramono Asri, menceritakan bahwa beberapa waktu lalu dia bertemu dengan Ketua KPID Sumut di Bandara Kuala Namu. Secara lisan, dia menceritakan tentang keresahan sejumlah tokoh masyarakat Jawa di daerah ini tentang tayangan iklan ‘wani piro’ tersebut. Para tokoh masyarakat Jawa, menurut Sigit, merasa bahwa ikan tersebut tidak mendidik. ‘’Kalimatnya memang ringan dan mungkin saja maksudnya canda. Tapi, kalimat itu melegitimasi sikap transaksional masyarakat dalam semua urusan. Padahal yang dikenal budaya kita adalah gotong royong. Bukan mendapat sesuatu karena membayar,’’ kata Sigit. Dikaitkan dengan suasana sosial politik saat ini, menurut Sigit, iklan itu juga sangat mengganggu. Yakni menggambarkan kalau kita sepakat melakukan transaksional. ‘’Juga pada tayangan itu, simbol-simbol yang dipakai bisa menyinggung suatu suku. Baik busana maupun bahasa yang digunakan,’’ katanya. Sigit, juga memuji sikap Ketua KPID Sumut yang sangat responsip. Walaupun dia hanya menyampaikan pengaduan itu secara lisan, tapi ditindaklanjuti dengan baik. ‘’Seterusnya, kita berharap stasiun TV yang menayangkan iklan itu juga menanggapi surat KPID Sumut,’’ katanya. (m12)

Penjualan Sepeda Motor 7,77 Juta Unit JAKARTA (Waspada): Penjualan sepeda motor nasional selama 2013 mencapai 7,77 juta unit atau naik 8,8 persen dari tahun sebelumnya 7,14 juta unit. Awal tahun 2013 diprediksi penjualan akan mengalami koreksi penurunan atau paling tidak stagnan hingga akhir 2013. Kenyataannya, dari data Asosiasi Industri Sepedemotor Indonesia (AISI) di lansir Kamis (9/1), justru mengalami kenaikan 8,8 persen dari tahun 2012. Tiga merek sepeda motor masih merajai pangsa pasar di Indonesia. Yakni Honda menguasai sampai 60,49 persen. Yamaha, menguasai 32,12 persen, dan Suzuki 5,16 persen. Begitupun marek Kawasaki berhasil menaikkan volume penjualan sekaligus pangsa pasar menjadi 1,98 persen, berkat dari peluncuran jenis sport. Terakhir marek TVS, hanya mencicipi 0,26 persen. Jenis sepeda motor skutik masih tetap menguasai market leader dengan penjualan 4,89 juta unit atau berkontribusi 63,02 persen terhadap total pasar. Sedangkan motor bebek terjual 1,77 juta unit atau 22,8 persen. Namun di tahun 2013, sepeda motor jenis sport terus memperbesar pangsa pasarnya menjadi 14,18 persen atau mencapai 1,10 juta unit. Dibandingkan dengan tahun sebelumnya, 765.520 unit, melesat10,72 persen. Semakin membaiknya pendapatan masyarakat kelas menengah di Indonesia, membuat konsumen cenderung membeli sepeda motor sport untuk kepuasan dan bukan lagi sebagai alat transportasi yang mengutamakan fungsional, seperti skutik dan bebek. (J03)

BRI Berbagi Hadiah ‘’Terbelit Untung’’ BALIKPAPAN (Waspada): Bank BRI kembali menyemarakkan program undian Untung Beliung Britama (UBB) 2013. Kali ini tema yang diusung adalah “Terbelit Untung”, melanjutkan pengundian sebelumnya pada Bulan November 2013 di Bandung dan Surabaya. Mengambil tempat di Ballroom Hotel Novotel-Balikpapan, acar dimeriahkan oleh penampilan dari penyanyi Citra Scholastika. Pengundian tahap kedua untuk Regional 2 ini mengundi 1 nominasi pemenang untuk Grand Prize (Range Rover Sport) atau Super Prize (Mercedes Benz S-Class), dan tidak lupa beragam hadiah menarik lainnya, seperti Toyota Alphard, Honda Brio dan Smartphone. “Kami senang dapat terus memberikan apresiasi kepada para nasabah setia Bank BRI. Program undian berhadiah ini juga merupakan salah satu wujud apresiasi terhadap nasabah yang telah bertransaksi menggunakan layanan e-Banking Bank BRI, “ujar Muhamad Ali, Corporate Secretary BANK BRI, Selasa (07/1). Dalam program ini, jutaan nasabah Bank BRI dari Sabang sampai Merauke yang menabung di Tabungan BRI BritAma, Tabungan BRI Junio, Tabungan BRI BritAma Bisnis dan BritAma Valas akan dihitung poinnya, sejak Agustus - Desember 2013 dan berpeluang memenangkan beragam hadiah menarik dari Bank BRI. Tabungan BRI BritAma merupakan produk tabungan Bank BRI yang memiliki beragam kemudahan. Dapat digunakan untuk bertransaksi di lebih dari 9.700 unit kerja Bank BRI. Dengan memiliki Tabungan BRI BritAma, nasabah akan mendapatkan Kartu Debit BRI/ Kartu ATM untuk dapat bertransaksi di lebih dari 18.000 jaringan ATM BRI yang tersebar di seluruh Indonesia, serta dapat digunakan di jaringan ATM Bersama, Prima, Cirrus, Bankcard dan Link didalam maupun luar negeri. Kecepatan dan kemudahan transaksi ditunjang oleh layanan e-Banking BRI, seperti Mobile Banking BRI, dan Internet Banking BRI yang juga dapat diakses melalui aplikasi BRI Mobile di smartphone Blackberry, iPhone dan Android. Selain di Merchant BRI Kartu Debit BRI juga dapat dipergunakan sebagai sarana belanja di berbagai merchant berlogo Master Card. (rel)

Direksi Bank Sumut Jangan Dipolitisasi MEDAN (Waspada): Penetapan direksi Bank Sumut yang saat ini sedang berlangsung jangan dipolitisasi oleh siapapun. Sebaliknya, semua pihak harus berpikir bahwa bank itu sangat penting untuk memajukan perekonomian daerah ini. To k o h m a s y a ra k a t Su m u t Meherban Shah (foto), mengatakan itu, Rabu (8/1). Dia juga merupakan Dewan Pimpinan Nasional (DPN) Masyarakat Pancasila Indonesia (MPI). “Saya pasti ikuti dan dapat info siapa saja yang namanya dimajukan. Dalam masalah ini harusnya sebagai anak bangsa, kita harus berpikir bahwa bank itu berkepentingan untuk memajukan ekonomi daerah,” jelasnya. Katanya, kalau masalah direksi Bank Sumut sampai di bawa ke wilayah politik, apalagi sampai memaksakan kehendak, malah akan membuat bank milik pemerintah tersebut sulit berkembang. “Kepentingan daerah ini, kepentingan orang yang menabung di dalamnya dan kepentingan para karyawannya harus di atas kepentingan segelintir elit yang memaksakan kehendak,” ungkapnya. MPI, katanya, mengaku prihatin dengan kosongnya kepemimpinan di bank tersebut sejak Juni 2012. “Kita mengultimatum pemegang saham pengendali agar jangan mengkhianati keinginan masyarakat. Kalau memang terbukti memiliki berbagai pelanggaran dan sudah pernah gagal ikut fit and proper test jangan diajukan lagi ke otoritas moneter atau ke Otoritas Jasa Keuangan (OJK),” ungkapnya. Meherban Shah, meminta agar para pemikir di Bank Sumut jangan berbuat sesuai kepentingan masing-masing. “Kalau memang selama ini mereka mau berbuat untuk kepentingan masyarakat banyak tanpa muatan politis harusnya jabatan direksi di Bank Sumut tidak begitu lama kosong,” tuturnya. Menurut Meherban Shah, harapan ke depan, tentu dengan terpilihnya direksi yang kapabel bisa memberi kenyamanan terhadap operasional Bank Sumut. (m06)

Waspada/Surya Efendi

JERUK: Seorang anak memetik jeruk di Kab. Karo, kemarin. Jeruk yang dikirim ke Jakarta ini dijual Rp 5.000 - Rp 10.000 per kg (tergantung ukuran). Sebagian hasil sayur dan buah di Karo ini masih terganggu erupsi Gunung Sinabung.

Di Batam:

Listrik Padam Pelanggan Dibayar MEDAN (Waspada): Kondisi kelistrikan di Sumut sangat berbanding terbalik dengan yang ada di Kota Batam, Provinsi Kepulauan Riau. Di Batam, perusahaan listrik akan membayar kompensasi kepada pelanggan, bila terjadi pemadaman listrik. Panitia Khusus (Pansus) Listrik DPRD Sumut, Rabu (8/ 1), mengundang pihak PT Pelayanan Listrik Nasional (PLN) Batam, untuk didegarkan presentasenya tetang pengelolaan listrik di sana. Perusahaan itu adalah anak PT Perusahaan Listrik Negara (PLN), yang dikelola secara mandiri, tanpa mendapat subsidi dari pemerintah ataupun induk perusahaannya. Direktur Bisnis dan Pengembangan Usaha PT Pelayanan Listrik Nasional (PLN) Batam Adrian Chalit, menyebutkan, masa pemadaman listrik di Batam sudah lama berakhir.Yang dibahas di sana adalah Tingkat Mutu Pelayanan (TMP). Artinya, menurut Adrian, kalau mutu pelayanan yang diberikan oleh perusahaan listrik kurang, maka konsumen mendapatkan kompensasi. ‘’Misal, kalau terjadi listrik padam, maka kami (perusahaan listrik) harus membayar kepada konsumen,’’ katanya. Memang, kata Adrian, berbeda dengan di Sumut atau daerah-daerah lain, tarif listrik di Batam selalu berubah. Katanya, masyarakat Batam sudah terbiasa dengan kondisi, setiap tiga bulan tarif listrik selalu berubah. Bisa naik, tapi juga bisa turun. Tergantung dari kurs dolar, tingkat inflasi dan harga ba-

han produksi (batubara, gas dan solar). Namun begitu, menurut Adrian, bukan berarti tarif listrik di sana tinggi. Malah dibandingkan dengan Tarif Dasar Listrik (TDL), tarif listrik di Batam masih lebih murah. Contohnya untuk tarif golongan R1 saat ini Rp601per kwh. Sedangkan TDL Rp1004 per kwh. Golongan R1 Rp791, sementara TDL Rp1.145 per kwh, dan seterusnya. ‘’Jadi, masih lebih murah tarif di Batam dari pada di Sumut,’’ katanya. Dari paparan Adrian, diperoleh informasi bahwa tenaga listrik di Batam memang tidak pernah dikelola oleh pemerintah. Pada saat wilayah itu dibuka sebagai kota industri dahulu, pengelolaan listrinya dikelola oleh Otoritas Batam. Setelah kota itu berkembang, listrik di sana kemudian dikelola oleh PT Pertamina. Baru pada tahun 1993, pengelolaan listrik Batam diserahkan kepada PT. Perusahaan Listrik Negara (PLN) melalui anak perusahaannya PT Pelayanan Listrik Nasional. ‘’Memang singkatannya samasama PLN. Tapi perusahaan kita tidak mendapat subsidi sedikitpun dari pemerintah maupun induk perusahaannya,’’ katanya. Sumatera Utara, menurut Adrian, sebenarnya dapat juga mengelola ketenagalistrikannya

sendiri. Itu sangat dimungkinkan dengan adanya UU No 30 tahun 2009 tentang ketenagalistrikan. Undang-undang ini, katanya, memberikan ruang yang lebih besar kepada pemerintah daerah untuk mengurusi kelistrikan. Sangat berbeda dengan undang-undang yang sama, yakni No 15 tahun 1985, yang menyerahkan usaha penyediaan tenaga listrik dilakukan oleh negara dan diselenggarakan oleh badan usaha milik negara. Dijelaskannya, di dalam UU No.30/2009, menyebutkan penyediaan tenaga listrik dikuasai oleh negara yang penyelenggaraannya dilakukan oleh pemerintah dan pemerintah daerah berlandaskan prinsip otonomi daerah. Sedangkan penyelenggarannya dapat dilaksanakan oleh BUMD, swasta, koperasi, dan swadaya masyarakat. Seperti di Batam, kata Adrian, penyedia tenaga listrik tidak dimonopoli oleh satu perusahaan saja. Di sana ada lima perusahaan sejenis yang memasok tenaga listrik. Bukan hanya swasta, tapi juga ada BUMD. “Jadi, di Batam, selain ada UU Ketenagalistikan, juga ada Perda dan Peraturan Walikota. Dan bedanya dengan Sumut, kalau menyangkut koodinasi masalah listrik harus ke Kementerian ESDM. Kalau kita di Batam, cukuk ke Dinas Perindustrian dan Perdagangan,’’ kata Adrian. Walau mengaku daya listrik yang dibutuhkan Kota Batam tidak sebesar Sumut, namun

Eksplorasi Tambang Akan Dibatasi

menurut Adrian, dengan mengelola listrik sendiri, pihaknya kini telah dapat mengembankan bisnisnya. Yakni tidak lagi hanya memasok Batam, tapi sudah mensuplay untuk Provinsi Kepulauan Riau. “Susahnya kalau listrik tidak kita kelola sendiri, kan distribusinya meluas. Katakanlah Sumut, kan tidak bisa hanya untuk Sumut, tapi juga untuk Aceh dan juga mungkin Sumbar. Kalau kita di Batam tidak demikian. Listrik yang kita hasilkan hanya untuk Batam. Makanya kita bisa surplus energi,’’ katanya. Hampir berakhir Ketua Pansus Listrik DPRD Sumut H.Ajib Shah, mengatakan saat ini tugas Pansus hampir berakhir. Pertemuan yang dilakukan hari itu adalah yang terakhir, sebelum Pansus membuat kesimpulan tentang masalah ketenagalistrikan di Sumut. Selain pihak PT Pelayanan Listrik Nasional (PLN) Batam, hari itu mengundang dan mendengar masukan dari berbagai pihak. Diantaranya para akademisi dari Frakultas Teknik Universitas Sumatera Utara (USU), Universitas Nomensen, UMA, UMSU, ITM dan UISU. Juga ada perwakilan Kadin Sumut dan Ketua Yayasan Lembaga Konsumen Indonesia (YLKI) Sumut. Kata Ajib Sah, seluruh masukan dari pihak berkompeten itu akan disimpulkan untuk kemudian disampaikan pada rapat paripurna dewan, yang akan dijadwalkan oleh Badan Musyawarah (Banmus) kemudian. (m12)

Harga Daging Sapi Capai Rp100 Ribu MEDAN (Waspada): Harga daging sapi di pasar tradisional Kota Medan mencapai Rp100 ribu perkilogram. Kenaikan harga tersebut yang bertahan sejak akhir tahun 2013 lalu, membuat banyak pedagang menghentikan jualannya karena merugi. Agus, salah seorang pedagang daging sapi di Pusat Pasar Medan mengatakan, tingginya harga daging sapi saat ini sudah terjadi dari distributor penyalur daging sapi. “Kami tidak tahu pasti apa penyebab dari kenaikan harga daging sapi tersebut, namun kenaikannya cukup tinggi dan membuat omzet pedagang menurun drastis. Biasanya, sehari penjualan bisa mencapai 150 sampai 200 kilogram, namun

kini hanya 100 kilogram saja,” ujar Agus kepada wartawan, Kamis (9/1). Mewakili pedagang daging sapi lainnya, Agus berharap pemerintah segera melakukan tindakan strategis untuk menstabilkan harga saat ini. Karena, tingginya harga daging sapi yang mencapai Rp100 ribu tersebut membuatbanyakpedagangyang memilih untuk menghentikan jualannya karena merugi. Sementara itu, di Pasar Pringgan harga daging juga sama seperti di Pusat Pasar yaitu mencapai Rp100.000 per kilogram. “Harga daging dari agen mengalami kenaikan, sehingga kami menjualnya ikut naik Rp100 ribu per kilogram,” ungkap Hasibuan. (m41)

wa harga kedelai yang ideal adalah 1,5 kali harga beras. Harga ini pernah ditetapkan pada tahun 1990-an. Kala itu, Indonesia pernah mencapai swasembada kedelai. “Ukuran harga kedelai itu 1,5 kali harga beras. Misalnya, harga beras Rp7 ribu, maka harga kedelainya Rp10 ribu. Itu baru layak,” ujar dia. Kemudian, pria ini menganjurkan agar pemerintah memberikan insentif harga kepada pembeli, tidak kepada petani. Sebab, yang terpenting bagi petani kedelai adalah harga beli

Petani Di Aceh Tidak Miliki Cadangan Beras BANDA ACEH (Waspada): Petani di Pidie dan Pidie Jaya kini terpaksa harus membeli beras yang mereka hasilkan sendiri dengan harga mahal. Itu terjadi karena mereka tidak memiliki cadangan untuk kebutuhan konsumsi sendiri. Kepala Dinas Pertanian Provinsi Aceh Razali Adami, mengaku prihatin melihat kondisi ini. Karena harga gabah saat ini naik signifikan. Mencapai Rp5.000 per kg. Harusnya, kondisi ini menguntungkan petani. “Namun sialnya, ketika harga beras naik petani menjadi kelabakan. Karena ternyata mereka tidak memiliki saving (stok beras atau gabah) untuk kebutuhan konsumsi sendiri. Bahkan celakanya lagi, mereka menjadi pembeli beras dengan harga mahal, “ungkap Razali Adami kepada Waspada, Kamis (9/1). Menurut dia, jika saja petani Aceh memiliki saving yang cukup selama menunggu masa panen berikutnya, kenaikan harga beras yang terjadi seperti sekarang ini tidak akan menjadi masalah. “Dahulu petani di Aceh tak pernah mengalami krisis stok pangan, kecuali akibat gagal panen yang. Phui, adalah satu bentuk stok pangan khas Aceh di masa lalu, “ kata Razali Adami. Mengatasi masalah ini, dia mengatakan akan kembali mengkampanyekan masalah disiplin pangan keluarga petani Aceh. Pihaknya akan berusaha agar gabah produksi Aceh langsung diolah dan digiling di Aceh, walaupun untuk itu diperlukan teknologi pengolah pertanian. Selama ini, sebut Razali, gabah yang dihasilkan para petani banyak dibawa ke umatera Utara, karena Aceh tidak memiliki mesin giling yang mampu memproduksi beras berkualitas super dan premium. (b09)

Aceh Utara Alami Krisis Pupuk


SEORANG pedagang sedang menawarkan daging sapi kepada calon pembeli di Pusat Pasar Medan.

Petani Nilai HBP Kedelai Kurang JAKARTA (Waspada): Pemerintah menetapkan harga beli petani (HBP) kedelai Rp7.500 per kg. Namun, petani menganggap harga tersebut masih kurang. “Harga produksi sekilo kedelai membutuhkan Rp7.1507.200 per kg. Kalau dihargai Rp7.500 per kg, petani dikasih untung hanya Rp200 per kg. Tinggal layak atau tidak kalau dikasih harga segitu,” kata seorang petani asal Nganjuk, Ahmad Shaiku, Kamis (9/1). Ahmad, mengatakan bah-

BANDA ACEH (Waspada): Gubernur Aceh Zaini Abdullah, berjanji akan melakukan pembatasan eksplorasi bahan tambang dan mineral di Aceh. Dia menilai sebagian besar lahan galian tersebut belum layak dibuka karena berada di kawasan hutan lindung. “Bahan mineral ini belum layak kita buka untuk saat ini. Karena itu kita perlu revisi kembali perizinan eksplorasi bahan tambang ini,” ujar Zaini Abdullah, menjawab Waspada, usai melakukan pertemuan dengan Dubes Republik Rakyat Tiongkok untuk RI, Liu Jian Chao, Kamis (9/1) di Meuligoe Gubernur, Banda Aceh. Zaini, mengakui, saat ini beberapa bahan mineral telah dieksplorasi di Aceh. Seperti bijih besi dan emas. Baik yang dilakukan masyarakat maupun perusahaan tambang. “Kita lihat, mineral yang di eksplorasi itu umumnya berada di kawasan hutan-hutan lindung yang wajib kita lindungi,” cetusnya. Untuk itu, tambah Zaini, langkah yang dilakukan Pemerintah Aceh mendidik generasi muda keluar negeri supaya mereka mampu mengelola sendiri kekayaan alam Aceh. Soal adanya masyarakat yang melakukan galian emas, Zaini, mengatakan itu persoalan yang harus dipikirkan bersama, seperti dengan memberi mereka pekerjaan lain. Sebelumnya Gubernur Zaini Abdullah dalam pertemuan dengan Dubes Liu Jian Chao dan rombongan juga menyampaikan tentang pembatasan dan moratorium bahan mineral ini. “Aceh masih punya banyak lahan untuk perkebunan, pertanian, perikanan dan peternakan yang bisa dilakukan kerjasama dengan pengusaha Tiongkok,” cetusnya. (b06)

petani yang bagus, sehingga para petani bisa bergairah untuk menanam kedelai. Apabila harga Rp10 ribu diterima pemerintah, Ahmad, mengklaim bahwa hal itu bisa melecut para petani kedelai untuk meningkatkan kapasitas produksinya. Seperti diketahui, Rabu (8/ 1) Januari 2014, Menteri Perdagangan Gita Wirjawan, mengatakan bahwa kebutuhan kedelai nasional masih cukup besar. Tapi memiliki ketergantungan terhadap impor yang cukup tinggi

sekitar 60-70 persen dari kebutuhan lokal. “Insentif harga diberikan dalam bentuk penetapan HBP kedelai yang ditentukan dengan mempertimbangkan biaya usaha tani kedelai, dampak terhadap tingkat inflasi dan keuntungan petani. HBP kedelai merupakan harga acuan pembelian kedelai di tingkat petani yang ditetapkan setiap tiga bulan,” kata Gita dalam keterangan tertulisnya. (vvn)

ACEH UTARA (Waspada): Dalam beberapa minggu terakhir, Kab. Aceh Utara mengalami krisis pupuk. Akibatnya, para petani kalang kabut. Karenanya, PT Pupuk Iskandar Muda (PIM) diminta untuk segera mengatasi kelangkaan itu. Kepala Dinas Pertanian dan Peternakan Aceh Utara Mukhtaruddin, Kamis (9/1), mengatakan, untuk bulan Januari ini, pupuk urea yang harus dipasok mencapai 360 ton. Kata Muktaruddin, surat permintaan pupuk telah disampaikan pihaknya kepada PT. PIM. Sekarang ini, dia juga mengaku masih menunggu Surat Keputusan (SK) dari Bupati Aceh Utara tentang penyaluran pupuk bersubsidi kepada masing-masing wilayah. “SK dari Gubernur Aceh sudah kita terima kemarin. Dalam SK itu tercantum tentang kebutuhan pupuk bersubsidi untuk sektor pertanian di Provinsi Aceh. Dalam SK itu juga disebutkan, Aceh Utara mendapat jatah pupuk pada tahun 2014 sebanyak 7.221 ton,” kata Mukhtaruddin. Pupuk sebanyak itu, katanya, diperuntukkan untuk kebutuhan tanaman perkebunan dan juga peternakan. Penyaluran pupuk disesuaikan dengan musim tanam. Sedangkan untuk pupuk SP 36 jatah untuk 2014 sebanyak, 2.205 ton, kemudian NPK 3.632 ton, organik 1.1163 ton dan ZA 455 ton. “Untuk pabrik penyedia pupuk NPK dan lainnya akan disurati juga, tapi yang terpenting, pupuk urea harus segera ada di pasaran,” sebutnya. Guna mengatasi kelangkaan pupuk, Distannak telah menyampaikan kepada 6 distributor yang ditunjuk PT. PIM untuk segera menebus pupuk, agar dapat segera didistribusi kepada petani, dan diharapkan dalam minggu ini semua petani di Aceh Utara bisa mendapatkan pupuk dengan mduah. Menyikapi hal tersebut di atas, Suryadi, Humas, PT. PIM kepada wartawan mengatakan, pupuk baru disalurkan kepada petani kalau mereka telah menerima rekomendasi dari Distannak Aceh Utara. (b18)



Pilpres 2014 Satu Putaran


etua Umum Partai Amanat Nasional Hatta Rajasa mengisyaratkan bahwa pada Pilpres 2014 partainya harus berkoalisi dengan partai lain untuk mengusung calon presiden. Namun, seperti halnya PDIP, partainya pun baru akan menentukan arah koalisi setelah pemilihan legislatif 9 April mendatang. Berkoalisi dalam menentukan Capres 2014 merupakan keharusan karena beratnya perjuangan parpol dalam merebut simpati suara pemilih. Kalaupun mungkin terjadi, hanya PDIP dan Golkar yang hampir bisa mencapai 20 persen suara di DPR RI atau 25 persen suara sah secara nasional untuk mengusung Capres dan Cawapres sendiri (tanpa harus berkoalisi dengan parpol lain). Selebihnya harus berkoalisi. Namun tidak tertutup kemungkinan parpol yang bisa mengajukan Capres sendiri pun berkoalisi dengan parpol-parpol lainnya untuk memperkuat dukungan dalam Pilpres mendatang. Semakin banyak yang mendukung koalisi semakin besar kans untuk memenangkan jagonya. Kalau berbicara jago-jago dalam Pilpres 2014 paling banyak hanya terdapat empat pasangan calon saja. Padahal, jumlah tokoh yang namanya digadang-gadang menjadi Capres dan Cawapres jumlahnya puluhan. Anehnya, nama Jokowi juga belum mendapat kepastian karena masih digantung oleh Ketua Umum DPP PDIP Megawati Soekarnoputri. Padahal, lembaga survei yang jumlahnya belasan, nama Gubernur DKI Jakarta itu (Joko Widodo) terus-menerus menempati posisi teratas. Bahkan dalam survei terbaru dari lembaga yang dinilai paling indepen-den pun elektabilitas Jokowi sudah mele-wati Intisari: 40 persen. kita, tidak tertutup kemungkiRakyat semakin cerdas nanHemat dalam waktu beberapa bulan ke dedalam memilih pemimpin. pan, terlebih pasca Pileg nanti tingkat podanterlebihlagielektabilitasJokoTidak suka dengan jago pularitas wi semakin melonjak. Bisa melebihi 50 tua, namun berharap mun- persensehinggabesarkemungkinandalam Pilpres 2014 nanti hanya berlang-sung culnya tokoh baru (muda) satu putaran saja. Tentu menjadi sejarah buat perjalanan politikdansuksesikepemimpinannasional jikaJokowimenangdalamsatuputaran.PrestasiituakanmengalahkantorehanSusiloBambang Yudhoyono.Sebab,dalamPilpres2004kemenanganSBYdiraihlewatputarankeduabersaing dengan Megawati. Baru pada Pilpres 2009 SBY mampu menang dalam satu putaran saja setelah berjanji kepada rakyat Indonesia melakukan perubahan dalam penegakan hukum, khususnyapemberantasankorupsi.Nyatanya,SBYgagalmewujudkanjanjinyakarenabanyak kader partainya malah terlibat, ditangkap, dan dihukum KPK/Tipikor. Menjadi tanda tanya mengapa PDIP belum memutuskan Jokowi sebagai Capres sehingga harus menunggu hasil Pileg dulu? Kemungkinannya bisa dua. Pertama, membuat para kader dan Caleg PDIP semakin penasaran dan bekerja keras menggalang kekuatan di masing-masing daerah. Kedua, bisa jadi Megawati masih berambisi dan menginginkan kursi RI-1 setelah tiga kali gagal. Sekali dikalahkan Gus Dur, dua kali dikalahkan SBY. Peluang Mega jelas terbuka karena dalam Pilpres 2014 SBY sudah tidak bisa mencalonkan dirinya lagi (sudah dua periode). Orang-orang dekat dan pengagum Soekarno/Mega jelas mengharapkantrahataudarahbirupresidenpertamalahyangmenjadiCapres.Masihbanyak kader PDIP yang menginginkan Mega maju lagi walau dengan risiko kalah. Itu sebabnya, muncul opsi untuk menduetkan Megawati dengan Jokowi dan disebut-sebut bakal meraih kemenangan, walau dengan angka tipis. Sebab, pengagum Jokowi pastilah kesal bila jagonya hanya menempati posisi Cawapres karena dalam survei yang menonjol sekali nama Jokowi, sementara rating Megawati tak sampai 10 persen. Andai PDIP bersikeras memajukan duet Mega – Jokowi pertarungan dalam Pilpres mendatang dipastikan seru dan menarik, terlebih dengan jagonya Gerindra yang sudah pasti memajukan Prabowo Subianto, sementara Golkar memajukan ketua umumnya Aburizal Bakrie. Kalau saja Prabowo berpasangan dengan Aburizal atau dengan jagonya Partai Demokrat koalisi tersebut berpeluang mengalahkan pasangan Mega-Jokowi. Belum lagi kalau dalam perjalanan waktu selama enam bulan ke depan menuju pentas Pilpres muncul jago baru sebagai kuda hitam, membuat pertarungan Pilpres tahun ini benar-benar kompetitif. Justru itu, isyarat Hatta Rajasa kelihatannya bakal terbukti. Capres dan parpol bakal berkoalisi untuk memenangkan Pilpres 2014 yang pasti akan berlangsung seru dan menegangkan. Lain hal kalau PDIP ikhlas memajukan Jokowi maka Pilpres 2014 bakalan mulus karena kondisinya saat ini rakyat semakin cerdas dalam memilih pemimpin. Tidak suka dengan jago-jago tua, namun berharap munculnya tokoh baru (muda) yang dekat dengan rakyat, berkomitmen membangun bangsa dan meningkatkan kesejahteraan 250 rakyat Indonesia.+


Faks 061 4510025

Facebook Smswaspada

+6282167855377 Dimana-mana Palang lintasan Kereta Api jadi judul berita,dari mulai Petugas sampai masyarakat pengguna jalan terutama pengguna kenderaan sering menerobos ,ya..yang pasti karena Palang Lintasan seperti yang kita lihat sekarang ini.bukankah bisa diciptakan palang dengan bentuk dan metode lain yang tidak bisa di terobos ?. +6285275050268 Sungguh menderita rakyat indonesia kalangan ekonomi lemah. Harga Sembako melambung tinggi, harga gas elpiji mendadak naik, BBM sdh duluan naik, TDL akan naik lagi. Belum lagi biaya pendidikan dan kesehatan. Mana hati nurani pemimpin dinegeri ini, kayaknya pemimpin suka bila melihat rakyatnya susah padahal dlm undang2 tujuannya adalah utk mensejahterakan rakyat. Ironis.. +6281362155246 “Siapa saja yang memfitnah orang Muslim dengan sesuatu hal, padahal dia (Muslim tersebut) bersih dari apa yang dituduhkannya itu; dgn tujuan menjatuhkan nama baiknya di dunia, maka pasti Allah akan meleburnya pada hari kiamat ke dalam neraka sampai ia dapat membuktikan kebenaran apa yang dituduhkannya.” (HR.At-Thabrani).Wallaahu a’laam. +6285359812866 Addunyaa Mataa ‘uw Wakhayru Mataa ‘ihalmar Atush Shaalihah.”HR.MUSLIM”. ARTINYA;Dunia Adalah Perhiasan,dan Sebaik-baiknya Perhiasan,adalahWanita Soleha. +6285372881543 Tekanan dan intimidasi pemilu di Aceh mulai dirasakan dan terang2an dilakukun oleh salah satu partai politik lokal di Aceh di pedalaman desa dlm kecLhok sukon...Panwaslu dan KIP Aceh harus berani bertindak terhadap pihak2 yg memancing dan mengganggu kenyamanan rakyat. Pastikam pemilu di Aceh berjalan fair dan demokratis..partai.peserta pemilu gentlemen dalam bersaing dan jangan coba merusak perdamaian tg telah terbina...Rakyat Aceh bukan boneka...atau ingin melihat rakyat bertindak melawan partai2 busuk yg sepatutnya tdk layak ikut pemilu di Aceh .Bek peu reman2 droe ngon bansa Aceh ..Putra Lamuri.. +6285275437438 Gampong Ranto Lhoksukon Barat sekarang tidak punya SEKDES < sekretaris desa > kalau ada yg mengatakan diri sekdes utk mendapat FEE Projek jangan dilayani atau lapor saja ke pihak yg berwajib !. +628126501779 LPG NONSUBSIDI: Kebanyakan orang politik & media kalau ngomong asaljeplak! Kalau toke2 TIAP HARI menaikkan harga2 kebutuhan pokok, mereka diam 100%! Membela Rakyat?! +6281362155246 Orang beriman selalu ada cara untuk menata hatinya, walaupun mimpinya tidak sama dengan kenyataan hidup yang dihadapinya.Jika dapat musibah, airmatanyapun menetes,tapi hatinya selalu yakin itu adalah yang terbaik dari Allah untuknya. Badannya lelah,pikirannya penat,tapi hatinya tetap yaqin”Insya Allah ada rencana Allah yang terbaik untuknya esok hari”.Wallaahu a’laam. +6285373491879 Orang sering terkecoh penampilan orang yg tampak diluar sangat shaleh, tetapi perilaku dan ucapan2nya sering menyakitkan dan menipu orang banyak. Dan kit a sering menemukan kebenaran justru keluar dr mulut orang yg kita anggap remeh,karena mungkin dari segi penampilan tdk menarik dan menampakkan diri seperti orang bodoh, tetapi perilaku selalu memancarkan cahaya kebenaran

Jumat 10 Januari 2014

Pemikiran Sosial Mohammad Said Oleh Budi Agustono MS adalah pemikir besar sekaligus meminjam bahasanya Antonio Gramsci seorang intelektual organik, seorang jurnalis cum intelektual organik.


nowledge is Power, pengetahuan adalahkekuasaan.Siapamenguasai pengetahuan dia akan menguasai masyarakat. Pengetahuan adalah istilah yang tidak netral. Ia diciptakan dan diproduksiuntukmerekayasa,mendefinisikan dan memisahkan masyarakat. Itulah semangat pengetahuan ketika ia berada dalam selimut kekuasaan. Ketika mesin kekuasaan kolonial bekerja di Sumatera Timur mulai paruh kedua abad ke sembilan belas, kekuasaanitumelaluipengetahuanyangdiproduksi dandinarasikanparailmuwankolonialseperti pelancong, misionaris dan aparatus birokrasi pengetahuandihasilkandandisebarkanuntuk memperkuat kekuasaan. Para pelancong, misionaris dan aparatus birokrasi ini turun ke lapangan menjelajah danmengumpulkanbongkahanpengetahuan lapangan dari berbagai wilayah tidak semata untuk perkembangan pengetahuan, tetapi juga untuk merekayasa masyarakat. Dari hasil pemikiran mereka itulah adat istiadat, keadaan masyarakat, stereotif etnik dan batasanwilayahgeografisdidefinisikandandirumuskan sehingga memunculkan sebuah wilayah. Bahkanpenamaaanwilayahbukanpulagenuin dari masyarakat setempat, tetapi penamaan ituberasaldarikekuasaanyangsedangberkuasa. Kekuasan kolonial di belahan dunia lain, termasuk di Sumatera Timur yang secara politis dikuasai empat Kesultanan besar (Langkat, Deli, Serdang, dan Asahan) dan kerajaan kecil lainnya, dapat mengendalikan dan menguasai wilayah jajahannya melalui pengetahuan. Dalam menguasai dan mengekstrasi sumber daya ekonomi dan politik di wilayah jajahannya, kekuasaan kolonial selalu memakai cara halus sampai menggunakankekerasan.Carahalusdilakukanmelalui politik belah bambu dengan mendukung satu golongan melalui perjanjian politik, tetapi pada saat yang sama melemahkan dan menghancurkangolonganlainnya.Sementara itu jika siapa saja yang dianggap sebagai lawan politiknyayangdapatmendisrupsikeamanan dan ketertiban kekuasaan, penguasa kolonial dengan enteng menggunakan kekerasan menindas pendisrupsi kekuasaan itu. Kekuasaan kolonial membawa perubahan besar di Sumatera Timur. Selan makin mantabnya tata kerja birokrasi kolonial, juga mendatangkan kemajuan yang luar biasa cepat di kantong-kantong pertumbuhan ekonomi seperti di wilayah berdirinya perkebunan tembakau, kelapa sawit, karet dan sebagainya. Bekerjanya birokrasi pemerintahan dan kehadiran perkebunan yang memanjang dari Asahan sampai Langkat mendorong banyak orang dari berbagai ras, kelompok etnik dan negara lain datang ke Sumatera

+6282161314651 Yth: BapakBupatidanWakilBupatiDeliSerdang,tolongperhatiannyauntukmemperbaiki jalan Marendal karena kondisi jalannya sangat parah,berlubang,becek dan kalau musim hujan banjir karena parit sepanjang jalan marendal tidak berfungsi karena banyak yg berjualan di atas parit..tolong pak karena setiap hari ada saja kecelakaan karena jalan yang rusak dan sempit pula sementara truk2 masuk kejalan marendalm terima kasih waspada +6281362155246 Hati itu ada 4 yaitu: 1)HATIYang bersih, didalamnya ada pelita yang bersinar,itulah Hati orang Mukmin (2)HATI Yang Hitamsemua Permukaannya, itulah Hati orang Kafir (3)HATI yang Tertutup Yang terikat tutupnya, itulah Hati orang Munafiq (4)HATI yang punyadua sisi,yang satu beriman danYang satu lagi Kufur (HR.Ahmad &Thabrani). Wallaahu a’laam.


Timur mencari peruntungan ekonomi. Kehadiran perkebunan ini membiakkan perkembangan fisik daerah dan modernisasi. Tetapi karena dalam pengelolaan kekuasaan kolonialinisangatrasis,diskriminatif,memaksa dan otoriter menciptakan disparitas ekonomi dan segregasi masyarakat. Masyarakat Sumatera Timur menjadi berlapis dan antara kelompok masyarakatkulturaldan politik terpisah satu sama. Tidak ada komunikasi budaya antara kelompok. Di tengah ekologi sosial kolonial seperti inilah Mohammad Said dibesarkandiLabuhanbilik, yang waktu masuk wilayah Labuhanbatu. Mohammad Said (MS) lahir 17 Agustus 1905, memulai pendidikannyasaat berusia enam tahun. Di masa awal pendidikannya, ayahnya Haji Hasan, seorang pedagang keliling, selalu meminta MS kecil membacakan koran mengikutiperkembanganterkini.HajiHasanmeminta MS membacakan koran bermaksud memperlancar membaca. Ayahnya berlangganan koran Andalas yang terbit di Medan. Setelah menamatkan sekolah rendahnya, MS meneruskan pendidikan lanjutan ke Pematangiantar tahun 1918. Namun ia tidak berhenti di tengah jalan lalu balik ke Labuhanbilik. Sepulang dari Pematansiantar MS tidak meneruskan pendidikannya tetapi melamar bekerja di birokrasi pemerintahan Belanda. Ia diterima dan perlahan belajar persoalan administrasi pemerintahan. Selain bekerja di pemerintahan, ia mulai belajar bahasa Belanda dan Inggris dan selalu melakukan percakapan dua bahasa itu kepada orang Belanda dan Inggris di Labuhanbilik. Salah satu pekerjaan MS adalah mengetik surat penguasa kolonial setempat ke para raja Panai, KotaPinang,BilahdanKualuhyangisinyamemintahalustetapimemaksaraja-rajaitumenye-

rahkan pajak ke penguasa kolonial setempat. Tidak lama bekerja di bagian pemerintahan, MS ditempatkan di kantor kejaksaan Labuhanbilik. Di sinilah MS mulai mengerti persoalan hukum terutama terkait buruh perkebunan. Ia menyaksikan sengsaranya menjadi buruh perkebunan karena jika menolak pekerjaan atau melanggar kontrak buruhdihukumpenjara.Iamarahkepadakekuasaan kolonial dan raja-raja yang memperlakukan buruh menderita. Tidak dapat menahan amarahnya MS berhenti bekerja di birokrasi pemerintahan di Labuhanbatu. Tahun 1928 ia memilih mencari peruntungan hidup di Medan yang pada 1928 telah berkembang menjadi kota satelit kolonial yang metropolitan dan menjadi ibukota keresi-denan Sumatera Timur—di jantung kotanya berdiri kantor pemerintahan yang menjadi lokus pengendalian birokrasi kolonial ke wilayahpedalam lainnya. Di samping itu telah berdiri kantor pos, hotel, perbankan, kantor markapai perkebunan, restoran, stasiun kereta api dan pusat-pusat bisnisyangmemfasilitasimasyarakatthehaves. Seturut bertumbuhnya Medan, surat kabar berdiri satu demi satu. Ada yang dikelola Eropa, Tionghoa dan penduduk setempat yang terinspirasi the age of motion, zaman bergerak yang di awal abad kedua puluh ditandai berdirinya surat kabar, organisasi buruh dan komunitas profesional berbasis pekerja. Pada masa itu di Medan telah berdiri surat kabar berbahasa Melayu Pertja Timur, Pewarta Deli, dan Tjin Po. Sewaktu MS merantau mencari pekerjaan ke Medan, karena latar belakang sekolah rendahan, ketika MS mencari pekerjaan tentu tidak bisa mendapat pekerjaan yang memiliki gaji tinggi. Lain dari itu karena menyaksikan penderitaan kaum buruh bekerja di birokrasi pemerintahan, ia tak sudi bekerja di pemerintahan. Argumen inilah yang mendorongnya mencemplungkan diri bekeja di surat kabar Penjedar. Ketika ia mulai bekerja di koran Tjin Po yang dikelola peranakan Tionghoa.

Tidak lama bekerja di koran ini, ia pindah pekerjaan di koran Oetoesan Sumatera. Dari sini pindah lagi ke Penjedar. Saat bekerja di koran ini, seorang wartawati Ani Idrus selalu mengirimkan tulisannya.Wartawati Ani Idrus ini tidak saja menulis di Penjedar, tetapi juga bekerja di Sinar Deli. Setelah bekerja beberapa tahun bekerja di Penjedar, MS dan Ani Idrus tahun 1937 bersama-sama menerbitkan Seroean Kita. Rupanyakeduaaktivispersinisalingmemadu kasih dan di tahun 1939 MS menikah dengan AniIdrus.Pasanganmudainidikaruniaienam anak, yaitu Tribuana Said, Saida Tumengkol, Indra Buana Said, Rayati Syafrin, Teruna Jasa Said dan Prabudi Said. Di masa itu koran lokal, meski menjadi alat perjuangan bangsa, satu sama lain saling berkompetisi. Surat kabar ini saling berebut pengaruh khalayak pembacanya. Karena kalah bersaing dengan PewartaDeli,koranSeroeanKitaakhirnyatutup. MS dan Ani Idrus menjadi jurnalis bebas yang tidak terikat dengan koran mana-pun. Ketika kekuasaan kolonial beralih ke pendudukan Jepang tahun 1942 situasi politik berubah. Jika di masa kolonial surat-surat kabar bermunculan menjadi media pelecut kesadaran bangsa dan pembangkit nasionalisme. Di masa pendudukan Jepang suratsurat kabar sangat dibatasi dan dilarang terbit karena dianggap sebagai propaganda politik. Pemerintah militer Jepang hanya memboleh surat kabar di bawah pengawasan mereka sepertiSumateraShimbun.PenerbitanSumateraShimbuninimendapatpengawasanketat dari Dinas Penerangan Jepang. Di masa Jepang MS bekerja di Dinas Penerangan Jepang ini. Di tempat bekerjanya inilah MS bertemu dengan Abdul Karim MS, salah seorang tokoh pergerakan terkemuka dari Sumatera Utara yang bekerja di pemerintahan Jepang. KekuasanJepangyangrelatifsingkattetapi membuat penderitaan hidup rakyat berakhir ditahun1945setelahproklamasikemerdekaan dikumandangkan di Jakarta. Berita tentang proklamasi ini simpang siur, termasuk di Sumatera. MS yang mendengar kesimpangsiuran dan keterlambatan proklamasi ini berniat mendirikan koran Pewarta Deli. Nama surat kabar ini mengingatkan sebuah surat kabar yang terbit di masa kolonial. MS menghidupkan kembali koran Pewarta Deli dan sejak September 1945 ia menjadi pemimpin redaksi surat kabar ini. Dari koran Pewarta Deli inilah berita proklamasi dengan cepat menyebar ke khalayak luas. Berita tentang seputar proklamasi selalu ditampilkan di halaman utama Perwarta Deli sehingga dengan cepat menarik dan menjadi perbincangan publik. Namun, karena masa itu situasi politik tidak menentu sebagai akibat kehadiran pasukan Inggris, maka koran Perwarta Deli dibreidel. Situasi politik semakin tidak menentu di tahun 1947. Pasukan Belanda melalui aksi polisionil terus menyerang dan menguasai kota Medan dengan maksud ingin menegakkan kembali masa emas kejayaan kekuasaan Bersambung ke hal C7

Densus 88 Luar Biasa Vs ‘Teroris’ Oleh Sofyan Harahap Padahal,teror ada di mana-mana,di Amerika,Inggris,Rusia, Jepang dll banyak aksi teroris terjadi, apakah mereka beragama Islam? Pasti tidak!


uar biasa sukses kinerja Densus 88 Antiteror Polri. Andai juga dibentuk Densus 88 Antikorupsi pastilah banyak koruptor pada bertewasan bersimbah darah tanpa proses hukum. Saya pun teringat di tahun 1980an ketika dibentuk Penembak Misterius (Petrus). Sebentar saja jaringan atau kelompok preman dibuat tiarap, setelah satu per satu tokoh preman di Sumut, khususnya Medan tewas secara mendadak menjadi korban Petrus. Banyak preman yang tiba-tiba menjadi alim, memakai peci, lobe, rajin ke masjid beribadah. Penggerebekan teroris di Ciputat,Tangerang Selatan (Banten) berhasil menewaskan enam orang merupakan salah satu bukti ‘’luar biasa’’ kerja Densus 88.Walau sudah dikepung belasan jam hasilnya semua tewas. Padahal, dengan jumlah personel yang begitu besar plus persenjataan lengkap, sebentar saja Densus 88 bisa membuat mereka yang disangka teroris itu bertekuk lutut. Wajar kalau begitu banyak pihak mempertanyakanprofesionalismepersonelDensus 88. Sebab, kalau mau dibuat tewas tak perlu berlama-lama hanya menghadapi enam orang dengan senjata bom rakitan. Cukup dalamtemposatujamsajasudahselesaiperlawanan yang katanya teroris anak buah Abu Roban. Mengapa Densus 88 disebut hebat? Masalahnya, pada umumnya penggerebekan sarang teroris atau tempat persembunyian jaringan teroris semua target tewas terkena peluru tajam. Kalau benar teroris tentu bagus namun begitu tetap menyulitkan pemerintah dalam melakukan pemberantasan radikalisme dan terorisme. Dampak lainnya bisa membuat sel teroris semakin berkembang melebarkan sayapnya. Sel-sel baru meretas di tengah masyarakat kota hingga pedesaan, walau satu per satu dedengkot teroris sudah ditembak mati, dihukum penjara, dikejarkejarDensus88. Yangjelasaksi-aksiradikalisme dan terorisme tidak menyusut. Malah cenderung semakin tumbuh dan berkembang di tengah-tengah masyarakat kita. Perbedaan Lantas apa perbedaan radikalisme dan terorisme? Tentu berbeda. Yang namanya radikalisme adalah perbuatan memaksakan kehendak oleh individu atau kelompok garis keras untuk melakukan perubahan sesuai keinginan kelompok itu dengan cara radikal atau kekerasan. Misal, seseorang atau kelompok bila sudah memegang prinsip ingin me-

ngubahkeadaan namunsistemnyaitubertentangan dengan perundangan, maka mereka menggunakan cara-cara radikal agar tujuannya tercapai. Sedangkan terorisme adalah serangan atau aksi terkoordinasi dari individu atau berkelompok dan berjaringan bertujuan membangkitkan perasaan takut pada masyarakat dan lembaga.Teror berbeda dengan perang, menurut referensi dari Wikipedia berdasarkan kamus bahasa Indonesia, aksi terorisme tidak tunduk pada tatacara peperangan seperti waktu pelaksanaan yang selalu tiba-tiba dan target korban jiwa yang acak serta seringkali merupakan warga sipil. Dan dari sudut pandang seorang teroris-radikal apa yg dia lakukan itu benar. Padahal sebenarnya aksinya sangat merugikan pihak lain. Namun begitu, banyak anggapan salah terkait terorisme karena mengaitkannya dengan agama (Islam). Padahal, teror ada di manamana, di Amerika, Inggris, Rusia, Jepang dll banyak aksi teroris terjadi, apakah mereka beragama Islam? Pasti tidak! Di negara-negara maju (Barat) muncul persepsi yang menyamakan jihad dengan aksi terorisme sehingga Indonesia terus dipantau, terutama pendidikan ala pesantren terus diawasi intel Amerika dan sekutu karena dicurigai merupakan‘’kawah candradimuka’’ atau tempat melahirkan teroris baru. Hal ini patut dikecam. Masalahnya, Islam adalah agama kasih sayang, agama yang penuh toleransi sehingga kalau tidak dizalimi umat Islam tidak akan melakukan aksi pembalasan. Itu terbukti, berdasarkan pengalaman empiris di daerah yang umat Islamnya mayoritas kalanganminoritassangataman,tidakterganggu, malah mendapat perlindungan. Namun jika masyarakat Islam berada di daerah nonMuslim, baik di dalam negeri apalagi di luar negeri (Barat) kondisinya terbalik. Mereka tidak pernah merasa aman, selalu diganggu dan tertekan perasaan karena terus dicurigai dan terzalimi secara fisik maupun mental. Justru itu, kekeliruan pemahaman jihad perlu diluruskan agar label teroris tidak lagi dikaitkan dengan Islam. Ini penting karena antara jihad dan terorisme jelas terdapat perbedaan sangat mendasar.Versinya Majelis Ulama Indonesia (MUI), terorisme adalah “tindakan kejahatan terhadap kemanusiaan dan peradaban yang menimbulkan ancaman serius terhadap kedaulatan negara, bahaya terhadap keamanan, perdamaian dunia merugikan kesejahteraan masyarakat.Terorisme adalah salah satu bentuk kejahatan yang dior-

ganisasi dengan baik (well-organized), bersifat transnasional dan digolongkan sebagai kejahatan luar biasa (extra ordinary crime) yang tidak membedakan sasaran (indiscriminative)”. Karena itulah, menurut MUI, hukum melakukan teror secara qath’ie adalah haram, dengan alasan apapun, apalagi jika dilakukan di negeri yang damai (dar al-shulh) dan negara muslim seperti Indonesia. Hukum jihad adalah wajib bagi yang mampu dengan beberapa syarat. Pertama, untuk membela agama dan menahan agresi musuh yang menyerang terlebih dahulu. Kedua, untuk menjaga kemaslahatan atau perbaikan, menegakkan agama Allah dan membela hak-hak yang teraniaya. Ketiga, terikat dengan aturan seperti musuh yang jelas, tidak boleh membunuh orang-orang tua renta, perempuan, dan anakanak yang tidak ikut berperang. Harus profesional Menurut anggota Komisi I dari Partai Hanura Susaningtyas Nefo H Kertopati penembakan mati terduga teroris tidak tepat. Sebab, menurutnya dengan cara seperti itu akan sulit membongkar embrio dan jaringan teroris. Sama dengan politisi Hanura sejumlah tokoh masyarakat juga menyesalkan tindakan ‘’hantam kromo’’ Densus 88. Masalahnya, merekayangtewasitumasihharusdibuktikan kesalahannya di depan hukum. Apa benar teroris? Kalau mereka ditangkap hidup-hidup banyak manfaatnya buat penyidik guna mendapatkaninformasiseputarjaringanterorisme. Dan yang terpenting, tidak melanggar hak asasi manusia untuk hidup. Sebab, dugaan, sangkaan belumlah bisa dianggap bersalah. Apalagi hukum kita menganut asas praduga tak bersalah sehingga harus melalui proses pengadilan dulu. Kepala Badan Nasional Penanggulangan Terorisme (BNPT) Ansyaad Mbai mengakui hingga saat ini belum ada cara lain selain langsung mengeksekusi para terduga teroris. Apakah benar penjelasan Ka. BNPT itu? Rasanya tidak juga.Sebab, banyak teknik yang bisa dilakukan petugas Densus 88 jika mereka profesional. Kalau saja di antara mereka yang berenam satu atau dua di antaranya dapat dilumpuhkan atau tewas, mungkin rekanrekannya akan menyerah. Atau dengan mengadakan komunikasi, membujuk ‘’akan diperlakukan manusiawi sesuai hukum yang berlaku’’ maka besar kemungkinan mereka akan mengangkat bendera putih dan keluar daritempatpersembunyiannyatanpaadegan tembak-menembakyangmengerikandimata masyarakat. Di sinilah Densus 88 Antiteror Polri perlu mendapat pelatihan lagi agar kasus-kasus pe-nangkapan teroris tidak selamanya berakhir dengan kematian. Apalagi cara-cara yang dilakukan Densus 88 selama ini tidak membuat jaringan terorisme semakin surut malahan semakin berkembang biak. Tidak

tertutupkemungkinanaksiterorismesemakin mengancam masyarakat di tahun politik ini terutama menjelang Pemilu 2014. Penutup Masyarakatmemberiapresiasiataskeberhasilan Densus 88 selama ini. Dan pasti akan lebih memujanya bila tingkat keterampilan Densus ditingkatkan, sehingga sasarannya dapatditangkaphidup-hidupuntukkeperluan penyidikan dan hukum. Kalau memang ingin membunuh tersangka teroris tidak perlu waktu begitu lama menewaskan enam orang yang terkepung di sebuah rumah di Banten. Cukup beberapa jam saja untuk menghabisi target sasaran. Wajar kalau muncul sikap pro dan kontra di tengah masyarakat dan mempertanyakan kebenaran target tewas apa betul teroris? Kiranya Densus 88 perlu bekerjasama dengan elemen masyarakat setelah terbukti tindakan represif saja tidak mampu menghabisi jaringan teroris. Dengan begitu upaya preventif atau pencegahan bisa dicoba dan diintensifkan untuk menangkal paham radikalisme dan terorisme.*** Penulis adalah Wapenjab Waspada

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * Wagubsu: Apresiasi mantan gubernur minim - Salah siapa, dosa siapa? * PLTP Sarulla diminta rekrut warga Pahae - Biar tak timbul kecemburuan sosial * Para Caleg rentan terkena gangguan jiwa - Makanya jangan yakin kali terpilih o ak D W



WASPADA Jumat 10 Januari 2014


DebirokratisasiRantaiPeringatanBencana Korupsi Di Aceh Merajalela Kasus korupsi di Aceh sangat banyak sudah terjadi. Indikasinya ditandai banyaknya proyek yang tidak sesuai harapan dan cenderung asal-asalan. Banyak proyek rehabilitasi dan pembangunan infrastruktur di Aceh, sehingga sangat mungkin terjadi penyelewengan. Bahkan pasca Pilkada di Aceh, para bupati terpilih banyak yang menyelewengkan APBD untuk kepentingan pribadi atau kelompoknya, termasuk uang reintegrasi yang seharusnya diterima mantan anggota GAM juga dikorupsi. Pada saat ini, Polisi Nanggroe Aceh Darussalam sedang membidik 14 kasus korupsi yang terjadi di Aceh sepanjang tahun 2009. Empat di antaranya kasus dugaan korupsi yang terjadi pada Badan Rehabilitasi dan Rekonstruksi (BRR) Aceh-Nias. Kapolda sudah menegaskan, polisi tidak main-main dalam menangani tindak pidana korupsi yang terjadi di Aceh. Agar data yang diperoleh polisi lebih akurat, kapolda meminta bantuan BPKP mengaudit proyek terindikasi korupsi, agar segera diketahui berapa kerugian yang disebabkannya. Pihaknya meminta seluruh jajaran Polres yang menangani kasus dugaan korupsi ini agar mengusutnya hingga tuntas, sehingga upaya-upaya yang merugikan negara bisa dihilangkan. Ke 14 kasus yang sedang ditangani polisi itu, di antaranya, proyek pembangunan irigasi pada supervisi jaringan sub di Arakundo. Lalu, kasus pembangunan pengamanan pantai di Pidie, Lhokseumawe, dan Aceh Utara dengan nilai indikasi korupsi Rp170,7 juta lebih. Ada juga kasus dugaan korupsi rehabilitasi Krueng Neg, Krueng Doy, dan Krueng Titi Panjang sebesar Rp150,5 juta lebih. Polisi, BPKP dan aparat yang berwenang di NAD sebaiknya menuntaskan kasus korupsi yang semakin meningkat di Aceh. Korupsi uang reintegrasi juga harus diusut tuntas, kemana uang yang seharusnya di terima mantan anggota GAM itu. Syathariah Mahasiswa Universitas Malikussaleh

Guru Deliserdang Merana Membawa Dusta MembacaWaspada di ruang rubrik pembaca Guru Deliserdang sengsara membawa derita (18/12/2013) sangat mengejutkan dan memprihatinkan. Sebab digembar gemborkannya program Cerdas tapi tidak cerdas untuk guru hanya cerdas untuk pejabat. Sebab dana sertifikasi guru Deliserdang tahun 2012 dan 2013 belum juga cair. Guru sudah mengadu ke DPRD Deliserdang dimana dalam perdebatan tersebut ada disinyalir dana sertifikasi 2012 digunakan untuk Pilgub, benar atau tidak yah pejabat yang tahu, semoga tidak yahhhhhhhhhh kasihan guru sempat tunggakan 2012 belum juga dicairkan. Demikian juga lambatnya pembayaran sertifikasi guru tahun 2013 ada kaitannya dengan Pilkada Deliserdang untuk memenangkan salah satu calon, benar atau tidak yahhhhhh namanya isu. Agar tidak ada isu segerakan bayar uang sertifikasi guru tahun 2013 lunas jangan ada lagi tunggakan seperti tahun 2012, demikian juga non sertifikasi guru juga harus dibayar. Kasihan melihat guru Deliserdang sebab uang makan tidak ada, tambahan penghasilan guru berupa insentif non sertifikasi dari APBD tak pernah dapat bertahuntahun. Demikian juga insentif untuk bantuan provinsi ke kabupaten untuk guru juga tak jelas selama 4 tahun. Padahal kita tahu guru terlilit utang untuk biaya anak sekolah. Bila dibiarkan terus menerus demikian maka guru Deliserdang sengsara membawa derita pas dan tepat. Karena itu bayarlah kepunyaan guru yakni sertifikasi yang menunggak tahun 2012 dan 2013 dan uang bantuan provinsi ke guru. Kasihanilah guru-guru dan peduli terhadap kesejahteraan guru, guru Deliserdang sengsara membawa derita dan merana, padahal kita tahun uang tersebut untuk biaya sekolah, kebutuhan sehari-hari dan membayar utang sebab guru 80 persen dililit utang di bank.

Oleh Dimas Salomo Sianipar Perlu dikaji debirokratisasi pemberian arahan evakuasi sehingga tidak memerlukan birokrasi berbelit agar masyarakat dapat diselamatkan dalam waktu singkat.


asihingatkahkitakejadiangempabumi outer rise Aceh 11 April 2012? Tim Kaji Cepat Bersama Lembaga Ilmu Pengetahuan Indonesia(LIPI)menemukanterjadibeberapa kesalahan birokrasi yang panjang mengakibatkan kekacauan dalam rantai sistem peringatan dini bencana tsunami.Tujuan tulisan inimemberikangagasanperludilakukankajian debirokratisasi terhadap rantai sistem peringatan dini bencana. Permasalahan birokrasi dalam rantai peringatan dini bencana mengerucut pada upaya menyelesaikannya melalui debirokratisasi. Perlu dicatat bahwa jangan sampai birokrat yang seharusnya merupakan pelayan masyarakat justru merugikan masyarakat. Hal ini tentunya sangat bertentangan dengan tujuan konstitusional NKRI dimana penguasaan negara sebesar-besarnya untuk kemakmuran rakyat serta melindungi segenap tumpah darah bangsa. Debirokratisasi lebih ke bagaimana memperpendek jalur birokrasi danmengembangkanpartisipasipublikdalam birokrasi. Contohnya prosedur yang menimbulkan kemacatan dalam rantai peringatan dini bencana diubah menjadi prosedur yang melancarkan proses tersebut. Birokrasi Dan Bencana Sistem peringatan dini bencana merupakan sistem yang dikerjakan birokrasi dalam hal ini instansi pemerintahan yang terlibat di dalamnya. Misalnya Sistem Peringatan DiniTsunami Indonesia (Indonesia Tsunami EarlyWarning System – InaTEWS) memiliki tiga komponen birokrasi yaitu komponen operasional(menanganipemantauan,pengolahan, analisa dan desiminasi warning tsunami), komponen mitigasi dan tanggap darurat serta komponen pembangunan kapasitas (capacity building). Pendirian InaTEWS merupakan program nasional di bawah koordinasiKementerianNegaraRisetdanTeknologi dan melibatkan 16 instansi nasional. Selain pemerintah pusat, dalam rantai sistem peringatan dini tsunami ini juga terdapat peran penting pemerintah daerah (Pemda). Dalam masa otonomi daerah dewasa ini, kepala daerah sebagai pemimpinnya dipilih langsung oleh rakyatnya. Siapa saja, dari berbagai latar belakang, memungkinkan terpilih menjadi kepala daerah. Lantas bagai-

Rizal Ns Warga Deliserdang

Perilaku Tak Sesuai Akidah Sebagaimana biasanya setelah shalat Subuh Berjamaah di Subuh Minggu di Masjid itu Pak Imam yang merangkap ustadz memberikan Tausiahnya. ustadz yang di datangkan bergantian pula. Sebagaimana biasanya setelah tausiah selesai diberikan Pak Ustadz bertanya kepada jamaah, “ada pertanyaan??” Pertanyaan dari 2 orang bapak-bapak, telah selesai di jawab, lalu Pak Ustadz bertanya pula kepada kaum ibu-ibu, “ada pertanyaan?” Ternyata di Subuh Minggu itu kaum ibu-ibu tidak ada yang mengajukan pertanyaan. kemudian Pak Ustadz menimpali pula, “ibu-ibu, beberapa hari lagi akan ada pergantian Tahun Masehi, ibu-ibu harus bisa menghempang anak-anak nya supaya jangan bermain-main terompet, itu bukan milik kita, itu bukan budaya kita. Kenyataannya apa yang kita lihat dan rasakan, bunyi terompet bertalu-talu di mana-mana, tidak terkecuali disekitar Masjid dimana Pak Ustadz memberikan ceramah di hari sebelumnya, di sumbang pula dengan suara mercon-mercon yang berdentuman disana-sini. Kalaulah permainan terompet-terompetan ini dilakukan oleh anak-anak seusia TK atau SD, bermain mercon-merconankan tidak dilakukan oleh manusia-manusia se usia dan sependidikan mereka, bahkan dilakukan oleh yang berstatus ayah-ayah. Kesimpulannya, apakah yang kita perdapat di dalam kenyataan-kenyataan ini? “Sedari masih kecil saja anak-anak kita tidak mampu menghempang kemanuannya yang tidak sesuai akidah apalagi setelah menginjak usia dewasa, apalagi orang yang seharusnya jadi panutan turut terlibat di dalamnya. Ragam kejahatan yang dilakukan oleh generasi muda kita pasti curiga dan mungkin telah mengetahui peranan mereka. Masalanya selalu tidak berada di rumah pada malam hari, pulang pagi atau tidak pulang berhari-hari ke rumah. Kalaulah ada pertanyaan dan pertanyan itu harus dijawab, jawabanya,” Saya sudah tidak mampu lagi.” Subhanallah. Syahruddin Mantan Atlet Trilomba Nasional

merlukan pembenahan menyeluruh dalam pola manajemen Pusdalops. Perlu dikaji juga debirokratisasi pemberian arahan evakuasi sehingga tidak memerlukan birokrasi berbelit dengantujuanmasyarakatdapatdiselamatkan dalam waktu yang singkat. Filosofi dari peringatan dini yaitu tersedianya waktu yang cukup (golden time) untuk menyelamatkan diri bagi masyarakat beresiko bencana. Golden time yang sangat singkat ini akan semakinberkurangjikadiseminasiperingatan dini dan arahan evakuasi harus melalui rantai birokrasi yang berbelit dan panjang. Birokrasi arahan evakuasi yang berbelit itu yaitu penyampaian peringatan dini pertama harus melalui pengolahan informasi di tingkat provinsi, pemberian informasi dan persetujuan Komando Pengendalian (Komdal) tingkat provinsi yang setidaknya terdiri atas gubernur, wakilgubernur,PangdamdanKapolda.Lantas bagaimana jika anggota Komdal sulit dihubungi dan tidak memahami sepenuhnya penanggulangan bencana. Belum lagi arahan evakuasi ke tingkat kabupaten/kota beresiko bencana juga membutuhkan waktu yang mengurangi golden time secara signifikan. Hasil Kaji Cepat Bersama LIPI tersebut juga

ntuk apa kita mengadakan pemilihan umum (Pemilu)? Pertanyaan tersebut perlu dicuatkan kembali karena adanya kerancuandalampersiapanpelaksanaanPemilu2014. Konsentrasikitalebihtertujukepadapersoalan teknis, sementara esensi dari tujuan melaksanakan pemilu malah kita tempatkan di belakang. Sejatinya Pemilu Tidakperlumalu-maluuntukmengatakan bahwapemiluditujukanuntukmemperebutkan kursi kekuasaan. Atau, secara blak-blakan katakanasajabahwaPemiluuntukmemperebutkan kursi kepresidenan. Mengapa kursi kepresidenan itu menjadi tujuan? Karena landasan pendirian sebuah partai politik adalah untuk memperjuangkan platformpolitik,yangdiyakiniakanbisamembawa bangsa dan negara meraih kemajuan. Posisipresidenmenjadisangatpentingkarena dialah eksekutif tertinggi di sebuah negara. Putusanyangdiambilnyasangatmenentukan bagi bisa diaplikasikannya platform partai, yang diharapkan bisa mengangkat kesejahteraan rakyat dan memajukan negara. Selanjutnya, untuk apa Pemilu anggota parlemen? Untuk mendukung langkah presiden agar platform politik yang ditujukan bagi kepentingan bangsa dan negara itu mendapat dukungan parlemen. Meski seorang presidenmerupakanpejabateksekutiftertinggi dan memiliki kekuasaan yang sangat besar, bukan berarti seorang presiden bisa bertindak sewenang-wenang. Check And Balances Presiden harus diawasi agar segala tindakannyabenar-benarditujukanuntukkepenti-

ngan bangsa dan negara, tidak diselewengkan untuk kepentingan lainnya. Parlemen memberikan rambu-rambu agar seorang presiden tetaplurusdengantanggungjawabnya,bekerja untuk kepentingan bangsa dan negaranya. Pengawasan merupakan salah satu tugas utama dari parlemen, di samping melakukan fungsilegislasiataumembuatundang-undang dan membuat anggaran, agar pemerintah bisamelaksanakanjanjinyamengangkatkesejahteraan rakyat dan membawa kemajuan bagi negara. Dengan dukungan dari parlemen, yang idealnyaberasaldaripartaiyangsama,seorang presiden lebih mudah melaksanakan programnya. Itu otomatis mendukung pelaksanaan platform Paprol tersebut. Karena kuncinya adalah adu program dan adu platform seorang presiden—sepantasnya titik berat Pemilu adalah pemilihan presidennya. Para calon presiden diminta menjelaskan apa yang mereka lihat tentang persoalan bangsa ini. Lalu, apa yang melandasi keyakinan bahwa sebagaipresidenakanmampumenyelesaikan persoalan tersebut. Platform seperti apa yang mereka usung membawa Indonesia keluar dari krisis dan kritis ini? Semua hal itu harus disampaikan secara terbuka. Bahkan sesekali diuji untuk mengukur konsistensi Capres untuk menjalankan program dan platformnya kelak. Dari sanalah kemudian rakyat bias menentukan siapa dari calon yang ada itu yang diyakini bisa menyelesaikan persoalan bangsa dan negara. Begitu pentingnya rakyat mengenal calon pemimpinnya dan juga mengetahui kualitas kepemimpinannya, seharusnya ada waktu yang cukup memadai bagi para calon untuk

memperkenalkan diri. Bahkan negeri seperti Amerika Serikat memberikan waktu khusus bagi pemilihan presiden agar seluruh konsentrasi rakyat tertuju untuk mengetahui benar calonpemimpinnya.Meskisecarabersamaan adapemilihananggotaDPR(houseofrepresentative), hal itu tidak mengurangi perhatian kepada pemilihan presiden. Bahkan, secara sadar, pemilihan anggota senat dilaksanakan dua tahun setelah pemilihan presiden . Ironinya, di Indonesia, kita justru menempatkan isu pemilihan presiden di belakang. Meskisudahmunculnama-namacalon,hanya beberapa saja yang sudah pasti akan diajukan Parpol tertentu. Adanya aturan yang membatasi seseorang dicalonkan sebagai presiden membuat banyak calon dan Parpol menjadi ragu untuk maju ke pemilihan presiden. Hal tersebut yang membuat pemilu kita jadi terasa aneh. Fokus kita lebih tertuju kepada urusan teknis dan paling jauh urusan calon anggota legislatif, sementara isu utama, yakni siapayangakanmemimpinnegeriini,menjadi terkebelakangkan. Tidak usah heran apabila rakyat tidak pemah mengetahui program dan platform yang akan diusung para calon presiden. Kalaupun sudah muncul wacana siapa presiden pilihan, kita tidak pemah mengetahui langkah yang akan dilakukan para calon itu kelak. Pemilihan presiden bahkan kemudian cenderunglebihdianggapsebagaimain-main atau sebuah hiburan belaka. Melalui SMS atau teknis polling lainnya, rakyat diajak menentukanpilihannya,tanpamerekatahusiapa sebenamya orang yang akan mereka pilih. Tidak usah heran apabila nama yang muncul sekadar terkenal, padahal bisa jadi orang itu tidak bemiat menjadi presiden. Virus Disorientasi Pemilihanumumsebenarnyadapatdigunakan membasmi virus disorientasi akut yang menjangkiti anggota parlemen maupun pejabat publik periode sebelumnya. Fakta membuktikan, virus disorientasi lebih berbahaya dibandingkansapigila,atau fluburung.Kualitas fisik dan batin penderita mengalami deteriorasi kronis akibat virus ini. Tiba-tiba penderita

Sambung dari hal C6 kolonial. Di tengah situasi ini MS ingin agar pers tetap terjaga kehadirannya sebagai obor pemberi kebenaran informasi. Apalagi di masa itu tidak ada koran pembela republik yang berjuang mempertahankan kemerdekaan. Karena itu, MS bertekad kuat mendirikan surat kabar di tengah kemelut politik masa itu. Tekad itu diwujudkannya dengan mendirikan Waspada 11 Januari 1947. Inilah harian besok, 11 Januari 2014 dirayakan hari kelahirannya ke 67 tahun. Pasca kemerdekaan di Sumatera Utara MS tidak hanya membenamkan dirinya dalam jagad pers, tetapi juga ia menambatkan dirinya dalam politik dan pernah pula memimpin Partai Nasional Indonesia (PNI) CabangMedan.Iatidakhanyamenjadipimpinan partai, tetapi juga menjadi aktivis politik yang turun ke jalan melalui Kongres Rakyat dengan membubarkanNegaraSumateraTimur(NST) tahun1950.NSTadalahnegarabonekabentukan Belanda yang hendak mengembalikan romantisme masa lalu Belanda di Sumatera Utara. NST berhasil dibubarkan dan di tahun 1950 terbentuklah provinsi Sumatera Utara.

Aktivisme sosial politik yang menyelimuti tubuh MS ini sangat memengaruhi basis pemikirannya dalam memroduksi karya ilmiahnya seperti Aceh Sepanjang Abad, Koeli Kontrak Tempo Doeloe,Sejarah Pers di Sumatera Utara, Soetan Koemala Bulan dan satu tulisan berbahasa Inggris, What Was Social Revolution in East Sumatra, yang terbit di jurnalinternasionalbergengsiterbitanUniversitas Cornell Amerika. Selain karya ilmiahnya yang terkenal ini masih banyak tulisan lain yangtersebardanbelumterkumpulkanuntuk keperluan publikasi. Jika dilihat dari latar belakang pendidikannya MS adalah sekolah rendahan, tetapi karena di masa itu ia menguasai bahasa pengetahuan (bahasa Belanda dan Inggris) dan menyaksikan bekerjanya pengetahuan dipakai kekuasaan kolonial untuk mengelola bangsanya sendiri, membuat MS sangat kritis menganalisis berbagai persoalan sosial dan politik saat itu. Karya magnum opusnya, Aceh Sepanjang Abad yang setebal bantal itu tidak akan mungkin selesai tanpa menguasai bahasa pengetahuan (Belanda)—sehingga dapat me-

nyisir berbagai arsip dan dokumen Belanda untuk menyelesaikan karyanya ini. Begitu juga dengan Koeli Kontrak Tempo Doeloe dan Sejarah Pers di Sumatera Utara, lagilagi melalui bahasa pengetahuan itu ia dapat membongkar kekejaman para baron Eropa yang mengeksploitasi buruh perkebunan dan kesaksian langsung bekerjanya mesin kekuasaankolonialmenindasparaburuhyang mengalirkan surplus ekonomi ke negeri induk kapitalismekolonial,theNetherlands,sehingga menjadi sumber akurat pemikirannya menganalisis persoalan buruh dan pers masa itu. Jika dilihat dari pemikiran dan karya besarnya dapat dikatakan MS adalah seorang the big thinker, pemikir besar di masanya. Sebagai pemikir besar ia tidak berada di menara gading sebagai mana banyak ilmuwan dan akademisi perguruan tinggi yang menghindar bertangan kotor dan mengambil jarak dengandenyutnadimasyarakatnya.MSadalah pemikirbesarsekaligusmeminjambahasanya Antonio Gramsci seorang intelektual organik, yang sedari mulanya menceburkan diri dan membela rakyat kecil. MS seorang jurnalis

Mahasiswi Tinggal Di Medan Guru Honor Di Deliserdang

Pajak dan jalan di Deliserdang hampir 80 persen hancur, mengapa bisa demikian? Contoh jalan di wilayah Batang Kuis bahkan di tengah kota jalan hancur. Sungguh mengerikan pembangunan di Deliserdang yang tak peduli terhadap perbaikan jalan. Sebagai contoh di Batang Kuis belum lagi di Kutalimbaru, Diski, Tembung, Pancurbatu, dan lain-lainnya. Kasihan warga Deliserdang yang jalannya kupak kapik. Demikian juga pajak tradisional di setiap kecamatan kumuh dan becek dan tak terawat, hampir seluruhnya di setiap kecamatan pajak dan pasar hancur lebur jadi bubur. Contoh pajak Batang Kuis di tengah kota kecamatan yang hancur dan kumuh demikian juga pajak di Tanjungmorawa yang kumuh, becek dan semrawut, bukan saja di Tanjungmorawa dan Batangkuis tetapi hampir di setiap kecamatan pajak dan pasar kumuh, kusam dan becek, kasihan masyarakat Deliserdang. Kapan jalan-jalan di Deliserdang yang rusak dan hancur diperbaiki demikian juga pajak tradisionalnya yang kumuh, becek dan kusam? Deliserdang cocok nya kabupaten jalan terjelek di Indonesia bahkan predikat terjelek di dunia demikian juga pajak tradisionalnya dapat dipredikatkan terjelek di Indonesia bahkan di dunia. Tolong diperhatikan jalan dan pajak Pak Bupati jangan dibiarkan jalan berlobang-lobang dan pajak kumuh dan becek, sehingga masyarakat senang dan perekonomian lancar kapan terealisasinya yah,,,,,,, kita tunggu saja

Gempa Aceh Rabu, 11 April 2012 pukul 15.40, tersebar cepat informasi terjadi gempabumi besar serta ancaman tsunami terhadap pesisir Barat Sumatera. Penulis menyoroti beberapa laporan yang menyebutkan bahwa sirine warning tsunami tidak berbunyi atau berbunyi lebih dari 30 menit setelah gempabumi. Ini kesalahan fatal. Juga tidak adanya arahan evakuasi kepadamasyarakatsecaratepatwaktusehingga kekacauan lebih dahulu terjadi. Informasi peringatan dini seharusnya diterjemahkan dengan cepat dan tepat menjadi arahan evakuasi oleh pemegang otoritas lokal. Log book sirinediBMKGmemperlihatkan tidak ada tanda-tanda sirine yang diaktifkan pemerintah daerah 10 menit setelah dikeluarkannya peringatan dini 1. Berdasarkan kenyataan itu, BMKG memutuskan mengaktifkan sirine sesuai kesepakatan bahwa jika lebih dari 10 menit ada potensi tsunami tetapi sirine tidak diaktifkan Pemda, maka BMKG akan mengaktifkannya dari jarak jauh. Sirine yang dinyalakan belakangan menimbulkan kebingungan karena BMKG mengambilalih pengaktivasian sirine itu dari Jakarta. Hal ini merupakan contoh birokrasi berbelit dan membingungkan dalam rantai peringatan dini bencana. Tidak ada salahnya pengaktivan sirine ini langsung dilakukan BMKG dari Jakarta secara langsung saat peringatan dini pertama didiseminasikan mengingat teknologi sekarang sudah memungkinkan untuk hal tersebut. Selain itu, kenyataan bahwa tidak adanya operator jaga di kantor-kantor Pusdalops Penanggulangan Bencana saat kejadian me-

menunjukkan tidak adanya mekanisme konfirmasi (feed back) untuk mengetahui seluruh informasi peringatan dini telah terkirim dan diterima secara tepat waktu oleh otoritas lokal. Contoh-contoh di atas memberikan fakta bahwa sistem peringatan dini memerlukan kajian debirokratisasi. Terkait contoh di atas, penulis mengusulkan kajian debirokratisasi yaitu dengan menerapkan SOP bahwa pengaktifasian sirine bersamaan dengan diseminasi peringatan dini pertama langsung dari BMKG Jakarta. Selain itu, BMKG juga diperbolehkan langsung memberikan arahan evakuasi langsung kepada operator jaga 24/ 7 di kantor-kantor daerah tingkat kabupaten/ kota, tanpa melalui pemerintah provinsi sehinggatidakadapotensipengurangangolden time. Hal ini juga didukung bahwa BMKG merupakaninstansiyangbekerja24/7dengan pemberlakuan sistem gilir jaga (shift). Usulan ini mengharuskan dilakukannya peninjauan kembali kepada PP 21 Tahun 2008 tentang penyelenggaraan penanggulangan bencana. Penulis adalah Staf Badan Meteorologi Klimatologi Dan Geofisika Wilayah I Medan.

Pemilu Dan Virus Disorientasi


Pajak Dan Jalan Deliserdang Hancur

mana jika kepala daerah terpilih tidak memahami tentang sistem penanggulangan bencana atau setidaknya tidak tahu konstruksi regulasi yang ada dalam rantai peringatan dini. Apalagi Badan Penanggulangan Bencana Daerah (BPBD) sebagai ujung tombak yang bertindak di daerah beresiko bencana dalam sistem peringatan dini sekarang merupakan Satuan Kerja Perangkat Daerah (SKPD) yang mana posisi-posisi strategis pengambil kebijakan terkait penanggulangan bencana tersebut bisa merupakan jabatan politik yang mudah diutak-atik seorang kepala daerah—belum tentu pejabat yang ditunjuk memahami penanggulangan bencana.

Oleh Ahmad Arif Ginting Pemilu sebenarnya dapat digunakan membasmi virus disorientasi akut yang menjangkiti anggota parlemen maupun pejabat publik periode sebelumnya.


kehilangan akal sehat, perasaan, rasa kepatutan, dan juga hati nurani. Virus disorientasi hidupsuburdilingkunganpolitikyangkumuh, seperti air parit. Joroknya lingkungan seperti itu telah menjungkirbalikkan akal sehat, melanggar nilai dan norma sosial, mengabaikan rasa keadilan, dan mengacuhkan kepentingan rakyat.Adapulakutuloncatyanghobiberganti Parpol.Virus tersebut mudah menjalar lewat koran, televisi, maupun obrolan.Virus disorientasiberasaldariulahpolitisi/pejabatbusuk. Entah kenapa mereka tidak segera dikebumikan sebelum membusuk ditelan belatung. Namanya juga politics, yang dalam bahasa Latin berarti poli (banyak) dan tics (makhluk pengisap darah yang menyebalkan). Mereka busuk karena otak mereka bebal, wajah tebal, hati nurani ba’al, dan kehilangan akal. Itulah jika terlalu lama berpolitik dan terlalu jenuh berkuasa. Dan temyata, kelompok politisi/pejabat busuk itu beranak-pinak cepat. Bak makhluk seram dalam film Alien, mereka membuat koloni dengan menariksekutudarikalangankampus,LSM,pengusaha,sampaidariduniahiburan.Orang-orang busuk ini sebenarnya ganjen. Walau sudah tenar dan kaya, mereka merambah ke manamana bagaikan Dasamuka berganti wajah. Utang belum lunas, mikir belum genah, eh mendadak mau jadi calon presiden. Sudah taklakulagijadibintangsinetronataupelawak, tiba-tiba jadi Caleg. Mungkin vaksin terampuh adalah rakyat bersikap pasrah, seperti kata pujangga nenekmoyang kita, Ronggowarsito, yang menulis Serat Kalatida di tahun 1873, “Hidup di dalam zaman edan, memang repot. Akan mengikut tidaksampaihati.Tetapi,kalautidakmengikuti geraknya zaman tidak mendapat apa pun juga. Akhimya bisa menderita kelaparan. Namun, sudah menjadi kehendak Tuhan. Bagaimana pun, walau orang yang lupa itu bahagia, tetapi masih lebih bahagia lagi orang yang senantiasa ingat dan waspada.”

cum intelektual organik. Saya percaya saat ini tidak akan ada lagi dari lingkungan jagat jurnalis dapat menghasilkanthebigthinkersekelasMSyangsekaligus menjadi intelektual organik. Apalagi di tengahmenebalnyakulturplagiasiyangmerajalela di beranda perguruan tinggi, dari lingkungan kampus pun akan semakin sukar melahirkan pemikir besar seperti MS. Semoga seminar The Big Thinkers: Melacak Pemikiran Mohammad Said dan Ani Idrus, yang diselenggarakan Fakultas Ilmu Budaya dan Harian Waspada 11 Januari 2014 ini dapat menjadi awal penggalian pemikiran sosial politik MS untuk pengembangan ilmu sosial di Sumatera Utara.

Penulis adalah Pendiri Rumoh Baca Aneuk Nanggroe (RUMAN) Aceh.

Penulis adalah Sekretaris Program Studi Ilmu Sejarah, Fakultas Ilmu Budaya USU.Tulisan Ini Merupakan Makalah Yang Disampaikan Pada Seminar The Big Thinkers: Melacak Pemikiran Mohammad Said dan Ani Idrus, Diselenggarakan Fakultas Ilmu Budaya USU dan Harian Waspada, Di Medan, 11 Januari 2014.




06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 terkini 11:03 Lanjutan FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:00 Liputan 6 Terkini 16:03 Lanjutan Eat Bulaga indonesia 16:30 SL Liputan 6 Petang 17:00 Bidadari-Bidadari Surga 18:15 Si Cemong 19:45 Cinta yang Sama 21:00 Emak Ijah Pengen Ke Mekah 22:30 SCTV FTV Utama

07:00 Kisah Unggulan 08:30 Pose 09:00 Layar Unggulan 11:00 Di Antara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Top Pop 15:00 Lintas Petang 15:30 Animasi Spesial 16:30 Tuntas 17:00 Biru 18:10 Juna Cinta Juni 19:10 Cinta Itu Anugerah 20:20 Gajah Mada 21:20 Raden Kian Santang 23:00 Suka-suka Uya 00:30 Lintas Malam 01:00 Sidik

07:30 Hati Ke Hati Bersama Mamah Dedeh 08:00 Seleb @ Seleb 08:30 Scooby DooWhere AreYou 09:00 Curious George 09:30 Marsha & The Bear 10:00 Fenomania Hits 11:00 Ngobrol Asik 11:30 New Friends 12:00 Topik Siang 13:00 Seputar Obrolan Selebriti 14:00 Tom & Jerry 14:30 Bima Sakti 15:00 Curious George 15:30 Mr. Bean 16:00 Angry Birds Toon 16:30 Topik Petang 19:30 Pesbukers 20:30 Campur-Campur 21:30 RT Sukowi 23:55 Sinema Spesial

08:30 Sinema Pagi 10:30 KISS Pagi 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 HOT KISS 15:00 Fokus 15:30 Drama Korea Sore: Jewel In The Palace 16:30 Drama Korea Sore: Full House Take 2 18:00 Drama Seri Indonesia: Aku BUkan Anak Haram 19:00 Sinema Indonesia: Si Buta Dari Lembah Hantu 20:00 Sinetron Unggulan: DamarWulan 21:00 Take Me Out Indonesia 23:00 One FC

07:05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 11:05 Sisi Berita 11:30 Metro Siang 12:05 Road To Eagle Awards 2013 13:05 Wideshot 17:05 Metro Hari Ini 18:05 Prime Time News 20:05 Suara Anda 20:30 Healthy Living 21:05 Top 9 News 21:30 Mata Najwa 2 2 : 3 0 S t a n d Up Comedy Show 23:05 Realitas

WASPADA Jumat 10 Januari 2014

07:30 YKS Best Moment 08:30 Sinema Spesial Liburan 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:30 Show Imah 16:30 Reportase Sore 17:00 Sinema Indonesia Sore 19:00 Oh Ternyata 20:00 YKS 22:30 Bioskop TransTV 00:30 Harta Tahta Wanita 01:00 Reportase Malam

07:00 Apa Kabar Indonesia Pagi 09:00 Tempo Hari 09:30 Kabar Pasar 10:00 Coffee Break 11:30 Kabar Siang 13:00 Kabar Haji 2013 13:30 Ruang Kita 14:30 Kabar Pasar 15:00 Coffee Break Sore 15:30 Kabar Pemilu 16:00 Menyingkap Tabir 16:30 Sorotan Kasus 17:00 Kabar Petang 19:30 Indonesia Lawyers Club 22:30 Kabar Malam 23:30 Kabar Hari Ini

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:00 Spongebob Squarepants 07:30 The Penguins Of Madagascar 08:00 Thomas and Friends 08:30 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Seleb On Cam 13:00 Super Hero Kocak 14:00 Unix14:30 Fokus Selebriti 15:00 Awas Ada Sule 16:00 Canda Lucu Bikin Ketawa 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:30 Big Movies

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Ga Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Laptop Si Unyil 13:00 Si Bolang 13:30 Dunia Binatang 14:00 Tau Gak Sih 14:30 Brownies 15:00 Jejak Petualang 15:30 Redaksi Sore 16:30 Indonesiaku 17:00 Orang Pinggiran 18:00 On The Spot 19:00 Opera Van Java 21:00 Hitam Putih 22:00 Bukan Empat Mata 23:30 Dua Dunia **m31/G

Eurythmics Reuni Untuk Konser Persembahan Beatles

The Amazing Spider-Man 2

Film-FilmTopTahun2014 Film-film top tahun 2014 bakal beredar dan sangat ditunggu penggemar layar lebar dibintangi aktor dan aktris terkenal serta diarahkan sutradara kawakan dimulai dari Martin Scorsese, David Fincher diantaranya: 1. Interstellar dirilis 24 November dibintangi Christopher Nolan setelah sukses dengan film Batman. Film ini didasari pada ide orijinal Nolan bersaudara dan kolaborator Jonathan menonjolkan satu tim eksplorasi dan ilmuan melakukan perjalanan di lobang cacing. Film ini juga dibintangi Matthew McCounaughey, Anne Hathaway dan Jessica Chastain. Instellar menjanjikan petualangan orijinal, imajinatif dan kecerdasan sain fiksi. Sebelumnya Nolan membintangi film Inception. 2. Gone Girls film diangkat dari novel karya Gillian Flyn mengisahkan tentang seorang pria gagal mencari istrinya yang hilang. Produksi ini disutradari David Fincher dan Flynn juga menulis naskah film dibintangi Ben Affleck dan Rosamund Pike ini sangat menarik untuk disaksikan di tahun 2014. 3. X-Men: Days of Future Past dirilis pada 22 Mei. Penggemar film dikejutkan dengan kembalinya Bryan Singer dalam seri X-Men bahkan sebelum menyaksikan trailer pertama memadukan kasting asli bersama Patrick Stewart dan Ian McKellen seperti dalam film First Class mereka. 4. The Hunger Games: Mockingjay-Part 1 dirilis 21 November didasari cerita perang karya

Suzanne Collin. Film ini disutradarai Francis Lawrence juga mengarahkan film sekuel Hunger Games: Catching Fire, The Butler dan Game Change ditulis Danny Strong. 5. 12Years a Slave dirilis pada 24 Januari. Film drama Steve McQueen ini diadaptasi dari kisah nyata Solomon Northup diculik dan dijual menjadi budak pada tahun 1840 di Louisiana. Film ini menggasak kemampuan akting Michael Fassbender, Chiwetel Ejiofor dan bintang pendatang baru Lupita Nyong’o. 6. Guardian of the Galaxy film superhero dirilis pada 4 April. Film ini menjadi andalan Marvel sejak terbitnya film The Avenger. Produksi ini dibintangi robert Downey Jr yang berperan sebagai Tony Stark. 7. Inside Llewyn Davis menceritakan pengalaman sulit seorang penyanyi di NewYork sebelum mencapai keberhasilan. Dibintangi Oscar Isaac juga terlibat dalam film Drive. 8. The Hobbit : There and Back Again diterbitkan pada 13 Desember. Film ini digawangi Martin Freeman sebagai Bilbo. Aktor ini juga bermain dalam sekuel film petualangan berjudul The Hobbit: The Desolution of Smaug menonjolkan bandit naga jahat yang diperankan Benedicht Cumberbatch. 9. Veronica Mars diluncurkan pada 14 Maret ini digawangi aktris Kristen Bell.Veronica Mars memaparkan seorang detektif yang kembali ke kampungnya di Neptune untuk menyelidiki pembunuhan melibatkan mantan Logannya dimainkan Ja-

son Dohring. 10.TheWolf ofWall Street dirilis pada 12 Januari memadukan aktor Leonardo DiCaprio dengan sutradara Martin Scorsese. Film ini mengisahkan keberhasilan dan kegagalan agen saham Jordan Belfort yang dipenjara karena melakukan pencucian uang. Film ini juga melibatkan Jonah Hill, Matthew McConaughey dan Jean Dujardin. 11. The Imitation Game dibintangi Benedict Cumberbatch, Keira Knightley, Charles Dance dan Mark Strong. Diramalkan film drama ini menjadikan Cumberbatch masuk nominasi pertama Oscar . 12. The Amazing SpiderMan2 diluncurkan pada 18 April. Film MarcWebb ini diperankan Andrew Garfield dan Dane DeHaan masing-masing memainkan karakter Harry Osborn dan Jamie Foxx yang menjadi ikon kejahatan elektronik. 13. Film Noah dirilis pada 28 Maret diperankan Russel Crowe menimbulkan kontroversi. Disebutkan film Darren Aronofsky ini layaknya film The Fountain. 14. Foxcatcher disutradarai Bennet Miller juga sukses memproduksi film Capote dan Moneyball. Miller kembali berkarya di tahun 2014 ini dengan kisah nyata pembunuhan John duPont. Steve Carrell, seorang pria berambut abu-abu dengan hidung prostetik menjadi bintang utama dalam film ini. 15. Captain America: The Winter Soldier dirilis pada 28 Maret. Produksi ini adalah sekuel film Captain America memaparkan cerita petualangan aksi

dengan Steve Rogers diperankan Chris Evans menjadi tokoh utamanya. Marvel akan terus mengembangkan karya sinematiknya dengan memperkenalkan Robert Redford sebagai Alexander Pierce, bos SHIELD dan Anthony Mackie sebagai Falcon. 16. Divergent bisa juga disebut sebagai film Hunger Games baru. Film trilogi sain fiksi dirilis pada 4 April ini diangkat dari karya Veronica Roth 17. Godzilla dirilis pada 16 Mei merupakan film diangkat dari cerita komik. Film ini dibintangi Aaron Taylor-Johnson, Bryan Cranston dan Juliette Binoche. 18. Trancendence dirilis pada 25 April menjadi loncatan sinematografi Christhoper Nolan memaparkan cerita sain fiksi tentang kelebihan komputer juga sebagai karya kecerdasan fikiran manusia. Aktor Johnny Depp mengatakan film ini menonjolkan penemuan ilmu pengetahuan dan teknologi canggih. 19. Exodus diterbitkan 12 Desember diarahkan Ridley Scott dengan Christian Bale menjadi pemeran utama. Film ini juga menandai reuni antara Scott dan bintang Alien, Sigourney Weaver. Produksi ini juga melibatkan Aaron Paul, Ben Kingsley dan Joel Edgerton. 20. Maleficent dirilis 30 Mei diproduksiWalt Disney. Bintang film Sleeping Beauty, Angelina Jolie kembali ke layar lebar sebagai Mistress of All Evil dalam Maleficent, sementara Elle Fanning berperan sebagai putri Aurora, demikian* Nur

Duo pop Inggris Eurythmics akan reuni pada perayaan ulang tahun ke-50 penampilan The Beatles di acara “Ed Sullivan Show” di Los Angeles pada 27 Januari mendatang. Duo terdiri atas Dave Stewart dan Annie Lennok akan membawakan lagu-lagu The Beatles dalam konser diorganisir Recording Academy, yang menyelenggarakan acara Grammy Awards. Duo terakhir kali tampil bersama tahun 2000 akan berbagi panggung dengan bintang R&B Alicia Keys, John Legend dan juga band pop rock Maroon 5 dalam konser disiarkan TV CBS pada 9 Februari mendatang, demikian seperti dilansir kantor berita Reuters. Konser bertajuk The Night that Changed America: A Grammy Salute to The Beatles ditujukan untuk menghormati penampilan The Fab Four’s di “Ed sullivan Show” pada Februari 1964, disebut sebagai peluncuran musik rock British Invasion. Penyanyi pop John Mayer dan penyanyi country Keith Urban juga akan tampil pada acara itu. Penyabet penghargaan Grammy, Eurythmics, merilis album perdana mereka pada 1981 dan telah menjual lebih dari 75 juta keping rekaman. Mereka bubar tahun 1990 namun secara mengejutkan kembali bersama untuk meluncurkan album kedua dan melakukan tur tahun 1999. Eurythmics terkenal dengan hits Sweet Dreams (Are Made of This) tahun 1983 dan Here Comes the Rain Again setahun kemudian. Mereka tampil sporadis dalam satu dekade terakhir.(ant)


Rossa Dirawat Di Singapura


Penyanyi Rossa dirawat di rumah sakit di Singapura setelah mengaku tidak sehat saat berlibur di Taman Tema Legoland, Nusajaya, Johor bersama keluarganya. Akibatnya Rosa batal menghadiri acara jumpa pers mengenai konser amal Malam Gala Cinta Tanpa Sempadan digelar di Kuala Lumpur pada Rabu (8/1) malam. Datuk Seri Rossa Roslaina Handiyani,35 seharusnya menghadiri jumpa pers bersama penyanyi terkenal lokal Datuk Jamal Abdillah dan seorang lagi penyanyi Indonesia Afgan di Hotel Royal Chulan, demikian dilaporkan media lokal di Kuala Lumpur, Kamis. Rossa diwakili manajernya Puteri Intan dalam jumpa pers tersebut. “Setelah mengadu kurang sehat saya membawa dia ke rumah sakit di Singapura untuk dirawat. Namun dia masih ditahan di rumah sakit itu. Keadaannya kini stabil dan diharapkan bisa diperbolehkan pulang dalam dua hari ini,” kata Puteri Intan. Menurut dia, dokter menyatakan bahwa Rossa perlu banyak istirahat karena terlalu capek bekerja. “Dokter memberitahu, mungkin dia terlalu penat tetapi keadaannya tidak serius. Saya rasa dia cuma terlalu capek karena sejak sebelum tahun baru Rossa sibuk dengan berbagai acara,” katanya. Terakhir kali ia tampil di Langkawi dalam acara Fiesta Magical Langkawi, kata Puteri Intan yang sudah menjadi manajer Rossa selama 14 tahun. Pelantun lagu Ayat-Ayat Cinta tersebut ditemani anak lelakinya Rizky Langit Ramadhan,8 di rumah sakit. Rossa bakal menggelar konser amal eksklusif bersama Datuk Jamal dan Afgan di Hotel Royale Chulan pada 14 Februari.(ant)


Morrissey Garap Novel Pertama Setelah sukses dengan memoarnya tahun lalu, bekas pentolan Smiths, Morrissey, mengungkapkan bahwa dia sedang menulis novel pertamanya. Dalam sesi tanya jawab pada situs penggemar Morrissey, True toYou, penyanyi itu menjelaskan: “Tahun 2013 saya menerbitkan Autobiography dan suksesnya melebihi rekaman sudah saya rilis, jadi, ya, saya sedang menggarap novel.” Penyanyi itu juga mengungkapkan alasannya berbalik ke

fiksi saat menjawab pertanyaan Hanna, seorang penggemar dari Jerman, tentang apakah dia pernah berfikir untuk menulis novel. “Kenyataannya adalah stasiun radio tidak akan memainkan musik saya dan kebanyakan orang kehilangan kepercayaan pada industri musik, dan secara umum dianggap cukup benar bahwa posisi nomor satu di tangga lagu dibeli label rekaman utama, jadi sebenarnya tidak ada gairah yang tersisa dalam musik pop dan rock.” “Semua itu, sekarang, sema-

ta pertanyaan masalah pemasaran. Semua kisah sukses itu aman dan menjemukan, dan kau tidak akan pernah dikejutkan lagu hits yang terdengar keluar tempat. Ini bukan cuma pandangan saya tapi juga semua orang yang saya tahu.” Tentang rencana Morrissey membuat novel, seorang juru bicara pemasar buku Waterstones mengatakan: “Kami akan percaya kalau sudah melihatnya. Tapi jika dia menulis novel, seperti dilakukan Nick Cave sebelumnya, dia akan menemukan penonton

yang siap untuk itu. Itu akan terjual dengan baik dan cepat.” “Jika itu sangat bagus, itu akan dibaca dan dibicarakan dalam waktu sangat lama—saya membayangkan ini tujuan Morrissey selanjutnya,” kata dia seperti dilansir laman The Telegraph. Sebelumnya Morrissey menerbitkan Autobiography. Buku otobiografi diterbitkan Penguin Classics bulan Oktober tahun lalu berada di puncak tangga buku terlaris pada pekan pertama. (ant)


WASPADA Jumat 10 Januari 2014

Disperindag Aceh Dan Pertamina Sidak Penjualan Elpiji 12 kg

Jalan Rusak Bikin Warga Resah BLANGKEJEREN (Waspada) : Jalan lintas utama di Kota Blangkejeren kian rusak. Pasalnya, tidak ada perhatian serius dinas terkait. Akibatnya, kenyamanan pengguna jalan menjadi terganggu. Kerusakan jalan yang parah dan menyebabkan lubang yang menganga cukup besar dan dalam, di Jalan Pengkala depan MIN Blangkejeren. Kondisi jalan sungguh memprihatinkan, jalan tersebut rusak sepanjang 100 meter lebih. “Selain akibat tonasi kendaraan yang sering melintas untuk mendistribusikan bahan material ke salah satu proyek pembangunanan, kerusakan jalan juga dikarenakan drainase di sepanjang jalan itu memang tidak ada,” papar Hamdi, salah satu warga Blangkejeren, kemarin. Dia mengaku kerusakan jalan ini karena banyaknya truk pengangkutan material bahan bangunan, yang melintas sehingga menyebab kekuatan jalan jadi rusak. (cjs)

Marzuki HM Ali Dilantik Sebagai PAW MEUREUDU (Waspada) : Ketua DPRK Abubakar Usman melantik Marzuki M Ali sebagai anggota DPRK PiJay menggantikan Heri Ahmadi yang telah mengabdi selama 4 tahun, Kamis (9/1) melalui rapat paripurna dengan agenda pelantikan Pergantian Antar Waktu (PAW). Dari anggota Partai Kebangkitan Nasional Ulama (PKNU) di DPRK. Diketahui juga, Heri Ahmad merupakan caleg dari Partai Kebangkitan Nasional Ulama untuk anggota dewan periode 2009-2014 dari daerah pemilihan Kabupaten Pidie Jaya. Wakil Bupati Pidie Jaya M Yusuf Ibrahim mengatakan, penggantian antarwaktu anggota DPRK Pidie Jaya dari Partai KNU merupakan hal yang wajar, karena hal ini sudah diatur dalam peraturan perundang-undangan. (b10)

Keluarga Erdi Masliansyam Dapat Santunan SIGLI (Waspada): PT Jasa Raharja (Persero), bersama Satuan Laka Lantas (Sat-Lantas), Polres Pidie, Rabu (8/1) menyerahkan santunan kepada almarhum Erdi Masliansyam berupa uang tunai senilai Rp25 juta, diserahkan Kanit Laka Polres Pidie Aiptu Azuar Effendi, didampingi Ka Sub, PT Jasa Raharja Pidie, Muhammad Rizki Thamrin. Santunan itu diterima istri almarhum, Dian Melanie, di rumah duka, Desa Mns Balek, Kecamatan Meureudu, Pidie Jaya. Kepala Sub Pt.Jasa Raharja, Pidie Muhammad Rizki Thamrin mengatakan, Erdi Masliansyam meninggal dunia dalam kecelakaan, Sabtu (4/1) setelah ditubruk minibus jenis L-300, di jalan negara, lintas Medan-Banda Aceh, tepatnya di kawasan Keude Pante Raja, Pidie Jaya. (b10)

Waspada/Muhammad Riza

KANIT Lantas Polres Pidie Aiptu Azuar Effedi menyerahkan santunan kepada Erdi Masliansyam (Alm), yang diterima istrinya, Dian Melanie, Rabu (8/1)

Sejarah Ajarkan Persatuan Islam BANDA ACEH (Waspada): Mempelajari sejarah bukan semata untuk mengetahui cerita masa silam, namun sejarah telah mengajarkan bagaimana seharusnya umat Islam menyatukan dirinya. “Apabila di zaman ini umat Islam belajar dari sejarahnya, maka persatuan itu kembali terjadi,” ujar cendikiawan Mesir Syekh Abu Muaz Muhammed Abdul Hayy Uwainah dalam pengajian Kaukus Wartawan Peduli Syari’at Islam di Rumoh Aceh, Jeulingke, Banda Aceh, Rabu (8/1). Dalam acara yang bertajuk ‘Memahami Makna Persatuan dalam Islam’, staf pengajar dari Universitas Al-Azhar, Kairo ini menerangkan, sejarah di masa lalu setelah Rasulullah wafat, bagaimana umat Islam saat itu diperfitnahkan sesamanya oleh penyusup yang mengakibatkan pembunuhan terhadap para sahabat rasul, seperti Utsman bin Affan, Ali bin Abi Thalib, Abu Musa Al-Asy’ari, dan lain-lain. Syekh Abu Muaz Muhammed yang dalam penyampaiannya diterjemahkan ustadz Muakhir Z, mengatakan sejarah ini mengajarkan kepada sekalian umat Islam supaya berhati-hati terhadap setiap fitnah yang mengacu kepada perpecahan. (b07)

Waspada/Gito Rolies

KADIS Perindag Aceh Safwan bersama Kepala Cabang PT Pertamina (Persero) wilayah Aceh, Aribawa melakukan sidak tabung gas elpiji 12 kg di wilayah Kota Banda Aceh, Kamis (9/1).

Hakim Gugurkan Gugatan Class Action YARA BANDA ACEH (Waspada): Ketua Majelis Hakim Makaroda Hafat dalam amar putusannya menyatakan menggugurkan gugatan Yayasan Advokasi Rakyat Aceh (YARA) terhadap Gubernur Aceh (tergugat I), Malik Mahmud selaku pimpinan GAM (tergugat II), Presiden RI (tergugat III) dan Marti Ahtisari sebagai fasilitator proses negosiasi RI-GAM (tergugat IV) pada sidang di Pengadilan Negeri Banda Aceh, Kamis (9/1), “YARA tak serius dalam perkara gugatannya, hingga sidang dimulai, Direktur YARA Safaruddin tidak hadir, bahkan tidak ada surat maupun pemberitahuan kepada kami,” kata hakim. Jadwal sidang pertama dijadwalkan pada pukul 09:00, namun sampai pukul 11:30, pi-hak penggugat yaitu YARA tidak hadir, sedangkan pihak tergugat sudah hadir di antaranya Kepala Biro Hukum Pemprov Aceh Edrian mewakili gubernur, dan Wakajati Aceh Agus Tri Handoko mewakili Presiden RI, sementara dari pihak Malik Mahmud dan Martti Ahtisaari tidak hadir dalam sidang. Ketua Majelis Hakim mengatakan, presiden saja sangat merespon gugatan yang dilaporkan YARA, sampai Presiden menghadirkan perwakilannya untuk hadir dalam siding. Wakajati Aceh Agus Tri Handoko mewakili Presiden RI usai sidang mengatakan, Presiden sangat merespon gugatan ini

sampai memberikan kuasa kepada Jaksa Agung dan kuasa kepada Kepala Kejaksaan Tinggi Aceh TM Syahrizal dan mensubtitusikan kepada Wakajati untuk hadir. Namun, Wakajati masih enggan menjawab tentang gugatan balik kepadaYARA karena dianggap telah mencemarkan nama baik, “Kita tunggu saja keputusan di tingkat pusat, jadi saya belum bisa menjawab sekarang,” tutur Agus Tri Handoko. SebelumnyaYayasan Advokasi Rakyat Aceh (YARA) menggugat class action Martti Ahtisaari selaku ketua Dewan Direktur Crisis Management Initiative, Presiden Susilo Bambang Yudhoyono, Gubernur Aceh dan Malek Mahmud, selaku pimpinan Gerakan Aceh Merdeka di Pengadilan Negeri Banda Aceh pada 1 Oktober 2013 lalu. Gugatan tersebut atas dasar pemerintah pusat dan Aceh belum membentuk joint claims settlement commission (JCSC) atau yang lebih dikenal dengan Komisi Bersama Penyelesaian Klaim (KBPK) untuk korban konflik di Aceh sebagaimana amanah MoU Helsinki. Tanggapan YARA Soal Hakim Gugurkan Gugatan Sementara Yayasan Advokasi Rakyat Aceh (YARA) menyesalkan tindakan Majelis Hakim Pengadilan Negeri Banda Aceh yang menggugurkan perkara gugatan class action terhadap pembentukan Komisi Bersama

Penyelesaian Klaim. “Kami hadir ke pengadilan tepat pukul 12:20. Ketika kami tanyakan ke panitera, ternyata soal perkara yang kami ajukan perkaranya telah digugurkan majelis hakim,” kata Direktur YARA Safaruddin dalam pers rilis yang diterima Waspada, Kamis (9/1). Dia mengaku terkejut dengan tindakan yang sepihak ini. Padahal para pihak yang hadir pada saat sidang hendak digugurkan adalah hanya sebatas perwakilan Gubernur Aceh dan Presiden RI. “Sedangkan Malik Mahmud dan Marti Ahtisari belum hadir. Sedangkan kami saat itu sedang dalam perjalanan menuju pengadilan,” kata Safaruddin. Seharusnya, menurut Safaruddin, hakim menunggu sampai kedua belah pihak hadir, karena biasanya sidang perdata menunggu para pihak (Penggugat dan Tergugat hadir). “Terhadap hal ini kami akan mengambil tindakan yakni akan melakukan protes terhadap pengguguran perkara ini dan akan mengajukan kembali gugatan tersebut,” tutur Safaruddin. PihakYARA keberatan ketika dikatakan tidak serius dalam gugatan ini. “Kami berharap hakim tidak terlalu berlebihan karena tergugat ini adalah presiden dan gubernur, harus tetap memperlakukan semua pihak setara di muka hukum,” kata Safaruddin. (b24/cb01)

Waspada/Gito Rolies

WAKAJATI Aceh Agus Tri Handoko mewakili presiden RI dalam sidang gugatan YARA di Pengadilan Negeri Banda Aceh, Kamis (9/1)

Ribut KIP Aceh Tengah Semakin Panas

Gubernur Meminta Dilantik, Bupati Punya Pertimbangan ACEH Tengah yang berhawa dingin, tetapi suhu politik semakin panas. Gubernur Aceh, Zaini Abdullah melayangkan surat resmi kedua kalinya kepada Bupati Aceh Tengah untuk segera melantik personil komisioner KIP Aceh Tengah yang sudah di SK kan KPU Pusat. Namun Bupati Aceh Tengah Nasaruddin punya pertimbangan, sampai sekarang 5 komisionir KIP belum dilantik. Sampai dengan berita ini diturunkan, Kamis (9/1), berbagai kegiatan Pemilu untuk daerah dingin itu diambil alih oleh KIP Provinsi Aceh. DPRK terbelah dua antara yang mendukung pelantikan dan menunggu kepastian hukum. Gugatan PTUN terhadap SK KPU masih belum ada keputusan. “Bukan saya tidak mau melantik KIP. Namun kita menunggu kepastian hukum. 50 persen jumlah anggota DPRK dan 7 Parpol mengajukan gugatan ke PTUN Jakarta, sehubungan dengan keluarnya SK KPU yang menetapkan 5 personil KIP di Aceh Tengah,” sebut Nasaruddin, Bupati Aceh Tengah menjawab Waspada via selular, Kamis (9/1). Selain menunggu keputusan gugatan PTUN oleh setengah anggota DPRK dan 7 Parpol di sana, Bupati juga mengirimkan surat ke Mahkamah

Agung, meminta petunjuk langkah apa yang harus diambil dengan kondisi yang seperti itu. “Kita inginkan tidak ada perpecahan dalam mengambil kebijakan. Semua elemen kita pertimbangkan. Yang mengajukan gugatan 50 persen jumlah anggota DPRK dan 7 Parpol, ini kan juga bagian dari rakyat Aceh Tengah. Kita tunggu fatwa MA, apakah kita dapat melaksanakan keputusan KPU yang sekarang digugat, atau menunggu proses peradilan yang sedang berlangung,” sebut Nas. Namun jawaban dari MA belum turun atas surat bupati 20 Desember 2013 lalu. Di sisi lain, Gubernur melayangkan surat kepada bupati untuk secepatnya melantik personil KIP yang sudah di SK KPU Pusat. Persoalan ini mencuat ke permukaan, ketika DPRK Aceh Tengah mengeluarkan SK tentang personil KIP. Para penggugat menilai SK DPRK itu melanggar ketentuan, karena tidak melalui sidang paripurna hanya ditandatanganipimpinandewan. Proses awal seleksi personil KIP ini juga dipersoalkan, karena dinilaimelanggaraturan.Akhinya DPRK terpecah dua, 50 persen personilnyamengajukangugatan ke KPU yang meminta agar SK KPUnomor706/Kpts/KPU/2013, ditinjau ulang dan dibatalkan. Gugatan awal dilangsung-


kan 7 pimpinan Parpol dan penggugat lainnya ke PTUN Banda Aceh. Isi materi gugatan mempersoalkan SK yang dikeluarkan pimpinan DPRK tanpa melalui prosedur dan mekanisme dalam menetapkan personil KIP. Namun kandas di PTUN Banda Aceh, kembali diajukan gugatan ke PTUN pusat, kali ini obyek sengketanya SK yang dikeluarkan KPU Pusat. Serta adanya overlaving SK pemberhentian personil KIP yang lama. Sementera DPRK Aceh Tengah bersikukuh, SK pimpinan dewan adalah keputusan lembaga. Namun setengah anggota DPRK lainnya tidak menerima dan mengajukan gugatan ke PTUN Jakarta. “Semuanya sudah sesuai dengan prosedur. Mekanisme jelas. Bahkan SK KPU sudah ada, bupati harus melaksanakan kewajibannya melantik personil KIP yang sudah resmi. Bila bupati tidak melantik maka bupati melanggar hukum,” sebutWajadal Muna, SH ketua Komisi A DPRK Aceh Tengah. Menurut Wajadal Muna, personil KIP yang sudah di SKkan KPU Pusat, adalah produk lembaga DPRK. “ Dari awal seleksi sampai keluarnya SK KPU kami sudah menjalankan tugas sesuai prosedur dan mekanisme,” sebutnya. Bila bupati tidak atau belum

melantik KIP Aceh Tengah hingga medio Januari 2014, muncul wacana kepermukaan akan dilantik oleh KIP provinsi Aceh dan atau oleh Gubernur Aceh. Apakah bisa? Dalam Qanun nomor 7 tahun 2007, jelas disebutkan, yang melantik KIP kabupaten adalah bupati atau wali kota. Apakah tidak cacat hukum bila bukan bupati atau wali kota yang melantiknya? Berbeda dengan pelantikan bupati, bila gubernur tidak bersedia melantiknya, maka presiden bisa menunjuk pihak lain untuk melantik bupati yang sudah disahkan melalui SK. Wewenang melantik KIP Aceh Tengah itu ada di tangan bupati. Namun bupati masih punya pertimbangan untuk kepentingansemuapihak,agardaerah ini nyaman dan aman, maka pelantikan itu menunggu adanya keputusan hukum tetap dan atau adanya petunjuk dari MA. Walau belum dilantik, kegiatan pelaksanaan Pemilu di daerah dingin itu diambil alih KIP Provinsi Aceh, dengan melibatkan sekretariat KIP Aceh Tengah. Semua proses taha-pan Pemilu berlangsung baik, walau tidak ada komisio-ner KIP daerah. “Saya berkeinginan menjaga stabilitas keamanan dan politik di daerah dalam tahun 2014 ini. Eksekutif tetap mem-

bina hubungan baik dengan legeslatif, di mana tahun ini ada-lah tahun terahir penugasan DPRK,” sebut bupati. Sementara itu gugatan PTUN di Jakarta, Senin (13/1) ini akan mendengarkan jawaban dari tergugat (KPU). Bagaimana kelanjutan dari kisah KIP Aceh Tengah ini? Bahtiar Gayo

BANDA ACEH (Waspada): Dinas Perindustrian dan Perdagangan (Disperindag) Aceh bersama dengan PT Pertamina (Persero) wilayah serta Himpunan wiraswasta nasional Minyak dan gas bumi (Hiswana Migas), Kamis (9/1) melakukan inspeksi mendadak (sidak) terhadap agen, SPBU, dan pedagang pengecer gas elpiji 12 Kg di wilayah Kota Banda Aceh. Dalam sidak yang dilakukan di agen resmi PT Pertamina, yakni PT Lon Mita Gah, pihak Disperindag dan BUMN migas tersebut, melakukan pengecekan isi tabung gas 12 Kg untuk memastikan takaran dan isi tabung. Selain melakukan pengecekan takaran gas dengan cara melakukan penimbangan langsung, PT Pertamina juga memastikan harga jual ditingkat agen sesuai dengan ketentuan yang ditetapkan, yakni Rp.95.800 untuk wilayah Kota Banda Aceh. Usai melakukan sidak di agen resmi, kemudian tim melanjutkan peninjauan harga di tingkat pedagang eceran, dan dari tiga toko yang didatangi, harga jual elpiji 12 Kg di ketiga toko sangat bervariasi, pada kisaran Rp100 ribuRp105 ribu. Kepala Disperindah Aceh, Safwan usai sidak pasar mengatakan, pihaknya akan terus melakukan pemantauan harga jual elpiji sesuai dengan ketentuan yang telah ditetapkan Pertamina. “Kita akan selalu terus melakukan pemantauan pasar,” katanya kepada wartawan. Terkait dengan disparitas atau perbedaan harga ditingkat pedagang pengecer, Safwan mengimbau kepada masyarakat untuk dapat

membeli elpiji 12 Kg di agen resmi harganya sudah ditetapkan, yakni Rp95.800,” ujarnya. Sementara itu, sambung Safwan, guna menetapkan harga jual eceran tertinggi (HET) untuk elpiji 12 Kg dan 3 Kg di 23 kabupaten dan kota di Aceh, dirinya akan segera mengkordinasikan hal ini kepada Gubernur Aceh, untuk segera ditetapkan Peraturan Gubernur (Pergub) nya. “Sesuai dengan ketentuan Peraturan Menteri ESDM Nomor 26 tahun 2009 tentang distribusi dan penyediaan elpiji, disebutkan bahwa Pemerintah provinsi dan kabupaten berhak menetapkan HET yang disesuaikan dengan wilayah distribusi,” sebutnya. Sementara itu, Kepala Cabang PT Pertamina (Persero) wilayah Aceh, Aribawa menerangkan, pihaknya akan memastikan stok dan harga elpiji terjamin. “Stok elpiji di Aceh kami pastikan aman,” terangnya. Selain itu juga, sambung Ari, saat ini pihaknya telah melakukan penambahan 3 ribu tabung elpiji ukuran 3 Kg, dan 6.000 tabung elpiji 12 Kg.“Kami pastikan untuk harga resmi di outlet sesuai yang ditetapkan, yang harga berbeda hanya di Kabupaten Simeulue dan Kota Sabang, sebab di dua wilayah ini terjadi double handling, atau dua penanganan yakni adanya penambahan ongkos bongkar muat kapal,” sebutnya Terkait dengan bila adanya temuan agen yang menjual harga lebih tinggi dari yang ditetapkan, maka PT Pertamina akan langsung melakukan PHU atau pemutusan hubungan usaha. “Kalau ada agen yang nakal, kita langsung PHU,” tegasnya. (cb01)

Jelang Penas, KTNA Pastikan Wakil Handal SUBULUSSALAM ( Waspada): Menghadapi Pekan Nasional (Penas) XIV Kontak Tani Nelayan Andalan (KTNA), Juni 2014 di Malang, Jawa Timur, KTNA Kota Subulussalam menggelar pertemuan khusus. Selain penetapan calon utusan harus handal dan berprestasi, dipersiapkan segala sesuatu yang terkait dengan Penas sekaligus evaluasi serta fasilitasi tim sehingga tidak terjadi utusan bersifat sekadar pelengkap. “Kita berharap semua utusan benar-benar menjadi perwakilan yang handal di setiap bidang dan proaktif selama Penas,” kata Abdul Hamid Padang, Ketua KTNA memimpin pertemuan di Saung Tani Telaga Biru Desa Suka Waspada/Khairul Boangmanalu Makmur, Kec. Simpang Kiri, SUASANA pertemuan KTNA Subulussalam, Kamis (9/1) Subulussalam, Kamis (9/1). Dijelaskan, dari Rp400 juta anggaran BKPP daerah ini, Joka mensinyalir 75 persen siluman Kota Subulussalam, diplotkan khusus untuk sehingga ke depan harus lebih diberdayakan pendamping dan peninjau serta 18 orang petani demi mengangkat harkat dan martabat para (KTNA). Sementara keikutsertaan instansi dinas petani. lain menggunakan anggaran masing-masing Soal pemberian bantuan pemerintah kepadan tidak mengganggu anggaran BKPP. da para kelompok tani selama ini, Joka pun Meski berharap perwakilan KTNA setiap mengkritisi. Ke depan, tandas Joka, jika dilakukecamatan tiga orang, kuota 65 utusan ke Penas kan hal serupa harus melalui rekomendasi Ketua benar-benar bisa terpenuhi dan mampu KTNA dan dipastikan kelompok taninya bukan memberi kontribusi positif pasca Penas kepada siluman. petani di daerah ini. Meski hanya 18 utusan yang didanai BKPP, Indikasi utusan KTNA daerah ini ke Kalimanrapat sepakat mengirim 21 utusan KTNA Subutan Timur tiga tahun lalu, ada nama namun tidak lussalam pada Penas XIV 2014 dengan ketenpergi, bahkan bukan unsur KTNA yang idealnya tuan, anggaran tiga utusan dibebankan kepada mengikuti semua event Penas harus menjadi dinas pertanian dan dinas perkebunan setembahan evaluasi sehingga tidak terulang. pat. (b28) Mengkritisi keberadaan kelompok tani di



WASPADA Jumat 10 Januari 2014

Kehadiran Siswa Capai 90 Persen

Petani Desa Blang Guron Kembali Tanam Padi GANDAPURA (Waspada): Para petani di kawasan Desa Blang Guron, dan desa sekitarnya di pedalaman Gandapura, Bireuen, sekarang ini kembali menananm padi musim tanam ini. Setelah mereka menggarap lahan persawahannya beberapa hari sebelumnya. Pantauan Waspada, Kamis (9/1), sejumlah petani sawah di Desa Blang Guron, Pante Sikumbong, Damakawan, Cot Teube, menanam padi dan sebagiannya terlihat masih membereskan lahan sawahnya persiapan. “Sekarang ini giliran menanam padi, setelah beberapa hari sebelumnya membereskan lahan,” kata Aisyah seorang petani di Desa Blang Guron. Menurut Aisyah, sawah di desanya yang masih mengandalkan irigasi teknis, menjadi lahan pekerjaan tetap untuk warganya mencari nafkah, makanya, kata Aisyah tidak heran di desanya hampir tiga kali turun ke sawah. “Sekarang ini saja ada terbantu dengan air hujan, namun kadang-kadang hanya mengandalkan air yang dialiri dengan mesin air dari sungai Sawang yang ada di desa,” katanya yang dibenarkan sejumlah petani lainnya saat itu. Ditanya, tentang kabar sawah di desanya bisa dialiri dengan air irigasi dari Gampong Teungoeh, Sawang, Aceh Utara, bila saluran irigasi non teknis dibuat dengan cara memasang pipa menyeberang sungai, Aisyah mengaku tidak begitu tahu, namun dirinya hanya mendengar pembicaraan para petani saja tentang hal itu pernah dan sebagian petani meyakini itu salah satu solusi untuk mengatasi bebean petani membayar sewa air setiap musim panen. “Selama ini kami selalu membayar sewa air setelah panen padi, sewa itu untuk membeli bahan bakar dan perawatan mesin serta yang bekerja membagikan air (Keujruen Blangred), alangkah senang hati kami bila saluran irigasi seperti kabar itu bisa terwujud, sehingga kami tidak lagi harus membayar sewa setiap musim panen lagi, mudah-mudahan menjadi kenyataan,” harapnya. (cb02)

Husaini Setiawan Bertemu Timses KUTACANE (Waspada) : Untuk menggalang kekuatan dan menyatukan suara kader serta simpatisan menuju kursi DPR –RI dari Daerah Pemilihan Aceh 1, Ketua DPC PDIP Kota Lhokseumawe Husaini Setiawan, calon anggota legislatif DPR-RI nomor urut 4 akan bertemu kader di Kutacane, Aceh Tenggara. Selain di Aceh Tenggara, kata Husaini, Kamis (9/1), Husaini juga akan mengadakan pertemuan dengan kader, simpatisan serta pengurus sembari membentuk tim pemenangan di Gayo Lues. “Saat ini sudah dibentuk tim pemenangan di 15 kabupaten/ kota di Dapil Aceh 1, bahkan sebelum bertolak ke Agara dan Gayo Lues, pihaknya telah membentuk tim pemenangan PDIP di Kabupaten Pidie Jaya dan Pidie,” tutur Husaini. (b26)

Pemberhentian Dan Pengangkatan Jabatan Struktural MEUREUDU ( Waspada) : Pemerintah Kabupaten Pidie Jaya, Rabu (9/1) melakukan pemberhentian dan pengangkatan Pegawai Negeri Sipil dalam jabatan struktural di lingkungan pemerintahan setempat sesuai keputusan Bupati Pijay Nomor : PEG.821.2/02/2014 Dalam acara badan pertimbangan jabatan dan kepangkatan (Baperjakat) Kabupaten Pidie Jaya Nomor : 01/BPJK/PJ/2014 tanggal 6 Januari 2014. Memberhentikan dengan hormat pegawai negeri sipil sekita 20 orang yaitu terdiri dari Kadis Ssial, Tenaga Kerja, Sekretariat BKB dan PP, BPBD, Kehutanan dan Perkebunan, staf Sekretariat Daerah, Dispora, Sekretaris Dispora dan lainnya. (b10)

IDI (Waspada): Hari pertama masuk sekolah pasca libur semester ganjir, kehadiran siswa di berbagai tingkatan dalam wilayah Kabupaten Aceh Timur mencapai 90 persen. Kondisi itu normal, apalagi didukung proses belajar mengajar berjalan sebagaimana biasanya, Kamis (9/1). Amatan Waspada, proses pembelajaran di SMA Negeri 1 Idi yang berada di Desa Tanoh Anoe berjalan lancar. Siswa/i hadir dengan persentase mencapai 95 persen. Hal yang sama juga terlihat di SMP Negeri 1 Idi yang berada di Gampong Jawa Idi. Proses belajar mengajar di sana terlihat berjalan lancar dan siswa/i diperbolehkan pulang sesuai dengan jadwal yang telah ditetapkan yakni pukul 13:30. Tidak hanya kehadiran pelajar di sekolah umum tingkat SMP dan SMA, namun kehadiran

Kantor Pelayanan Samsat Atim Butuh Peningkatan Fasilitas Waspada/Abdul Mukthi Hasan

PARA ibu tani menanam padi di sawah di Desa Blang Guron, pedalaman Gandapura, Bireuen, Kamis (9/1), yang dibantu dua petani di belakangnya membereskan lahan tanam.

Aceh Utara Rawan Korupsi LHOKSUKON (Waspada): Kabupaten Aceh Utara, terindikasi sebagai salah satu kabupaten paling rawan praktik korupsi di Provinsi Aceh. Selama 2013, kejaksaan di wilayah ini menangani sembilan perkara tindak pidana korupsi dan satu di antaranya sudah dieksekusi. “Yang lain, masih tahap penyelidikan, penuntutan dan masihdalamprosesupayahukum,” ujar Kepala Kejaksaan Negeri Lhoksukon, Aceh Utara, Teuku Rahmatsyah, Rabu (8/1) siang.

Rahmatsyah merincikan, kesembilan perkara itu, masingmasing; kasus dugaan korupsi dana North Aceh Expo (NAE) tahun 2010, dana sanggar seni Cut Meutia, pembangunan Rumah Sakit Aceh Utara, kasus Alkes RSUD Cut Meutia yang ditangani dalam tiga perkara terpisah, korupsi KONI dan satu kasus yang dilimpahkan polisi, yakni kasus dana hibah untuk koperasi Cot Tgk Ni. “Kasus Sanggar dan pembangunan RS masih tahap penyelidikan. NAE sudah tahap penyidikan dan sedang kita dalami untuk menentukan tersangka. Target kita, dalam tiga bulan ini sudah bisa kita tingkatkan ke tahap penuntutan. Kasus

KONI sudah dieksekusi. Sedangkan tiga perkara kasus Alkes, masih tahap kasasi,” kata Rahmatsyah. Kajari juga menyebutkan, khusus tindak pidana umum, selama 2013, Kejari Lhoksukon menangani 924 perkara, dengan rincian 324 kasus masih prapenuntutan, 310 sudah masuk tahap penuntutan dan 252 perkara sudah dieksekusi. Kasus paling dominan, narkoba. “Selama 2013, kita juga mengembalikan aset dan pemulihan keuangan negara dengan nilai total Rp5,2 miliar. Ini semua, berkat kerjasama yang sungguh-sungguh dari seluruh jajaran Kejari Lhoksukon,” papar Rahmatsyah. (b19)

Tertibkan Alat Peraga Kampanye MEUREUDU ( Waspada) : Hingga kini Komisi Independen Pemilihan (KIP) dan Pengawas Pemilu Pidie Jaya belum juga melakukan penertiban alat peraga kampanye yang dipasang sembarangan di daerah itu. Koordinator Aliansi Mahasiswa Peduli Pidie Jaya ( AMP2J), Zikrillah dan Ketua Gerakan Mahasiswa Pidie Jaya (GeMPA), Muhammad Rizal, Kamis (9/1) menyatakan pihaknya mendesak KIP dan Panwaslu segera melakukan penertiban alat peraga kampanye. Sampai sekarang masih ada beberapa tempat alat peraga kampanye milik calon anggota legislatif yang tidak mematuhi aturan dalam kampanye sehingga membuat masyarakat resah. Ia menambahkan, Panwaslu dan KIP harus tegas mengambil sikap terhadap para caleg yang tidak mematuhi aturan yang telah ditetapkan. (b10)

Belajarlah Dari Semut TAKENGEN (Waspada): Kehidupan sosial masyarakat dapat mengambil pelajaran dari kehidupan semut yang berkoloni. Demikian dikatakan Wakil Bupati Aceh Tengah Khairul Asmara ketika berbicara di hadapan pengajian Badan Kontak MajelisTaklim (BKMT) Kecamatan Silih Nara, Rabu (8/1) di Kampung Arul Putih. Wabup mengatakan, interaksi dan komunikasi yang terjadi antara sesama semut membuat koloni mereka lebih teratur dan tertib. Sebelumnya, penceramah pada pengajian BKMT hari itu, Muslim menggambarkan secara jelas bagaimana kehidupan semut dalam membangun masyarakatnya. Dikatakan Muslim, semut merupakan serangga eusosial yang berasal dari keluarga Formisidae, dan semut termasuk dalam ordo Himenoptera bersama dengan lebah dan tawon. (b33)

Mahasiswa Keperawatan Unsyiah Gelar Baksos JULI (Waspada) : Sebanyak 172 mahasiswa yang tergabung dalam Gerakan Mahasiswa Keperawatan Peduli Masyarakat (Gempar) Fakultas Keperawatan Unsyiah Banda Aceh, menggelar bakti sosial di desa terpencil Batee Raya, Kecamatan Juli. Ketua pelaksana bakti sosial Iskandar Zulkarnain, Kamis (9/1) menjelaskan, bakti sosial berlangsung 10-12 Januari dibuka Bupati Bireuen di Meunasah Desa Batee Raya, Kecamatan Juli, Jumat (10/1). Tujuan pelaksanaan bakti sosial, kata Iskandar, sebagai wahana mempererat silaturahmi masyarakat dengan elemen mahasiswa Fakultas Keperawatan guna menumbuhkan sikap kepedulian sesama. (b12)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

guru juga mencapai 95 persen, kecuali guru yang sakit dan izin dengan alasan penting. “Proses belajar mengajar berjalan lancar. Tidak ada namanya hari pertama dan hari kedua. Kehadiran guru menjadi tanggungjawab kami, begitu juga dengan kehadiran siswa/i. Alhamdulillah proses pembelajaran berjalan lancar,” kata Kepala SMAN 1 Idi, Saiful Anwar, SPd menjawab Waspada Kamis (9/1). Saiful Basri mengatakan, jadwal libur semester ganjil sebagaimana ketentuan tetap dijalankan. Meskipun libur kalin ini tidak mencapai sepekan,namunsemangatbelajarparasiswatidakmenurun. Hal itu terbukti kehadiran mencapai 95 persen. “Kita tetap belajar, apalagi kami di kelas IX sangat membutuhkan ilmu dan harus mengejar materi menghadapiUjianNasional(UN)yanghanyatersisa tiga bulan lagi,” kata Fitriani, siswi Kelas IX. (b24)


KAJARI Lhoksukon Rahmatsyah (tengah) foto bersama jaksa di Kantor Kejari Lhoksukon, Rabu (8/1)

Jangan Kutip Dana Masuk Dari Tamu LP Dan Rutan LHOKSUKON (Waspada): Jika ketahuan ada petugas (sipir) LP dan Rutan yang memungut biaya masuk dari para tamu (keluarga tahanan dan Napi), maka Kanwil Kemenkumham Wilayah Aceh akan memberikan tindakan tegas kepada yang bersangkutan. “Kalau ada petugas yang memungut biaya masuk dari para tamu, silahkan laporkan kepada kami, dan kami akan memberikan tindakan tegas terhadap petugas bersangku-

tan. Hal itu bertentangan dengan aturan kita dan itu kami larang. Saya ingatkan sekali lagi, jangan kutip dana masuk dari tamu LP dan Rutan,” kata Fathlurachman, SH. MM, Kepala Kantor Wilayah Kementerian Hukum dan HAM Aceh, Kamis (9/1) siang usai pertemuan dengan H Muhammad Taib, Bupati Aceh Utara. Tapi sampai saat ini, kata dia, pihaknya belum menerima informasi tentang adanya pungutan dana dari para tamu LP

dan Rutan. Fathlurrachman meminta semua petugas LP dan Rutan di seluruh Aceh untuk bersikap baik kepada masyarakat dan memberikan pelayanan terbaik bagi masyarakat. Untuk masyarakat yang merasa dirugikan oleh para petugas LP dan Rutan diminta untuk melaporkan langsung ke Kanwil Kementerian Hukum dan HAM, bahkan masyarakat boleh melaporkan melalui SMS. (b18)

‘Layani’ Bandar Sabu, Perempuan Kisaran Itu Berlabuh Di Sel UNTUNG tak dapat diraih, malang tak dapat ditolak. Begitu nasib yang dialami perempuan muda asal Kisaran, Sumatera Utara ini. Perempuan yang akrab disapa SW, 26, berstatus janda ini, kini meringkuk dalam ruang tahanan Mapolsek Darul Imarah, Aceh Besar, setelah ditangkap Anggota Polsek setempat, saat sedang ‘indehoi’ bersama MS alias Adun, 36, yang tak lain bandar sabu yang dicari polisi karena aktivitasnya itu. Mereka ditangkap Polisi saat sedang naik ke bulan di sebuah rumah yang diakui milik keluarga MS, di Gampong Aron, Kecamatan Darul Imarah, Aceh Besar, Selasa (7/1) malam. Polisi mengakui, SW dan MS ditangkap bukan karena perbuatan mesum yang mereka lakukan, tapi karena keberadaan MS yang berstatus narapidana Rumah Tahanan (Rutan) Janto di wilayah mereka. Seperti pernah diberitakan, narapidana kasus narkoba yang divonis enam tahun penjara dan baru satu tahun dijalaninya, sekira 7 Oktober 2013, lari dari pengawalan petugas Rutan Jatho saat dirinya dibawa ke Puskesmas untuk mengobati pembengkakan pada kupingnya. Namun, pada hari itu berhasil ditangkap kembali setelah ter-

cium oleh polisi keberadaannya di wilayah itu. Kebetulan pada saat itu, SW sedang bersana MS, sehingga SW ikut dibawa petugas karena sebelum naik ke bulan, SW sempat menghirup sabu yang ditawarkan MS. Seperti dituturkan dalam pertemuan dengan Waspada di Mapolsek Darul Imarah, SW yang sudah hijrah ke Banda Aceh sejak 2008 setelah dipersunting seorang laki-laki asal Kota Sabang. Dari perkawinannya itu, SW dikaruniai seorang anak yang kini berusia enam tahun dan duduk di bangku Kelas III Sekolah Dasar. SW mengakui, selama menjadi perempuan pemuas nafsu, dirinya baru dua kali bertemu dan melakukan hubungan dengan MS. Selebihnya, SW hanya menjadi penjaja seks dari hotel ke hotel. “Saya butuh uang bang, untuk biaya makan dan sekolah anak, kebutuhan orang tua dan adik yang sedang kuliah,” ujar SW dengan nada lesu. Perempuan berkulit putih yang mendiami sebuah tempat kontrakan di Gampong Merduati, Kecamatan Kutaraja menceritakan, sebenarnya dirinya keberatan melayani nafsu bejat sang bandar narkoba itu, karena selain orangnya kasar, MS juga suka memaksa dirinya

menggunakan narkoba dan alat bantu seperti guli-guli serta obat kuat yang membuat SW kepayahan. Namun, karena SW membutuhkan uang, terpaksa dirinya melayani keinginan MS. Saat ditanyakan apakah dirinya tau jika MS adalah bandar narkoba dan sudah mempunyai istri dan anak? Perempuan bertubuh ramping ini mengatakan dirinya tahu karena sudah diceritakan oleh MS. “Karena saya butuh uang, saya tidak begitu peduli. Pada hari itu sebenarnya saya sudah tidak mau melayani dia, karena istri MS terus-terusan menelepon. Tapi dia terus memaksa, sampai polisi datang dan menangkap kami. Dia sempat lari dari jendela, tapi berhasil ditangkap oleh polisi yang mengepungnya di luar,” kata SW. Diakui SW, sebenarnya hidup gemerlap dengan narkoba sudah lama ditinggalkannya. Namun, sejak berpisah dengan suaminya dan adanya keinginan sang ‘pelanggan’, dia terpaksa menuruti keinginan itu. SW berjanji, jika kasus yang dihadapinya itu selesai, dia akan berhenti dari kehidupan yang nista itu, dan akan membesarkan anaknya dengan cara yang benar. Semoga..!(b05)

IDI (Waspada): Kantor Sistem Administrasi Manunggal Satu Atap (Samsat) Idi, Aceh Timur diminta meningkatkan pelayanan dengan mengembangkan beberapa fasilitas sehingga memberikan kenyamanan bagi masyarakat yang melakukan pengurusan Pajak Kendaraan Bermotor (PKB) dan lainnya. Demikian Munawir Sazli, seorang pemerhati pembangunan di Aceh Timur kepada Waspada, Kamis (9/1). “ Bahkan terkesan kantor Samsat Idi yang berada di bawah naungan Dinas Pendapatan dan Kekayaan Aceh (DPKA) wilayah IV Aceh Timur terlihat amburadul,” ujarnya. Seperti fasilitas tempat menunggu warga yang melakukan pengurusan PKB dan BBN (Biaya Balik Nama) saat ini tenda yang dipasangkan sudah rusak dan tampak kumuh, kemudian papan informasi juga tidak dipasangkan. Kepala Seksi (Kasi) Bidang Perpajakan Dinas Pendapatan dan Kekayaan Aceh (DPKA)Wilayah IV pada kantor Samsat Aceh Timur, Taharuddin SE yang ditemui di kantornya mengakui, sejumlah sarana dan prasarana . “ Termasuk juga ruang tunggu mengurus PKB dan BBN dan lainnya,” sebutnya. Selain sarana yang belum memadai, bahkan

kantor Samsat yang digunakan saat ini juga sudah tidak layak menjadi kantor untuk memberi pelayanan prima bagi masyarakat. “ Kondisi itu dilihat dari sisi gedungnya yang kecil dan sempit sehingga ruangan yang tersedia tidak memadai untuk digunakan,” pungkasnya seraya mengatakan, kebutuhan gedung dan sarana lainnya sudah diajukan ke tingkat provinsi. Untuk tahun 2013 penerimaan pajak dari sektor PKB dan BBM peringkat pertama didominasi jenis sepedamotor. Pengurusan PKB sepedamotor yaitu mencapai 24.985 unit, kemudian baru diikuti truk, pick-up sebanyak 792 unit, kenderaan pribadi jenis sedan, jeep, station wagon untuk pemakaian pribadi berjumlah 694 unit, sedangkan untuk kendaraan umum yaitu hanya berjumlah 277 unit, kendaraan khusus tidak umum 30 unit, bus dan mikro bus 23 unit, kemudian kendaraan jenis sedan, jeep, station wagon umum hanya 8 unit serta bus dan mikro bus umum berjumlah 3 unit. Begitu juga halnya dengan pengurusan BBN yang juga didominasi sepedamotor yaitu 496 unit, sedangkan truk dan pick- up 63 unit, kendaraan pribadi 53 unit, truk dan pick-up umum hanya 41 unit, demikian Tahruddin. (cri)

RSUD Fauziah Susun Daftar Obat Pasien JKN BIREUEN (Waspada): Sekaitan dengan diberlakukannya Jaminan Kesehatan Nasional ( JKN), maka Rumah Sakit Umum Daerah (RSUD) Dr Fauziah Kabupaten Bireuen mulai membentukTim Formularium untuk menyusun daftar obat untuk pasien. “Dengan adanya daftar obat ini, sehingga setiap dokter akan memberikan obat sesuai kebutuhan dan masuk dalam daftar obat yang ditanggung JKN. Sehingga pasien tidak harus membeli obat keluar,” tutur Direktur RSUD Fauziah, Mukhtar Mars, Kamis (9/1). Formularium merupakan himpunan obat yang diterima dan disetujui oleh panitia farmasi dan terapi untuk digunakan di RS pada batas waktu tertentu. Formularium berupa dokumen

yang selalu diperbaharui secara terus menerus, berisi sediaan-sediaan obat yang terpilih. Dia menjelaskan, Tim Formularium akan bekerja untuk menyusun daftar obat yang ditanggung JKN. Di mana, daftar obat tersebut akan dijadikan referensi oleh dokter untuk dituliskan di resep pasien yang menggunakan fasilitas JKN. Terkait dengan pasian Jaminan Kesehatan Aceh (JKA) yang sudah berganti nama menjadi Jaminan Kesehatan Rakyat Aceh (JKRA) juga tidak adanya kendala yang berarti. “Hanya administrasinya pasien JKRA yang terintegrasi dengan JKN dilayani secara manual, sebab server entry datanya belum terkoneksi di rumah sakit kita,” papar Mukhtar. (b17)

Bupati Bersama Wakil DPRK Bireuen Tinjau Desa Terpencil BIREUEN (Waspada) : Bupati Bireuen Ruslan M Daud danWakil Ketua DPRK Syafruddin turun ke kawasan desa pedalaman terpencil di Uteuen Gathom, Kecamatan Peusangan Selatan, Krueng Simpo dan Pante Peusangan, Kecamatan Juli, Selasa (7/1). Kunjungan kerja bupati didampingi Sekda Zulkifli, SP, Kadis Bina Marga Cipta Karya Fadli, Camat Juli M Fuad meninjau rencana pembangunan dan pengaspalan jalan tembus Desa Ureuen Gathom, Kecamatan Peusangan Selatan–Krueng Simpo, Kecamatan Juli sepanjang

17,8 kilometer melalui sumber dana ABPK sebesar Rp 43 miliar. Bupati Ruslan Ruslan M Daud mengatakan, rencana pembangunan dan pengaspalan jalan tembus Desa Uteue Gathom – Krueng Simpo tahun ini sangat penting untuk menunjang peningkatan perekonomian petani di desa pedalaman terpencil yang selama ini masih sulit dilalui untuk mengangkut hasil pertanian. Sementara menyahuti harapan masyarakat petani desa pedalaman sudah merespon membangun jembatan rangka baja tahun 2015. (b12)

Rocky Didesak Evaluasi Kinerja Camat IDI (Waspada): Banyaknya camat yang belum menetap di kecamatan tempat bertugas sama artinya pejabat di kecamatan telah mengangkangi Intruksi Bupati. Oleh sebab itu, Hasballah M. Thaib selaku Bupati Aceh Timur diharapkan segera melakukan evaluasi terhadap kinerja camat. “Sudah sewajarnya Bupati Aceh Timur mengevaluasi kinerja camat, karena banyak masyarakat yang kecewa akibat camat tidak menetap di tempat bertugas. Di saat masyarakat hendak menjumpai camat terkadang camat berada di Langsa, karena rumahnya di Kota Langsa,” kata Direktur EksekutifYayasan Advokasi Rakyat Aceh (YARA) Safaruddin, SH kepada Waspada, Rabu (8/1). Dia meminta, tim pengawasan di instansi terkait segera turun ke kecamatan untuk melakukan evaluasi terhadap kinerja para camat di 24

kecamatan dalam wilayah Kabupaten Aceh Timur. “Rumah dinas camat tidak ada yang menempati, bahkan binatang ternak siang malam berkeliaran di dalam pekarangan rumah dinas camat,” kata Safaruddin seraya menambahkan, meskipun tidak seluruhnya namun bagian tengah, timur dan barat Aceh Timur terdapat rumah dinas camat yang tidak ada yang menempati. Disarakan, Bupati Aceh Timur untuk menugaskan para camat di kecamatan putra asli kecamatan ataupun putra-putra Aceh Timur yang berdomisili di Aceh Timur. Hal ini dianggap penting agar pelayanan masyarakat tetap terjaga. “Jika tidak mau bekerja serius untuk apa dipertahankan disebuah kecamatan, karena masih banyak putra-putra Aceh Timur yang cukup pangkat dan punya keinginan untuk bekerja serius,” tandas Safaruddin. (b19)

Sikap Militansi Pelajar Aceh Harus Dipupuk Sejak Dini PEUREULAK (Waspada): Para pelajar di Aceh harus memupuk diri dengan sikap militansi sejak dini, sehingga akan terciptanya masyarakat Aceh yang lebih tangguh dalam melawan segala bentuk penzaliman, baik itu di bidang budaya maupun penzaliman sistemik. Demikian Iskandar Usman Al-Farlaky salah seorang tokoh muda Aceh Timur yang juga Ketua KNPI Aceh Timur kepada Waspada di selasela kegiatan Leadership Basic Training (LBT) PII Kabupaten Aceh Timur, Rabu (8/1) di aula MAN Ranto Peureulak. “ Kebangkitan negeri ini berada di tangan para pelajar, kemudian menjadi pemuda dan pemimpin bangsa nantinya. Karena itu, sikap militansi harus melekat pada diri kita masingmasing,” ungkap aktivis muda ini seraya mengatakan, dimana maju tidaknya sebuah bangsa sangat tergantung dari gagasan militansi pelajar dan pemuda dan bila pelajar sudah dilalaikan dengan hal- hal negatif, maka sangat mustahil itu bisa terwujud. Jika melihat masa depan sebuah masyarakat dan eksitensi agama di masa mendatang, bisa diukur dengan parameter para pelajar bagaimana keadaan mereka, apakah mengembira-

kan atau mengecewakan. Perlu juga digarisbawahi, tegas Iskandar Usman, bahwa pengertian sikap militansi bukan identik dengan sikap kekerasan dalam penyelesaian masalah. Namun, militansi menolong kebenaran dan membela keadilan serta siap berkorban demi sesama. “ Pelajar harus optimisme dalam menatap masa depan yang lebih baik, maka bermimpilah setinggi langit, itu lebih baik daripada orang yang tidak memiliki impian sama sekali,” cetus Iskandar. Iskandar juga berpesan kepada para peserta LBT PII untuk mengikuti training secara baik dengan mengamalkan setiap materi yang disampaikan oleh para pemateri. Dalam kesempatan yang sama, ia juga menyampaikan agar pelajar dan pemuda tidak melupakan identitas diri sebuah bangsa, dari mana kita berasal dan tidak melupakan sejarah seperti sejarah masuknya Islam pertama di Asia Tengggara. “Bumi Peureulak ini merupakan pintu masuk Islam pertama di Asia Tenggara, tapi sangat sedikit pelajaran sejarah yang mengupas tentang itu, tentunya ini disebabkan minimnya kita mendokumentasikan dan mempelajari sejarah,” tambah Iskanda Usman. (cri)



WASPADA Jumat 10 Januari 2014

Putusan Hakim :PT KA Bayar Ganti Rugi Rp114 Miliar

91 Pejabat Atim Tes Urin IDI (Waspada): Sedikitnya 91 pejabat dan mantan pejabat dalam lingkungan Pemerintah Kabupaten Aceh Timur dilakukan tes urin. Tes yang dilakukan para medis dipusatkan di Rumah Sakit Umum Daerah (RSUD) Idi. Amatan Waspada, hampir seratus pejabat dan mantan pejabat sejak pukul 08:15 mulai mendatangi RSUD Idi. Setelah mendaftar di loket, lalu para pejabat menunggu antrian. Setelah selesai diambil urin, lalu para abdi negara itu pulang. “Hasil tes urin ini akan diambil oleh pihak BKPP Aceh Timur, karena ini kerjasama antara BKPP Aceh Timur dengan RSUD Idi,” kata Direktur RSUD Idi, dr H Munawwir, Sp.B. (b24)

Divisi Pengawasan Bank Aceh Lemah MANGGENG RAYA (Waspada) : Pascaterkuaknya kasus pembo-bolan di Bank Aceh Capem Balai Kota, beragam tanggapan dari Lembaga Swadaya Masyarakat (LSM) dan kekhawatiran warga yang mulai menipis kepercayaan terhadap bank plat merah itu muncul. Seperti di Aceh Barat Daya, sejumlah warga baik dari pengusaha konstruksi, pedagang tekstil bahkan tukang sayur pun mengaku mulai enggan berurusan dengan pihak Bank Aceh. “Kasus di Bank Aceh Capem Balai Kota itu sebuah pukulan telak bagi citra bank plat merah itu, disamping itu, pengurusan di Bank Aceh dari zaman ke zaman memang tertutup,” kata Zulbayani, salah seorang kontraktor di Abdya yang mengaku sering berurusan di Bank Aceh cabang Blangpidie, Kamis (9/1). Demikian juga halnya dengan pengakuan dari Abdul Jalil, salah seorang pedagang tekstil. Pihaknya mengungkapkan di samping kepercayaannya terhadap Bank Aceh mulai menurun, dirinya juga mengaku sulitnya berurusan dalam hal pengurusan kredit dagang, untuk menembus dalam hal pengurusan kredit harus ada beking ‘orang dalam’ yang dalam pengurusan itu mengajukan syarat-syarat yang mencekik leher para pengusaha. Pj Ketua Komisi Nasional-Pengawasan Aparatur Negara (Komnas-Waspan) Abdya Irfan Faisal mengatakan, kasus bobolnya Bank Aceh Capem Balai Kota menunjukkan dengan pasti kalau Divisi Pengawasan Bank sangat lemah, bahkan bisa jadi tidak pernah melakukan pengawasan rutin terhadap operasional bank. (cza)

Gayo Art Summit Masuk Agenda Disbudpar Aceh BANDA ACEH (Waspada): Pelaksanaan event Gayo Art Summit yang digelar Ikatan Pemuda dan Mahasiswa Dataran Tinggi Gayo-Alas, sudah masuk dalam agenda tetap Dinas Kebudayaan dan Pariwisata Aceh tahun 2014. Demikian Gubernur Aceh Zaini Abdullah dalam sambutannya saat membuka Gayo Art Summit, pagelaran seni budaya tanah Gayo dan Alas, Rabu (8/1) di gedung AAC Dayan Dawood, Darussalam, Banda Aceh. Sebagai kepala Pemprov Aceh, kata gubernur dalam sambutan yang dibacakan Sekda Aceh Dermawan, mendukung pagelaran seni budaya Gayo-Alas tersebut. Karena bertujuan melestarikan seni tradisional daerah. “Pagelaran seni ini mendorong anak-anak muda tertarik dan mau belajar budaya dan seni kebanggaan daerah kita. Dengan begitu, seni budaya Aceh tidak akan lekang ditelan zaman,” sambungnya. Menurut gubernur, semua peradaban sejarah yang berlangsung di Aceh tidak lepas dari seni. Bahkan sejarah penyebaran Islam di Aceh pun sarat dengan kreasi seni. Sebut saja misalnya Tari Saman yang dikembangkan seorang ulama bernama Syekh Saman. “Tari ini hadir di tanah Gayo bersamaan dengan penyebaran Islam di wilayah itu. Tak heran jika syair-syair yang melekat dalam tarian itu sarat dengan ajaran-ajaran Islam,” kata gubernur. Gubernur juga mengimbau pemerintahan kabupaten/kota agar terus mendukung pementasan berbagai seni tradisional daerah masing-masing sehingga citra Aceh sebagai daerah yang kaya seni, bisa terus dipertahankan. (b06)

Tidak Ada Aset Aceh Timur Terbengkalai IDI (Waspada): Pemanfaatan aset di wilayah Kabupaten Aceh Timur dinilai sudah maksimal sesuai dengan ketentuan seperti belasan unit gedung pusat Pemkab setempat di Desa Titi Baroe, Kecamatan Idi Rayeuk dan Seuneubok Teungoh, Kecamatan Idi Timur. “Kita sudah manfaatkan semua aset dengan benar,” kata Bupati Aceh Timur Hasballah M. Thaib atau Rocky menjawab Waspada Rabu (8/1) di Idi. Dia menyinggung, dua aset besar yang dibangun beberapa tahun lalu yakni gedung Maghnit School di Peureulak Kota dan gedung baru RSUD Idi—sering disebut RS Medco—yang berlokasi di Idi Timur menurut dia tidak juga terbengkalai. Pasalnya, Gedung RSUD Idi sudah dimanfaatkan untuk berbagai kegiatan oleh Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Aceh Timur, seperti Pendidikan dan Pelatihan (Diklat) yang pesertanya menginap di lokasi RS Medco. Sementara Gedung Maghnit School belum bisa dimanfaatkan oleh Pemkab Aceh Timur, karena statusnya milik Kementerian Agama (Kemenag) sesuai dengan perjanjian awal antara Aceh Timur periode lama dengan Kemenag RI. “Tapi kita sudah jumpai jajaran Kementerian Agama (Kemenag) RI di Jakarta agar Maghnit School dinegerikan menjadi sebuah sekolah unggulan agama, namun hingga sekarang belum turun surat resmi atas usulan Pemkab Aceh Timur baru-baru ini,” kata Rokcy. (b24)

Syamsul Anwar, 20 Tahun Baca Waspada Secara historis hubungan emosional Harian Waspada dengan masyarakat Aceh dari dulu sampai saat ini dirasakan sangat kental. Karenanya tidaklah heran jika harian tertua yang terbit di Medan, Sumut ini, masih dicintai dan melekat di relung hati rakyat Aceh. Indikasinya, peredaran Waspada di bumi Serambi Mekkah, masih eksis dan berlanjut hingga saat ini. Bahkan banyak masyarakat di kampong-kampong mengaku kecewa karena tidak kebagian membacanya setiap hari. Padahal masyarakat mendambakan koran ini sampai ke tangan mereka, mengingat banyak pemberitaannya tampil beda dengan surat kabar lain. Penilaian itu dikatakan Syamsul Anwar, 67, warga Gampong Pasar, Jalan Merdeka Tapaktuan, Aceh Selatan, Kamis (9/1) sehubungan HUT ke-67 Harian Waspada, 11 Januari 2014. Pensiunan Polri dan mantan Kapolsek Sawang, Aceh Selatan ini mengaku telah 20 tahun membaca Waspada, sejak masih bertugas di Sigli, Kabupaten Pidie. Hingga saat ini meski telah pindah ke Tapaktuan, ia masih cinta dan setia membaca Waspada. Pada saat konflik mendera Aceh sepuluh tahun lalu, Waspada menurut dia merupakan media yang dapat dipercaya objektivitas pemberitaannya. Karena setiap informasi yang gonjang ganjing di lapangan, belum dapat diyakini kebenarannya sebelum pemberitaannya muncul di Waspada. (b30)

Waspada/Zamzamy Surya

SYAMSUL Anwar, saat membaca Waspda di kediamannya Warung Kopi Halim, Jalan Merdeka Tapaktuan


Waspada/Muhammad Zairin

PAGELARAN atraksi seni dan budaya tanah Gayo-Alas yang digelar, Rabu (8/1) malam di gedung AAC Dayan Dawood, Darussalam, Banda Aceh menjadi agenda tetap Disbudpar Aceh tahun 2014

Mahasiswa Unsyiah Protes UKTB BANDA ACEH (Waspada): Pihak Rektorat Universitas Syiah Kuala (Unsyiah) dituntut untuk meninjau kembali sistem uang kuliah tunggal berkeadilan (UKTB). Tuntutan itu disampaikan 30 mahasiswa yang tergabung dalam Komite Aksi Mahasiswa Kota. Dalam aksi demonstrasi di gedung Rektorat Unsyiah, Banda Aceh, Kamis (9/1) mereka mengakui biaya UKTB di Unsyiah masih bermasalah. Apa-lagi fasilitas yang diberikan tak sesuai. “Kami merasa uang yang

kami bayarkan terlalu besar dan tidakrelevandenganfasilitasyang diberikan,” ungkap Rizky Burnama, koordinator aksi, dalam orasinya di depan gedung rektor. Kata dia, sistem uang kuliah berkeadilan tersebut ditetapkan berdasarkan pendapatan orang tua mahasiswa. Akan tetapi, dalam pelaksanaannya tidak sesuai kenyataan. “Namun, dalam praktiknya ada mahasiswa dari kalangan ekonomi lemah harus membayar mahal uang kuliah yang melebihi kemampuan orang tuanya,” ungkap Rizky. Menurut dia, karena itu, pihaknya mendesak rektorat meninjau ulang kebijakan pelaksanaan sistem uang kuliah tunggal berkeadilan. “Jangan sampai

sistem ini merugikan mahasiswadariekonomirendah,”ujardia. Kata Rizky, imbas kebijakan yang tidak berkeadilan membuat banyak mahasiswa dari kalangan ekonomi rendah berhenti kuliah karena tidak sanggup membayar uang kuliah. Pembantu Rektor III Unsyiah RusliYusuf yang menjumpai pengunjuk rasa mengatakan, pihaknya akan menampung aspirasi mahasiswa dan menyampaikannya kepada Rektor Unsyiah. “Apa yang kalian sampaikan kami tampung. Tuntutan kalian juga akan saya sampaikan agar kebijakan sistem uang kuliah ini ditinjau ulang,” ungkap Rusli Yusuf. (b07)

Residivis Ditangkap Buka Kios Ganja IDI (Waspada): Setelah dihukum 2,5 tahun penjara di Rutan Cabang Idi, residivis ganja yang selama ini berprofesi sebagai pedagang kembali ditangkap petugas Satuan Narkoba Polres Aceh Timur di Desa Cot Keh, Kecamatan Peureulak Kota, Kamis (9/1) sekira pukul 00:05. Tersangka MTF, 40, asal Desa Cot Keh, Kecamatan Peureulak Kota, AcehTimur.“Tersangka residivis. Dia (MTF) sudah pernah dihukum 2,5 tahun penjara dan sekarang kita tangkap lagi

karena terbukti menjadi pedagang ganja,” kata Kapolres Aceh Timur AKBP Muhajir, SIk.MH melalui Kasat Narkoba AKP Adi Sofyan. Dijelaskan, selama ini tersangka kembali menggeluti pekerjaan haramnya menjadi pengedar ganja. “Jika dilihat sepintas kios tersangka yang berada di depan rumahnya menjual jajanan dan rempah-rempah eceran. Hanya pelanggan tertentu yang mengetahui tersangka juga ikut menjual ganja di sana,” kata

AKP Adi Sofyan. Adi menyebutkan, setelah mengintai lalu petugas mengerebek kiosnya. Petugas menemukan 10 paket ganja kering siap edar dengan harga Rp10. 000 per paket. Setelah dilakukan pengembangan dan pemeriksaan rumah tersangka yang tidak jauh dari kiosnya lalu petugas berhasil menemukan bungkusan plastik warna biru yang diletakkan di belakang pintu belakang rumahnya berisi 1 kilogram ganja kering. (b24)

Kinerja Panwaslu Langsa Jalan Di Tempat LANGSA (Waspada): Kinerja Panitia Pengawas Pemilihan Umum (Panwaslu) Kota Langsa terkesan sepi, tidak bergairah alias berjalan di tempat. Padahal sudah seharusnya Panwaslu sebagai lembaga pengawas dalam pemilu untuk menyaring dan bekerja maksimal dalam melihat calon legislatif yang memang merangkap jabatan d desa dan lembaga-lembaga dalam pemerintah. Sebagaimana tertuang dalam UU Pemilu No 8 pasal 51 poin m tahun 2013 bahwasanya setiap pencalonan anggota DPR, DPD, DPR Provinsi dan DPR Kabupaten/Kota bersedia untuk tidak merangkap jabatan sebagai pejabat negara lainnya, direksi, komisaris, dewan negara dan/atau karyawan usaha milik

daerah serta badan lain yang anggarannya bersumber dari keuangan negara. ‘’Jadi kami menilai Panwaslu Kota Langsa bisa membuat pengawasan yang intensif dan koordinasi dengan pihak KPU untuk kelangsungan pemilu yang sesuai dengan peraturan dan prosedur sesuai dengan undang-undang,” kata Koordinator Aliansi Mahasiwa Langsa (AMAL), Muhammad Husaini, kepada Waspada, Kamis. (9/1). Ditegaskan, Panwaslu Kota Langsa harus bekerja maksimal, setelah berakhirnya tahun 2013 dan masuk di tahun 2014, banyak kegiatan-kegiatan yang akan lahir dan menjadi pesta demokrasi rakyat. Karena 9 April nanti semua masyarakat Indonesia akan memilih kembali pe-

mimpin yang akan diusung untuk menjadi wakil rakyat. ‘’Selain itu, kita ketahui bersama saat ini setiap calon legislatif sudah mulai menunjukkan visi misi ke setiap daerah dan masyarakat.Jadi di sini juga panwaslu harus berperan aktif untuk mengawasi dalam artian cara-cara yang tidak dibolehkan dalam undang-undang. Dalam hal ini panwaslu yang juga termasuk dalam UU penyelenggara pemilu maka panwas tidak hanya melukakan kerja pengawasan tapi lebih dari itu. Paling tidak masyarakat kota langsa pada umumnya menyadari pemilu ini bukan hanya satu atau dua hari tetapi untuk 5 tahun yang akan datang untuk menjadi masyarakat dan bangsa yang sejahtera,” tandasnya.(cms)

BANDA ACEH (Waspada): Ketua majelis hakim dalam sidang perkara pembakaran lahan gambut di Kabupaten Nagan Raya memutuskan dengan menyatakan tergugat yaitu PT Kalista Alam telah melakukan perbuatan melanggar hukum sehingga harus membayar ganti rugi sebesar Rp114 miliar. Artinya majelis hakim telah mengabulkan gugatan Kementerian Lingkungan Hidup (KLH) atas tuduhan pembakaran lahan gambut yang dilakukan PT Kalista Alam karena telah merusak lingkungan dan fungsi lahan gambut seluas 1.000 hektare di kawasan Suak Bahong, Kecamatan Darul Makmur, Kabupaten Nagan Raya. Kasipenkum Kejati Aceh Amir Hamzah didampingi Jaksa Pengacara Negara Abdul Khadir yang mengikuti sidang mengatakan, dalam sidang di Pengadilan Negeri Meulaboh itu, Hakim Ketua Rahmawati bersama anggotanya JuandaWijaya dan Rahma Novatiana menolak eksepsi tergugat PT Kalista Alam dan mengabulkan bukti dari penggugat KLH. Putusan dibacakan majelis hakim, Rabu (8/1) yang dimulai sejak pukul 15:00 hingga pukul 22:30.

Hakim juga memutuskan, PT Kalista Alam harus membayar uang pemulihan lahan atau rehabilitasi Rp215 miliar atau bila tidak melaksanakan akan dikenakan uang paksa (Dwangsom) sebesar Rp1 miliar. Kemudian di atas lahan 1.000 hektare tidak dibolehkan adanya aktivitas. Sementara kuasa hukum PT Kalista Alam Alfian Sarumaha kepada wartawan mengatakan, dalam waktu 14 hari setelah putusan sidang ini, pihak perusahaan akan mengajukan banding. Kasus PT Kalista Alam bermula pada Agustus 2011 ketika Gubernur Aceh saat itu menerbitkan izin usaha perkebunan bagi PT Kalista Alam. Padahal, pada Mei 2011, areal seluas 1.605 hektare yang diizinkan, masuk dalam areal moratorium. Izin Gubernur Aceh kemudian digugat oleh Wahana Lingkungan Hidup (Walhi) Indonesia Aceh ke PTUN Aceh. Namun majelis hakim saat itu memutuskan menolak gugatan Walhi Aceh danWalhi pun menyatakan banding. Isu tersebut kemudian diketahui UKP4 dan merekomendasikan penyidikan menyeluruh atas kasus itu, termasuk penyelidikan di lapangan. (cb01)

KPPA Langsa Dilantik LANGSA (Waspada): Komite Pemenangan Partai Aceh (KPPA) Pusat, Tgk Zulkarnaini Bin Hamzah melantik Komite Pemenangan Partai Aceh (KPPA) Kota Langsa di aula Hotel Harmoni Langsa, Rabu (8/1) malam. Hadiri Tuha Peut Partai Aceh Langsa Tgk Usman Abdulllah,SE yang jugaWali Kota Langsa, Wakil Wali Kota Drs Marzuki Hamid, MM, Ketua DPW Partai Aceh Langsa, Iskandar, juru bicara PA pusat Fahrurazi, petinggi PA dan KPA, para mantan kombatan serta pimpinan SKPK di jajaran Pemko Langsa. Ketua DPW Partai Aceh Langsa, Iskandar dalam sambutannya mengatakan, pelantikan ini bertujuan untuk mengorganisir secara sinergis dalam upaya meraih kursi pada Pemilu 2014 baik tingkat DPRK Langsa maupun DPR Aceh. Ketua KPPA Langsa Muhammad Zulfri, ST. MM. MT dan Tuha Peut PA Langsa Tgk Usman

Abdullah, SE dalam sambutannya menyebutkan, apa yang direncanakan harus dapat terlaksana dengan baik, untuk itu butuh orang untuk mengorganisir. Ini lah fungsi dan tugas KPPA Langsa ke depan. KPPA Pusat, Tgk Zulkarnaini Bin Hamzah dalam orasinya mengatakan target 80 persen suara dalam pemilu April mendatang bukan muluk-muluk, tapi suatu kerja yang sangat realisitis mengingat sumber daya yang dimiliki Partai Aceh saat ini sudah tidak perlu diragukan lagi. Adapun pengurus KPPA Kota Langsa, Ketua Muhammad Zulfri, ST. MM. MT, Wakil Ketua Khairul Azmi, SH, Wakil Ketua Kamarudzaman, Wakil Ketua Nurasiah, Sekretaris Umum, Adlin Furqan, Wakil Sekretaris Saiful Bahri, Wakil Sekretaris Ali Akbar, Wakil Sekretaris Musliadi, Bendahara Umum, Furqan,SPdi, Wakil Bendahara Chaidar dan Hasan Basri. (cms)

Majelis Taklim Manzilul Minan Peujame Anak Yatim PEUREULAK (Waspada): Menyambut hari ulang tahun ke 15 Majelis Taklim Manzilul Minan, Gampong Beusa, Kecamatan Peureulak Barat, Kabupaten Aceh Timur dan bertepatan dengan Maulid Nabi Muhammad SAW menggelar kegiatan peujame (menjamu) anak - anak yatim sekaligus memberikan santunan serta kenduri di Masjid Manzilul Minan, kecamatan setempat pada Rabu (8/1). Ketua Panitia Palaksana Tgk. H. Anwar Abda didampingi Sekretarisnya Tgk Saiful Mulki Sulaiman mengatakan, kegiatan peujame aneuk yatim dan khanduri Maulid Nabi Muhammad Rasulullah , SAW, merupakan agenda rutin

setiap tahunnya dilakukan Majelis Taklim Manzilul Minan Peureulak Barat sejak berdirinya Majelis Taklim pada tahun 1999. “ Majelis Taklim Manzilul Minan Gampong Beusa dicetus oleh alm. Abu H Abdul Wahab, pimpinan Dayah Darul Sa’dah Idi Cut pada tahun 1999, selain mengelar acara santunan anak yatim jamaah juga mengelar doa bersama dan tauziah agama yang disampaikan Abi Jafaruddin Dayah Lueng Angen Lhok Nibong,” sebutTgk Anwar Abda. Majelis Taklim Manzilul Minan, sejak berdirinya hingga saat ini yang sudah berusia 15 tahun, masih tetap eksis mengelar pengajian rutin di Masjid Manzilul Minan Peureulak Barat. (cri)

Alumni SMAN I Kualasimpang 1984 Gelar Reuni KUALASIMPANG (Waspada): Alumni Jurusan Ilmu Pengetahuan Sosial ( IPS) II SMAN I Kualasimpang menggelar reuni di Desa Bukit Tempurung,Kecamatan Kota Kualasimpang, Kab.Aceh Tamiang, Rabu (8/1) Acara reuni khusus untuk mantan siswa/ siswi jurusan IPS2 SMAN I Kualasimpang ( sekarang berubah nama menjadi SMAN I Kejuruan Muda) menurut T Zahrita bertujuan untuk menjalin hubungan silaturahmi antar sesama mantan siswa. Para alumni jurusan IPS II Angkatan 1984 SMAN I Kualasimpang berdasarkan laporan yang diterimanya semuanya masih lengkap dan tersebar di berbagai provinsi di Indonesia. “ Saya berdomisili di Medan,” ujar T Zahrita yang turut didampingi RahmaYunita dan rekanrekan lainnya. Zahrita kepada Waspada mengaku selama ini dirinya bersama rekan-rekan lainnya rajin mencari nomor kontak person para alumni IPS II SMAN I Kualasimpang yang tersebar di berbagai kota. Adapun sejumlah alumni IPS 2 SMAN I Kualasimpang Angkatan 1984 yang turut hadir antara lain Muhammad Hanafiah (Agam) yang

kini wartawan Waspada di Aceh Tamiang,T Zahrita, Rahma Yunita, T Arlinda, Nurhayati, Nurlis, Nurasbah, Rajmah, Siswati, Erliani, Linda, Razali, Junaidi Nasution, Maimun ( Glanter Kualasimpang /Vallhalla Band Medan ),Rudian, Maimun, Rasyidin, Said Hasan, Said Abdul Rasyid, Muhammad Nasir, Supriyono, Suwandi, Said Zuhri, Mahfud, Khaidir, Syahbuddin . Dari namanama itu selama ini ada yang berdomisili di Kualasimpang, Karang Baru,Manyak Payed, Rantau, Kejuruan Muda, Langsa, Medan, Sigli dan Banda Aceh. Sedangkan yang tidak hadir antara lain, Fatimah ,Wiwin Aswina,Azmain, M.Nurdin yang sudah tidak ada komunikasinya. Sedangkan Untung S ( Kalimantan), Wisneri, Mahmuda ( Jakarta), Susilawati ( Batam), Selviani Yusni ( Padang) , Fatmawati ( Lhokseumawe) walaupun sudah dihubungi melalui telepon selular ,namun karena faktor kesibukan kerja dan jarak yang jauh, sehingga mereka berhalangan untuk hadir. Para alumni ada yang sudah bekerja sebagai guru SMP, SMA, SMK, MAN, PNS, pegawai BUMD,Karyawan perkebunan,wiraswasta, mantan anggota DPRD dan ada juga sebagai ibu rumah tangga. (b23)

Potret Buram Anak-anak Di Aceh Tamiang SEBAGAimana kita ketahui anak adalah amanah dan karunia Tuhan Yang Maha Esa. Dalam diri anak melekat harkat dan martabat sebagai manusia yang seutuhnya.Anak adalah tunas, potensi dan generasi muda penerus cita-cita perjuangan bangsa,memiliki peran strategis dan mempunyai ciri dan sifat khusus yang menjamin kelangsungan eksistensi bangsa dan negara pada masa depan. Namun berbicara kehidupan bagi anak-anak di Kabupaten Aceh Tamiang sudah sangat memprihatinkan .Potret buram yang dihiasi dalam bingkai perjalanan “hitam-putih” sejumlah anak-anak di Kabupaten Aceh Tamiang mulai mengisi barisbaris grafik pada data statistik angka kriminalitas yang bergulir sampai ke meja hijau di Pengadilan Negeri Kualasimpang. Hal itu terjadi karena ada anak-anak yang ikut terlibat dalam kasus pembunuhan, narkotika, penipuan, pemerasan, kekerasan, penggelapan, penadah dan kasus lainnya. Anak-anak di Bumi Muda Sedia itu memang perlu mendapat kesempatan yang seluas-luasnya untuk tumbuh dan berkembang secara optimal. Hal ini perlu dilakukan perlindungan serta untuk mewujudkan kesejahteraan anak dengan memberikan jaminan terhadap pemenuhan hak-haknya serta adanya perlakuan tanpa diskriminasi. Bahkan menurut Undang-undang RI Nomor 23 Tahun 2002 Tentang Perlindungan Anak, BAB IX Penyelenggaraan –Perlindungan anak sudah jelas disebutkan yang ada relevansinya dengan agama, kesehatan, pendidikan, sosial dan perlindungan hukum bagi anak-anak . Bahkan, sebelumnya sudah diatur juga dalam UUD 1945,Undang-undang Nomor 4 tahun 1979 tentang kesejahteraan anak, Undang-undang Nomor 7 tahun 1984 tentang Penghapusan Segala Bentuk Diskriminasi Terhadap Perempuan (Convention on The Elimination of all Forms of Discrimination Against Women), Undang-undang Nomor 3 Tahun 1997 Tentang Pengadilan Anak,Undang-undang Nomor 20 Tahun 1999 Tentang Pengesahan ILO Convention No.138 Concerning Minimum Age for Admission to Emplayment ,Undang-undang Nomor 39 tahun 1999Tentang Hak Asasi manusia,Undang-undang Nomor 1 Tahun 2000 Tentang Pengesahan ILO Convention No.182 Concerning The Prohibition and Immediate Action For The Elimination of The Worst Forms of Child Labour, dan masih banyak

peraturan lainnya yang ada relevansinya dengan anak-anak Indonesia. Namun fakta berbicara, sejumlah anak dan perempuan yang tersandung sejumlah kasus kriminalitas di Kabupaten Aceh Tamiang. Dari 109 orang pelaku pencurian di kalangan kaum pria, ada 15 orang anak-anak sebagai pencuri. Yang sangat memprihatinkan ada enam orang anak dan delapan orang perempuan yang terlibat kasus narkotika, anak-anak juga ikut membunuh dan terlibat berbagai kasus kriminal lainnya. Data diperoleh dari Ketua Pengadilan Negeri Kualasimpang, Kab.Aceh Tamiang, Aimafni Arli,SH melalui Humas PN setempat, Eka Prasetya Pratama,SH ketika dikonfirmasi Waspada, Rabu (8/1) Menurut hasil penelusuran Waspada, sepanjang tahun 2013 yang lalu tercatat perkara yang masuk cukup banyak yaitu mencapai 292 orang terlibat berbagai perkara. “ Ada peningkatan sekira 10 persen jumlah orang yang terilbat berbagai kasus dan perkaranya masuk pada tahun 2013 jika dibandingkan dengan jumlah perkara yang masuk pada tahun 2012 di PN Kualasimpang,” ujar Eka. Dari jumlah itu, jelas Eka, tercatat perkara kasus pencurian melibatkan sebanyak 128 orang pencuri, rinciannya yakni sebanyak 109 laki-laki dewasa sebagai pencuri,sedangkan perempuan yang mencuri ada empat orang dan anak-anak sebagai pencuri jumlahnya mencapai 15 orang. “ Kasus pencurian yang berkasnya masuk ke PN Kualasimpang memang paling menonjol di Aceh Tamiang ,” terang Eka. Humas PN Kualasimpang itu juga menerangkan, Sedangkan kasus /perkara penadah yang masuk di PN Kualasimpang mencapai 20 perkara, rinciannya adalah 18 orang laki-laki yang sudah dewasa, ada juga seorang perempuan dan seorang anak-anak sebagai penadah. Perkara lainnya yang juga sangat menonjol dan sangat memprihatinkan, adalah kasus narkotika mencapai 97 perkara yang masuk pada periode Januari-Desember 2013. Dari jumlah tersebut tercatat laki-laki dewasa yang terlibat narkotika sebanyak 83 orang, perempuan delapan orang dan anak-anak ada enam orang yang terlibat narkotika. Kasus lainnya yang juga melibatkan anak-anak sebagai pelakunya yaitu kasus kekerasan. Ada tujuh yang terlibat kasus kekerasan, rinciannya lima pelakunya laki-laki yang sudah dewasa dan dua anak-anak juga terlibat dalam kasus itu.

Kasus lainnya yang juga melibatkan anak-anak pelakunya yaitu kasus penganiayaan. Ada tujuh orang laki-laki yang sudah dewasa dan seorang anak-anak terlibat dalam kasus itu. Pada kasus pemerasan yang terjadi pada tahun 2013 juga ada seorang pelakunya dan tercatat pelakunya ternyata seorang anak-anak. Kasus lainnya yang juga ikut menyeret anak-anak sebagai pelakunya yaitu kasus penipuan ada sembilan orang yang terlibat yaitu tujuh orang laki-laki yang sudah dewasa, seorang perempuan dan seorang anak-anak juga ikut terlibat dalam kasus penipuan. Ada juga kasus pembunuhan yang pelakunya seorang lakilaki yang sudah dewasa dan seorang anak di Kabupaten Aceh Tamiang juga terlibat dalam kasus pembunuhan. Sedangkan kasus Kekerasan Dalam Rumah Tangga atau yang terkait dengan Undang-undang RI Nomor 23 tahun 2004 Tentang Penghapusan Kekerasan Dalam Rumah Tangga (KDRT) ,tercatat ada tiga kasus KDRT .Pelakunya semuanya laki-laki . Kasus yang ada relevansinya dengan Undang-undang RI Nomor 23 Tahun 2002 Tentang Perlindungan Anak, tercatat ada dua kasus Kejahatan Susila/Perlindungan Anak dan tiga kasus lainnya yang terkait dengan UU Nomor 23 tahun 2002. Kejahatan asusila yang bukan terkait dengan undang-undang hanya ada dua kasus. Semua pelakunya adalah laki-laki. Kasus-kasus lainnya yaitu kasus lalu lintas hanya ada seorang pelaku, kasus pelanggaran UULAJ hanya ada seorang pelaku, kasus penghinaan hanya ada seorang pelaku, kasus perbuatan tidak menyenangkan ada tiga orang pelaku,kasus kehutanan seorang pelaku, pra peradilan 1 kasus,Perikanan ada dua orang pelaku, kasus karantina,ikan, hewan dan tumbuhan ada dua orang pelaku, kasus minyak dan gas Bumi ada seorang pelaku,kasus Kejahatan bagi orang atau barang ada tiga orang pelakunya. Semua kasus tersebut pelakunya adalah laki-laki yang sudah dewasa dan tidak melibatkan anak-anak maupun perempuan. Dari semua data di atas membuktikan kesadaran sejumlah warga di Kabupaten Aceh Tamiang, baik anak-anak ,laki-laki dewasa dan perempuan terhadap hukum relatif masih rendah. Lantas dalam hal ini siapa yang harus disalahkan. Muhammad Hanafiah


Datar Khatib Shalat Jumat

MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Matsum II Ar-Rahim Ranting Halat Kota Matsum Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Lingk. III Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib No. 15 Al-Istiqomah Jl. Seto No. 33 Kel. Tegal Sari II Al-Makmur Gg. Langgar/Bahagia No. 25 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Damai No. 27 Al-Wathan Jl. A.R. Hakim Gg. Langgar No. 53 Al-Utaminiyah Jl. Utama Gg. H. Syukur No. 1 Darul Ikhlas Jl. Batu No. 13 Kel. Sei Rengas Permata Istiqlal Jl. Halat No. 36 Kel. Kota Matsum IV Jamik Jl. Medan Area Selatan No.289 Kel.Sukaramai-I Jamik Jl. Sutrisno Gg. Damai I No.6 Kel.Kota Matsum I Khairiyah Jl. Rahmadsyah/Puri Gg. Subur No. 192 Muslim Jl. Gedung Arca No. 3 Muslimin Jl. Dr. Sun Yat Sen No. 71 Nurul Huda Jl. Denai Gg. Pinang No. 12 Tegal Sari-I Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Quwwatul Muslimin Jl. H.M. Jhoni No. 69-D Shilaturrahim Jl. Emas No. 10 Kel. Sei Rengas Permata Syekh Hasan Maksum Jl. Puri Gg. Madrasah No. 181 Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. A.R. Hakim Gg. Langgar No. 8-A Taqwa Jl. Puri No. 183 Kompleks Masjid Taqwa Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Mhd. Khawari Susianto H. Arif Muhammad Erde, Lc Drs. H. Abdullah Sani Sinaga Ahmad Hadi Sumardi Zulkifli Drs. H. Syahruddin Nasri Hsb. Drs. H.M. Hafiz Ismail Muhammad Imran, S.Ag Dr. H.M. Roihan Nst., MA Drs. Syafrizal, S.Pd.I H. Jasmi Assuyuty, S.Pd.I Drs. H. Muhiddin Gurning Ahmad Syafi’i Harahap, S.Ag H. Ali Amran Zakaria, Lc H. Nurdin Muhammad, BA Drs. H. Kemal Fauzi Drs. H. Muniruddin, M.Ag Drs. H. Ahmad Azizi Syahril Basyrah, MA Drs. Alwi Batubara Drs. Suramin Hadi Drs. H. Sokon Saragih, MA Drs. H. Ulumuddin Siraj Rajdinal, S.Sos, M.AP Drs. H. Masyaluddin Berutu Drs. Khudri Lubis Prof. DR. Nawir Yuslem, MA

MEDAN AMPLAS Ar-Rahmat Jl. Bajak II-H Harjosari II Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Al-Hidayah Jl. S.M. Raja Km. 10,5 No. 60 Al-Hikmah Jl. Garu II B Kel. Harjosari I Al-Muslimin Jl. Pangilar No. 35-A Lingk. II Kel. Amplas Baiturrahman Jl. Bajak III Kel. Harjosari II Daarul Azhar Jadid Jl. Bajak II Gg. Cengkeh No. 1 Jami’Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Nurul Hidayah Jl. Garu IIA No. 26 Lingk. II Nurul Barkah Jl. Selambo IV No. 7 Nurul Iman Jl. S.M. Raja Km. 9 Kel. Timbang Deli Nurul Tuvail Khatijah Jl. Garu IV No. 140 Rohaniah Jl. Selamat Ujung No. 181 Kel. Sitirejo III Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Bali Ramadhan Jl. Garu VI Kel. Harjosari I Salman Jl. STM Kel. Sitirejo II Tarbiyah Jl. S.M. Raja XII Gg.Masjid No.351 Sp.Limun Taqwa Jl. S.M. Raja Gg. Pulau Harahapan No. 1-B

Drs. Adam Sakiman Anwar Saleh, S.Pd.I Drs. H. Zahiruddin Nst., MA Drs. H. Syahroni Husin H. Ismail Nasution Muhammad Abidin, S.Pd.I Badrin Rizaldi, S.Pd.I Drs. Hasanuddin Parinduri H. Mhd. Basir Yahya M. Tholib Harahap, MA H. Abdurrahim, SH Drs. Pangeran Harhap, MA Drs. M. Yusuf As’ady Akmal Fikri Drs. Saifuddin, SH Drs. H. Yusdarli Amar Zainuddin, MA Gunawan, MA, M.SI

MEDAN BARU Al-Amanah Jl. Diponegoro No.30-AKomp.Gd.KeuanganProf. Dr. H. HasballahThalib, MA Al-Falah Bank Sumut Lantai X Jl. Imam Bonjol No. 18 Syafruddin Syam, MA Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Asmuri Lubis Al-Ikhlas Jl. Sei Padang No. 129 Abdul Gani, S.Pd.I Al-Ikhlas Pasar 7 Padang Bulan Khaidir, S.Ag, M.Pd Muslimin Jl. Sei Batang Serangan No. 93 Muhyidin Nasution Nurul Muslimin Jl. DR. TD. Pardede No. 42 Drs. Anshari Ahmad Nurul Huda Asrama Bromob Medan Drs. H. Ilyas Purba MEDAN BARAT Akmal Jl. Putri Merak Jingga No. 19 Asy-Syafiyah Jl. Karya Dalam (Depan Kantor Lurah) KB Al-Furqan Jl. Karya 2 Lingk. VI Kel. Barang Berombak Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul Al-Muflihun Jl. K.L. Yos Sudarso Lingk.X Glugur Kota Haji Maraset Jl. Sei Deli No. 139 Kel. Silalas Jami’ Jl. Merdeka No. 3 P. Brayan Kota Jami’ Jl. Karya No. 85 Kel. Sei Agul Muslimin Jl. Karya Gg. Kartini No. 41 Nurul Hidayah Jl. Danau Singkarak Gg. Masjid No. 6

Febry Lesmana, S.Ag H.M. Nasir Zainuri, S.Ag H.M. Daud Sagitaputra, S.Ag Rajudin Sagala, S.Kom Shofian, MS Rahmad Lubis, S.Sos.I Drs. Abdul Majid Drs. Zulkifli Nasution Nano Wahyudi, Lc, MA Drs. Irwansyah, MA Ismail Harun, S.HI Drs. Armansyah, MMTaqwa Jl. Jamaluddin Al-Bathani

MEDAN DELI Ar-Rahim Jl. Simpang Tanjung No. 1-A Ar-Ridha Komp. TNI-AL Jl. Alumunium Raya Tg. Mulia As-Sa’adah Jl. Alumunium IV Gg. Tawon Tg. Mulia Al-Ikhlas Jl. Alumunium III Lingk. XII Kel. Tg. Mulia Al-Jihad Jl. Mangaan I/Jl. Bahagia Raya Lingk. VI Al-Munawwarah Jl. Pulau Batam No. 1 Al-Qurqaan Jl. Alfaka Raya/Sp.Alfaka VIII Lk.VI Tg.Mulia Al-Syarifah Jl. Metal, G. Rukun Lingk. 18 Kel. Tg. Mulia Darussalam Jl. Suasa Selatan Lingk.IX Kel. Mabar Hilir Jam’iyyatush Shoolihiin Kel. Tg. Mulia Nurul Ikhsan Jl. Mangaan I Lingk. VIII Mabar

H. As’ad Marlan, MA Iqror Anshori, S.Ag Nizamuddin, S.Ag, SH Waizul Qorni, MA Drs. Zulfarman Lubis K.H. Hasan Basri Nurtuah Tanjung, S.Ag Edy Susanto, S.Pd.I Ristanto Abdul Rony Hasibuan, MA Saiful Bahri, MA

MEDAN DENAI Arafah Jl. Pertiwi/Jl. Selamat No. 20 Kel. Binjai Amal Bakti Jl. Raya Menteng Gg. Abadi No. 21-A Al-Amanah Jl. A.R. Hakim Gg. Aman No. 90 Al-Hidayah Jl. Bromo Gg.Masjid Al-Hidayah Kel. Binjai Al-Hidayah Jl. Menteng Indah VI Kel. Medan Tenggara Al-Hasanah Perumnas Mandala Perumnas Mandala Al-Mukhlishin Jl.Enggang I Perumnas Mandala Al-Mukhlishin Jl. Selamat No. 8 Kel. Binjai Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg. Kurnia Al-Muslimin Jl. Menteng II Gg. Pembangunan Lingk. XI Al-Quba Jl. Denai No. 233 Al-Ridha Jl. Jermal VII Baiturrahman Jl. Medan Tenggara VII No. 42 Baiturrahim Jl. Pelajar Timur Gg. Darno No. 5 Hijraturridho Jl. Selamat Ujung Gg. Subrah Sp. Limun Nurul Islam Jl. M. Nawi Harahap Nur Hidayah Jl. Datuk Kabu No.17BGg.Masjid No.11-C Taqwa Jl. Jermal III No. 10 Taqwa Jl. Pancasila Gg. Masjid No.1 Kel.T.S.Mandala III Taqwa Jl. Mandala By Pass No. 140 Taqwa Jl. Seksama Gg. Rela No. 10

H.Darwin Zainuddin, MA Isa Ansari, S.Pd.I Awaluddin Pulungan, MA Drs. H. Manaon Batubara, MA H. Hafiz Yazid Drs. H. Hamid Mashudi Drs. H. Mar’ie Batubara Edi Yanto, MA Drs. H. Muchtar Amin Indra Drs. Muchsin Harahap Ruskhan Nawawi Khoiruzzaman, S.HI, S.Pd.I Khoiruzzaman, S.HI, S.Pd.I Ibrahim Yuan, S.Pd.I Drs. H. Dariansyah Emde H.M. Silahuddin P., S.Pd.I Drs. Usman Batubara Drs. Faisal Lubis, MA Samidi Yasma, S.Ag, M.Pd Drs. Satiman Syaifuddin Daulay

MEDAN HELVETIA Amaliyah Jl. Sakura Lingk. XI Blok 19 Perumnas Asy-Syakirin Jl. Kompl. TNI-AD Gaperta Ar-Raudhah Jl. Persatuan No. 22 AR Helvetia Timur At-Taubah Jl. Pasar II Kompl. Kasmil Kel. Cinta Damai At-Taqwa Makodam I\Bukit Barisan Jl. Binjai Km. 7 Al-Falah Jl. Palem Raya Perumnas Helvetia Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Al-Ikhlas Jl. Teratai II Blok 18 Perumnas Helvetia Al-Ikhlas Jl. Bahagia Lingk. VI Kel. Cinta Damai Al-Ikhlas Jl. Jongkong Kompl. Dolog SU Lingk. I, II, III Al-Ishlah Jl. Kapten Muslim 54-A Al-Mukhlisin Jl. Bakti Utara No. 21 Lingk.VI Kel. T.Gusta Al-Mukhlisin Jl. Cempaka V Blok XV Perumnas Helvetia Al-Mahabbah Jl. Kelambir Lima Gg. Sentosa Tg. Gusta Shilaturrahim Jl. Perkutut Lingk. XXII Kel.Helvet Tengah Darussalam Jl. Asrama No. 11 Ikhlasiyah Jl. Amal Luhur No. 29 Kel. Dwikora Shilaturrahmi Jl. Perkutut Gg. Masjid No. 3 Lingk. XXII Taqwa Perumnas Helvetia Taqwa Jl.Setia No. 30 Tanjung Gusta Taqwa Jl. Pemasyarakatan Gg. Masjid No. 7 Sukadono Taqwa Jl. Kapten Sumarsono Gg. Safar Pasar III

Drs. Zulham Effendy, BB, MBA Drs. H. Dariansyah Ende H. Maddin Nasution Drs. Ali Imron Sinaga Dr. H. Zamakhsyari Hasballah, Lc,MA M. Ridho M. Ghozali, S.Pd.I H. Burhanuddin Noor, Lc Drs. Zulkifli Lubis, BA Drs. H.M. Suib Saragih Drs. P. Simamora Prof. Dr. Ir. H.Basyaruddin, MS Drs. Wahid Hasan Drs. H. Syamsuddi Hasan Ilyas Amri Sirait, S.HI Drs. H. Rusli, M.R.

MEDAN KOTA Al-Hidayah Kel. Sudirejo II Drs. H. Usman Batubara Al-Hasanah Jl. Tanjung Bunga II Kel. Sudirejo II Drs. Adam Amin Al-Ikhlas Jl. Salak No. 9 Drs. Irwan Syahputra, MA Al-Muttaqin Jl. Amaliun/Paduan Tenaga Gg. Tengah Drs. Suid Alam Al-Mashun Medan Deli Jl. S.M. Raja Drs. H. Syarifuddin Elhayat, MA Da’wah Jl. Sakti Lubis Gg. Amal No. 19-B Dr. H. Zulheddy,MA Hikmah Hongkong Plaza Jl. Cerebon Drs. Waldemar Gazali Jami’ Teladan Jl. Gembira No. 2 Kel. Teladan Timur Drs. H. Abdul Rozak Muslimin Jl. Air Bersih No. 86 Lingk.VIII Kel. Sudirejo I Son Haji Harahap, S.Ag Mu’allimin Jl. S.M. Raja Kp. Keluarga No. 33 Dr. Faizar Ananda, MA Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 DR. H. Hasan Mansur, MA Nurun Nabatiyah Kantor Kehutanan Provsu Jl.S.M.Raja Drs. H. Syahlan Harun Pahlawan Muslimin Jl. Pencak Drs. H. Harmein Tanjung Raya Pusat Pasar Drs. Maulana Siregar, MA Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sidorejo-I Drs. Dahrul, MA Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Mar’i Muhammad, S.HI Taqwa Jl. Turi Gg. Sepakat No. 5 Kel. Teladan Timur Taqwa Jl. Demak No. 3 Dr. H. Sudirman, MA Thawalib Jl. S.M. Raja Gg. Thawalib No. 11 Ilham Syah Putra, S.Pd.I Yayasan Zending Islam Indonesia Jl.S.M.Raja No. 11 M. Ramadhan Lubis, S.HI MEDAN LABUHAN Al-Mukarramah Kampung Besar Darat Kel. Martubung H. Herman Yusuf, B.Sc Nurul Khairiyah Jl. Veteran Ujung Psr X Ds Manunggal Muhammad Syahri MEDAN MARELAN Al-Barokah Jl. Kapt. Rahmad Buddin Gg. Mangga Al-Ikhlas Jl. Marelan IX Lingk. VII Kel. Tanah 600 Al-Ihsan Lingk. XVII Kel. Terjun Taqwa Jl. Penghulu Lama Gg. Famili Paya Pasir Taqwa Kampung Tengah Lingk. IX Terjun Taqwa Pasar 3 Timur Regas Pulau Marelan

Drs. H. Syahruddin Samosir, M.Pd Baringin Siregar, S.Ag M. Zais Nasution, S.Sos.I Drs. M. Hamim R, S.Pd.I M. Iqbal lHusen, S.Pd.I Khaidir Sulaiman, MA

MEDAN MAIMUN Abidin Jl. Brigjen Katamso Km.3 Gg. Nira Kel.Kp. Baru Al-Ikhlas Jl. Brigjen Katamso Gg. Wakaf Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Jami’ Al-Fajar Jl. Brigjen Katamso Gg. Al-Fajar Jami’ Aur Jl. Brigjen Katamso No. 32-D Kel. Aur Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Jami’ Kampung Baru Jl. B. Katamso Gg.Masjid No. 53

Irman Samosir Abdul Halim Surya Lubis Ruslan Idris Batubara, S.Pd.I Indra Budiman, S.Pd.I Fahrizal Drs. H. Arifin Gunawan Ahmad Supriadi, M.Ag


MEDAN BELAWAN As-Sa’adah Kel. Belawan Bahagia Raya Taqwa Belawan Veteran Belawan

Al-Muharram Jl. Eka Budi Kel. Gedung Johor Al-Ma’sum Jl. Al Falah No. 16 Al-Mustafa Jl. Karya Jaya Gg. Karya XII-XIV Al-Mahmudiyah Jl. Brigjen Hamid Km.6,5 Kel. T.Kuning Fajar Ramadhan Perumahan Johor Indah Permai II Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Baitussholihin Jl. Karya Bakti No. 71 Kel. P. Masyhur Baitussalam Jl. Brigjen Hamid Km. 5,5 Kel. T. Kuning Daurun Nur Jl. Suka Eka No.221 Lingk.XI Kel. S.Maju Muslimin Jl. Karya Jaya No. 120 Kel. Pangk. Masyhur Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Nurul Aldys Jl. Karya Bakti No. 34 Pangk. Masyhur Nurul Huda Jl. Letjen Ginting Km. 8 Kwala Bekala Nurul Huda Jl. M. Basir No. 9-A Lingk. Pkl. Masyhur Nurul Iman Jl. Stasiun No. 75 Kel. Kedai Durian Sholihin Jl. Karya Jaya No. 160-C

Drs. H. Ponu Siregar Drs. H. Khairul Anwar Drs. H. Sudarso Turman Nasution Prof. Dr. H. Ramli AW, MA Drs. Syamsuri Drs. H. Hazrat Ibrahim Khairul Adenan M. Nasrun H.M. Nadzrul Fakhri Hamyar Drs. H. Marasonang Siregar Drs. Syafruddin Harahap, S.Ag Amri Sembiring, S.HI Muhammad Ridwan, S.Pd.I DR. H. Muhammad Jamil, MA Hakimuddin Saragih, S.Ag Adi Suryanto, S.Pd DR. H. Muhammad Jamil, MA Drs. H. Budiman Nuzli Matseh, M. Drs. H. Syamsuddin Amin Khairul Shaleh, S.Sos.I

MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk.IV Kel.Gedung Johor Syahruddin Ritonga, S.Pd.I Drs. Khuwailid Daulay, S.Pd.I, MA Ainul Iman Jl. Ekawarni I Kel. Gedung Johor Ar-Raudhah Kompl. Rispa I Blok V Kel. Gedung Johor Drs. H. Sulthoni, MA Assyafi’iyah Jl. STM - Suka Tari No. 9 Kel. Suka Maju Ahmad Faisal Nasution, MA Al-Badar Jl. Karya Darma No. 19 Kel. Pkl. Masyhur Rustam Harahap, S.Pd.I Al-Firdaus Jl. Karya Jaya Gg. Eka Jaya II Lingk. II Ahmad Faisal Nasution, MA Al-Furqon Jl. Karya Perbatasan Lingk. XII P. Masyhur Asmu’i Lubis, S.HI Al-Hidayah Jl. Brigjen Katamso Km. 7,2 Kel. Titi Kuning Drs. Ngadimin Al-Hidayah Jl. Karya Jaya Gedung Johor Drs. H. Irfan Batubara Al-Ikhlas Jl. STM Suka Ikhlas Kel. Gedung Johor Drs. Sariman Al-Faruqi K.H. Khaidir AbdulWahab, Lc, MA Al-Ikhlas Jl. Karya Tani Lingk. VII Kel. Pkl. Masyhur Al-Ikhlas Jl. Karya Kasih Baru Lingk. X Kel. P. Masyhur M. Nasir Anshori, S.HI, M.HI Al-Muslimin Jl. Suka Luhur Kel. Suka Maju Drs. H. Sempurna Silalahi Al-Mukhlisin Jl. Karya Sehati No. 14 Kel. Pkl. Masyhur Mhd. Arifin Jahari, Lc, MA

Amal Jl. Ngalengko Lr. Saudara No. 11 Amar Ma’ruf Jl. Pertemuan No. 51 Kel.Sidorame Timur Ar-Rahmah Jl. Gurilla Gg.Melati No.5 Kel. S.Kerah Hilir Ar-Raudah Dinas Pendidikan Jl. Pelita IV No. 77 Al-Amin Jl. Prof. H.M. Yamin SH, No. 482 Al-Falaah Jl. Ibrahim Umar (Gg. Sado) No. 3 Al-Fajar Jl. Prof. H.M. Yamin SH Gg. Kelambir Al-Huda Jl. Malaka No. 117 Al-Hidayah Jl. Pahlawan Gg. Anom No. 12 Lingk. III Al-Ikhlas Jl. Setiajadi Kel. Tegalrejo Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Hidayatul Ihsaniah Jl. Sentosa Lama Gg. Aman No. 5 Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir I Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Syuhada Jl. Pahlawan No. 11 Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat I

Drs. Azhari Musa Purba H.M. Daud Sagita Drs. Syuahlul Amri Harahap Drs.Sahnim Siregar, S.Pd.I Drs. H. Effendi Rambe Drs. H. Usman, MA Drs. Musa Yahya H. Bustami, H.A., S.Ag Drs. Zulfahmi Hutasuhut, M.Ag Khairul Fattah, SH Drs. Abdul Kadir Jailani Mukhlis Muaz, S.HI Drs. H. Aswan Lubis Drs. H.M. Yamin Lubis Sarwan Nasution, S.Pd.I Prof.DR.H. Hasan Bakti Nst., MA Drs. M. Sofyan Lubis Drs. H. Ngadimin Hadi, KR.

MEDAN PETISAH Amaliyah Jl. M. Idris No. 22 Kel. SPT II Ar-Ridhwan Jl. Abd. Hamid No. 28 As-Syahaadah Jl. Sikambing Belakang No. 18 Asy-Syura Jl. Surau No. 18 Kel. Sei Putih Timur Al-Hidayah Jl. Periuk Gg. Mesjid No. 2 Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Al-Mukarram Jl. Sikambing Gg. Patimura No. 9 Al-Yasamin Jl. Sultan Iskandar Muda Baru No. 10 Istiqamah Pasar Petisah Jamik Jl. Kejaksaan Kebun Bunga Nurul Haq Jl. Listrik No. 12 Nurul Islam Jl. Kertas No. 2 Raya Aceh Sepakat Jl. Mengkara No. 2 Petisah Tengah

Drs. M. Idris Ritonga, M.Pd H. Jamaluddin Batubara, Lc Drs. Nazaruddin Usmar Chan M. Nasir Drs. H. Irwan Sulaiman Lubis M. Halim Harahap, S.Pd.I Dr. H. Ansari Yamamah, MA Drs. M. Yunus Daulay, MA H. Aslam Umar, S.Ag Prof. DR. H.M. Hatta Drs. Ibrahim Nasution Drs. Syafruddin Syam, M.Ag

MEDAN POLONIA As-Sakinah Kompl. Perumahan TNI Angk. Udara Awaluddin Banurea, MA Al-Hidayah Jl. Starban Kel. Polonia H. Herman Syahputra Al-Ikhlas Jl. Sejati No. 08 Kel. Sari Rejo Drs. H.M. Efendi Daud Al-Jihad Jl. Perjuangan 2 No. 5 Malibu 2 Kel. Sukadamai Syaiful Haq, S.Ag Al-Mujahidin Kompleks Paskhas Sarirejo Polonia Syarbaini, S.Pd.I Baitussalam Kompl. Kantor Kosek Hanudnas III Bambang Irawan, S.Ag Dirgantara Jl. Imam Bonjol No. 52 P. TNI AU Soewondo Drs. H. Azwardin Nasution Qiblatin Jl. Langgar No. 1 Kel. Sarirejo Azman, S.HI Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Drs. H. Poniman Silaturrahim Jl. Cinta Karya No. 39 Kel. Sari Rejo Drs. P. Hasibuan Sabilillah Komp. TNI-AU Karang Sari-I Kel. Sari Rejo Drs. Ishaq Ibrahim, MA Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D Drs. Badaruddin MEDAN SELAYANG Ar-Ridho Jl. Abdul Hakim Pasar I Tanjung Sari Drs. H. Ansari P., M.Ag Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Pd.Bulan Ahmad Bashori, S.Ag Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Heri Fitriansyah, MA Al-Ikhwan Jl. Bunga Wijaya Kesuma Gg. Masjid Ahmad Zaini, S.Ag Al-Istiqomah Jl. Sei Asahan Gg. Masjid No. 3 Drs. Mahyuddin Daulay Jami’ Jl. Pasar I Lingk. VIII Tg. Sari Drs. H. Lukman Hakim Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H. Arifinsyah Nurul Mukminin Jl. Kenanga Raya No. 10 Kel. Tg. Sari Azizon, SH, M.Hum Muslimin Jl. Setia Budi Kel. Tanjung Sari Sugeng Raharjo, S.Pd.I Nurul Hidayah Jl. Pembangunan USU Gg.Masjid No.22 H. Bahrinaldi Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Yusman Nasution, S.Ag Nurul Mukmin Jl. Bunga Mawar No. 46 Kel. P. Bulan Drs. H. Ibrahim Isa Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H. Basyaruddin Dja’far Taqwa Jl. Abdul Hakim No. 2 Pasar I Tanjung Sari Drs. Agus Taher Nasution MEDAN SUNGGAL Ar-Ridho Jl. Tut Wuri Handayani Perkamp. Kodam I/BB As-Saajidiin Jl. Prasetya I Komp. BTN Dusun III Sei.S. Al-Amin Jl. Setia Budi No. 202 Kel. Tg. Rejo Al-Badar Jl. Binjai Km. 6,8 Al-Falah Jl. Murni No. 27 Tg. Rejo Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Al-Hikmah Jl. Kiwi No. 7 Sei Sikambing-B Al-Ikhlas Jl. Beo Indah No. 15 Sei Sikambing-B Al-Ikhwan Jl. Gatot Subroto Km. 8,5 Pasar 5 Al-Istiqomah Dusun I Desa Pujimulio Al-Istiqomah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Al-Irma Jl. Rajawali Sei Sikambing-B Al-Islamiyah Jl. Binjai Km. 14.5 Gg.Gembira Ds. V Diski Al-Muttaqin Jl. Hanura No. 10 Tanjung Rejo Al-Mujahirin BBLKI Medan Al-Muhtadin Jl. Setiabudi Tanjung Rejo Al-Musabbihin Jl. Musabbihin Blok C T.Sedia Budi Indah Al-Raudhah Jl. Kemuning No. 7 Kel. Tanjung Rejo Darul Huda Jl. Sei Serayu No. 53-55 Sikambing-B Isti’adah Jl. Amal No. 4 Kel. Sunggal Istiqamah Jl. Perwira Utama No. 20 Kampung Lalang Jami’ Jl. Masjid No. 6 Tg. Rejo No. 6 Jamik Jl. Pinang Baris No. 19 Kel. Lalang Jamik M. Jayak Jl. Jend. Gatot Subroto Km.5,5 No. 184 Maimun Al-Munir Jl. Karya Baru No. 7 Tg. Rejo Nurul Huda Jl. Sei Serayu No. 38 Kel. Babura Nurul Ikhsan Jl. Kelambir Lima No. 53-B Kel. Lalang

Drs. Syaiful Asro Dalimunthe, MA Cece M. S.Pd.I Drs. H. Suparmin Sareh Drs. Hadi Syam Haris Drs. Lukman Hakim Hsb., M.Ag Jauhari Marpaung, S.HI Mhd. Solihul Amri Drs. H. Zainal Arifin, MA H. Amaluddin, S.Ag Drs. Syafi’i Zaini Drs. H. Marajaksa Harahap Drs. Bahren Manik, S.Pd.I Drs. Misnan, MA Zul Fahmi, S.Ag M. Fadli, SH Drs. H. Irham Hasibuan Drs. Suhendri, MA Watni Marpaung, MA Drs. Asman Ali Nur Harahap Marwan Rangkuti, S.Ag Hasnan, S.Ag Drs. M. Thohiruddin Drs. H.M. Yazid Mufti Lubis Ds. H. Syaiful Aziz Lubis Drs. Idrus Uteh Khomaini, S.Pd.I Nasrum

Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Syafinatus Salamah Perum Bulog Jl.Gatot Subroto 180 Taqwa Jl. Kapten Muslim Gg. Jawa Sei Sikambing C II Taqwa Jl. Taqwa Gg. Pendidikan Tanjung Rejo Taqwa Sugengrejo Jl. Merpati Gg.Mushola Sei. S-B

WASPADA Jumat 10 Januari 2014

Drs. H. Sunaryo Drs. Asyroruddin, S. Drs. Suprapto Nurdin, S.Pd Drs. Hasanuddin, MA

MEDAN TIMUR Amaliyah Jl. Perwira II Pulo Brayan Bengkel As-Sholah Jl. Pendidikan No. 39 Glugur Darat-I Al-Barkah Jl. Setia Jadi Kel. Glugur Darat I Al-Furqan Jl. Asahan No. 78 Kel. Sidodadi Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Al-Iman Jl. Sidang Raya, Kompl. DPRD Tk.I P.B.Bengkel Al-Ikhlas Jl. Timor No. 23 Kec. Medan Timur Al-Ikhlas Jl. Muara Sipongi Kel. Gaharu Al-Ikhwan Jl. Prajurit No. 28 Lingk. XI Gg. Bali Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Al-Mukhlishin Jl. G.B. Josua No. 8 Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B. Darat II Al-Waritsiin Jl. Bilal No. 71 Kel. Pulo Brayan Darat I Baiturrahman Jl. Gaharu Kel. Gaharu Bustanul Huda Jl. Perwira I Lingk. VIII P.B. Bengkel Nur Chadidjah Komp. Wartawan Jl. Letter Press No. 51 Nurul Yaqin Jl. Bukit Barisan I No. 74 Nurul Iman Jl. Bambu VI Kel. Durian Rabithatul Muslimin Lingk. 14 Gelugur Kota Syuhada Jl. Budi Pengabdian No. 2 P. Brayan Kota Taqwa Jl. Bilal Gg.Keluarga No.74 Kel. P.Brayan Darat I Taqwa Jl. Kapten Mukhtar Basri No. 3 Taqwa Jl. Rakyat/Lr. Maninjau No. 6 Sidorame Timur Taqwa Ubudiyah Jl. Bambu III Kel. Durian MEDAN TEMBUNG

Drs. Ahmad Dairobi Butar-butar Drs. H. Aspan Abdullah Sianipar Drs. Suparlan Drs. Ishaq Ibrahim, MA Bukhori Muslim, S.Ag Drs. H. Ali Suti Abdullah Syah, MA Ahmad Mulyono Sayuti, S.Ag Mardian Idris, M.Ag Mahmuddin, M.Ag Drs. H. Zakaria Batubara H. Sofwan, S.Ag, M.Pd.I Drs. Saipul Amin H.M. Thohir Ritonga, Lc Dr. H. Ardiansyah, Lc, MA DR. Mhd. Syahdan Nst., MA Drs. Nasiruddin Drs. H. Amrin Siregar DR. H. Syarbaini Tanjung Drs. Faisal Lubis Zailani, MA Abd. Rasyid, S.Ag Drs. H. Dalail Ahmad, MA

Ar-Rahman Jl. Willem Iskandar No. 35 Rasyid Anwar Dalimunthe, MA Ar-Rahman Jl. Durung Gg. Aspin H.D. Juntak, S.Ag Ar-Ramli Jl. Surya Lingk. XII Kel. Indra Kasih Drs. H. Abdurrahman Kasmi Ash-Shobirin Jl. Pukat Banting II (Mestika) No. 45 Irvan Wahyudi, S.Ag At-Tawwabin Jl. Pimpinan No. 1 Drs. H. Amhar Nasution, MA Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Dr. H. Ahmad Bangun Nst., MA Al-Falah Jl. Kemenangan 151 Kel. Indra Kasih Drs. Syamsul Bahri Al-Hijrah Jl. Beringin/Pancasila Dusun 8 Pasar 7 Drs. Sudirman Al-Hidayah Jl. Letda Sujono No.62 Kel.Bandar Selamat Drs. H. Amir Saleh Nasution Al-Huda Jl. Tangkul I Kel. Sidorejo Hilir Drs. H. Ali Amran Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5-B Drs. H. Bachron Nasution Al-Ikhlas Jl. Mandala By Pass Gg. Tengah Lingk. II Drs. H. Abubakar Siregar, MA Al-Ikhlas Jl. Pasar V Gg. Mesjid Al-Ikhlash Dusun XIII Parlin Bancin, Lc Al-Ihsan Jl. Suluh No. 148 Budi Setioso, S.Ag Al-Istiqomah Komplek Veteran Medan Estate H. Aspil Batubara, Lc Al-Ijtima’iyah Jl. Letda Sujono No. 152 Kel. Tembung Nazaruddin Nasution Al-Muslimun Jl. Pertiwi No. 94-C Kel. Bantan Drs. Joko Santoso Al-Mukhlisin Jl.Terusan Dusun II Kec. Percut Sei Tuan Herman, S.Ag Al-Mubiin Desa VII Selasih Desa Bandar Khalipah Suheri, S.Pd.I Al-Muhajir Jl. Rel Pasar X No. 6 Bandar Khalipah Kumpul Pandapotan, S.Ag Al-Muqorrobin Jl. Pukat II/52 Kel. Bantan Timur Zulkifli Nasution, S.Pd.I Akbar Baitus Sujud Jl. Meteorologi Raya Gg.Karya No.1 Hasan Ma’sum, MA Hidayatul Muslimin Jl. Bersama No.105 Bdr. Selamat Drs. Ahmad Raja Pasaribu Ikhlashiyah Jl. Tempuling/Suluh No. 20 Kel. Sidorejo Hendra, S.Pd.I Jamik Al-Ikhlas Jl. Pengabdian Dsn I Desa Bandar Setia Drs. Abdul Halim Ombak Jamik Al-Jihad Jl. Besar Tembung Dusun I No. 17 H. Bustami, Lc Nurul Iman Jl. Rawa I Lorong Sedar Drs. H. Syamsul Rizal, P. Raya Muslimin Jl. Pukat I No. 1 d/h Jl. Mandailing H. Akhyar Nasution, Lc, MA Taqwa Jl. Enggang Raya No. 85 Perumnas Medan II Drs. Zulkarnain Lubis, MA Taqwa Kampus UMA Jl. Kolam No. 01 Medan Estate Dr. H. Azhar AkmalTarigan, MA Taqwa Jl. Belat No. 76-B Ibnu Hajar MEDAN TUNTUNGAN Ar-Rahman Jl. Plamboyan Raya Perum Griya Nusatiga Ar-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Al-Hidayah Jl. Seroja Raya lingk.I Kel. Tanjung Selamat Al-Ikhlash Cengkeh Jl. Cengkeh No. 24 Kel. Mangga Al-Muhtadin Jl. Kemiri Raya I No. 1 Blok-G. Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Baiturrahman Jl. Flamboyan I/04 No. 2 Tg. Selamat Baitul Rahman Jl. Rami 2 Perumnas Simalingkar Iklab Jl. Letjen. Jamin Ginting Km. 12,7 Nurul Hayat Kompl. LIZARDI Kel. Kemenangan Tani Nurul Yaqin Kel. Simpang Selayang Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Taqwa Jl. Sawit Raya, Perumnas Simalingkar

Drs. M. Ashlah Drs. H. Romsil Harahap M. Iqbal, SE Drs. Hasan Basri A.Ritonga Junindra Banurea, M.Ag Khairul Patah, S.Pd.I Ali Imran Nasution, S.Ag Drs. Amrin Yusuf Muhammad Al Farabi, MA Drs. H. Muchsin Faisal Akmal, S.Pd.I, SE H. Qosim Nurseha, Lc, MA M. Arief, MA

DELISERDANG Awaluddin Jl. Medan-Bt. Kuis Dsn I S.Rotan Gg.Abduh Amal Islamiyah Jl. Sudirman No. 4 Lubuk Pakam Ash-Sholah Jl. Roso Marindal 1 Al-Furqan Perum. Bumi Tuntungan SejahteraDesa SC Al-Falah Jl. Pasar V No. 73 Dusun XIV Desa Tembung Al-Ikhlhas Jl. Karya Wisata Kec. Namo Rambe Al-Ikhlas Jl. Deli Tua Dusun VI Desa Suka Makmur Al-Mustaqim Pasar IV Desa Marindal II Kec. Patumbak Baitussalam Dagang Kerawan Tanjung Morawa Baiturrahman Jl. Merica Raya Blok F Per. Simalingkar Baiturrohim Jl. Purwo Desa Suka Makmur Graha Deli Permai Jl. Sidodadi Jami’ Lubuk Pakam Kab. Deliserdang Jami’ Al-Ihsan Desa Selemak Kec. Hamparan Perak Khairul Fatihin Dusun II Kec. Tg. Morawa Nurusyahadah Dusun I Desa Tg. Morawa Nursa’adah Jl. Raya Medan- Tanjung Morawa Km. 12 Nurul Ikhwan Jl. H.A. Dahlan Tanjung No. 226 Raya Lubuk Pakam Jl. T. Raja Muda No. 39 L.Pakam Tarbiyah Jl. Bakti Desa Sekip Lubuk Pakam

Muhammad Fahri, MA H. Ahmad Taufik Lubis, S.Pd.I Jurianto, S.Ag Syafi’i Zein, S.Ag Drs. Ismail, S.Pd.I Pelda Ponijan H.A. Sugianto, Lc Harisman Aripin DR. H. Harianto, Lc, MA Drs. Syahridan L. Tobing Ahmad Fuad Sinaga, S.HI Drs. Fachruddin Afwan Helmi, MA Baharuddin Drs. Harmaini Margolang Yatiman, S.Pd.I Drs. H. Khaidir Tanjung Awaluddin, S.Pd, S.S. Drs. Syahdan Drs. H. Mujahuddin

LANGKAT Ar-Raudhah Dusun VII Kebun Balok Kec. Wampu Al-Furqan Stabat Nurul Huda Kel. Perdamaian Kec. Stabat

Salman Ardiansyah H.M. Ja’fars

TEBING TINGGI Amal Muslimin Kp. Rao Al Haq Kel. Deblod Sundoro Istikmal Jl. K.F. Tandean Lingk. III Kel. Bandar Sakti

M. Ridwan Syam Syamsuddin Harahap Emil Sofyan, S.Pd.I

SIDIKALANG Agung Kota Sidikalang

Drs. H. Mawardi Lingga, MA

PEMATANGSIANTAR Ar-Rahmah Jl. Kamboja Kel. Sinaksak Kec. T. Dolok Abrar Jl. Aru Kel. Bantan Amin Jl. Brigjend. Rajamin Purba Kel. Bukit Sofa Al-Falah Jl. Pane No. 1 Kel. Karo Al-Falah Jl. Rakutta Sembiring No. 5 Kel. Naga Pita Al-Furqon Jl. Tekukur No. 2 Kel. Sipinggol-pinggol Al-Hanif Jl. Ade Irma Suryani Nst. No. 28 Kel. Melayu Al-Hidayah Jl. Bazoka No. 6 Kel. Bukit Sofa Al-Hidayah Jl. MelanthonSiregar No. 36 Sukamakmur Al-Hikmah Jl. Sibatu-batu Kel. Bah Kapul Al-Hikmah YAPIM Jl. Viyata Yudha Kel. Setianegara Al-Hilal Jl. Melanthon Siregar No. 218 P. Marihat Al-Huda Jl. Medan Km. 7,5 Kel. Tambun Nabolon Al-Huda Rindam Jl. Bangau Kel. Setianegara Al-Ihsan Gang Kapuk Kel. Tanjung Tengah Al-Ihsan Jl. Rajawali No. 26 Kel. Simarito Al-Ikhlas Jl. Ampi No. 17 Kel. Bantan Al-Ikhlas Jl. Bakung No. 44 Kel. Simarito Al-Ikhlas Blok II Sibatu-batu Bukit Makmur Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba Al-Ikhlas Jl. Palangkaraya No. 12 Kep. Pahlawan Al-Ikhlas Jl. Sisingamangaraja Kel. Bah Kapul Al-Ikhlas Jl. Tangki Kel. Naga Pitu Al-Ikhlas Gg. Air Bersih No. 22 Kel. Naga Pitu Al-Ikhlas Jl. Silou Raya No. 2 Kel. Siopat Suhu Al-Jihad Jl. Jenderal Ahmad Yani Kel. Asuhan Al-Jihad Jl. Melati No. 11 Kel. Simarito Al-Jihad Jl. Tongkol No. 86 Kel. Pardomuan Al-Jihad PT. Telkom Jl. WR Supratman Kel.Proklamasi Al-Khairiyah Jl. Jorlang Hataran No. 1 Kel. Simarito Al-Khoirot Tambun Timur Kel. Tambun Nabolon Al-Muhajirin J. Viyata Yudha Kel. Bah Kapul Al-Mukminun Jl. Sang Nawaluh Kel. Siopat Suhu Al-Munawarah Gg. Karya Islam Kel. Melayu Al-Musyawarah Jl. Flores II Kel. Bantan Al-Muttaqin Jl. Patuan Anggi Gg. Emas Kel. Baru Baitul Abrar Jl. Meranti Kel. Kahean Baiturrahmah Jl. Tanah Jawa No. 75 Kel. Melayu

Drs. A. Syamsul, W. Drs. Tajussalim Ahmad Fauzi Lubis, S.Pd.I Suheimi, S.Ag Mhd. Rusli, S.Ag H. Muzayyin, BA H.M. Rafii Nasir, BA Nasrianto Nasution Samantio Sinaga, S.Pd.I Syamsuddin SRA, S.Pd.I Drs. Borkat Pandiangan, MM Mhd. Arifin Siregar Drs. Umar Hamid M. Rasyidan Drs. Junaed Harahap Drs. H. Chaidir Sitompul Abdussalam Lubis, S.Ag Ridwansyah Drs. H. Muhammad Asli Drs. H. Rasyid Nasution Abdussalam Lubis, S.Ag Zulfakar, SH H. Hasan Basri Siregar, MA Hanizar, S.Ag, S.Pd.I Mhd. Ikhwan Saragih, S.Ag Drs. H. Mustafa Kamal Siregar H. Abdul Halim Lubis, S.HI H.M. Thamrin Nasution Suwardin Drs. Badaruddin Dalimunthe Salamun Siregar Syarifuddin, S.HI Drs. Rustam Asy’ari, MA Hasan Basri Saragih Muhammad Yunan Arga Drs. H. Usman KI A.H. Mugiono Zer Drs. H. Ammar Lubis

Mimbar Jumat

WASPADA Jumat 10 Januari 2014

Kerugian Hakiki

Haram Membela Koruptor

Oleh Imam Pratomo, M.HI

Oleh Achyar Zein

Ka. Bag Peribadatan & Bahasa Ponpes Modern Darul Hikmah TPI Medan, Pegiat Kajian Ke-Islaman

Dosen FITK IAIN Sumatera Utara


engawali dari tulisan yang sederhana ini, penulis ingin mengajak kita semua agar tidak lalai untuk selalu mengingat Allah SWT. Sebab dengan mengingat Allah SWT hidup yang kita jalani ini akan selalu senantiasa bermakna mewarnai kebahagiaan, itulah tantangan buat kita hamba Allah SWT. Semua orang pasti ingin selalu bahagia dan tidak pernah menginginkan kesengsaraan walau sejenak. Semua orang ingin senantiasa beruntung dan berusaha maksimal menghindari kerugian, namun apa hendak dikata, fakta berbicara lain. Tidak semua yang diinginkan manusia di dunia ini terwujud, terkadang apa yang justru dihindari menjadi fakta yang harus diterima, meski terasa pahit. Kerugian terus mendera. Kenyataan pahit ini disikapi dengan sikap yang berbeda-beda, mulai dari sikap ekstrim sampai yang biasa-biasa saja. Terkadang sikap itu justru mendatangkan kerugian atau penderitaan baru, seperti bunuh diri , merusak harta-benda, mencederai diri sen-diri atau mencederai orang lain. Tapi ada juga yang menyikapi dengan santai, tenang dan penuh kesabaran. Dia menyadari bahwa kerugian yang dialami di dunia ini bukanlah kerugian hakiki, bukan kerugian yang akan mendatangkan penderitaan abadi itu bukanlah kerugian yang disebutkan oleh Allah SWT dalam fiman-Nya “Katakanlah, “Sesungguhnya orang-orang yang rugi ialah orang-orang yang merugikan diri mereka sendiri dan keluarganya pada hari Kiamat.” Ingatlah yang demikian itu adalah kerugian yang nyata. (QS. Az-Zumar: 15). Karugian yang disebutkan dalam ayat di atas itulah kerugian yang hakiki, yang akan menyebabkan penyesalan yang kekal. Kerugian pada Hari Kiamat adalah kerugian di saat kebaikan dan keburukan manusia ditimbang dengan timbangan teradil yang tidak mengandung kecurangan sama sekali. Semoga Allah SWT menyelamatkan kita semua dari kerugian tersebut. Kerugian pada Hari Kiamat juga merupakan akibat dari perbuatan kita selama hidup di dunia. Jika kesempatan hidup ini bisa kita manfaatkan dengan baik dan maksimal, sebagaimana seorang pebisnis memanfaatkan modal usahanya yang sangat terbatas untuk meraih keuntungan sebanyakbanyaknya, maka Insya Allah kita akan terselamatkan dari kerugian tersebut. Kerugian terburuk yang menimpa seseorang adalah kerugian yang menimpa agamanya, karena kerugian ini akan

menyebabkan penderitaan abadi di akhirat. Kerugian yang menimpa agama seseorang merupakan musibah terparah bagi seseorang. Oleh karena itu, diantara doa Nabi shallallahu ‘alaihi wa sallam adalah “Janganlah Engkau menjadikan musibah pada agama kami”. Diantara ciri orang yang menderita kerugian dengan kerugian hakiki adalah ia melalaikan kesempatan beramal shaleh dalam kehidupannya. Dia membiarkan kesempatan itu lewat begitu saja, sehingga akhirnya saat kematian tiba, amal kebaikan yang pernah dilakukannya masih sedikit, sementara keburukannya menggunung. Termasuk orang-orang yang merugi pada Hari Kiamat adalah orang yang hanya beribadah kepada Allah SWT di saat dia mendapatkan anugerah kebaikan, di saat hidupnya nyaman, disaat hidupnya enak dan makmur atau dia beribadah kepada Allah SWT disaat apa yang dilakukan itu bisa mendatangkan keuntungan atau kebaikan duniawi. Allah SWT Berfirman: “Dan di antara manusia ada orang yang menyembah Allah dengan berada di tepi, maka jika memperoleh kebajikan, tetaplah ia dalam keadaan itu, dan jika ia ditimpa oleh suatu bencana, berbaliklah ia ke belakang. Rugilah ia di dunia dan di akhirat. Yang demikian itu adalah kerugian yang nyata.” (QS. Al-Hajj: 11). Termasuk merugi juga yaitu orang yang dilalaikan oleh harta dan keluarga sehingga tidak bisa beribadah kepada Allah. Dan masih banyak lagi ayat-ayat Alquran yang menyebutkan kata merugi dan hal-hal yang menyebabkan kerugian. Ini semua dalam rangka mengingatkan manusia agar tidak tertimpa kerugian yang meng-akibatkan penderitaan yang berkepanjangan lagi abadi dalam kehidupan dunia maupun kehidupan akhirat.

Termasuk merugi juga yaitu orang yang dilalaikan oleh harta dan keluarga sehingga tidak bisa beribadah kepada Allah.

Penutup : Akhir dari tulisan ini, hendaklah kita sadar bahwa kehidupan yang kita jalani ini dapat berbuah manis dan jangan mengalami kerugian apalagi kerugian hakiki (akhirat). Sangat tepat di momentum tahun baru 2014 ini, kita hijrah dari yang buruk kebaik, dari yang baik ke lebih baik lagi, itulah standarisasi ke imanan kita kepada Allah SWT dengan melakukan perubahan. Firman Allah SWT “ Jikalau suatu penduduk negeri ini beriman dan bertakwa kepada Allah SWT, niscaya kami turunkan berkah dari langit dan bumi”. Semoga kita semua menjadi insan-insan yang tidak mengalami kerugian hakiki. Fastabiqul Khairat.



esungguhnya Kami telah menurunkan Kitab kepadamu dengan membawa kebenaran, supaya kamu mengadili antara manusia dengan apa yang telah Allah wahyukan kepadamu, dan janganlah kamu menjadi penantang (orang yang tidak bersalah), karena (membela) orang-orang yang khianat. (Q.S. al-Nisa’ ayat 105) Anjuran Alquran adalah membela yang benar dan menumpas yang salah bukan sebaliknya. Adapun tindakan para koruptor yang melakukan korupsi adalah tindakan yang salah terlebih lagi karena banyak mudharat yang ditimbulkan dari perbuatan ini sehingga para koruptor haram untuk dibela. Oleh karena itu, perbuatan yang membela para koruptor adalah sama dengan koruptor itu sendiri. Pada umumnya, tindak pidana korupsi sangat sulit dilakukan secara individu karena perbuatan ini mudah sekali dibuktikan. Mengingat akan hal tersebut maka para koruptor biasanya melibatkan orang lain yang diduganya dapat menutupi perbuatan jahat yang dilakukannya. Berdasarkan fakta yang selalu kita lihat ketika seorang koruptor ditangkap maka ada saja orang-orang lain yang terlibat. Selain terdapat adanya pihak lain yang terlibat maka muncul pula pembelaan-pembelaan yang datang dari orangorang yang punya kepentingan dengan para koruptor. Munculnya pembelaan ini adakalanya melalui permintaan langsung dari sang koruptor dan adakalanya berdasarkan atas inisiatip sendiri sebagai bentuk perbuatan balas jasa. Salah satu faktor yang menyebabkan tindak pidana korupsi semakin membudaya karena ada saja pembelaan yang muncul untuk menyelamatkan mereka. Biasanya, pembelaan ini muncul datang pertama kali

dari pihak keluarga yang kemudian dari para kolega yang akhirnya merambah kepada partai, organisasi dan para penegak hukum bahkan agamawan. Imam al-Samarqandi di dalam tafsirnya Bahr al-‘Ulum mengartikan kata “khianat” pada ayat di atas dengan “pencuri”. Menurutnya lebih lanjut bahwa para pencuri tidak perlu untuk dibela. Melalui pernyataan al-Samarqandi ini dapat dipahami bahwa jika membela pencuri adalah dilarang maka lebih dilarang lagi membela para koruptor. Paling tidak, pembelaan terhadap para koruptor biasanya dilakukan melalui enam hal. Pertama, melindungi mereka dari jeratan hukum. Biasanya, pembelaan ini muncul dari orang-orang yang mengerti tentang hukum. Berbagai dalih selalu dikemukakan agar kliennya bebas dari tuntutan hukum. Adapun alasan yang selalu dikemukakan untuk mangkir adalah sakit dan lain-lain . Pembelaan yang seperti ini diharamkan jika tujuannya untuk mengelakkan kliennya dari jeratan hukum. Kedua, berdiam diri melihat aksi kejahatan mereka secara terang-terangan. Pembelaan yang semacam ini biasanya datang dari masyarakat yang mendapat cipratan dari hasil korupsi. Biasanya yang selalu ditonjolkan adalah kebaikan para koruptor seperti menyumbang masjid dan lain-lain padahal uang sumbangan tersebut adalah sebagian kecil dari uang rakyat yang mereka korupsi. Ketiga, ikut serta menikmati sebagian hasil korupsi yang mereka lakukan. Pembelaan ini biasanya muncul dari kolegakolega para koruptor yang selama ini mendapatkan keuntungan darinya. Adapun bentuk pembelaan para kolega ini pada umumnya ialah tidak segan-

Biasanya, pembelaan ini muncul dari orang-orang yang mengerti tentang hukum. Berbagai dalih selalu dikemukakan agar kliennya bebas dari tuntutan hukum. segan mengeluarkan uang mereka untuk melepaskan para koruptor dengan menyogok penegak hukum. Keempat, ikut mendoakan mereka supaya selamat, kontiniu di dalam kekuasaan dan lain-lain. Pembelaan ini biasanya muncul dari tokoh-tokoh agama dimana mereka memanjatkan doa, zikir, yasinan dan munajat kepada Tuhan agar sosok koruptor yang mereka kagumi mendapat perlindungan dari Tuhan. Sebenarnya, hati mereka menolak untuk melakukannya karena Tuhan tidak akan pernah mau membela yang salah akan tetapi ada faktor-faktor sebagai penyebab sehingga mereka berani melakukannya. Kelima, mengelu-elukan para koruptor untuk mempengaruhi opini publik. Pembelaan semacam ini biasanya muncul dari tim sukses agar publik tidak pernah menaruh curiga kepada para koruptor. Adapun yang selalu ditonjolkan adalah kebaikan-kebaikan yang dilakukan oleh para koruptor supaya kejahatan-kejahatan yang dilakukannya dapat diredam. Padahal, kebaikan dengan kejahatan yang dilakukan oleh para koruptor tidak seimbang sama sekali. Keenam, membungkam penegak dan institusi hukum supaya tidak berdaya melawan para koruptor. Pada umumnya pembelaan yang semacam ini biasanya muncul dari pihak politisi yang nota benenya adalah

satu partai. Sebagai contoh, ketika orang partainya ditangkap oleh KPK mereka bersuara lantang dengan menuduh bahwa orang-orang KPK bukanlah malaikat. Akan tetapi yang bersangkutan lupa daratan bahwa sosok yang dibelanya juga bukan malaikat. Semua bentuk pembelaan terhadap para koruptor di atas dapat dikategorikan sebagai perbuatan haram karena dapat melanggengkan kejahatan tindak pidana korupsi. Oleh karena itu, membela kejahatan adalah bagian dari kejahatan itu sendiri sama halnya membela orang-orang yang melakukan korupsi adalah bagian dari korupsi itu sendiri. Nabi Muhammad pernah mencela perbuatan suatu kaum (al-Makhzumi) yang berupaya untuk melepaskan seorang yang terhormat di antara mereka dari jeratan hukum. Dalam tataran ini Rasulullah bersabda yang artinya “sekiranya Fathimah (anak kandungnya) kedapatan mencuri maka hukuman potong tangan akan tetap dilaksanakannya”. Melakukan pembelaan terhadap para koruptor dalam bentuk dan cara apapun dilarang oleh Alquran karena pembelaan tersebut berarti telah bersekutu dalam perbuatan dosa dan permusuhan. Persekutuan dosa ini berlaku juga kepada orang-orang yang memilih pemimpin yang secara kasat mata sudah diketahui telah melakukan tindak pidana korupsi.

Misi Alquran Dan Harian Waspada Prasangka Terhadap Syiah Bacalah Dengan Menyebut Nama Tuhan-Mu Yang Telah Menciptakan(Qs. Al-Alaq: 1)

(Tanggapan Untuk Artikel Ahmad Muzani “Meneliti Kedok Dakwah Syiah”)

Oleh Watni Marpaung, MA

Oleh Candiki Repantu

Dosen Fakultas Syariah IAIN-SU Medan

Ketua Yayasan Islam Abu Thalib dan Dewan Pembina Ijabi Sumut


Alquran seputar tradisi baca tulis. Bahkan, mendirikan urat al-Alaq di atas merupakan wahyu pertama pustaka raksasa Bait al-Hikmah pada masa Dinasti kali yang diturunkan Allah kepada Muhammad Abbasiyah mengindikasikan bahwa tradisi baca tulis di RasulullahSAW. Suatu hal yang cukup apresiatif bahwa Alquran membawa misi pencerdasan dan kalangan umat Islam sudah berlanjut dengan baik yang mengentaskan kebodohan seluruh umat manusia. Iqra’ pada saat itu dunia Barat yang dikenal dewasa ini sebagai adalah kata pembuka pada surat al-Alaq tersebut, yang pusat ilmu pengetahuan masih dalam kegelapan. memerintahkan untuk membaca. Senada dengan itu, Dalam rentetan kitab thabaqat seputar kehidupan Waspada sebagai sebuah media massa nomor wahid para ulama klasik yang masyhur terkait dengan produkdi Sumatera Utara yang telah berkiprah selama 67 tahun, tivitas membaca dan menghasilkan karya-karya besar, setidaknya telah mengambil peran strategis dari misi misalnya, ibn Taymiyah, ibn khaldun, ibn Hajar alAlquran yang cukup mendasar terhadap kebutuhan Asqalani dan banyak ulama-ulama lainnya yang jika hidup manusia. dibandingkan dan dihitung umur mereka dengan hasil Dikatakan Waspada mengambil peran strategis karya-karya yang mereka hasilkan terkadang tidak Alquran tidak dapat dipungkiri atas kontribusiWaspada cukup umur mereka untuk menghasilkan karya-karya yang telah memberikan pencerahan dan pencerdasan monumental tersebut. Namun, cukup disayangkan beterhadap masyarakat mulai dari pemberitaan yang lakangan terjadi tingkat penurunan di kalangan umat sifatnya umum sampai pada perbincangan dan diskusi Islam dalam menyikapi tradisi baca tulis yang seagama dalam kolom setiap hari jum’at. Bahkan, mestinya terus dikembangkan dan dijaga. Sementara Waspada telah mampu melakukan stimulus bagi itu, dunia Barat cukup signifikan melakukan penelitian, masyarakat muslim khuperbukuan, penerbitan, susnya dengan artikel kedengan mengembangkan agamaan dalam melihat semangat baca tulis yang Waspada telah mampu melakurealitas keragaman pensekali lagi perlu ditegaskan dapat dan pemahaman kan stimulus bagi masyarakat merupakan spirit dari Aldalam Islam untuk seDi tengah-tengah muslim khususnya dengan arti- quran. lanjutnya menyadarkan masyarakat misalnya, para harus punya kemammuballigh, pencekel keagamaan dalam melihat ustadz, puan untuk melihat perramah dan sebagainya realitas keragaman pendapat lebih cenderung dengan bedaan pendapat bukan sebuah hal yang jelek dan budaya oral (penyampaian dan pemahaman dalam Islam. ditakuti tetapi merupadengan lisan) saja. kan khazanah yang perlu Memang dalam rentedipelihara dan dikembangkan dalam membangun tatan ulama di Indonesia misalnya hanya beberapa orperadaban yang cerdas dan dinamis. ang saja yang mampu mengembangkan agama ini Oleh karena itu, setidaknya, pesan Alquran yang cudengan budaya oral sekaligus tulis misalnya Hamka, kup urgen dalam ayat di atas memberikan catatan penting Endang Saifuddin Anshari, Abdul Halim Hasan Albahwa dunia surat kabar, perbukuan dan seje-nisnya satu Binjai, Arsyad Thalib Lubis, dan sebagainya. hal yang sangat menentukan bagi kelanjutan dan Satu pesan yang perlu ditangkap dari refleksi Hut perkembangan suatu peradaban. Tingginya Pe-radaban Waspada 67 pada momen ini adalah dengan meYunani dengan para filosofnya, peradaban Cina, Mesir, ngintrospeksi diri kita masing-masing sejauh maka dan sebagainya terus eksis sehingga diketahui umat kecintaan pada tradisi membaca. Jika ada kata-kata manusia belakangan dikarenakan tercatat dalam untaian bijak “buku adalah jendela dunia”, tidak salah kiranya buku sejarah. Jika tidak, dapat dipastikan setinggi apa pun menyebut “surat kabar adalah jendela dunia” karena suatu peradaban hanya bersemayam dalam pikiran orsetidaknya menekankan urgensitas dan maha penang-orang tertentu tidak akan bertahan dan berketingnya membaca dalam kehidupan ini. sinambungan sampai dewasa ini. Jika ingin mengetahui sejarah dunia yang cukup tua Motivasi Alquran Dalam Membaca ini dengan beragam pengalamannya dari mulai Setidaknya, dalam surat al-Alaq ayat 1-5 yang ditupergantian generasi umat, ilmu pengetahuan, tokoh, runkan pertama kali terdapat dua kata yang perlu kejadian-kejadian yang maha dahsyat dan sebagainya direnungkan untuk menunjukkan Alquran datang tidak kuncinya terletak pada bacaan kita masing-masing. saja untuk mengubah sebuah perilaku masyarakat jaSetinggi apa pun gelar akademis yang diperoleh hiliyah secara akidah, dan akhlak terhadap Tuhan, tetapi seseorang sampai profesor (guru besar) tanpa terus lebih jauh lagi untuk mengentaskan kebodohan tidak membaca akan menjadi menurun tingkat kualitasnya pandai baca, dan menulis. Dalam literatur sejarah baik dalam pengayaan khazanah, analisis, perspektif, masyarakat Arab pada saat itu memang banyak yang dan sebagainya. Semakin membaiknya tingkat minat ‘ummi” tidak pandai baca dan menulis. baca tentunya punya pengaruh baik pula kepada Dua kata pada rangkaian ayat di atas adalah kata pengembangan Sumber daya manusia (SDM) “iqra’” dan kata “al-qalam”. Iqra’ adalah kata yang masyarakat Indonesia. Mungkin lebih khusus bagi insan menuntut untuk membaca, sedangkan al-qalam makakademis mahasiswa, dosen dan sebagainya perlu nanya pena, yang secara eksplisit dalam konteks menginventaris buku yang mendukung dalam kekinian alat yang digunakan untuk menulis. pengembangan keilmuan berapa banyak yang dapat Setidaknya, dari dua kata tersebut sudah sangat jelas dibeli setiap bulannya, dan bukan sebaliknya sekali bagi siapa pun yang membaca Alqurankhususnya mencukupkan yang sudah lama dan terus produktivitas umat Islam untuk memberikan apresiasi yang cukup dalam menuangkan gagasan briliannya untuk dunia. tinggi dengan konsep yang dibawa Alqurandengan Kesimpulan : menggiatkan tradisi membaca dan menulis. Pada hakikatnya pesan Alquran yang cukup tinggi Surat al-Alaq di atas dalam kaitannya dengan peranan tersebut telah ditangkap dan diaplikasikan dengan baik Waspada yang telah berkiprah 67 tahun dalam pencerRasulullah, para sahabat, sampai para tabi’in. Penulisan dasan masyarakat merupakan momen penting untuk Alquran, penulisan Hadis Rasul, penulisan kitab-kitab kembali menyadarkan kepada seluruh masyarakat dalam berbagai disiplin ilmu, misalnya, fikih, ilmu kabetapa pentingnya tradisi membaca dalam kehidupan. lam, tasawuf, tafsir, dan yang lainnya merupakan bukti Semoga Waspada terus eksis mengusung misi pencernyata bahwa generasi awal dapat menangkap pesan dasan dan pencerahan umat yang menjadi misi Alquran.


ai orang-orang yang beriman, jauhilah kebanyakan dari prasangka, sesungguhnya sebagian prasangka itu adalah dosa dan janganlah kamu mencari-cari kesalahan orang lain dan janganlah sebagian kamu menggunjing sebagian yang lain. Sukakah salah seorang di antara kamu memakan daging saudaranya yang sudah mati, maka tentulah kamu merasa jijik kepadanya. Dan bertakwalah kepada Allah. Sesungguhnya Allah Maha Penerima tobat lagi Maha Penyayang. (QS. Al Hujurat:12)”. Setelah membaca tulisan saudara Ahmad Muzani (selanjutnya disebut AM) dari Aswaja Sumut, saya menemukan beberapa penyimpangan karena dipengaruhi prasangka. Jika penyimpangan itu karena ketidaktahuannya, maka dimaafkan, tetapi jika itu kesengajaan, berarti beliau menebar fitnah, dan layaklah meminta maaf. Berikut ini penyimpangan yang dilakukan oleh Saudara AM. (1). Masalah Tahrif Alquran. Sebelumnya (saat menjawab Prof Hatta) saya membuktikan bahwa Syiah meyakini Alquran terjaga keasliannya hingga hari kiamat. Namun, saudara AM menuduh ulama Syiah inkonsistensi. Salah satu ulama Syiah yang dituduh AM inkonsistensi adalah Syaikh Mufid. AM mengatakan, “Al-Mufid dalam kitabnya Awail al-Maqalat sendiri telah terjadi perbedaan ketika membahas apakah Alquran yang kita pegang sekarang asli atau tidak.” Saya ragu AM membaca dengan baik kitab Awail al-Maqalat. Sebab, Syaikh Mufid dengan tegas menolak perubahan Alquran. Sebagai buktinya saya akan bawakan teks lebih lengkapnya yaitu: Bab 59 : Tentang Penyusunan, Penambahan dan Pengurangan Alquran. “Sesungguhnya riwayatriwayat para imam...terdapat pernyataan tentang perbedaan Alquran, dan menceritakan sebagian orang zalim yang membuang dan mengurangi Alquran, yang terjadi pada saat penyusunan (Alquran)...begitu pula tentang pengurangan (Alquran), yang dianggap secara akal tidaklah mustahil terjadinya. Maka setelah aku cermati para penyerunya, pendapat Muktazilah dan selain mereka, maka tidaklah dapat dipegang hujjah mereka tersebut. Dan telah berkata jamaah ahli imamah (Syiah), sesungguhnya alquran tidak berkurang walaupun satu kata, satu ayat, atau satu surat. Namun, yang dibuang adalah apa yang ada dalam mushaf Amirul Mukminin yang merupakan ta’wil

dan tafsir sesuai hakikat turunnya (tanzil)... Menurut saya pendapat ini lebih tepat daripada pendapat orang yang menganggap adanya pengurangan alquran yang bukan ta’wilnya. Dan saya memilih pendapat ini.” (Awail al-Maqalat hal. 55-56, cetakan lain hal. 80-81). Jadi, inkonsistensi Syaikh Mufid hanyalah prasangka saudara AM saja, karena menyebutkan bagian awalnya dan memotong bagian berikutnya. Hal sama dilakukan AM terhadap Al-Majlisi, dengan menyatakan bahwa “Muhammad Baqir al-Majlisi (Ulama Syiah), mengatakan dalam kitab Mir’at al-’Uqul, juz 12, hal. 525, bahwa al-Qur’an telah mengalami pengurangan dan perubahan...” Di sini saudara AM juga memotong tulisan al-Majlisi. AlMajlisi memang menyebutkan terdapat riwayat yang secara makna menyatakan perubahan Alquran, tetapi hal itu tidak bisa dijadikan dalil meyakini tahrif Alquran. Karenanya, beliau menegaskan “jika kita menetapkan tahrif alquran, maka hal itu bisa terjadi pada seluruh ayatnya, sementara secara mutawatir para imam ahlul bait membolehkan membaca alquran ini dan beramal dengannya. Dan tidak seorangpun yang menukil bahwasanya salah seorang imam memberikan Alquran atau mengajarkan bacaan yang berbeda...”(Mir’atul Uqul juz 12/525). Jadi, AM memanipulasi data dengan mengutip sepotong tulisan al-Majlisi dan membuang lainnya. Berikutnya, Saudara AM menyatakan bahwa “Al-Qummi (Ulama Syiah) dalam mukaddimah Tafsir-nya, hal. 79, menegaskan bahwa ayat-ayat al-Qur’an ada yang diubah, ada yang tidak sesuai dengan ayat aslinya seperti ketika diturunkan oleh Allah.” Perlu diketahui, menurut ulama Syiah nuzul Alquran (turunnya Alquran) terdiri dari dua hal, yakni teks dan makna Alquran yang disertai tafsir, takwil, hukum, rahasia, dan lainnya. Karenanya, Nabi SAW adalah penafsir pertama Alquran yang menyampaikan teks sekaligus maknanya. Inilah hakikat nuzul Alquran yang mana Allah swt yang menurunkannya, membacakannya, mengumpulkannya, dan menjelaskan maksudnya (Q.S. al-Qiyamah: 16-19). Jadi yang dimaksud “tidak sesuai dengan apa yang diturunkan Allah” adalah hakikat turunnya yang disertai takwilnya dan rahasianya kepada Rasul saaw. Itulah yang dijelaskanya pada Muqaddimah Tafsir al-Qummi tersebut.

Al-Majlisi memang menyebutkan terdapat riwayat yang secara makna menyatakan perubahan Alquran, tetapi hal itu tidak bisa dijadikan dalil meyakini tahrif Alquran. Selanjutnya saudara AM menya-takan “Al-Nuri ath-Thabrisi dalam sebuah buku yang berjudul Fashl al-Khitab fii Itsbati Tahrifi Kitabi al-Arbab..,ada lebih dari 2.000 riwayat yang menyatakan adanya distorsi al-Quran, pendapat ini didukung oleh pemuka Syiah yang telah hengkang dari Syiah, Sayyid Husain alMusawi dalam Lilllah tsumma li at-Tarikh.” Dengan buku al-Nuri, AM menuduh Syiah percaya tahrif Alquran, dan melupakan ratusan kitab yang menegaskan keasliannya. Bahkan, para peneliti menyebutkan dari sekitar 2000 riwayat di kitab Fashl al-Khitab, separuhnya adalah riwayat Sunni. Jadi, an-Nuri sebagai ahli hadis pada dasarnya mengumpulkan riwayat Sunni dan Syiah tentang tahrif (distorsi) Alquran tanpa seleksi. Beliau juga menolak tahrif Alquran, seperti disampaikan murid an-Nuri, Agha Buzurkh Tehrani, bahwa gurunya berkata : “Saya keliru membuat judul buku tersebut. Seharusnya judulnya Fashlul Khitab fi Adami Tahrif alKitab, sebab dalam kitab itu saya membuktikan Alquran yang menyebar di dunia ini adalah wahyu Ilahi dengan semua surat, ayat dan kalimatnya. Tidak ada perubahan, penambahan atau pengurangan yang terjadi sejak dikumpulkan hingga sekarang yang disampaikan secara mutawatir dan meyakinkan. Karena kalalaian saya ini maka sayapun mendapat banyak celaan dan kritikan.” Ulama Syiah juga mengritik buku tersebut seperti kitab Kasyful Irtiyab fi Adami Tahrifil Kitab karya Mahmud bin Abi Qasim (w. 1313 H/1892 M ). Bahkan, anggap saja an-Nuri atau beberapa ulama lainnya (yang tidak sampai 1 % jumlahnya) meyakini tahrif Alquran. Maka nisbatkanlah itu kepada mereka, bukan kepada Syiah, karena 99 % ulama Syiah dari dulu hingga kini menegaskan keaslian Alquran. Jadi, kelirulah AM menghukumi Syiah dengan yang 1 % dan melupakan yang 99 %. Apalagi menggunakan buku yang sudah dikoreksi, bahkan diakui penu-

lisnya sebagai kekeliruan. Adapun kitab Lillahi Tsumma li at-Tarikh adalah buku yang berisi kedustaan dan ditulis penulis palsu (Saya pernah membedah buku ini di IAIN SU dan membuktikan kepalsuannya). Jadi, AM sangat gegabah menuduh Syiah dengan menggunakan buku palsu. Berikutnya saudara AM menuduh ulama Syiah Ahmad bin Ali alThabarsi, menyatakan “Bahwa alQur’an yang ada sekarang palsu, tidak asli, terjadi pengurangan”(al-Ihtijaj, j.1 h. 156). Di sini, AM melakukan penyimpangan lagi. At-Thabarshi tidak menyatakan demikian. Beliau hanya meriwayatkan bahwa Imam Ali menyusun Alquran yang di dalamnya terdapat penjelasan hakikat turunnya serta pelanggaran kaum muhajirin dan anshar. Para sahabat menolak Alquran susunan Imam Ali dan menyusun Alquran yang tidak mengandung hal-hal tersebut. Inilah makna hadis Al-Kafi bahwa tidak ada yang mengumpulkan Alquran seperti Imam Ali yaitu mengumpulkannya sesuai hakikat turunnya, nasikh-mansukh, tafsir, takwil, dan rahasianya. Kemudian, AM ketika mengatakan, “Karena dalam Syiah sendiri konsep taqiyyah amat dilegalkan dan dalam hal ini tidak dapat dipungkiri bahwa bisa saja saudara CR juga sedang bertaqiyyah ketika menjawab tulisan Prof. Hatta.” Ketahulilah, ratusan kitab ulama syi’ah menegaskan keterjagaan Alquran dengan argumentasi yang akurat dan meyakini hal tersebut sesuai janji Allah swt. Sayapun membuktikannya. Tapi, sungguh aneh, saudara AM menuduh saya taqiyah, padahal saya mengulas tulisan Prof. Hatta dengan bukti-bukti nyata. Saya menunjukkan bukti, tapi AM menunjukkan prasangka. Terakhir, AM menisbahkan Shahifah, al-Jafr, al-Jamiah dan mushaf Fatimah sebagai tandingan Alquran, padahal semua itu bukanlah Alquran. Kesimpulannya menuduh Syiah meyakini tahrif Alquran adalah prasangka yang dipaksakan dan ditebarkan.

Mimbar Jumat


Peringatan Maulid Perspektif Sosiologi Hukum Islam Oleh H.M. Nasir, Lc, MA Pimpinan Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara, Wakil Sekretaris Dewan Fatwa Pengurus Besar Al Washliyah.


slam diyakini sebagai agama yang universal, untuk seluruh umat manusia, tidak terbatas oleh ruang dan waktu. Alqur’an sendiri menyatakan bahwa ajaran Islam berlaku untuk seluruh umat manusia. Oleh karena itu, Islam seharusnya dapat diterima oleh setiap manusia, tanpa harus ada pertentangan dengan situasi dan kondisi di mana manusia itu berada. Islam dapat berhadapan dengan masyarakat modern, sebagaimana ia dapat berhadapan dengan masyarakat tradisional. Islam senantiasa cocok untuk umat manusia kapan pun dan dimanapun. Pada dasarnya, ajaran Islam dapat dibedakan menjadi dua kelompok ajaran, qath’iyyat dan zhanniyat. Pertama, ajaran Islam yang bersifat absolut, universal dan permanen, tidak berubah dan tidak dapat diubah. Termasuk kelompok ini adalah ajaran Islam yang tercantum dalam Alqur’an dan Hadits muta-watir yang penunjukannya telah jelas (qath’i al-dalalah). Kedua ajaran Islam yang bersifat relatif, tidak universal dan tidak permanen, dapat berubah dan diubah yang berakar pada nash yang zhanniyat yang membuka ruang berijtihad. Ranah ini memberikan kemungkinan epistemilogis hukum bahwa setiap wilayah yang dihuni umat Islam dapat menerapkan hukum Islam secara berbedabeda karena faktor sejarah, sosiologis, situasi dan kondisi yang berbeda yang melingkupi para mujtahid. Menurut saya, peringatan maulid Nabi SAW masuk dalam kategori ini. Imam al-Suyuthi di dalam kitab beliau, Hawi li al-Fatawa Syaikhul Islam tentang maulid serta Ibn Hajar al-Asqalani ketika ditanya mengenai perbuatan menyambut kelahiran Nabi Saw, beliau memberi jawaban secara tertulis: Adapun perbuatan menyambut maulid merupakan bid’ah yang tidak pernah diriwayatkan oleh para salafush-shaleh pada 300 tahun pertama selepas hijrah. Namun perayaan itu penuh dengan kebaikan dan perkara-perkara yang terpuji, meski tidak jarang cacat oleh perbuatan-perbuatan yang tidak

sepatutnya. Jika sambutan maulid itu terpelihara dari perkara-perkara yang melanggar syari’ah, maka tergolong dalam perbuatan bid’ah hasanah. Akan tetapi jika sambutan tersebut terselip perkara-perkara yang melanggar syari’ah, maka tidak tergolong di dalam bida’ah hasanah. Memahami peringatan hari kelahiran Nabi Muhammad SAW

waktu dan tempat, perayaan yang dibuat untuk memperingati hari kelahiran Nabi Muhammad SAW mengalami modifikasi berdasarkan asas kebiasaan yang dianggap baik masing-masing wilayah umat Islam. Sekali lagi perlu ditegaskan bahwa modifikasi ini menunjukkan perayaan ini bukan ibadah baru karena tidak memiliki rukun atau syarat

Sebagai bagian dari umat Islam, barangkali kita ada di salah satu pihak dari dua pendapat yang berbeda. dengan pendekatan sosial akan memberikan alternatif lain sehingga dapat memberikan gambaran lain tentang peringatan ini, yakni tidak hanya berkisar pada apakah acara peringatan semisal ini termasuk perbuatan yang dibolehkan atau terlarang. Meskipun begitu, agaknya argumentasi yang mempertimbangkan bahwa peringatan Maulid bukanlah sebagai ritual wajib yang memiliki ketentuan rukun atau syarat sahnya dirasa cukup dijadikan dalil bahwa mengadakan maulid bukan perkara ibadah mahdhah. Kedudukannya sama dengan se-orang yang menulis buku tentang kisah Nabi. Padahal di masa Rasulullah SAW, tidak ada perintah atau anjuran untuk membukukan sejarah kehidupan beliau. Bahkan hingga masamasa berikutnya belum pernah ada buku yang khusus ditulis tentang kehidupan beliau. Dengan demikian kita dapat memahami mengapa mayoritas muslim, khususnya di Indonesia, tetap berkesinambungan dalam memperingati hari kelahiran Nabi Muhammad SAW. Para ahli sejarah, seperti Ibn Khallikan, Sibth Ibn al-Jauzi, Ibn Katsir, al-Hafizh al-Sakhawi, alHafizh al-Suyuthi dan lainnya telah bersepakat menyatakan bahwa orang yang pertama kali mengadakan peringatan maulid adalah Sultan alMuzhaffar pada awal abad ketujuh Hijriyah, bukan sultan Shalahuddin al-Ayyubi. Seiring perkembangan

sahnya. Eksistensi maulid hingga saat ini adalah karena pertimbangan psikologi umat Muhammad yang menganggap peringatan Maulid akan membawa kemaslahatan untuk membangkitkan kecintaan kepada Rasul. Dengan kata lain, momentum hari lahir Nabi dijadikan sebagai salah satu sarana (bukan satu-satunya) yang diharapkan dapat menyegarkan memori akan adanya sosok yang semestinya dijadikan teladan sukses dunia dan akhirat. Dengan kerangka pemikiran seperti di atas, maka dari sisi niat tentu ini dapat dikategorikan sebagai kebaikan. Namun patut digarisbawahi bahwa niat yang baik harus didukung dengan cara yang benar. Dengan paradigma ini maka kita harus menjaga peringatan Maulid tidak berisi perkara-perkara yang justru bertentangan dengan ajaran syariat seperti khurafat atau kesyirikan. Oleh karena itu kewajiban para dai adalah mengawasi isi acara Maulid agar tidak berisi perkara yang melanggar prinsip Islam. Tentu kita semua berharap esensi Maulid Nabi tidak kehilangan maknanya di tengah-tengah masyarakat yang semakin menggandrungi entertain atau hiburan semata. Kita memang mengkritisi peringatan ini agar tidak hanya sekedar seremonial saja dan tanpa hasil akhir yang diharapkan. Kadang paradigma sebagian umat Islam

perlu diluruskan tentang konten materi acara ini, sehingga ukuran segala sesuatunya adalah “menghibur”. Termasuk para penceramah yang diundang hadir adalah mereka yang paling banyak unsur humornya. Bila penceramah tidak mampu mengeluarkan humor saat ceramah, dipastikan penceramah tersebut tidak akan dihadirkan lagi pada perayaan maulid tahun-tahun mendatang. Kita memaklumi tradisi maulid lahir dan berkembang dalam rahim kalangan sebagian muslimin yang mempersepsikan baik peringatan ini. Oleh karena itu, perbedaan pendapat terkait hal ini dapat diminimalisir apabila kita menggunakan perspektif sosial dalam hal ini. Namun kita prihatin bila ada segelintir orang yang lebih toleran dengan seremonial atau ritual agama lain, seperti ikut serta hadir dalam acara seremonialnya atau sekedar memberikan ucapan selamat merayakannya saja. Sementara terhadap saudaranya yang memperingati Maulid nabi Muhammad justru bersikap apatis sehingga terasa berat memberikan ucapan selamat apalagi menghadiri undangan acara panitia Maulid. Sebagai bagian dari umat Islam, barangkali kita ada di salah satu pihak dari dua pendapat yang berbeda. Kalau pun kita mendukung salah satunya, tentu saja bukan pada tempatnya untuk menjadikan perbedaan pandangan ini sebagai bahan baku saling menjelekkan, saling caci dan saling menghujat, saling merendahkan. Bukan masanya lagi buat kita untuk meninggalkan banyak kewajiban berislam hanya lantaran masih saja meributkan perbedaan pendapat terhadap masalah furu’iyyah tersebut. Kita justru harus saling membela, menguatkan, membantu dan mengisi kekurangan masingmasing. Perbedaan pandangan sudah pasti ada dan tidak akan pernah ada habisnya. Kalau kita terjebak untuk terus bertikai, maka para musuh Islam akan semakin gembira. Semoga Allah selalu merahmati dan meridhai kita semua.

Selaraskan Ucapan Dengan Perbuatan Oleh Muhammad Hidayat Alumnus Pascasarjana IAIN SU/ Dosen STIK “Pembangunan” Medan.


ering kita mendengar orang bilang; “aku orangnya bla, bla....”. Ada juga orang mengungkapkan, “Nanti, saya akan melakukannya”. Ucapan itu disampaikan untuk menunjukan jati diri. Sayangnya, pernyataan itu dibantah sendiri. Bukan dengan ucapan, tapi dengan perbuatan. Bukankah kita sering berbuat sesuatu yang tidak selaras dengan penyataan. Kita bisa bilang diri kita itu sebagai orang yang begini begitu, tetapi perbuatan menunjukkan hal yang berbeda dengan ucapan itu. Ingatlah, manusia itu diukur dengan perbuatannya bukan dengan cakapnya. Allah memerintahkan orang beriman agar menyelaraskan perkataannya dengan ucapannya. Allah membenci orang yang tidak menyesuaikan ucapannya dengan perkataannya. Anjuran itu termaktub dalam surah Ash Shaf ayat 2 – 3. Redaksinya berbunyi: “Wahai orang-orang yang beriman, mengapa kamu mengatakan sesuatu yang tidak kamu kerjakan? Amat besar kebencian di sisi Allah jika kamu mengatakan apa-apa yang tidak

kamu kerjakan”. Ayat ini menggunakan kata taf ’aluun yang berbentuk fi’il mudhori’. Dalam bahasa Arab, fi’il mudhori’ adalah kata yang menunjukkan pekerjaan yang sedang dilakukan atau akan dilakukan. Maka dari kata taf ’aluun dapat disimpulkan, selaras perkataan dengan perbuatan ini dapat dikelompokkan dalam dua sikap. Pertama; mengerjakan perbuatan yang dijanjikan akan dilakukan. Kedua; tidak bercerita tentang perbuatan yang tidak pernah dilakukan. Janji adalah bagian kehidupan manusia. Kita selalu mengucapkan kata “saya akan” dengan mudah. Sayangnya, jarang dipikirkan konsekuensi dari ucapan itu. Kalimat itu meluncur begitu saja dari mulut tanpa pertimbangan matang. Akibatnya, kita tidak serius melakukan perbuatan yang telah kita janjikan itu. Mungkin, saat berbicara kita mengganggap perkataan itu biasa aja. Namun lawan bicara menilai pernyataan itu sebagai sebuah komitmen yang akan dipenuhi. Hal ini membuat kepercayaan lawan bicara

Konsultasi Alquran Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Alquran, yang meliputi: tajwid, fashohah, menghafal Alquran, Ghina (lagu) Alquran, Hukum dan ulumul Alquran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H. Ismail Hasyim, MA) 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Ustadz, dirumah ada kitab fiqh dan kitab lainnya yang berisi juga ayat-ayat Alquran, bolehkan saya membawa atau menyentuhnya kalau saya tidak ada wudhuk? Syukron. Dari Ibu Eli di Medan Jawab : Terima Kasih atas pertanyaannya. DR.Ahmad Salim menyatakan Ulama berbeda pendapat dalam masalah ini: 1. Orang yang berhadas boleh menyentuh kitab fiqh, hadis atau kitab lainnya yang memuat ayat-ayat Alquran. Ini adalah pendapat fuqoha mazhab Maliki. Dalil mereka adalah hadis Nabi yang mengirim surat kepada Heraclius yang memuat surat Ali ‘imran ayat 64. Selain itu, meskipun kitab hadis, fiqh dan lainnya yang memuat ayat-ayat Alquran tidak bisa disebut mushaf sehingga orang yang berhadas dibolehkan menyentuhnya. 2. Orang yang berhadas boleh menyentuhnya, hanya disunnahkan bersuci terlebih dahulu. Ini pendapat mazhab Hanafi. 3. Orang yang berhadas makruh menyentuh kitab hadis, fiqh yang memuat ayat-ayat Alquran. Ini pendapat sebagian fuqoha Syafi’i. 4. Orang yang berhadas haram menyentuh kitab-kitab hadis dan lainnya yang memuat ayat-ayat Alquran. Menurut pendapat ini membo-lehkan orang yang berhadas menyentuh kitab-kitab yang memuat ayat-ayat Alquran sama dengan tidak memuliakan Alquran. Kami sependapat dengan pendapat pertama yang membolehkan menyentuh kitab-kitab yang berisi ayat-ayat Alquran. Wallahu A’lam Al-ustadz H. Ismail Hasyim, MA.

Allah mengingatkan itu dalam surah Al Isra ayat 34, redaksinya; “penuhilah janji; sesungguhnya janji itu pasti diminta pertanggunganjawabnya” kita hilang ketika pernyataan itu tidak dipenuhi. Kondisi paling parah, kita dicap sebagai pembohong. Nah, kalau label pembohong telah menempel pada diri seseorang maka ia akan sulit membangun hubungan dengan manusia lainnya. Dalam surah Al-Maidah ayat 1, Allah memerintahkan orang beriman supaya memenuhi janjinya. Redaksi ayat; “Hai orang-orang yang beriman, penuhilah aqad-aqad itu”. Para ulama mengatakan kata aqadaqad dalam ayat ini bermakna janji setia hamba kepada Allah serta perjanjian sesama manusia dalam pergaulan sesamanya. Orang yang berjanji akan mempertanggungjawabkan janjinya di hadapan Allah dan manusia. Allah mengingatkan itu dalam surah Al Isra ayat 34, redaksinya; “penuhilah janji; sesungguhnya janji itu pasti diminta pertanggunganjawabnya” Selain menepati janji, orang beriman dilarang bercerita tentang perbuatan yang tidak pernah dilakukan. Orang yang mengatakan berbuat sesuatu tapi tidak melakukannya adalah perbuatan bohong. Ada orang yang suka bercerita tentang sesuatu perbuatan padahal pekerjaan itu tidak pernah dilakukannya. Hal ini dipicu dua hal. Pertama; menilai cerita tersebut cuma guyonan. Saat bercerita sering kali tanpa kesadaran. Ia menilai semua uca-pannya hanya sebagai candaan tanpa makna. Orang seperti ini baru memikirkan ucapannya jika menimbulkan dampak buruk bagi dirinya. Kedua; sebagai upaya menarik simpati orang lain (lawan bicara). Lazimnya, orang seperti ini mengisahkan pekerjaan yang sulit dikerjakan orang kebanyakan. Termasuk juga pekerjaan yang bisa menimbulkan kemaslahatan masyarakat. Harapannya, lawan bicara memberikan penilaian positif. Kalau penilaian positif itu telah didapat, maka ia akan mudah mengendalikan lawan bicaranya. Korelasi Iman Dengan Ucapan Bohong atau ingkar janji adalah aktivitas lidah. Dalam Alquran banyak memuat perintah menepati janji dan larangan berbohong. Kalau diperhatikan ayat tersebut, ada kolerasi iman dan ucapan. Con-

tohnya; ayat yang bercerita tentang janji lazimnya dihubungkan dengan kata iman. Alquran menyebutkan menepati janji merupakan indikator orang yang bertakwa. Hal itu diterangkan dalam surah Al-Baqarah ayat 177. Dalam ayat itu dimulai dengan kata “bukanlah menghadapkan wajahmu ke arah timur dan barat itu suatu kebajikan”. Pada lanjutan ayat, dijelaskan beberapa kreteria kebajikan itu, salah satunya adalah menepati janji jika berjanji. Akhir ayat ditutup dengan kalimat “mereka Itulah orang-orang yang benar (imannya); dan mereka itulah orang-orang yang bertakwa” Kadar keimanannya dapat diukur dari komitmennya menepati janji yang telah diucapkan. Jika seseorang, selalu melanggar janjinya maka kadar keimanannya masih rendah. Alasanya, pada akhir ayat Qur’an menyebut menepati janji adalah indikator orang yang shiddiq (benar imannya). Ayat-ayat tentang perintah menyeleraskan ucapan dengan perbuatan itu ditujukan kepada semua mukmin. Semua orang yang beriman harus berkomitmen menepati janji yang telah diucapkan. Selain itu, seorang mukmin tidak boleh mengakui-ngaku berbuat sesuatu padahal itu tidak pernah dikerjakannya. Saat ini masa kampanye Pemilu 2014. Pada masa ini janji bermunculan. Para Caleg dengan mudah mengumbar janji dan berita keberhasilannya. Pada baliho dan spanduk, Caleg memuat program kerja yang akan dilakukan kalau terpilih. Hal ini biasanya dilakukan oleh Caleg yang belum terpilih. Sebaliknya, Caleg yang sedang menjabat di legislatif menonjolkan program kerja yang dibuatnya. Sebagai Caleg muslim seharusnya menghindarkan diri dari dari slogan kampanye yang tidak dapat dipenuhi. Bagi Caleg yang sedang menjabat di legislatif seharusnya tidak menceritakan sesuatu yang tidak pernah dilakukannya. Siapa pun–Caleg atau bukan–seharusnya seorang Mukmin berkomitmen menyelaraskan perkataan dengan perbuatan. Karena hal itu menjadi indikator keimanan.

WASPADA Jumat 10 Januari 2014

Bekerja Dan Beramal Ikhlas Mendapatkan Dua Pahala (1) Para ulama selalu mengingatkan jamaahnya (umat Islam) menjadi kaya harta dan kaya pula dalam mendermakan hartanya di jalan Allah SWT. Yang tercela adalah mencari kemasyhuran, tahta, dan kedudukan, serta sangat bercita-cita mendapatkannya, bahkan dengan menghalalkan segala cara. Misalnya menzalimi hak orang, melakukan tindakan represif, agar bisa menjadi pemimpin dan setelah itu membentuk raja-raja kecil. Memang sebaiknya jika kita ingin membantu atau bersedekah, berinfak, berzakat sebaiknya jangan sampai riya (ingin dipuji - dilihat orang lain). Bisa-bisa tidak ikhlas dan tidak ada pahalanya sama sekali. Tapi, jika niatnya positif. Seseorang mendermakan hartanya, walau memperlihatkan kedermawaan atau diberitakan media massa pemberian sedekah kepada publik yang memerlukan boleh-boleh saja dengan niat agar orang lain melakukan hal yang sama, berlombalomba berbuat baik di jalan-Nya. Jadi, semua tergantung niatnya. Kalau semata demi Allah SWT maka apa yang dilakukannya sah (positif) dan insya Allah memperoleh pahala dari Sang Pencipta Allah Azza Wazallah. Tapi, kalau tujuan dan niatnya karena ingin dipuji, pamer kekayaan atau riya, jelas tidak memperoleh pahala alias sia-sia di mata Allah SWT. Dalam sebuah kajian disebutkan bahwa kemasyhuran itu sendiri bukanlah suatu yang tercela. Tiada yang lebih masyhur dari para Anbia’, Al-Khulafa’ Ar-Rasyidin, dan imam-imam mujtahidin. Tetapi yang tercela adalah mencari kemasyhuran, tahta dan kedudukan, serta sangat bercita-cita mendapatkannya dengan menghalalkan segala cara untuk kepentingan pribadi. Ambisius. (Sumber kumpulan buku hadist shahih.

Rasulullah Dan Teologi Cinta Oleh Muhammad Qorib Staf Pengajar FAI UMSU dan Ketua Majelis Pustaka Informasi PDM Medan


asulullah adalah pribadi yang paling mengangumTeologi cinta Rasulullah itu sebenarnya kan untuk diteladani dan bersifat progresif dan jauh melampaui tokoh historis yang paling menarik untuk dikaji. Rangkaian hidup masanya. Karena itu dapat dikatakan bahbeliau dapat dilihat dari berbagai karya akademik yang tersebar luas wa teologi cinta Rasulullah bersifat modan tidak ada yang bersifat ahidern bahkan demikian modern kala itu. toris. Para islamis seperti Michael Hart, Karen Armstrong, E.F. Peter, telah mencurahkan atensi yang demikian besar un- “Kamu tidak akan mendapat kebajikan yang tuk menguak babakan kehidupan yang dilalui Ra- sempurna (al-birr) sebelum kamu menginfakkan sulullah. Belum lagi para pengkaji Muslim yang harta yang kamu cintai…” (QS. Ali-Imraan/ 3: 92). jumlahnya cukup banyak untuk dipaparkan. Menarik- Dapat dicermati, teologi cinta dalam ayat tersebut nya, mereka terhantar pada sebuah konklusi jujur dan diekspresikan melalui berbagai upaya tak kenal lelah berani bahwa Rasulullah merupakan manusia untuk membahagiakan orang lain. Dan yang terdepan di panggung sejarah yang kuat secara etis dan terpenting, upaya itu dilakukan dengan memberikan lontaran-lontaran pemikirannya menjadi spirit tak sebagian harta yang dicintai dan disayangi. Dengan menjadikan Alquran sebagai pedoman, Rasulullah pernah padam untuk pencerahan peradaban. Beliau dilahirkan pada 571 Masehi di Mekah, se- melakukan konkritisasi teologi cinta dalam ruang buah daerah yang secara geografis amat gersang. Via praksis. Ternyata, teologi cinta itu cukup dekat dengan perspektif peradaban, Mekah meskipun ramai dan pembelaan terhadap kaum marjinal dan tertindas. Salah satu peran teologi cinta yang dipaktikkan dikenal orang namun belum berperadaban (uncivilized). Secara sosial politik, Mekah dikuasai oleh para Rasulullah adalah pembebasan terhadap status budak. bangsawan dan raja-raja yang memiliki kebijakan Melalui lisannya yang suci beliau meyampaikan bahwa sosial politik tak terbatas. Dalam konteks demografi, perbedaan tidak boleh dilihat dari warna kulit, Arab dan ‘ajam, kaya dan miskin, kecuali melalui Mekah dihuni oleh pluralitas kabilah namun kerap prestasi ketakwaannya kepada Allah. terjadi peperangan untuk mempereBahkan salah satu ayat butkan atau mempertahankan Alquran menjelaskan bahsumber-sumber ekonomi. wa “bukit perjuangan” diSecara teologis, masyaaktualisasikan dengan rakat Mekah penganut membebaskan budak dari politeisme. perbudakan. Dengan teologi Kala itu terjadi tirani cinta itu pula status kaum minoritas di mana komuperempuan yang cukup nitas kecil dengan berbarendah disejajarkan degai kekuatan sosial, politik ngan kaum pria. Dalam perdan ekonomi, atas mayoritas spektif modern, sesungguhmasyarakat yang lemah nya Rasulullah telah melakudalam banyak hal. Perbukan gerakan feminisme, badakan dianggap sebuah gaimana peran kaum petradisi dan mirisnya para burempuan memainkan dak setara dengan barang daandil di berbagai ruang gangan yang diperjualbelikan di pasar-pasar secara publik sebagaimana yang bebas. Kala itu, terminologi cinta merupakan sebuah dimainkan kaum pria. kata yang dirasakan aneh dan oleh pihak-pihak tertentu Teologi cinta terhadap lingkungan juga dapat kita cukup dibenci. Kehadiran Rasulullah saat itu justru mempromosikan teologi cinta. Tentu saja misi tersebut lihat dari perintah Alquran agar berinteraksi dengan bertentangan dengan arus utama yang telah menjadi alam secara harmonis. Misalnya Alquran menjelaskan, hegemoni tersendiri. Konsekuensi dari misi Ra-sulullah “Telah nampak kerusakan di darat dan di laut akibat itu mewujud pada tindakan ekskomunikasi dan pen- ulah tangan manusia. Allah merasakan akibat dari cekalan berbagai kegiatan dakwah yang beliau lakukan. aktivitas destruktif mereka agar mereka kembali ke Demikian kelamnya masyarakat Arab kala itu jalan yang benar.” (QS. Al-Ruum/ 30: 41). Ayat tersebut sehingga kedatangan Rasulullah dengan teologi kental dengan nuansa cinta terhadap alam. Artinya cintanya berada pada momentum yang tepat. alam juga merupakan mahluk Allah dan sahabat Tentunya ini merupakan sekenario dari Allah sendiri. manusia yang juga mesti dirawat dengan baik. Seperti Teologi cinta tersebut berisi kasih sayang (affection), yang dilakukan manusia, alam menurut Seyyed persamaan (egalitarianism) bahkan pembebasan Hossein Nasr juga berzikir, namun alam memiliki style zikir tersendiri. Karena keterbatasan indera manusia, (liberation).. Dalam teologi cinta terdapat tiga elemen senyawa maka aktivitas zikir alam tak terlihat kasat mata. Bahkan yang menjadi kekuatan teologi itu. Tiga elemen dengan teologi cintanya Rasulullah mengajarkan para tersebut adalah elemen vertikal kepada Allah, elemen sahabat untuk tetap melakukan konservasi terhadap horizontal kepada sesama umat manusia dan elemen alam kendatipun dalam suasana perang. Tak sampai di situ, teologi cinta yang dicontohkan interaksi positif dengan alam. Jika selama ini relasi yang dikenal luas memadukan elemen vertikal dan Rasulullah dapat diamati dari sabda beliau kepada paelemen horizontal saja sebagai substansi dalam ra sahabat bahwa berbuat baik kepada setiap yang teologi cinta, ternyata elemen ketiga tidak kalah bernyawa (hewan) mendatangkan ganjaran dari Allah. pentingnya yaitu bagaimana cinta juga Bahkan Rasulullah menaruh rasa hormat yang cukup didistribusikan kepada alam secara luas. Teologi cinta tinggi terhadap hak-hak hidup hewan (semut) yang Rasulullah tersebut bergerak dari filosofi rahmatan menempati lubang-lubang tanah dengan melarang lil ‘aalamiin (rahmat bagi semesta alam). Dengan umat Islam buang air di dalamnya. Jika di banyak filosofi ini cinta yang tumbuh dan berkembang dalam perguruan tinggi baik di Amerika maupun Eropa, mata diri Rasulullah adalah cinta yang utuh, memadukan kuliah animal rights (hak-hak hewan) menjadi kajianunsur sakralitas, humanitas dan moralitas semesta. kajian intensif, maka Rasulullah jauh-jauh hari sudah Unsur sakralitas menjadi spirit yang bermuara pada menjadi teladan dalam hal itu. Meskipun kemudian yang berkembang di kebanyakan dunia Islam masalah anihumanitas dan moralitas terhadap alam. Teologi cinta Rasulullah itu sebenarnya bersifat mal rights kurang mendapat apresiasi. Demikianlah, teologi cinta yang dibawa Rasulullah progresif dan jauh melampaui masanya. Karena itu dapat dikatakan bahwa teologi cinta Rasulullah bersifat mod- menjadi suluh penerang dan sumber pencerahan ern bahkan demikian modern kala itu. Tentu yang cukup kehidupan. Teologi cinta itu kaya akan nilai-nilai ilamenarik teologi cinta tersebut mencakup semua paham hiyah sekaligus peka terhadap masalah kemanusiaan, yang belakangan digaungkan masyarakat modern seperti: hewan, tumbuhan dan lingkungan alam semesta. teosentrisme, antroposentrisme, feminisme, yang kerap Inilah sesungguhnya poin-poin penting yang terkanberjalan secara ekstrim dan tak jarang saling menegasikan. dung dalam Diinul Islam itu. Jika teologi cinta RasuDi sinilah inklusivisme dan universalisme teologi cinta itu. lullah difungsionalisasikan lagi bukan tidak mungkin Ini pula yang menjadi nilai lebih teologi cinta itu jika dunia Islam dapat kembali menjadi mercusuar dan rahim bagi lahirnya kehidupan yang berperadaban dibandingkan dengan isme-isme modern tersebut. Dalam Alquran teologi cinta ditemukan misalnya, dalam bingkai ilahiyah. Wallaahu a’lam.

Mimbar Jumat

WASPADA Jumat 10 Januari 2014


Doa Bukan Lampu Aladin Anjuran Menikah Dan Larangan Membujang Agar Hidup Tenteram (1) Menikah itu sunnah Nabi Muhammad SAW, nilai ibadahnya sangat tinggi dan mulia, asalkan dijalani dengan penuh kasih sayang dalam balutan sakinah, mawaddah dan wa-rahmah. Terkait dengan anjuran menikah ini Allah SWT berfirman: Hai sekalian manusia, bertakwalah kepada Tuhanmu yang telah menciptakan kamu dari diri yang satu, dan daripadanya Allah menciptakan istrinya; dan daripada keduanya Allah memperkembangbiakkan laki-laki dan perempuan yang banyak. Dan bertakwalah ke-pada Allah yang dengan (mem-pergunakan) nama-Nya kamu saling meminta satu sama lain, dan (peliharalah) hubungan silaturrahim. Sesungguhnya Allah selalu menjaga dan mengawasi kamu. (S. An-Nisaa’:1). Dalam ayat lain disebutkan: Dan di antara tanda-tanda kekuasaan-Nya ialah Dia menciptakan untukmu istri-istri dari jenismu sendiri, supaya kamu cenderung dan merasa tenteram kepadanya, dan dijadikan-Nya di antaramu rasa kasih dan sayang. Sesungguhnya pada yang demikian itu benar-benar terdapat tanda-tanda bagi kaum yang berpikir. (QS. Ar-Ruum: 2). Selanjutnya: Dan sesungguhnya Kami telah mengutus beberapa Rasul sebelum kamu dan Kami memberikan kepada mereka istri-istri dan keturunan. (QS. Ar-Ra’d : 38).Kemudian: Dan kawinkanlah orang-orang yang sendirian di antara kamu, dan orang-orang yang layak (berkawin) dari hamba-hamba sahayamu yang lelaki dan hamba-hamba sahayamu yang perempuan. Jika mereka miskin Allah akan memampukan mereka dengan kurnia-Nya. Dan Allah Maha luas (pemberian-Nya) lagi Maha Mengetahui. (QS. An-Nuur) (Sumber: Kumpulan Hadits Shahih).

Pacaran Islami, Adakah ? Oleh Junaidi, M.Si Dosen FU IAIN, FAI UMSU dan Sekretaris Majelis Tarjih PDM Medan


acaran sudah menjadi trend para remaja masa kini dan bahkan banyak yang menganggapnya sebagai sebuah kewajiban. Bisa dipastikan hampir semua remaja masa kini pernah melakukannya. Pandangan ini akan mengakibatkan remaja yang tidak pacaran dianggap sebagai re-maja yang kuno, tidak gaul, kampungan dan ketinggalan zaman. Banyak remaja yang karena takut dikatakan kampungan dan ketinggalan zaman akhirnya mereka juga ikut-ikutan pacaran, bahkan banyak yang sampai kebablasan. Kita sering melihat muda-mudi Islam yang sedang pacaran jalan berduaan sambil bergandeng tangan, nongkrong dan mojok berduaan di tempat yang sepi. Sekilas Pandang tentang Pacaran Dalam kamus bahasa Indonesia, kata “pacaran” mempunyai beberapa arti (Purwodar-minto, 1976) yaitu: Pertama, Pergaulan bebas antara laki-laki dan perempuan, bersuka-sukaan mencapai apa yang disenangi mereka. Kedua, Pacaran ber-arti “bergendak” yang sama artinya dengan ber-kencan atau berpasangan untuk berzina. Ketiga, Pacaran berarti berteman dan saling menjajaki kemungkinan untuk mencari jodoh berupa suami atau istri. Pengertian pertama dan kedua menunjukkan bahwa aktivitas pacaran tidak dibenarkan karena mengandung unsur-unsur mendekati perzinahan. Bukankah Allah SWT berfirman dalam surat Al-Isra’ ayat 32 yang artinya: “Dan janganlah kamu mendekati zina; sesungguhnya zina itu adalah suatu perbuatan yang keji dan suatu jalan yang buruk”. Kalau kita perhatikan aktivitas pacaran rema-ja masa kini jarang sekali yang bisa menghindar-kan diri dari aktivitas berduaan (khalwat). Padahal Islam melarang laki-laki berduaduan dengan perempuan yang bukan muhrimnya. Hal ini ditegaskan oleh Ra-sulullah SAW dalam hadits yang diriwayatkan oleh Bukhari Muslim yang artinya: “Dari Ibnu Abbas ra. Ia berkata: Aku mendengar Rasulullah saw berkhutbah, ia berkata: Jangan sekali-kali seorang laki-laki berkhalwat dengan se-orang perempuan kecuali be-serta ada mahramnya, dan ja-nganlah seorang perempuan melakukan musafir kecuali beserta ada mahramnya”. Di samping berduaduaan, orang yang pacaran umumnya juga saling berpegang tangan, berpelukan, ciuman dan bahkan lebih dari itu. Dalam sebuah wawancara yang pernah penulis lakukan pada 10 orang mahasiswa/mahasiswi yang pa-caran, semuanya mengatakan pernah berpegangan tangan, berpelukan dan bahkan berciuman. Semua aktivitas tersebut adalah bagian dari perbuatan zina. Perhatikan hadits Rasulullah SAW yang ber-asal dari Abu Hurairah RA. “Telah ditulis bagi setiap Bani Adam bagiannya dari zina, pasti dia akan melakukannya, kedua mata zinanya ada-lah memandang, kedua telinga zinanya adalah mendengar, lidah(lisan) zinanya adalah berbi-cara, tangan zinanya adalah memegang, kaki zinanya adalah melangkah”. Hadits ini menunjukkan bahwa menyentuh wanita yang tidak dihalalkan untuk disentuh baik dengan memegang atau yang lainnya adalah zina tangan. Mengayunkan langkah menuju wanita yang menarik hatinya atau menuju tempat perzinaan adalah zina

Setiap orang tentu menginginkan perbaikan dan kemajuan bagi kehidupannya. Yang perlu ditanamkan adalah Perubahan kearah yang lebih baik hanya dapat dilakukan oleh diri sendiri. kaki.Sedangkan pengertian ketiga menunjukkan bahwa pacaran adalah perbuatan yang boleh dila-kukan. Hal ini karena pada umumnya suatu per-kawinan terjadi setelah melalui beberapa proses, yaitu proses sebelum terjadi akad nikah, proses akad nikah dan proses setelah terjadi akad nikah. Proses sebelum terjadi akad nikah melalui beberapa tahap, yaitu tahap penjajakan, tahap peminangan dan tahap pertunangan. Tahap penjajakan mungkin dilakukan oleh pihak laki-laki kepada pihak perempuan atau sebaliknya, atau pihak keluarga masing-masing. Rasulullah SAW memerintahkan agar pihak-pihak yang melakukan perka-winan melihat atau mengetahui calon jodoh yang akan dinikahinya, Seba-gaimana hadits Rasulullah SAW riwayat An-Na-sai Ibnu Majah dan At-Tirmidzi yang artinya “Dari Abu Hurairah ra ia berkata: berkata se-orang laki-laki sesungguhnya ia telah meminang seorang perempuan Anshar, maka berkata Rasulullah kepadanya:“Apakah eng-kau telah melihatnya? Lakilaki itu menjawab: “Belum”. Berkata Rasulullah: “Pergilah dan perhatikan ia, maka sesungguhnya pada mata perempuan Anshor ada sesuatu” . Hadits di atas menarangkan bahwa perlu ada masa penjajakan untuk memilih calon suami atau isteri sebelum menetapkan keputusan untuk malakukan peminangan. Penjajakan ini mungkin dilakukan oleh pihak laki-laki atau pihak perempuan atau keluarga mereka. Pacaran Islami, Adakah? Dalam rangka melegalkan perbuatan pacaran, banyak orang yang mengatakan bahwa pacaran yang ia lakukan adalah pacaran islami. Lalu benarkah ada pacaran yang islami? Jika ada pacaran Islami, apakah ada pacaran yang kafiri? Lantas, bagaimana caranya kalau ingin merubah pacaran kafiri menjadi pacaran Islami? Apakah harus disucikan terlebih dahulu? Tentu saja tidak, karena pacaran bukanlah barang najis yang harus disucikan. Pacaran merupakan simbol (kata-kata) dari salah satu bentuk pergaulan bagi orang-orang yang sedang jatuh cinta (khususnya mudamudi). Pacaran pada dasarnya bukanlah merupakan sesuatu yang najis dan kotor. Adapun yang kotor dan najis adalah perilaku menyimpang dari orang-orang yang melakukan aktivitas pacaran tersebut. Dengan demikian, berarti tidak ada istilah islami atau kafiri dalam pacaran, hal ini karena pacaran hanyalah sebuah simbol. Yang perlu menjadi perhatian adalah perilaku orang yang pacaran, mau yang Islam atau yang bukan Islam, kalau melakukan perbuatan terlarang maka tetap salah dan yang salah adalah orang tersebut, bukan pacarannya. Tidak etis membawa-bawa nama Islam dalam aktivitas negatif. Kalau anda mau pacaran jangan bawabawa nama Islam jangan jadikan Islam sebagai tameng melegalkan aktivitas pacaran anda, sebab itu hanya akan membawa kesengsaraan di akhirat kelak. Wallahu A’lam.

Oleh Azhari Akmal Tarigan Wakil Dekan I Fakultas Syari’ah dan Ekonomi Islam IAIN.SU


asus Do’a berbayar yang akhir-akhir ini menjadi topik yang dihangat dibicarakan di berbagai media menyadarkan kita betapa agama sesungguhnya sangat rentan untuk dikomersialisasikan.Upaya yang harus kita lakukan ke depan adalah meningkatkan pemahaman keagamaan. Agama sesungguhnya bukan hanya memiliki dimensi pengamalan semata. Namun di dalamnya ada pemahaman. Bahkan rasa (dzauq). Agama juga harus “dirasakan.” Merasakan kedekatan dengan Allah ketika Shalat atau Thawaf. Merasakan tak berjarak dengan Allah ketika berdo’a. Justru pada level yang disebut terakhir inilah, seseorang akan merasakan kenikmatan beragama. Dalam konteks artikel ini, ketika Islam dipahami dengan benar dan dalam tingkat tertentu mampu “merasakan” – setidaknya ritual-ritualnya, maka kita sesungguhnya tidak membutuhkan orang lain dalam membangun relasi dan kontak dengan Allah SWT. Termasuk dalam do’a. Bukan berarti kita perlu do’a orang lain. Bukan pula salah meminta orang lain mendo’akan kita. Pointnya justru kita tidak akan menggantungkan nasib do’a kita pada orang tertentu. Lebih parah dari itu adalah, ketika kita lebih percaya kepada orang lain untuk meminta kepada Allah ketimbang kita sendiri. Sungguh do’a bukan seperti lampu aladin. Nabi Zakaria membutuhkan waktu 80 tahun berdo’a barulah do’anya terkabul. Ia hanya meminta seorang anak. Sampai tulang belulangnya mulai rapuh. Rambut putihpun sudah menutupi kulit kepalanya. Barulah Allah anugerahkan seorang anak yang bernama Yahyah. (QS. Maryam:1-5). Demikian pula halnya dengan Nabi Musa yang berdo’a agar kezaliman yang dilambangkan dengan sosok Fir’aun dihancurkan. Nabi Musa menunggu waktu 40 tahun, barulah Fir’aun yang zalim itu tenggelam di laut merah. Tentu ada banyak do’a para Nabi lainnya yang tidak seperti Nabi Musa. Do’a Nabi Muhammad adalah do’a yang cepat diijabah Allah. itulah do’a seorang kekasih kepada kekasihnya. Do’a sesungguhnya bermakna seruan atau ajakan. Dalam bahasa Arab “meminta” itu lebih tepat diwakili kata asta’in. Di dalam QS. AL-Fatihah terdapat ayat yang berbunyi, “iyyakan na’budu wa iyyaka nasta’in.” (hanya kepadamu aku menyembah dan hanya kepadamu aku minta pertolongan). Allah

adalah al-musta’an (tempat meminta). Jika demikian do’a hakikatnya bukanlah meminta. Do’a adalah seruan sang hamba kepada Allah SWT. Seruan yang penuh kelembutan dalam keheningan. Alquran menyebut panggilan Nabi Zakariya itu dengan kalimat, “nida’an khafiyya” (panggilan yang halus, lembut). Di dalam do’a tentu tidak ada pemaksaan. Tidaklah pantas sang makhluk memaksa khaliknya untuk memenuhi keinginannya. Sebaliknya di dalam do’a ada ajakan dan seruan kepada sosok yang maha agung. Seruan yang kita meminta Allah untuk menatap dan memperhatikan kita dan menyayangi kita. Do’a juga mengandung rasa cemas dan khawatir jika Allah tidak lagi memperdulikan kita. Mengabaikan dan lebih parah dari itu, marah kepada kita hambanya. Dalam tingkat tertentu kita hakikatnya merayu Allah untuk selalu menyertai dan bersama kita. Di dalam Alquran, Allah SWT tidak hanya menjelaskan urgensi do’a seperti pada QS. Al-Baqarah yang menjadi rangkaian ayat-ayat puasa. Ternyata Allah SWT juga mengajarkan bagaimana kalimat-kalimat do’a tersebut dilantuntankan. Tidaklah mengherankan jika di dalam Alquranbanyak do’a yang diawali kalimat rabbana atau rabbi. Hemat saya hal ini luar bisa. Allah mengajarkan bagaimana cara kita memanggilnya. Bahkan Allah mengizinkan umatnya untuk memanggilnya dengan 99 nama terbaik (al-asma’ al-husna). Pesan yang penulis tangkap, pada saat Allah mengajarkan kalimatkalimat do’a dengan lafaz rabbana atau rabbi, atau lafaz lain seperti do’ado’a dalam hadis, itu menunjukkan bahwa manusia tidak memerlukan perantara dalam menyampaikan do’anya. Bahkan dalam kasus Nabi Adam yang berdosa tersebut, Allah masih izinkan Adam untuk menyampaikan permintaan-nya. Rabbana zhalamna anfusana wa in lam taghfirlana wa tarhamna lanakunanna min al-khasirin. Inilah do’a orang yang zalim. Sekali lagi, Allah masih mengizinkan orang yang zhalim untuk memanggil namanya. Justru jika ada orang yang menitip do’a dan lebih percaya bahwa orang yang membawa do’a-do’anya, maka orang tersebut sesungguhnya tidak berbeda dengan orang-orang jahiliyyah. Bukankah menurut sejarah, orang-orang quraisy itu sebelum masa Nabi adalah orang saleh keturunan nabi Isma’il. Namun lama-lama karena mereka merasa dirinya kotor dan karenanya tidak pantas berhubungan dengan Allah,

Manusia tidak memerlukan perantara dalam menyampaikan doanya. Bahkan dalam kasus Nabi Adam yang berdosa tersebut, Allah masih izinkan Adam untuk menyampaikan permintaannya maka mereka ciptakanlah perantara. Lahirlah patung yang akhirnya menjadi objek sembehan mereka. mereka menyembah patung karena patung itulah yang selanjutnya akan menyampaikan do’a-do’a mereka kepada Allah SWT. Dengan demikian, kita menyadari bahwa setiap manusia lebihlebih muslim memiliki hak yang sama untuk mengakses Allah SWT. Setiap kita berhak untuk memanggil, menyeru dan menyapa Allah SWT. Bahkan orang yang paling zhalim sekalipun, berkubang maksiat, haknya untuk menyeru dan meminta kepada Allah tidak akan hilang. Dalam kekumuhan dosa itulah ia memanggil Allah yang maha suci dengan penuh penyesalan diri. Orang ini justru akan disambut Allah dan memberinya kabar gembira. Persoalannya hemat saya adalah bagaimana sesungguhnya pada bagaimana adab kita dalam berdo’a. Pada dasarnya, tidak ada aturan khusus tentang do’a. Setiap orang boleh menyeru, meminta kepada Allah dengan bahasanya sendiri juga gaya dan cara tersendiri. Semuanya akan di dengar Allah yang maha sami’. Justru yang kerap diperbincangkan para ulama adalah bagaimana adab kita dalam berdo’a. Oleh sebab itu, di dalam buku-buku keagamaan, telah dirumuskan urutanurutan do’a misalnya diawali dengan hamdalah, lalu shlawat, do’ado’a dalam Alqurandan akhirnya permintaan sendiri. Ada yang menambahkan dengannya orang yang berdo’a harus berwudhu’, menghadap kiblat dan menutup do’anya dengan al-fatihah. Aturan-aturan tersebut tentu saja absah untuk diikuti. Namun bagi saya, do’a itu sesungguhnya sangat personal. Do’a sejatinya ibadah tidak bisa diintervensi oleh siapapun. Oleh karena itu saya lebih melihat do’a sebagai suara hati. Ungkapan jiwa yang paling dalam kepada sesuatu yang maha agung namun sangat dekat dengan dirinya. Jika do’a kita terjemahkan dengan seruan, maka do’a itu adalah seruan kekasih dengan kekasihnya. Sekali lagi substansi do’a itu adalah

seruan jiwa yang terdalam dari seorang hamba. Syarat yang utama, kita harus merasakan kedekatan dengan Allah. Dekat yang tak berjarak (wa iza saalaka ‘ibadi ‘anni fainni qariib). Kita yang sudah merasa dekat dengan Allah maka kita dapat menyerunya dengan suara jiwa. Tidak lagi dengan suara raga. Dalam bahasa Alqurandisebut dengan nida’an khafiyya. Sampai di sini, ada tiga model do’a. Pertama, model meminta (isti’anah) kepada Allah. kalimat-kalimat yang kita gunakan adalah kalimat perintah walaupun dalam makna permintaan. Ya Allah, berikanlah aku...limpahkan kepadaku...anugerahkan aku, dan lain-lain. do’a seperti ini tidak salah. Namun do’a jenis ini adalah permintaan hamba kepada Tuhannya yang serba maha. Kedua, model pernyataan. Seperti do’a Nabi Ibrahim yang artinya, jika aku sakit, Dialah yang menyembuhkankanku. Nabi Ayub yang tidak meminta untuk disembuhkan tapi menyatakan betapa sakitnya membawanya semakin dekat dengan Allah SWT. Ketiga, model pengakuan. Pada level ini, ia tidak meminta kepada Allah. tidak juga membuat pernyataan. Ia lebih banyak mengungkapkan dirinya dihadapan Allah. ia telanjangin dirinya dihadapan Allah. Tak ada yang dia sembunyikan dari Allah. Kalimat-kalimatnya adalah kalimat orang yang tidak ingin berpisah dari Allah walau sekedipan mata. Ungkapan rindu dari sang kekasih. Tegasnya, ia berbicara dan berdialog dengan Allah melalui suara hatinya. Sekali lagi do’a adalah ibadah yang sesungguhnya amat personal. Di dalam do’a yang muncul adalah alnafs dan suara jiwa kita. Dengan cara ini kita akan mampu merasakan kedekatan dengan Allah SWT. Akankah Allah akan membiarkan kita merana padahal kita telah masuk dalam kelompok orang-orang yang dicintainya. Perlukah lagi kita meminta yang kita butuhkan pada hal Allah tahu apa yang kita perlukan. Bukankah seorang kekasih akan memberikan yang terbaik buat kekasihnya tanpa harus didahului dengan permintaan ? Semoga....

Waspada Melalui Waspada Oleh Fachrurrozy Pulungan Sekretaris Majelis Dakwah Al Washliyah Sumatera Utara dan Ketua FKLD Sumut.


an apabila kamu melihat mereka, tubuhtubuh mereka menjadikan kamu kagum. Dan jika mereka berkata, kamu mendengarkan perkataan mereka. Mereka seperti kayu yang tersandar. Mereka mengira bahwa tiap-tiap teriakan yang keras ditujukan kepada mereka. Mereka-mereka itulah musuh kamu, maka waspadalah terhadap mereka, Allah akan membinasakan mereka. Bagaimana mereka sampai dipalingkan (dari kebenaran) ” . Qur’an surah al Munafikun ayat 4. Kata Waspada dalam Kamus Besar Bahasa Indonesia diartikan sebagai, “ tidak lengah, berjagajaga”. Digunakan juga sebagai kata seru yang bermakna hati-hati. Dalam Alqur’an kata ‘waspada’ atau hati-hati diterjemahkan dengan kata hidzr, dan beberapa kali disampaikan kepada umat manusia, khususnya kepada umat Nabi Muhammad SAW, seperti contoh pada ayat pembuka di atas. Tidak lengah atau hati-hati mengajarkan kepada kita untuk selalu melihat kedepan sehingga tidak terjerumus kedalam lobang yang sama, atau setidak-tidaknya bisa menghindarkan diri dari sesuatu yang tidak kita harapkan terjadi pada diri kita, maupun keluarga kita. Banyak hal yang harus kita waspadai dalam menjalankan kehidupan ini. Hal-hal yang mungkin kita anggap selama ini baik-baik saja, ternyata memiliki dampak/akibat yang sangat membahayakan kehidupan kita dan keluarga kita, bahkan membahayakan masyarakat luas, dan boleh jadi dapat menghancurkan kehidupan berbangsa dan bernegara. Sebagai contoh, maraknya dakwah di kalangan masyarakat yang sebelumnya kita menganggap hal itu merupakan suatu kemajuan karena kesadaran masyarakat akan agamanya. Ternyata di balik dakwah itu terselip sesuatu yang menakutkan, yaitu pembunuhan, perampokan, dan penculikan dengan kedok agama. Tidak sedikit kemudian orang tua yang merasa was-was anakanaknya akan menjadi korban, atau sebagai pelaku itu sendiri. Pembunuhan dengan bom bunuh diri, atau jenis bom lainnya tidak mengenal sasaran maupun tempat. Bom bunuh diri di dalam masjid ketika semua orang dalam keadaan shalat, adalah suatu per-

buatan keji yang tak termaafkan bagi pelaku dan jaringannya. Karena Allah ‘Azza Wajalla telah mengharamkan membunuh jiwa orang lain tanpa hak. Hal itu tegas dan jelas disampaikan Alqur’an dalam berbagai surat. Dakwah dengan menebar kebencian merupakan hal yang perlu di waspadai. Islam adalah agama perdamaian, ajarannya penuh dengan kasih sayang. Namun bukan berarti Islam berdamai atau bertoleransi dengan segala bentuk kemaksiatan dan tidak pula berdamai dan toleransi terhadap kekerasan. Disamping itu maraknya peredaran narkoba yang telah menjangkau ke seluruh lapisan masyarakat, bahkan sudah menjalar kepada anak-anak yang duduk di sekolah dasar. Hal ini terlihat dari tingginya prevelensi pengguna narkoba di kalangan pelajar. Hasil penelitian Badan Narkotika Nasional (BNN) bekerjasama dengan Universitas Indonesia (UI) menunujukan 22 persen pelajar di Indonesia pernah mencoba bahkan menjadi pecandu dari barang haram tersebut. Fenomena ini menunjukkan bahwa narkoba tidak mengenal usia, jenis kelamin, status pekerjaan dan lain-lain. Siapa saja bisa terjerumus pada penyalahgunaan narkoba, ketika kewaspadaan dan kontrol sosial di keluarga, sekolah dan lingkungan mulai longgar. Disamping itu, kejadian di atas menjadi momentum untuk memodifikasi strategi pemberantasan narkoba, seperti target sosialisasi bahaya narkoba tidak hanya pelajar dan mahasiswa, tetapi juga masyarakat luas, seperti pejabat pemerintah, anggota legislatif dan kalangan swasta, termasuk terhadap aparat penegak hukum sendiri. Tidak salah selama ini kita sangat khawatir dengan penggunaan narkoba oleh pelajar dan mahasiswa, namun jangan lupa bahwa narkoba tidak kenal usia dan money oriented. Sehingga tidak aneh ketika ada oknum pejabat atau aparat yang terlibat. Oleh karena itu, kewaspadaan harus dimiliki oleh siapa saja, kapan saja dan dimana saja. Untuk itu diperlukan alat atau media yang bisa memberikan informasi semua bentuk yang mengkhawatirkan diri kita, dan itu bisa melalui media cetak. Media cetak atau bahasa asingnya ‘printed publication’ adalah

Media berita menjadi faktor utama dalam hubungan masyarakat, yang mengontrol arus publisitas melalui saluran-saluran komunikasi umum, yang amat penting. media untuk menyampaikan informasi melalui tulisan yang tercetak. Media cetak merupakan media yang sudah lama dikenal dan mudah dijumpai di mana-mana.Media ini sangat besar manfaatnya, sebab ia termasuk dari beberapa media masa yang mampu membentuk opini masyarakat, ia hampir bisa di sebut sebagai “makanan pokok”. Masyarakat mendambakan informasi dan untuk selalu bisa mengikuti perkembangan lingkungan disekitarnya maupun perkembangan dunia. Baik perkembangan yang menyangkut ekonomi, politik, pendidikan, budaya dan bahkan agama. Dari informasi yang diberikan media, masyarakat bisa waspada terhadap sesuatu yang membahayakan dirinya maupun keluarganya. Media berita menjadi faktor utama dalam hubungan masyarakat, yang mengontrol arus publisitas melalui saluran-saluran komunikasi umum, yang amat penting. Cerminan media dalam masyarakat merupakan pokok pembahasan yang memang tidak terlepas dari peran aktif media tersebut dalam melakukan peningkatan kualitas dalam penulisan, thema pembahasan yang harus sesuai dengan persoalan gejala sosial yang terjadi pada masyarakat, sehingga akan menciptakan cerminan yang baik atau berdampak positif pada masyarakat. Harian WASPADA adalah salah satu media yang memberikan informasi kepada masyarakat tentang semua yang dibutuhkan. Realitas sosial menunjukan bahwa jumlah orang yang aktif dalam berdakwah jauh lebih sedikit dengan jumlah orang yang menjadi sasaran dakwah. Disinilah peran media untuk lebih dapat melaksanakan dakwah, sehingga masyarakat dapat mengetahui dan mendalami ajaran agama nya. Waspada, sebagai salah satu media terbesar di Sumatera Utara dan NAD, telah melaksanakan hal itu, walau disadari masih ada kekukarangan-

kekurangannya. Namun hal itu sudah banyak membantu para da’i dalam mewaspadai ajaran-ajaran yang menyimpang dalam agama. Memberikan informasi kepada masyarakat khususnya umat Islam, tentang bahaya Singkretisme, Liberalisme, Radikalisme-Ekstrimisme dan isme-isme lain yang sangat meresahkan. Waspada dengan kolom Mimbar Jum’at nya merupakan salah satu media saluran informasi dan mengandung unsur dakwah yang sangat efektif untuk melakukan perubahan dan peningkatan pola berfikir serta menjadikan alat media penghubung antara satu tradisi yang ada pada masyarakat di Sumatera Utara dan NAD, sehinggga mewujudkan kedamaian dan kekondusifan antra suku-suku yang berbeda. Disamping itu media ini juga miningkatkan rasa kecintaan dan menumbuhkan kwalitas ibadah kepada Allah SWT dan merupakan salah satu media yang mampu menaikan derajat Islam lebih tinggi lagi. Dalam hal pencerminan media, Waspada sampai saat ini cukup efektif, karena setiap wartawanwartawan yang ada di harian ini telah ditempatkan disetiap daerah di Sumatera Utara dan Nangroe Aceh Darussalam, sehingga informasi dan gejala sosial, ekonomi, budaya dan politik di setiap daerah mampu mereka tuangkan secara obyektif. Artinya, media ini mampu mengoptimalkan situasi keadaan masyarakat yang sebenarnya terjadi dengan berita dan tulisan yang berimbang. Dan terlebih dalam kolom Mimbar jum’at yang ada di Waspada mampu menampilkan hal-hal yang hangat di bincangkan baik di daerah, nasional dan internasional yang dipadukan dengan nilai-nilai Islam pada umumnya. Dari hal seperti inilahWaspada mampu memberikan sebuah cerminan keadaan masyarakat yang sebenarnya, sehingga masyarakat bisa waspada. Selamat Ulang Tahun Waspada ke 67 tahun.

Mimbar Jumat


WASPADA Jumat 10 Januarai 2014

Kerajaan Islam Ternate Mulai pertengahan abad ke-15, Islam diadopsi secara total oleh kerajaan dan penerapan syariat Islam diberlakukan. Kerajaan Gapi atau yang kemudian lebih dikenal sebagai kerajaan Islam Ternate adalah salah satu dari 4 kerajaan Islam di Maluku dan merupakan salah satu kerajaan Islam tertua di Nusantara. Didirikan oleh Baab Mashur Malamo pada 1257. Kesultanan Ternate memiliki peran penting di kawasan timur Nusantara antara abad ke 13 sampai abad ke 17. Kerajaan Ternate menikmati kegemilangan pada abad ke 16 berkat perdagangan rempah-rempah dan kekuatan militernya. Di masa jaya kekuasaannya membentang mencakup wilayah Maluku, Sulawesi utara, timur dan tengah, bagian selatan kepulauan Filipina hingga sejauh kepulauan Marshall di Pasifik. Pulau Gapi (kini Ternate) mulai ramai di awal abad ke 13, penduduk Ternate awal merupakan warga eksodus dari Halmahera. Awalnya di Ternate terdapat 4 kampung yang masing - masing dikepalai oleh seorang momole (kepala marga), merekalah yang pertama – tama mengadakan hubungan dengan para pedagang yang datang dari segala penjuru mencari rempah – rempah. Penduduk Ternate semakin heterogen dengan bermukimnya pedagang Arab, Jawa, Melayu dan Tionghoa. Oleh karena aktivitas perdagangan yang semakin ramai ditambah ancaman yang sering datang dari para perompak maka atas prakarsa momole Guna pemimpin Tobona diadakan musyawarah untuk membentuk suatu organisasi yang lebih kuat dan mengangkat seorang pemimpin tunggal sebagai raja. Tahun 1257 momole Ciko pemimpin Sampalu dan diangkat sebagai Kolano (raja) pertama dengan gelar Baab Mashur Malamo (1257-1272). Kerajaan Gapi berpusat di kampung Ternate yang dalam perkembangan selanjutnya semakin besar dan ramai sehingga oleh penduduk disebut juga sebagai “Gam Lamo” atau kampung besar (belakangan orang menyebut Gam Lamo dengan Gamalama). Semakin besar dan populernya Kota Ternate, sehingga kemudian orang lebih suka mengatakan kerajaan Ternate daripada

kerajaan Gapi. Di bawah pimpinan beberapa generasi penguasa berikutnya, Ternate berkembang dari sebuah kerajaan yang hanya berwilayahkan sebuah pulau kecil menjadi kerajaan yang berpengaruh dan terbesar di bagian timur Indonesia khususnya Maluku. Di masa – masa awal suku Ternate dipimpin oleh para momole. Setelah membentuk kerajaan jabatan pimpinan dipegang seorang raja yang disebut Kolano. Mulai pertengahan abad ke-15, Islam diadopsi secara total oleh kerajaan dan penerapan syariat Islam diberlakukan. Sultan Zainal Abidin meninggalkan gelar Kolano dan menggantinya dengan gelar sultan. Para ulama menjadi figur penting dalam kerajaan. Selain Ternate, di Maluku juga terdapat paling tidak 5 kerajaan lain yang memiliki pengaruh. Tidore, Jailolo, Bacan, Obi dan Loloda. Kedatangan Islam Tak ada sumber yang jelas mengenai kapan awal kedatangan Islam di Maluku khususnya Ternate. Namun diperkirakan sejak awal berdirinya kerajaan Ternate masyarakat Ternate telah mengenal Islam mengingat banyaknya pedagang Arab yang telah bermukim di Ternate kala itu. Beberapa raja awal Ternate sudah menggunakan nama bernuansa Islam namun kepastian mereka maupun keluarga kerajaan memeluk Islam masih diperdebatkan. Hanya dapat dipastikan bahwa keluarga kerajaan Ternate resmi memeluk Islam pertengahan abad ke-15. Kolano Marhum (1465-1486), pe-nguasa Ternate ke-18 adalah raja pertama yang diketahui memeluk Islam bersama seluruh kerabat dan pejabat istana. Pengganti Kolano Marhum adalah puteranya, Zainal Abidin (1486-1500). Beberapa langkah yang diambil Sultan Zainal Abidin adalah meninggalkan gelar Kolano dan menggantinya dengan sultan. Islam diakui sebagai agama resmi kerajaan, syariat Islam diberlakukan dan membentuk lembaga kerajaan sesuai hukum Islam dengan melibatkan para ulama. Langkah-langkahnya ini kemudian diikuti kerajaan lain di Maluku secara total, hampir tanpa perubahan. Ia juga mendirikan madrasah yang pertama di Ternate. Sultan Zai-

Masjid Kesultanan Ternate nal Abidin pernah memperda-lam ajaran Islam dengan berguru pada Sunan Giri di pulau Jawa, disana beliau dikenal sebagai “Sultan Bualawa” (Sultan Cengkih). Di masa pemerintahan Sultan Bayanullah (1500-1521), Ternate semakin berkembang, rakyatnya diwajibkan berpakaian secara islami, teknik pembuatan perahu dan senjata yang diperoleh dari orang Arab dan Turki digunakan untuk memperkuat pasukan Ternate. Di masa ini pula datang orang Eropa pertama di Maluku, Loedwijk de Bartomo (Ludovico Varthema) tahun 1506. Tahun 1512 Portugal untuk pertama kalinya menginjakkan kaki di Ternate dibawah pimpinan Fransisco Serrao, atas persetujuan sultan, Portugal diizinkan mendirikan pos dagang di Ternate. Portugal datang bukan hanya untuk berdagang melainkan untuk menguasai perdagangan rempah – rempah pala dan Cengkih di Maluku. Untuk itu terlebih dulu mereka harus menaklukkan Ternate. Sultan Bayanullah wafat meninggalkan pewaris - pewaris yang masih sangat belia. Janda sultan, permaisuri Nukila dan Pangeran Taruwese, adik almarhum sultan bertindak sebagai

wali. Permaisuri Nukila yang asal Tidore bermaksud menyatukan Ternate dan Tidore dibawah satu mahkota yakni salah satu dari kedua puteranya, pangeran Hidayat ( Sultan Dayalu) dan pangeran Abu Hayat ( Sultan Abu Hayat II). Gubernur Portugal bertindak sebagai penasihat kerajaan dan dengan pengaruh yang dimiliki berhasil membujuk dewan kerajaan untuk mengangkat pangeran Tabariji sebagai sultan. Tetapi ketika Sultan Tabariji mulai menunjukkan sikap bermusuhan, ia difitnah dan dibuang ke Goa, India. Disana ia dipaksa Portugal untuk menandatangani perjanjian menjadikan Ternate sebagai kerajaan Kristen dan vasal kerajaan Portugal, namun perjanjian itu ditolak mentah-mentah Sultan Khairun (1534-1570). Perlakuan Portugal terhadap saudara – saudaranya membuat Sultan Khairun geram dan bertekad mengusir Portugal dari Maluku. Tindak – tanduk bangsa barat yang satu ini juga menimbulkan kemarahan rakyat yang akhirnya berdiri di belakang sultan Khairun. Sejak masa Sultan Bayanullah, Ternate telah menjadi salah satu dari tiga kesultanan terkuat dan pusat Islam

utama di Nusantara abad ke 16 selain Aceh dan Demak setelah kejatuhan kesultanan Malaka tahun 1511. Ketiganya membentuk Aliansi Tiga untuk membendung sepak terjang Portugal di Nusantara. Tak ingin menjadi Malaka kedua, Sultan Khairun mengobarkan perang pengusiran Portugal. Kedudukan Portugal kala itu sudah sangat kuat, selain memiliki benteng dan kantong kekuatan di seluruh Maluku mereka juga memiliki sekutu suku pribumi yang bisa dikerahkan untuk menghadang Ternate. Dengan adanya Aceh dan Demak yang terus mengancam kedudukan Portugal di Malaka, Portugal di Maluku kesulitan mendapat bantuan hingga terpaksa memohon damai kepada Sultan Khairun. Secara licik Gubernur Portugal, Lopez de Mesquita mengundang Sultan Khairun ke meja perundingan dan akhirnya dengan kejam membunuh Sultan yang datang tanpa pengawalnya. Pembunuhan Sultan Khairun semakin mendorong rakyat Ternate untuk menyingkirkan Portugal, bahkan seluruh Maluku kini mendukung kepemimpinan dan perjuangan Sultan Baabullah (1570-1583), pos-pos Portugal di seluruh Maluku

dan wilayah timur Indonesia digempur, setelah peperangan selama 5 tahun, akhirnya Portugal meninggalkan Maluku untuk selamanya tahun 1575. Di bawah pimpinan Sultan Baabullah, Ternate mencapai puncak kejayaan, wilayah membentang dari Sulawesi Utara dan Tengah di bagian barat hingga kepulauan Marshall dibagian timur, dari Philipina (Selatan) dibagian utara hingga kepulauan Nusa Tenggara dibagian selatan. Sepeninggal Sultan Baabullah Ternate mulai melemah, Spanyol yang telah bersatu dengan Portugal tahun 1580 mencoba menguasai kembali Maluku dengan menyerang Ternate. Dengan kekuatan baru Spanyol memperkuat kedudukannya di Filipina, Ternate pun menjalin aliansi dengan Mindanao untuk menghalau Spanyol namun gagal bahkan Sultan Said Barakati berhasil ditawan Spanyol dan dibuang ke Manila. Kekalahan yang diderita memaksa Ternate meminta bantuan Belanda tahun 1603. Ternate akhirnya sukses menahan Spanyol namun dengan imbalan yang amat mahal. Belanda akhirnya secara perlahan-lahan menguasai Ternate, tanggal 26 Juni 1607 Sultan Ternate menandatangani kontrak monopoli VOC di Maluku sebagai imbalan bantuan Belanda melawan Spanyol. Pada tahun 1607, Belanda membangun benteng Oranje di Ternate yang merupakan benteng pertama mereka di nusantara. Sultan Muhammad Nurul Islam atau yang lebih dikenal dengan nama Sultan Sibori (1675 – 1691) merasa gerah dengan tindak – tanduk Belanda yang semena - mena. Ia kemudian menjalin persekutuan dengan Datuk Abdulrahman penguasa Mindanao, namun upayanya untuk menggalang kekuatan kurang maksimal karena daerah – daerah strategis yang bisa diandalkan untuk basis perlawanan terlanjur jatuh ke tangan Belanda oleh berbagai perjanjian yang dibuat para pendahulunya. Ia kalah dan terpaksa menyingkir ke Jailolo. Tanggal 7 Juli 1683 Sultan Sibori terpaksa menandatangani perjanjian yang intinya menjadikan Ternate sebagai kerajaan dependen Belanda. Perjanjian ini mengakhiri masa Ternate sebagai negara berdaulat.

Dengan kemampuan yang terbatas karena selalu diawasi mereka hanya mampu menyokong perjuangan rakyatnya secara diam – diam. Yang terakhir tahun 1914 Sultan Haji Muhammad Usman Syah (18961927) menggerakkan perlawanan rakyat di wilayah – wilayah kekuasaannya, bermula di wilayah Banggai dibawah pimpinan Hairuddin Tomagola namun gagal. Dalam usianya yang kini memasuki usia ke-750 tahun, Kesultanan Ternate masih tetap bertahan meskipun hanya sebatas simbol budaya. Jabatan sultan sebagai pemimpin Ternate ke-49 kini dipegang oleh sultan Drs. H. Mudaffar Sjah, BcHk. (Mudaffar II) yang dinobatkan tahun 1986. Imperium nusantara timur yang dipimpin Ternate memang telah runtuh sejak pertengahan abad ke-17 namun pengaruh Ternate sebagai kerajaan dengan sejarah yang panjang masih terus terasa hingga berabad kemudian. Ternate memiliki andil yang sangat besar dalam kebudayaan nusantara bagian timur khususnya Sulawesi (utara dan pesisir timur) dan Maluku. Pengaruh itu mencakup agama, adat istiadat dan bahasa. Sebagai kerajaan pertama yang memeluk Islam Ternate memiliki peran yang besar dalam upaya pengislaman dan pengenalan syariat-syariat Islam di wilayah timur nusantara dan bagian selatan Filipina. Bentuk organisasi kesultanan serta penerapan syariat Islam yang diperkenalkan pertama kali oleh sultan Zainal Abidin menjadi standar yang diikuti semua kerajaan di Maluku hampir tanpa perubahan yang berarti. Keberhasilan rakyat Ternate dibawah sultan Baabullah dalam mengusir Portugal tahun 1575 merupakan kemenangan pertama pribumi nusantara atas kekuatan barat, oleh karenanya almarhum Buya Hamka bahkan memuji kemenangan rakyat Ternate ini telah menunda penjajahan barat atas bumi nusantara selama 100 tahun sekaligus memperkokoh kedudukan Islam dan sekiranya rakyat Ternate gagal niscaya wilayah timur Indonesia akan menjadi pusat Kristen seperti halnya Filipina. Nurhayati Baheramsyah/wikpd

Pemuda Hari Ini

Bahaya Komersialisasi Doa Dan Dakwah

Oleh Drs H. As’ad Marlan, M.Ag

Oleh Sugeng Wanto

Dosen FITK IAIN SU dan STAI Al-Islahiyah Binjai

Ketua Umum Ikatan Da’I Muda Cendikiawan (Idaman) Sumatera Utara dan Dosen Fak. Ushuluddin IAIN-SU


alah seorang ahli hikmah dan ilmuan muslim yang Tidak cukup hanya dengan kasih sayang, anak juga bernama Syaikh Musthafa Al-Ghalayani menga- perlu pendidikan yang berkesinambungan kelak akan takan: “Subbanul yaumi rijalul ghaddi” (pemuda dapat dijadikan benteng dalam menghadapi dan hari ini adalah pemimpin masa depan). Sedangkan menahan serangan setan-setan kemajuan zaman. menurut imam Syafi’i, seorang diantara empat mujtahid, Rasulullah SAW telah mengingatkan “Suruhlah anakmenaruh harapan lebih besar terhadap pemuda. “Sesung- anak kamu itu mengerjakan salat apabila telah guhnya di tangan pemudalah terletak segala urusan umat, berumur tujuh tahun dan apabila tidak mau salat bila telah berumur sepuluh tahun, maka pukullah (kerasi dan di kedua kakinya lah terletak kejayaan umat.” Sedemikian besar harapan tercurah kepada pemuda dia dengan tegas)”. (HR. Turmuzi). Pendidikan anak atau remaja dalam islam dimulai tetapi juga seimbang dengan besar dan beratnya tanggungjawab pemuda untuk menjawabnya. Adalah bagian dengan shalat, mengapa justru salat yang pertama dan dari fitrah, pemuda mempunyai sifat inovatif (pem- bukan wajib belajar di bangku sekolah? Karena dengan baruan) yang melekat kuat. Perannya dalam perubahan salat, anak akan mengenal dan mengabdi serta cinta sosial tidak dibatasi ruang dan waktu. Banyak hal di- kepada Allah, pertama kali harus ditanamkan dalam tuntut dari pemuda, keterampilan, idealisme, inte- keadaan murni, belum dipengaruhi oleh rekaman negatif. Jelasnya, buat si legensia, militansia, kebeanak atau remaja, salat ranian, bersikap dan bertindak yang berpihak pada Pendidikan anak atau remaja berfungsi sebagai pengisi rohaniyahnya dan sebanilai-nilai kebenaran. dalam islam dimulai dengan gai pembentuk kepribaNamun, secara realita yang utuh dan tangtidak semua pemuda deshalat, mengapa justru shalat dian guh kelak apabila dia telah mikian, apalagi bila dilihat dibalik semua sanjuyang pertama dan bukan wajib dewasa. Kedua, menanamkan ngan, kebanggaan, presbelajar di bangku sekolah? fungsi ilmu, untuk mengtasi dan harapan yang imbangi kemampuan rotercurah kepada pemuda haniyahnya dengan keterlintas keraguan, kekhawatiran dan keprihatinan melihat kondisi objektif mampuan aqliyahnya (akal) maka anak atau remaja perlu remaja, pemuda, pelajar dam mahasiswa dewasa ini diserahkan kepada pendidikan formal madrasah, yang telah kehilangan identitas dan arah hidupnya, pesantren, sekolah-sekolah yang dianggap bermutu dan terjerumus dalam budaya “bebas nilai” sekuler dan berkualitas. Disinilah peran dan tanggungjawab seorang guru melanjutkan tugas dan tanggungjawab orang tua. kebarat-baratan. Peran guru bukan hanya memberikan ilmu, dalam Gejala rusaknya moral yang melanda anak bangsa khususnya generasi muda akhir-akhir ini seperti, arti ilmu semata tetapi dengan ilmu yang diajarkannya penyalahgunaan obat terlarang, minuman keras, sa- hendaknya mampu menggiring dan menyadarkan si disme, kebebasan seks, tingkah laku yang melawan or- anak akan kesadaran keberadaan dan fungsi diri, ang tua dan guru, tawuran pelajar dan belakangan ini eksistensi diri di tengah kehidupan alam disekelilingnya, marak dihebohkan dengan adanya genk motor hamper eksisitensi diri dan fungsi diri sebagai makhluk kepada disetiap propinsi dan daerah. Mereka membalap di jalan sang pencipta, serta dengan kreativitasnya senantiasa raya dan mengganggu ketentraman orang lain dan tidak cenderung mengembangkan ilmunya untuk kesejarang mereka membunuh atau menghilangkan nyawa jahteraan umat manusia.Upaya mewujudkan keberhasilan tersebut diatas, adalah kerjasama antara ororang lain tanpa ada rasa kasih saying sedikit pun. Sifat-sifat individualisme konsumerisme dan sifat- ang tua, guru dan pemerintah. Harus dipahami besifat tercela lainnya kian hari kian merajalela dalam nar hubungan antara orang tua dan guru seperti mikehidupan masyarakat terutama dikalangan generasi nyak dan sumbu lampu, yang nyaris tidak dapat muda. Penetrasi budaya asing baik yang masuk melalui dipisahkan, saling topang, saling isi dan saling memedia massa cetak ataupun elektronik seperti majalah lengkapi sehingga menyalanya pelita itu. Akan tetapi, kalau yang terjadi sebaliknya, maka dan buku-buku yang mengumbar syahwat dan film-film maupun yang ditayangkan televisi swasta semakin lama sulitlah untuk mengatakan pendidikan yang mampu dirasakan pengaruhnya semakin besar terhadap mewujudkan manusia Indonesia seutuhnya, karena orang tua dan guru telah kehilangna wibawanya di mata perilaku dan tingkah laku generasi muda. Tampaknya, jawaban yang bersifat anjuran ini masih anak-anak dan murid-muridnya. Bukan hal yang kurang tajam, apalagi bila dilihat serbuan setan-setan mustahil, kalau banyak anak-anak muda yang frustasi kemajuan zaman yang jauh lebih perkasa dari anjuran menyesali kepada kadua orang tuanya dan guru karena kebenaran tersebut, kejahatan seks, perkosaan, prostitusi, tidak berhasil dalam pendidikan keluarga dan sekolah. hubungan intim pra nikah, hamil “kecelakaan”, suburnya Penutup : Masyarakat menilai bahwa pemuda memiliki popergaulan bebas, maraknya pornografi dan pornoaksi dan kasus-kasus serupa lainnya, seperti sudah menjadi berita tensi-potensi yang sangat besar, kedudukannya sangat rutin di media massa cetak dan elektronik bahkan sampai strategis tersebut membuat setiap bangsa menaruh di dunia maya yang menjadi padanan beritanya biasanya harapan. Maka tidak heran banyak para ilmuan memadalah perkelahian dan pembunuhan karena cemburu, berikan julukan para pemuda seperti: pemuda harapan berebut pasangan hidup, tidak kuasa menahan birahi bangsa, ahli waris, cita-cita perjuangan atau generasi setelah menonton film porno, perampokan, hingga penerus. Terutama ungkapan Bung Hatta, “Pemuda engkau adalah pahlawan dalam hatiku”. penggelapan uang dengan cara korupsi. Oleh karena itu, di era modern ini dan langkah Untuk mengatasi kejahatan tersebut diantaranya: Pertama, memperhatikan lingkungan keluarga, generasi muda sangat diperlukan dan dibutuhkan oleh tentang hal ini Rasulullah SAW pernah bersabda: bangsa dan Negara, karena potensi generasi muda In“Setiap anak yang baru dilahirkan adalah dalam ke- donesia dalam kiprahnya harus berorientasi ke depan adaan fitrah atau suci (tidak berdosa) maka orang hari ini lebih baik dari hari kemarin, bukan saja duniawi tuanya lah yang menjadikan anak itu menjadi Ya- tapi juga ukhrawi yang dilaksanakan dengan niat ibadah untuk mencari ridha Allah SWT. Wallahu “Alam. hudi, Nasrani atau Majusi”. (HR. Bukhari Muslim).


khir-akhir ini kita disuguhi berita tentang doa berbayar. Jadi, kalau ingin doa di tempat-tempat yang maqbul berdoa seperti depan multazam atau yang lainnya cukup titip dengan membayar uang sedekah minimal atau maksimal. Setelah itu, ada yang akan mendoakan kita di depan ka’bah. Bagaimana strateginya berdoa, wallahu a’lamu. Persoalan ini tentunya memicu konflik karena doa yang merupakan mukhul ibadah sudah dibisniskan atau di komersilkan. Kemunculan banyak istilah seperti komersialisasi dakwah, komersialisasi doa atau juga komersialisasi zikir, bisa jadi juga komersialiasi thariqat membuat kita harus mengevaluasi dan memperbaharui niat dalam aktivitas kita untuk umat hanya karena AllahSWT. Marilah kita berkaca dan belajar serta menauladani gaya dakwah Rasulullah SAW Faktor-Faktor Komersialisasi Penyakit ini ditandai dengan terjadinya gejala kevakuman dalam beragama dan hilangnya semangat beribadah, apakah itu penyampaian pesan dakwah dalam rangka amar ma’ruf nahi munkar kepada diri sendiri ataupun kepada orang lain. Dengan kata lain, terjadinya penurunan ghirah (semangat) untuk melaksanakan perintah Allah dan RasulNya. Kemudian, muncul motivasi amar ma’ruf nahi munkar dengan menjadikan hal tersebut hanya sebagai ladang untuk memenuhi kebutuhan materi atau duniawi. Sehingga, memasang tarif dalam berdakwah yang konteksnya adalah ibadah, meminta fasilitas untuk kenyamanan dakwah, menawarkan proposal dakwah dengan taksasi biayanya, dan lain-lain. Ironisnya, semua itu dianggap suatu yang lumrah dalam berdakwah demi penegakan amar ma’ruf dan nahi munkar. Yang perlu diwaspadai sebagaimana yang dikatakan oleh Yusuf Qaradhawi adalah jika wabah tersebut merata dan menggerogoti sebagian besar umat Islam, maka tidak mungkin kebangkitan umat Islam dapat ditegakkan. Yang terjadi mungkin sebaliknya, kekuatan umat semangkin tenggelam bahkan mungkin karam. Semua musuh Islam siap sedia mencengkramkan kukukukunya yang tajam guna mencabik-cabik kehormatan umat ini. Akhirnya, tidak akan muncul sosok-sosok yang layak ditauladani dalam berdakwah sebagai-

mana dahulu ada M. Nasir, Buya Hamka, dan lain-lain. Sekarang ini yang lahir hanya ulama yang oportunis, da’i yang pragmatis, cendikiawan yang hedonis. Tidak bisa menjadi contoh bagi umat. Secara terperinci, terjadinya penyakit komersialisasi ini disebabkan beberapa faktor, antara lain adalah : Pertama, tenggelam dan hanyut dalam kemaksiyatan. Sejak manusia dilahirkan secara sunnatullah hatinya memang bersih, ibarat sebuah cermin yang begitu jernih. Ia akan semakin jelas bila diisi dengan nilainilai keimanan akan tetapi sebaliknya. Bila diisi dengan perbuatan dosa (kemaksiyatan) maka ia akan kotor, walaupun maksiyat yang ia kerjakan itu merupakan maksiyat yang kecil. Rasulullah saw. mengingatkan, “tidak ada dosa kecil kalau dilakukan terus menerus, dan tidak ada dosa besar jika disertai dengan istighfar”. Bila kita sudah tenggelam dalam kemaksiyatan maka ghirah beragama untuk mendekatkan diri dengan Tuhan akan menurun. Bahkan orang yang semacam ini akan menganggap dirinya aman dari azab Allah. Artinya, menghalalkan segala cara dengan berlindung di balik simbol keagamaan atau mengatasnamakan Tuhan demi meraup uang dan mengisi pundi-pundi dolarnya. Kedua, cinta dunia dan melalaikan Akhirat. Nafsu dan syahwat merupakan bagian dari anugrah yang telah Allah berikan kepada manusia. Nikmat ini termasuk sarana dan fasilitas hidup yang harus disyukuri dalam wujud ibadah dan khilafah manusia di bumi ini. Bahayanya, jika hati manusia ini sudah terbelenggu penyakit cinta dunia, kedudukan, popularitas, atau harta kekayaan. Akhirnya syahwat dan nafsunya yang secara tabi’i (alami) cendrung pada kejelekan akan mengendalikan hatinya agar menjadi budak bagi semua yang dicintainya. Akibatnya, bimbingan hati nurani atas semua jasad akan lepas. Rasulullah bersabda: “seseorang yang rakus harta dan jabatan akan lebih merusak agamanya daripada dua binatang buas yang lapar dan dilepas di antara domba.” (H.R.Turmudzi). Bagi para da’i yang telah terbelenggu dengan orientasi materi dunia, populeritas, pujian atau prestise akan cenderung mengkomersilkan dakwah yang dilakukanya. Da’i seperti ini ketika diundang untuk dakwah dia akan mengatakan:

Orang Mukmin itu adalah orang yang keimanannya sempurna, dihatinya tidak tersusupi oleh niatan untuk menentang Allah dan tidak menempatkan dirinya pada arus godaan. “Wani Piro” atau “dalam kota, pakai mobil sendiri, nyupir sendiri, sekian, kalau di luar kota dijemput sekian dan tidak dijemput berbeda lagi sekian”, na’udzubillah min dzalik. Inilah da’I yang komersil dalam dakwahnya. Ketiga, tidak tahan menghadapi ujian. Ujian dalam kehidupan dakwah merupakan benturan yang paling kuat dan ujian yang paling besar. Berapa banyak orang yang mundur dari panggung amal islami dalam artian jauh dari Allah setelah mendapatkan cobaan dan ujian dari Allah. Berapa banyak ustadz yang seharusnya jadi tauladan umat justru dicibir dan cenderung direndahkan karena tidak tahan menghadapi ujian. Padahal sebelumnya mereka tergolong orang-orang yang bersemangat dan ikhlash dalam berdakwah. Firman Allah SWT. : “ apakah manusia itu mengira bahwa mereka dibiarkan saja mengatakan kami telah beriman sedang mereka tidak diuji.” (Q.S. al-Ankabut (29) : 2). Menjadi ustadz kondang, populer, terkenal, masyhur, banyak jadwal, jarang di rumah, sering ke luar kota, satu meja dengan pejabat pemerintahan, tarif tinggi, dan lain-lain adalah ujian bagi para ustadz sekarang ini. Menauladani Rasulullah SAW Saat Rasulullah SAW memulai dakwahnya di Mekkah, pesan pertama yang beliau sampaikan adalah Tauhid. Tauhid adalah inti ajaran setiap rasul yang merupakan batas demarkasi antara iman dan kufr. Setelah seseorang menyakini dan bersaksi akan keesaan Allah dan Muhammad SAW sebagai utusannya, barulah babak baru dimulai. Ia harus tunduk dan patuh terhadap aturan Islam. Bagi setiap muslim prinsip ketauhidan ini harus betul-betul diistiqomahkan. Mengesakan Allah ini menuntut 2 hal: pertama, menyerahkan ibadah dan perbuatan kita betul-betul hanya kepada Allah SWT. (tauhid uluhiyah) dan kedua, menyakini keesaan Allah terhadap hak-hak ketuhanan-Nya. Seperti, menciptakan, memberi rizki, ma-

ha memiliki, maha berkuasa dan lain sebagainya. Intinya, betulbetul bergantung kepada Allah SWT. (bukan bermakna pesimis) karena kesadaran bahwa kita ini adalah makhluk yang membutuhkan tempat bergantung yaitu Allah. Setelah visi tauhid maka visi selanjutnya yang ditanamkan oleh Rasulullah SAW adalah mengikutinya (ittabi’). Rasulullah sebagai suri tauladan umat (uswah hasanah) merupakan tuntunan dalam kehidupan. Untuk itu, kecintaan kepada Rasulullah saw harus betul-betul ditanamkan. Mencintai Rasulullah SAW berarti kita mencintai sunnahnya, mentaati peraturannya. Bila kita sudah mencintai Rasulullah maka otomatis juga telah mencintai Allah, demikian pula sebaliknya. Pesan yang selanjutnya adalah tazkiyah an-nafs (pembersihan hati). Ini merupakan proses penyucian dan pengobatan hati dari segala kotoran dan cela. Hati yang bersih adalah hati yang jauh dari berbagai penyakit hati, semisal dengki, dusta, khianat yang dicela oleh agama dan akal sehat. Allah berfirman: “ Dia-lah yang mengutus kepada kaum buta huruf seorang Rasul di antara mereka yang membacakan ayat-ayat-Nya kepada mereka menyucikan mereka dan mengajarkan kepada mereka kitab dan hikmah (sunnah)”. (Q.S. al-Jumu’ah (62) : 2 ). Ada tiga hal utama yang harus kita tanamkan khususnya bagi para da’I, yaitu: pertama, kuatkan iman (tauhid); kedua, tauladani Rasulullah SAW ketiga, bersihkan diri dari kemunafikan dan kemak-siyatan. Apa yang telah divisikan Rasulullah SAW. hendaknya dapat kita jadikan sebagai cerminan sehingga komersialisasi dakwah yang dapat menghambat kebangkitan umat Islam akan mampu dihindari. Dengan menanamkan sikap istiqomah untuk bertauhid, mengikuti apa yang telah diaturkan oleh Rasul serta senantiasa menyucikan diri (jiwa) insya Allah ghirah kita dalam beragama, dalam berdakwah senantiasa akan terpelihara. Wallahu a’lamu.

Waspada, jumat 10 januari 2013  
Waspada, jumat 10 januari 2013