Page 1

Tiki-taka Melawan Kuda Hitam Balkan Analisis Sarman Panggabean SETELAH puas mempermainkan Irlandia kemudian menang 4-0, dinihari nanti Andres Iniesta dan kawan-kawan akan menghadapi kuda hitam dari Balkan, Kroasia, yang masih bermain konvensional. Formasi klasik 4-4-2 yang diterapkan pelatih Slaven Bilic juga dimainkan dengan sederhana. Tetapi diaktifkannya Ivan Rakitic dan Darijo Srna, gelandang yang selalu melakukan gerakan bayangan ke arah sayap, membuat dua ujung tombak mendapat bantuan penuh bola-bola matang dari pinggir garis lapangan pertahanan lawan.

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SENIN, Pon, 18 Juni 2012/28 Rajab 1433 H

No: 23899 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12)

Klasemen Akhir Grup B Jerman 3 3 0 0 5-2 Portugal 3 2 0 1 5-4 Denmark 3 1 1 1 4-5 Belanda 3 0 0 3 2-5

Lanjut ke hal A2 kol. 1

CR7 Antar Portugal Dampingi Jerman KHARKIV, Ukraina (Waspada): Sempat tertinggal 0-1, Portugal mampu membalikkan kedudukan menjadi 2-1 berkat dua gol Cristiano Ronaldo. Alhasil, Seleccao berhak melaju ke perempatfinal dan Belanda diharuskan pulang tertunduk lesu. Tampil di Stadion Metalist, Senin (18/6) dinihari, masuknya Rafael van der Vaart sebagai starter sekaligus kapten menggantikan Mark van Bommel membawa perubahan positif bagi Belanda. VDV bahkan membuka asa skuad Oranye dengan gol pada menit 10 lewat tendangan melengkung yang sulit dijangkau Rui Patricio. Namun, gol itu seolah membangkitkan Portugal yang langsung mengancam balik. Berawal dari gerakan Ronaldo di sayap kirim, winger Real Madrid itu melepaskan tendangan keras. Sayang, arahnya masih melebar di kanan gawang. Portugal akhirnya menyamakan kedudukan di menit 28 ketika CR7 menuntaskan bola kiriman Joao Pereira dan menaklukkan Maarten Stekelenburg. Di babak kedua, Portugal mempersulit perjuangan Belanda berkat gol kedua di menit 74. Untuk kedua kali, Ronaldo melesakkan bola ke gawang Negeri Kincir Angin sekaligus menjawab kritik atas performa buruknya pada dua laga perdana. Hasil ini membuat Portugal lolos ke perempatfinal sebagai runner-up Grup B karena Jerman mengalahkan Denmark 21 dan berhak menjadi juara grup. Di Lviv, Lukas Podolski mencetak gol Jerman di menit 20 sebelum dibalas Michael Krohn-Dehli lima menit berselang. Absennya Jerome Boateng membuat pelatih Joachim Loew memasang Lars Bender sebagai bek kanan. Ternyata, keberuntungan berpihak ke pemain Bayer Leverkusen ini. Tepat menit 80, Bender memadamkan Dinamit Denmark. Di perempatfinal nanti, Jerman akan bersua Yunani dan Portugal berhadapan dengan Republik Ceko. (m33)

Harga Eceran: 2.500,-

9 6 4 0


BINTANG Portugal, Cristiano Ronaldo (kiri), mencetak dua gol kemenangan timnya sekaligus memaksa Belanda tersingkir dari persaingan perebutan juara Euro 2012 di Kharkiv, Senin (18/6) dinihari WIB. Belanda kalah 1-2, sehingga Portugal mendampingi Jerman sebagai wakil Grup B.

DEMOKRAT ANJLOK KE 3 JAKARTA ( Waspada): Hasil survei kembali menunjukkan menurunnya elektabilitas Partai Demokrat. Kali ini, survei Lingkaran Survei Indonesia (LSI) menunjukkan Partai besutan Susilo Bambang Yudhoyono itu anjlok ke peringkat tiga.

Hasil survei itu dipaparkan pada Minggu (17/6) di kantor LSI, Rawamangun, Jakarta Timur. “Survei LSI ini dilaksanakan pada 2 sampai 11 Juni 2012,” kata peneliti LSI Aji Al Farabi.

Kisruh internal dan terlibatnya sejumlah elit partai dalam kasus korupsi wisma atlet SEA Games dan proyek Hambalang menjadi faktor menurunnya tingkat keterpilihan

Demokrat itu. Tingkat penurunan itu termasuk drastis. Survei itu menunjukkan Demokrat terancam hanya memperoleh suara di bawah 10 persen dan akan

menjadi partai papan tengah. Berdasar survei itu diketahui, jika pemilu legislatif dilakukan saat ini, Partai Golkar akan memperoleh 20,9 persen, PDIP 14,0 persen, sedangkan

Pergantian Direksi Bank Sumut Sesuai UU

JAKARTA (Waspada): Tiga nama menjadi kandidat terkuat untuk Capres pada Pilpres 2014. Hal tersebut sesuai hasil survei LSI dari 1200 responden. Para responden menjawab hanya ada tiga nama yang menjadi kandidat terkuat untuk Capres pada Pilpres 2014. “Capres divisi utama saat ini adalah pertarungan tiga tokoh saja, yakni Megawati, Prabowo dan Aburizal Bakrie,” kata Adjie Alfarabi. Margin of error survei ini adalah 2,9 persen. Dari survei yang dilaksanakan pada 2 Juni sampai 11 Juni 2012, nama Megawati Soekarnoputri memperoleh duku-

Bank Sumut

Lanjut ke hal A2 kol. 6

Al Bayan

Dikyanus Pengkhianat Oleh Tgk H. Ameer Hamzah Hai Dikyanus kadong dilee Ka pateh kee saboh calitra Kapoh syeikh jeh di lee beumate Hareuta han le bagi dua. (Suara Syeithan) ALKISAH, seorang pemuda penganggur yang bernama Dikyanus bermimpi menemukan sumur harta Karun. Ia bermimpi berulang-ulang tentang sumur tersebut yang penuh dengan emas. Namun ia tidak tahu lokasi sumur tersebut. Lalu ia menjumpai seorang Syeikh (ulama) tua di Kota Damaskus untuk mencari kepastian. Sang Syeikh siap membantu Dikyanus asal saja ada bagian untuknya. “Saya akan bagi dua, setengah untukku dan setengah untuk tuan!”, ujar Dikyanus bersumpah. “Alhamdulillah nanti harta itu akan saya gunakan untuk kepentingan agama Allah!”, jawab Syeikh tua yang sudah puluhan tahun memerangi maksiat. Lanjut ke hal A2 kol. 3

Menurut Aji, survei ini dilakukan dengan metode multistage random sampling dengan jumlah responden sebanyak Lanjut ke hal A2 kol. 3

Mega, Prabowo Dan Aburizal

MEDAN (Waspada): Pergantian direksi Bank Sumut adalah mekanisme yang wajar dan sudah sesuai undang-undang serta anggaran dasar PT Bank Sumut. Demikian dikatakan Komisaris Utama PT Bank Sumut Dzaili Azwar kepada wartawan di Medan, Minggu (17/6), menyikapi pergantian jajaran direksi PT Bank Sumut, beberapa hari lalu. “Kami mengimbau kepada nasabah agar tidak perlu khawatir tentang pergantian jajaran direksi, karena ini adalah mekanisme yang wajar. Sesuai anggaran dasar PT Bank Sumut, pergantian kepengurusan dilakukan empat tahun sekali. Jadi ini merupakan hal yang lumrah, tidak perlu dicemaskan,” ujar Dzaili dan memohon dukungan dan doa masyarakat Sumut agar bank kebanggaan daerah tersebut dapat berkembang lebih baik pada masa mendatang. Sebelumnya, pimpinan BI pada RUPS tahunan tersebut mengajak Bank Sumut agar terus memperkuat modalnya sehingga tidak tergantung kepada pemegang saham. Salah satu cara adalah menjadikan Bank Sumut sebagai perusahaan terbuka dan melakukan ekspansi usaha, antara lain masuk dalam bank devisa. Lanjut ke hal A2 kol. 3

SAAT menyiapkan tulisan ini sebenarnya saya sedang sibuksibuknya mengepak barang di Bank Sumut. Bank yang telah memberikan banyak pelajaran untuk saya. Bank yang kini menjadi salah satu kebanggaan Sumatera Utara. Dan bank yang kemudian menyumbang PAD (pendapatan asli daerah) untuk para pemegang saham dalam hal ini Catatan pemerintah kabupaten dan kota. jalan hidup yang ditempuh Gus Irawan pastiDiBank Sumut adalah bagian dari sejarah hidup saya. Tak akan pernah lepas, lupa atau menjadikannya lembaran usang. Bank ini tetap akan ada di hati saya. Terutama para jajaran direktur, kepala divisi dan karyawan yang

Demokrat memperoleh 11,3 persen. “Demokrat terancam di bawah 10 persen, sementara semua partai papan tengah masing-masing di bawah 5 persen,” tutur Aji.

L. Batu Siap Menangkan H. Amri Tambunan


RAJA Arab Saudi Abdullah (kanan) dan adiknya Pangeran Salman tiba di Makkah menghadiri pemakaman Putra Mahkota Pangeran Nayef, Minggu (17/6).

Raja Abdullah Di Makkah Pimpin Upacara Pemakaman Putra Mahkota MAKKAH (Waspada): Pengasuh dua masjid suci Raja Abdullah bin Abdulaziz Al Saud saat ini berada di Makkah untuk memimpin upacara pemakaman Pangeran Mahkota Nayef, demikian Saudi Press Agency (SPA) memberitakan Minggu (17/6).

Jenazah Pangeran Nayef diperkirakan tiba Minggu di Jeddah dari Jenewa, di mana dia menjalani perawatan medis. Upacara pemakaman direncanakan Minggu sore di Makkah. Raja Abdullah tiba di kota suci dari Jeddah, Sabtu malam dan diterima di Istana Tamu

Pengurusan SIM Di Satlantas Polresta Medan Normal MEDAN (Waspada): Pelayanan pengurusan Surat Izin Mengemudi (SIM) di Satlantas Polresta Medan, pasca terbakarnya markas komando (Mako) Sat Lantas Polresta Medan beberapa hari, berjalan normal.Pada Senin (18/ 6), operasional tetap berjalan seperti biasa. Lanjut ke hal A2 kol. 2


DUA personil Reg Ident Sat Lantas Polresta Medan Bripka G Naibaho dan Brigadir Poltak Silalahi mempersiapkan peralatan untuk foto SIM baru dan perpanjangan.

oleh Pangeran Miteb bin Abdulaziz bersama para pejabat tinggi dan para pangeran Arab Saudi lainnya. SPA mengatakan di Bandara Jeddah,Raja ditemani Menteri Pertahanan Pangeran Lanjut ke hal A2 kol. 7

Pangeran Mahkota Nayef

LABUHAN BATU (Waspada): Semakin dekatnya pesta demokrasi di Sumatera Utara, membuat masyarakat mulai berpikir menentukan pilihan, siapa calon yang akan didukung untuk memimpin di provinsi paling besar di pulau Sumatera ini. H. Amri Tambunan sejak mendaftar di Partai Demokrat sebagai calon gubernur Sumut terus menerima dukungan dari berbagai lapisan masyarakat. Sahabat H. Amri Tambunan sewaktu menimba ilmu

1,8 Kg Emas Raib Dari Rumah Dua Warga Mantan Sekretaris DPRDSU Binjai Kritis MEDAN (Waspada): Kawanan penjahat berhasil membawa satu brandkas berisi uang kontan, emas seberat 1,8 Dibakar Warga Kg dan surat-surat berharga lainnya milik keluarga Ali Musa BINJAI (Waspada): Dua warga Kel. Suramai, Kec. Binjai Barat, Rusdianto alias Anto, 32, dan Fendi Barus, 21, penduduk Jl. Letnan Umar Baki, Kel. Suramai Kec. Binjai Barat, kritis setelah dibakar massa Minggu (17/6). Informasi Waspada peroleh, amuk massa terhadap kedua pemuda itu karena keduanya dicurigai akan melakukan aksi kejahatan di kampung mereka. Hal itu bermula pada Minggu(17/6) dinihari, ketika kedua korban dipergoki warga di belakang rumah seorang penduduk. ‘’ Ketika dipanggil, kedua pemuda itu malahan lari, Lanjut ke hal A2 kol. 4

ngan sebanyak 18,3 persen. Petinggi Gerindra Prabowo Subianto 18,0 persen dan Aburizal Bakrie (Ical) 17,5 persen. “Sementara kader Demokrat terancam hanya kuat sebagai Wapres,” ujarnya Minggu(17/6). Sementara itu, nama Prabowo Subianto muncul dari luar dominasi tiga partai besar Partai Golkar, PDI Perjuangan dan Partai Demokrat. Prabowo mengalahkan sejumlah nama baru yang disebut bakal meramaikan bursa Capres dan Cawapres. Seperti Wiranto, Hatta Rajasa, Surya Paloh, Mahfud MD, Dahlan Iskan dan Sri Mulyani. (m11/vvn)

Siregar (alm), mantan sekretaris DPRDSU di Kompleks Lanjut ke hal A2 kol. 4

kepamongan di Institut Ilmu Pemerintahan (IIP) Drs Kaharuddin bersama masyarakat Labuhanbatu menyampaikan dukungannya terhadap putra H. Djamaluddin Tambunan sebagai gubernur Sumut itu. Menurut alumni IIP ini, ia sudah mengenal bagaimana H. Amri Tambunan termasuk kemampuannya memimpin Kabupatena Deliserdang. “Saya temannya satu lesting di IIP, saya tahu bagaimana Lanjut ke hal A2 kol. 3

Ada-ada Saja Nasehat Perampok

ADA-ada saja ulah perampok asal negeri jiran ini. Setelah merampok, mereka sempat-sempatnya memberi nasehat kepada korbannya sebelum melarikan diri. Kepada koran lokal di Malaysia, korban menuturkan bahwa mereka dirampok dua Lanjut ke hal A2 kol. 2

Serampang Waspada/Ismanto Ismail

RUMAH mewah milik Ali Musa Siregar (alm) di Komplek Tasbi I, Blok SS No. 86, yang disatroni penjahat bersenjata golok dengan mengendarai mobil.

- Ada fulus bisa balik nomor 1 - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Pon, 18 Juni 2012/28 Rajab 1433 H z zNo: 23899 Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Waspada/Riswan Rika

KORBAN pembakaran warga.

Nilai UN SD Tertinggi Diperoleh Padangsidimpuan

Dua Warga Binjai Barat Kritis Dibakar Warga BINJAI (Waspada): Dua warga Kel. Suramai, Kec. Binjai Barat, Rusdianto alias Anto, 32, dan Fendi Barus, 21, penduduk Jl. Letnan Umar Baki, Kel. Suramai Kec. Binjai Barat, kritis setelah dibakar massa Minggu (17/6). Informasi Waspada peroleh, amuk massa terhadap kedua pemuda itu karena keduanya dicurigai akan melakukan aksi kejahatan di kampung mereka. Hal itu bermula pada Minggu(17/6) dinihari, ketika kedua korban dipergoki warga di belakang rumah seorang penduduk. ‘’Ketika dipanggil, kedua pemuda itu malahan lari, membuat warga curiga dan berteriak maling,’’ ujar sumber. Sejumlah warga yang sedang menyaksikan pertandingan piala Eropa, mendengar teriakan ada maling, dan berhamburan keluar, mengejar keduanya dan tertangkap. Ketika ditanya, keduanya mengaku polisi.Namun, tidak bisa menunjukkan KTA (kartu tanda anggota) sebagai polisi. ‘’ Hal itu membuat masa marah dan beringas. Dengan menyiramkan bensin, keduanya dibakar.Namun, salah seorangnya kabur ke parit dan bersembunyi di bawah got. Sedangkan Fendi, diselamatkan KeplingSuparno,’’ ujar sumber. Anggota Polsek Binjai Utara yang turun ke TKP membawa Fendi ke RSUD dr. Djoelham Binjai. Sedangkan,Anto yang bersembunyi, berhasil ditangkap dan dibawa ke RS yang sama. Kapolsek Binjai Utara AKP Widya Budi Hartati melalui Kanit Resintel AKP J.Pasaribu, mengatakan, kasusnya masih diselidiki. (a04)


EMAS PERAHU NAGA. Tim putra perahu naga Indonesia usai penyematan medali final nomor 500 meter Asian Beach Games ke-III di Danau Jiulong, Haiyang, China, Minggu (17/6). Tim putra Indonesia meraih medali emas dengan catatan waktu 1 menit 52,477 detik.

P.SIDIMPUAN ( Waspada): Nilai tertinggi Ujian Nasional (UN) setingkat Sekolah Dasar (SD) diperoleh alumni SD swasta di Kota Padangsidimpuan, Rani Elfrida Ramadhona dan Daffa Daifulli, kata Kepala Dinas Pendidikan Kota Padangsidimpuan, Drs H Abdul Rosad Lubis kepada Waspada, Minggu (17/6) sore. ‘’Keduanya tercatat mendapatkan nilai UN tertinggi se Sumatera Utara pada pengumuman Sabtu (16/6) kemarin. Nilai keduanya rata-rata 9.5,’’tutur Kadis melalui telefon. Menurut Kadis, seluruh peserta UN SD di Kota Padangsidimpuan 4504, mendapat kelulusan 100 persen. Sehingga nilai ujian SD di kota pelajar ini tetap bertahan seperti tahun lalu. ‘’Tahun 2011, nilai UN SD se Sumut ini diperoleh alumni salah satu SD swasta. Peringkat tahun lalu dengan sekarang tetap dipertahankan oleh salah satu SD swasta di kota pelajar ini dan didukung Dinas Pendidikan setempat,’’ujar Kadis yang pernah diundang Presiden Susilo Bambang Yudhoyono ke Istana Negara, Jakarta. ‘’Program pemerintah adalah mengentaskan buta huruf dan meningkatkan sumber daya manusia (SDM) di bidang pendidikan. Program tersebut selalu kami berdayakan dengan memberikan kesempatan kepada guru untuk memperoleh sertifikasi sesuai kemampuannya,’’ demikian Kadis.(c13)

PARTAI DEMOKRAT ANJLOK JAKARTA (Waspada): Hasil survei kembali menunjukkan menurunnya elektabilitas Partai Demokrat. Kali ini, survei Lingkaran Survei Indonesia (LSI) menunjukkan Partai besutan Susilo Bambang Yudhoyono itu anjlok ke peringkat tiga.

Hasil survei itu dipaparkan pada Minggu (17/6) di kantor LSI, Rawamangun, Jakarta Timur. “Survei LSI ini dilaksanakan pada 2 sampai 11 Juni 2012,” kata peneliti LSI, Aji Al Farabi. Kisruh internal dan terlibatnya sejumlah elit partai da-

lam kasus korupsi wisma atlet SEA Games dan proyek Hambalang menjadi faktor menurunnya tingkat keterpilihan Demokrat itu. Tingkat penurunan itu termasuk drastis. Survei itu menunjukkan Demokrat terancam hanya memperoleh suara

di bawah 10 persen dan akan menjadi partai papan tengah. Berdasar survei itu diketahui, jika pemilu legislatif dilakukan saat ini, Partai Golkar akan memperoleh 20,9 persen, PDIP 14,0 persen, sedangkan Demokrat memperoleh 11,3 persen. “Demokrat terancam

BMKG Serukan Hemat Air

di bawah 10 persen, sementara semua partai papan tengah masing-masing di bawah 5 persen,” tutur Aji. Menurut Aji, survei ini dilakukan dengan metode multistage random sampling dengan jumlah responden sebanyak 1.200. Margin of error

sebesar 2,9 persen. Dia menambahkan, survei ini menunjukkan Demokrat terus mengalami penurunan dukungan. “Partai Demokrat semakin menjauh dari perolehan suaranya pada Pemilu 2009. Terbukti, sejak Januari 2011

elektabilitasnya semakin menurun dengan 20,5 persen. Juni 2011 menjadi 15,5 persen. Oktober 2011 sebesar 16,5 persen. Januari 2012 sebesar 13,7 persen, dan Juni 2012 hanya 11,3 persen,” papar Aji. Lanjut ke hal A2 kol.3

Tiba Di Meksiko, SBY Didampingi Ibu Ani

Sumur Warga Di Lhokseumawe Menyusut

Bank Sumut SAAT menyiapkan tulisan ini sebenarnya saya sedang sibuksibuknya mengepak barang di Bank Sumut. Bank yang telah memberikan banyak pelajaran untuk saya. Bank yang kini menjadi salah satu kebanggaan Sumatera Utara. Dan bank yang kemudian menyumbang PAD (pendapatan asli daerah) untuk para pemegang saham dalam hal ini Catatan pemerintah kabupaten dan kota. Gus Irawan Di jalan hidup yang ditempuh pasti Bank Sumut adalah bagian dari sejarah hidup saya. Tak akan pernah lepas, lupa atau menjadikannya lembaran usang. Bank ini tetap akan ada di hati saya. Terutama para jajaran direktur, kepala divisi dan karyawan yang ‘memberikan cintanya’ sepenuh hati untuk kemajuan bank ini. Saya bukan ingin melankolis. Tapi selama 12 tahun Lanjut ke hal A2 kol. 2

Al Bayan

Dikyanus Pengkhianat Oleh: H Ameer Hamzah Hai Dikyanus kadong dilee Ka pateh kee saboh calitra Kapoh syeikh jeh di lee beumate Hareuta han le bagi dua (Suara Syeithan)

ALKISAH, seorang pemuda penganggur yang bernama Dikyanus bermimpi menemukan sumur harta Karun. Ia bermimpi berulang-ulang tentang sumur tersebut yang penuh dengan emas. Namun ia tidak tahu lokasi sumur tersebut. Lalu ia menjumpai seorang Syeikh (ulama) tua di Kota Damaskus untuk mencari kepastian. Sang Syeikh siap membantu Dikyanus asal saja ada bagian untuknya. Lanjut ke hal A2 kol.6

Waspada/Jaka Rasyid

SEJUMLAH Polisi terlihat mengamankan lokasi peribatan ilegal di Jln HT Daudsyah No 47 Peunayong Kota Banda Aceh, Minggu (17/6) .

Kebaktian Jamaat GBI Dibubarkan Massa BANDA ACEH (Waspada): Jamaat Geraja Bethel Indonesia (GBI) yang sedang melakukan kebaktian di sebuah ruko Jl. HT Daudsyah No 47, Peunayong ,Kota Banda Aceh dibubarkan massa, minggu(17/6) pagi. Aksi massa menilai kebaktian belum memiliki izin. Massa berjumlah puluhan orang dari Peunayong juga merusak sejumlah peralatan

LHOKSEUMAWE (Waspada ): Badan Meteorologi Klimatologi dan Geofisika ( BMKG ),Minggu (17/6) menyerukan masyarakat hemat penggunaan air bersih, menyusul air sumur di Kec. Muara Dua, Kota Lhokseumawe menyusut ke dasar secara drastis. Masyarakat di kawasan Kec. Muara Dua mulai panik menghadapi musim panas yang menyebabkan menyusutnya air sumur. Sebagaimana dialami warga Meunasah Asan Kandang, mata air sumur mereka semakin menyusut dan nyaris kering. Salah seorang warga Meunasah Blang Hajimah membenarkan, dalam satu pekan ini air di dalam sumur warga setempat menyusut, mungkin faktor musim panas yang sedang terjadi. Lanjut ke hal A2 kol.6

Warga Langkat Dianiaya Tiga Pria Mengaku Dari Poldasu P.BRANDAN (Waspada): Tiga pria mengaku dari Polda Sumut menganiaya seorang warga Dusun Pasar XX, Desa Securai Selatan, Kec. Babalan, Langkat, Minggu (17/6) sore. Seorang pelaku menodongkan pistol ke rongga mulut korban. Perbuatan itu dilakukan para pelaku setelah mereka memaksa korban untuk menunjukkan rumah seseorang yang mereka cari. Menurut Kades, Yulial Fahri, korban, Abdul Wahid, 47, bersama pria bersenjata ini ada terdapat seorang warga Medan berinisial, dr. JRK. Korban ditodong, tubuhnya diinjak-injak dan lehernya dicekik.Sedangkan, jam tangan berikut sebuah handphone dirampas pelaku secara paksa. Lanjut ke hal A2 kol.1

Lanjut ke hal A2 kol.1

Bayi Orangutan Sumatera Selamat Dari Perdagangan BANDAACEH ( Waspada): Tim terdiri dari staf Program Konservasi Orangutan Sumatera (SOCP), bersama Polsek Babahrot dan Polres Abdya, Sabtu (16/6), menyita seekor bayi orangutan jantan dari masyarakat Babahrot, Aceh Barat Daya. Menurut Direktur Konservasi SOCP, Dr. Singleton, bayi orangutan itu hendak dijual kepada anggota tim investigasi. “Penyelamatan hari ini merupakan kesuksesan hasil kolaborasi polisi dan berbagai institusi yang terlibat. Bayi orangutan ini merupakan salah satu yang beruntung, dan bagi kami ini penyelamatan kedua di Tripa dalam 48 jam terakhir” terangnya melalui rilis yang d i k i r i m k e Wa s p a d a , Minggu (17/6).

Labuhanbatu Siap Menangkan H. Amri Tambunan Jadi Gubsu LABUHAN BATU (Waspada): Semakin dekatnya pesta demokrasi di Sumatera Utara, membuat masyarakat mulai berpikir menentukan pilihan, siapa calon yang akan didukung untuk memimpin di provinsi paling besar di pulau Sumatera ini. H. Amri Tambunan

sejak mendaftar di Partai Demokrat sebagai calon gubernur Sumut terus menerima dukungan dari berbagai lapisan masyarakat. Sahabat H. Amri Tambunan sewaktu menimba ilmu kepamongan di Institut Ilmu Pemerintahan (IIP) Drs Kaha-

Lanjut ke hal A2 kol.3

Tiki-taka Melawan Kuda Hitam Balkan Nasehat Analisis Sarman Panggabean

versi hutan menjadi perkebunan sawit yang masih terus berlangsung hingga saat ini. Lanjut ke hal A2 kol.3

Lanjut ke hal A2 kol.6

Waspada/Gito Rolies

ruddin bersama masyarakat Labuhanbatu menyampaikan dukungannya terhadap putra H. Djamaluddin Tambunan sebagai gubernur Sumut itu. Menurut alumni IIP ini, ia sudah mengenal bagaimana

Ada-ada Saja

SETELAH puas mempermainkan Irlandia kemudian menang 4-0, dinihari nanti Andres Iniesta dan kawankawan akan menghadapi kuda hitam dari Balkan, Kroasia, yang masih bermain konvensional. Formasi klasik 4-4-2 yang diterapkan pelatih Slaven Bilic juga dimainkan dengan sederhana. Tetapi diaktifkannya Ivan Rakitic dan Darijo Srna, gelandang yang selalu melakukan gerakan bayangan ke arah sayap, membuat dua ujung tombak mendapat bantuan penuh bola-bola matang dari pinggir garis lapangan pertahanan lawan. Gelandang menyerang Kroasia sebagai pengatur tempo permainan adalah Luka Modric, bintang klub Tottenham Hotspur. Dia selalu menjamin tersedianya umpanumpan matang yang siap dijebolkan ke gawang lawan. Modric telah membuktikan bagaimana mendobrak ketatnya pertahanan Italia. Melalui otak Modric pula, Kroasia membuktikan mampu menjebol gawang Italia, yang biasanya sangat payah dilakukan. Data penyerangan yang dihasilkan oleh Kroasia selama babak kualifikasi Euro 2012 menunjukkan bagaimana garansi serangan mereka. Latvia, Malta, Israel serta Turki, mereka kalahkan semuanya dengan membobolkan tiga gol. Jadi kuda hitam Kroasia dari kawasan Balkan jangan dianggap enteng.

TIM Staf Program Konservasi Orangutan Sumatera (SOCP), sedang menggendong seekor bayi orangutan jantan. Ia menyebutkan, pada tahun 1990 terdapat hampir 2.000 orangutan di rawa gambut Tripa, dan sekarang mungkin hanya tersisa sekitar 200 ekor, dikarenakan oleh kon-

Biro Pers Istana Presiden

IBU Negara Ani Yudhoyono tampak mendampingi Presiden Susilo Bambang Yudhoyono saat tiba Los Cabos, Meksiko, Sabtu waktu setempat atau Minggu (17/6) subuh waktu Jakarta. Mengenakan baju biru, Ibu Negara tampak sehat dan bugar. Ani Yudhoyono sudah menjalani operasi saraf di Allegheny General Hospital, Pittsburgh, Pennsylvania, Amerika Serikat, Jumat malam waktu Jakarta. Presiden SBY yang lepas landas dari Jakarta, Jumat (15/6), langsung ke Amerika Serikat untuk menjemput Ibu Negara.


ADA-ADA saja ulah perampok asal negeri jiran ini. Setelah merampok, mereka sempat-sempatnya memberi nasehat kepada korbannya sebelum melarikan diri. Kepada koran lokal di Malaysia, korban menuturkan bahwa mereka dirampok dua orang remaja di rumahnya di Alor Gajah. Para perampok berhasil menggondol sejumlah uang, dua ponsel dan sebuah alat pemotong rumput. Lanjut ke hal A2 kol.1

Serampang - Ada fulus bisa balek no.1 - He.... he....he....

Berita Utama


Tor-tor Dan Gordang Sambilan Diklaim Malaysia MEDAN (Waspada): Setelah mengklaim beberapa budaya Indonesia, kini Malaysia mengklaim kebudayaan asli Indonesia, tor-tor dan Gordang Sambilan sebagai peninggalan nasional mereka. Di Indonesia, dua kesenian itu dikenal sebagai kebudayaan masyarakat Batak, Sumatera Utara. Bahkan, tari Tor-tor selalu ditarikan dalam upacara adat masyarakat Batak. Namun kini, Malaysia dengan berani akan meregistrasi kebudayaan itu berdasarkan Bab 67 Undang-undang Peninggalan Nasional 2005. “Pertunjukan periodik harus diadakan. Artinya, tarian harus disajikan sementara irama gendang harus dimainkan di depan publik,” kata Menteri Informasi, Komunikasi, dan Kebudayaan Malaysia, Datuk

Seri Rais Yatim sebagaimana dikutip laman Bernama. Menurut Rais, mempromosikan kebudayaan dan seni Mandailing sangat penting, sebab bisa mengungkap asalusulnya. Selain itu bisa mempererat persatuan dan kesatuan dengan masyarakat lainnya. Sejalan dengan konsep Malaysia, upaya masyarakat Mandailing untuk mengangkat seni dan budaya mereka telah didukung oleh kementerian untuk diakui dan dikenalkan ke publik Malaysia. Sebelumnya, Malaysia pernah mengklaim sejumlah kesenian asal Indonesia sebagai milik mereka. Malaysia pernah menampilkan tari Pendet asal Bali dalam video iklan ‘Enigmatic Malaysia’ di Discovery Channel. Aksi ini memancing reaksi

Warga... Abdul Wahid, kata Fahri, dianiaya dan dipaksa pelaku untuk menunjukkan rumah, Azar, warga Dusun Paluhsipat, Desa Telukmeku, Kec. Babalan. Setelah bertemu orang yang mereka cari, pria bersenjata itu mengancam akan menembak, namun aksi pria yang mengaku dari Poldasu itu mendapat perlawanan. “Coba tembak kalau kalian berani,” kata Kades menirukan ucapan Azwar. Menuurut Farhi, pelaku meninggalkan lokasi kejadian setelah Azwar, mengambil sebilah parang dan berupaya mengejar pelaku. Ada dugaan, pria bersenjata itu orang bayaran untuk mengintimidasi warga. Informasi Waspada diperoleh, penganiayaan dan pengancaman dari orang bersenjata api ini disebut-sebut dipicu konflik tanah. Namun, Fahri menegaskan, dr. JRK, tidak memiliki tanah di desanya. “Kalau dahulu sang dokter itu ada memiliki tanah di daerah saya, tapi tanah tersebut sudah dijualnya,” terang Kades. “Saya pernah melayangkan undangan kepada orangtua JRK, untuk meminta penjelasan seputar klaim atas tanah mereka, namun yang bersangkutan tidak mau hadir. Kalau ia merasa ada memiliki tanah di Desa Securai Selatan, silahkan bawa bukti-bukti yang otentik,” kata Fahri. Kades menyatakan, kasus itu segera dilaporkan kepada aparat penegak hukum. Beberapa saksi telah siap memberikan kesaksiannya. Kapolsek P.Brandan, AKP. HM. Kosim Sihombing yang dikonfirmasi Waspada menjelaskan, pihaknya sedang berupaya mengecek kebenaran tentang peritiwa ini. “Saat ini anggota sudah turun dan mereka lagi mengecek lokasi tempat kejadian perkara (TKP),” ujarnya. Kapolsek siap menerima pengaduan warga.(a02)

Kebaktian... seperti sound system dan memecahkan kaca pintu ruko. Polisi yang turun ke TKP segera mengaman Pendeta Niko Tarigan dan para jamaat serta lokasi peribatan yang berhadapan dengan SMPN 9 Banda Aceh. Menurut seorang warga, peribatan di lokasi tersebut sudah berlangsung awal April lalu. Sebelumnya aktivitas peribatan jamaat GBI dilakukan di sebuah ruko di sekitar Pasar Sayur Peunayong, 200 meter dari lokosi saat ini. Kapolresta Banda Aceh, Kombes Pol Moffan di lokasi kejadian menyebutkan, terjadi peristiwa itu karena warga , sebab mereka belum ada izin. “Cuma soal izin saja, sebelumnya di tempat lain tidak masalah,” kata Moffan. Sementara itu seorang umat kristiani di lokasi kejadian menyebutkan beberapa jamaat GBI telah diperingatkan untuk tidak melakukan aktivitas peribatan sebelum ada izin. Namun peringatan itu menurutnya diabaikan. ‘’Kami tidak menyalahkan pembubaran tersebut karena menyalahi memang melanggar aturan SKB 3 Menteri, sudah ada yang menyampaikan tapi tidak didengar,” kata Hendra.(b08)

Ada-ada Saja... Pensiunan guru bernama Mohammed Amin Ismail, 74, menceritakan kejadian itu kepada Harian Metro, bahwa sebelum kabur perampok itu ‘menasehatinya’ untuk tidak tinggal sendirian. “Sebelum mereka kabur, satu dari perampok ini mengatakan kepada kami bahwa kami harusnya tinggal bersama anak-anak kami, ujar Amin. Dalam insiden itu, Amin mengalami luka terkena parang saat perampokan terjadi Kamis dinihari waktu setempat. Amin mengatakan para perampok mengarahkan parang Jawaban Problem Catur, ke lehernya dan kemudian mengikat tangannya.(st/rzl) TTS Dan Sudoku

Dari Halaman Sport.

Bank Sumut...

Jawaban Problem Catur: 1. ...., Gh4+. 2. Kg3, GxK+. 3. Rg2, MxG+ atau Me2+. 4. Rg1, Mf2+. 5. Rh1, Mh2+mat.

Jawaban TTS: TTS Topik

Umum Serba “Pos”

Jawaban Sudoku: 2 9 3 5 4 8 1 6 7

1 8 6 3 9 7 2 5 4

5 4 7 1 2 6 9 3 8

6 1 8 2 7 3 4 9 5

3 7 4 6 5 9 8 2 1

9 5 2 8 1 4 6 7 3

8 6 1 7 3 2 5 4 9

7 2 9 4 8 5 3 1 6

4 3 5 9 6 1 7 8 2

atau tiga periode, bank ini telah menjelma dan disegani hingga tingkat nasional. Saya masih ingat ketika Dirut Bank Mandiri Agus Martowadojo [sekarang Menteri Keuangan] beberapa tahun lalu menjadi the best CEO bank BUMN, maka saya juga terpilih menjadi the best CEO BUMD. Kala bank besar lain mampu memperoleh penghargaan dengan servis terbaik maka Bank Sumut pun mampu memperoleh apresiasi yang sama untuk bank daerah. Di penghujung masa jabatan terutama sebulan terakhir, saya memang fokus memberikan perhatian lebih untuk menyelesaikan semua tugas. Mohon maaf kepada berbagai pihak, berbagai kalangan, pejabat pemerintah, organisasi kemasyarakat juga adik-adik mahasiswa yang tak bisa saya penuhi undangannya. Baik itu menjadi narasumber atau undangan diskusi. Saya benar-benar ingin mengakhiri tugas di Bank Sumut dengan totalitas seperti layaknya memulai tugas dulu saat terpilih menjadi direktur utama. Sepeninggal saya, bank ini sudah memiliki nama. Karyawan sudah bangga menggunakan tagname, mau menempel stiker Bank Sumut di mobilnya. Padahal dulu di awal-awal saya menjadi direktur utama, para karyawan tidak seperti itu. Mereka malah banyak yang mau keluar dari Bank Sumut. Bayangkan saja saat diberi kepercayaan memimpin Bank Sumut saya harus memulihkan

keras dari masyarakat Indonesia. Bahkan, Presiden Susilo Bambang Yudhoyono saat itu sempat marah atas klaim itu. Budayawan Malaysia juga menyesalkan klaim ini. Namun, Malaysia berkilah iklan pariwisata itu yang membuat bukan negaranya, melainkan pihak Discovery Channel. Selain tari Pendet, Malaysia pernah mengklaim tari Reog asal Ponorogo, Jawa Timur dan sejumlah kebudayaan Indonesia lainnya. Berlebihan Sementara itu, Wakil Ketua DPRD Sumut Chaidir Ritonga, Minggu (17/6), mengatakan klaim Malaysia itu berlebihan. Kalau secara fisik yang dimaksud Malaysia, Tor-tor dan Gor-

dang Sembilan itu sama dengan yang kita miliki di sini, maka pemerintah Indonesia harus protes. Disebutkan Chaidir Ritoga, sudah berulang kali Malaysia, mengeluarkan pernyataan yang membuat kita tersinggung. Dia mencurigai, itu dilakukan hanya untuk memancing-mancing emosi masyarakat Indonesia saja. Sebagai saudara serumpun, sikap itu menunjukkan rasa tidak menghargai sama sekali. Pemerintah Indonesia, kata Chaidir Ritonga, harus cepatcepat untuk meminta klarifikasi pihak Malaysia terhadap masalah Tor-tor dan Gordang Sambilan ini, sebelum masyarakat Indonesia marah. Ini hal yang sudah sekian kalinya dila-

kukan Malaysia terhadap kebudayaan Indonesia. Secara fisik, kata Chaidir Ritonga, Tor-tor dan Gordang Sambilan yang dimiliki Indonesia sangat khas. Walaupun terdapat perbedaan pada setiap marga di Tapanuli Selatan (Tapsel), namun secara umum, Tor-tor dan Gordang Sambilan itu sama pada setiap marga. Yang membedakan hanya detail tarian atau irama gendangnya saja. ‘’Jadi, kalau yang dimaksud Malaysia itu adalah Tor-tor dan Gordang Sambilan yang kita punya, pemerintah harus cepat-cepat protes. Bisa juga yang mereka (Malaysia) maksud itu lain, baik perangkat maupun geraknya,’’ kata Chaidir Ritonga. (m12)


keluarga pamong, jadi saya siap ikut memenangkan Pak Amri Tambunan, karena kami yakin dengan kemampuannya layak memimpin Sumut,” tandasnya. Senada dengan sahabat Amri Tambunan semasa di IIP tersebut HT Mahyuddin selaku pejuang dan tokoh masyarakat di Labuhanbatu ikut menyatakan dukungannya, menurutnya sebagai keluarga pejuang selayaknya ia siap memenangkan H. Amri Tambunan yang telah mendaftar di Partai Demokrat sebagai gubernur Sumut priode 20132018 mendatang. “Yang hadir di sini tidak hanya masyarakat Labuhanbatu saja, dari Labura, pensiunan TNI, tukang bangunan, PNS juga pengusaha siap memenangkan H. Amri Tambunan, karena kami sadar betul siapa Amri Tambunan, apalagi dalam hal kemampuannya memimpin,” ungkapnya. Orangtua Amri Tambunan,

yakni Djamaludin Tambunan lanjut HT Mahyuddin, sudah berjasa bagi kabupaten Labuhanbatu khususnya, Aslab umumnya. “Sebagai bupati pertama di Asahan Labuhanbatu (Aslab) H Djamaludin Tambunan begitu berjasa bagi daerah kami sehingga seperti sekarang ini. Makanya, kami sebagai masyarakat Labuhanbatu harus ikut mendukung apa yang dicita-citakannya,” ujar HT Mahyuddin yang juga diaminkan Ir. Lukman Harahap salah satu pengusaha bunga di daerah tersebut. Seusai acara silaturrahim masyarakat Padang Matinggi Labuhanbatu, warga yang di antaranya para alim ulama hadir dalam pertemuan tersebut mulai menjadwalkan pertemuan selanjutnya untuk mensosialisasikan H. Amri Tambunan kepada masyarakat. “Ini keluarga besar kita juga,” tandas Samsudin. (m13)

Pemilu 2014 mendatang. Pertanyaanya, jika Pemilu Presiden dilaksanakan hari ini, sebanyak 1200 responden menjawab hanya ada tiga nama yang menjadi kandidat terkuat. “Capres divisi utama saat ini adalah pertarungan tiga tokoh saja, yakni Megawati, Prabowo dan Aburizal Bakrie,” kata Adjie Alfarabi. Margin of error survei ini adalah 2,9 persen. Dari survei yang dilaksanakan pada 2 Juni sampai 11 Juni 2012, nama Megawati Soekarnoputri memperoleh dukungan sebanyak 18,3 persen. Petinggi Gerindra Prabowo Subianto 18,0 persen dan Aburizal Bakrie (Ical) 17,5 persen. “Sementara

kader Demokrat terancam hanya kuat sebagai Wapres,” ujarnya. Sementara itu, nama Prabowo Subianto muncul dari luar dominasi tiga partai besar Partai Golkar, PDI Perjuangan dan Partai Demokrat. Prabowo mengalahkan sejumlah nama baru yang disebut bakal meramaikan bursa capres dan cawapres. Seperti Wiranto, Hatta Rajasa, Surya Paloh, Mahfud MD, Dahlan Iskan dan Sri Mulyani. “Dari sejumlah tokoh ini Prabowo memperoleh dukungan sebanyak 23,9 persen. Artinya Prabowo memimpin kekuatan poros tengah,” terangnya. (vvn)

Foto yang diperoleh dari satelit menunjukkan dalam enam bulan terakhir telah terjadi konversi lebih dari 1500 hektare. “Tim lapangan kami melaporkan, pembakaran lahan dan aktivitas ilegal di perkebunan sawit masih terus berlangsung walaupun tim penyidik dari pemerintah pusat telah turun untuk menyelidiki kegiatan ilegal,” sebutnya. Penyelamatan orangutan pada Sabtu ini merupakan penyelamatan kedua di Tripa, hanya berselang sehari dari pe-

nyelamatan seekor orangutan jantan remaja yang direlokasi karena daerah tinggal nya hampir habis dibersihkan untuk perkebunan kelapa sawit. Nurdin dari BKSDA mengatakan, orangutan merupakan satwa langka dilindungi yang seharusnya tidak ditangkap, dijadikan hewan peliharaan maupun diperdagangkan. Sementara, Kapolres Abdya AKBP Eko Budi mengaku senang atas keberhasilan dan hasil dari operasi ini, “Satwa liar dan habitatnya saling terikat, dan masyarakat tidak seharusnya merusak lingkungannya. Dari

sisi hukum hal melanggar hukum dan jika masyarakat merusak alam, masyarakat sendiri lah yang akan terkena dampak dari kerusakan lingkungan,” terang kapolres. Fa r w i z a d a r i B P K E L memberikan apresiasi terhadap penyelamatan orangutan. “ Untuk memberikan solusi terbaik bagi orangutan, masyarakat, dan lingkungan maka UndangUndang tata ruang No 26/20007 harus dijalankan, dan Tripa harus direhabilitasi karena merupakan bagian penting dari ekosistem Leuser,” demikian Farwiza. (cb01)

kondisi yang sangat buruk. NPL (kredit bermasalah) di tahun 2000 itu mencapai 83 persen dan CAR (rasio kecukupan modal/capital adequacy ratio) terperosok ke minus 34 persen dengan kerugian Rp300 miliar, padahal modal saja saat itu hanya Rp60 miliar.Tahun 2000, aset Bank Sumut baru Rp1 triliun dengan jumlah kantor 30 unit. Ini beban sangat berat bagi seorang bankir. Sebenarnya bukan karyawan saja waktu itu yang ingin keluar dari Bank Sumut. Saya juga sempat kecut. Di awal-awal menjadi pemimpin Bank Sumut banyak sekali isu beredar. Bank ini bakal ditutup karena kondisinya sekarat. Informasi itu saya peroleh dari pusat. Kondisi yang begitu berat membuat saya juga sempat berfikir lain. Saya ini lulusan akuntan. Ketika sudah di Bank Sumut saya beberapa kali pergi ke Aceh untuk menyelesaikan sertifikasi akuntan saya. Seperti itulah gambaran kegamangan dan beratnya bekerja di Bank Sumut. Seperti esok akan kiamat. Namun karena kemudian ada program rekapitalisasi perbankan dari pemerintah saya dan tim kemudian bekerja keras untuk menyelamatkan aset Sumut ini. Walau berat tapi kredit macet yang menyelimuti Bank Sumut perlahan-lahan saya bersihkan. Di tengah kepemimpinan tentu saja ada yang suka dan tidak suka. Tapi kerja keras terbukti memberikan hasil. Tentu saja karena ada ‘invisible hand’ (tangan Tuhan) yang ikut campur hingga Bank Sumut bisa seperti sekarang.

Tanpa kuasa Tuhan saya yakin membalikkan bank dari minus ke sekarang menghasilkan laba adalah mustahil. Ketika bertemu dengan para karyawan, selalu saya motivasi mereka sekarang agar terus bekerja keras dan jangan lupa ibadah. Sebab itulah salah satu yang membuat Bank Sumut seperti sekarang. Apalagi kalau melihat penghargaan yang diterima bank ini. Rasa syukur yang luar biasa. Begitupula ketika laporan pertanggungjawaban saya diterima para pemegang saham, pun sangat saya syukuri. Setelah tak lagi menjadi direktur utama di bank kebanggaan ini pasti akan ada regenerasi. Saat berjumpa dengan karyawan saya selalu katakan sudah cukup masanya harus keluar dari singgasana ini. Untuk memberi kesempatan kepada mereka yang berhak menduduki jabatan direksi. Paling tidak di Bank Sumut saat ini ada banyak kader yang mampu memimpin dilihat dari golongan jabatan. Baik itu setingkat pemimpin divisi atau juga kepala cabang. Bank Sumut bukan sedang krisis sumber daya manusia. Kalau saya kemudian bertahan terlalu lama pasti akan menutup pintu bagi mereka untuk maju. Di 2008, pun sebenarnya saya sudah utarakan untuk mundur, tapi waktu itu pemegang saham meminta untuk kembali memimpin. Jadi sekarang regenerasi itu harus berjalan. Bukan hanya itu, tahun ini setidaknya Bank Sumut juga akan menjadi bank devisa. Bank yang akan mengakomodasi kebutuhan

eksportir dan importir di Sumatera Utara. Untuk bank devisa hanya tinggal menunggu izin dari Bank Indonesia. Layanan yang nantinya disediakan Bank Sumut meliputi bank notes (layanan penukaran mata uang), penyaluran kredit valuta asing, layanan pengiriman uang (remittance), letter of credit (L/C), pembukaan rekening simpanan tabungan, deposito dan giro dalam bentuk valuta asing, layanan bank garansi dalam bentuk valuta asing dan transaksi perbankan yang berkaitan dengan ekspor impor. Jika situasi memungkinkan tahun ini bahkan harus ada initial public offering (IPO) atau melepas saham di Bursa Efek Indonesia (BEI). Tujuan jangka panjang adalah menjadi regional champion pada 2014. Cetak biru regional champion BPD yang terdiri dari tiga pilar, yaitu, pertama, ketahanan kelembagaan yang kuat. Kedua, kemampuan sebagai agen pembangunan daerah. Peningkatan fungsi intermediasi BPD kepada sektor riil yang produktif harus menjadi fokus. Ketiga, kemampuan melayani kebutuhan masyarakat. Semoga itu bisa tercapai. Pada akhirnya saya berharap bank ini tetap menjadi kebanggaan masyarakat Sumatera Utara. Semua cita-cita tercapai ke arah yang lebih baik. Saya harusberterimakasihkepadasemua fihak,seluruhkaryawanyangtelah mau bekerjasama, guyub (padu) dan memberikan bakti sehingga bank ini kelak meningkatkan kapasitasnya untuk bersaing di level mana pun.*

H. Amri Tambunan termasuk kemampuannya memimpin Kabupatena Deliserdang. “Saya temannya satu lesting di IIP, saya tahu bagaimana kemampuannya dalam memimpin, kepamongannya sudah teruji, Pak Amri tidak saya ragukan dia layak memimpin Sumut,” ujar tokoh masyarakat Labuhanbatu tersebut kepada wartawan di sela-sela acara silaturrahmi masyarakat Padang Matinggi, Kabupaten Labuhanbatu, kemarin, di rumah salah satu veteran HT Mahyuddin Jalan Sado, Padang Matinggi. Alumni IIP yang sudah pensiun di Pemkab Labuhanbatu ini menyatakan, ia bersama masyarakat tidak hanya mendukung malah siap memenangkan Bupati Deliserdang yang bergelar Datuk Utama Wirawangsa tersebut menjadi Gubernur Sumut. “Kami

Partai... Sementara itu, lanjut dia, survei ini sekaligus menegaskan Partai Golkar untuk pertama kalinya memperoleh dukungan di atas 20 persen. Terbukti sejak survei yang dilakukan pada Januari 2011, Golkar memperoleh dukungan sebanyak 13,5 persen. Juni 2011 memperoleh 17,9 persen, Oktober 2011 sekitar 18,2 persen, Januari 2012 sebesar18,9 persen, dan Juni 2012 sebesar 20,9 persen. Mega, Prabowo Dan Ical LSI merilis hasil survei nasional terhadap dukungan calon presiden dan wakil presiden di


WASPADA Senin 18 Juni 2012

Akhir Juni, Golkar Tetapkan Calon Presiden JAKARTA(Waspada):Wakil Sekjen Partai Golkar, Lalu Mara Satriawangsa, menyatakan Partai Golkar akan menetapkan calon presiden akhir bulan ini. “Penetapan Capres Golkar akan dilakukan dalam Rapat Pimpinan Nasional tanggal 29 Juni 2012,” kata Lalu Mara kepada pers, Sabtu (16 /6). Mayoritas pengurus Partai Golkar sendiri telah lama mengisyaratkan akan bulat mengusung nama Ketua Umum Golkar Aburizal Bakrie sebagai capres. Ketua Dewan Pertimbangan Partai Golkar, Akbar Tandjung, misalnya beberapa waktu lalu mengatakan seluruh elemen Partai Golkar tampak sudah bulat mendukung Aburizal. “Rapimnas yang akan mengukuhkannya nanti. Jadi tunggu saja Rapimnas besok. Itu yang menjadi pegangan keabsahan Aburizal jadi Capres,” kata Akbar. Bakal mulusnya langkah Aburizal menjadi capres Gol-

kar sudah terlihat ketika Mei lalu 33 Dewan Pimpinan Daerah Tingkat I Golkar se-Indonesia berkumpul di Yogyakarta untuk menggelar rapat konsolidasi guna memenangkan Aburizal menjadi Capres. “Sikap politik kami adalah merekomendasikan Aburizal Bakrie maju menjadi capres Golkar 2014,” kata Marsiyono, Ketua DPD II Golkar Gunungkidul, Yogyakarta. Sebagai simbol dukungan bagi Aburizal, DPD Golkar se-Indonesia bahkan menandatangani lukisan prasasti bergambar ‘Ical for President.’ Cawapres Menyusul Sementara terkait DPD Golkar DIY yang mengusulkan Sri Sultan Hamengku Bowono X sebagai calon wakil presiden mendampingi Aburizal, Dewan Pimpinan Pusat Golkar mengatakan akan mempertimbangkan saran itu. “Semua aspirasi dan usul Cawapres yang masuk dipertimbangkan. Namun meka-

nisme pemilihan cawapresnya seperti apa, itu baru akan diputuskan di Rapimnas nanti,” terang Lalu Mara. Menurutnya, ada dua kemungkinan model penjaringan cawapres di Golkar. Pertama, kata lalu Mara, hak memilih Cawapres bisa diberikan kepada Capres Golkar yang nanti ditetapkan dalam Rapimnas. Kedua, Cawapres dipilih berdasarkan sejumlah kriteria yang nantinya ditetapkan di Rapimnas. DPD Golkar DIY memandang Sultan tepat mendampingi Aburizal dilihat dari faktor kesukuan dan jiwa negarawan yang ia miliki. “Pendamping Ical akan dicari dari Jawa, dan sosok Sultan ini jelas berasal dari Jawa. Ia pun punya filosofi kenegarawanan,” ujar Ketua DPD Golkar DIY Gandung Pardiman. I s u k e s u k u a n Ja w a nonJawa selama ini menjadi pertimbangan dalam setiap Pemilihan Presiden. (vvn)


ini air di sumur kami hanya tinggal setengah cincin dan masih bisa dipergunakan untuk seadanya,”ujarnya. Hal serupa dialami Maryam warga di desa yang sama, juga mengaku kondisi air dalam sumurnya nyaris kering. “Kalau begini kondisi saya merasa khawatir terjadi kekeringan tanpa air. Apalagi cuaca sekarang buruk dan tidak menentu perubahannya,” tutur Maryam. Sementara itu, petugas BMKG Banda Aceh Jaya Maratua Sinaga yang dihubungi Waspada mengatakan menyusutnya mata air sumur dipe-

ngaruhi faktor cuaca musim panas yang semakiin tinggi. Dalam dua hari ini saja, suhu naik antara 35 derajat celcius atau 37 derajat celcius. “ Kita imbau warga untuk hemat air dan gunakan seperlunya saja,” katanya dan menambahkan, dampak buruk lain yang bisa ditimbulkan pada manusia dan makhluk hidup adalah dehidrasi atau kekurangan cairan dan gerah. Tetapi, katanya, masyarakat tidak perlu cemas, karena siatuasi pancaroba sebentar lagi atau memasuki Juli terjadi musim penghujan. (b16)

sebagai pemain utama, langsung mencetak dua gol yang sangat meyakinkan ke gawang Irlandia. Torres senjata penuntas, setelah Iniesta – Fabregas – Xavi begitu asyik menjalankan irama permainan Matador, yang tanpa terasa menghanyutkan pertahanan lawanlawannya. Tapi menurut dugaan saya, Kroasia tetap akan memberikan perlawanan yang sangat keras. Untuk menjebol gawang Spanyol dari serangan balik yang sangat cepat adalah sangat mungkin, karena poros halang Carles Puyol cedera dan tidak ikut ke PolandiaUkraina. Saya akan membayangkan permainan tiki-taka yang dimainkan sejak dari sektor pertahanan, mengalir ke tengah dan tiba-tiba menusuk ke jantung pertahanan Kroasia. Itu akan membuat pertandi-

ngan malam nanti menjadi sangat kontras. Saya juga memprediksikan seluruh lini pertahanan ditambah dengan gelandang akan merupakan palang pintu Kroasia yang sangat berat untuk dilalui oleh para pemain Spanyol. Mengingat kedisiplinan tinggi yang dilatihkan Slaven Bilic, kemungkinan besar Spanyol akan sangat sulit mencetak gol. Apalagi, para pemain Kroasia rata-rata bandel dan berjiwa pejuang. Serangan balik dari Kroasia justru sangat berbahaya, karena bagaimanapun juga telah terbukti bahwa mereka mempunyai penyerang yang sangat produktif mencetak gol. Hanya serangan balik itu harapan mereka, sebab tiki-taka milik Iniesta dkk akan menguasai jalannya laga. Tentu saja setelah menguasai permainan Spanyol akan memenangkan pertandingan...?

ingin kusampaikan satu ide. Bunuhlah Syeikh itu, supaya harta tersebut menjadi milikmu semuanya,”. Dikyanus langsung melaksanakan tugasnya. Syeikh yang alim itu dibunuh dengan alat tajam, mayatnya dibuang dalam jurang. Tak ada yang tahu, kecuali dia sendiri. Kemudian dengan harta karun itu dia menjadi orang yang paling kaya raya. Pengikutnya semakin banyak, ia menyogok rakyat, (money politics) dan memperluas pengaruhnya. Selanjutnya dia menjadi Raja yang paling kejam dan sangat berkuasa. Raja zalim ini kemudian mengangkat dirinya menjadi Tuhan yang wajib disembah oleh manusia. Tujuh pemuda (Aulia Tujoh) yang beriman, kemudian meninggalkan kota dan uzlah ke sebuah gua yang dalam

Alwuran disebut Gua Kaffi. Mereka uzlah karena tidak mau menyembah manusia zalim dan pengkhianat Dikyanus. Tiga abad kemudian, tujuh pemuda ditakdirkan Allah hidup kembali. Mereka pulang ke kota! Ternyata era telah berubah. Raja Dikyanus sudah lama mati. Kini negeri itu dikuasai Raja Abdurrahman yang beriman dan bertaqwa. Dikyanus si zalim pengkhianat tak mampu menjaga harta yang sangat banyak itu. Akhirnya hartanya itu menyesatkannya. Dia lupa, harta hanya titipan dari Allah kepadanya sebagai ujian. Saat kezalimannya memuncak, Allah menghancurkannya dengan datang banjir besar. Istana, harta danpengikutnyayangsudahsesat itumusnahsemuanya.Kemudian Allahmenggantikangenerasibaru yang lebih baik.

Dikatakan, persediaan air dalam sumur rumahnya hanya tinggal setengah cincin dari biasanya mencapai tiga cincin. Menyusutnya air seperti ini merupakan fenomena alam yang baru pertama kali terjadi di daerahnya. Hajimah mengatakan pada umumnya kedalaman sumur di kawasan tempatnya tinggal mencapai dua meter lebih atau 25 cincin. Daerah setempat merupakan kawasan karang. “Sudah dua hari lalu air di tempat kami berkurang, saat

Tiki-taka... Irlandia juga dijebol oleh Kroasia 3-1, tetapi Spanyol menjebol lebih besar 4-0. Apakah hasil jebol menjebol gawang ini telah menunjukkan El Matador lebih baik dari Hrvatska? Belum tentu, karen perebutan kekuasaan untuk menjadi wakil Grup C sementara ini masih sangat terbuka untuk tiga besar Spanyol – Kroasia – Italia. Begitu sengitnya persaingan, namun menurut analisa saya, Spanyol tetap favorit untuk menguasai jalannya permainan. Bahkan diperkirakan, bisa saja Spanyol unggul penguasaan bola sebanyak lebih dari 60%. Juga menjadi sebuah pertanyaan yang sangat berarti, apakah malam nanti Fernando Torres mampu menjebol gawang Kroasia. Dia comeback

Al Bayan... “Saya akan bagi dua, setengah untukku dan setengah untuk tuan!”, ujar Dikyanus bersumpah. “Alhamdulillah nanti harta itu akan saya gunakan untuk kepentingan agama Allah!”, jawab Syeikh tua yang sudah puluhan tahun memerangi maksiat. Setelah kesepakatan, kedua manusia itu pergi ke hutan dengan membawa perbekalan dan alat penggalian. Mereka berdua berhari-hari menggali sumur tersebut dan bermalan di tengah hutan. Setelah emas itu didapat, sebagian kecil mereka bawa pulang ke kampung dan sebagian besar lagi masih dalam sumur. Dalam perjalan itulah syaithan terkutuk menyerupai diri sebagai manusia dan memanggil Dikyanus. “Wahai Dikyanus tunggu dulu,


Berita Utama

Tor-tor Dan Gordang Sambilan Diklaim Malaysia ●

reka. Malaysia pernah menampilkan tari Pendet asal Bali dalam video iklan ‘Enigmatic Malaysia’ di Discovery Channel. Aksi ini memancing reaksi masyarakat Indonesia. Bahkan, Presiden Susilo Bambang Yudhoyono saat itu sempat marah atas klaim itu. Budayawan Malaysia juga menyesalkan klaim ini. Namun, Malaysia berkilah iklan pariwisata itu yang membuat bukan negaranya, melainkan pihak Discovery Channel. Selain tari Pendet, Malaysia pernah mengklaim tari Reog asal Ponorogo, Jawa Timur dan sejumlah kebudayaan Indonesia lainnya. Berlebihan Sementara itu, Wakil Ketua DPRD Sumut Chaidir Ritonga, Minggu (17/6), mengatakan klaim Malaysia itu berlebihan. Kalau secara fisik yang dimaksud Malaysia, Tor-tor dan Gordang Sembilan itu sama dengan yang kita miliki di sini, pemerintah Indonesia harus protes. Disebutkan Chaidir Ritoga, sudah berulang kali Malaysia, mengeluarkan pernyataan yang membuat kita tersinggung. Dia mencurigai, itu dilakukan hanya untuk memancing-mancing emosi masyarakat Indonesia saja. Sebagai saudara serumpun, sikap itu menunjukkan rasa tidak menghargai sama sekali. Pemerintah Indonesia, kata Chaidir Ritonga, harus cepat meminta klarifikasi pihak Malaysia terhadap masalah Tor-

Tiki-taka Melawan ... Gelandang menyerang Kroasia sebagai pengatur tempo permainan adalah Luka Modric, bintang klub Tottenham Hotspur. Dia selalu menjamin tersedianya umpan-umpan matang yang siap dijebolkan ke gawang lawan. Modric telah membuktikan bagaimana mendobrak ketatnya pertahanan Italia. Melalui otak Modric pula, Kroasia membuktikan mampu menjebol gawang Italia, yang biasanya sangat payah dilakukan. Data penyerangan yang dihasilkan oleh Kroasia selama babak kualifikasi Euro 2012 menunjukkan bagaimana garansi serangan mereka. Latvia, Malta, Israel serta Turki, mereka kalahkan semuanya dengan membobolkan tiga gol. Jadi kuda hitam Kroasia dari kawasan Balkan jangan dianggap enteng. Irlandia juga dijebol oleh Kroasia 3-1, tetapi Spanyol menjebol lebih besar 4-0. Apakah hasil jebol menjebol gawang ini telah menunjukkan El Matador lebih baik dari Hrvatska? Belum tentu, karen perebutan kekuasaan untuk menjadi wakil Grup C sementara ini masih sangat terbuka untuk tiga besar Spanyol – Kroasia – Italia. Begitu sengitnya persaingan, namun menurut analisa saya, Spanyol tetap favorit untuk menguasai jalannya permainan. Bahkan diperkirakan, bisa saja Spanyol unggul penguasaan bola sebanyak lebih dari 60%. Juga menjadi sebuah pertanyaan yang sangat berarti, apakah malam nanti Fernando Torres mampu menjebol gawang Kroasia. Dia comeback sebagai pemain utama, langsung mencetak dua gol yang sangat meyakinkan ke gawang Irlandia. Torres senjata penuntas, setelah Iniesta – Fabregas – Xavi begitu asyik menjalankan irama permainan Matador, yang tanpa terasa menghanyutkan pertahanan lawan-lawannya. Tapi menurut dugaan saya, Kroasia tetap akan memberikan perlawanan yang sangat keras. Untuk menjebol gawang Spanyol dari serangan balik yang sangat cepat adalah sangat mungkin, karena poros halang Carles Puyol cedera dan tidak ikut ke Polandia-Ukraina. Saya akan membayangkan permainan tiki-taka yang dimainkan sejak dari sektor pertahanan, mengalir ke tengah dan tiba-tiba menusuk ke jantung pertahanan Kroasia. Itu akan membuat pertandingan malam nanti menjadi sangat kontras. Saya juga memprediksikan seluruh lini pertahanan ditambah dengan gelandang akan merupakan palang pintu Kroasia yang sangat berat untuk dilalui oleh para pemain Spanyol. Mengingat kedisiplinan tinggi yang dilatihkan Slaven Bilic, kemungkinan besar Spanyol akan sangat sulit mencetak gol. Apalagi, para pemain Kroasia rata-rata bandel dan berjiwa pejuang. Serangan balik dari Kroasia justru sangat berbahaya, karena bagaimanapun juga telah terbukti bahwa mereka mempunyai penyerang yang sangat produktif mencetak gol. Hanya serangan balik itu harapan mereka, sebab tiki-taka milik Iniesta dkk akan menguasai jalannya laga. Tentu saja setelah menguasai permainan Spanyol akan memenangkan pertandingan...?

Pengurusan SIM ...

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ...., Gh4+. 2. Kg3, GxK+. 3. Rg2, MxG+ atau Me2+. 4. Rg1, Mf2+. 5. Rh1, Mh2+mat.

Jawaban TTS: TTS Topik

Umum Serba “Pos”

“Pelayanan berjalan seperti biasa.Jumatkemarin,kitamemindahkan pelayanan pengurusan SIM keMapolrestaMedankarena saat itu kita masih melakukan pembersihan di ruang yang tak ikut terbakar dan ada tim Labfor dari Poldasu melakukan olah TKP. Hari ini, Senin (18/6) pelayanan mulai dioptimalkan,” jelas Kasat Lantas Polresta Medan Kompol M Risya Mustario saat dikonfirmasi, Minggu (17/6). Ditambahkan Risya, mulai Senin (18/6) pelayanan Satlantas kembali dilakukan di gedung Sat Lantas Polresta Medan di Jl. Adinegoro yang sempat terbakar pada Kamis (14/6) kemarin.Hal ini dilakukan karena tidak ada barang yang di lantai I yang menjadi tempat pelayanan pembuatan SIM yang rusak. Dijelaskan Risya, semua kegiatan yangdilakukan pihak Sat Lantas Polresta Medan, seperti pelayanan pembuatan SIM, Laka Lantas hingga Operasi Simpatik Toba yang saat ini sedang digelar berjalan dengan normal. Saat disinggung mengenai perbaikan lantai II gedung yang terbakar ini, Risya mengatakan, pihaknya belum mengetahui kapan gedung tersebut direnovasi. (h04)

Ada-ada Saja ...

Jawaban Sudoku: 2 9 3 5 4 8 1 6 7

1 8 6 3 9 7 2 5 4

Warga Langkat Dianiaya Tiga Pria Mengaku Dari Poldasu

DPRDSU: Klaim Itu Berlebihan

MEDAN (Waspada): Setelah mengklaim beberapa budaya Indonesia, kini Malaysia mengklaim kebudayaan asli Indonesia, Tor-tor dan Gordang Sambilan sebagai peninggalan nasional mereka. Di Indonesia, dua kesenian itu dikenal sebagai kebudayaan masyarakat Batak, Sumatera Utara. Bahkan, tari Tor-tor selalu ditarikan dalam upacara adat masyarakat Batak. Namun kini, Malaysia dengan berani akan meregistrasi kebudayaan itu berdasarkan Bab 67 Undang-undang Peninggalan Nasional 2005. “Pertunjukan periodik harus diadakan. Artinya, tarian harus disajikan sementara irama gendang harus dimainkan di depan publik,” kata Menteri Informasi, Komunikasi, dan Kebudayaan Malaysia, Datuk Seri Rais Yatim sebagaimana dikutip laman Bernama. Menurut Rais, mempromosikan kebudayaan dan seni Mandailing sangat penting, sebab bisa mengungkap asal-usulnya. Selain itu bisa mempererat persatuan dan kesatuan dengan masyarakat lainnya. Sejalan dengan konsep Malaysia, upaya masyarakat Mandailing mengangkat seni dan budaya mereka telah didukung kementerian untuk diakui dan dikenalkan ke publik Malaysia. Sebelumnya, Malaysia mengklaim sejumlah kesenian asal Indonesia sebagai milik me-

5 4 7 1 2 6 9 3 8

6 1 8 2 7 3 4 9 5

3 7 4 6 5 9 8 2 1

9 5 2 8 1 4 6 7 3

8 6 1 7 3 2 5 4 9

7 2 9 4 8 5 3 1 6

4 3 5 9 6 1 7 8 2

orang remaja di rumahnya di Alor Gajah. Para perampok berhasil menggondol sejumlah uang, dua ponsel dan sebuah alat pemotong rumput. Pensiunan guru bernama Mohammed Amin Ismail, 74, menceritakan kejadian itu kepada Harian Metro, bahwa sebelum kabur perampok itu ‘menasehatinya’ untuk tidak tinggal sendirian. “Sebelum mereka kabur, satu dari perampok ini mengatakan kepada kami bahwa kami harusnya tinggal bersama anak-anak kami, ujar Amin. Dalaminsidenitu,Aminmengalami luka terkena parang saat perampokan terjadi Kamis dinihariwaktusetempat.Aminmengatakan para perampok mengarahkanparangkelehernyadankemudian mengikat tangannya.(st/rzl)

tor dan Gordang Sembilan ini. Ini sudah sekian kalinya dilakukan Malaysia terhadap kebudayaan Indonesia. Secara fisik, kata Chaidir Ritonga, Tor-tor dan Gordang Sembilan yang dimiliki Indonesia sangat khas. Walaupun terdapat perbedaan pada setiap marga di Tapanuli Selatan (Tapsel), namun secara umum, Tortor dan Gordang Sembilan sama pada setiap marga. Yang membedakan hanya detail tarian atau irama gendangnya saja. ‘’Jadi, kalau yang dimaksud Malaysia itu adalah Tor-tor dan Gordang Sembilan yang kita punya, pemerintah harus protes. Bisa juga yang mereka (Malaysia) maksud itu lain, baik perangkat maupun geraknya,’’ kata Chaidir Ritonga. (m12)

KORBAN pembakaran warga.

Waspada/ Riswan Rika

Dua Warga Kritis ... membuat warga curiga dan berteriak maling,’’ ujar sumber. Sejumlah warga yang sedang menyaksikan pertandingan piala Eropa, mendengar teriakan ada maling, dan berhamburan keluar, mengejar keduanya dan tertangkap. Ketika ditanya, keduanya mengaku polisi.Namun, tidak bisa menunjukkan KTA (kartu tanda anggota) sebagai polisi. ‘’ Hal itu membuat masa marah dan beringas. Dengan menyiramkan bensin, keduanya dibakar.Namun, salah seorangnya kabur ke parit dan bersembunyi di bawah got. Sedangkan Fendi , diselamatkan KeplingSuparno,’’ ujar sumber. Anggota Polsek Binjai Utara yang turun ke TKP membawa Fendi ke RSUD dr. Djoelham Binjai. Sedangkan,Anto yang bersembunyi, berhasil ditangkap dan dibawa ke RS yang sama. Kapolsek Binjai Utara AKP Widya Budi Hartati melalui Kanit Resintel AKP J.Pasaribu, mengatakan, kasusnya masih diselidiki dan kedua korban saat ini dirawat di rumah sakit. (a04)

Dua Kader PAN Daftar Cabubsu Ke Golkar MEDAN (Waspada): Dua kader Partai Amanat Nasional (PAN), Kamluddin Harahap dan Wildan Aswan Tanjung, mengambil formulir pendaftaran calon Gubsu ke Partai Golkar Sumut. Wakil Ketua DPRD Sumut, juga Wasekjen DPP PAN Kamaluddin Harahap dan Bupati serta Ketua DPD PAN Labuhanbatu Selatan (Labusel)Wildan Aswan Tanjung, mendaftar ke Partai Golkar,Sabtu(16/6).Pengambilanformulir pendaftaran dilakukan utusanmereka,AnangAnasAzhar. Di kantor DPD I Partai Gol-

DEMOKRAT ANJLOK ... 1.200. Margin of error sebesar 2,9 persen. Dia menambahkan, survei ini menunjukkan Demokrat terus mengalami penurunan dukungan. “Partai Demokrat semakin menjauh dari perolehan suaranya pada Pemilu 2009. Terbukti, sejak Januari 2011 elektabilitasnya semakin menurun dengan 20,5 persen. Juni 2011 menjadi 15,5 persen. Oktober 2011 sebesar 16,5 persen. Januari 2012 sebesar 13,7 persen, dan Juni 2012 hanya 11,3 persen,” papar Aji. Sementara itu, lanjut dia, survei ini sekaligus menegaskan Partai Golkar untuk pertama kalinya memperoleh dukungan di atas 20 persen. Terbukti sejak survei yang dilakukan pada Januari 2011, Golkar memperoleh dukungan sebanyak 13,5 persen. Juni 2011 memperoleh 17,9 persen, Oktober 2011 sekitar 18,2 persen, Januari 2012 sebesar18,9 persen, dan Juni 2012 sebesar 20,9 persen. (vvn)

L. Batu Siap ... kemampuannyadalammemimpin, kepamongannya sudah teruji, Pak Amri tidak saya ragukan dialayakmemimpinSumut,”ujar tokoh masyarakat Labuhanbatu tersebutkepadawartawandiselasela acara silaturrahmi masyarakat Padang Matinggi, Kabupaten Labuhanbatu, kemarin, di rumah salahsatuveteranHTMahyuddin Jalan Sado, Padang Matinggi. Alumni IIP yang sudah pensiun di Pemkab Labuhanbatu ini menyatakan, ia bersama masyarakat tidak hanya mendukung malah siap memenangkan Bupati Deliserdang yang bergelar Datuk UtamaWirawangsa tersebut menjadi Gubernur Sumut. “Kami keluarga pamong, jadi saya siap ikut memenangkan Pak Amri Tambunan, karena kami yakin dengan kemampuan-

Pergantian Direksi ... Berkaitan dengan pergantian direksi, Dzaili menyebutkan, pergantian sesuai dengan ketentuan dan mekanisme yang berlaku. “Kepengurusan direksi periode 2008-2012, berakhir pada 17 Juni 2012. Artinya, dibiarin saja pun direksi ini, pada 18 Juni 2012 mereka gak mungkin masuk kantor lagi,” ujar Dzaili. Dengan berakhirnya masa jabatan kepengurusan, akan terjadi kekosongan sehingga sebagaimana Undang-undang no 40 tahun 2007 tentang perseroan terbatas, pasal 118 ayat 1 yang menyebutkan, berdasarkan anggaran dasar atau keputusan RUPS, Dewan Komisaris dapat melakukan tindakan pengurusan perseroan dalam keadaan tertentu untuk jangka waktu tertentu. “Dengan demikian, berdasarkan undang-undang, komisaris independen yang sudah ditetapkan dalam RUPS yaitu Rizal Fahlevi Hasibuan sah menurut undang undang menjadi Plt Dirut,” kata Dzaili.

WASPADA Senin 18 Juni 2012

kar Sumut, utusan kedua Cagub dari PAN, Anang Anas Azhar, diterima Tim Pemilukada Partai Korkar H.M. Hanafiah, Ketua Bidang Infokom H.Firdaus Nasution dan anggota Tim Pemilukada H.Wagirin Arman. Kepada wartawan, Anang Anas Azhar, mengatakan diutus Kamaluddin danWildan, untuk mengambil formulir Cagubsu. Dia mengaku bangga terhadap Partai Golkar, yang menerima calon dari luar partai. ‘’ Ini membuktikan Partai Golkar benarbenar partai terbuka. Mereka tidak membeda-bedakan calon dari partai lain,’’ kata Anang. Kamaluddin Harahap dan Wildan, katanya, mendaftar ke Partai Golkar, bukan karena mereka ditolak PAN. Tujuannya untuk membangun komunika-

si dengan Parpol lain, karena dalam Pilgubsu, PAN tidak bisa mengusung calon sendirian. PAN yang hanya memiliki tujuh persen suara pada Pemilu Legislatif (Pileg) 2009, harus menggandeng Parpol lain untuk mengusung Cagubsu secara bersama-sama. Disebutkan Anang, Kamaluddin Harahap danWildan, serius maju sebagai Cagubsu 2013. Mereka adalah kader terbaik PAN Sumut yang mempunyai niat memajukan daerah ini. Kamaluddin Harahap, saat ini menjabat sebagaiWakil Ketua DPRD Sumut. Jabatannya di partai adalah Wakil Sekjen DPP PAN dan pernah menjabat sebagai Ketua DPW PAN Sumut. SementaraWildan, saat ini menjabat sebagai Bupati Labusel dan Ketua DPD PAN Labusel. (m12)

1,8 Kg Emas Raib ... Tasbi I, Blok SS No.86, Medan, Sabtu (16/6) malam. Akibat peristiwa itu, keluarga Ali Musa mengalami kerugian lebih kurang Rp7 miliar. Informasi Waspada peroleh di Tempat Kejadian Perkara (TKP),rumah mewah yang kini ditempati istri Ali Musa, Hj. Nila Kesuma, 57, pensiunan Bank Indonesia (BI) bersama putra bungsunyaTeguh Pribadi Siregar, 31, PNSKantorDispendaPemkabBinjaidanistrinya,Sabtuditinggalkan. Hj. NIla Kesuma bersama anak bungsu dan keluarga pergi ke rumah atoknya di kawasan Abdul Hamid Jl. Binjai, Sunggal, Kab. Deliserdang. Namun, ketika istri Ali Musa bersama anak dan

menantunya pulang ke rumah, terlihat pintu pagar besi samping sudah terbuka.Bahkan,pintu samping rumah rusak bekas dicongkel. Ketika dilakukan pemeriksaan, satu brandkas berisi perhiasan emas murni 1,8 Kg, 200 gram emas mahar berbentuk pintu Aceh, surat-surat tanah dan BPKB mobil hilang. Kasat Reskrim Polresta Medan Kompol M Yoris Marzuki, SH, SIK, bersama Kapolsek Sunggal Kompol M Budi Hendrawan, SH, SIK, Waka Polsek AKP SupryadiYTO, SH, Kanit Reskrim AKP Victor Ziliwu, SH, SIK, dan Intel Brimobda Sumut serta para personelturunkeTKPmelakukan penyelidikan. Sekaligus mengambil sidik jari di beberapa titik di lokasi tersebut. (m36)

nya layak memimpin Sumut,” tandasnya. Senada dengan sahabat Amri Tambunan semasa di IIP tersebut HT Mahyuddin selaku pejuang dan tokoh masyarakat di Labuhanbatu ikut menyatakan dukungannya,menurutnyasebagai keluarga pejuang selayaknya ia siap memenangkan H. Amri Tambunan yang telah mendaftar di Partai Demokrat sebagai gubernur Sumut priode 2013-2018 mendatang. “Yanghadirdisinitidakhanya masyarakat Labuhanbatu saja, dari Labura, pensiunan TNI, tukang bangunan, PNS juga pengusaha siap memenangkan H. Amri Tambunan, karena kami sadar betul siapa AmriTambunan, apalagi dalam hal kemampuannya memimpin,” ungkapnya. Orangtua Amri Tambunan, yakniDjamaludinTambunanlan-

jut HT Mahyuddin, sudah berjasa bagi kabupaten Labuhanbatu khususnya, Aslab umumnya. “Sebagai bupati pertama di Asahan Labuhanbatu (Aslab) H Djamaludin Tambunan begitu berjasa bagi daerah kami sehingga seperti sekarang ini. Makanya, kami sebagai masyarakat Labuhanbatu harus ikut mendukung apa yang dicita-citakannya,” ujar HT Mahyuddin yang juga diaminkan Ir. Lukman Harahap salah satu pengusaha bunga di daerah tersebut. Seusaiacarasilaturrahimmasyarakat Padang Matinggi Labuhanbatu,wargayangdiantaranya para alim ulama hadir dalam pertemuan tersebut mulai menjadwalkan pertemuan selanjutnya untuk mensosialisasikan H. Amri Tambunan kepada masyarakat. “Ini keluarga besar kita juga,” tandas Samsudin. (m13)

Bahkan, imbuh Dzaili, pada Ayat 2 disebutkan, apabila Dewan Komisaris yang dalam keadaan tertentu untuk jangka waktu tertentu melakukan tindakan pengurusan sebagaimana ayat 1 berlaku semua wewenang dan kewajiban direksi terhadap perseroan dan pihak ke tiga. “Dengan demikian Rizal Fahlevi sebagai pelaksana tugas Dirut boleh melakukan berbagai kebijakan yang diperlukan,’’ kata Dzaili.Dia memaparkan, apabila dikaitkan dengan anggaran dasar PT Bank Sumut pasal 13 ayat 5, disebutkan, jika oleh suatu sebab jabatan anggota direksi lowong, untuk sementara perseroan diurus oleh anggota Dewan Komisaris yang ditunjuk oleh rapat Dewan Komisaris. Sebagaimana diberitakan, rapat umum pemegang saham (RUPS) pada 16 Juni 2012, memberhentikan direksi PT Bank Sumut periode 2008-2012. Direksi yang dibehentikan antara lain Direktur Utama Gus Irawan, Direktur Pemasaran Zenilhar dan Direktur Umum M Yahya.

Untuk menghindari kekosongan jabatan direksi, RUPS mengangkat direksi sementara yaitu Rizal Fahlevi Hasibuan sebagai Plt Dirut, Zenilhar sebagai Plt Direktur Umum dan Rudi Dogar Harahap sebagai Plt Direktur Pemasaran. RUPS juga menetapkan Rizal Fahlevi yang lulus dalam fit and propper tes BI, sebagai pejabat defenitif komisaris independen. Pejabat komisaris independen lain yang diangkat Brata Kesuma berlaku efektif setelah lulus fit and propper test oleh Bank Indonesia. Untuk selanjutnya dicari pejabat direksi melalui berbagai mekanisme yang akan dilakukan penjaringannya oleh Komite Renumerasi dan Nominasi (KRN), sebagai salah satu organ yang ada dalam bank. KRN ini diketuai oleh Komisaris Independen dan anggota yang terdiri atas komisaris dan pimpinan divisi SDM. Terkait pembatasan periode direksi PT Bank Sumut, Dzaili menyebutkan hal tersebut juga disinggung Pimpinan BI Medan Nasser Atorf dalam pidatonya. (m28)

Al Bayan ... Setelah kesepakatan, kedua manusia itu pergi ke hutan dengan membawa perbekalan dan alat penggalian. Mereka berdua berhari-hari menggali sumur tersebut dan bermalan di tengah hutan. Setelah emas itu didapat, sebagian kecil mereka bawa pulang ke kampung dan sebagian besar lagi masih dalam sumur. Dalam perjalan itulah syaithan terkutuk menyerupai diri sebagai manusia dan memanggil Dikyanus. “Wahai Dikyanus tunggu dulu, ingin kusampaikan satu ide. Bunuhlah Syeikh itu, supaya harta tersebut menjadi milikmu semuanya,”. Dikyanus langsung melaksanakan tugasnya. Syeikh yang alim itu dibunuh dengan alat tajam, mayatnya dibuang dalam jurang. Tak ada yang tahu, kecuali dia sendiri. Kemudian dengan harta karun itu dia menjadi orang yang paling kaya raya. Pengikutnya semakin banyak, ia menyogok rakyat, (money politics) dan memperluas pengaruhnya. Selanjutnya dia menjadi Raja yang

paling kejam dan sangat berkuasa. Raja zalim ini kemudian mengangkat dirinya menjadi Tuhan yang wajib disembah oleh manusia. Tujuh pemuda (Aulia Tujoh) yang beriman, kemudian meninggalkan kota dan uzlah ke sebuah gua yang dalam Alwuran disebut Gua Kaffi. Mereka uzlah karena tidak mau menyembah manusia zalim dan pengkhianat Dikyanus. Tiga abad kemudian, tujuh pemuda ditakdirkan Allah hidup kembali. Mereka pulang ke kota! Ternyata era telah berubah. Raja Dikyanus sudah lama mati. Kini negeri itu dikuasai Raja Abdurrahman yang beriman dan bertaqwa. Dikyanus si zalim pengkhianat tak mampu menjaga harta yang sangat banyak itu. Akhirnya hartanya itu menyesatkannya. Dia lupa, harta hanya titipan dari Allah kepadanya sebagai ujian. Saat kezalimannya memuncak, Allah menghancurkannya dengan datang banjir besar. Istana, harta dan pengikutnya yang sudah sesat itu musnah semuanya. Kemudian Allah menggantikan generasi baru yang lebih baik.

P.BRANDAN (Waspada): Tiga pria mengaku dari Polda Sumut menganiaya seorang warga Dusun Pasar XX, Desa Securai Selatan, Kec. Babalan, Langkat, Minggu (17/6) sore. Seorang pelaku menodongkan pistol ke rongga mulut korban. Perbuatan itu dilakukan para pelaku setelah mereka memaksa korban untuk menunjukkan rumah seseorang yang mereka cari. Menurut Kades,Yulial Fahri, korban, AbdulWahid, 47, bersama pria bersenjata ini ada terdapat seorang warga Medan berinisial, dr. JRK. Korban ditodong, tubuhnya diinjak-injak dan lehernya dicekik. Sedangkan, jam tangan berikut sebuah handphone dirampas pelaku. Abdul Wahid, kata Fahri, dianiaya dan dipaksa pelaku untuk menunjukkan rumah, Azar, warga Dusun Paluhsipat, Desa Telukmeku, Kec. Babalan. Setelah bertemu orang yang mereka cari, pria bersenjata itu mengancam akan menembak, namun aksi pria yang mengaku dari Poldasu itu mendapat perlawanan. “Coba tembak kalau kalian berani,” kata Kades menirukan ucapan Azwar. Menuurut Farhi, pelaku meninggalkan lokasi kejadian setelah Azwar, mengambil sebilah parang dan berupaya mengejar pelaku. Ada dugaan, pria bersenjata itu orang bayaran untuk mengintimidasi warga.

Informasi Waspada diperoleh, penganiayaan dan pengancaman dari orang bersenjata api ini disebut-sebut dipicu konflik tanah. Namun, Fahri menegaskan, dr. JRK, tidak memiliki tanah di desanya. “Kalau dahulu sang dokter itu ada memiliki tanah di daerah saya, tapi tanah tersebut sudah dijualnya,” terang Kades. “Saya pernah melayangkan undangan kepada orangtua JRK, untuk meminta penjelasan seputar klaim atas tanah mereka, namun yang bersangkutan tidak mau hadir. Kalau ia merasa ada memiliki tanah di Desa Secu-

rai Selatan, silakan bawa buktibukti yang otentik,” kata Fahri. Kades menyatakan, kasus itu segera dilaporkan kepada aparat penegak hukum. Beberapa saksi telah siap memberikan kesaksiannya, Kapolsek P.Brandan, AKP. HM. Kosim Sihombing yang dikonfirmasi Waspada menjelaskan, pihaknya sedang berupaya mengecek kebenaran tentang peritiwa ini. “Saat ini anggota sudah turun dan mereka lagi mengecek lokasi tempat kejadian perkara (TKP),” ujarnya. Kapolsek siap menerima pengaduan warga.(a02)

Raja Abdullah Di Makkah ... Salman bin Abdulaziz, Pangeran Ahmad bin Abdulaziz, Deputi Menteri Dalam Negeri; Pangeran Sultan bin Salman bin Abdulaziz, Presiden Komisi Pariwisata Arab Saudi; dan pejabat lainnya. Menurut SPA,sejumlah pemimpin dan pejabat Dewan Kerjasama Teluk (GCC) dan para pejabat dari negara-negara Arab telah mengirimkan pernyataan belasungkawa kepada kerajaan. Sheikh Sabah Khalid Al-Hamad Al-Sabah, deputi PM Kuwait dan menteri luar negeri, mengatakan Kuwait merasa kehilangan saudara dekatnya. Prof. Tawfiq bin Ahmed Khoja, Direktur Jenderal Dewan Eksekutif dari para Menteri Kesehatan GCC, mengatakan Pangeran Mahkota Nayef “telah mencapai prestasi di segala bidang, khususnya di bidang pertahanan, keamanan, kemajuan dan kemakmuran tanahairnya.” Reuters memberitakan, Minggu (17/6), sejumlah pengamat politik di Arab Saudi memprediksi nama Pangeran Salman bin Abdulaziz, 76, pengganti putra mahkotana. Salman adalah adik Raja Abdullah sekaligus Menteri Pertahanan Arab Saudi. “Kandidat yang paling jelas adalah Pangeran Salman,” ucap profesor ilmu politik Arab Saudi, Khalid al-Dakhil. Namun seperti dikatakan seorang pejabat di Arab Saudi yang dilansir CNN, kepastian penerus Putera Mahkota akan diumumkan beberapa hari mendatang. (an/m10/zal)

Bank Sumut ... ‘memberikan cintanya’ sepenuh hati untuk kemajuan bank ini. Saya bukan ingin melankolis. Tapi selama 12 tahun atau tiga periode, bank ini telah menjelma dan disegani hingga tingkat nasional. Saya masih ingat ketika Dirut Bank Mandiri Agus Martowadojo [sekarang Menteri Keuangan] beberapa tahun lalu menjadi the best CEO bank BUMN, maka saya juga terpilih menjadi the best CEO BUMD. Kala bank besar lain mampu memperoleh penghargaan dengan servis terbaik maka Bank Sumut pun mampu memperoleh apresiasi yang sama untuk bank daerah. Di penghujung masa jabatan terutama sebulan terakhir, saya memang fokus memberikan perhatian lebih untuk menyelesaikan semua tugas. Mohon maaf kepada berbagai pihak, berbagai kalangan, pejabat pemerintah, organisasi kemasyarakat juga adik-adik mahasiswa yang tak bisa saya penuhi undangannya. Baik itu menjadi narasumber atau undangan diskusi. Saya benar-benar ingin mengakhiri tugas di Bank Sumut dengan totalitas seperti layaknya memulai tugas dulu saat terpilih menjadi direktur utama. Sepeninggal saya, bank ini sudah memiliki nama. Karyawan sudah bangga menggunakan tagname, mau menempel stiker Bank Sumut di mobilnya. Padahal dulu di awal-awal saya menjadi direktur utama, para karyawan tidak seperti itu. Mereka malah banyak yang mau keluar dari Bank Sumut. Bayangkan saja saat diberi kepercayaan memimpin Bank Sumut saya harus memulihkan kondisi yang sangat buruk. NPL (kredit bermasalah) di tahun 2000 itu mencapai 83 persen dan CAR (rasio kecukupan modal/capital adequacy ratio) terperosok ke minus 34 persen dengan kerugian Rp300 miliar, padahal modal saja saat itu hanya Rp60 miliar. Tahun 2000, aset Bank Sumut baru Rp1 triliun dengan jumlah kantor 30 unit Ini beban sangat berat bagi seorang bankir. Sebenarnya bukan karyawan saja waktu itu yang ingin keluar dari Bank Sumut. Saya juga sempat kecut. Di awal-awal menjadi pemimpin Bank Sumut banyak sekali isu beredar. Bank ini bakal ditutup karena kondisinya sekarat. Informasi itu saya peroleh dari pusat. Kondisi yang begitu berat membuat saya juga sempat berfikir lain. Saya ini lulusan akuntan. Ketika sudah di Bank Sumut saya beberapa kali pergi ke Aceh untuk menyelesaikan sertifikasi akuntan saya. Seperti itulah gambaran kegamangan dan beratnya bekerja di Bank Sumut. Seperti esok akan kiamat. Namun karena kemudian ada program rekapitalisasi perbankan dari pemerintah saya dan tim kemudian bekerja keras untuk menyelamatkan aset Sumut ini. Walau berat tapi kredit macet yang menyelimuti Bank Sumut perlahan-lahan saya bersihkan. Di tengah kepemimpinan tentu saja ada yang suka dan tidak suka. Tapi kerja keras terbukti memberikan hasil. Tentu saja karena ada ‘invi-

sible hand’ (tangan Tuhan) yang ikut campur hingga Bank Sumut bisa seperti sekarang. Tanpa kuasa Tuhan saya yakin membalikkan bank dari minus ke sekarang menghasilkan laba adalah mustahil. Ketika bertemu dengan para karyawan, selalu saya motivasi mereka sekarang agar terus bekerja keras dan jangan lupa ibadah. Sebab itulah salah satu yang membuat Bank Sumut seperti sekarang. Apalagi kalau melihat penghargaan yang diterima bank ini. Rasa syukur yang luar biasa. Begitupula ketika laporan pertanggungjawaban saya diterima para pemegang saham, pun sangat saya syukuri. Setelah tak lagi menjadi direktur utama di bank kebanggaan ini pasti akan ada regenerasi. Saat berjumpa dengan karyawan saya selalu katakan sudah cukup masanya harus keluar dari singgasana ini. Untuk memberi kesempatan kepada mereka yang berhak menduduki jabatan direksi. Paling tidak di Bank Sumut saat ini ada banyak kader yang mampu memimpin dilihat dari golongan jabatan. Baik itu setingkat pemimpin divisi atau juga kepala cabang. Bank Sumut bukan sedang krisis sumber daya manusia. Kalau saya kemudian bertahan terlalu lama pasti akan menutup pintu bagi mereka untuk maju. Di 2008, pun sebenarnya saya sudah utarakan untuk mundur, tapi waktu itu pemegang saham meminta untuk kembali memimpin. Jadi sekarang regenerasi itu harus berjalan. Bukan hanya itu, tahun ini setidaknya Bank Sumut juga akan menjadi bank devisa. Bank yang akan mengakomodasi kebutuhan eksportir dan importir di Sumatera Utara. Untuk bank devisa hanya tinggal menunggu izin dari Bank Indonesia. Layanan yang nantinya disediakan Bank Sumut meliputi bank notes (layanan penukaran mata uang), penyaluran kredit valuta asing, layanan pengiriman uang (remittance), letter of credit (L/C), pembukaan rekening simpanan tabungan, deposito dan giro dalam bentuk valuta asing, layanan bank garansi dalam bentuk valuta asing dan transaksi perbankan yang berkaitan dengan ekspor impor. Jika situasi memungkinkan tahun ini bahkan harus ada initial public offering (IPO) atau melepas saham di Bursa Efek Indonesia (BEI). Tujuan jangka panjang adalah menjadi regional champion pada 2014. Cetak biru regional champion BPD yang terdiri dari tiga pilar, yaitu, pertama, ketahanan kelembagaan yang kuat. Kedua, kemampuan sebagai agen pembangunan daerah. Peningkatan fungsi intermediasi BPD kepada sektor riil yang produktif harus menjadi fokus. Ketiga, kemampuan melayani kebutuhan masyarakat. Semoga itu bisa tercapai. Pada akhirnya saya berharap bank ini tetap menjadi kebanggaan masyarakat Sumatera Utara. Semua citacita tercapai ke arah yang lebih baik. Saya harus berterimakasih kepada semua fihak, seluruh karyawan yang telah mau bekerjasama, guyub (padu) dan memberikan bakti sehingga bank ini kelak meningkatkan kapasitasnya untuk bersaing di level mana pun.*

Medan Metropolitan

WASPADA Senin, 18 Juni 2012

Kanit Reskrim Polsek Sunggal Tangkap Pengedar Narkoba MEDAN (Waspada): Kanit Reskrim Polsek Sunggal AKP Victor Ziliwu, SH, SIK, menangkap seorang resividis pemakai dan pengedar narkoba dalam penyergapan di Jln. Sunggal Km 7, Kelurahan Tanjungrejo, Kecamatan Medan Sunggal. “Selain menangkap tersangka ASS, 31, penduduk Jln. Sunggal Km 7, polisi juga meng-

amankan barang bukti berupa dua ons ganja kering yang baru dibeli seharga Rp280 ribu, kata Victor kepada Waspada, Minggu (17/6) sore. Victor mengatakan, tersangka ditangkap pada Rabu (13/6) malam. Saat itu,Victor bersama personelnya melakukan Operasi Hunting dengan mengendarai sepedamotor guna meng-

Warga Glugur Darat II Bersama TNI Gotong Royong MEDAN (Waspada): Warga Kelurahan Glugur Darat II bersama unsur Koramil 02 Medan Timur melakukan gotong royong membersihkan areal perkuburan serta parit di Jln. Kapten Muchtar Basri, Jumat (15/ 6) dan Sabtu (16/6). Menurut Lurah Kelurahan Glugur Darat II Zuhri Abrar Nasution Sabtu (16/6), gotong royong dilakukan dalam rangka menyambut datangnya bulan suci Ramadhan 1433H serta mendukung program kebersihan Pemko Medan dan HUT ke62 Kodam I/BB. Sementara Dan Ramil 02 Medan Timur Kapten Arh. Suherwan yang memimpin ang-

gotanya melakukan gotong royong mengatakan, dari unsurTNI dikerahkan masing-masing dari PomdamI/BB,Koramil02Medan Timur, Zipur dan Hubdam. Kapten Suherwan menambahkan, selain menyambut HUT Kodam I/BB ke-62, kegiatan gotong royong ini juga mendukung program kebersihan Pemko Medan dan menyambut bulan suci Ramadhan 1433H. Camat Medan Timur Drs Parulian Pasaribu, MSi dan Medan Perjuangan ASP Harahap tampak hadir di lokasi gotong royong menambahkan, kegiatan sosial ini juga dilakukan dalam menyambut HUT ke-422 Kota Medan.(m19)

antisipasi kejahatan jalanan di Jln. Gagak Hitam-Ringroad, Jln. Asrama, Jln. Kaswari, Jln. Setiabudi, Jln. Gatot Subroto, Jln. TB Simatupang, Jln. Amal, Jln. Sei Batanghari Medan. Saat melintas di Jln. Sunggal, Victor melihat seorang tersangka membawa ransel mengendarai sepedamotorYamaha Mio. Karena gerak-geriknya mencurigakan,Victor membuntutinya. Namun tersangka menambah kecepatan kendaraannya. Setibanya di depan rumah, tersangka lalu bergegas masuk. Namun Victor tetap melakukan pengintaian seorang diri. Ketika tersangka sedang mengemas ganja kering dalam bungkus kecil,Victor langsung meng-

gerebek rumah tersebut dan menangkapnya. Meski tidak membawa anggotanya,Victor tetap melakukan penggeledahandirumahtersebut sendirian dan menemukan barang bukti ganja seberat dua ons. Kapolsek Sunggal Kompol M Budi Hendrawan, SH, SIK, mengatakan, tersangka ASS sudah masuk daftar pencarian orang (DPO) dalam kasus narkoba. Usai menjalani pemeriksaan, tersangka mendekam dalam tahanan. Saat menjalani pemeriksaan, tersangka mengaku memakai narkobajenisganjaselamaempat tahun. Selain digunakan untuk diri sendiri, ganja tersebut juga dijual kepada peminatnya. (m36)

Waspada/Ismanto Ismail

KANIT Reskrim Polsek Sunggal AKP Victor Ziluwu, SH, SIK, (kiri) sedang membawa tersangka untuk melakukan pengembangan.



Medan Metropolitan

WASPADA Senin 18 Juni 2012

Sopir Truk Tidak Gentar Hadapi Operasi Simpatik Toba 2012

Waspada/Surya Efendi

TRUK molen menurunkan muatan semen dengan parkir sembarangan di Jln. Rahmadsyah tidak jauh dari simpang Jln. Sutomo Medan, Sabtu (16/6), mengakibatkan arus lalulintas macat.

Polisi Buru Geng Kereta 21 Sepedamotor Diamankan MEDAN (Waspada): Pihak kepolisian di jajaran Polresta Medan terus melakukan perburuan terhadap anggota geng kereta yang meresahkan masyarakat. Sabtu (16/6) malam hingga Minggu (17/6) dinihari, personel Polsek Medan Baru, Medan Kota dan Medan Timur menggelar Operasi Hunting di wilayah hukumnya masing-masing. Dalam razia yang dilakukan dengan cara patroli keliling kota ini, polisi mengamankan 21 sepedamotor. Sebab, pengendaranya tidak bisa memperlihatkan surat-surat kendaraan dan sepedamotor tersebut tidak dilengkapi nomor polisi. Kapolsek Medan Baru Kompol Dony Alexander, SH, SIK, M.Hum mengatakan, pihaknya melakukan Operasi Hunting di sejumlah lokasi yang dianggap rawan seperti Jln. Patimura, Jln. Mongonsidi, Jln. S. Parman, Jln. Gajahmada, Jln. Iskandarmuda, Jln. Darusalam, Jln. Ayahanda, Jln. Gatot Subroto, Jln. Sekip, Jln. H Adam Malik, kawasan Padangbulan dan Dr. Mansyur Medan. Selain melakukan patroli, polisi juga melakukan pengamanan di seluruh SPBU serta memantau situasi objek vital se-

perti perkantoran pemerintah/ swasta, perbankan dan pusat perbelanjaan yang ada di wilayah hukum Polsek Medan Baru. Sesuai instruksi Kapoldasu Irjen Pol Drs H. Wisjnu Amat Sastro, SH yang ditindaklanjuti Kapolresta Medan Kombes Pol Monang Situmorang, SH, MSi, kata Dony, maka Polsek Medan melakukan Operasi Hunting untuk memburu anggota Geng Kereta dan mengamankan objek vital guna mengantisipasi terjadinya hal-hal yang tidak diinginkan. “Dalam Operasi Hunting tersebut, polisi mengamankan 10 sepedamotor yang tidak memiliki nomor polisi dan pengendaranya tidak bisa memperlihatkan surat-surat kendaraan,” kata Dony didampingi Waka Polsek Medan Baru AKP Tris Lesmana Zeviansyah, SIK, SH, MH, Kanit Reskrim, Kanit Intelkam dan Kanit Sabhara. Medan Kota Sementara itu, Polsek Medan Kota juga menggelar Operasi Hunting di sejumlah lokasi yang dianggap rawan kejahatan jalanan seperti kawasan Stadion Teladan, Jln. Turi, Jln. Sisingamangaraja, Jln. Pelangi, Jln. Brigjen Katamso dan Jln. Seksama. “Sasarannya lebih mengarah kepada pengguna jalan raya berusia remaja dan layak dicurigai sebagai anggota geng kereta

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru Kompol Dony Alexander, SH, SIK, M.Hum memimpin apel di Jln. Patimura sebelum pelaksanaan Operasi Hunting di wilayah hukumnya guna mengantisipasi geng kereta dan kejahatan jalanan, Sabtu (16/6) malam. kelompok bermotor,” kata Kapolsek Medan Kota Kompol Sandy Sinurat. Selain Operasi Hunting, kata Sandy, pihaknya juga mendatangi lokasi yang biasa dijadikan tempat berkumpul anggota geng kereta. “Polsek Medan Kota mengamankan 11 sepedamotor tanpanomorpolisi,knalpotblong dan pengendaranya tidak mem-

bawa surat kendaraan,” ujarnya. Medan Timur Sementara Polsek Medan Timur yang melakukan Operasi Hunting di wilayah hukumnya, Minggu dinihari, untuk mengantisipasi kejahatan dan berkeliarannya geng kereta. Kapolsek Medan Timur Kompol Patar Silalahi SIk, SH mengatakan, razia dilakukan

Badan Hukum Yayasan Dr Rusdi Dalam Pengurusan MEDAN (Waspada): Ketua Yayasan Rumah Sakit Dr Rusdi Dra Hj Marlina Rusdi Nasution menegaskan, hingga kini badan hukum yayasan yang dipimpinnya masih dalam urusan di Kementerian Hukum dan HAM RI cq Direktorat Jenderal Administrasi Hukum Umum sesuai dengan UU No 16 dan Perubahan UU No 28 tentang yayasan. “Badan hukum yayasan masih dalam pengurusan di Kemenkum HAM RI. Jadi, tudingan yang menyatakan

yayasan ini tidak berbadan hukum adalah tidak benar dan menyesatkan,” kata Hj Marlina Rusdi Nasution kepada Waspada, di kantor Yayasan Rumah Sakit Dr Rusdi Medan, Jumat (15/6), terkait tudingan dirinya lalai untuk mendaftarkan badan hukum yayasan tersebut. Selain telah mengurus badan hukum yayasan, tambah Marlina, Politeknik Kesehatan Dr Rusdi yang mengelola Prodi Keperawatan, Analisis Kesehatan dan Jurusan D IV Fisioterapi juga telah memiliki izin dari

Dirjen Dikti. Dia menjelaskan, sebelumnya yayasan yang dipimpinnya juga sempat digugat di Pengadilan Negeri Medan dan memenangkan gugatan tersebut, begitu juga dengan pengaduan di kepolisian. “Biarlah mereka meributinya, apalagi saya tidak mau ribut-ribut. Fokus saya sekarang yakni berupaya untuk memajukan dan mengembangkan Poltekkes ini,” ujar Marlina. Sebagaimana diberitakan

sebelumnya, Lisa Yulina Nasution SPd, selaku SekretarisYayasan Dr Rusdi menudingYayasan Dr Rusdi yang dipimpin Dra Hj Marlina Rusdi Nasution telah lalai menjalankan tugasnya karena tidak pernah mengadakan rapat pengurus yayasan dan telah lalai untuk mendaftarkan yayasan tersebut kepada Kementerian Hukum dan Hak Azasi Manusia RI cq Direktorat Jenderal Administrasi Hukum Umum sesuai dengan UU No 16 dan Perubahan UU No 28 tentang yayasan. (h04)

selain untuk antisipasi aksi geng kereta juga mengantisipasi aksi kejahatan jalanan seperti perampokan dan penjambretan yang akhir-akhir ini semakin marak terjadi. “Razia kita lakukan untuk antisipasi geng kereta dan kejahatan jalanan,” ujarnya. Menurut Patar, razia tersebut bersifat monitoring yang dilakukan anggota diberbagai kawasan wilayah hukum Polsek Medan Timur, seperti di Jln. Prof HM Yamin, Jln. Krakatau, Jln. Bilal, dan Jln. Sutomo Medan. “Bukan razia khusus, lebih bersifat monitoring, personel melakukan patroli untuk memantau apakah ada aksi geng kereta atau kejahatan jalanan,” jelasnya. Saat disinggung apakah ada anggota geng kereta atau pelaku kejahatan jalanan yang diamankan dalam razia tersebut, Patar mengatakan tidak ada yang diamankan. Kata dia, pihaknya akan terus melakukan razia dan monitoring secara rutin untuk antisipasi aksi geng kereta dan kejahatan jalanan lainnya. “Kita akan terus adakan razia untuk antisipasi kejahatan yang ada di wilayahhukumPolsekMedanTimur,” sebutnya. (m36/m27/m39)

MEDAN (Waspada): Operasi Simpatik Toba 2012 yang digelar sesuai instruksi Kapoldasu Irjen Pol Wisjnu Amat Sastro, ternyata tidak membuat sopir truk gentar. Meski jelasjelas melanggar peraturan dan menjadi penyebab kemacatan lalulintas, namun sang sopir tetap membawa truk masuk inti Kota Medan pada siang hari. Pantauan Waspada di lapangan pada Sabtu (16/6) dan Minggu (17/6), sejumlah truk terutama yang mengangkut semen curah tetap melintas di Jln. Cirebon, Jln. Sisingamangaraja, Jln. Brigjen Katamso, Jln. Rahmadsyah, Jln. Sutomo, Jln. Ir. H. Juanda, Jln. Imam Bonjol, Jln. Gatot Subroto, Jln. Darusalam dan kawasan Padangbulan. Bebasnya truk masuk inti kota pada siang hari, membuktikan bahwa Operasi Simpatik Toba 2012 yang dicanangkan Kapoldasu Irjen PolWisjnu Amat Sastro tidak efektif. Buktinya, personel polisi di lapangan tidak mampu menghentikan aktivitas truk yang sangat meresahkan pengguna jalan ini. Bahkan di Jln. Rahmadsyah, sopir truk pengangkut semen curah seenaknya parkir menutupi separuh badan jalan sehingga menyebabkan kemacatan lalulintas, Sabtu (16/6). Sikap sopir truk tersebut mengisyaratkan bahwa mereka bisa berbuat sesuka hati dan kebal hukum. “Kalau truk-truk ini bisa bebas masuk inti kota Medan pada siang hari, apa gunanya Operasi Simpatik Toba 2012? Sebaiknya Operasi Simpatik Toba 2012 ini dihentikan, karena hanya menimbulkan kecemburuan sosial di kalangan pengguna jalan raya,” ujar Fadli, warga Medan Area. Pria yang berprofesi sebagai wiraswasta ini mempertanyakan mengapa polisi tidak

mampu menertibkan truk? “Kita lihat saja, jumlah truk pengangkut semen curah itu hanya sedikit. Paling tidak berkisar 20 unit. Tapi, mengapa sulit sekali menertibkannya? Berbeda dengan sepedamotor dan becak bermotor (betor) yang jumlah cukup banyak. Mengapa polisi hanya berani menindak sepedamotor dan betor,” tambahnya. Ditindak Sementara itu, petugas Sat Lantas Polresta Medan menindak truk pengangkut semen curah yang menjadi penyebab kemacatan di Jln. Rahmadsyah Medan, Sabtu (16/6) siang sekira pukul 11:30. Truk tersebut parkir di pinggir Jln. Rahmadsyah persis di depan rumah toko (ruko) berlantai III yang sedang dibangun. Keberadaan truk yang parkir sembarangan itu telah menyebabkan kemacatan lalulintas di sepanjang Jln. Rahmadsyah. Puluhan kendaraan bermotor yang datang dari arah Jln, Sisingamangaraja menuju ke Jln. Rahmadsyah terpaksa berhenti karena terjadi penyempitan ruas jalan akibat truk yang parkir sembarangan. Kasat Lantas Polresta Medan Kompol M Risya Mustario yang dikonfirmasi terkait masih adanya truk molen yang melintasi inti Kota Medan langsung mengambil tindakan. Seorang personel Sat Lantas langsung menilang sopir truk tersebut dan STNK nya ditahan. “Sopir truk tersebut sudah ditilang dan STNK-nya ditahan,” katanya. Melalui Operasi Simpatik Toba 2012, kata Risya, pihaknya tetap menilang truk-truk yang masuk inti kota. Selain mengganggu kelancaran arus lalulintas, truk-truk tersebut akan mempercepat kerusakan jalan raya. “Seharusnya truk-truk masuk inti kota pada waktu yang telah ditentukan operasionalnya yakni pada malam hari, namun para sopir truk membandal sehingga kita tindak tegas,” ujar Risya.(m36/h04)

Medan Butuh160 Kantong Darah Setiap Hari MEDAN (Waspada): Kota Medan membutuhkan 160 kantong darah setiap harinya. Namun kebutuhan akan darah baru bisa dipenuhi 100 kantong perhari. “Ini merupakan pekerjaan rumah PMI untuk lebih sering mensosialisasikan pentingnya donor darah, sehingga target kecukupan akan darah di Kota Medan terpenuhi,” kata dr Horas Rajaguguk, wakil ketua bidang kesehatan dan donor darah PMI Sumut, saat memperingati Hari Donor Darah se-Dunia di kantor PMI Sumut Jln. Perintis Kemerdekaan, Medan, Minggu (17/6). Pada acara itu, PMI Sumut menggelar gebyar donor darah dengan melibatkan Polri dan Kodam I/BB yang dalam waktu dekat memperingati HUT-nya. Horas Rajaguguk, sekaligus ketua pelaksana acara mengatakan, kegiatan bertema every blood donor is hero, mengajak masyarakat memaknai pentingnya donor darah bagi diri maupun orang lain. “Keikhlasan mendonorkan darah adalah sikap pebuatan seorang pahlawan, dimana setiap tetes darah yang diberikan memiliki manfaat bagi jutaan masyarakat,” ujar dia. Pada acara itu, PMI Sumut memberikan penghargaan kepada para pendonor rutin, juga menandatangani kesepakatan (MoU) dengan berbagai instansi, termasuk Perguruan Tinggi, Majelis Ulama Indonesia (MUI) dan lainnya, sehingga pelaksanaan donor darah dapat dilakukan rutin untuk memenuhi kebutuhan darah di Sumut. Saat bersamaan PMI Kota Medan juga melakukan MoU de-

ngan beberapa rumah sakit di Medan, dengan tujuan yang sama. “Dengan MoU tersebut, kebutuhan 160 kantong darah di kota Medan per hari bisa dipenuhi,” katanya sembari menyebutkan saat ini PMI baru bisa menyediakan 100 kantong per harinya. Tetapi, lanjut dia, angka 100 kantong per hari telah menunjukkan sebuah peningkatan signifikan dibanding beberapa tahun sebelumnya yang hanya mampu memenuhi 30 kantong per harinya. “Jumlah ini akan terus kita genjot, tidak hanya di Kota Medan saja, namun seluruh daerah di Sumatera Utara,” sebutnya. Sementara Ketua PMI Kota Medan Musa Rajeck Shah mengakui adanya peningkatan penyediaan kantong darah di Kota Medan, yakni lebih dari 3.000 kantung per bulan. Bahkan permintaan sejumlah instansi dan perusahaan, baik swasta maupun pemerintahjugasemakintinggiuntukmelakukandonor. Hal ini, menurutnya, sebuah pembuktian bahwa tingkat pengetahuan dan keinginan masyarakat terhadap pentingnya donor darah semakin meningkat. “Namun kita tidak harus berpuas diri, tetapi akan terus berupaya mensosialisasikan kepadamasyarakattentangpentingmendonorkandarah,” kata Musa Rajeck Shah yang akrab disapa Ijek. Pada acara itu, ratusan pendonor terlihat menyumbangkan darah, di antaranya dari Himpunan Pengusaha Muda Indonesia (HIPMI), TNI, AU, Polda, Polresta, MUI, Yayasan Surya Kebenaran Internasional (YSKI), serta persatuan sepeda ontel. Hari itu PMI Sumut menargetkan 400 kantong darah guna memenuhi kesediaan darah, baik untuk Kota Medan maupun daerah lainnya di Sumut.(m27)

Saat Ini, BAN-PT Hanya Proses Akreditasi UISU Jln. Karya Bakti MEDAN (Waspada): Keputusan Rapat Pleno Badan Akreditasi Nasional Perguruan Tinggi (BAN PT) yang dituangkan dalam surat Nomor:929/BAN-PT/LL2012 menyatakan, saat inihanyamemprosesakreditasiUniversitas Islam Sumatera Utara (UISU) kampus IV beralamat di Jln. Karya Bakti, Medan Johor. “Beradasarkan hasil rapat pelno BANPT tanggal 1 Juni 2012, dinyatakan bahwa yang diproses akreditasinya adalah UISU yang diselenggarakan yayasan dengan pimpinan Ketua Prof. Dr. Usman Pelly MA,” kata Humas UISU Fauziah Dongoran, Minggu (17/6) seraya menyerahkan fotokopi surat BAN-PT tersebut kepada Waspada. Katanya, surat keputusan rapat pleno tersebut disampaikan BAN-PT melalui surat Nomor 929/BAN-PT/LL/2012 perihal legalitas UISU KampusVI Jln. Karya Bakti No. 34, Kel. Pangkalan Masyhur, Kecamatan Medan Johor dan Kampus UISU Jln. Sisingamangaraja. Hasil pengamatan Waspada, Surat BANPT itu ditembuskan ke Sekretariat Eksekutif BAN-PT, Dirjen Dikti Kemdikbud, Dir Kelembagaan dan Kerjasama Ditjen Dikti serta Koordinator Kopertis Wilayah I. Menurut Fauziah, kepetusan itu mengacu kepada surat dari Direktur Kelembagaan dan Kerjasama Direktorat Jenderal Pendidikan Tinggi Kementerian Pendidikan dan Kebudayaan Nomor: 3226/E2.2/2012 tanggal 16 Mei 2012 perihal legalitas UISU di Medan. Latar belakang terbitnya Surat BAN-PT Nomor 929/BAN-PT/LL/2012, kata Fauziah

karena adanya permintaan dari Koordinator KopertisWilayahINomor202/K1.2.1/PS/2012tanggal 2 April 2012 yang meminta UISU KampusVI Jln. Karya Bakti No. 34 Kelurahan Pangkalan Masyhur, Kecamatan Medan Johor Medan dan Kampus UISU Jln. Sisingamangaraja sama-sama diakreditasi. Menyikapi surat dari Koordinator Kopertis Wilayah I tersebut, kata Fauziah, pihak BAN-PT mempertanyakannya kepada Direktur Kelembagaan dan Kerjasama Kementerian Pendidikan dan Kebudayaan, Direktorat Jenderal Pendidikan Tinggi tentang legialitas UISU di Medan. Berdasarkan Surat Mendiknas No.131/MPN/ DT/2009 tanggal 11 September 2009, yang ditujukan kepada Ketua Umum Pengurus Yayasan UISU Up. Prof. Dr. Usman Pelly, MA, Yayasan UISU yang sah adalah yayasan yang dipimpin Prof. Dr. Usman Pelly, MA. Seperti yang tersebut dalam Putusan Mahkamah Agung RI Nomor 150/K/TUN/2008 tanggal 16 Februari 2009; Surat Direktur Jenderal Administrasi Hukum Umum, Departemen Hukum dan Hak Asasi Manusia Nomor C.HT.01-14 tanggal 3 April 2007 perihal Penegasan Yayasan UISU yang sah; Surat Direktur Jenderal Administrasi Hukum Umum, Departemen Hukum dan Hak Asasi Manusia Nomor AHU-AH.01.08-418 tanggal 16 Juli 2009 perihal Yayasan UISU. Ketua Yayasan UISU Jln. Karya Bakti Medan Prof Usman Pelly dan Rektor UISU Dr Ir Mhd Asaad MSi ketika dikonfirmasi mengakui sudah menerima surat itu. “Alhamdulillah UISU Jln. Karya Bakti diproses akreditasinya, “ kata keduanya ketika dihubungi secara terpisah. (m49)

Medan Metropolitan

WASPADA Senin 18 Juni 2012


Aksi Mogok Makan Bertahan Di DPRDSU

Dewan Lebih Pilih Kunker MEDAN (Waspada): Nasib Kelompok Tani Torang Jaya Mandiri (KTTJM) semakin tidak jelas. Sampai Minggu (17/6), mereka masih bertahan dengan melakukan aksi nginap di depan kantor DPRD Sumut. Sementara anggota dewan belum menunjukkan sikap apapun,

sedangkan pengusaha tetap berpedoman kepada aturan tentang kepemilikan lahan. Perwakilan masyarakat Kab.Padang Lawas (Palas) yang tergabung dalam KTTJM mulai melakukan unjukrasa di depan kantor DPRD Sumut sejak tanggal 6 Juni 2012. Mereka mendi-

Waspada/Rudi Arman

KANIT Reskrim AKP Faidir Chaniago menunjukkan barang bukti 1 ons ganja yang diamankan dari tersangka A (tengah) diapit anggota tugas luar di ruang kerjanya.

Pengedar Ganja Diciduk MEDAN (Waspada): Polsek Percut Seituan menciduk pengedar ganja saat transaksi dengan pembeli tidak jauh dari kediamannya di Jln. Sejati, Kel. Bantan, Kec. Medan Tembung, Kamis (14/6). Dari tersangka A, 40, polisi menyita barang bukti 1 ons dan 11 paket ganja siap edar. Kapolsek Percut Seituan Kompol Maringan Simanjuntak melalui Kanit Reskrim AKP Faidir Chaniago kepada wartawan mengatakan, penangkapan tersangka A berawal adanya informasi dari warga. Tersangka ditangkap ketika hendak bertransaksi dengan pembelinya di salah satu wa-

Dua Rumah Musnah Terbakar MEDAN (Waspada): Dua rumah musnah terbakar di Jalan Bhayangkara, Kec. Medan Tembung, Jumat (15/6). Tidak ada korban jiwa dalam peristiwa tersebutsedangkankerugianditaksir mencapai puluhan juta rupiah. Rumahyangterbakaritumilik Edi, 40, yang membuka rumah makan dan Sulastro, 52, saat kejadian tidak berada di rumah. Peristiwa berawal ketika korban Edi, bersama karyawannya sedang memasang nasi. Tiba-tiba gas yang digunakan untuk memasak habis. Korban kemudian keluar dari dapur untuk mengambil gas. Selang beberapa menit saat korban kembali, dapurnya sudah terbakar. Korban berusaha memadan api tapi tidak berhasil. Api terus berkobar dan merembet ke rumah milik Sulastro yang ada di sebelahnya. Beberapa unit mobil pemadam kebakaran yang tiba di lokasi berhasil memadam api. Namun kedua rumah tersebut sudah musnah terbakar. Kapolsek Percut Seituan Kompol Maringan Simanjuntak mengatakan, pihaknya masih melakukan pemeriksaan terhadap pemilik rumah. (m39)

Gubsu Mendatang Harus Mampu Bawa Perubahan MEDAN (Waspada): Gubernur Sumatera Utara (Gubsu) mendatang harus mampu membawa perubahan signifikan bagi kesejahteraan masyarakat. Kepentingan umum diharapkan menjadi prioritas utama. “Masyarakat harus selektif dan bijaksana memilih calon gubsu mendatang, artinya jangan sampai masyarakat salah pilih, seperti memilih kucing dalam karung,” kata tokoh pemuda Kelurahan Perintis, Kec. Medan Timur SK Gultom (foto), Kamis (13/6). Menurut Gultom, Gubsu yang terpilih nanti tetap mengutamakan kepentingan umum daripada kelompok atau partainya.”Pemimpin masa depan harus sosok yang amanah dan bisa menyahuti aspirasi semua pihak,” ujarnya. (m49)

rung tak jauh dari kediamannya. “Saat itulah tersangka kita tangkap dan dari saku celananya ditemukan barang bukti 11 paket ganja,” kata Faidir. Polisi kemudian melakukan pengembangan dengan menggeledah kediaman tersangka. Dari rumah tersangka ditemukan lagi bungkusan kertas koran berisikan 1 ons ganja. Ketika dilakukan pemeriksaan, tersangka mengaku sudah empat tahun sebagai bandar narkoba. Itu dilakukannya, karena selama ini dirinya tak mempunyai pekerjaan tetap. Kata Faidir, pihaknya akan menangkap pemasok barang haram tersebut, yang di sebutsebut bandar besarnya. “Kita terus memburu bandar besarnya,” sebutnya. (m39)

rikan tenda di depan pagar gedung dewan. Harapannya, para wakil rakyat itu terketuk hatinya untuk membantu menyelesaikan kasus mereka. Untuk meraih simpatik lebih besar, malah beberapa orang di antaranya melakukan mogok makan dan aksi jahit mulut. Tapi usaha masyarakat itu tampaknya sia-sia. Buktinya, walaupun sudah 11 hari mereka nginap di sekitar gedung dewan, tapi tidak ada reaksi dari dewan. Mungkin hanya Wakil Ketua DPRD Sumut Chaidir Ritonga, yang awalnya memberikan respon. Itupun kemudian berhenti, setelah dia tidak dapat lagi menghubungi Kapolres Tapsel dan Kapoldasu. Kepada Waspada sebelumnya Chaidir Ritonga mengatakan, polisi tidak mau mengalah. Setelah bertemu dengan pengunjukrasa, Chaidir mengaku langsung menghubungi Kapolres Tapanuli Selatan (Tapsel) dan Kapoldasu. “Tapi permintaan warga tidak diserpon. Kalau sudah seperti ini kan sulit. Karena kita (DPRD Sumut) bisa apa?,” sebutnya. Sikap keras juga ditunjukkan oleh perusahaan PT Sumatera Riang Lestari (SRL) dan PT Sumatera Sylva Lestari (SSL). Humas kedua perusahaan ini Andhika dan Haryanto Halim, mengaku mau berunding, tapi tetap berdasarkan hukum. Menurut keduanya, mereka sama sekali tidak merampas tanah masyarakat. PT SRL dan PT SSL sudah mengantongi izin HPH sejak tahun 1978. Selanjutnya tahu 1992 Menteri Kehutanan mengeluarkan lagi Izin Usaha Pengelolaan Hasil Hutan Kayu – Hutan Tanaman Industri (IUPHHK-HTI) seluas 65.000 hektare. Dari izin yang diberikan, kata Andhika, terlihat kalau perusahaan mereka bukan baru berada di Padang Lawas dan menyerobot lahan masyarakat. Katanya, sudah menjadi kewajiban bagi pemegang IUPHHK-

HTI untuk menjaga dan mempertahankan kawasan hutan untuk tetap menjadi hutan yang mampu bernilai ekonomis, sosial, konservasi, dan ekologi. Tentang pembakaran rumah yang dituduhkan warga, juga dibantah oleh Andhika dan Haryanto Halim. Mereka menyebut hanya menertibkan gubuk-gubuk liar yang tidak jelas pemiliknya yang berada dalam areal kerja perusahaan yang didirikan tanpa izin. Pilih kunker Walaupun sudah 11 hari masyarakat Kab. Padang Lawas (Palas) nginap di sekitar gedung DPRD Sumut, namun tidak membuat gusar anggota dewan. Mereka lebih memilih melakukan kunjungan kerja (kunker) dan menghadiri rapat paripurna, ketimbang menanggani masalah ini. Dewan juga saling mencari celah untuk membela diri. Anggota Komisi A DPRD Sumut Syamsul Hilal saat dihubungi Waspada melalui telepon selular, Minggu (17/6), mengaku pihaknya belum sedikitpun membahas masalah sengketa lahan masyarakat dengan PT SRL dan SSL tersebut. Alasannya, karena Komisi A masih disibukkan oleh urusan tugas luar kota dan rapat paripurna.

Kata Syamsul Hilal, saat unjukrasa tanggal 6 Juni 2012, pengunjukrasa bukan diterima oleh personel Komisi A, tapi oleh anggota dewan dari komisi lain. Kemudian, staf dewan tidak membuat laporan ke Komisi A sampai akhir pekan. Hal itu juga yang dilakukan olehWakil Ketua Chaidir Ritonga. Pada hari Senin pekan lalu, kata Syamsul, Komisi A tidak sempat membahas masalah ini karena ada rapat paripurna. Kemudian pada hari Rabu nya, dewan berangkat tugas ke Jakarta dan baru pulang Sabtu (16/6). “Dan besok, (hari ini) rapat paripurna lagi,” katanya. Menjawab pertanyaan, Syamsul Hilal, mengatakan bukan dewan lebih memilih kunjungan kerja darpada mengurusi pengunjukrasa. Tapi memang tidak boleh anggota dewan tidak mengikuti kunjungan kerja ke luar provinsi. Katanya, semua anggota komisi yang bertugas harus ikut. Kalau ada peristiwa terjadi di gedung dewan, untuk sementara ditangani oleh anggota dewan yang kena giliran piket. “Tapi waktu kami (Komisi A) berada di Jakarta, masalah ini sudah kita bahas juga. Tapi memang belum ditangani secara serius,” ujarnya. (m12)

Waspada/Surya Efendi

SEORANG petani dengan mulut dijahit terduduk lemah di depan gedung DPRDSU, Minggu (17/6). Sudah sebelas hari belasan petani asal Kab. Padang Lawas berunjukrasa dengan mogok makan, mendesak pemerintah membantu mereka menyelesaikan sengketa tanah dengan dua perusahaan hutan tanaman industri (HTI).

Waspada/Mursal AI

DIREKTUR Bina Pelayanan Kesehatan Tradisional Alternatif dan Komplementer dr. Abidinsyah Siregar, DHSM, M.Kes (kanan) saat menyampaikan materi tarkait kebijakan pemerintah tentang pelayanan kesehatan tradisional, Sabtu (16/6).

Puskesmas Dan RS Harus Gabungkan Pelayanan Kesehatan Tradisional Dengan Modern MEDAN (Waspada): Setiap kabupaten/ kota di Indonesia harus mempunyai program pelayanan kesehatan tradisional baik untuk tingkat Puskesmas dan rumah sakit hingga tahun 2014. Terkait program ini, Kemenkes RI sedang menyusun rencana strategisnya. Dua Puskesmas di setiap kabupaten/kota harus menerapkan hal tersebut. Saat ini, sudah ada 200 Puskesmas dan 70 rumah sakit yang menjalankan program ini, yaitu menggabungkan pelayanan kesehatan modern dengan pelayanan kesehatan tradisional. Hal itu disampaikan Direktur Bina Pelayanan Kesehatan Tradisional Alternatif dan Komplementer (Tradkom) Kementrian Kesehatan RI dr. Abidinsyah Siregar, DHSM, MKes kepada wartawan disela-sela Simposium Nasional Herbal Medik, Penerapan Complementary Alternative Medicine (CAM), Herbal Medik dan Akupuntur Dalam Pelayanan Kesehatan yang diadakan PT. Sidomuncul bersama Perhimpunan Dokter Herbal Medik Indonesia (PDHMI), Perhimpunan Dokter Spesialis Akupuntur Medik Indonesia (PDAI) dan IDI Sumut di RSU Dr Pirngadi, Sabtu (16/6). Menurutnya, tidak ada alasan Indonesia bisa tertinggal dari negara-negara lain dalam hal pelayanan kesehatan tradisional. Kementerian Kesehatan telah merekomendasikan beberapa rumah sakit boleh menjalankan pengobatan dengan cara tradisional medik seperti akupuntur, herbal medik seperti tanaman tertentu yang diubah menjadi kapsul, serta akupresser atau pijatan tertentu untuk menghilangkan rasa sakit. “Tiga sistem pelayanan kesehatan tradisional ini telah direkomendasikan. Artinya, kita jangan berharap lagi dengan obatobat modern. Ternyata banyak sistem pengobatan non modern yang mempunyai khasiat sama. Dengan catatan, harus tetap

ada kombinasi antara keduanya,” kata Abidinsyah. Keberadaan tanaman herbal bukan hanya bisa berperan di Indonesia, tetapi berkontribusi di tingkat dunia. “Hal ini dikarenakan ketersediaan bahan tradisional kita terbesar dan nomor satu di dunia, bahan tradisional kita mengalahkan Brasil dan Angola. Semua itu bisa digunakan untuk kesehatan, bukan hanya untuk pengobatan,” tegasnya. Meski dalam hal bahan baku Indonesia unggul, namun justru yang banyak beredar adalah obatobat herbal atau tradisional dari China dan Jepang. Kementerian Kesehatan mencatat hanya ada tujuh obat herbal atau tradisional yang masuk ke dalam phito farmaka. Padahal ada ribuan jenis tumbuhan yang bisa dimanfaatkan jadi obat tradisional dan baru 38 obat herbal berstandar asli Indonesia. Sementara itu, Prof Dr Edi Dharmana dari Pengurus Besar Ikatan Dokter Indonesia (IDI) mengatakan, obat herbal atau sistem pelayanan kesehatan herbal sebenarnya sudah dikenal sejak puluhan bahkan ratusan tahun lalu. Namun kendalanya sosialisasi di tingkat masyarakat perkotaan, serta belum adanya bukti empiris dan fakta-fakta penelitian terkait khasiat obat herbal atau pengobatan tradisonal ini. “Selama ini, pembuktiannya hanya didasari oleh pendapat orang-orang terdahulu, sementara belum ada pembuktian yang ilmiah akan hal itu,” ujarnya. Sedangkan Senior Public Relation PT. Sidomuncul Nanik R Sunarso menambahkan, seminar ini bertujuan untuk memahami perlunya dilakukan implementasi sesegera mungkin guna penerapan pelayanan CAM dalam hal ini akupuntur dan herbal medik pada pelayanan kesehatan primer sampai rumah sakit. “Medan merupakan kota ke-21 yang melaksanakan simposium ini. Sidomuncul terus mensosialisasikan penggunaan herbal. Diharapkan dunia kedokteran serta masyarakat di Indonesia mengerti dan mengetahui tentang hasil penelitian perkembangan mengenai obat herbal di Indonesiam,” ujarnya. (h02)

Medan Metropolitan Produk Pertanian Sumut Kalah Bersaing A6

MEDAN (Waspada): Pelaksana Tugas (Plt) Gubernur Sumatera Utara (Gubsu) H Gatot Pujo Nugroho ST mengemukakan, penyuluh merupakan ujung tombak pembangunan pertanian dan perdesaan. ”Ujung tombak perbaikan ada di tangan penyuluh. Maka saya mengucapkan apresiasi sebesar-besarnya pada para penyuluh yang hingga saat ini setia mendampingi para petani. Kemudian saya mengajak semua pemangku kepentingan pertanian harus memperkuat peran penyuluh,” katanya pada

acara pendistribusian kendaraan roda dua untuk penyuluh provinsi dan kabupaten/ kota, di Sekretariat Bakorluh Provsu, Jumat (15/6). Gatot mengatakan, produkproduk pertanian pernah mengalami masa kejayaan dan keemasan seperti yang terjadi pada era orde baru. “Harus diakui sekarang di era reformasi atas nama otonomi daerah sering kali bidang pertanian agak dilewatkan dan terlupakan, makanya di dalam setiap pertemuan saya sering sampaikan ke produk pertanian kita kalah saing dengan produk Thailand dan Malaysia,” ujarnya. Untuk itu, mari kita perkuat produksi pertanian kita yang

ujung tombaknya adalah dari para penyuluh yang dengan fungsinya mendampingi para petani, untuk kembali kepada masa keemasan yang pernah dicapai pada masa orde baru. Walau begitu, pihaknya bersyukur telah ada peningkatan terus menerus pada produksi pertanian. “Saya baru diskusi dengan dinas pertanian, bahwa produksi pertanian kita terus meningkat seperti produksi jagung dan lainnya tentu ini tak lepas dari peran para penyuluh kita,” tuturnya. Kepala Badan Koordinasi Penyuluhan (Bakorluh) Pertanian, Perikanan dan Kehutanan Provinsi Sumut Pulung Hutabarat mengungkapkan, untuk

menjamin ketersediaan produksi beras nasional, maka pemerintah telah melakukan berbagai gerakan yang melibatkan semua pemangku kepentingan, yakni melalui Program Peningkatan Produksi Beras Nasional (P2BN). ”Seiring dengan itu, pemerintah meningkatkan sarana dan perasarana dengan memberikan kendaraan roda dua kepada penyuluh guna meningkatkan kinerja penyuluh pertanian di lapangan, sehingga target surplus beras 2014 dapat tercapai,” sebutnya. Melalui Kementerian Pertanian, untuk Sumatera Utara dialokasikan kendaraan roda dua 147 unit yang didistribusi-

kan yakni 7 unit untuk Provsu dan 140 unit kepada penyuluh pertanian dari 28 kabupetan/ kota di Sumut, yang diserahkan secara simbolis oleh Plt Gubsu H Gatot Pujo Nugroho, ST. Disamping itu juga, lanjutnya, untuk meningkatkan kinerja, pemerintah mengucurkan dana anggaran 2011 melalui APBD Provinsi Sumut, telah dialokasi dana perluasan Bakorluh untuk pembangunan gedung berlantai dua. Dalam kesempatan itu Plt Gubsu H Gatot Pujo Nugroho meresmikan gedung baru Bakorluh Provsu dengan penandatanganan prasasti dan melakukan dialog langsung dengan seluruh penyuluh yang hadir.(m28)

Korban Eksekusi Adukan Oknum Advokat Ke DK Peradi

Waspada/M.Ferdinan Sembiring

REKTOR UISU Al-Manar Mhd. Asaad MSi, melantik Ketua dan Sekretaris Prodi S1 dan S2 Fak. Sastra, di Auditorium Kampus UISU.

Rektor UISU Lantik Ketua, Sekretaris Prodi Fak Sastra MEDAN (Waspada): Rektor Universitas Islam Sumatera Utara (UISU) Al-Manar Jln. Karya Bakti Medan Dr Ir Mhd. Asaad MSi, melantik Ketua dan Sekretaris Program Studi (Prodi) S1 dan S2 Fakultas Sastra masa bakti 2012-2016, di Auditorium kampus tersebut, baru-baru ini. Pelantikan itu dihadiriWakil Rektor, Dekanat se-UISU, Wakil Dekan, Ketua dan Sekretaris Prodi se-UISU, Kepala Biro, Lembaga di Lingkungan UISU, dan dosen serta mahasiswa Prodi S-1 dan S-2 Fakultas Sastra UISU. Ketua dan Sekretaris Program Studi S2 masa bakti 20122016 yang dilantik yakni Prof Drs H Jumino Suhadi, dan Drs M Manugeren MA. Sedangkan Ketua dan Sekretaris Program Studi S1 masa bakti 2012-2016 adalah Hj Asnani SS. MPd dan Susi Ekalestari SS. M.Hum yang sebelumnya dijabat oleh Drs M Amrin Siregar MA, sebagai Ketua Prodi S1 dan M Ali Pawiro SS, MA, sebagai sekretaris

Program Studi S1 masa bakti 2007-2011. Rektor UISU Mhd. Asaad mengharapkan pejabat baru yang dilantik terus berkomitmen dalam melaksanakan program kerja UISU secara umum maupun Fakultas Sastra secara khusus. Dia meminta kesediaan seluruh elemen civitas akademika UISU untuk bekerja keras dalam merekrut mahasiswa baru serta berdedikasi tinggi dalam melaksanakan tugas dan loyal kepada UISU. Dekan Fakultas Sastra UISU Purwarno SS. MA menambahkan, pihaknya optimis Fakultas Sastra UISU akan menjadi salah satu fakultas terbaik di Sumatera Utara, karena mempunyai Ketua dan Sekretaris Prodi yang memiliki visi dan misi cemerlang untuk meningkatkan mutu pendidikan di Fakultas Sastra. “Dengan kerja keras, dibarengi dengan niat yang ikhlas, akan menghasilkan sesuatu yang baik dan diridhoi oleh Allah SWT,” ujarnya. (m49)

MEDAN (Waspada): Warga korban eksekusi di Jln. Jati Kelurahan Pulo Brayan Bengkel, Kecamatan Medan Timur, mengadukan seorang oknum advokat ke Dewan Kehormatan Perhimpunan Advokat Indonesia (Peradi) Sumut di Jln. Brigjen Katamso Medan, Jumat (14/6). Empat warga Jln. Jati yakni Demak Tobing, Sukasno, Sofyan dan Marice Br Siahaan mengadukan advokat berinisial AH, SH selaku kuasa hukum Abdul Kiram bersama 23 KK, atas pernyataannya di salah satu media terbitan Medan bahwa sertifikat tanah warga tersebut palsu dan terkait pengajuan permohonan eksekusi ke PN Medan dan dikabulkan PN Medan. Akibat putusan Pengadilan Negeri Medan No.113/Pdt.G/2006/PN tahun 2011, lahan dan rumah warga dieksekusi dan dihancurkan pada 27 Juni 2011. Demak Tobing, 54, didampingi sejumlah warga korban eksekusi Jln. Jati Kelurahan Pulo Brayan Bengkel, Kecamatan Medan Timur usai membuat pengaduan ke DK Peradi Sumut mengatakan, mereka mengadukan advokat AH, SH selaku kuasa hukum Abdul Kiram, karena telah menuduh warga memiliki sertifikat palsu yang disiarkan/ dipublikasikan melalui salah satu media massa terbitan Medan. Padahal tanah yang merupakan hak milik mereka, jelasjelas memiliki sertifikat asli yang sah dan hingga sekarang/saat ini belum pernah dibatalkan oleh BPN. Hal itu sudah dipertegas pegawai BPN Sumut dalam persidangan di PN Medan yang menyatakan bahwa sertifikat warga Jln. Jati sah dan asli. Selain itu, bangunan milik war-

ga yang dirubuhkan telah memiliki IMB. Mereka juga mengadukan advokat AH, SH yang mengaku secara tertulis mendapat surat kuasa khusus dari Abdul Kiram dkk pada 10 September 2009 dan mengajukan permohonan eksekusi serta dikabulkan Ketua PN Medan sesuai penetapan No.20/Eks/2010/113/Pdt.G/PN Medan tanggal 7 september 2010. Eksekusi penghancuran rumah penduduk dilakukan pada 27 Juni 2011 . Sementara pada putusan no 113/Pdt.G/ 2006/PN Medan tersebut tidak terdapat satu pun nama warga. Padahal yang berperkara adalah Abdul Kiram dkk, dengan Ruslim Lugianto dan bukan dengan warga Jln. Jati Medan. Hal itu terbukti, ketika dalam persidangan, kuasa hukum tergugat Abdul Kiram dkk, tidak

mampu menghadirkan orangorang yang namanya disebutkan sesuai putusan No.113/ Pdt.G/2006/PN Medan. Karena nama-nama dan orang yang tertera dalam putusan itu ternyata fiktif dan tidak sesuai dengan KTP-nya. Seperti nama Abdul Kiram yang tertera di KTP bernama Mat Dul Kiram, Erwin di dalam KTP tertera nama M Darwin, Sofyan tertera di KTP Mi Sofyan, Nasib Suryono di KTP Nasib Supeno dan lainnya. Akhirnya, Majelis Hakim membatalkan nama-nama yang tertera di dalam putusan No.113/Pdt.G/ 2006/PN Medan. Berdasarkan hal itulah, Demak Tobing, Sukasno, Sofyan dan Marice Br Siahaan selaku korban eksekusi mengadu ke Dewan Kehormatan Peradi Sumut. (h04)

Waspada/Rudi Arman

PJS Kasat Res Narkoba Polresta Medan AKP Baktiar Marpaung menunjukkan barang bukti sabu-sabu kepada tersangka Ipan di ruang kerjanya.

Jual Narkoba Kepada Polisi Diringkus MEDAN (Waspada): Seorang kurir narkoba diringkus Sat Narkoba Polresta Medan saat bertransaksi kepada polisi yang menyaru sebagai pembeli sabu-sabu, di kawasan Jln. Karya Wisata, Kel. Pangkalan Mansyur, Kec. Medan Johor, Kamis (14/ 6) sekira pukul 20:00. Dari tersangka Ir alias Ipan, 36, warga Gang Buntu, Desa Bandarsetia, Kec. Percut Seituan, disita barang bukti 69 gram sabu-sabu. Informasi yang diperoleh di kepolisian, tersangka Ipan dengan mengendarai sepedamotor datang ke kawasan Jln. Karya Wisata, untuk mengantarkan pesanan sabu kepada seorang pemesannya. Setelah bertemu dan hendak menyerahkan bungkusan sabu-sabu tersebut, tersangka langsung disergap oleh pembelinya yang ternyata petugas kepolisian yang menyaru.

Tersangka saat dimintai keterangannya di Mapolresta Medan, Jumat (15/6) mengatakan, dirinya hanya sebagai kurir dan mendapat upah sebesar Rp500 ribu untuk mengantar sabu-sabu tersebut kepada pembeli.“Saya cuma kurir, kalau ngantarkan sabu ini saya dapat upah Rp500 ribu,” ujarnya. Dia mengaku mengaku mendapatkan sabu-sabu tersebut dari seorang bandar narkoba berinisial De yang kini meringkuk dalam sel LP Tanjunggusta. Sementara itu, Pjs Kasat Res Narkoba Polresta Medan AKP Baktiar Marpaung menjelaskan, tersangka Ipan diringkus berkat informasi dari warga. Menurut Marpaung, tersangka Ipan dijerat Pasal 114 Ayat 2 subsider Pasal 112 Ayat 2 UURI Tahun 2009 tentang narkotika dengan ancaman hukuman minimal 5 tahun penjara.(h04)

WASPADA Senin 18 Juni 2012

Waspada/Amir Syarifuddin

PLT GUBSU Gatot Pujo Nugroho berdialog dengan para penyuluh pertanian pada acara penyerahan bantuan kendaraan roda dua kepada penyuluh tersebut, di Kantor Bakorluh Provsu.

Oknum Mahasiswa Cabuli Siswi SMA Ditangkap MEDAN (Waspada): Seorang oknum mahasiswa yang mencabuli secara paksa siswi SMA di satu hotel di Jalan Jamin Ginting Medan, ditangkap orangtua korban bersama polisi, Kamis (14/6) sore. Tersangka berinisial RDP, 19, warga Medan Selayang, diserahkan ke Unit PPA Polresta Medan. Informasi yang diperoleh di kepolisian, Jumat (15/6), korban berinisial M ,16, warga Jalan AR Hakim Medan dan kekasihnya RDP yang baru dua minggu berpacaran, sebelumnya ditelefon oknum mahasiswa itu mengajak jalan-jalan. Selanjutnya, tersangka dan korban dengan mengendarai sepedamotor milik RDP pergi jalan-jalan di seputaran Kota Medan. Namun, beberapa jam kemudian, usai makan siang, RDP melajukan sepedamotornya ke arah Jalan Jamin Ginting, Padangbulan. Persis di satu penginapan, RDP membelokkan sepeda-

motornya dan langsung masuk ke lokasi penginapan tersebut. Korban awalnya menolak diajak masuk ke penginapan tersebut dan meminta kekasihnya itu mengantarkan dia pulang. Namun tersangka RDP menolak permintaan korban. Bahkan, tersangka memukul wajah korban. Tak hanya itu, RDP juga memiting korban hingga lemas dan kemudian mencabulinya. Saat tersangka RDP tertidur, diam-diam korban mengirim pesan singkat kepada orangtuanya agar segera menjemputnya di satu kamar hotel. Orangtua korban, Iwan ,40, yang menerima SMS dari putrinya itu segera menghubungi petugas kepolisian dan bersama-sama mendatangi kamar hotel tempat keduanya menginap. Polisi bersama orangtua korban menggerebek kamar keduanya menginap. Tersangka RDP tak berkutik ketika polisi membawanya ke Unit PPA Polresta Medan. (h04)

Pengemudi Betor Larikan Barang Penumpang MEDAN (Waspada): Mobil mainan anakanak seharga Rp1,5 juta milik pegawai Angkasa Pura Accun Purba, 26, dilarikan pengemudi becak bermotor (betor), Kamis (14/6) malam. Korban kemudian melaporkan kejadian itu ke Polsek Medan Baru. Saksi mata kepada Waspada mengatakan, kejadian itu terjadi Kamis malam pukul 21:00. Korban Accun, penduduk Jln. AH Nasution Gg. Permai, Medan Johor, dengan mengendarai sepedamotor pergi ke Medan Fair Plaza Jln. Gatot Subroto Medan, untuk mengambil mobil mainan anak-anak yang sudah dibelinya pada Rabu (13/6). Selanjutnya dia membawa barang mobil mainan itu yang dibungkus dengan kardus coklat dari toko penjualnya. Korban bermaksud membawanya barang tersebut pulang, namun tidak bisa dibawa pakai sepedamotor. Korban lalu memanggil betor yang sedang melintas di depan Medan Fair Plaza. Setelah

cocok masalah ongkos, korban menaikkan barang tersebut ke betor, sedangkan dia mengikuti dengan mengendarai sepedamotor. Ketika korban berhenti di Jln. S Parman simpang Jln. Sudirman karena traffic light lagi merah, dia melihat dari kaca spionnya ternyata betor yang membawa mobil mainan tersebut tidak terlihat. Setelah ditunggu beberapa saat, pengemudi betor itu tidak muncul, akhirnya korban melakukan pencarian dengan mengitari lokasi jalan yang sudah dilalui, namun betor itu tidak kelihatan lagi. Selanjutnya korban membuat laporan pengaduan ke Polsek Medan Baru. Kapolsek Medan Baru Kompol Dony Alexander SH, SIK, M.Hum mengatakan, pihaknya telah menurunkan personel ke lokasi kejadian mengumpulkan berbagai informasi baik dari korban maupun saksi di lapangan.“Kita telah mengambil keterangan korban dan saksi lainnya. Sedangkan pengemudi betor masih dalam pencarian,” sebutnya. (m36)

Harmonisasi TNI Dan Rakyat Harus Dipertahankan MEDAN (Waspada): Kebersamaan, harmonisasi dan sinergitas antara TNI dan rakyat harus tetap dijaga dan dipertahankan. Pasalnya, TNI berasal dari rakyat dan bertugas bukan hanya sebagai aparatur pertahanan dan keamanan demi menegakkan NKRI, tapi juga sudah menjadi bagian dari rakyat. “Begitu juga dengan kebudayaan peninggalan nenek moyang bangsa Indonesia, yaitu gotong royong. Ini harus dilestarikan dan direalisasikan secara berkelanjutan,” kata Danramil 01/Medan Barat Kapten Czi TM Panjaitan, di sela-sela kegiatan karya bakti menyambut HUT ke-62 Kodam I/BB di wilayah pembinaan teritorial Koramil 01/MB, Jumat (15/6). Pada karya bakti ini, sebanyak 147 orang dilibatkan dalam kegiatan pembersihan jalan dan parit tersebut. Mereka terdiri dari 30 prajurit Raider/100, 10 prajurit Paldam I/BB, 12 prajurit Koramil 01/MB, 10 petugas Polsek Medan Barat, 45 orang dari OKP dan 40 masyarakat setempat. Selain membantu pemerintahan Kota Medan untuk mewujudkan keindahan, kebersihan dan kenyamanan di tengah-tengah mas-

yarakat, karya bhakti ini juga sebagai wujud dari rasa kepedulian prajurit Kodam I/BB, khususnya Koramil 01/MB dalam membantu warga menciptakan lingkungan yang bersih, nyaman dan indah. “Keharmonisan dalam karya bhakti bekerjasama dengan unsur muspika setempat seperti ini harus terus dipupuk dan dipertahankan demi tercipta rasa kebersamaan maupun kemanunggalan antara TNI dengan rakyat,” sebutnya. Bersihkan parit Sementara itu, karya bakti juga diadakan diwilayah Koramil 03/Medan Denai. “Karya bakti ini juga untuk lebih mendekatkan diri kepada masyarakat, karena TNI ini berasal dari masyarakat dan untuk masyarakat juga,” kata Danramil 03/Medan Denai Kapt. Inf. Hari Susilo. Menurut dia, karya bakti kali ini, anggota TNI di wilayah Koramil 03/Medan Denai melakukan pembersihan parit. Hal ini dilakukan agar jika hujan, parit ini berjalan lancar sehingga tidak ada yang tumpat bisa menyebabkan banjir. “Mudah-mudahan karya bakti ini bisa mengugah masyarakat agar lebih peduli akan kebersihan lingkungan,” ujar Susilo. (h02)

Polsek Medan Area Bersihkan Pasar Sukaramai MEDAN (Waspada): Sebanyak 50 personel Polsek Medan Area dipimpin Kapolsek Kompol SonnyW Siregar melakukan gotong royong dengan membersihkan kawasan Pasar Sukaramai dan sekitarnya, Sabtu (16/6). Menurut Sonny Siregar, kegiatan gotong royong itu dilaksanakan dalam rangka menyambut HUT ke-66 Bhayangkara. “Kita melibatkan puluhan personel dari seluruh unit yang ada untuk membersihkan kawasan Pasar Sukaramai ini sehingga menimbulkan kenyamanan bagi warga yang ingin berbelanja maupun warga sekitarnya. Kegiatan ini dalam rangka menyambut HUT ke-66 Bha-

yangkara yang jatuh pada tanggal 1 Juli 2012,” sebutnya. Kata dia, selain gotong royong, pihaknya juga menggelar Operasi Simpatik Toba 2012 dengan melibatkan Unit Lantas Polsek Medan Area agar pengendara kendaraan bermotor tertib berlalulintas sekaligus menekan angka kecelakaan lalulintas serta mengantisipasi kemacatan arus lalulintas. “Dalam Ops Simpatik ini kita lebih menekankan pemberian teguran daripada penindakan kepada pengendara kendaraan bermotor yang melanggar peraturan lalulintas seperti pengendara sepedamotor tidak menghidupkan lampu utama di siang hari,” kara Sonny. (m39)


SEJUMLAH anggota TNI AD membersihkan parit atau selokan sekitar rumah warga di wilayah Koramil Medan Barat.

Laporan Khusus

WASPADA Senin 18 Juni 2012


Empat Tahun Kepemimpinan Gubsu Periode 2008 - 2013

Gatot Mengabdi Di Atas “Badai” Oleh Asren Nasution Kadis Komunikasi dan Informatika Provsu


akikat kepemimpinan dapat difahami seba gai kemampuan menggerakkan orang lain atau organisasi untuk mewujudkan tujuan yang telah ditetapkan. Kekuatan untuk menggerakkan bisa diperoleh dari mempelajari ilmu pengetahuan tentang kepemimpinan atau bisa juga diperoleh dari bakat yang memang dianugerahkan oleh Tuhan. Berdasarkan pengalaman para pemimpin besar di dunia, bakat (talenta) dan ilmu tentang kepemimpinan merupakan perpaduan yang saling menguatkan satu sama lain. Seorang pemimpin yang dianugerahi bakat kepemimpinan manakala diperkaya dengan pelatihan dan pengalaman yang memadai akan menjadikan kemampuan memimpinnya menjadi luar biasa. Kepemimpinan yang hebat adalah perpaduan antara seni (art) dan ilmu (science) yang muncul dari pribadi seorang pemimpin. Eisenhower menggambarkan kepemimpinan sebagai seni menggerakkan orang yang diinginkan untuk melakukan sesuatu dengan kesadarannya sendiri (Leadership: The art of getting someone else to do something you want done because he wants to do it}. Tepatnya tanggal 16 Juni 2012, empat tahun sudah kepemimpinan Gubsu masa bakti 2008 – 2013 telah berlalu. Bagi Plt. Gubsu Gatot Pujonugroho, dalam kurun waktu ini, banyak torehan sejarah terukir, baik semasa menjabat Wagub mendampingi Gubsu H. Syamsul Arifin, SE maupun setelah diberi amanah memegang tongkat estafet kepemimpinan Sumut sebagai Plt. Gubsu sejak Maret 2011. Memang tidak semua torehan sejarah tersebut bisa dikatakan manis. Namun begitulah perjalanan kehidupan, ada manis dan ada pula yang pahit, ibarat pisau yang tumpul, pengalaman merupakan batu asah untuk mempertajam kepemimpinan seseorang. Semuanya tentu mengandung hikmah, bahkan yang pahit itu terkadang dibutuhkan karena berfungsi sebagai obat. Tidak berlebihan barangkali, jika dikatakan bahwa kepemimpinan Plt. Gubsu H. Gatot Pujo Nugroho, ST, ibarat mengabdi di atas “badai” melihat sederetan tantangan yang dihadapi sejak penon-aktifan H. Syamsul Arifin, SE sebagai Gubsu. Sudah pasti dalam menghadapi “badai” membutuhkan komitmen yang kuat, hati yang tulus dan integritas yang tinggi, berjuang semata-mata demi kepentingan masyarakat Sumut. Petuah orang tua yang menyatakan “Di mana ada kemauan dan kesungguhan pasti di situ ada jalan” barangkali tepat dilontarkan sebagai spirit untuk mengharungi “badai” tersebut sehingga dapat dilalui dengan baik sambil menoreh catatan prestasi di sana-sini, sebagaimana prinsip beliau “badai pasti akan berlalu”…”di balik berbagai kesulitan, di situ ada pintu kemudahan…”. Perlu diingat, bahwa pembangunan bukanlah suatu proses sim salabim yang dapat dicapai secara instan. Pembangunan membutuhkan proses kerja keras seluruh elemen untuk wujudkan tujuan yang telah ditetapkan, berdasarkan program prioritas daerah yang telah ditentukan. Itulah sebabnya, meski sejumlah catatan kinerja dengan berbagai prestasi telah diraih dalam rentang waktu 2011 hingga saat ini, Plt. Gubsu dengan jajaran satuan kerja perangkat daerah (SKPD) mengakui secara kesatria masih banyak kelemahan, keterbatasan dan kealpaan dalam mengemban amanah menjalankan roda pemerintahan di Sumut, semuanya menjadi kesadaran dan pelajaran berharga untuk melakukan perbaikan implementasi program pembangunan lebih signifikan

PENGHARGAAN: Plt Gubernur Sumatera Utara Gatot Pujo Nugroho menerima Anugerah Parahita Ekapraya (APE) dari Presiden Susilo Bambang Yudhoyono disaksikan Wapres Boediono pada puncak peringatan Hari Ibu ke-83 beberapa waktu lalu di Balai Kartini, Jakarta. APE diberikan atas prestasi dan kontribusi dalam mendukung pelaksanaan dan pengarusutamaan gender, pemberdayaan perempuan dan perlindungan anak. di masa mendatang. Maka untuk menyempurnakan komposisi struktural pemerintahan Sumut, pelantikan Sekdaprovsu H. M. Nurdin Lubis, SH, MM, tanggal 31 September 2011 seolah menghidupkan kembali sebelah tangan yang lumpuh, demi efektifitas pengendalian aparatur pemerintah Sumatera Utara ke depan. Terus Berkembang Tentang pencapaian hingga tahun ke empat periode ini, kita mengakui tidak bisa sekedar angka-angka statistik, sebab yang paling mendasar adalah meletakkan pola, sistem dan schedule. Kalau ada yang bilang belum mencapai target, hal itu wajar, sebab sampai 10 tahun saja pun belum tentu tercapai karena target itu akan terus berkembang sesuai dinamika, aspirasi, tuntutan dan kebutuhan masyarakat yang terus berkembang. Konsistensi dalam meletakkan dasar-dasar pola kerja, harmonisasi sistem koordinasi dan komunikasi bottomup dan top down, dengan seluruh elemen masyarakat, akan membuka sumbatan-sumbatan informasi antara pemerintah dan rakyat, yang seringkali merupakan persoalan utama, kendala dalam upaya mewujudkan pembangunan. Komitmen seperti ini adalah obsesi dan optimisme Plt. Gubsu untuk menjadikan Provinsi Sumatera Utara (Sumut) segera menjadi pusat pertumbuhan ekonomi Indonesia bagian barat, bahkan menjadi salah satu kawasan unggulan dunia. Beberapa hal yang perlu dicatat adalah, pertumbuhan ekonomi Sumatera Utara pada tahun 2010 mencapai 6,35 persen dan ini lebih tinggi dari pencapaian pertumbuhan ekonomi nasional yang hanya sebesar 6,10 persen. Sedangkan pada tahun 2011 hingga triwulan IV pertumbuhan ekonomi Sumatera Utara mencapai 6,58 persen. Untuk tingkat inflasi tahun 2010 mencapai 8,00 persen dan tahun 2011 hingga triwulan IV mencapai 3,67 persen. Dari sisi perdagangan luar negeri, tahun 2010 Provinsi Sumatera Utara mengalami surplus sebesar US $ 5,57 milyar berasal dari hasil ekspor dengan volume 7,98 juta ton senilai US$ 9,14 milyar dan volume impor sebesar 6,71 juta ton senilai US$ 3,57 milyar. Pada tahun 2011

sampai dengan triwulan IV neraca perdagangan luar negeri Provinsi Sumatera Utara cukup menggembirakan dengan surplus US$ 6,93 milyar yang berasal dari hasil ekspor dengan volume 8,16 juta ton senilai US$ 11,88 milyar dan volume impor sebesar 6,71 juta ton senilai US$ 4,95 milyar. Sedangkan kondisi makro sosial untuk bidang pendidikan, dari total penduduk Sumatera Utara tahun 2010 (diperhitungkan dari Sensus Nasioal 2010 sebesar 12.985.075 jiwa), angka melek huruf sudah mencapai 98,26%. Untuk capaian Indikator utama bidang kesehatan tahun 2010 terdiri dari angka kematian bayi yang mencapai 23 per seribu kelahiran hidup, angka kematian ibu mencapai 268 per seratus ribu kelahiran hidup. Prevelansi gizi buruk dan kurang mencapai 21,4 persen. Sedang-

kan angka Usia Harapan Hidup (UHH) penduduk Sumatera Utara mengalami peningkatan dari 66,7 tahun pada tahun 2000 menjadi 69,8 tahun pada tahun 2010. Sedangkan dari sisi ketenagakerjaan dan sosial lainnya, Provinsi Sumatera Utara tahun 2010 memiliki persentase penduduk miskin yang diukur dari pendapatan perkapita/bulan sebesar 11,31 persen. Sedangkan tingkat pengangguran terbuka mengalami penurunan dari 8,45 persen pada tahun 2009 menjadi 7,43 persen pada tahun 2010. Heterogenitas Sumut merupakan potensi besar. Sinergitas para tokoh agama, pemuka adat, etnis dan budaya, masyarakat dan pemuda akan menciptakan pembangunan Sumut luar biasa. Ke depan Sumut dapat terus berkembang menjadi zona industri berbasis ramah

lingkungan antara lain karena penggunaan power plant hidro yang potensinya cukup besar, bagian dari pusat pangan nasional dengan pusat perkebunan, pertanian dan agribisnis. Program nasional bidang agribisnis, juga akan memberi peluang bagi Sumut, dengan kehadiran Proyek Raksana Dunia Masa Depan, yaitu sentra kelapa sawit sebagai motor pertumbuhan ekonomi kawasan barat. Program Prioritas Komitmen Mewujudkan Masyarakat Sumatera Utara yang Beriman dan Bertaqwa kepada Tuhan Yang Maha Esa, dengan program/kegiatan prioritas tahun 2013 yaitu melanjutkan Pembangunan Islamic Center; Peningkatan implementasi e-Procurement untuk pengadaan barang dan jasa pada pemerintahan kab/kota;

Program Peningkatan Kualitas Pelayanan Informasi Publik; Program Peningkatan Keberdayaan Masyarakat Perdesaan; Program Peningkatan Kapasitas Aparatur Pemerintah Desa; Peningkatan kerjasama antar daerah dan Peningkatan hubungan kerjasama luar negeri. Komitmen Mewujudkan Masyarakat Sumatera Utara yang Tidak Lapar, dengan program/kegiatan prioritas tahun 2013 yakni Sub sektor pertanian antara lain : Peningkatan produksi menuju swasembada pangan; Pemanfaatan sumber benih/bibit unggul ; Peningkatan sarana dan prasarana (Pembangunan jalan produksi dan irigasi); Pengadaan pupuk non subsidi; Pembangunan rumah kompos pada sentra produksi pertanian; Pencetakan sawah baru; Pengadaan bibit/benih unggul dan pengembangan

PENGHARGAAN: Menteri Koordinator Bidang Perekonomian Hatta Rajasa menyerahkan penghargaan dari Presiden Susilo Bambang Yudhoyono kepada Plt Gubsu Gatot Pujo Nugroho karena Pemprovsu berhasil mengendalikan inflasi, di Grand Sahid Hotel, Jakarta beberapa waktu lalu.

program Agropolitan dan Agromarinepolitan. Komitmen Mewujudkan Masyarakat Sumatera Utara yang Tidak Bodoh, dengan program kegiatan prioritas tahun 2013 yakni Mendorong ketersediaan sarana dan pra-sarana pendidikan melalui rehabilitasi sekolah, kesejahteraan guru; Meningkatkan kualitas pendidikan mulai PAUD s/d pendidikan tinggi; Menuntaskan kualifikasi guru ke jenjang S1; Pemberian Intensif kepada Guru; Dukungan pendidikan kejuruan dan politeknik mendukung KISM dan kawasan industry lainnya; Pemberdayaan dana BOS bagi kabupaten/kota; Peningkatan lama usia sekolah untuk program wajib 12 tahun; Pemberian beasiswa kurang mampudan Pengembangan SMK sebagai Pusat Pelatihan Kejuruan Terpadu (PPKT) dan Community College atau Carier Center. Komitmen Mewujudkan Masyarakat Sumatera Utara yang Tidak Sakit dengan program/ kegiatan prioritas tahun 2013 yakni Peningkatan derajat kesehatan khususnya perbaikan gizi anak dan kesehatan ibu melalui pelaksanaan Rencana Aksi Daerah Pangan dan Gizi; Peningkatan Layanan masyarakat; Pemberdayaan Desa Siaga; Jaminan persalinan; Jaminan kesehatan masyarakat dan Pengadaan stock obat-obatan. Komitmen Mewujudkan Masyarakat Sumatera Utara yang Punya Masa Depan dengan program/ kegiatan prioritas tahun 2013 yakni peningkatan kualitas kelembagaan dan usaha koperasi; Pembentukan Koperasi Primer; Pemberdayaan usaha Mikro dan Menengah; Pelatihan-pelatihan UMKM untuk mendukung produktifitas; Peningkatan peran UMKM dalam struktur pasar domestik; Pembangunan Rumah Produktifitas Daerah dan Pembentukan Badan layanan Umum Daerah (BLUD) dalam upaya untuk meng-akomodir penyaluran Modal Bergulir. Meningkatkan infrastruktur dan pengembangan wilayah, antara lain untuk pembangunan jalan dan jembatan dengan program/ kegiatan prioritas tahun 2013 yakni membangun, memelihara dan meningkatkan kapasitas infrastruktur jalan, kereta api, irigasi, Bandar udara, dan pelabuhan, sarana dan

prasarana permukiman (air bersih, MCK, sanitasi); Peningkatan kapasitas jalan nasional/ provinsi/kabupaten/kota. Meningkatkan fungsi jalan lingkar luar Danau Toba; Mendorong kabupaten/kota menyelesaikan pembangunan jalan lingkar perkotaan, dan jalan perkotaan; Peningkatan kapasitas pelabuhan Kuala Tanjung, pelabuhan Belawan, dan pelabuhan kolektor lainnya; Penyelesaian terrace rencana jalan susur pantai timur Sumatera Utara; Pengembangan pelabuhan Belawan; Mendukung pembangunan jalan tol, arteri; Peningkatan jalan nasional/provinsi/kabupaten mendukung Kawasan Industri Sei Mangke dan Peningkatan jalan provinsi mendukung pariwisata dan sentra produksi . Pembangunan irigasi dengan program/ kegiatan prioritas tahun 2013 yakni pemeliharaan irigasi (rutin tiap tahun), seluas 73.326 Ha; Perbaikan/Peningkatan irigasi seluas 5.000 Ha; Pemeliharaan rawa (tutin tiap tahun) seluas 61.732 Ha; Perbaikan/ Peningkatan rawa seluas 3.500 Ha; Perkuatan Tebing sungai sepanjang 5.500 m; Normalisasi/Pelurusan sungai sepanjang 9.500 m; Pembangunan/perbaikan tanggul sepanjang 10.250 m dan Penyediaan air baku/embung 4 unit. Pembangunan kelistrikan dengan program/ kegiatan prioritas tahun 2013 yakni Pembangunan PLTS di desa terpencil Sumut; Pembangunan PLTMH di desa terpencil Sumut dan Pembangunan Biogas di Sumatera Utara. Berbagai program diatas hendaknya tidak dipersepsikan sebagai tugas eksekutif semata melainkan tanggung jawab kita semua, termasuk legislative, pemerintah kabupaten/kota, instansi vertikal dan seluruh komponen masyarakat lainnya. Sebagaimana yang selalu disampaikan Plt. Gubsu Gatot Pujo Nugroho, “……sudah saatnya kita membangun kesadaran kolektif dalam mengejar ketertinggalan Sumut”. Penutup Rocky Gerung dosen Filsafat UI di dalam salah satu tulisannya di buku The Dancing Leader; Hening, Mengalir, Bertindak, menuliskan bahwa “Kepemimpinan adalah kompas untuk meyakinkan kita bahwa pembagian tanggungjawab merupakan keperluan untuk keselamatan bersama. Kepemimpinan bukan lagi dipahami dalam arti “kompetisi otoritas”, melainkan sebagai “ko-operasi humanitas”. Keputusan di buat di “meja Bundar”, dan dilaksanakan dalam skema kemitraan. Pendekatan kepemimpinan beralih dari prinsip keras “leadership” menjadi “Partnership”. Demikian pula Komaruddin Hidayat, menyatakan bahwa seorang pemimpin harus menguasai betul atmosfir panggung, gerak, penonton, dan makna episode agar tampil seindah mungkin, laksana satu tarian. Sebuah tarian adalah ekspresi imajinasi, pikiran, emosi dan kata-kata ke dalam sebuah bahasa gerak dan perbuatan yang sanggup menenggelamkan ego seseorang dan hanyut ke dalam emosi dan imajinasi kolektif. Di situ berlangsung interkoneksitas dan peleburan dari aku menjadi engkau dan kita. Menghilangkan jarak antara penari, gamelan dan penontonnya. Seorang pemimpin ibarat penari, dia mampu berempati dan lebur ke dalam suasana kekitaan. Rencana besar yang telah digariskan pemerintah provsu tentu tidak akan berhasil tanpa dukungan semua rakyat. Hanya dengan kemauan kuat, kebersamaan dan harmoni antara Pemprovsu dengan seluruh elemen masyarakat, cita-cita rakyat Sumut menjadi mudah dan memungkinkan untuk dihadirkan. Tidak ada kepemimpinan yang sunyi dari kritik, hujatan dan hasutan. Ibarat karang dilautan, kritik membuat kepemimpinan menjadi indah, terpaan ombak melahirkan bunyi yang mendamaikan jiwa sekaligus menguatkannya. Bukankah karang yang diterpa ombak dan tetap berdiri tegar akan membuktikan dirinya kuat dan kokoh. Sekali layar terkembang surut mundur kebelakang, walau harus menerjang “badai” untuk sampai di tujuan. Wallahu a’lam bi al-Shawab.

Luar Negeri


WASPADA Senin 18 Juni 2012

Kebakaran Semak Hancurkan Hampir Semua Rumah Colorado

Seputar ASEAN Mahathir: Najib Terlalu Lemah KUALA LUMPUR (Waspada): Mantan PM Malaysia Mahathir Muhammad berkomentar mengenai proses reformasi di negaranya. Sejauh ini, beberapa pihak menganggap reformasi akan menghilangkan ketegangan antar-etnis di Malaysia, namun Mahathir justru mengatakan sebaliknya. Tokoh berusia 86 tahun itu mengutarakan kekhawatirannya terhadaplangkah-langkahyangdilakukanPMNajibRazak.Mahathir menganggapNajibterlalulembutdalammenyikapioposisinya.”Kita membutuhkan pemerintahan yang kuat. Mereka harus adil dan juga tegas,” ujar Mahathir, seperti dikutip AFP, Minggu (17/6/2012). Mahathiryangpensiunpada2003silammengingatkankembali tentang munculnya demonstrasi di negaranya. Menurut Mahathir, terlalu sering memberi kebebasan pada masyarakat akan menimbulkan resiko yang berat. Akan muncul sebuah perseteruan antarentis di Negeri Jiran itu. “Saat ini, kita ingin menjadi liberal, tapi apa yang terjadi saat ini? Kita justru sangat memperhatikan isu rasial. Banyak warga yang menuduh warga lainnya rasial,” imbuhnya. Mahatir menilai, kampanye persatuan ras yang diusung oleh Najib sama sekali tidak bermakna. Mahathir pun mengkritisi kebijakan Najib yang tidakmenahanseseorangatasdasarpemikiranpolitiknya.Kebijakan itu dianggap membuka pintu untuk masuknya ekstrimisme. “Kita semua harus mengharapkan sebuah transisi kekuasaan yangmulus,namunbilakoalisiPemerintahMalaysiatidakbisamelakukan itu, peristiwa ini tidaklah baik untuk Malaysia,” tutupnya. (ok)

DENVER (AP): Sejumlah petugas pemadam kebakaran tambahan tiba di lokasi kebakaran semak di utara Colorado yang telah menghanguskan kira-kira 220 km2 kawasan dan memusnahkan sekurang-kurangnya 181 rumah — angka paling besar dalam sejarah negara bagian itu. Lebih dari 1.500 personil bekerja keras menangani api kirakira 24 km barat Fort Collins. Petir telah memicu kebakaran tersebut yangmulaidilaporkan9Junilaludan20persenberhasildikendalikan. PetugasinformasikebakaranBrettHaberstickmengatakancuaca panas dan kering diperkirakan akan berlanjut, namun para petugas telah berhasil membuat kemajuan menangani titik api di kawasan seluas 81 Ha di utara Sungai Cache La Poudre, satu jalur pertahanan penting mengatasi maraknya di sebelah utara. (m10) SATU helikopter terbang di atas kobaran api untuk menjatuhkan air guna memadamkan kebakaran hutan yang terus meluas dengan cepat di kawasan hutan seluas 2 km2 di Los Padres National Forest di California, Sabtu (16/6). Kebakaran itu mulai terjadi Sabtu sore di perbukitan antara kota-kota Frazier Park dan Ojai. Tidak ada bangunan yang dilalap api di kawasan tersebut pada saat itu.


Suu Kyi Kecewa, Rusuh Ditujukan Pada Muslim YANGON (AP/Antara/AFP): Pemenang Nobel Myanmar Aung San Suu Kyi mengatakan bahwa ‘permusuhan tidak berhenti’ di Myanmar, menunjuk konflik dengan pemberontak utara dan kerusuhan komunal yang menargetkan minoritas Muslim. “Permusuhan tidak berhenti di ujung utara. Di wilayah barat, kekerasan kelompok mengakibatkanpembakaran dan pembunuhanyangterjadihanyabeberapa hari sebelum saya mulai melakukanperjalananyangmembawa sayakesinihariini,”katanyaSabtu (16/6). Rezimtelahmenandatangani kesepakatan gencatan senjata

sementara dengan sejumlah kelompok pemberontak dalam beberapa bulan terakhir dalam upaya untuk meredakan konflik sipil yang telah mendera di bagianbagian negara sejak kemerdekaan tahun 1948. Tetapi jauh di utara, di mana perang pecah dengan Tentara Pembebasan Kachin (KIA) Juni lalu setelah gencatan senjata 17

Arab Saudi Ingin Beli Lebih Banyak Tank Dari Jerman BERLIN (Reuters): Arab Saudi ingin membeli 600 sampai 800 tank tempur Leopard dari Jerman, jumlah tersebut dua kali lipat dari perkiraan sebelumnya, demikian laporan suratkabar Jerman Minggu (17/6). Perjanjian pembelian 300 tank seyogyanya telah ditandatangani, kata suratkabar Bild am Sonntag dalam laporan yang dikirim ke Reuters. Suratkabar itu mengatakan, meski ada penentangan terhadap perjanjian itu di lembaga kanseliran, Kementrian Luar Negeri dan Kementrian Pertahanan Jerman, namun perjanjian tersebut mendapat dukungan di Kementrian Perekonomian. “Pesanan dari Arab Saudi akan menyelamatkan masa depan perusahaan pembuat tank Jerman, Krauss-Maffei Wegman dan Rheinmetall, yang sangat membutuhkan pasar baru karena terjadinya perombakan di angkatan bersenjata Jerman,” kata Bild am Sonntag. Seorang jubir pemerintah Jerman menolak berkomentar. Tahun lalu, Jerman membantah laporan bahwa pihaknya setuju mengekspor 270 tank Leopard ke Arab Saudi. Ekspor peralatan militer tidak bisa diakui secara resmi karena kegiatan tersebut merupakan rahasia dan pengungkapannya bisa dijatuhi hukuman penjara atau denda. Anggota parlemen dari pihak oposisi menekan pemerintah Kanselir Angela Merkel setelah laporan mengatakan pihaknya telah membatalkan perjanjian rahasia untuk menjual tank itu, dengan mengatakan tindakan tersebut melanggar aturan ekspor peralatan keras militer negara itu. Ekspor senjata merupakan masalah sensitive di Jerman dikarenakan sejarah Nazi serta peran perusahaan senjata seperti Krupp yang memasok senjata selama perang di abad 19 dan 20, di mana perusahaan tersebut memasok senjata untuk kedua pihak yang terlibat konflik. Jerman membatasi ekspor senjata berat untuk negara-negara Teluk di masa lalu, karena hubungan akrabnya dengan Israel dan akhir-akhir ini karena apa yang disebut Arab Spring. Mengutip sumber industry, suratkabar Bild am Sonntag mengatakan Arab Saudi ingin menandatangani perjanjian tanggal 20 Juli mendatang, awal bulan Ramadhan. Perusahaan Spanyol General Dynamic/Santa Barbara akan memproduksi tank tersebut dengan surat ijin dari perusahaan Jerman, kata suratkabar itu.(m23)

tahun hancur, konflik kembali berkobar. Beberapa pekan terakhir juga telah terlihat bentrokan regional antara mayoritas umat Buddha dan Muslim Rohingya tanpa negara dekat perbatasan barat dengan Bangladesh. Lima puluh orang tewas dan puluhanterlukadalambentrokan di negara bagian Rakhine tersebut, kata media pemerintah Sabtu, pada saat PBB memperingatkan“adanya kesulitan sangat besar” yang dihadapi oleh ribuan mengungsi akibat kerusuhan. Menurut The Associated

Press,yangmengutiplaporanmedia pemerintah Myanmar Sabtu bahwa angka kematian akibat kerusuhan etnis terakhir di barat meningkat jadi 50 orang, meski dilaporkan kerusuhan sebagian besar dapat dkendalikan sejak beberapa hari lalu. Suratkabar The New Light of Myanmar juga mengatakan bahwa 54 orang lainnya mengalami cedera dan 2.230 rumah dan gedung rusak akibat pembakaran dalam kerusuhan itu. Kerusuhan itu merupakan dampak ketegangan panjang di negara bagian Rakhine antara

komunitas etnis Rakhine dan warga Muslim Rohingya, yang dianggap warga tanpa negara meski mereka telah hidup berabad-abad di sana. Hadiah Nobel hancurkan kekangan Suu Kyi mendapatkan penghargaan Nobel Perdamaian yang sudah diraihnya 21 tahun lalu, ketika dia masih ditahan. Suu Kyi pun berpidato di depan keluarga Kerajaan Norwegia. “Ketikasayamenjaditahanan rumah,sayamerasatidakmenjadi bagian dari dunia nyata ini. Ada rumah yang merupakan dunia

Kebakaran Hari Kedua Dekat Ibukota Yunani ATHENA (AP): Satu kebakaranbesarterjadididekatbagian selatan ibukota Yunani Minggu (17/6), yang merupakan hari kedua ketika angin kencang memarakkan kobaran api sehingga memunculkan tiga front baru. Para pejabat lokal mengatakan sejumlah rumah terbakar habis dan tiga anggota regu pemadam kebakaran cedera dalam usaha memadamkan kebakaran itu sehari sebelumnya. Lebih dari 250 pemadam kebakaran dan tentara yang menggunakan lebih dari 60 kendaraan berperang melawan kobaran api di satu kawasan berpenduduk jarang di selatanAthena.Merekajugadibantu denganempatpesawatpenyiram air dan satu helikopter, demikian menurut departemen pemadam kebakaran. 45 Pemadam kebakaranlainnyadan15kendaraanpendukung telah dikirimkan melalui kawasan lainnya untuk memperkuat tim pemadam. Yunanimenyerukanbantuan pada Uni Eropa.Italia telah mengirimkanduapesawatpenyiram air Minggu pagi, kata Menteri Perlindungan Warga Yunani Eleftherios Economou. Athena masih menunggu respon dari Prancis dan Kroasia. Empat orang tampil di pengadilan Minggu sore

setelah ditangkap karena diduga secara kebetulan memicu kebakaran pada saat dia melakukan pekerjaan pengelasan di satu tempat pembangunan. Menjelang Sabtu malam, kobaran api marak di satu kawasan hutan seluas 12 km ke barat dan selatan kota Keratea, 50 km selatan Athena. Kepala Departemen Kebakaran Panagiotis Bonatsos mengatakan kepada jaringan televisipemerintahNETTVbahwa tiga front baru muncul setelah api terus marak sampai Minggu pagi. Dia menyeru masyarakat agar menghindari pekerjaan di luar rumah yang dapat memicu kobaran api.

Saat ratusan petugas pemadam yang dibantu oleh empat pesawat dan satu helikopter berjuang memadamkan api di Keratea Sabtu sementara angin berhembus kencang dengan kecepatan 7-8 Skala Beaufort, serangkaian kebakaran yang lebih kecil terjadi di seluruh Prefektur Attica dan Peloponnese di Yunani selatan. Sementara itu, di pinggiran Athena utara, Pallini, di kaki Gunung Penteli, si jago merah mengancam tanaman produksi susu. PM sementara Panayiotis Pikrammenos dilaporkan telah menyatakan Yunani mungkin meminta bantuan, seperti pesa-

Pesawat Jatuh Setelah Sambar Kabel Listrik Di Rumania BUKHAREST(AP):Parapejabatmengatakansatupilottewasketika pesawat ringan yang dikemudikannya jatuh karena menyambar kabel listrik dan menukik ke tanah di selatan Rumania. MadalinIpatie,kepalapelayananambulandikawasanitu,mengatakan bahwa pesawat itu terbakar setelah terbang memasuki kabel listrik berwarna merah dan meledak kemudian jatuh ke tanah Minggu (16/ 6) pagi. Suratkabar Ziarul de Bacau menyebutkan nama korban yang berusia57tahun,sementarainstrukturpenerbanganPetruLazar,seorang pilotberpengalamanyangtelahmenerbangkanberbagaijenispesawat, termasukMiGbuatanUniSovietdalamkarirpanjangpenerbangannya. Kecelakaanituterjadidalamsuasanacerah,setelahpertemuaninformal parapilotRumaniadekatBanesti,kira-kira60kmutaraBucharest (m10).

Rakyat Mesir Memilih Di Tengah Masalah Apakah Militer Siap Serahkan Kekuasaan RAKYAT Mesir Minggu (17/ 6) memilih antara seorang tokoh Islamis konservatif dan mantan PM era Hosni Mubarak pada hari kedua putaran kedua pemilihan presiden yang dibayangi oleh tandatanya apakah penguasa militer siap mengalihkan kekuasaan kepada pihak berwenang sipil pada 1 Juli seperti yang dijanjikan. Bersaing ketat pada putaran kedua pemilihan itu adalah Ahmed Shafiq, seorang teman lama dan orang yang mengaku sebagai pengagum Mubarak, dan Mohammed Morsi, calon dari kelompok fundamentalis Persaudaraan Islam (Ikhwanul Muslimin = IM). Sehubungan dengan kegalauan dengan tindakan penguasa hukum yang semena-mena membubarkan parlemen hasil pemilihan secara demokratis pasca Mubarak, Partai Kebebasan dan Keadilan —sayap politik Ikhwanul Muslimin, Mesir — mendesak agar diselenggarakannya referendum mengenai pem-

bubaran parlemen yang diputuskan Mahkamah Konstitusi. “Parlemen ini hasil pilihan rakyat. Oleh karena itu, perlu diadakan referendum nasional untuk menentukan apakah keberadaan parlemen ini sah atau tidak,” kata Wakil Ketua Partai Kebebasan dan Keadilan, Essam Al Aryan, Minggu. Pernyataan Al Aryan, yang jugaKetuaKomiteHubunganLuar Negeri pada Palemen Mesir itu, mengacu kepada keputusan MK Kamis —yang menyebutkan bahwaprosespembentukanparlemen sejak awal tidak sah. Sebelumnya, Muhammad Moursi, Ketua Partai Kebebasan dan Keadilan —yangjugacalonpresiden,sempat mempertanya-kan keabsahan keputusan MK, namun belakangan dia menyatakan pihaknya menghormatikeputusantersebut. Sementara itu, Ketua Dewan Tertinggi Angkatan Bersenjata (SCAF) —yang berkuasa, Marsekal Hussein Tantawi,menyatakanSCAFsecararesmitelahmem-bubarkan parlemen sebagai pe-

saya, ada dunia untuk mereka yang tidak bebas dan hidup di tahanan, ada pula dunia yang memang bebas. Setiap dunia itu adalah planet yang berbeda, yang saling mengejar mengejar di alam semesta,” ujar Suu Kyi dalam pidatonya, seperti dikutip The Associated Press, Minggu (17/6). “Penghargaan Nobel Perdamaian menarik saya keluar dari isolasi dan membangkitkan akal sehat saya tentang realita. Nobel ini juga akan menarik perhatian dunia dalam perjuangan demokratisasi di Myanmar,” imbuhnya. (m10)

laksanaan keputusan MK. Hasil pemilihan itu nantinya bukan tidak mungkin akan memunculkan kembali tokoh pro-Mubarak, yang sekaligus dia akan menghidupkan kembali rezim lama. Tetapi ada juga kemungkinan lain yang akan membawa Islam ke pemerintahan jika pemilihan itu dimenangkan calon Islami. Persaingan antara Ahmed Shafiq, seorang perwira karir AU seperti Mubarak dan Mohammed Morsi, seorang insinyur jebolan AS, telah memecah negara yang mayoritas penduduknya yang berjumlah 85 juta jiwa beragama Islam. Pemilihan dilakukan 16 bulan setelah pergolakan oleh jutaan yang memaksa Mubarak untukmengundurkandirisetelah berkuasa selama 29 tahun. Jumlah pemilih diperkirakan tidak akan melebihi 50 persen, kemungkinan karena warga sudah jenuh atau kelelahan memilih, kemudian hasilnya belum tentu akan berlaku. Sejak penggulingan Mubarak 11 Februari

2011 lalu, Mesir telah melakukan pemilihan beberapa kali, bahkan kini militer telah membatalkan parlemen hasil pemilihan yang dimenangkan kelompok Islamis. Tidak seperti pemilihan pasca-Mubarak sebelumnya, ketika warga Mesir yakin pemungutan suara akan berlangsung bebas, banyak orang saat ini mengatakan mereka memperkirakan pemilihan akhir pekan boleh jadi akan dirusak. “Saya kira Shafiq tidak akan mememangkan pemilu, tetapi dengan kekuasaan yang ada di pihaknya, saya pikir dia akan menang,” kata Nagwan Gamal, 26, yang kuliah tehnik di Universitas Kairo. “Saya pikir akan ada korupsi untuk menjamin kemenangan dia, namun saya kira banyak orang akan memberi suara pada dia. Sementara itu, tank tempur dan panser anti-huruhara tampak mengawal jalannya pemilihan presiden Mesir tahap kedua yang digelar Sabtu dan Minggu,

di tengah ketidakpastian politik menyusul keputusan Mahkamah Konstitusi yang menyatakan pembentukan parlemen adalah tidak sah. Para pakar hukum mempersoalkan legitimasi pemilihan presiden untuk menggantikan Presiden Mubarak yang mengundurkandiri11Februariakibattekanan revolusi.“Legitimasipresidenhasil Pilpres ini akan sangat lemah karena dia terpilih di tengah ketidakjelasan konstitusi,” kata ahli hukum, Salim Al Sharif, Sabtu. Namun, Ketua MK yang juga merangkap Ketua Pemilu Presiden, Farouk Soltan, kepada harian berbahasa Arab, Al Ahram, Sabtu, mengatakan, presiden terpilih akan diambil sumpah di depan Mahkamah Konstitusi. “MK akan segera mengambil keputusan tambahan pelengkap konstitusi menyangkut batasan kekuasaan presiden dan presiden terpilih dapat diambil sumpahnya di depan Mahkamah Konstitusi seperti terjadi di sejumlah negara,” kata Soltan.(ap/mujo)

watuntukmemerangikebakaran, darinegaralainanggotaUniEropa dalam konteks mekanisme Uni Eropabagiperlindungansipil,jika perlu. (m10)

13 Narapidana Tewas Dalam Kebakaran Di Penjara Turki ISTANBUL (Antara/Reuters):Tigabelas narapidana tewas akibat kebakaran melanda satu penjara di Turki tenggara Sabtu malam, setelah terjadi sengketa di kalangan tahanan, kata seorang pejabat lokal Minggu (17/6). Kebakaran di satu penjara yang menampung 1.000 narapidana di provinsi Sanliurfa terjadi setelah satu pertengkaran di antara satu kelompok 18 narapidana di salah satu sel Sabtu petang, kata gubernur provinsi itu Celalettin Guvenc kepada wartawan. Beberapa laporan media Turki mengatakan para narapidana membakar tempat tidur mereka dalam satu protes, tetapi gubernur membantah terjadi pemberontakan. Lima narapidana lagi di sel itu menderita cedera.Para petugas pemadam kebakaran berhasil memadamkan api setelah satu setengah jam kemudian. Personel keamanan juga dikirim ke penjara untuk memulihkan ketertiban, kata laporan-laporan media. Ibrahim Ayhan, seorang anggota parlemen dari Partai Perdamaian dan Demokrasi (BDP) di antara para narapidana di penjara itu, tetapi diduga ia tidak mengalami cedera, kata stasiun televisi NTV.

Berlusconi Gerayangi Wanita Anggota DPR Saat Menari Bugil MILAN (Waspada): Seorang perempuan yang anggota Parlemen Italia dikabarkan menari-nari tanpa busana di depan mantan PM SilvioBerlusconi,yangdiperbolehkanuntukmenggerayangitubuhnya. Saksimata di pengadilan Berlusconi, Ambra Battilana, menceritakan isu skandal seks yang menimpa Berlusconi. Battilana pun menyebutkan nama dari tiga orang politisi Italia Nicole Minetti serta dua orang rekannya, Emilio Fede dan Lele Mora. “Nicole Minetti melakukan striptease tanpa busana, dia pun menari di dekat Berlusconi. Minetti menyentuh Berlusconi dan memperbolehkan Berlusconi untuk menggerayanginya,” ujar Battilana, seperti dikutip Corriere della Sera, Minggu (17/6). Battilanajugamengatakan,Berlusconibersenang-senangdengan Fededanpadasaatyangsama,perempuan-perempuanitupundisentuh oleh Berlusconi. Pria yang berusia 75 tahun itu pun menikmati situasi di saat dirinya berada di sekeliling perempuan tanpa busana. Seperti diketahui, Minetti yang masih berusia 27 tahun itu merupakan seorang mantan model, namun perempuan itu ikut dalam politik dan menjadi anggota Parlemen Italia dari partai Berlusconi. Minetti, Fede dan Mora langsung melontarkan bantahan terhadap kesaksian Battilana.(ok)

China Kirim Astronot Wanita Pertama Ke Angkasa Luar BEIJING (AP/BBC): Liu Yang menjadi astronot wanita pertama China yang berpartisipasi dalam misi roket berawakShenzhou-9,yangdiluncurkan Sabtu (16/6). Kehadiran Liu bertujuan untuk melengkapi misi dengan kehadiran kaum hawa. “Secara umum, astronot wanita memiliki ketahanan tubuh, kondisi psikologis dan kemampuan mengatasi kesendirian yang lebih baik,” kata Wu Ping,jurubicaramisi,diberitakan kantor berita Xinhua.“Fakta itu membuktikan wanita sangat kompeten untuk melaksanakan misi luar angkasa.” Selama ini, sudah lebih dari 50 astronot wanita dari tujuh negaraberpartisipasidalammisi luarangkasa,dengandurasimisi terpanjang mencapai 188 hari. Diamerupakanveteranpilot dengancatatan1.680jampengalaman terbang dan memperoleh hasil tertinggi dari ujian tentang ruang angkasa setelah dua tahun menjalani pelatihan.Jika semuanyaberjalanbaik,pesawat Shenzhou-9 akan mendarat di laboratorium orbit ruang angkasaChinadanituberartinegara tersebut menjadi negara ketiga setelah AS dan Rusia yang berhasil mengirim pesawat berawak ke ruang angkasa. Turutsertanyawanitadiruang angkasaakanmembantupelatihan,meningkatkankemampuan awak terbang soal penggunaan peralatan dan memperluas pengetahuan tentang dampak fisik dan psikologis terhadap wanita ketika berada di ruang angkasa, kataWu Ping, seorang jubir program ruang angkasa berawak China. “Selain itu juga untuk memperluas dampak sosial tentang misiruangangkasamanusiadan contoh positif bagi wanita China,” kataWu sebelum peluncuran.“Sebagaiwanita,sayasangat inginmelihatastronotwanitamenguasaipesawatruangangkasa.” China punya harapan besar bagi programnya itu dan berharap bisa membangun stasiun ruang angkata dan melakukan

misi pesawat berawak ke bulan. Laboratorium orbit ruang angkasa China Tiangong-1 diluncurkan ke ruang angkasa Septemberlalu,danduabulankemudian pihaknya berhasil melakukan pendaratan pertama dengan pesawat ruang angkasa tanpa awak, Shenzhou-8, menurut laporan Xinhua. DimasukkannyaLiukedalam tim juga terkait anggapan bahwa astronot wanita memberi kontribusi besar bagi keberhasilan misi luar angkasa. “Contohnya seperti Valentina Tereshkova dari Rusia

dan Sally Ride dari AS, yang merupakan astronot wanita pertama di negaranya masing-masing,” kata Wu. Bagi China, kehadiran astronot wanita juga dapat menunjukkan citra positif wanita Negeri Tirai Bambu itu serta mempromosikan program roket berawak. Selain LiuYang, roket Shenzhou9 juga akan berawak dua astronot pria, yaitu Jing Haipeng dan Liu Wang. Roket ini diluncurkan secara manual Sabtu, bersama dengan modul eksperimental Tiangong-1. (m23/m10)


ROKET Long March II-F yang membawa satu pesawat angkasa luar berawak Shenzhou-9 bersama tiga astronot China, Jing Haipeng, Liu Wang dan Liu Yang mengangkasa dari landasan peluncuran di Pusat Peluncuran Satelit Jiuquan, provinsi Gansu Sabtu (16/6). Pilot pesawat tempur AU China Liu Yang (inzet) menjadi astronot wanita pertama yang dikirim ke ruang angkasa.


WASPADA Senin 18 Juni 2012


Simon Selamatkan Merah Putih Djarum Indonesia Open Super Series 2012 JAKARTA (Waspada): Sesaat Simon Santoso (foto) memastikan kemenangan atas Du Pengyu di final tunggal putra Djarum Indonesia Open Super Series Premier 2012, Minggu (17/6), seisi Istora Senayan Jakarta yang dipadati ribuan penonton bergemuruh. Menghadapi tunggal China tersebut, Simon berhasil mendominasi jalannya set pertama. Angka demi angka didapat melalui pertahanan rapat dan smes keras. Sony memimpin 11-7 dan berada di atas angin untuk membuat selisih perolehan melebar 17-7. Di saat skor 20-13, Simon sempat membuat publik Istora tegang karena kegigihan Du mengejar ketinggalannya. Namun lima angka Du diakhiri dengan sebuah netting sempurna. Simon memenangi set awal 21-18. Di set kedua, Simon balik tertekan dan menyerah 13-21.

Berpeluang mengakhiri paceklik gelar Indonesia di ajang ini, Simon berhasil menemukan permainan terbaiknya. Kesalahan seperti yang terjadi di set kedua diminimalisir untuk memimpin 11-6, sebelumnya menuai sukses bagi Merah Putih di Djarum Indonesia Open dengan kemenangan 21-11. “Beban memang ada, tetapi saya tidak terlalu membuatnya menjadi beban. Peluang saya untuk meraih medali tentu terbuka, sama seperti Taufik Hidayat, maka saya menjadikan Djarum Indonesia Open dan Singapura Terbuka minggu depan sebagai ajang latihan menghadapi Olimpiade 2012 mendatang,” pungkas Simon yang mengantongi hadiah uang Rp457 juta. Di partai terakhir, Indonesia juga memiliki harapan mendulang medali emas dari ganda campuran. Sayang, Tontowi Ahmad/ Liliyana Natsir dipaksa mengakui ketangguhan ganda campuran Thailand, Sudket Prapakamol/Saralee Thoungthongkam, 17-

21, 21-17, 12-21. Tiga gelar sebelumnya dibagai merata. Final ganda putri yang menampilkan All Chinese Final dimenangi Wang Xiaoli/ Yu Yang atas Zhao Yunlei/Tian Qing 17-21, 21-9, 21-16. Juara ganda putra 2009, Lee Yong Dae, mendapat dukungan penuh publik Istora bersama Jung Jae Sung, sehingga mengulangi suksesnya berkat kemenangan atas Mathias Boe/Carsten Morgensen (Denmark) 23-21, 19-21, 21-11. Gelar tunggal putri menjadi milik pemain asal India, Saina Nehwal. Peringkat lima dunia itu menumbangkan andalan China, Li Xuerui, 13-21, 22-20, 21-19, untuk mengoleksi gelar juara ketiganya di pentas Djarum Indonesia Open. Sebelumnya, dara berusia 22 tahun itu menjadi juara pada 2009 dan 2010. (m33/yuslan)

Waspada/Danau Antariksa

Kemenangan Dramatis Ayam Kinantan MEDAN (Waspada): PSMS Medan berhasil memenuhi ambisi meraih poin penuh dengan mengalahkan Persib Bandung 3-2 dalam lanjutan Indonesian Super League (ISL) di Stadion Teladan Medan, Minggu (17/6) malam. Sejak kick off, Zulkarnaen dan kawan-kawan tampil ngotot di hadapan publiknya sendiri. Namun serangan demi serangan yang dilancarkan ke jantung pertahanan lawan belum juga mengancam Jendri Pitoy. Sebaliknya, skema apik Persib justru membawa skuad Maung Bandung lebih dulu unggul melalui tendangan Marcio Souza di menit 36 memanfaatkan umpan Miljan Radovic. Ketinggalan satu gol, serangan tuan rumah semakin gencar. Upaya Ayam Kinantan menyamakan kedudukan baru berhasil pada masa injury time babak pertama melalui tandukan Denny Rumba. Gol berawal dari tendangan bebas Nastja Ceh beberapa meter dari kotak terlarang. Menit 47, Persib kembali unggul lagi-lagi hasil set piece yang dieksekusi Radovic. Kali ini, sundulan Maman Abdurahman menjebol gawang Edi Kurnia. Setelah itu, kedua tim silih berganti melakukan serangan. Gol penyeimbang Ayam Kinantan lahir pada menit 67. Berawal dari tendangan Zulkarnaen yang ditepis Pitoy, Osas Saha yang berdiri bebas mudah menceploskan bola liar ke jala gawang. Menit 78, pertandingan terhenti akibat Pitoy terkapar di lapangan. Diduga mantan kiper Persipura Jayapura itu terkena lemparan di kepalanya, sehingga digantikan Cecep Supriatana.

Todung Pimpin Komite Gabungan JAKARTA (Waspada): PSSI akhirnya menetapkan Todung Mulya Lubis sebagai pimpinan Komite Gabungan (Joint Committee) bentukan Task Force AFC dalam menyelesaikan masalah yang terjadi di sepakbola nasional. Nantinya, pengacara kondang ini didampingi Saleh Ismail Mukadar, Catur Agus Saptono, dan Widjayanto sebagai wakil PSSI membahas masalah perubahan Statuta PSSI serta mengevaluasi kompetisi Indonesian Premier League (IPL) dan Indonesian Super League (ISL). “Beliau (Todung) sangat layak memimpin komite gabungan. Meski komite ini tidak memiliki kewenangan menetapkan putusan, hasil kerja mereka sangat menentukan nasib sepakbola Indonesia ke depan,” kata Ketua Umum PSSI, Djohar Arifin Husin, kepada Waspada, Minggu (17/6). Ditambahkan, penetapan Ketua Komite Etik PSSI itu sebagai pimpinan komite gabungan beserta tiga nama lainnya dilakukan melalui rapat pengurus yang digelar pada Jumat lalu di Kantor PSSI. Keempat wakil PSSI tersebut, imbuh Djohar, dinilai memiliki kapasitas untuk duduk di komite gabungan. Maklum saja, komite ini akan bekerja dan memberikan laporan kepada Task Force AFC, sebelum akhirnya dituangkan dalam satu keputusan. “Kita berharap apa yang disampaikan kepada Waspada/Hamdani

SUNDULAN Denny Rumba (tengah) memastikan kemenangan PSMS atas Persib Bandung dalam lanjutan ISL di Stadion Teladan Medan, Minggu (17/6) malam. Inzet: Marcio Souza (kiri bawah) bersitegang dengan aparat TNI. Jelang akhir permainan, kembali terjadi insiden tepat. Di sini, wasit mengeluarkan kartu merah untuk playmaker PSMS, Nastja Ceh, yang dinilai wasit memukul Marcio Souza. Beruntung PSMS tetap semangat mencari gol kemenangan yang akhirnya tercipta melalui sundulan Denny Rumba saat masa tambahan waktu melewati empat menit. Manajer Tim PSMS, Benny Tomasoa, menilai Marcio Souza sebagai penyulut keributan antara kedua tim dan seharusnya tidak diizinkan bermain sepakbola di Indonesia. Souza, dikenal kerap melakukan trik, meman-

cing kemarahan seolah dipukul pemain PSMS. Aksinya itu membuat wasit memberi kartu merah kepada Ceh yang sebenarnya tidak melakukan pemukulan. “Kami telah layangkan surat protes terhadap tindakan Marcio Souza kepada PT Liga Indonesia (LI) serta minta kartu merah Ceh ditinjau kembali,” ujar Benny menambahkan Souza juga telah memakinya, begitu juga kepada tim dokter PSMS dr Raja. Sementara itu, salah satu kelompok pendukung PSMS terlibat bentrok dengan warga Kampung Aur dalam konvoi

sehabis pertandingan. Bentrokan saling lempar batu itu terjadi di perempatan lampu merah samping kantor Harian Waspada. Beberapa pendukung itu mengalami luka terkena lemparan batu dan babak-belur dihajar karena terpisah dari kelompoknya. Warga Kampung Aur, ditanya pasca-kejadian, mengatakan tiba-tiba pendukung PSMS dari salah satu kelompok melempar batu ke arah steling pedagang makanan dan minuman. Saat dibalas, ratusan pendukung PSMS itu melakukan penyerangan. “Mereka (pendukung

PSMS) selalu melintas di jalan ini setiap kali usai nonton di Teladan sambil berteriak, menabuh drum, dan tidak pernah sekalipun kami ganggu. Tapi malam ini sebagian dari mereka membuat permusuhan,” kata warga Kampung Aur geram. Beberapa menit setelah peristiwa itu, sejumlah aparat kepolisian dari Polsek Medan Kota melakukan pengamanan dan mengantisipasi kemungkinan balasan dari pendukung PSMS. Kapolsek Medan Kota, Kompol Sandy Sinurat, mengatakan telah menempatkan sejumlah personil di lokasi bentrokan. (m17/m27)

Indonesia Target Maksimal Di Liga Dunia Indonesia untuk menduduki peringkat pertama Liga Dunia adalah Thailand. Apalagi kali ini Negeri Gajah Putih menjadi tuan rumah. “Seperti kita ketahui, pada seri III di Singapura yang berlangsung 2-7 Mei 2012 lalu, Timnas Putra Indonesia menempati peringkat kedua di bawah Thailand. Namun dengan persiapan tim yang saat ini, kami bertekad bisa mengimbangi Thailand,” ucap Husni. Lebih lanjut, Wakil Bendahara PSSI ini mengaku, meski saat ini dirinya tidak lagi duduk di kepengurusan PSTI, namun dirinya sangat siap sebagai insan olahraga yang telah diberi

Problem Catur

kepercayaan untuk membawa nama negara. “Sebagai orang Sumut, kita harus selalu siap menerima tantangan. Apalagi ini membawa nama baik bangsa dan negara. Saya menilai kepercayaan yang diberikan PB PSTI kepada saya sebuah amanah yang harus saya jalankan sebaik-baiknya,” ucap pengurus PS Medan Jaya itu. Meski lebih banyak menghabiskan waktunya untuk mengurusi sepakbola, Husni sendiri dinilai cukup berjasa dalam membangun olahraga sepak takraw di Sumatera Utara. Terbukti, sejak dirinya memimpin Pengpov PSTI pada 2007, sepak takraw Sumut sudah dua kali


lolos ke PON, yakni di Kaltim 2008 dan Riau 2012. Padahal, selama 24 tahun sebelumnya, sepak takraw Sumut tidak pernah lolos ke PON. “Mungkin hal itu pula yang menjadi alasan mengapa PB PTSI mempercayakan saya untuk menjadi Manajer Timnas Sepak Takraw Indonesia di Liga Dunia Series IV tahun ini,” pungkas Husni, yang memilih mundur sebagai calon Ketua Umum PSTI Sumut pada Musprov PSTI yang berlangsung Maret 2012 lalu, demi berjalannya regenerasi kepengurusan. Seperti diketahui, Indonesia akan menurunkan tim putra dan putri sekaligus di Liga Sepak

Indonesia Rebut 1 Emas 1 Perak Hari Pertama ABG III

JAKARTA (Waspada): Atlet Indonesia sukses merebut 1 medali emas dan 1 perak pada hari pertama Cabang Perahu Naga Asian Beach Games III di Haiyang, Cina Minggu (17/6). Menurut Ketua Komite Olimpiade Indonesia, Rita Subowo, hasil yang dicapai sangat menggembirakan karena Indonesia sudah mampu mempersembahkan medali emas dari Perahu Naga. Rita berharap sukses Perahu Naga mempersembahkan medali emas mampu diikuti cabang lainnya yang ikut ambil bagian pada event olahraga pantai ketiga yang kali ini digelar di Haiyang, China. Medali emas Perahu Naga dipersembahkan dari nomor 500 meter putra. Di nomor ini, pedayung Merah Putih berhasil

SSB Putra Muara Cunda Wakili Indonesia

Waspada/Dedi Riono

Takraw Dunia Super Series IV/ 2012. Selain mengikuti Liga Dunia, Timnas Indonesia juga akan turut bersaing di Kejuaraan Dunia King’s Cup 2012 yang merupakan kejuaraan rutin setiap tahunnya untuk memperingati hari ulang tahun raja Thailand. (m42)

BANDA ACEH (Waspada): SSB Putra Muara Cunda asal Lhokseumawe mengharumkan nama Provinsi Aceh di final nasional Festival Aqua Danone Cup 2012. Di final, Putra Muara Cunda mengalahkan SSB Mabar Putra Medan lewat drama penalti 3-1 di Stadion Soemantri Brodjonegoro, Minggu (17/6). Kemenangan ini otomatis membuat Babul Huda cs akan berangkat ke Polandia sebagai wakil Indonesia dalam keikutsertaannya mengikutiWorld Final Danone Nations Cup 2012, September mendatang. Di final, laga adu penalti dilakukan setelah dua kali 45 menit pertandingan imbang tanpa gol. Dalam duel seru, tim Aceh akhirnya unggul sekaligus menggagalkan ambisi Mabar Putra mengangkat trofi. Sekretaris Panitia Piala DanoneWilayah Aceh, Zahirsyah Oemardy, mengatakan selain juara, pemain Muara Cunda juga tampil sebagai top skor dengan enam gol. Selanjutnya, anak-anak Putra Muara Cunda akan ditangani Timo Scheu-


Jawaban di halaman A2


1. Kartu pos; Dari kata Inggris postcard yang telah diindonesiakan oleh Kamus Besar Bahasa Indonesia cetakan Kemdiknas. 4. Plakat yang dipasang di tempat umum, berupa pengumuman atau iklan. 7. Susunan; Tata susun. 8. Pupuk campuran bahan organik dan kotoran hewan. 10. Letak: kedudukan orang; Jabatan. 12. Rancangan usulan; Ungkapan yang dapat dipercaya, disangkal atau dibuktikan benar-tidaknya. 16. Tanda baca untuk menunjukkan ada huruf atau angka yang dihilangkan, misalnya tahun 1999 menjadi ’99. 17. Penggubah lagu; Komponis. 18. Singkatan pos komando. 19. Orang atau golongan oposisi. 20. Cerita kepahlawanan. 21. Embus; Tiup.















Waspada/Munawardi Ismail

SKUAD Putra Muara Cunda meraih sukses sebagai wakil Indonesia di putaran World Final Danone Nations Cup di Warsawa, Polandia.

nemann jelang persiapan ke Polandia. Selanjutnya, Muhammad Reza cs akan digembleng melalui pemusatan latihan di Malang sebelum berangkat ke Warsawa. Selain menempatkan diri sebagai kampiun, SSB Putra Muara Cunda juga mengantongi prestasi lain. Pasalnya, sejak babak kualifikasi di Banda Aceh, Andika Saputra cs tidak pernah kebobolan. (b07)


Hitam melangkah, mematikan lawannya lima langkah.


menyentuh garis finish dengan catatan waktu 1 menit 52.477 detik. Filipina berada di posisi kedua sekaligus meraih medali perak dengan catatan 1 menit 52.927 detik disusul Thailand dengan waktu 1 menit 54.088 detik. Di bagian putri, Indonesia mempersembahkan medali perak di nomor 500 meter setelah meraih catatan waktu 2 menit 08.159 detik di belakang tuan rumah China (2:05.830 detik). Sementara itu, medali perunggu direbut Thailand. Asian Beach Games III akan berlangsung hingga 23 Juni nanti dengan mempertandingkan 13 cabang olahraga. Indonesia sendiri hanya mengikuti delapan cabang, yaitu perahu naga, sepatu roda, ski air, sepak takraw, panjat tebing, bola voli, selancar, dan power gliding. (yuslan)

Kalahkan Mabar Putra Medan Di Final

Husni Hasibuan Manajer Timnas Sepak Takraw MEDAN (Waspada):Timnas Sepak Takraw Indonesia memasang target maksimal di Liga Dunia Super SeriesVI/2012 yang akan berlangsung di Bangkok, Thailand, pada 28 Juni hingga 1 Juli mendatang. “Tim sudah dipersiapkan dengan matang dan tekad kami adalah mengimbangi tuan rumah Thailand untuk bisa menduduki peringkat teratas di seri IV tahun ini,” ujar Manajer Timnas Sepak Takraw Indonesia, H Husni Hasibuan (foto), di Medan, Minggu (17/6). Mantan Ketua Umum Persatuan Sepak Takraw Indonesia (PSTI) Sumut periode 2007-2011 itu mengatakan, saingan terberat

Task Force sesuai dengan tekad kuat PSSI saat ini, yaitu membersihkan sepakbola Indonesia dari perjudian. Sebab hal inilah yang merusak sehingga kita sulit berprestasi,” tegas Djohar. Masih kata Djohar, dirinya prihatin dengan masih adanya upaya kelompok tertentu untuk mempertahankan status quo. Padahal selama beberapa tahun terakhir prestasi sepakbola Indonesia terjun bebas. Ia pun heran dengan pernyataan yang menyebutkan bahwa PSSI di bawah kendalinya telah demisioner menyusul dibentuknya Komite Gabungan sebagai pengganti Komite Normalisasi, seperti yang pernah dibentuk FIFA menyelesaikan prosesi pergantian kepengurusan di organisasi sepakbola nasional. “Di dalam MoU (nota kesepakatan) yang sudah ditandangani sangat jelas disebutkan, komite gabungan tidak berhak mengeluarkan keputusan apapun, kecuali laporan kepada Task Force AFC. Jadi kewenangan komite ini jelas berbeda dengan Komite Normalisasi,” pungkas Djohar sembari berharap tidak lagi ada kebohongan publik dengan memutarbalikkan fakta. Dari nota kesepahaman (MoU) yang sudah ditandatangani bersama di Kuala Lumpur, beberapa waktu lalu, utusan PSSI akan bekerjasama dengan Joko Driyono, Djamal Aziz, Hinca Panjaitan, dan Togar Manahan Nero dari Komite Penyelamat Sepakbola Indonesia (KPSI). (yuslan)

2. Pertemuan dengan beberapa pembicara tentang topik tertentu atau tentang beberapa aspek dari topik yang sama.

3. Ungkapan yang berfungsi menambah atau menjelaskan ungkapan sebelumnya dalam kalimat yang bersangkutan. 4. Gaya ketika dipotret atau dilukis. 5. Nama tempat peternakan sapi di Bogor, Jawa Barat, populer di era pemerintah Soeharto. 6. Partai penentang pemerintah di parlemen. 7. Gabungan; Campuran; Paduan serat gelas dan karbon. 9. Pasti; Tegas; Yakin; Lawan kata negatif. 11. Nama desa di kota Balige, Sumut, dimana terdapat museum batak dan makam pahlawan Sisingamangaraja XII. 12. Kata yang biasa terdapat di depan nomina, misal, dari, dengan, di, dan ke. 13. Menawarkan (Inggris, kata kerja), kata bendanya proposal. 14. Tidak ada isinya; Lapuk (kayu atau besi berkarat). 15. Padang rumput di daerah tropis. 17. (Tulis dari bawah) Singkatan Polski Osrodek Spoleczno Kulturalny (promosi budaya Polandia di kota London, Inggris).

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1.

1 9 8

6 3 9 7 1 7 5 2 3 7 1 4 8 5 3 2 4 9 4 9 2 5 3 8 6 4 5 1 8 7 3 9 8 5 6 5 9 2 7 1 8 5 1 3 4 6 *237



WASPADA Senin 18 Juni 2012

Semua Kredit Layak Bagi Ethniki dak perlu membuktikan apapun kepada masyarakat Yunani. Kami hanya ingin membuat semua orang di Yunani senang,” klaim Karagounis kepada Sporting Life.

WARSAWA (Waspada): Kapten Giorgos Karagounis, menghentikan perjalanan Rusia di Piala Eropa 2012, Sabtu (Minggu WIB), setelah gol tunggalnya memenangkan Yunani 10 pada partai pamungkas Grup A di National Stadium, Warsawa. Beberapa detik sebelum babak pertama usai, gelandang 35 tahun itu mendobrak benteng pertahanan Rusia, menyambut bola lemparan ke dalam yang gagal diatasi bek Sergei Ignashevich. Karagounis menghindari bek Rusia lainnya, sebelum melepaskan tembakan mendatar keras melewati kiper Vyacheslav Malafeev. Sebanyak 4.000 pendukung Ethniki, yang kalah jumlah dibandingkan 20.000 fans Rusia, langsung menggila menyambut gol Karagounis. Negeri Dewa lolos karena mengungguli Beruang Merah berdasarkan aturan head-to-head, setelah kedua tim menyelesaikan fase penyisihan grup dengan koleksi empat poin. Sukses Ethniki diyakini dapat melepaskan beban masyarakatnya, yang sedang dilanda krisis ekonomi. “Semua kredit mesti diberikan kepada Yunani, yang bertahan dengan gagah berani dan berhasil membatasi ruang


KAPTEN Giorgos Karagounis (10) dan rekan-rekannya, merayakan sukses menembus perempatfinal Euro 2012, setelah gol tunggalnya membawa Yunani menang head-to-head atas Rusia di Warsawa, Polandia, Minggu (17/6) dinihari WIB. tembak lawannya,” tulis ESPN, Minggu (17/6). Semua kredit memang layak bagi Yunani, yang ibaratkan ‘telur di ujung tanduk’ setelah bermain 1-1 dengan Polandia kemudian kalah 1-2 dari Ceko. Rusia di atas angin pasca meng-

gebuk Republik Ceko 4-1 dan menahan Polandia 1-1. “Prestasi ini sejarah bagi kami, yang mungkin tidak dimiliki bangsa-bangsa lain. Kami tahu melawan tim kuat, tapi kami telah menunjukkan karakter dan kualitas,” jelas Karagounis.

Pahlawan perangYunani ketika menjuarai Euro 2004 itu bermain habis-habisan dengan rekan-rekannya untuk menggagalkan setiap serangan pasukan Dick Advocaat. Mereka sepenuhnya sadar, hanya kemenangan yang mampu memper-

Republik Ceko Vs Polandia 1-0 Stadion Penonton Gol Wasit Kartu Kuning


BINTANG kemenangan Ceko, Petr Jiracek (kiri), merayakan golnya ke gawang Polandia dengan Milan Baros di Wroclaw, Minggu (17/6) dinihair WIB.

: Miejski (Wroclaw), Polandia : 55.614 Orang : Petr Jiracek 72' : Jonas Eriksson (Swedia) : Limbersky 12, Plasil 87, Tomas Pekhart 90; Murawski 22, Polanski 48, Wasilewski 61, Blaszczykowski 87, Perquis 90

Ceko 1-4-4-2 1 Petr Cech 3 Michal Kadlec 6 Tomas Sivok 8 David Limbersky 2 Gebre Selassie 13 Jaroslav Plasil 17 Tomas Hubschman 14 Vaclav Pilar/Jan Rezek 88 18 Daniel Kolar 15 Milan Baros/Pekhart 90 19 Petr Jiracek/Rajtoral 84

Polandia 1-4-2-3-1 22 Przemyslaw Tyton 15 Damien Perquis 13 Marcin Wasilewski 2 Sebastian Boenisch 20 Lukasz Piszczek 5 Dariusz Dudka 7 Eugen Polanski/Grosicki 56 11 Rafal Murawski/Mierzejewski 73 10 Ludovic Obraniak/Brozek 73 16 Jakub Blaszczykowski 9 Robert Lewandowski

Ceko Sudah Belajar Dari Kesalahan WROCLAW, Polandia (Waspada): Republik Ceko melaju ke perempatfinal Euro 2012 sebagai juara Grup A, karena sudah belajar dari kesalahan. Demikian pelatih Michal Bilek seperti dikutip dari AFP, Minggu (17/6). “Kami belajar dari kesalahan, lalu pada laga kedua dan ketiga kami bertahan dengan lebih bertanggungjawab sekaligus menunjukkan kualitas kami,” ungkapnya. Pelajaran berharga itu adalah ketika Ceko bermain indah, namun kemudian menyerah 1-4 dari Rusia pada partai perdana Grup A. “Kami memainkan sepakbola indah, mulanya kami berhasil. Namun kadang kami melupakan bertahan, itulah mengapa Rusia mencetak begitu banyak gol,” beber Bilek. Setelah kekalahan atas Ru-


sia, Ceko mampu bangkit dengan memukul Yunani 2-1 kemudian tuan rumah Polandia 1-0, sehingga merajai Grup A dengan enam poin. “Polandia hebat, tapi kamilah yang memainkan sepakbola indah, bertahan dengan baik dan menguasai bola,” klaim Bilek. Petr Jiracek yang mencetak gol semata wayang Ceko ke gawang Polandia menit 72, di tempat lainYunani juga memastikan lolos setelah mempecundangi Rusia 1-0. “Kami mengawali laga dengan buruk, tapi kami bisa membaik dan mulai menciptakan peluang. Akhirnya, kami pantas untuk mendapatkan sebuah gol,” tegas Jiracek melalui Soccerway. Ceko sepertinya akan pulang lebih awal ke Praha, karena


1 Skor Akhir 58% Penguasaan Bola 11 Tembakan Total 7 Tembakan Tepat 4 Penyelamatan 6 Sepak Pojok 3 Offsides 20 Pelanggaran 3 Kartu Kuning 0 Kartu Merah *Sumber ESPN

0 42% 16 7 4 6 1 22 5 0 AP

Smuda Selesai WROCLAW (Antara/AFP): Kontrak pelatih Franciszek Smuda (foto) dipastikan selesai, setelah Polandia tersingkir dari Euro 2012 menyusul kekalahan 0-1 dari Republik Ceko pada partai pamungkas Grup A. “Saya tidak harus mengundurkan diri karena saya memiliki kontrak sampai akhir Euro 2012. Saya tahu apa yang akan sekarang terjadi,” ungkap Smuda, Minggu (17/6). Dia mengaku, harus menaati pimpinan asosiasi sepakbola Polandia, kendati White Eagles tampil cukup impresif sepanjang Euro 2012. Termasuk di babak pertama, sebelum Robert Lewandowski dipecundangi Ceko lewat gol Petr Jiracek menit 72 di Wroclaw. “Ceko bermain cukup sempurna dan berhasil menciptakan gol yang begitu sangat baik. Kami sendiri sangat sulit untuk mendapatkan peluang dan selalu gagal memanfaatkannya dengan baik,” keluh Smuda. Padahal, hanya sedikit pengamat yang memprediksi hasil ini. Bahkan lebih sedikit lagi yang berpikir demikian ketika melihat babak pertama begitu didominasi skuad Smuda. Namun satu kesalahan, nilainya berharga sangat mahal bagi Polandia. Rafal Murawski coba merangsek ke depan dari lapangan tengah, namun dia kehilangan bola hingga membuat Jiracek cs langsung tancap gas melancarkan serangan balik. Polandia dengan demikian tidak pernah mencapai fase knock out di Piala Eropa, sedangkan Republik Ceko telah lolos untuk ketiga kalinya dari lima kali partisipasi sejak pecah kongsi dengan Slovakia.

lebih banyak di tekan pada babak pertama. Jelang memasuki masa rehat, barulah mereka menguasai permainan dan berlanjut sepanjang babak kedua. “Kami sungguh sangat puas, karena kami mengalahkan sebuah tim yang tempur di kandangnya. Mereka telah memainkan dua laga yang fantastik dan difavoritkan di laga ini,” jelas Jiracek, winger Ceko yang mentas di VfL Wolfsburg. Kiper Petr Cech juga tampil sebagai pahlawan, karena penampilan gemilangnya mem-

buat Milan Baros cs lebih berani keluar menyerang. “Kami memulai laga dengan buruk dan membiarkan hal itu untuk beberapa saat. Tapi seiring berjalannya waktu, kami bermain lebih baik,” ucap kiper Chelsea itu. “Kami membuat peluang, lantas mencetak sebuah gol yang memang pantas kami dapat. Kami tahu hasil Yunani melawan Rusia, tapi kami fokus pada diri sendiri, tidak mau menunggu keajaiban,” pungkas Cech. (m15/ant/afp/sw)

panjang kiprah di PolandiaUkraina. Anak asuh Fernando Santos

itu juga berniat memberikan kebahagian pada negerinya yang tengah dilanda krisis. “Kami ti-

Sukses 2004 Tanpa ragu, gelandang Panathinaikos itu menyebutkan, kemenangan kontra Rusia menjadi pintu gerbang Ethniki untuk kembali mengulang sukses delapan tahun silam, saat menjuarai Piala Eropa 2004 di Portugal. “Kami memberi kebahagiaan bagi semua orangYunani dan ini luar biasa. Apa yang menginspirasi kami adalah sejarahYunani, ini yang sangat banyak menginspirasi saya,” papar Fernando Santos. “Orang-orang Yunani memiliki kebanggaan besar dan mereka telah mendapatkan respek dari semua orang. Sejarah demokrasi, ilmu pengetahuan, dan nilai-nilai kehidupan semuanya dimulai diYunani,” tambah pelatih asal Portugal itu. Ketua Federasi Sepakbola Yunani, Sofolis Pilavios, bahkan sampai meminta maaf karena tidak bisa menggambarkan apa yang terjadi. “Ini malam emosional buat Karagounis. Kami salah satu tim terbaik di Eropa. Sesuatu yang sangat penting dan kami pantas mendapatkannya,” tegas Pilavios. Menurut striker Giorgios Samaras, penampilan mereka telah membawa kebahagiaan



1 Skor Akhir 38% Penguasaan Bola 5 Tembakan Total 2 Tembakan Tepat 5 Penyelamatan 5 Sepak Pojok 1 Offsides 8 Pelanggaran 2 Kartu Kuning 0 Kartu Merah *Sumber ESPN

0 62% 25 10 0 12 0 14 4 0

besar buat seantero negeri yang terletak di Timur Laut Mediterania tersebut. “Kebahagiaan luar biasa bagi kami semua, bisa memberikan kegembiraan untuk semua masyarakat Yunani, yang telah berjuang. Saya bangga,” tukas Samaras. Bomber klub Celtic itu juga membeberkan kunci sukses Hellas menundukkan Beruang Merah. “Kami tidak pernah membiarkan Rusia mencetak peluang. Kami mungkin terlihat letih selama laga, namun setelah mencetak gol kami tidak membiarkan Rusia menyamakan kedudukan,” pungkas Samaras. Beda dengan rekan-rekan setimnya, bek Kyriakos Papadopoulus, justru tak ingin timnya larut dalam euforia. Sebab dia berambisi menghapus sentimen negatif terhadap kekuatan Negeri Dewa, yang sempat dipandang sebelah mata. “Kami belum menyadari apa yang terjadi, kinerja kami luar biasa ketika mengalahkan tim besar seperti Rusia. Kini kami fokus pada laga berikutnya. Kami ingin memberikan jawaban atas mereka yang sempat meragukan kualitas kami,” tekad Papadopoulus. (m15/espn/uefa/sw)

Advocaat: Yunani Cuma Bertahan WARSAWA (Waspada): Pelatih Dick Advocaat mengeluhkan ketidakmampuan tim Rusia mendobrak pertahanan Yunani di Warsawa, Sabtu (Minggu WIB), padahal Beruang Merah sangat mendominasi laga pamungkas Grup A Euro 2012 tersebut. “Kami bermain sangat bagus, tim lain (Yunani) cuma bertahan. Dengan segala hormat, sulit bermain melawan mereka. Tapi itu tidak berarti kami tak bermain bagus,” sindir Advocaat, seperti dilansir Reuters, Minggu (17/6). Rusia akhirnya kalah 0-1 sekaligus gagal melaju ke perempatfinal, setelah kapten Yunani Giorgos Karagounis menciptakan gol semata wayang jelang istirahat pertandinang. Advocaat seakan tak mempercayai bahwa timnya yang dengan cemerlang mencukur Republik Ceko 4-1 di laga pertama, bisa tersingkir dengan cara seperti itu. Mereka angkat kopor karena kalah head-to-head atas Ethniki. “Bersama seluruh ofisial, kami bekerja sangat keras untuk memiliki sebuah tim bagus. Kami sebelumnya tak terkalahkan dalam 16 pertandingan dan kami tidak menang malam ini. Itulah sepakbola, salut buat Yunani,” ucap Advocaat. Pelatih asal Belanda itu menyesali, Andrei Arshavin cs tidak mampu memulihkan diri dari terjangan gol Karagounis. “Seharusnya kami menang malam ini, tapi memang begitulah sepakbola,” ujarnya lagi. (m15/ant/rtr/espn)

Yunani Vs Rusia 1-0 Stadion Penonton Gol Wasit Kartu Kuning

: : : : :

National (Warsawa), Polandia 41.480 Orang Giorgos Karagounis 45 Craig Thomson Karagounis 61, Jose Holebas 90; Anyukov 61, Zhirkov 69, Dzagoev 70, Pogrebnyak 90

Yunani 1-4-3-3 13 Michail Sifakis 19 Sokratis Papastathopoulos 5 Kyriakos Papadopoulos 3 Giorgios Tzavellas 15 Vasilis Torosidis 2 Giannis Maniatis 21 Kostas Katsouranis 17 Theofanis Gekas/Holebas 64 10 Giorgos Karagounis/Makos 67 7 Georgios Samaras 14 Dimitris Salpingidis/Ninis 83'

Rusia 1-4-4-2 16 Vyacheslav Malafeev 4 Sergei Ignashevich 12 Alexei Berezutsky 5 Yuri Zhirkov 2 Alexander Anyukov/Izmailov 81 7 Igor Denisov 22 Denis Glushakov/Pogrebnyak 72 6 Roman Shirokov 10 Andrei Arshavin 11 Alexander Kerzhakov/Pavlyuchenko 45 17 Alan Dzagoev


DICK Advocaat (kanan) melampiaskan kekesalannya di banch Rusia.


WASPADA Senin 18 Juni 2012


Spanyol Tak Pernah Cari Seri GDANSK, Polandia (Waspada): Xavi Hernandez yakin, Spanyol bisa mempertahankan mahkota Piala Eropa. Playmaker Barcelona itu juga optimis, El Matador menggasak Kroasia pada partai pamungkas Grup C Euro 2012 dinihari WIB nanti di PGE Gdansk Arena, Polandia. “Kami ingin melakukan sesuatu yang hebat. Meski kami bermain imbang dengan Italia di pertandingan pertama, saya tetap optimistis dan ini juga dirasakan di antara para pemain,” ucap Xavi dalam situs resmi UEFA, Minggu (17/6). La Furia Roja hanya membutuhkan hasil imbang lawan Kroasia untuk memastikan tiket ke babak perempatfinal. Tetapi Xavi dengan tegas mengatakan, Matador tak pernah mengincar hasil seri. “Kami tidak bisa bermain seperti itu, yang kami tahu adalah kami harus mengambil alih pertandingan dan mendulang kemenangan,” klaim gelandang serang berusia 32 tahun ter-

ENTRENADOR Vicente del Bosque (kiri) tersenyum saat mengawasi sesi latihan anakanak Spanyol di Gniewino, Polandia, Minggu (17/6). -AP-

Karier Klub 1996-2003 2003-2007 2005-2006 2007-2011 2010-2011 2011-

Hajduk Split (Kroasia) Shakhtar Donetsk (Ukraina) Hajduk Split (Kroasia) Spartak Moskow (Rusia) Tottenham Hotspur (Inggris) FC Rostov (Rusia)

Karier Timnas 1994 Kroasia U-17 1995-1997 Kroasia U-18 1997-2001 Kroasia U-21 1999Kroasia (senior) Debut vs Denmark (1999) 93 caps/0 gol


Pletikosa Benteng Tangguh Kroasia

sebut. Xavi juga yakin, Italia akan menemani mereka lolos dari Grup C. “Italia akan mencapai perempatfinal Euro 2012 bersama Spanyol, mentalitas kami tidak membiarkan kami bermain untuk mencari hasil seri,” ujarnya lagi. Gli Azzurri akan tersingkir jika laga Spanyol kontra Kroasia berakhir dengan skor 2-2, situasi identik kala Italia tersingkir dari penyisihan grup Euro 2004 oleh

Denmark dan Swedia. “Kami tidak terbiasa bermain untuk mencari hasil 2-2. Mentalitas kami tidak membiarkan kami bermain untuk hasil imbang, seperti yang selalu kami lakukan, kami bertanding untuk menang,” tegas Xavi. “Saya yakin Italia akan mencapai perempatfinal Euro 2012 dengan kami. Setelah tim kami sendiri, Italia adalah tim yang paling mengesankan saya selama turnamen ini,” katanya menam-

Silva Striker Kejutan Matador


bahkan. Namun menurut gelandang Kroasia, Ivan Rakitic, timnya akan memberikan perlawanan ekstra kekpada Xavi cs. Dia berjanji, Hrvatskan bakal memaksa Spanyol melakukan kesalahan. “Ada kemungkinan mengalahkan Spanyol, setelah Swiss mengalahkan mereka pada Piala Dunia 2010. Mereka adalah manusia biasa, memiliki kekurangan, membuat kesalahan, dan di situlah kami akan meman-

Karier Klub 2003-2004 2004-2010 2004-2005 2005-2006 2010-

Valencia B 14 (1) Valencia 119 (21) SAAT menjadi juara Piala Dunia 2010, ’! Eibar (loan) 35 (5) David Silva (foto) tidak memberi kontribusi ’! Celta Vigo (loan) 34 (4) besar buat Spanyol. Namun, cerita berbeda Manchester City di Polandia-Ukraina, karena winger lincah Karier Timnas andalan Manchester City ini sedang menunjukkan performa gemilang bersama 2001-2002 Spanyol U-16 skuad El Matador. 2002-2003 Spanyol U-17 Dari dua laga di Euro 2012, Silva selalu 2004-2005 Spanyol U-19 tampil sebagai starter dan telah menoreh 2005 Spanyol U-20 statistik satu gol dan tiga assist. Di laga 2004-2006 Spanyol U-21 pembuka melawan Italia, Silva memberi 2006Spanyol (senior) umpan penyelamat kepada Cesc Fabregas. Debut vs Rumania (15 Nov 2006) Lalu melawan Republik Irlandia, Silva 60 caps/17 gol mengukir gol serta menciptakan assist buat Fernando Torres dan Fabregas. Dari aksinya itu, Silva menjadi pemain pertama yang terlibat dalam terciptanya tiga gol di sebuah laga Euro 2012. Performa Silva memang sedang dalam kondisi puncak. Musim lalu, mantan punggawa Valencia ini terpilih sebagai pemain terbaik Manchester City dan masuk tim Liga Premier Terbaik. Sebagai gelandang, statistiknya memang memuaskan. Dari 49 pertandingan yang dimainkannya di semua kompetisi, ia membuat 22 assist plus delapan gol kendati memiliki tinggi badan 1,70 meter. Di mata pelatih Vicente del Bosque, Silva ibarat penakluk Goliath sebagai sayap yang sangat agresif dan second striker yang mengejutkan setiap saat. Itu sebabnya Del Bosque memberikan posisi David Villa yang absen kepada Silva. Mengenai perubahan posisi sebagai second striker, Silva memang tidak terlalu ambil pusing. Baginya, kepercayaan pelatih harus dijawab dengan bukti dan kontribusi di atas lapangan. Karena itu, pemain kidal berusia 26 tahun siap fleksibel di segala posisi. “Tidak peduli, apakah saya bermain sebagai midfielder atau striker. Memulai pertandingan sebagai pemain depan memberi banyak kesempatan untuk mencetak gol. Kebijakan ini sepenuhnya berada di tangan pelatih,” sambung salah satu anggota Generasi Emas Spanyol tersebut. (m33/afp/uefa)

Euro Grup C Malam Ini Di Poznan : Italia vs Irlandia Di Gdansk : Kroasia vs Spanyol *RCTI Live mulai pkl 01:45 WIB

Klasemen Akhir Grup A Rep Ceko 3 2 0 1 4-5 6* Yunani 3 1 1 1 3-3 4* Rusia 3 1 1 1 5-3 4 Polandia 3 0 2 1 2-3 2 *Yunani runner-up menang head-to-head atas Rusia

Klasemen Grup B Jerman Portugal Denmark Belanda

2 2 2 2

2 1 1 0

0 0 0 0

0 3-1 1 3-3 1 3-3 2 1-3

6 3 3 0

Klasemen Grup C Spanyol Kroasia Italia Irlandia

2 2 2 2

1 1 0 0

1 1 2 0

0 5-1 0 4-2 0 2-2 2 1-7

4 4 2 0

Klasemen Grup D Prancis Inggris Ukraina Swedia

2 2 2 2

1 1 1 0

1 1 0 0

0 0 1 2

3-1 4-3 2-3 3-5

4 4 3 0

Calon Top Skor 3 Gol : Alan Dzagoev (Rusia) Mario Gomez (Jerman) Mario Mandzukic (Kroasia) 2 Gol : Vaclav Pilar (Ceko) Andriy Shevchenko (Ukraina) Nicklas Bendtner (Denmark) Fernando Torres (Spanyol) Cesc Fabregas (Spanyol) Petr Jiracek (Ceko)

faatkan kesalahan mereka,” ujar Rakitic. “Ketika kesempatan hadir, kami akan memanfaatkan itu. Kami akan membuktikan kualitas kami. Sekarang kamilah yang akan memutuskan takdir kami, tentu saja kami memiliki keyakinan besar,” ucapnya lagi. Dia pun menyadari, La Roja memiliki segalanya untuk memenangkan setiap pertandingan. “Maka dari itu kami harus tampil agresif. Pemain-pemain Italia menunjukkan kepada kami bagaimana cara menghadapi Spanyol, lini tengah harus agresif,” pungkas Rakitic. (m15/okz/uefa/fi)

PENJAGA gawang Kroasia, Stipe Pletikosa (foto), pantas dinobatkan sebagai man of the match pada laga melawan Italia dalam penyisihan Grup C beberapa hari lalu. Dalam pertandingan tersebut, Italia harus puas berbagi angka 1-1. Kiper kelahiran 8 Januari 1979 ini berhasil mementahkan beberapa ancaman yang dilancarkan Mario Balotelli cs. Dia pun turut ambil bagian dalam mempertahankan posisi runner-up Kroasia di Grup C untuk memantapkan langkah ke fase knock out. Meskipun sempat kebobolan eksekusi free kick terukur dari Andrea Pirlo, Pletikosa terus mempertahankan gawangnya di sisa pertandingan. Kecemerlangan penampilannya di skuad Vatreni akhirnya membuahkan hasil. Kegigihan Pletikosa menga-

wal gawangnya memotivasi rekan-rekannya mengejar gol. Menit 71, Mario Mandzukic merespon ketangguhan kipernya. Di matchday kedua melawan Italia, Pletikosa memang tampil luar biasa. Beberapa peluang emas Italia, termasuk tendangan keras Balotelli dan akselerasi Claudio Marchisio saat tinggal one on one mampu ditepisnya. Pletikosa akhirnya kebobolan jua, tukan karena kualitasnya, melainkan tendangan bebas Pirlo memang luar biasa. Tak heran Harry Redknapp saat masih menukangi Tottenham Hotspurs tertarik memboyong mantan kiper Spartak Moskow itu. Saat itu, Redknapp memang berhasil meminangnya dan berencana menjadikannya sebagai kiper utama Spurs menggeser Carlo Cudicini.

Sayang, dirinya hanya menjadi penonton di White Hart Lane karena bergelut dengan cedera lutut. Saat ini Spurs sudah punya tiga pemain asal Kroasia, yakni Luka Modric, Vedran Corluka, dan Niko Kranjcar. Di mata Redknapp, ketiga pesepak bola beda posisi ini merupakan pemainpemain yang bagus dan berbakat. Redknapp bahkan tak ragu menyanjung pemain asal negara Balkan itu. Jelang laga krusial melawan Spanyol, kiper FC Rostov (Liga Rusia) ini yakin timnya mampu melewati tantangan dan lolos ke babak selanjutnya. “Saya merasa benar-benar siap menghadapi striker lawan dan akan melakukan apa saja demi kelolosan Kroasia,” pungkasnya. (m33/afp/uefa)


A12 Pasang Iklan

Telp. 4528431 HP. 081370328259 Email:

Lorenzo Kampiun SILVERSTONE, Inggris (Waspada): Jorge Lorenzo (foto) tampil impresif untuk memenangi MotoGP Inggris di Sirkuit Silverstone, Minggu (17/6). Start dari posisi keempat, pebalap Yamaha ini mampu melibas rival abadinya dari Repsol Honda, Casey Stoner, sekaligus pemegang pole position, Alvaro Bautista (Gresini Honda). Kemenangan keempat musim ini membawa Lorenzo mendapat total 140 angka untuk unggul 25 poin atas Stoner yang finish kedua. Peringkat ketiga ditempati rekan setim Stoner, Dani Pedrosa, yang berhasil melewati Bautista. Dalam balapan selama 20 lap ini, Cal Crutchlow (Yamaha Tech 3) juga berhasil membuat kejutan. Pebalap tuan rumah ini finish keenam dalam kondisi cedera engkel yang didapatkan saat kecelakaan di pelatihan be-

Stoner Santai SILVERSTONE, Inggris (Waspada): Casey Stoner kalah dalam persaingan dengan Jorge Lorenzo di MotoGP Inggris dan harus puas duduk di posisi runner-up. Dengan jarak yang kini terus bertambah jauh dari puncak klasemen, Stoner belum khawatir. Dalam balapan yang digelar di Sirkuit Silverstone, Minggu (17/6), Stoner harus kembali mengakui keunggulan Lorenzo. Saat menyentuh garis finish, pebalap Repsol Honda asal Australia itu terpaut tiga detik. Hasil seri keenam ini membuat Stoner tertinggal semakin jauh dari puncak klasemen. Jarak yang memisahkan dirinya dengan Lorenzo kini 25 poin. Terkait kondisi itu, Stoner sama sekali belum khawatir. Karena musim masih menyisakan 12 balapan lagi, Stoner menilai masih terlalu dini membicarakan titel juara dunia. “Itu terlalu dini (membicarakan gelar juara dunia). Saya lebih khawatir dengan kecepatan kami, jujur saja. Itu satu hal yang sangat mengecewakan saya,”sahut Stoner usai balapan. “Kejuaraan ini bisa berbalik hanya di satu seri saja. Dengan sekali saja (Lorenzo) tak finish dan saya jadi pemenang maka poinnya akan sama lagi,” lanjutnya.(m33/auto)

basan. Tampil di hadapan publik sendiri membuat Cruthclow termotivasi kendati start dari posisi terakhir. Balapan dimulai dengan Ben Spies (Yamaha) yang start dari urutan kedua, merangsek naik satu posisi setelah tikungan perdana. Sementara itu, Stoner mengikuti di belakangnya dan Bautista tergusur ke urutan tiga. Spies memimpin lima putaran sampai akhirnya disalip Stoner. Ancaman muncul dari belakang ketika Lorenzo melaju dan menyalip pebalap-pebalap di depannya, termasuk Spies. Sembilan lap jelang akhir, Stoner dan Lorenzo terlibat duel sengit. Lorenzo berhasil melewati Stoner, sebelum rider asal Australia itu kembali menyalipnya. Pada akhirnya, Lorenzo sukses mengungguli Stoner dalam sebuah tikungan hingga tak terkejar sampai garis finish. Bagi Lorenzo sendiri, kemenangan ini merupakan ketiga beruntun setelah sukses menjadi juara di Prancis dan Catalunya. (m33/ap)

WASPADA Senin 18 Juni 2012

EURO 2012

WASPADA Senin 18 Juni 2012


Sandiwara Azzurri RUSIA yang ‘di atas angin’ tersingkir secara mengejutkan, Sabtu (Minggu WIB), setelah pertahanan total Yunani membuat mereka frustrasi sampai akhirnya menyerah 0-1 pada partai pamungkas penyisihan Grup A Euro 2012 di Warsawa.


MARIO Balotelli (tengah) dan Antonio Cassano (kiri) masih kurang ganas di lini depan Italia.

Balotelli Tinggalkan Sesi Latihan POZNAN, Polandia (Waspada): Mario Balotelli meninggalkan sesi latihan Italia, Sabtu (Minggu WIB), karena masalah yang mendera lututnya. Kondisi penyerang Manchester City ini masih akan dinilai staf medis Gli0 Azzurri, guna memastikan apakah dirinya dapat bermain pada pertandingan pamungkas Grup C Piala Eropa 2012 melawan Republik Irlandia dinihari WIB nanti. Balotelli bermain sebagai starter pada dua partai awal Italia melawan Spanyol dan Kroasia, yang semuanya berakhir 1-1. Bomber berumur 21 tahun itu tampil mengecewakan, terutama ketika membuang banyak peluang ketika menghadapi Hrvatska. Penggantinya Antonio Di Natale, justru mencetak gol Italia saat melawan Spanyol. Balotelli bahkan baru mencetak satu gol dari 10 kali membela Gli Azzurri. Tetapi allenatore Cesare Prandelli menegaskan, tetap menaruh kepercayaan kepada mantan striker Inter Milan itu.

“Apabila Anda tidak menyukai seseorang, Anda harus berbicara secara langsung,” jelasnya. “Saya tidak akan meninggalkan dia. Saya juga akan menurunkannya ketika pers menginginkan dirinya dicadangkan. Saya mengharapkan adanya reaksi positif darinya,” pungkas Prandelli dalam Football Italia, Minggu (17/6). Prandelli sendiri kemungkinan menggunakan formasi 13-4-1-2 saat menjajal The Boys in Green. Sinyal kea rah sana terlihat dari sesi latihan Gli Azzurri, Sabtu (Minggu WIB) di Krakow, Polandia. Perombakan akan terjadi, mengingat kebutuhan poin yang mendesak. Italia harus menang telak atas tim asuhan Giovanni Trapattoni, supaya lolos ke babak perempatfinal. Pemain Bologna, Alessandro Diamanti, dipersiapkan menjalani debutnya di Piala Eropa untuk menempati posisi trequista. Dia akan berdiri di belakang dua striker, yang kemungkinan diiisi Antonio Cassano dan Antonio Di Natale.

Perubahan lain terjadi di kedua sayap, kemungkinan Christian Maggio dan Emanuele Giaccherini akan diganti. Peran mereka diambil alih Ignazio Abate dan Federico Balzaretti. Italia kini menghuni posisi tiga klasemen Grup C dengan poin 2 dari dua partai. Mereka harus menang untuk lolos, sedangkan Irlandia sudah dipastikan tersingkir setelah ditaklukkan Kroasia 1-3 dan Spanyol 0-4. Namun Robbie Keane, kapten Si Bocah Hijau, mengklaim timnya tetap serius menghadapi Azzurri. “Kami akan serius menghadapi laga ini dan tak akan pernah berpikir bahwa Italia bisa mengalahkan kami dengan mudah,” janjinya melalui Sky Sports. “Tak ada pertanyaan akan hal tersebut. Kami akan menghadapi pertandingan dengan harapan bisa membawa pulang tiga poin ke Irlandia.. Pastinya, para pemain Irlandia akan berikan 110% kemampuan kami,” tambah mantan striker Tottenham Hotspur dan Liverpool tersebut. (m15/ant/fi/sky)

Marchisio Yakin Spanyol Membantu KRAKOW (Waspada): Gelandang Italia, Claudio Marchisio (foto), yakin Spanyol akan mengalahkan Kroasia pada partai pamungkas Grup C Euro 2012 dan membantu mereka lolos ke perempatfinal. “Kami percaya, kami harus percaya (Spanyol). Jika tidak, maka tidak akan ada gunanya memainkan pertandingan,” tegas gelandang Juventus itu, sebagaimana dikutip dari AFP, Minggu (17/6). Italia perlu mengalahkan Irlandia dinihari WIB nanti di Poznan, Polandia, guna menjaga peluang lolos ke fase sistem gugur. Gli Azzurri bisa tak bergantung pada hasil duel Spanyol-Kroasia di Gdansk, jika

mampu menang dengan selisih minimal tiga gol dari The Irish. Spanyol (nilai 4, gol 5-1dan Kroasia (nilai 4, gol 4-2), kini memimpin di puncak klasemen Grup C, unggul dua poin di atas skuad Cesare Prandelli. Jika mereka imbang dan Italia menang, maka catatan head-tohead dan selisih gol akan menjadi penentu tim yang lolos dari fase grup. “Kroasia adalah tim yang sangat bagus, namun saya pikir Spanyol adalah favorit untuk duel itu,” tutur Marchisio. “Mereka nyata-nyata lebih baik, bahkan kendati Kroasia memiliki kualitas di lapangan tengah dengan (Luka) Modric dan penyerang-penyerang pe-


kerja keras,” tambah gelandang Juventus tersebut. Meski Italia terlihat lebih tertarik pada partai Spanyol kontra Kroasia, mereka juga harus memenangi pertandingannya sendiri. Prandelli pun telah mengatakan, segera melakukan tiga atau empat pergantian personel setelah Azzurri bermain 1-1 melawan Spanyol dan Kroasia. “Meskipun terdapat sejumlah perubahan, kami harus berusaha melakukan seperti yang kami lakukan pada babak pertama (melawan Kroasia), itulah Italia yang sebenarnya,” tegas Marchisio. (m15/ant/afp)

Ibaratkan musibah Sukhoi Super Jet 100, penerbangan pasukan Dick Advocaat yang sebelumnya begitu luar biasa, tak bisa diperpanjang karena saat bersamaan Republik Ceko mempecundangi Polandia 1-0. Tragis, Rusia kalah headto-head dari Ethniki, padahal mereka bakal menjadi juara grup seandainya Ceko hanya bermain seri dengan Polandia di Wroclaw. Terpuruknya Rusia merupakan kejutan besar dalam kejuaraan akbar empat tahunan di Benua Biru tersebut. Seperti kata Advocaat bahwa apa pun bisa terjadi di dunia sepakbola, maka firasat awak menyatakan, kejutan demi kejutan masih memungkinkan terjadi hingga partai puncak 1 Juli mendatang. Begitu pula di Grup C, tempat bernaungnya juara bertahan Spanyol, yang sudah ‘di atas angin’ pasca bermain 1-1 de-

ngan Italia dan menggunduli Irlandia 4-0. El Matador bisa saja menyusuli langkah Beruang Merah, jika dinihari nanti kalah dari Kroasia dan saat yang sama Italia mengatasi Republik Irlandia. Juara Piala Dunia 1934, 1938, 1982 dan 2006 Italia, juga mesti angkat kopor jika hanya menang satu bola atas The Boys in Green, sedangkan Spanyol ditahan Kroasia. Itu makanya, punggawa Gli Azzurri sibuk memprovokasi Matador supaya menusuk Hrvatska di PGE Arena Gdansk. Segala cara diupayakan Claudio Marchisio cs, termasuk mengusik komitmen pasukan Vicente del Bosque terhadap fair play. Azzurri seolah-olah takut sekali Spanyol-Kroasia ‘main mata’, meski sebenarnya mereka lah aktor paling watak bermain sandiwara di dunia sepakbola. Berbagai ‘penghargaan’ te-

Ulasan Khaidar Aswan Mantan Pemain PSMS lah dianugerahi kepada sepakbola Italia berkat akting gemilang mereka mengutak-atik skor dari luar lapangan pertandingan. Mulai dari skorsing, hukuman penjara hingga klub turun kasta, tetapi sandiwara sepakbola tetap saja melanda Liga Italia. Peristiwa terbaru malah sempat menghebohkan persiapan Azzurri menuju PolandiaUkraina 2012. Tapi tim besutan Cesare Prandellis bagai tak terusik, persis seperti saat mereka menjuarai Piala Dunia 2006 dan Piala Dunia 1982, yang masinmasing diwarnai skandal calciopoli dan totonero.

Belajar dari fakta sejarah, sesungguhnya Italia sangat tak pantas meragukan komitmen fair play Spanyol-Kroasia. Justru sandiwara Azzurri yang paling awak takutkan, mengingat lawannya Irlandia diotaki legenda sepakbola Negeri Pizza, Giovanni Trapattoni. Maestro Trap yang telah menjuarai semua kompetisi antar klub UEFA merupakan mantan allenatore Gli Azzurri (2000-2004), serta beberapa klub top Italia di antaranya AC Milan, Juventus, Inter Milan, dan Fiorentina. Profesionalisme Trap sudah lama teruji. Tetapi fanatisme kenegaraan dan semangat nasionalisme bukan mustahil menggerogoti akal sehatnya dalam usia yang kini telah mencapai angka 73. Asistennya, Marco Tardelli, pun demikian. Tardelli merupakan pemain legendaris Italia dan Juventus, yang bersama Maestro Trap sejak semula memang sangat mengharapkan Bocah Hijau dan Azzurri yang lolos dari Grup C. Ketika Boys in Green dipastikan out pasca digasak Kroasia 1-3 dan Spanyol 0-4, harapan tersisa berarti Italia. Tetapi ini asumsi awak saja, se-

Buffon Jaminan Benteng Azzurri KEPASTIAN Juventus merebut gelar scudetto musim ini tentunya membuat seluruh punggawa Juventus gembira. Tak terkecuali sang kiper, Gianluigi Buffon (foto). Euforia jelas terjadi di Kota Turin setelah tim kesayangan mereka meraih titel musim lalu. Keberhasilan si Nyonya Tua ini tentu tak lepas dari peranan kepiawaian Buffon mengawal gawang pasukan Antonio Conte, setelah kembali merasakan gelar pascaabsen enam tahun. Memiliki sosok Buffon di mistar gawang memang jaminan mutu bagi Juve, begitu pula bagi timnas Gli Azzurri. Melakonipartaimenentukan Grup C Euro 2012 melawan Irlandiadiniharinanti,Buffonmemastikan akan menjaga setiap inci gawangnya dari serbuan Robbie Keane cs. Pasalnya, hasil seri apalagi kekalahan akan berakibat gagalnya tim besutan Cesare Prandelli lolos ke perempatfinal. “Sejujurnya aku sangat takut jika Italia gagal meraih tiket perempatfinal, mengingat sejarah tim ini. Aku mengalami ketegangan yang teramat sangat, namun berhasil meraih scudetto turut meringankan beban psikologisku sejak momen terbaik menjuarai Piala Dunia 2006,” ujar Buffon. Kiper kelahiran 28 Januari 1978 di Carrara, Italia, ini memang beranggapan bahwa laga terakhir grup amat menentukan. Apalagi, sejak awal penyisihan dominasi Gli Azzurri tidak dibarengi kehadiran dewi fortuna. “Kami memiliki kemampuan dan berkeinginan untuk memenangkan pertandingan, namun kami berada di situasi di mana semuanya bergantung kepada kami. Jika kami menang di laga terakhir kami akan bisa melaluinya,” tutur kiper legendaris berusia 34 tahun itu. Pada musim pertamanya

bersama Juventus, Buffon menjadi kiper utama dalam 45 laga resmi. Buffon lantas berhasil mengantar Juve menjuara Seri A melalui aksi heroik di partai terakhir. Di musim 2002-2003, Buffon sekali lagi mengantar Juve meraih scudetto dan mengantar Juve tampil di finalis Liga Champions, setelah kalah penalti dari AC Milan. Atas prestasinya tersebut, Buffon dianugerahi penghargaan MVP UEFA dan Kiper Terbaik Dunia. Di Piala Dunia 2006, Buffon tampil dalam form yang luar biasa dengan tidak kebobolan selama 453 menit. Puncaknya adalah saat menjadi pahlawan dalam drama penalti kaa dengan mengalahkan Prancis. Dengan segudang prestasi dan pengalaman, publik Italia berharap banyak kepada Buffon. Amat disayangkan bila kiper sekelas Buffon gagal melangkahkan kakinya di babak delapan besar. (m33/uefa/afp)

kadar penyeimbang dari kecurigaan pasukan Prandelli terhadap keseriusan La Furia Roja untuk menggebuk anak asuh Slavin Bilic. Siapa yang bersandiwara memang patut dicermati. Italia butuh kemenangan dengan selisih minimal tiga gol di Municipal Stadium, supaya tak terpengaruh hasil duel SpanyolKroasia di Gdansk. Jika Maestro Trap mau, maka pasukannya bisa saja menyulitkan atau bahkan menghambat langkah Antonio Cassano cs. Setidaknya, itu telah dia buktikan dalam tiga pertemuan terakhir, pasukan Prandelli tak pernah mampu menaklukkan Robbie Keane dan kawan-kawan. Teraktual pada 7 Juni 2011, The Irish menghantam Andrea Pirlo 2-0. Sebagian pelaku laga eksibisi tahun lalu itu masih menghuni daftar skuad kedua negara di Euro 2012. Sebelumnya di babak kualifikasi Piala Dunia 2010, Irlandia juga berhasil memaksakan hasil imbang home and away, yakni 1-1 di Roma dan 2-2 di Dublin. Bocah Hijau bisa melakukan itu, tak lain karena faktor Trap dan Tardelli, yang mengetahui betul seluk-beluk calcio.*****

Karier Klub 1995-2001 Parma (Italia) 2001Juventus (Italia)

Karier Timnas 1995-1997 Italia U-21 1997Italia (senior) Debut vs Rusia (29 Okt 1997) 115 caps/0 gol


Sumatera Utara

B2 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:27 12:40 12:28 12:35 12:34 12:31 12:28 12:23 12:30 12:30

‘Ashar 15:54 16:07 15:54 16:02 16:01 15:57 15:54 15:50 15:57 15:56

Magrib 18:37 18:54 18:38 18:48 18:47 18:38 18:37 18:33 18:40 18:42



Shubuh Syuruq


19:52 20:09 19:53 20:03 20:02 19:52 19:52 19:47 19:55 19:57

04:43 05:52 04:43 04:47 04:48 04:51 04:44 04:40 04:46 04:44

04:53 05:02 04:53 04:57 04:58 05:01 04:54 04:50 04:56 04:54

L.Seumawe 12:33 L. Pakam 12:26 Sei Rampah12:25 Meulaboh 12:37 P.Sidimpuan12:24 P. Siantar 12:25 Balige 12:25 R. Prapat 12:22 Sabang 12:40 Pandan 12:26

06:14 06:24 06:15 06:19 06:20 06:23 06:16 06:12 06:18 06:16

Zhuhur ‘Ashar 16:00 15:53 15:52 16:04 15:51 15:52 15:52 15:48 16:07 15:53

WASPADA Senin 18 Juni 2012




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:46 18:37 18:36 18:48 18:31 18:35 18:34 18:30 18:55 18:34

20:01 19:51 19:51 20:03 19:46 19:49 19:48 19:45 20:10 19:48

04:45 04:42 04:41 04:52 04:45 04:42 04:44 04:41 04:51 04:46

04:55 04:52 04:51 05:02 04:55 04:52 04:54 04:51 05:01 04:56

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:26 12:28 12:38 12:30 12:27 12:34 12:22 12:33 12:26 12:25

18:34 18:37 18:51 18:39 18:38 18:46 18:32 18:43 18:34 18:35

19:48 19:52 20:06 19:53 19:53 20:01 19:47 19:57 19:48 19:50

04:46 04:45 04:50 04:49 04:43 04:48 04:40 04:49 04:45 04:41

04:56 04:55 05:00 04:59 04:53 04:58 04:50 04:59 04:55 04:51

Panyabungan 12:23 Teluk Dalam12:30 Salak 12:28 Limapuluh 12:24 Parapat 12:26 GunungTua 12:23 Sibuhuan 12:23 Lhoksukon 12:32 D.Sanggul 12:26 Kotapinang 12:21 AekKanopan 12:23

06:18 06:14 06:13 06:24 06:16 06:14 06:15 06:12 06:24 06:17

15:53 15:54 16:05 15:57 15:54 16:01 15:49 15:59 15:52 15:52

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:17 06:17 06:22 06:20 06:15 06:20 06:11 06:21 06:16 06:13

Zhuhur ‘Ashar 15:49 15:56 15:55 15:50 15:52 15:49 15:49 15:59 15:53 15:47 15:49




Shubuh Syuruq

18:29 18:36 18:37 18:34 18:35 18:30 18:29 18:45 18:35 18:29 18:32

19:43 19:50 19:51 19:48 19:49 19:44 19:43 20:01 19:49 19:43 19:46

04:44 04:52 04:46 04:40 04:43 04:43 04:43 04:45 04:45 04:40 04:41

04:54 05:02 04:56 04:50 04:53 04:53 04:53 04:55 04:55 04:50 04:51

06:16 06:23 06:18 06:12 06:15 06:14 06:15 06:17 06:16 06:12 06:12

Kebakaran Di Sergai, Dokumen Dan Surat Berharga BRI Selamat TANJUNGBERINGIN (Waspada): Dokumen dan surat berharga milik kantor Bank Rakyat Indonesia (BRI) Unit Tanjung Beringin, berhasil diselamatkan pada peristiwa kebakaran, Sabtu siang.

Waspada/Edi Saputra

KELUARGA korban kebakaran memunguti barang yang masih bisa digunakan di puing-puing kebakaran panglong Akmal Sitorus.

Polres Binjai Gerebek Bengkel Perombakan mobil BINJAI (Waspada): Anggota Sat Reskrim Polres Binjai, Rabu (13/6) sore membongkar bengkel perombakan mobil yang diduga tidak memiliki izin di Jalan Sei Bangkatan, Kel. Binjai Estate, Kec. Binjai Selatan. Keterangan diperoleh, penggerebekan berawal dari hasil pengembangankasuspencurianmobildiBelawan.PetugasdiBelawan mencurigai pelaku pencurian mobil Mitsubishi Pick Up itu berada di Kota Binjai. Hasil kerjasama dengan Polres Binjai, ditemukan bengkel yang sekaligus tempat merombak mobil hasil curian. Disita barang bukti dua unit mobil pick up yang tengah dirakit. Petugas mengamankan pemilik bengkel, Kh alias Udin, 42, warga Jalan Sei Bangkatan, Kel. Tanah Seribu, Kec. Binjai Selatan. Di Polres Binjai tersangka mengakui semua perbuatannya. Dia menjelaskan,dalampembuatanmobilbarujenispickupini,diabekerja tidakseorangdiri,tetapidibantubeberapatemannyayangmasihburon. Mereka membeli mobil bekas jenis pick up dari berbagai daerah di Sumut. Kemudian dirombak sehingga mesin menjadi baru. Lalu, nomor mesin diganti baru, termasuk rangka. Kemudian mobil itu dijual Rp120 juta - Rp140 juta per unit. “Modal merakitnya habis Rp90 juta per unit,” sebut tersangka. Kh mengaku sudah memproduksi 10 unit mobil dan sebagian besar jenis Mitsubishi Pick Up. “Sudah ada 10 mobil yang dijual. Kasat Reskrim Polres Binjai AKP Aris Fianto ketika dikonfirmasi Waspada, Jumat (15/6), membenarkan penangkapan tersebut.(a05)

Waspada/Riswan Rika

WALI KOTA Binjai HM Idaham, SH, M.Si menyiram pohon mangga disaksikan Dandim 0203 Langkat Letkol Arh YP Girsang, Ketua DPRD Zainuddin Purba, SH dan Pabandia Komsos Kodam I/BB Letkol Khairuddin.

Ketika dihubungi Waspada, Minggu (17/6), Kepala BRI Unit Tanjung Beringin, Gokma Pasaribu membenarkan, dokumen dan surat berharga aset BRI Unit Tanjung Beringin sempat terselamatkan dalam peristiwa itu. Kebakaran, juga meludeskan rumah Kepala Desa Pekan Tanjung Beringin dan panglong di Jl. Kesatria, Dusun IX, Desa Pekan Tanjung Beringin, dengan kerugian diperkirakan mencapai

miliaran rupiah itu. Namun Gokma tak menampik, ada juga aset yang terbakar. “Kami berharap nasabah tidak lagi khawatir. Untuk melayani nasabah, BRI kini berkantor sementara sekitar 50 meter dari kantor lama, yang diupayakan Senin sudah mulai beroperasi,” terang Gokma Pasaribu sambil menambahkan, soal jumlah kerugian belum dapat dirinci, karena masih dalam proses

penghitungan. Sementarapemilikpanglong, Akmal Sitorus, 39, menuturkan saat peristiwa terjadi dia sedang sibuk melayani pembeli. “Tibatibaapidarirumahtetanggamenjalar ke bagian atas rumah kami. Yang bisa diselamatkan hanya brankas berisi surat dan harta bendaberharga,selebihnyahangus,” kenang Akmal sambil menyebut, akibatperistiwaitudiamengalami kerugian sekira Rp800 juta. Pengamatan Waspada, di lokasi kebakaran terpasang Police Line (garis polisi). Tampak keluargakorbankebakaranAkmal Sitorus memunguti barang yang masih bisa digunakan, di puingpuing kebakaran.(c03)

Kades Se Tamora Dukung Proyek Swakelola TANJUNGMORAWA (Waspada):KepalaDesa(Kades)/Lurah se Kec. Tanjungmorawa, Kab. Deliserdang, mendukung pola proyek swakelola gagasan Kadis PU Ir Faisal dalam percepatan pembangunan infrastruktur, utamanya jalan dan jembatan. “Pola proyek swakelola ini sangat signifikan dalam proses percepatan pembangunan di Deliserdang. Hal ini bukan hanya sekedar omongan, bukti nyata di lapangan sudah tampak dan manfaatnya sangat dirasakan masyarakat Deliserdang,” kata Kades Dalu X-B Irianto kepada Waspada, kemarin, menanggapi manfaat dari pola proyek swakelola yang sudah lama digulirkan

Kadis PU Ir Faisal. Diungkapkan, kondisi jalan di Desa Dalu X-B dulunya cukup memprihatinkan dan didambakan masyarakat agar segera diaspal. “Namun dengan adanya proyek swakelola harapan masyarakatdapatterealisasi.Terlepas dari proses hukum yang sedang dijalani Kadis PU Ir Faisal, kita berharap pola proyek ini terus dilaksanakan sehingga cita-cita Kab. Deliserdang menjadi salah satu kabupaten terbaik di Indonesia, tercapai,” ungkap Irianto. Senada, Kades Wonosari Suparman mengatakan, dengan mulai bergulirnya pola proyek swakelola gagasan Ir Faisal, taraf kehidupanmasyarakatdidesanya

praktis membaik. Pembangunan tembok penahan pasir berada di dekat areal persawahan warga menjadisalahsatubukti.“Dengan adanya tembok penahan pasir yang dibangun, petani tidak khawatir lagi sawahnya terkena banjir di musim hujan, sehingga ancaman gagal panen dapat dihindari,” tambah Suparman. Selain itu, lanjutnya, sistem pengairan sawah warga juga semakinbaikdenganadanyapola proyek swakelola, sehingga hasil panen petani juga memuaskan. “Dengan adanya pola proyek swakelola, petani sudah jarang mengeluhkan pengairan yang dapat mengganggu hasil panen,” ujarnya. (c02)

Bupati DS Lantik Tiga Pejabat Eselon II:

Pimpinan SKPD Jangan Ada Yang Buang Waktu LUBUK PAKAM (Waspada): Bupati Deliserdang Drs. H. Amri Tambunan diwakili Wabup H. Zainuddin Mars menekankan, agar seluruh pimpinan Satuan Kerja Perangkat Daerah (SKPD) di jajaran Pemkab Deliserdang tidak ragu mengambil tindakan dalam penegakan peraturan perundangan yang berlaku, guna mencegahaparaturmasukkepada wilayah pelanggaran hukum. Tugas ini harus saudara lakukansungguh-sungguhsertaselalu tanggap terhadap semua kemungkinan yang terjadi. “Karenanya semua pimpinan SKPD janganadayangmembuangwaktu sedetik pun. Semua harus bekerja keras untuk mengejar

ketertinggalan dan tunggakan kerja yang masih ada,” tegas Wabup H. Zainuddin Mars pada pengambilan sumpah/janji serta pelantikan tiga pejabat eselon II di jajaran Pemkab Deliserdang, di Balairung Pemkab Deliserdang di Lubukpakam, baru-baru ini. Tiga pejabat eselon II yang dilantik, Drs. H. Hasbi sebelumnya Kabag Risalah Persidangan DPRD Deliserdang/mantan CamatTanjungmorawa menjadi Kepala Badan Kesatuan Bangsa (Kaban Kesbang) menggantikan Drs. H. Edy Azwar, Jentralim Purba, SH, MH menjadi Inspektur Kabupaten menggantikan Poltak L.Tobing, SH yang kini menjabat Kepala Dinas PKD Kab. Tapanuli

Utara, dan Ir. Ikhsar Risyad Marbun, M.Si menduduki jabatan Kepala Dinas Perikanan dan Kelautan menggantikan Ir. Zulkifli Nasution. Wabup menyatakan keyakinandenganberbekalpengalaman dan pengetahuan yang telah dimiliki selama ini, tugas yang cukuppentinguntukmendukung terwujudnya“good governance” di daerah ini dapat dilakukan dengan sebaik-baiknya. Lakukan perubahan ke arah perbaikan yang lebih baik, karena kita ingin menjadikan Kab. Deliserdang sebagai daerah yang maju sekaligus percontohan dalam melaksanakantatapemerintahan yang baik.(a06)

BINJAI (Waspada): Wali Kota Binjai HM Idaham, SH, M.Si menyatakan penghijauan sangat diperlukan untuk mengatasi perubahan iklim. “Cuaca panas kita rasakan sekarang, akibat kurangnya penghijauan dan banyaknya pohon yang ditebang. Hal itu dikemukakan Wali Kota Binjai HM Idaham, Kamis (14/ 6) di Kel. Tunggurono, Kec. Binjai Timur. Ketika penanaman pohon diselenggarakan Kodim 0203 Langkat dalam memperingati HUT Kodam I/BB ke 62. Penanaman pohon disaksikan Kodim 0203 Langkat Letkol Art. YP Girsang, Ketua DPRD Binjai Zainuddin Purba, SH, Mewakili Pangdam I/BB Letkol Khairuddin dan pimpinan SKPD Pemko Binjai. HM Idaham minta pohon yang ditanam harus dijaga masyarakat, sehingga bisa tumbuh dengan baik dan bermanfaat bagi masyarakat dimasa mendatang.(a04)

LUBUKPAKAM(Waspada):KejaksaanNegeri(Kejari)Lubukpakam telah melaunching alamat website beberapa waktu lalu. “Ini yang pertama di Sumut. Launchingnya dua pekan lalu. Website yang beralamat sebagai tuntutan era keterbukaan saat ini. Masyarakat luas dapat secara online mengakses website ini sehingga dapat mengetahui kinerja perkembangan kasus hukum di lingkungan Kejari Lubukpakam,” sebut Kajari Lubukpakam H. Khairil Aswan H, SH, M.Hum. Kajari menambahkan, untuk memenuhi hasrat masyarakat dan tuntutan reformasi birokrasi dan keterbukaan dalam informasi publik, pihaknya berupaya memenuhi tuntutan itu dengan menghadirkan website agar mampu memberi layanan terbaik.(m16)

Karang Taruna DS Terbentuk DELISERDANG (Waspada): Temu Karya Karang Taruna Kab. Deliserdang di Bumi Perkemahan Sibolangit, memilih Zulfan Surbakti sebagai Ketua Karang Taruna Deliserdang periode 2012-2017. Jabatan sebelumnya diduduki Master Sembiring yang kini anggota DPRD Deliserdang. Zulfan Surbakti, Jumat (15/6) menjelaskan, dalam temu karya pekan lalu dihadiri 16 Kecamatan Karang Taruna, 1 WO. Zulfan Subakti menang secara aklmasi menjadi pemimpin 5 tahun ke depan. Dengan terpilihnya Ketua KarangTaruna Deliserdang yang baru, maka ketua terpilih bersama 5 karang taruna kecamatan akan menyusun kepengurusan Karang Taruna Kab. Deliserdang yang baru selama 14 hari ke depan.(a07)

Bupati Langkat Berdialog Dengan Warga Sei Bingei LANGKAT (Waspada) : Ribuan masyarakat Sei Bingei menghadiri dialog bersama Bupati Langkat H. Ngogesa Sitepu, SH di Balai Desa Telagah Kec. Sei Bingai, Jumat (15/6) sore. Warga tanpa ragu menyampaikan aspirasi dan harapan kepada bupati, di antaranya Rasita br.Bangun,SembiringPelawi,SyahmainSembiring dan Jiwa Surbakti, yang intinya mohon perhatian terhadap infrastruktur sarana perhubungan. Menyahuti aspirasi masyarakat, Bupati H. Ngogesa didampingi Kadis PU Bambang Irawadi, Asisten Adm. Ekbangsos Indra Salahuddin, Asisten Adm. Pemerintahan Abdul Karim dan sejumlah SKPD lainnya menyatakan untuk jalan Telagah dalam proses tender tahun ini, sementara untuk Dusun Kuta Bangun dia secara pribadi akan mengirim sirtu untuk pembenahan sementara, menunggu dana ditampung dalam APBD tahun depan.

Sebelumnya H. Ngogesa di tempat sama menghadiripengukuhanDewanPengurusDaerah Asosiasi Hutan Tanaman Rakyat Mandiri Indonesia (DPD-AHTRMI) Kab. Langkat-Kota Binjai. Bupati mengajak masyarakat menjaga kelangsungan ekosistem lingkungan, karena terganggunya lingkungansebagaimanahutanakanberpengaruh terhadap ketersediaan oksigen yang bersih. “Kita sambut keberadaan asosiasi ini untuk menyadarkan masyarakat pentingnya pohon dan lingkungan dalam kehidupan,” ujar bupati yang membagi-bagi cenderamata berupa kain sarung kepada masyarakat yang hadir. Bupati H. Ngogesa yang hadir bersama Dandim 0203 Langkat Letkol. Arh. YP. Girsang juga menanam pohon Jati Jabon di sekitar lokasi didampingiWakilKetuaDPRDSurialamdanKetum DPP-AHTRMI B. Siregar, Camat Sei Bingai H. Sutrisuanto serta para tokoh adat.(a01)

Tuntutan Rendah, Massa Serbu Gedung PN Dan Kejari L. Pakam LUBUKPAKAM (Waspada):Tak puas dengan tuntutan terhadap terdakwa, massa OKP asal Kec. Batangkuis menyerbu Gedung PN Lubukpakam, baru-baru ini.Tak hanya itu, massa juga menggeruduk Kantor Kejaksaan Negeri (Kejari) Lubukpakam yang hanya berjarak 200 meter dari gedung PN. Tak ayal, karena mendadak sejumlah jaksa yang sedang di kantor terlihat bingung. Betapa tidak, sejumlah massa sempat merangsek masuk dan berdebat mulut dengan pengacara terdakwa dan salah seorang Jaksa, di ruang kerjanya. Namun upaya massa berhasil diredam polisi yang sejak awal bersiaga di gedung PN. Situasi punredasetelahlimaperwakilanmassadidampingi kuasa hukumnya Endra Fauzi Hasibuan, menggelar mediasi dengan pihak jaksa.“Tuntutan pasal 170 ayat (1) tentang pengrusakan mengacu dari berkas polisi. Nah, diteliti kemudian diajukan sesuai dakwaan,” papar Kasi Pidana Umum

(Kasipidum) Amri Siregar. Hasilnya, dari sembilan terdakwa Suryanto alias Gembur dituntut 7 tahun penjara, sedangkan lainnya dengan kumulatif 2 tahun 6 bulan penjara. Mereka Indra Deprianto alias Bagong, Junaidi alias Gonjleng, Boby Johari alias Boby,Suyatmono aliasEmon,EdiSuyantoaliasEdol(berkasTerpisah), Ngatiman alias Mandor, Hendra Gunawan Pulungan. Amri didampingi Kasi Intel Khairul Fadly dan Kasi Perdata Tata Usaha M. Iqbal mengingatkan, tuntutan itu bukan vonis. Sebab kebijakan itu mutlak milik majelis hakim. Meski tak bisa otak-atik lagi, namun para petinggidiKejarimenjanjikanakanmembicarakannya dengan Kajari, yang lagi keluar kota. Endra Fauzi Hasibuan mewakiliWarsito mengatakan jeratan itu taksesuai.Pasalnya,aksipembakaranrumahkliennya pada 11 Desember 2011 sekira pukul 13:00 di Desa Sena,KecamatanBatangkuissudahterencana,karena melibatkan 500 lebih massa.(m16/a07)

Kelangkaan Gas 3 Kg Diduga Akibat Oplosan

Penghijauan Atasi Perubahan Iklim

Pertama Di Sumut, Website Kejari Lubukpakam Online

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH berdialog bersama masyarakat di Balaidesa Telagah Kec. Sei Bingei.

Waspada/HM Husni Siregar

WABUP Deliserdang H. Zainuddin Mars memberikan ucapan selamat kepada Drs. H. Hasbi Nasution yang dilantik sebagai Kaban Kesbang Deliserdang.

‘Tolonglah….’ MATANYA berkaca-kaca, raut wajahnya seperti kebingungan. Amrun (foto) takut denganpenyakityangdideritanya. Mata kirinya hampir tertutupbenjolantumorganas yang lengket di wajahnya. Untukmembukamatadia kesakitan. Rasa perih, pedas bercampur gatal setiap saat dia rasakan. Namun kakek 27 cucu itu tidak putus asa. Beberapa rumah sakit dan paranormal terus dia datangi demi harapan sembuh. Berbulan-bulan mengandalkan ramuan tradisional penyakit yang dideritanya belum juga memperlihatkan tanda-tanda sembuh. Amrun makin gundah, sementara biaya perobatan sudah tidak

ada meski selama ini hanya mengharapkanpemberiananakanak yang umumnya berpenghasilan pas-pasan. “Tolonglah, kakek ingin sembuh,” katanya kepada Waspada sambil menangis, Kamis (14/6).

Beberapa tetangga yang menyaksikan juga tak kuasa menahansedih.Sangistri,Nur Aini berniat membawa suaminya ke rumah sakit di Medan agar dioperasi, namun mereka tidak punya uang. Korbanpernahmemilikikartu jaminan kesehatan tapi beberapa bulan silam hilang. Petugas Dinas Kesehatan Langkat setelah diinformasikan Waspada, meninjau korban di Desa Ara Condong Stabat dan berencana membawanya ke RS Adam Malik Medan. Kunjungan petugas disambut semangat oleh keluarga korban karena mereka menginginkan agar sang ayah mendapat perawatan intensif. * Abdul Hakim

BINJAI (Waspada): Masyarakat Kota Binjai kesulitan memperoleh gas isi 3 kg.Wali Kota Binjai diwakili Asisten bidang Ekonomi dan Pembangunan H.Wahyudi, SH mengaku banyak menerima keluhan masyarakat tentang sulitnya membeli gas isi 3 kg. Padahal pemakaian gas mengantisipasi kesulitan, terutama pada bulan suci Ramadhan, Pemko Binjai mengadakan pertemuan dengan pihak Pertamina UPMS I Medan. Selain masalah kelangkaan,Wahyudi juga mempertayakan harga elpiji 3 kg mencapai Rp15.000/tabung, dari harga eceran tertinggi (HET) yang ditetapkan Rp11.850. Pemilik pangkalan semaunya membuat harga, sehingga membingungkan agen, pangkalan juga tidak memiliki modal tabung.

Sementara Dodi dari Pertamina UPMS I Medan, mengatakan distribusi gas elpiji 3 kg bersubsidi, untuk kota Binjai sudah terpenuhi 5.000 tabung atau 15.000 kg, (15 ton) didasarkan kebutuhan permintaan dan penawaran. Kelangkaan gas dinilai akibat adanya praktek pengoplosan dari tabung 3 kg ke 12 kg. Juga adanya gas elpiji dijual ke luar kota Binjai. Pihak Pertamina tidak akan menambah kuota lagi karena merugikan subsidi pemerintah. Jumlah yang ditetapkan sudah data valid dari Badan Pusat Statistik (BPS), berdasarkankonversidariminyaktanahkegaselpiji. Kabag Perekonomian Dr. Hartono berjanji akan mengawasi penyaluran bekerjasama dengan pihak agen, pangkalan, kecamatan, kelurahan dan kepolisian.(a04)

Mantan Kadis Perikanan Dan Kelautan Dilapor Ke Polisi PANGKALANSUSU(Waspada):MantanKadis Perikanan dan Kelautan Kab. Langkat dilaporkan ke Polres Langkat terkait kasus dugaan penjualan lahan pertambakan seluas 2 ha kepada seorang warga. Kini, lahan tambak percontohan tersebut telah diganti rugi untuk kepentingan pengembangan mega proyek PLTU di DesaTanjungpasir, Kec. Pangkalansusu. Sesuai berkas laporan tertulis yang diperoleh Waspada dari Ketua LSM FPF, Kamis (14/6), pelapor menyatakan mantan Kadis Perikanan dan Kelautan, Ir. KS diduga menjual sebidang tanah seluas 2 ha di DesaTanjungpasir, Kec. Pangkalansusu, seharga Rp20 juta kepada Musa, penduduk Desa Lubuk Kertang, Kec. Brandan Barat. Penjualanasetini,lanjutnya,disaksikanoknum PNS di Dinas Perikanan dan Kelautan, Su. Padahal, kata Mustafa Kamal, lahan itu bukan milik pribadi oknum bersangkutan, melainkan areal tambak percontohan yang noabene milik Dinas Perikanan dan Kelautan Langkat. Perbuatan Ir. KS, kata Ketua FPF, dianggap tidakhanyamerugikannegaratapijugamasyarakat,

sebab tambak percontohan ini dibangun untuk kepentingan meningkatkan taraf perekonomian komunitasmasyarakatpesisirdiDesaTanjungpasir. “Kami sangat menyesalkan perbuatan oknum, Ir. KS,” kata Mustafa. Ketua LSM Forum Pencari Fakta (FPF) menyatakan, kasus ini telah dilaporkan ke Sat Intel Polres Langkat pada awal Mei 2012. SementaraSubianto,pegawaiDinasPerikanan dan Kelautan Langkat yang disebut-sebut sebagai saksi dalam proses penjualan lahan ketika dikonfirmasi Waspada pada hari yang sama menjelaskan, lahan seluas 2 ha itu milik pribadi Ir. HS, bukan tambak percontohan milik Dinas Perikanan dan Kelautan seperti disebutkan. “Mana mungkin kita berani menjual aset negara,” jelasnya. Menurut dia, lahan itu tidak dijual, melainkan dilepas melalui proses ganti rugi kepada Musa pada 2006. “Jangan salah, lahan ini tidak dijual tapi diganti rugi,” kilahnya seraya menambahkan, dia bukan dipanggil sebagai saksi oleh Polres Langkat, tapi diundang untuk dimintai keterangan.(a02)

Sumatera Utara

WASPADA Senin 18 Juni 2012


Wali Kota P. Sidimpuan Tanggapi Dugaan Korupsi P. SIDIMPUAN (Waspada): Wali Kota Padangsidimpuan Zulkarnain Nasution memberi reaksi terhadap banyaknya media yang menyajikan pemberitaan tentang dugaan korupsi dan bobroknya birokrasi di pemerintahan kota yang dia pimpin saat ini. Antara lain, dia meminta agar mengedepankan asas praduga tidak bersalah. Melalui Penasehat Hukum Tetap Pemko Padangsidimpuan, H. Ridwan Rangkuti SH.MH (bukan lewat Kabag Humas), wali kota memberi enam poin tanggapan dan imbauan terkait pemberitaan di media selama ini, Sabtu (16/6). Pemberitaan yang ditanggapai adalah seputar tudingan LSM dan politisi yang diarahkan kepada wali kota. Utamanya terkait dugaan korupsi dana Persatuan Sepakbola (PS) Sidimpuan, proyek pembangunan yang terbengkalai, daerah yang terancam bangkrut, dan pergantian Sekretaris Daerah (Sekda). Terkait dugaan korupsi,

Zulkarnain Nasution yang juga Ketua Umum PS Sidimpuan mengatakan bahwa pertanggung jawabanpenggunaandanatahun 2009sudahjelas.Diamembantah dugaan korupsi anggaran tim sepakbolainiadakaitandengannya. “Saat dugaan korupsi ini berproses hukum di pengadilan, terdakwa HAN selaku Wakil Manager PS Sidimpuan dan HMSP selaku Kepala Dinas Pemuda Olahraga, tidakpernahmenyebutadaaliran danakepadasaya,”kataWaliKota. Anggaran yang diterima PS Sidimpuan dari KONI dan Dispora, semuanya dikelola oleh Wakil Manager, HAN. Sementara Zulkarnain selaku Ketua Umum

Dua Siswa Samosir Ikut Festival Seni Siswa Nasional SAMOSIR (Waspada): Dua siswa SMAN 1 Pangururan Kabupaten Samosir mewakili Sumatera Utara akan mengikuti Festival dan Lomba Seni Nasional (FLS2N) di Mataram, Provinsi Nusa Tenggara Barat 17 – 23 Juli 2012. Wakil Bupati Samosir Ir. Mangadap Sinaga memotivasi siswa untuk mengikuti kegiatan dengan penuh semangat demi menjaga prestasi dan nama baik Kabupaten Samosir di tingkat nasional. “Kesempatan seperti ini merupakan peluanguntuk meningkatkan prestasi dan wawasan siswa sebagai generasi muda yang punya keterampilan di bidang seni, terutama Samosir sebagai kabupaten yang mempunyai kekayaan seni budaya,” demikian harapanWabup. Siswa yang akan mengikuti festival di Mataram adalah Ketty Nella Simbolon dan Syah Putra Gabe Harianja dan guru pendamping Marlita Simbolon S.Pd. Siswa tersebut akan bergabung dengan tim Provinsi Sumut di Medan untuk sama-sama berangkat ke Mataram. Ketty Nella Simbolon mengatakan, keberhasilannya mengikuti even ini berkat kerja keras selama ini yang ditopang oleh motivasi dari orangtua dan gurunya. Nomor perlombaan yang akan diikuti oleh kedua siswa tersebut adalah Tari Kreasi Daerah Berpasangan. (c11)

Tewas Digilas Mobil Barang PEMATANGSIANTAR (Waspada): Seorang pria, penumpang sepedamotor, Kiki Amri, 20, warga Pasarbaru, Kel. Sinaksak, Kec. Tapiandolok, Kab. Simalungun diduga terjatuh dari sepedamotor dan akhirnya tewas digilas mobil barang. Kecelakaan lalu lintas yang mengakibatkan korban jiwa itu terjadi di jalan umum Km 8-9, jurusan Pematangsiantar-Medan, Kelurahan Sinaksak, Kecamatan Tapian Dolok, Simalungun, Jumat (15/6) sekira pukul 10:00. Korban bersama pengemudi sepedamotor Yamaha Soul BK 5971 VAG, Adamyansyah, 43, warga Jalan Tuan Gunung Purba, Lingkungan IX, Kel. Sinaksak, Kec. Tapiandolok, Simalungun keluar dari Lorong Jengkol Doyong, Kel. Sinaksak dan masuk ke jalan umum Pematangsiantar-Medan dengan tujuan hendak ke Pematangsiantar. Namun, ketika sampai di jalan umum, pengemudi sepedamotor diduga selip dan terjatuh di badan jalan. Pada saat sepedamotor terjatuh bersama pengemudi dan korban, mobil barang yang dikemudikan Siswanto, 32, swasta, warga Jalan Pertanian, Desa Jambur Pulau, Kec. Perbaungan, Kab. Serdang Bedagai datang dengan kecepatan tinggi dari arah Medan, kemudian menggilas korban yang mengakibatkan korban tewas di tempat kejadian. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik, saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean SH, Kasat Lantas AKP Baginda Sitohang dan Kanit Laka Iptu Alsem Sinaga, Sabtu (16/6) membenarkan terjadinya kecelakaan lalulintas ini. (a30)

Tanpa Iman Sulit Menjauhi Perbuatan Dosa SIDIKALANG (Waspada): Tanpa iman sangat sulit menjauhi perbuatan dosa. Hal tersebut dijelaskan Uskup Agung Medan, MGR. HP. Sinaga dalam ceramahnya di hadapan ratusan jemaat pada acara kebaktian yang dirangkai dengan peresmian pemakaian Gereja Katolik Simobi Paroki Desa Siboras Kec. Sumbul Dairi, Sabtu (16/6). Untuk itu, semua jemaat Katolik dimanapun berada harus dapat menjauhi segala perbuatan dosa seperti korupsi, menjauhi narkoba, perselingkuhan dan lainnya. Menjauhi hal tersebut sulit dilakukan tanpa iman. Justru itu semua jemaad harus meningkatkan iman sehingga diterima Tuhan menjadi warga Sorgawi, sebutnya. Peresmian gereja tersebut dihadiri Bupati KRA Johnny Sitohang Adinegoro, Sekda Julius Gurning S.Sos, beberapa pimpinan SKPD, Asisten serta utusan jemaad dari berbagai Gereja Katolik yang ada di Dairi. KRA Johnny Sitohang dalam sambutannya mengatakan, pada 2007 sudah pernah beribadah di gereja tersebut. Kala itu gereja ini masih dinding tepas yang terbuat dari anyaman bambu. Atapnya terbuat dari lalang dan sudah bocor. Sehingga dari dalam gereja dapat terlihat langit karena atap sudah bolong.”Kepada pengurus gereja saya sarankan agar pembangunan dilaksanakan. Ternyata dapat terlaksana dan kini gereja sudah terbuat dari konstruksi beton,” ujar bupati. Pada acara peresmian gedung gereja tersebut terkumpul dana untuk kelanjutan pembangunan dan mobil senilai Rp55 juta yang bersumber dari uluran tangan beberapa pimpinan SKPD, bupati, Sekda dan pengusaha. (a20)

Warga Dapat Bantuan Saat HKG PKK Dan BBGRM PEMATANGSIANTAR (Waspada): Berbagai bantuan berupa mesin jahit, modal, bola voli dan net diberikan kepada masyarakat saat peringatan Hari Kesatuan Gerak (HKG) PKK ke-40 dan Bulan Bakti Gotong Royong Masyarakat (BBGRM) ke-9 tingkat Kota Pematangsiantar. “Hakikat gotong-royong yakni membangun kebersamaan untuk mencapai suatu tujuan. Indonesia tidak bisa merdeka jika tidak ada persatuan, karena persatuan itu merupakan gotong-royong,” tegas Wali Kota Pematangsiantar Hulman Sitorus, SE melaluiWakilWali Kota Drs. Koni Ismail Siregar saat peringatan HKG PKK ke-40 dan BBGRM ke-9 tahun 2012 yang dipusatkan di lapangan voly, Kelurahan Mekar Nauli, Kecamatan Siantar Marihat, baru-baru ini. Pada kesempatan itu, Wali Kota menyampaikan terimakasih kepada Ketua Tim Penggerak PKK dan para kader PKK terutama kader PKK yang ada di kecamatan dan kelurahan, karena perannya dalam pengabdiannya kepada masyarakat. Ketua TP PKK Pematangsiantar Ny. Rusmiati RP Hulman Sitorus menyebutkan, TP PKK berupaya mengajak keluarga-keluarga Indonesia menjadi keluarga yang cerdas, sejahtera dan mempunyai ketangguhan membangun bangsa. Kepala Badan Pemberdayaan Masyarakat (BPM) Pemko selaku penyelenggara dalam laporannya yang dibacakan Sekretaris Drs. Tarzan Simarmata menyebutkan pelaksanaan BBGRM dan HKG PKKuntuklebihmeningkatkanrasapersatuandankesatuanmasyarakat serta meningkatkan peran aktif masyarakat dalam pembangunan partisipatif meliputi bidang ekonomi, sosial budaya dan lingkungan serta meningkatkan peran dan fungsi kelembagaan masyarakat terhadap hasil-hasil pembangunan.(a30)

tidak pernah menerima uang itu, tapi Manager PS Sidimpuan juga Sekretaris Daerah, Sarmadhan Hasibuan, ada menerima honor sebesar Rp24 juta. “PS Sidimpuan bukan lembaga atau dinas di Pemko Padangsidimpuan, sehingga pertanggungjawaban penggunaan dananya bersifat personal dan bukan hirarkis. Kami menilai penegak hukum sudah profesional dantidakadarekayasapenetapan HAN dan HMSP sebagai tersangka,” terang Zulkarnain. Sementara terkait tudingan Pemko Padangsidimpuan terancambangkrut.Menurutnyatudingan itu mengada-ngada, bersifat pribadi dan tendensius. Karena

pembangunankotainibukanhanya tanggungjawab wali kota, tapi semua masyarakat dan politisi. “Anggota DPRD Sidimpuan, DPRD Sumut dan DPR RI asal pemilihan Sidimpuan, juga memiliki tanggungjawab agar kotainitidakbangkrut.Kemudian kebangkrutan itu tidak semudah membalik telapak tangan, karena pemerintahpusatharuslebihdulu melakukanpembinaan,”ujarnya. Terkait proyek pembangunan yang terbengkalai. Menurut wali kota, anggaran proyek terbengkalai itu bukan dari APBD Pemko Padangsidimpuan, tapi APBN. Artinya, tanggungjawab harus dipikul semua pihak, terutama anggota DPRD Sumut

dan DPR RI asal pemilihan TapanuliBagianSelatan(Tabagsel) yang harus menggiring dana lanjutan pembangunannya. TerkaitdesakanagarWaliKota segeramenggantiSekda.Menurut Zulkarnain hingga kini dia belum ada rencana untuk mengganti Sarmadhan Hasibuan dengan oranglaindijabatanSekda.“Sampaisaatinitidakadaalasanyuridis dan politik untuk mengganti Sarmadhan dari Sekda,” ujarnya. KarenaituWaliKotaPadangsidimpuan, Zulkarnain Nasution, meminta semua pihak untuk menyikapi permasalahan yang timbul di kota ini secara hukum danmengedepankanasaspraduga tak bersalah. (a27)

Pemkab Karo Targetkan Produksi 10 Juta Ton Beras KABANJAHE (Waspada): Dinas Pertanian Kab. Karo menindaklanjuti program Menteri PertanianRIuntukmeningkatkan produktifitas dan mutu tanaman pangan menuju swasembada beras berkelanjutan sehingga dapat ditargetkan mencapai 10 juta ton di tahun 2014. Hal ini disampaikan, Bupati Karo Kena Ukur Karo Jambi Surbakti melalui Kadis Pertanian dan Perkebunan, Agustoni Tarigan SP, didampingi Kabid Produksi, Munarta Ginting SP, dan Kabid Saprodi Ir. Seridah kepada Waspada, Jumat (15/6) di Desa Batu Karang Kec. Payung saat menyalurkan bantuan fungisida kepada beberapa petani padi sawah yang terkena serangan penyakit blast (prikularia orizae). Untukmendukungkebijakan ini,selainmemberibantuanfungsida, Dinas Pertanian Kab. Karo

juga menyalurkan bantuan langsung benih unggul (BLBU), juga melakukan sekolah lapang pengelolaan tanaman terpadu (SLPTT),bantuanlangsungpemupukan (BLP) dan perbaikan infrastruktur seperti irigasi dan jalan usaha tani di tingkat terutama daerah produsen beras di Tanah Karo. Disebutkannya data 2011 lahan produktif beras di Kabupaten Tanah Karo tersebar di 17 kecamatanuntukjenispadisawah ada 14.817 hektare dan padi gogo 9.090 hektare. Sedangkan produksi padi sawah dan padi gogo saat ini mencapai 107.381,7 ton. Sedangkan khusus untuk Desa Batu Karang, lahan produktif padi sawah mencapai 700 hektare dengan dua kali musim tanam, yakni musim Panggung Baru mencapai 350 hektare yang biasa dilakukan pada Januari-

April sedangkan untuk persawahan Panggung Lama musim tanaman pada Juli-Agustus. Penyaluran bantuan fungisida kepada petani sawah di Desa Batu Karangtelahdilakukanduatahap. Tahap pertama dilakukan penyaluranya pada bulan Mei 2012 dengan populasi tanaman 10 hektare bantuan fungisida 10 Kg dan tahap kedua dilakukan pada Jumat (15/6) sebanyak 13 Kg dengan hamparan 13 hektare kata Agustoni. Sedangkan Kades Batu Karang, Saksi Bakti Bangun mengaku kalau petaninya terbantu dengan sistem yang telah diterapkan. Menurutnya, penyaluran batuan fungisida kepada petani sawah di Batu Karang telah dua kali diterima dan petani telah memanfaatkan program yang disampaikan instasi terkait di Kabupaten Karo ini. (c10/a36)

Tidak Ada Alasan Lulusan SLTA Madina Tidak Kuliah PANYABUNGAN(Waspada): Tidak ada lagi alasan lulusan SLTA Madina tidak kuliah, sebab Pemkab Mandailing Natal (Madina) sudah menyediakan beasiswa bagi keluarga tidak mampu dan bagi yang berprestasi. “Begitu juga dengan tingkat SLTA, tidak ada alasan tidak sekolah lagi karena ketiadaan dana karena Pemkab juga sudah menyediakan uang sekolah Rp50 ribu/siswa,”ujarSekdakabMadina M. Daud Batubara saat memberikankatasambutanpelaksanaan wisuda TK Al Khairot di Kec. Kotanopan, Kamis (14/6). Dikatakannya, selama ini alasan paling krusial penyebab banyak lulusan SLTA di Madina tidak kuliah karena masalah ekonomi. Jadi Pemkab Madina akan memberikan solusi, bagi mereka yang berprestasi dan kurang mampu akan diberikan

beasiswaRp5jutapertahun.“Kita berharap program ini dapat dimanfaatkan lulusan SLTA atau mahasiswa Madina yang kuliah di perguruan tinggi negeri.” Program pendidikan gratis ini dilakukan sebagai bentuk realisasi visi misi Bupati danWakil Bupati Madina. “Jadi mari kita dukung perwujudan visi misi ini agar kualitas pendidikan di Madina meningkat. Pendidikan adalahtolakukurterhadapkemajuan suatu bangsa. Saat ini kita terus berpacu agar pendidikan di Madina terus meningkat kualitasnya,” ujar Sekda. Ditambahkannya, agar kualitas pendidikan di Madina terus meningkat di tahun depan, direncanakan bagi yang masuk ke Fakultas Kedokteran Perguruan Tinggi Negeri akan dibiaya Pemkab Madina sampai yang bersangkutan selesai kuliahnya.

“Tapi sebelumnya yang bersangkutan harus membuat perjanjian yang bersangkutan akan mengabdi di Pemkab Madina selama-selamanya setelah selesai kuliahnya. Selain akan menambah jumlah dokter kita, tentunya pembiayaan ini akan membantu mahasiswa yang bersangkutan. Muda-mudahan program ini akanterealissaitahundepan,”ujar Sekda. KetuaYayasan TK Al Khoirot Hj.ChairaniNasutiondidampingi Wakil Kepala Sekolah Hasrini Lubis S.Pd, dalam kata sambutannyamengatakan,wisudayang dilaksanakan kali adalah wisuda yang kesembilan, sedangkan jumlah siswa TK yang di wisuda sebanyak 170 orang, yang terdiri 70 orang dari TK Alkhairot Kotanopan, 30 orang TK Alkhairot Tamiang dan 70 orang TK Alkhairot Muara Sipongi. (c15)

PDM Simanosor Julu Siap Harumkan Sumut Pada OSAM Nasional TAPANULI SELATAN (Waspada): Pesantren Modern Darul Mursyid (PDM) Simanosor Julu Sidadap, Kec. Saipardolok Hole, Kab. Tapanuli Selatan kembali ikut mengharumkan nama Sumut ke pentas nasional seiring ditetapkan dua siswanya bertarung dalam Olimpiade Sains Antar Madrasah (OSAM) tingkat MA Nasional di Bandung akhir Juni mendatang. Dua siswa yang menjadi utusan tersebut, Fajra Insani Kudadiri putra seorang dokter berasal dari Padanglawas, dia juara I Fisika OSAM Provinsi Sumut tahun 2012. berdasarkan prestasi inilah Fajra dikirim ke Bandung untuk OSAM Fisika Nasional. Sebelum meraih juara provinsi, Fajra sudah sering meraih prestasi, yakni jauara I OSN Fisika Kab.Tapanuli Selatan tahun 2009 tingkat SMP, juara I Fisika OSN kabupaten tahun 2012 tingkat SMA, peserta OSN Fisika tingkat provinsi di Berastagi awal Juni lalu,hasilnyabelumdiumumkan, juara I Fisika OSAM kabupaten tingkat MA. Saat pesta sains di IPB Bogor tahun 2010-2011, dari 200 peserta seluruh Indonesia, Fajrah yang berulang kali ikuti OlImpiade Sains di Methodis Medan masuk 60 besar, menuju juara I Fisika Nasionalsekaligusmasukpelatnas OSN ahir Juni ini. dia terus mengikuti bimbingan tIm konsultan OSN Bandung yang didatangkan ke PDM, selanjutnya mendapat bimbing jarak jauh via internet dan HP. GhosaliSiahaanjuaraiBiologi OSAM Sumut tingkat MA yang mengantarnya ikut lomba tingkat nasional, merupakan putra Sipirok, juga sudah berulang kali meraih prestasi. Juara I Biologi OSN Kab. Tapanuli Selatan 2011 tingkat SMA, juara I Biologi OSN kabupaten tahun 2012 tingkat SMA, juara I OSAM Kab. Tapsel 2012 tingkat MA. Sosoksiswayanguletinitidak pernahabsenmengikutiberbagai

momenOlimpiadeBiologiregional maupunnasional,jugapernahikut bimbingan khusus olimpiade bersama LOPI di Jakarta. Dia bercita-cita menjadi Master Biologi, tentu terlebih dahulumeraihjuaranasionalyang akan dilaksanakan di Bandung dalam waktu dekat, sehingga bisa masuk pelatnas OSN tahun ini. Untuk meraih sukses tersebut, tentunya kami mohon doa warga Tapanuli Selatan, ujar keduanya. Menurut Ketua Umum (Ketum) Yayasan Pendidikan Haji IhutanRitonga(Yaspenhir)selaku Badan Pengelola PDM, H. Jafar Syahbuddin Ritonga SE, MBA, yang ditemuiacaraOSAMSumut di Asrama Haji, bersana ibu pendiri yayasan Hj. Riana Siregar, mengatakan, keikutsertaan PDM mengharumkan nama Sumut ke pentas nasional dalam OSAM 2012, berkat kerja keras semua pihak,termasukibubadanpendiri sebagai motivator yang banyak memiliki ide, pengurus yasayan, jajaran pendidik, lengkapnya sarana prasanara dan lingkungan sekolah yang nyaman. Namun tidak terlepas dari kemampuan

guru untuk memotivasi anak, bersikap positif dan memahami jika persaingan itu akan memacu kemampuan/kualitas diri. “Kami berusaha di masa datang lebih banyak lagi siswa PDM yang mampu menjuarai cabang yang dilombakan, sehingga PDM benar-benar unggulan, mampu mengharumkan Tapsel khususnya Sumut umumnya ke tingkat nasional,” ujar pengusaha muda dan dosen S2 MM ini. Sebelumnya, Muammar Dani masuk enam besar Lomba Literasi Matematika (LLM) NasionaldiYogyajakartamengguli berbagai sekolah favorit. Keberhasilan Muammar Dani sempat mendapat tanggapan tokoh Sumut seperti Dekan Fak. Ekonomi USU Jhon T Ritonga, Dirut Bank Sumut Gus Irawan,BupatiTapselSahrulMPasaribu. Mereka menyebut, keberhasilan PDM memoles Muammar hingga masuk ke tingkat nasional, merupakan hal yang tidak bisa dibantah pusat keunggulan talenta akademik bangsa masih tetap di Tapanuli Selatan. (a26)


FAJRA, juara I Fisika OSAM MA provinsi dan Ghozali juara I Biologi OSAM MA Sumut, menjadi duta Sumut ke OSAM MA Nasional di Bandung, akhir Juni ini.

Waspada/Idaham Butar butar

KASAT Reskrim Polres Tapsel AKP Lukmin Siregar didampingi Kanit Reskrim Iptu Agus M. Butar butar bersama aparat kecamatan lakukan peninjauan ke lokasi kejadian bentrok antar warga dengan PT SRL yang kini sudah kondusif.

Situasi Kondusif Pasca Bentrok Warga Aek Nabara - PT SRL SIBUHUAN (Waspada): Pasca bentrok warga Koperasi Tani Torang Jaya Mandiri Desa Tobing Tinggi Kec. Aek Nabara Barumun dengan pihak PT SRL yang telah menyebabkan delapan gubuk warga diduga dibakar oknum karyawan perusahaan,PemkabPadanglawasbersamaunsur Muspida langsung turun ke lapangan. Kini situasi sudah kondusif. Seperti disampaikan Camat Aek Nabara Barumun, Syahmiran Hasibuan S.Sos, Kamis (15/6) bahwa situasi di areal bentrok kini kondusif. Data diperoleh 1.250 Ha areal yang diklaim warga tersebut termasuk areal konsesi PT SRL. Dan 250 KK warga yang menduduki dan mengusahai lahan yang diklaim warga telah mulai diusahai sejak tahun 2003. Tetapi belakangan ini ternyata telah masuk areal konsesi perusahaan. Camat Aek Nabara Barumun juga mengakui bahwa 250 KK warga itu bukan warga tempatan, tetapipendatangyangmasihbelumjelasstatusnya. Pemkab Padanglawas bersama unsur Muspida Plusmelakukanberbagaiupayapendekatandemi penyelesaian permasalahan.

Kapolres Tapsel AKBP Subandriya SH, MH, diwakili Kasat Reskrim, AKP Lukmin Siregar didampingi Kapolsek Barumun Tengah AKP H. Syahnur Siregar dan Kanit Res, Iptu Agus M ButarButar, kepada wartawan, Kamis (15/6), situasi di areal yang menjadi penyebab terjadinya bentrok itu kini sudah aman dan kondusif. Apalagi setelah kejadian, aparat keamanan terusdisiagakanuntukmenjagakeamanan.Sedang yang berkaitan pidana dan pelanggaran hukum juga akan tetap diproses dan ditindaklanjuti sesuai aturan hukum yang berlaku. Termasuk menyangkut kerusakan empat unit sepedamotor, satu unit mobil Mitsubishi jenis Strada yang rusak dan terbakar akibat bentrok tersebut. Selain sejumlah warga dan karyawan mengalami lukaluka. Namun upaya perdamaian juga tetap akan ditempuh, karena Pemkab Padanglawas bersama unsurMuspidaPlussudahmelakukanpendekatan terhadap kedua belah pihak, baik pihak perusahaan maupun pihak masyarakat, demi menjaga situasi daerah agar tetap kondusif. (a33)

Mona Sidabutar Juara I Kapolres Dairi Idol 2012 SIDIKALANG (Waspada): Dari 20 finalis yang berhasil maju ke grand final Kapolres Dairi Idol 2012 di halaman Mapolres, Sabtu (16/6), Mona Sidabutar 19, berhasil meraih juara pertama, diikuti Amnericha Siburian juara II dan Amne Ade juara III. Kegiatan itu dilakukan untuk menyambut Hari Bhayangkara ke-66. Para pemenang lomba, selain mendapatkan tropi dan sertifikat, para pemenang juara I, II, dan III, mendapatkan uang pembinaan masing Rp5 juta, Rp3 juta dan Rp2 juta diserahkan tokoh masyarakat BT.Pakpahan, Sasta Tambunan, Dandim 0206 Dairi diwakili Dan Ramil Sidikalang Kapt. Inf. Aman simbolon,disaksikan Kapolres AKBP Enggar Pareanon dan Ketua Bhayangkari Ny. Susi Enggar Pareanom. Sebelumnya, Kapolres AKBP Enggar Pareanom, S.Sos, SIK dalam sambutannya mengungkapkan, latar belakang pelaksanaan even yang disambut sangat antusias masyarakat, terutamaanakremajaDairi,adalahkarenamelihat

banyaknya anak remaja yang hobi bernyanyi, sehingga pihaknya mencoba membuat suatu wadah kompetisi untuk mengasah bakat keterampilan bernyanyi melalui Kapolres Dairi Idol 2012, sekaligus dalam rangka menyambut HUT ke-66 Bhayangkara. Selain itu, kegiatan ini merupakan salah satu implementasi dari program unggulan Polres Dairi yakni, “Polisi Kade-kadenta”yang mengandung arti, Polisi Saudara kita, Polisi sahabat kita.Sehingga diharapkan, melalui kegiatan ini, tujuan dari program Polisi Kadekadenta, dapat tercapai, demi terciptanya situasi Kamtibmas yang kondusif Menurut Enggar, bila tidak ada kendala, kegiatan Kapolres Dairi Idol, yang baru pertama kali digelar itu, akan digelar setiap tahunnya dan akan menjadi agenda tahunan Polres Dairi. “Bagi para juara, akan kita promosikan ke kontes-kontes di tingkat yang lebih tinggi, baik provinsi, maupun tingkat nasional,” sebut Enggar.(a20)

Bocah Tewas Ditabrak, Siswa SMA Luka Berat PEMATANGSIANTAR(Waspada):Kecelakaan lalu lintas (laka lantas) di wilayah hukum Polres Simalungun di dua tempat terpisah mengakibatkan satu anak perempuan usia enam tahun tewas dan satu pelajar SMA mengalami luka berat. Korban tewas, Putri, 6, warga Dusun IV, Desa Tanjung Hataran, Kecamatan Bandar Huluan, Kab. Simalungun sedangkan korban luka berat, Endi Norman Saragih, 16, pelajar, warga Dusun Batu 20, Desa Sigodang, Kec. Panei, Simalungun. Sedang korban luka ringan terdiri, Togi Ardian Purba, 16, pelajar,warga sama dengan Endi Norman Saragih dan Darwin, 22, swasta, warga sama dengan Putri. Korban Putri tewas sesudah ditabrak sepeda motor Suzuki Smash tanpa plat nomor polisi yang dikemudikan Darwin di jalan umum Km 3-4, jurusan Tanjung Hataran-Turunan Sore, Dusun IV, Desa Tanjung Hataran baru-baru ini. Personel kepolisian dari Pos Lantas Bandar Huluan terdiri Aiptu W. Aritonang, Bripka H Sitinjak, SH dan Brigadir Andrie Wijaya segera

mendatangi tempat kejadian dan melakukan olah tempatkejadiansertamengamankansepedamotor Darwin. Sementara, laka lantas yang mengakibatkan EndiNormanSaragihmengalamilukaberatterjadi ketika mobil sedan Toyota Altis BK 1272 NR yang dikemudikan Suriadi S, 32, sopir, warga Kelurahan Pematang Raya, Kec. Raya, Simalungun menabrak dari belakang sepedamotor Honda Supra BK 2443 TT yang dikemudikan Endi Norman Saragih dengan membonceng Togi Ardin Purba di jalan umum Km 19-20, jurusan PematangsiantarSeribudolok, Dusun Batu 20, Desa Sigodang. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H.Panggabean,SH,KasatLantasAKPBaginda Sitohang dan Kanit Laka Ipda Alsem Sinaga, menyebutkan, laka lantas di dua tempat terpisah itumasihdalampenyelidikan,sedangkerugianmateril akibat laka lantas di Desa Tanjung Hataran Rp 200 ribu, sedang kerugian materil akibat laka lantas di Desa Sigodang mencapai Rp10 juta.(a30)

Dishub Madina Didesak Pasang Traffic Light Di Titik Rawan Lakalantas PANYABUNGAN (Waspada): Pemkab Madina melalui Dinas Perhubungan dan Informatika didesak melengkapi rambu lalulintas di beberapa titik rawan kecelakaan lalulintas (lakalantas) di wilayah Kota Panyabungan, khususnya di persimpangan menuju jalan lingkar timur yang saat ini sangat ramai dilalui kendaraan. “Pemasangan rambu-rambu itu dianggap sangatpentinguntuktertibnyaberlalulintasdijalan raya.Tidakkalahpentingnyagunameminimalisasi angka kecelakaan lalu lintas (lakalantas) di daerah ini,” ujar Ridwan Lubis, salah seorang penduduk Kota Panyabungan, kemarin. Menurutnya, di sepanjang jalan lingkar timur tidak hanya peringatan lalu lintas yang perlu dipasang Dinas Perhubungan, tetapi rambu penunjuk arahpun sangat mendesak dibangun. “Untuk mewujudkan kota tertib lalu lintas, selain ditunjang dengan infrastruktur jalan yang baik juga harus didukung dengan rambu-rambu yang mencukupi,” katanya. Selain pemasangan rambu lanjut tokoh pemuda itu, Dinas Perhubungan juga sudah sewajarnya merencanakan terpasangnya traffic light (lampu lalu lintas) di titik persimpangan yang arus lalu lintasnya padat dan dinilai rawan terjadi kecelakaan lalu lintas. “Ada tiga titik rawan kecelakaan yang menjadi prioritas terpasangnya traffic light yakni di titik persimpangan masuk jalan lingkar timur atau

simpang empat masuk BLU-STAIM, simpang tigadepanrumahmakanParanginanmenujuPasar BaruPanyabungandan satutitiklagidipintumasuk jalan lingkar timur di depan rumah makan Ladang Sari Gunungtua Panggorengan,” ungkapnya. Dikatakan, pemasangan traffic light di persimpangan jalan menuju BLU-STAIM harus bisa dipastikan dan dananya dapat ditampung diAPBDTA2012.Sementara duatitikrawanlainnya yaitu persimpangan depan rumah makan Paranginan dan Ladang Sari tentunya sangat membutuhkan petunjuk dari pemerintah pusat. “Pemasangan traffic light di kedua titik persimpanganituperludirencanakanmendapatbantuan dana dari pemerintah pusat, sehingga bisa direalisasikan dengan secepatnya,” terangnya. Terkait tingkat kemacetan yang semakin bertambah di pusat kota Panyabungan, Dinas Perhubungan dan Imformatika Madina sangat tepat memberdayakan Forum Lalu Lintas Angkutan Jalan (FLLAJ) yang melibatkan sejumlah instansitermasukpengusahaangkutan.Kemudian melakukan kerjasama dan kesepakatan dengan para agen, sopir serta pihak yang terkait dengan perparkiran di kota itu. “DinasPerhubungandanImformatikaMadina harus terus berupaya mengurangi kemacetan di inti kota, salah satunya dengan cara melakukan kesepakatandenganpengusahamaupunpengelola angkutan,” harapya. (a28)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, . Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

TANJUNGBALAI (Waspada): 400 Gram narkoba jenis sabu-sabu asal Malaysia diamankan petugas Polres Tanjungbalai. Barang haram itu dibawa dua TKI ilegal. Demikian diungkapkan Kapolres Tanjungbalai AKBP Edward P Sirait didampingi Wakapolres Kompol Junaidy dan Kasat Narkoba AKP Novie Ardhie, Minggu (17/6). Modusnya, dengan memasukkan masing-masing 200 gram ke dalam sebuah kaos kaki pelaku lalu disembunyikan di perut. DiterangkanKapolres,kronologi penangkapan berawal dari informasimasyarakatbahwasatu unit kapal rambo (pembawa TKI dan barang ilegal) akan merapat di sebuah pelabuhan tradisional milik warga, Jumat (15/6). Dari keterangan diperoleh, dua TKI itu dicurigai akan menyelundupkan sabu-sabu. Setelah turun dari kapal dan melintas di Jalan Masjid, Kel. Keramatkubah, Kec. Seitualang Raso, tersangka berinisial AB, 44, pendudukBlanggongBasah,Kec. Mutiara Timur, Kab. Pidie,

Provinsi Aceh diringkus. Dari tangannya diamankan barang bukti diduga sabu seberat 200 gram dalam kaos kaki. Selain itu turut disita sebuah paspor dengan nomor 804062 dan satu unit telepon genggam merek Samsung. Di tempat yang sama seorang tersangka lainnya MH, 22, warga Dusun Tengku Bitai, Kel. Cot Mane, Kec. Bhatia, Kab. Aceh Utara, Provinsi Aceh juga membawa narkotika berbentuk kristal putih. Dari kaos kaki milik tersangka MH ditemukan narkoba diduga sabu seberat 200 gram. Di samping itu satu unit telepon seluler merek Nokia warna hitam juga dirampas selanjutnya dijadikan barang bukti. Menurut tersangka AB, merekahanyalahsebagaikurir(pembawa) narkoba titipan seorang pria keturunan untuk dibawa kepada seseorang di Medan dan

Aceh. Menurutnya, mereka dijanjikanupahRp8jutadanbaru akan diterima jika sabu telah sampai di tangan yang dituju. Lelaki berkulit hitam manis itu mengaku tidak mengenal identitas penerima sabu sebab belum pernah bertemu dengan dalih hanya berkomunikasi lewat telepon seluler. Dia juga mengaku terpaksa menjadi kurir karena desakan kebutuhan ekonomi. SedangkanMHmengatakan, dia masuk Malaysia melalui jalur resmi namun terpaksa pulang memilihjalanilegalkarenapaspornya hilang beberapa waktu lalu. Remaja itu mengaku baru sekali memasukkan sabu ke Indonesia. Kapolresmenegaskan,pihaknya tidak akan mentolerir masuknyanarkobakeKotaTanjungbalai. Disebutkan, Kepolisian telah memperketat pengawasan dan meningkatkan intelijen untuk memonitor peredaran masuknyanarkobadiKotaTanjungbalai. Diterangkan, kedua tersangka menjalani pemeriksaan intensif. Merekaakandikenakanpasal112, 113,dan114tentangnarkotikadengan ancaman seumur hidup. (a32)

PT Jampalan Baru Ramah Lingkungan SIMPANGEMPAT, Asahan (Waspada): Untuk menjaga ekosistem, PT Jampalan Baru Asahan ramah lingkungan, dengan tidak mengeluarkan limbah beracun dalam menghasilkan bahan produksi. Hal itu terbukti dengan tertibnya pihak yang memproduksi sabun, pengemasan minyak goreng dan penggilingan padi (beras) memeriksakan suhu udara selama enam bulan sekali dan air tiga bulan sekali oleh UPT Laboratorium Badan Lingkungan Hidup, hasilnya masih di bawah ambang batas dan ramah lingkungan. Demikian diungkapkan Bagian Humas PT Jampalan Baru Amrizal, didampingi Kepala Bagian Produksi Hendri, kepada Waspada, Sabtu (16/6). Menurutnya, perusahaan ini berdiri sejak 1970, tidak mengeluarkan limbah

yang berbahaya, hanya mengeluarkan air cucian mobil dan truk. “Pabrik kita bersih dari limbah, hal itu terbukti dari hasil pemeriksaan suhu udara dan air oleh laboratorium Bandan Lingkungan Hidup. Ditambah lagi pihakDPRDdanPemkabAsahan selalu rutin memeriksa kondisi lingkungan sekitar pabrik, dan sampai saat ini belum ditemukan zat berbahaya,” ujar Amrizal. Amrizal juga mengatakan, pihaknya membangun saluran air (drainase) sepanjang 1 km, karena mengantisipasi banjir di pemukiman warga yang ada di sekitar wilayah pabrik bila musim hujan tiba, serta membudayakan hidup bersih. “PT Jampalan Baru bukan saja semata untuk memproduksi, namun kita juga memperhatikan lingkungan terutama masyarakat yang tinggal di sekitar kawasan

PT,sehinggabisamembudayakan hidup bersih dan ramah lingkungan dalam menghadapi perubahan iklim. Tidak hanya itu, untuk membantu masyarakat, PT juga membantu penimbunan jalan sehingga masyarakat bisa mudahmemutarrodaperekonomiannya,” ujar Amrizal. Sementara di lain tempat, salah satu warga Dusun X, Desa Simpangempat,KecamatanSimpangempat, Mujiran,40, menuturkan selama kurang lebih 15 tahundiatinggaldiwilayahsekitar PT Jampalan Baru, air yang keluar dari PT tidak beracun, malah pihak pihak perusahaan membangun drainase untuk menghindari banjir di pemukiman warga. “PT selalu peduli dengan masyarakat sekitar, masalah limbah belum ada yang mengkhawatirkandansemuabaik-baik saja,” ujar Mujiran. (a15)

Penerbit: PT Penerbitan Harian Waspada

Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

217 Perusahaan Ikut Tender PUPE Labusel KOTAPINANG (Waspada): 217 Perusahaan mengikuti pelelangan manual yang dilakukan Dinas Pekerjaan Umum, Pertambangan, dan Energi (PUPE) Labusel. Sejumlah perusahaan yang pada 2011 lalu proyeknya tidak selesai pun masih turut mendaftar. Ketua Panitia Pelelangan Dinas PUPE Labusel, Bangun Siregar yang dikonfirmasi, Kamis (14/6) mengatakan, hingga pendaftaran dan pembukaan penawaran ditutup, Rabu (13/6), tercatat 217 perusahaan ikut bersaing untuk memenangkan 25 paket proyek yang ditenderkan. “Seluruhnya 217. Sekarang akan kita lakukan evaluasi selama tiga minggu, kalau waktunya kita rasa kurang akan kita mintakan pertambahan,” kata Bangun. Berdasarkan pengamatanWaspada, sejumlah perusahaan yang tidak mampu menyelesaikan proyek hingga batas kontrak selesai pada proyek APBD 2011 lalu juga turut mendaftar dan memasukkan penawaran, satu di antaranya CV.Wangi. Pada 2011 lalu, perusahaan ini mengerjakan proyek pembangunan jembatan di Dusun Simongi, Desa PasirTuntung, Kec. Kotapinang. Namun hingga kontrak diputus, rekanan hanya mampu mengerjakan 50 persen proyek dengan nilai Rp870.372.000 ini. Hal tersebut tidak ditampik Bangun. Menurutnya, seluruh perusahaan tetap diterima mendaftar dan memasukkan penawaran. Namun kata dia, hal tersebut menjadi catatan bagi pihaknya dalam melakukan evaluasi. “Perusahaan yang proyeknya nggak selesai tahun lalu ya tetap kita layani, tapi ini menjadi catatan kita,” katanya. Menanggapihaltersebut,pengurusAsosiasiPengusahaKonstruksi Indonesia(Aspekindo)Labusel,MuhammadHashirmengimbauDinas PUPE jeli melihat rekanan bermasalah dan tidak memenangkannya pada pelelangan 2012. Menurutnya, jika dimenangkan, dikhawatirkan proyek tersebut kembali akan bermasalah. (c18)

Waspada/Rasudin Sihotang

KAPOLRES Tanjungbalai AKBP EP Sirait (kanan) didampingi Wakapolres AKP Junaidy (tengah) dan Kasat Narkoba AKP Novie Ardhie (kiri) memaparkan kronologi penangkapan dan modus penyelundupan narkoba asal Malaysia.

ABG Korban Trafficking Dipaksa Berpakaian Seksi TANJUNGBALAI (Waspada): Korban trafficking (perdagangan) anak baru gede (ABG), Mawar (nama samaran), 15, mengaku selama beradadikafetempatpenampungandiUjungbatu, Kab. Rokan Hulu, Prov. Riau mereka dipaksa berpakaian seksi. “Kamidipaksapakaibajuterusantanpalengan (you can see) yang panjangnya sampai ke paha.Di sana wajib berpakaian serba minim,” ujar Mawar kepada Waspada, Jumat (15/6). Diterangkan Mawar, menjelang malam hingga pukul 21:00, para ABG yang direkrut dari berbagai daerah umumnya Kota Tanjungbalai disuruh berdiri di pinggir jalan tepatnya di pintu masuk kafe milik Syamsul dan istrinya Dewi. Pemilik kafe memerintahkan agar setiap lelaki yang lewat dipanggil agar mau masuk ke kafe Syamsul. Ketika pukul 22:00, para ABG itu selanjutnya dipanggil masuk ke kafe untuk melayani para tamu yang umumnya didominasi pria hidung belang. Bukan itu saja, mereka diminta menemani tamu minumminumanberalkoholsembariberjogetdan menari dan harus memakai pakaian serba mini. Parahnya lagi, para tamu itu mengajak kencan (tidur bareng) dan membawa mereka ke suatu tempat dengan izin pemilik kafe. Jika tidak mau,

gadis-gadis cilik itu tidak akan diberi makan dan minum bahkan kerap mendapat tindakan kekerasan yang tidak manusiawi. “Akukelaparan,terusdiajakmakankerestoran. Rupanyakamibukanmakan,tetapidibawamasuk kamar, karena tidak mau, aku dipukuli dan dikasih pil tidur, setelah itu aku diperkosa,” ungkap korban lain Belia, 16. Mawar dan Belia berhasil kabur dari kafe Syamsul berkat usaha keluarga dan bantuan tamu yang merasa iba melihat mereka. Sesampainya di Tanjungbalai, kejadian tragis itu lalu dilaporkan ke Mapolres Tanjungbalai beberapa minggu lalu. Kepolisian lalu memanggil dan memeriksa sejumlah orang termasuk Endang dan Uli yang diduga sebagai kaki tangan Syamsul di Kota Kerang, Rabu (6/6). Namun anehnya, Kepolisian belum menetapkan seorangpun tersangka kendati pemeriksaan telah berlangsung lebih dari seminggu. Atas lambannya proses hukum dan pelimpahan ke jaksa itu, Kepolisian selalu berdalih bahwa kasusnya masih didalami. Pelaku masih bebas berkeliaran, bahkan mendatangi korban untuk meminta berdamai. Ironisnya, korban juga disuruh untuk menarik laporan dari kepolisian dengan berbagai ancaman dan intimidasi. (a32)

Honorer Pemkab Batubara Resah

Hubungi kami


Senin 18 Juni 2012

Polres Tanjungbalai Amankan Sabu 400 Gram Asal Malaysia

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002



SALURAN pembuangan air dari PT Jampalan Baru tegolong bersih dan tidak menghasilkan limbah beracun. Hal itu karena pabrik tidak menghasilkan limbah beracun sehingga ramah lingkungan dalam menghadapi perubahan iklim.

BATUBARA (Waspada): Ratusan pegawai honorer di desa/kecamatan se Kab. Batubara resah bercampur bingung, karena mereka mendengar: jika mau lulus menjadi Calon Pegawai NegeriSipil(CPNS)harusmenyetorsejumlahuang, yang bisa mencapai puluhan juta rupiah, kepada oknum tertentu yang bertindak sebagai calo. Menurut sumber, disebut-sebut oknum berinitial H menjabat sebagai Kepala SD di salah satu kecamatan di Batubara door to door mencari mangsa mendatangi SD/SMP/SMA dan kantor dinas yang ada pegawai honor sudah masuk databese. “Kami sesama pegawai honor calon CPNS di Batubara jadi bingung. Ada oknum disebut H bisa mengurus gol jadi CPNS asalkan mau menyetor uang pelicin Rp25 s/d Rp30 juta/orang,” sebut sumber di Batubara, Minggu (17/6). Dikabarkan, oknum tersebut mempromosikan diri mampu mengurus ke pusat karena ada keluarganya di Kemenpan. Bahkan, diduga sudah

puluhan orang yang sudah membayar sebagai panjar bervariasi Rp5 s/d Rp10 juta bahkan ada yang membayar lunas. Lebih jauh isu berkembang bahwa pihak BKD Batubarasudahmengirim databasecalondiangkat jadi CPNS 400 orang dan yang diterima tahun 2013 hanya 100 orang. Karena itu tindakan oknum H sebagai calo dianggap sangat berbahaya karena ratusan honorer bisa saja masuk perangkap. “BisasajaHnekatmenjadicalomengharapkan nasib untung-untungan seperti menembak di atas kuda,” ujar sumber, apalagi H nekat diduga orang dekat dengan penguasa di Pemkab Batubara. Sumber di BKD Batubara menyebutkan tidak mungkin ada oknum yang berani menjadi calo/ agen karena database sudah dikirim ke pusat, tak mungkin bisa diganti-ganti/ditukar. “Diminta kepada semua honorer yang masuk daftar database jangan mudah percaya bujuk rayu oknum mengaku sanggup mengurus dengan meminta uang puluhan juta,” sebut sumber. (a12)

Kantor Bupati L. Batu Labuhanbatu Raih Penghargaan Dilelang Rp39,8 juta Sekolah Adiwiyata Tingkat Nasional

RANTAUPRAPAT (Waspada): Kabupaten Labuhanbatu merupakan salah satu kabupaten/kota yang berhasil meraih penghargaan sekolah Adiwiyata Tingkat Nasional Tahun 2012. Prestasimembanggakanitudiraih Madrasah Ibtidaiyah Negeri (MIN) Padangbulan setelah menyisihkan ratusan sekolah dari berbagai kabupaten/kota di Sumatera Utara. Kepala Badan Lingkungan Hidup (BLH) Labuhanbatu Romiduk Sitompul SH, MH, Kamis (14/6) kepada wartawan mengatakan, penghargaan Adiwiyata Tingkat Nasional yang diraih oleh MIN Padang Bulan itu berkat kerjasama yang baik antara Pemkab L.Batu dalam hal ini Badan Lingkungan Hidup

dengan pihak sekolah dan stakeholder lainnya. “Ini membuktikan bahwa kerja keras kita untuk menata lingkungan sekolah bersih dan asri tidak pernah berhenti,” kata Romiduk. Dikatakan, sejak diluncurkannya program Adiwiyata Tingkat Nasional tahun 2006, L.Batu menerapkan program tersebut sejak 2007 untuk kategori SD/sederajat, SMP/sederajat dan SMA/sederajat. Khusus untuk tahun 2012 ini ditambah dengan kategori SMK/sederajat. Ditambahkannya, pembinaan BLH kepada setiap sekolah mencakup empat komponen, yaitu: kebijakan berwawasan lingkungan, kurikulum berbasis lingkungan, kegiatan lingkungan berbasis partisipatif dan penge-

lolaan sarana pendukung ramah lingkungan. Kabid Penyuluhan dan Kelembagaan BLH Labuhanbatu Lidya B Purba SKM dan Kepala Sekolah MIN Padang Bulan Drs. Zulkarnain yang menerima langsung Piagam Penghargaan Adiwiyata dari Menteri Lingkungan Hidup,Prof.DR.BeerthKambuaya, padaMalamAnugerahLingkungandiJakartamengatakan,penghargaanyangditerimaitumerupakan penghargaan yang cukup membanggakankarenauntukpertama kalinya diperoleh Labuhanbatu. Dengan diraihnya penghargaan ini, kata Lidya, sekolah lain akantermotivasiuntukmelakukan langkah-langkahkearahyanglebih baikdemiterciptanyasekolahyang berwawasanlingkungan. (a18/c07)

Waspada/Armansyah Abdi

MENTERI Lingkungan Hidup Prof. DR. Beerth Kambuaya (tengah) foto bersama dengan Lidya B Purba SKM (kiri) dan Drs. Zulkarnain (kanan) usai penyerahan piagam penghargaan Sekolah Adiwiyata Tingkat Nasional di Jakarta.

RANTAUPRAPAT ( Waspada): Lelang (penjualan di muka umum) Pembongkaran Blok II dan Blok III Kantor Bupati Labuhanbatu di Ruang Data dan Karya Kantor Bupati setempat, Jumat (15/6) yang dipandu Putra Sugiharto SH, Pejabat Lelang dari Kantor Pelayanan Kekayaan dan Lelang Negara, Kisaran, dimenangkan seorang peserta dengan nilai lelang Rp39.815.000. Kabag Keuangan dan Perlengkapan, Sapri SIP, selaku Kuasa Penjual yang ditugaskan oleh Sekdakab L.Batu mengatakan, pembongkaran bangunan blok II dan III kantor bupati dilakukan berdasarkan Keputusan Bupati L.Batu Nomor : 028/157/DPPKAD-IV/2012 tanggal 29 Mei 2012 tentang Penghapusan Sebahagian Gedung Kantor Bupati L.Batu Jl SM Raja No.60 Ujung Bandar, Rantauprapat Tahun Anggaran 2012. Ditambahkan, pembongkaran tahap II kantor bupati ini sebelumnya telah melalui proses penaksiran dan penilaian yang dilakukan oleh tim yang melibatkan seluruh instansi terkait, seperti

DinasCiptaKarya,PerindustriandanPerdagangan serta Dinas Pendapatan Pengelolaan Kekayaan dan Aset Daerah L.Batu. Disinggungtentangpengumumanlelang,Sapri menjelaskan,pengumumanlelangpembongkaran kantor dilakukan melalui HarianWaspada tanggal 8 Juni 2012 dengan Nomor Pengumuman : 027/ 01/KP/2012. Harga limit lelang sebesar Rp39.015.0000, dengan harga jaminan Rp30.000.000. Setelah dilakukan lelang, harga akhir yang dicapai adalah Rp39.815.000, yang dimenangkan oleh Teo dari Rantauprapat. Terkait sedikitnya peserta lelang, Safri berpendapat disebabkan nilai bangunan yang dilelang kurang diminati oleh peserta, karena memang nilai jual fisik bangunan tersebut dinilai rendah karena termakan usia. Safri berharap pemenang lelang segera melakukan langkahlangkah pembongkaran, karena pembangunan gedung baru kantor bupati tahap II akan segera dilaksanakan. (a18)

Kejari Rantauprapat Dipraperadilankan MEDAN (Waspada) : Melakukan penahanan didugatanpalandasanhukumyangjelas,tersangka perkara dugaan tindak pidana pemalsuan surat keterangan warisan mempraperadilankan Kejari Rantauprapat. “DalamhalinikitamendesakPengadilanNegeri (PN) Rantauprapat untuk menggelar praperadilan jaksa dari Kejari Rantauprapat,” ujar Zulisrak, SH, didampingi Themis Simaremare dan Husni, SH, selaku kuasa hukum tersangka Anwar Ak, dkk di Medan, Sabtu (16/6). Adapun para termohon, lanjutnya, seorang pejabat kejaksaan yang menerbitkan surat perintah penahanan tingkat penuntutan terhadap Anwar AK dan Syafruddin AK merupakan termohon pertama. “Sedangkan termohon ke dua adalah Ajun Jaksa yang telah melaksanakan penahananterhadappemohonpraperadilansesuai berita acara pelaksanaan penahanan lanjutan.” “Hal ini mengingat penahanan yang dilakukan olehTermohonIdanTermohonIItidaklahmemiliki landasan hukum yang kuat dimana tidak ditemukannya bukti permulaan yang cukup, sehingga perbuatan termohon bertentangan pasal 21 ayat (1) KUHAP,” ujarnya. Dijelaskannya, KUHAP berisikan “Perintah penahanan atau penahanan lanjutan dilakukan

terhadap seorang tersangka atau terdakwa yang diduga keras melakukan tindakan pidana berdasarkan bukti yang cukup, dan dikhawatirkan akan melarikan diri, atau merusak atau menghilangkan barang bukti.” “Bagaimana mungkin seorang yang tidak pernah melakukan tindak pidana sebagaimana yangdituduhkankepadaAnwarAKdanSyafruddin AK dapat ditahan sebagaimana layaknya seorang pelaku tindak pidana,” ujarnya. Dalam hal ini, lanjut dia, unsur-unsur delik pidana yang dituduhkan terhadap Anwar AK dan SyafruddinAKterkesanmemaksanakankehendak atas program kerja target para termohon saja, sehinggatindakannyatersebutdinilaicacathukum. “Untuk itu kita meminta PN Rantauprapat dapat menerima permohonan praperadilan pemohon dan menyatakan tindakan termohon yang telah menahan Anwar Ak, dkk selaku terdakwa tidak sah, dan memerintahkan termohon untuk segera membebaskan Anwar Ak dan Syafruddin Ak dari tahanan,” ujar Zulisrak, SH. Kuasahukumtersangka,Tambunan&Partners mendesak agar PN Rantauprapat untuk menghukum termohon segera merehabilitasi nama baik Anwar Ak dan Syafruddin AK atau pemohon praperadilan. (m38)

1 CM 2 CM

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca P S : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window


Bensin 4x4. BK Medan Warna abu2, AC, Tape, TV, Velg Rac. B. Radial, Jok kulit. Boleh TT. Panther. Hub. 0813 600 75306 DAIHATSU Zebra 1,3 Long. thn. 95/94. Minibus, 5 Speed, Biru met. BK Mdn, cat mulus, mesin sehat. Harga 25,5Juta. Hub. 0852 6144 3096 - 0813 7015 4503

DAIHATSU Xenia Th. 2007 Famili VVTi 1000cc. BK. Hrg. 107Jt. Nego. Wrn Hitam. Hub. HP. 0813 6212 2339 ALL NEW XENIA (BARU) 1300cc, AC DB, Sensor Parking, CD, MP3, USB, Alarm, Central Lock, Angs. 2.333.100. Terios Angs. 2.747.000. Pick Up Ang. 2.339.000. Hub. ASTRA DAIHATSU 0812 6340055 PIN 274CA61C


Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 3 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067

DAIHATSU Xenia 2006. Type Li W. Hitam. H. 96Jt. HP. 0852 6162 5569


5 CM 6 CM

Rp. 65.000 Rp. 78.000


HONDA Maestro (sedan) Thn. 90 Dijual. Wrn hitam met, VR, BR, AC, PW, TP CD Power, Remote, BK 2 Angka, pjk panjang, siap pakai nggak kecewa. Hrg. 45Jt Nego. Hub. 0813 7030 1442 # ISUZU 100% BARU (0%) # Panther Pick Up Turbo...DP 20 Jt-an Panther LV,LS, Touring...DP 40 Jt-an Hub. Suprapto HP. 0813 7507 0088/ 061.7786 0168

MITSUBISHI L300. PU. 99 BK Mdn Cat Asli Tanpa Dempul. Ban Baru, Tape, H. Nego. HP. 0813 6270 0125

ALAT BERAT Komatsu, Hitachi, Kobelko, CAT dll PRESS TRACK LINK Ganti Bushing dan Pin Baru Excavator = 10 Jt Bulldozer = 14 Jt Tersedia: Track Link Second, Baru BAN: Glader, Loader, Vibro HP. 0852.7077.2488

TOYOTA Kijang LGX Solar W. Biru met, BK Medan asli Th. 2001. Lengkap, siap pakai. Rp. 125Juta Nego. Hub. 0813 6227 1115. Jl. Amaliun. Dpn SD Kartini No. 146 Toko ULGA TOYOTA BARU 2012 Bunga 3,35 %. Proses Cepat & Data Dijemput. Hub. Predy Simatupang. 0853 6207 2000 - 0813 6165 1801

TOYOTA Kijang super Thn. ‘96 Dijual. Hijau metalik, AC DB, kondisi baik. Hub. 0812 6050 667 (TP)


FORTUNER DIESEL/ INNOVA/AVANZA/APV Kontrak pun Ok !! H. Saiful 0811.613.107







Tanaman investasi umur 7 thn bisa panen, Puluhan Juta, yg butuh bibit Gaharu, Obat suntik gaharu & mau jual isi batang gaharu, serta mau pesan bbt yg lain, yg bersertifikat Hub. Pak Jamal di Limau Manis Tanjung Morawa HP. 0813.7091.2113


Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.


- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

Dahsyaatt, Hanya 16 Juta bisa buka usaha laundry kiloan + diajarkan Cry clean + Spa helm, kami yg termurah, terprofesional di dunia, maukan penghasilan halal minimal 300 ribu - 1 juta tiap hari seumur hidup? 0852.6298.7114





0812 631 6631 Ada Garansi


845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim


I n g i n u s a h a m o d a l k c l --( Mesin Laminasi=795rb (Prin bisa foto copy warna 695rb)kertas cetak kaos & kartu nama

Dana Tunai





1 Buah BPKB No. Pol. BK 1470 QN. Nama: Juni Sri Rejeki Br. Tarigan SE. Alamat: Jl. Kapas Raya No. 6 P. Simalingkar. No. Mesin: G4HEM101211. No. Rangka: MHXARM5CGI/ JOOZ11. Jenis/Merk: Atoz 4x2 M/T / M. Penumpang.

Study Banding: - Akademi Kebidanan & Keperawatan di Jakarta - Luar Negeri (Malaysia dan Jepang)


Surat Akta Pelepasan Hak/ Ganti Rugi, No. 767/Akte/1987, A/n. Basrah yg terletak ling. XX Kel. Bantam Medan Denai, Luas ±380,90m²


Ingin Menjadi BIDAN Dan PERAWAT yang Profesional Berintegritas And, Pelayanan Prima Bergabung dengan kami AKADEMI KEBIDANAN DAN AKADEMI KEPERAWATAN DEWI MAYA MEDAN TERAKREDITASI “B” IZIN DIKNAS: No. 07/D/0/2005 IZIN DEPARTEMEN KESEHATAN RI No: HK.06.01/III/3/02231/2010





Tukang Pangkas (Lokasi tempat Marindal) Hub. 0813.9682.3449 (SMS aja)





* PAKET 4 CHANEL + INFRARED + HARD DISK 500 GB 4 Bh Camera + DVR 4 Channel + HDD 500 Gb + Power Suply 10 A

..........................Rp. 2,8Jt

PAKET 8 CHANEL + INFRARED + HARD DISK 500 GB 8 Bh Camera + DVR 8 Channel + HDD 500 GB + Power Suply 15 A ....................Rp. 4,5Jt NB: Harga belum termasuk Pemasangan dan Kabel KAMI MENYEDIAKAN HARGA GROSIR KHUSUS UNTUK DEALER !! Setiap pembelian Paket dapat memilih Camera Outdoor / Indoor sesuai dengan Kebutuhan Rumah, Kantor, Pabrik, dll

Toko H.W JALAN ASIA NO. 1C TELP. 061.7346093 - 75330002

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput




Jl. Sutomo Ujung No. 102 B-Medan Telp. (061) 664.3024 Fax. 061) 664.0250 Email:

Merawat kejantanan secara alami (tidak ada efek samping) besar dan panjang, permanen dan cukup sekali datang




UMROH RAMADHAN: SPECIAL PAKET IQTIKAF (Apartement) 9 Hari (Rp. 16.200.000) 11 Hari (Rp. 17.000.000) 13 Hari (Rp. 18.000.000) Lailatul Qadar + Puasa Syawal 17 Hari (Rp. 19.500.000,-) Full Ramadhan 37 - 38 Hari (Rp. 23.500.000) Arbain HAJI PLUS 27-28 Hari Harga Mulai USD 7000 Info lebih lanjut hub: Hj. Nasla: 0813.7077.7555 - 0852.2177.7555 Dian: 0852.7556.6555


Alamat: Jl. SM. Raja masuk Jl. Sempurna No. 18 (samping UISU SM. Raja) H P. 0 8 1 3 1 1 1 9 6 3 3 1 No. Izin Kejaksaan, Nomor : B12/DSP.5/01/2012 Metode: Penanganan dari ujung kaki sampai pada pangkal alat vital untuk membetulkan urat yang tersumbat dan melancarkan peradaran darah membetulkan aliran sperma. kemudian dikusuk/ terapy untuk penambah ukuran besar dan panjang tidak ada efek samping, permanen, bebas pantangan dan untuk semua agama.

PRIA - Panjang: 10 - 12 - 14 - 16 - 18 - Besar: 3 - 4 - 5 - 6 - 7 - Sperma encer - Lemah syahwat - Ejakulasi dini - Impotensi



Kirimkan segera surat lamaran anda ke:


Setelah surat lamaran diantar ke alamat diatas, SMS ke nomor HP. 0813.6210.5778

BUtuh cepat P/W (17-45 thn) utk posisi di bagian “MITRA KERJA” di kantor (100% bukan Sales) min SMU sederajat Syarat: Bawa KTP + Guntingan iklan utk interview yg lain menyusul Penghasilan Rp. 1.200.000-Rp. 2.500.000/bln + Bonus harian Hub: Ibu NURHALIMAH/ IBU RIKA LUBIS HP. 0853.7376.2805 - 0812.6388.5458 Alamat: Jl. Gatot Subroto, simpang 4 Lampu merah Medan Plaza, diseberang Rumah Makan Simpang Raya NB: Lebih cepat lebih baik, terbuka bagi Mahasiwa/i


Dibutuhkan Supir Toko, syarat: 1. Berpengalaman 2. Rajin 3. Domisili di Medan 4. Bertanggung jawab

Antarlamaranke:TOKO ANGKASA GYPSUM Yg beralamat di Jl. Setia Budi No. 272B dengan membawa Foto copy KTP, Serta Kartu Keluarga atau hub. 0812.6050.8773/ Bpk. Suirwan



DalamrangkapengembanganSMK&STMIK TritechInformatikamembutuhkanGuru-guru yang mempunyai kompetensi lebih untuk bidang studi: A. Dosen dan Guru Komputer Jaringan B. Dosen dan Guru Multimedia C. Dosen dan Guru Pemograman D. Dosen dan Guru Matematika E. Staff F. Guru BP G. KTU Dengan syarat-syarat sebagai berikut: 1. Pria/ wanita (A s/d G) 2. Muslim/ Muslimah (A s/d G) 3. Dapat bekerja individu atau dengan team (A s/d G) 4. Mampu mengoperasikan Ms. Word, Ms. Excel dan Ms Power Point (A s/d G) 5. Pengalaman minimal 3 tahun (A s/d G) 6. Diutamakan yang mampu berbahasa inggris lisan atau tulisan (A s/d G) 7. Khusus Dosen harus S2 (A s/d D) 8. S1 Tehnik Informatika (A s/d D) 9 Mengerti sistem jaringan (A s/d D) 10. Memahami Design Web (A s/d D) 11. Mengerti menggunakan Adobe Photo shop dan CorelDraw (B) 12. Sistem Informatika (C) 13. MemahamiSistemOperasiOpenSource(C) 14. MemahamiVisualBasic,PhpdanJava(C) 15. S1 Psikologi (F) 16. MinimaltamatanSMEAjurusanSekretaris(E) Lamaran dan CV diantar langsung ke:

SMK TRITECH INFORMATIKA Jl. Bhayangkara No. 522 D Medan Paling lambat 2 minggu setelah iklan ini terbit


W A N I TA : - Memperindah payudara - Menjadikan G-spot, seperti perawan kembali - keturunan

DIJAMIN BERGARANSI KONSULTASI UMUM: - Susuk semar asih - Ajian tali raga - Susuk Ratu Malam - Bedak aura kinasih - Ajian pemutus & penyambung cinta - Pelet tuyul

Ingin Promosikan Produk Anda Harian

Dibutuhkan Segera Tenaga Kerja untuk Restoran sebagai: 1. Waiter/ Waitress 2. Steward Persyaratan: a. Berpenampilan baik dan menarik b. Mau bekerja keras c. Dapat berkomunikasi dengan baik d. Mau menerima tantangan Antarkan lamaran Anda langsung ke: OFFICE SDM: Jl. Sei Batang Hari No. 60 RM. Waroenk Nenek, atau ke Cabang JOKO SOLO terdekat, Telp. (061) 452.5311 LOWONGAN KERJA






HP. 8442246

Latop-Hp axio, Zyr-Co2du+Kamera..(1.995rb) Kamera-DSLR-Canon Profsnal..3.850rb Latop - hp / acer / asus - Co2 atom = 1.685rb Kamera-sony12mp (899) casio 14mp (799rb) acer co2d 15” vga + Games online. . .1.98Jt IPAD apple 1 (Rp. 2,950rb) Lenovo Cor2tom/cam (1,59Jt) hp14” +dvd 1,5Jt Projector2Jt Cctv 185rb TOSHIBA-P4/512+kamera,wifi30dvcrw14”(1,59Jt) Ups+Stbil (289) stbil (39) spker (55rb) LCD 10” 14” for LAPTOP=579rb Jaminan, BB, Ipad, Iphone, Ps2, Nb, kamera DLSR, LCD TV, Projector?? Kredit, Jual-beli, Tukar + SERVIS (Pantas) PT.0812 636 1967 Jl. Rantang 20s




1 Buah BPKB No. Pol BK 1875 GL. Nama: S. Sakradary. Alamat: Jl. Sei Blutu PS IX No. 65 Mdn.No.Mesin: E 256565. No.Rangka: MHERBR54F4 K256565. Jenis/Merk: Isuzu / M. Penumpang.

Hub. 0852 7084 7017 0852 6111 7724 Terima Tukar Tambah



SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Apabila anda mencurigai sesuatu, silahkan hubungi kami di


11 CM Rp. 165.000 12 CM Rp. 180.000

Pelanggan Yang Terhormat


DEALER RESMI SUZUKI MOBIL Carry PU 1.5 FD DP 10Jt-an Angs. Rp. 2.663.000. Ertiga Ready: Pesan sekarang juga Hub. 0852 6222 6789 / 77722121

Carry Pick Up - Ertiga / APV DP Murah, Angsuran Ringan

9 CM Rp. 126.000 10 CM Rp. 140.000

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab






SUZUKI APV Tahun 2005 2006. TPX wrn. hitam original 103 Juta. Hub. 0811 634 279

SUZUKI Jimny Thn. 84. Warna putih, AC, Tape, Power Steering, Ban besar 4x4 Aktif. Free Lock. Lengkap Hrg. 43Jt/Nego. Hub. 0812 6351 3360

Rp. 91.000 Rp. 104.000


Avanza, Innova, Fortuner Purba: 08139 789 4633

Complit, Hitam, Velg Cobra, Harga Rp. 50 Jt/nego 0811.657.024 HONDA Grand Civic ‘88. Warna Hijau tua, PS, CL, PW, AC, Mulus. 0853 5955 7488

7 CM 8 CM


Bursa Automotive

A C : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower



Senin, 18 Juni 2012

WASPADA Media yang Tepat untuk Iklan Anda




Dijual aset kedai kopi lengkap, Siap usaha, Omzet bagus, Sudah ada pelanggan, Lokasi Langsa (B.U) 0823.6413.7501


Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500


PERABOT TEMPAHAN & REHAPAN SOFA Bahan “Bagus”, harga “Murah”, Jahit jarum 2 + Garansi Hub. (061) 7773.9090/ 0812.638.9090

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

DIJUAL RUKO GANDENG 2 UNIT, 3 TINGKAT Ukuran @4x21, 125, Jl. KL. Yos Sudaro No. 175/175A Medan Hub. 0823.6768.0009

DISEWAKAN Rumah baru Lt

2,5 di komplek Gaperta Mansion, KT3, KM2, LT. 126/95m2, PAM, Listrik 2200, Jalan depan 9 m, dekat sekolah, swalayan, security24 jam. hub: 081377106415 (Dedi) atau 081215322451 (nana)

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243


Di Villa Mutiara Johor II Blok C12A Type 45, Luas Tanah 113m² Luas Bangunan 45m² H u b . 0813.6409.9905 / 0812.602.9460




Garansi 10 Hari Sembuh Tanpa Operasi HUBUNGI: SPECIALIST WASIR




Terletak di Jl. Pertahanan Gg. Pinang, Uk. 11x13m, Surat SK Camat, 450 Rb/m, Strategis, 50 mtr dari Jalan besar di samping Mesjid, Khusus Muslim Hub. 0813.7027.4878

Jl. Brigjend. Katamso No. 683C Medan (±50m dari Simpang Pelangi) Hubungi: 0852.9751.4253 0812.6050.0881


Rp. 13.500.000 18x8m Terima Surat Camat Lokasi Desa Sei Mencirim Pasar I, 8 Km dari Jalan Medan Binjai (Diski), Tanah Tinggi, Rata, Bebas banjir, Ada listerik, Jl. Dilokasi 6 meter, Langsung bangun gratis Batu-Bata 7000

Hub: H. SALIMIK 0812.601.8160 Jl. Binjai Km. 15 (Amal Water)

Ingin Promosikan Produk Anda Harian

(Untuk reumatik & asam urat)

WASPADA Media yang Tepat untuk Iklan Anda

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887


Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KHUSUS PRIA: - Ejakulasi dini - Impotensi - Memperbesar “Alvit” - Memperpanjang “Alvit” - Keras dan tahan lama dll KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll KONSULTASI UMUM: - Buka Aura - Cari Jodoh - Sesama jenis - Pelaris - Memikat lawan jenis - Besar PYDR


Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP .0812.4038.333



Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222



WASPADA Senin 18 Juni 2012


Faksi Anas Kuat Tak Mudah Dilengserkan


etua Dewan Pembina Partai Demokrat (PD) yang juga Presiden RI Susilo Bambang Yudhoyono (SBY) mempersilakan kader PD yang terlibat kasus korupsi supaya mundur. Jumlah kader terlibat korupsi kecil dibanding kader yang bersih, tapi dampaknya, tingkat elektabilitas partai terus menukik tajam. Hemat kita, pidato politik dan arahan SBY di hadapan pengurus DPD PD seluruh Indonesia maupun pertemuannya dengan jajaran Dewan Pengurus Forum Komunikasi Pendiri dan Deklarator sangat penting bagi masa depan PD. Tapi, itu hanya mungkin bisa menyelamatkan citra PD jika disahuti oleh kadernya yang disebut-sebut korupsi untuk mundur, baik kader yang sudah divonis pengadilan maupun kader yang masih dalam proses hukum, termasuk sejumlah kader yang namanya sudah sering disebut-sebut media, meskipun belum diperiksa KPK namun snaksi sosialnya dari masyarakat sudah menimpa PD. Kalau pada kongres 2010 para pendiri manaruh harapan besar pada Anas untuk memperbesar partai ini, karena Anas dinilai memiliki kemampuan, kritis, bersih, mantan ketua umum PB HMI, nyatanya partai ini justru makin terpuruk baru setahun lebih dipimpin Anas. Jangankan meningkatkan elektabilitas partai menjadi 30 persen, nyatanya kini terperosok di ambang batas10 persen. Kondisi internal dan citra PD memang dalam kondisi ‘’babak-belur’’ akibat keterlibatan sejumlah kadernya dalam berbagai kasus korupsi, termasuk sejumlah nama pejabat tinggi partai, seperti Anas Urbaningrum, Andi Mallarangeng, Angelina Sondakh, M. Nazaruddin dll. Nama mereka acapkali disebut-sebut dalam pemberitaan media terkait kasus megakorupsi proyek Wisma Atlet Palembang dan Sport Centre Hambalang sebagaimana tuduhan Nazaruddin, mantan bendahara umum DPP PD. Dengan semakin terpuruknya citra PD dalam setahun belakangan ini maka langkah melakukan ‘’bersih-bersih’’ internal partai sangat penting, sehingga statement SBY harus disikapi dengan tindakan tegas melakukan perombakan pengurus, baik di pusat maupun di daerahdaerah, jika terindikasi pengurusnya terlibat korupsi. Intisari Upaya ‘’bersih-bersih’’ internal PD oleh SBY jelas tidak mudah dilakukan. Ibarat membersihkan dengan sapu kotor, Sasaran bersih-bersih Par- sehingga rasanyalantai mustahil ‘’bersih-bersih’’ tai Demokrat tampaknya dilakukan oleh pengurus yang terlibat kasus ber-ujung melengserkan korupsi terhadap para kadernya. Justru itu, pengurus dulu harus bersih, baru bisa medan menyingkirkan Anas cs nindak kadernya yang terlibat korupsi. Tanda-tanda kegagalan melakukan ‘’bersih-bersih’’ terlihat jelas dari minimnya suara kritis dari pengurus teras PD. Nyaris tidak ada yang berani bicara vokal, kecuali Ruhut Sitompul. Baru kader partai berlambang mercy ini berani menunjukkan sikap tegas sebagaimana biasanya orang Medan etnis Batak. Tanpa tedeng aling-aling Ruhut mendesak Anas mundur atau non-aktif untuk menyelamatkan masa depan partainya. Kalau tidak maka tingkat popularitas dan elektabilitas partai akan semakin merosot/ menurun. Jadi, langkah tegas sebagaimana diinginkan Ruhut perlu dilakukan oleh SBY. Tidak perlu tunjuk hidung secara langsung, apalagi di forum rapat besar. SBY cukup memanggil sejumlah nama yang menyebabkan pamor PD merosot tajam, dari parpol pemenang pemilu kini berada di urutan ketiga, sesuai survei SSS pekan lalu. Hasil survei Soegeng Sarjadi Syndicate menyatakan jika pemilu diadakan saat ini, Partai Golkar memenangi, mengungguli partai penguasa, Demokrat. Dalam survei dengan 2.192 responden Golkar meraih 23 persen, PDI Perjuangan mendapat dukungan 19,6 persen, dan Demokrat 10,7 persen. Tak pelak lagi, internal PD dari pusat hingga daerah kini terpecah menjadi beberapa faksi, dari faksi Anas, faksi Andi, faksi Marzuki, muncul lagi faksi-faksi lainnya, termasuk dari tokoh pendiri-deklarator partai yang menginginkan SBY segera melakukan bersih-bersih. Tapi, sangat tidak mudah melengserkan atau menonaktifkan Anas selaku ketua umum terpilih dalam kongres yang bertabur uang miliaran rupiah. Forum konstitusional ya harus lewat kongres, sehingga rasanya mustahil Anas bisa dilengserkan dengan kata-kata atau imbauan semata. Bagaimanapun juga faksi Anas dalam PD masih dominan. Andai pun Kongres Luar Biasa (KLB) diselenggarakan posisi Anas masih tetap solid dibandingkan faksi-faksi lainnya. Bahkan, jika Anas dipaksa lengser dengan cara-cara inkonstitusional dampaknya bisa mengerikan bagi masa depan PD itu sendiri. Sebab, Anas banyak menyimpan rahasia dan andil dalam memenangkan PD dalam pemilu dan Pilpres lalu. Apalagi kalau sampai Anas mundur dan mendirikan partai baru, PD bisa semakin kolaps dan tenggelam. Seperti diketahui PD menggelar pertemuan akbar melibatkan seluruh elemen PD di Hotel Sahid, Jl Sudirman, Jakarta, Rabu (13/6), tanpa dihadiri Anas. Agendanya ‘’bersih-bersih’’ sehingga dengan mudah ditebak sasarannya adalah Anas cs.+


Faks 061 4510025

Facebook Smswaspada

+6285762397065 Salam waspada.. Saya langganan waspada,, beritanya bagus2.. Tapi tolong perbanyak berita rakyat kecil.. Agar saling tau kalau perkembangan ekomi ini berawal dari rakyat kecil.. Trimakasih.. Waspada tetap jaya..

Ketika Uang Jadi Alat Seleksi Mahasiswa Oleh Endah Sefria Sesak dada jika kita menilik dunia kampus lebih dalam. Kampus adalah harapan perubahan negeri, tapi jika dijadikan komoditi mencari gelar untuk mendapatkan pekerjaan, sungguh tak akan ada kebangkitan untuk negeri ini.


endidikan mahal! Semua serba uang! Mau pintar pun butuh uang! Lantas, gimana si miskin yang gak punya uang? Orang miskin dilarang pintar. Itu kata bijaknya. Miris!Sangatmirisketikamelihatkekayaan alamyangmelimpahruah,namunpenduduknya dilanda kemiskinan. Kemiskinan terstruktur. Kemiskinan yang disengaja. Kemiskinantersistematis.ItulahIndonesia. Negeri yang katanya aman sentosa, tapi faktanya negeri yang punya beribu masalah. Memang pantas dikatakan orang miskin dilarang pintar. Karena kalau mereka pintar, akan menuntut haknya sebagai warga negara dimana negerinya punya kekayaan yang begitu wahh! Masuk ke perguruan tinggi merupakan dambaan bagi setiap individu yang hendak mengejar cita-citanya tinggi. Karenagambaranperguruantinggiadalah tempat berkumpulnya para intelektual yang akan membawa pengaruh di tengah masyarakat. Namun untuk masuk ke perguruan tinggi dibutuhkan perjuangan besar.mulaidariIQ,hinggauang.Tapipada faktanya, perjuangan yang paling besar adalah uang. Memang benar, “kan ada beasiswa membiayai mahasiswa kurang mampu”. Tapi, beasiswa yang diberikan pun hanya segelintir orang yang “beruntung” bisa menikmatinya. Bahkan banyak daripihakfakultasyangsalahmenyalurkan beasiswa. Contohnya saja di kampus penulis, banyak yang menerima beasiswa adalahorang-orangyangmampu.Bahkan yang miskin gak dapat karena mereka gak bisa mengambil surat keterangan kurang mampu dari kampungnya yang merupakan salah satu syarat dalam pendaftaran beasiswa. Karena untuk mengambil surat keterangan kurang mampu pun harus bayar juga. Administrasi yang serba uang! Konon lagi ini musim ujian masuk perguruan tinggi. Tapi bayangkan kalau

+6281265893812 Njuah njuah sumut.kepada seluruh kader partai demokrat DPD, DPW, DPC tolonglah berlaku jujur di dalam segala hal +6282161031860 Mencari org yg jujur di jaman sekarang sulit di jumpai .ada di kampung beta di sana seberang sana .klw di sumut org nya jujur semua .sebelum jadi dia di dukung satu partai yg top eh dah jadi dia mau pula diangkat partai lain .pada hal org dh muak partai itu .kecual seperti Nabi Muhammad di bedah dada di bersih dgn air zamzam baru paten dari lb katorong di pondo nyo nan langang tembung +6282161031860 Sekedar bertanya.tiga hri yg lalu penulis ada membaca di komentar anda ka kaw salah lihat ada tertera nama hj drs samsul arifn. Klw boleh tau apa kh samsul yg asli atw yg imitasi nya. Maksud penulis mantan gubsu .klw ya apa gx nyalon lagi pak.nyalon lagi lah pak ! Ambo dukung apak jadi gubsu.udah ibarat janda ditangan org makin cantik nampaknya dari lb katorong di pondok nyo langang tmbg +6285278662461 yg dibutuhkan umat islam sekarang ini, USTAD yg BERILMU TINGGI dan DO’A nya MAK’MUL.cth( bisa menawar bisa beracun,pawang hujan,tak takut sama preman,) YG +6282163458511 Sudah 3 hari pengguna modem dengan kartu SimPATI di Padang Lawas tidak bisa memakai internet, signal GPRS ada tapi saaaangaaat keciiiillll. kecewa sekali deh.... padahal kita sudah beli paket TelkomselFLASH seharga Rp.100.000 untuk 30 hari, mohon WASPADA terbitkan ya. Mks

ini kian hari kian rusak. Mulai dari sistem pendidikan, sistem ekonomi, perpolitikan, budaya, dan lain-lain diatur dalam paham pemisahan agama dari kehidupan.Tidak adaruanguntukTuhandalammembicarakan ekonomi, politik, ataupun pendidikan. Manusia yang gak mampu menghitung bulu matanya sendiri, memompa jantungnya sendiri, dengan berbagai kelemahannya disuruh membuat aturannya sendiribahkanaturanuntukmanusiaseluruhnya.Wajar, terjadi kerusakan dimanamana. Harusnya kita sebagai manusia yang lemah dan sangat terbatas ini, gak pantas membuataturanlewattangan-tangankita. Allah sebagai Pencipta kita dan sekaligus Sang Pengatur yang berhak memberikan aturan untuk kehidupan kita. Karena Dialah yang Mahatahu atas segala sesuatunya. Sebagai contoh pendidikan yang berdasarkandariaturanIslam,negarawajibmenyediakan perpustakaan, laboratorim dan sarana ilmu pengetahuan lainnya, di samping gedung-gedung sekolah, universitas untuk memberi kesempatan bagi mereka yang inginmelanjutkanpenelitiandalamberbagai cabang pengetahuan, seperti fiqih, hadits dan tafsir, termasuk di bidang ilmu murni, kedokteran, teknik, kimia, penemuan-penemuan baru (discovery and inventory) sehingga lahir di tengah umat sekelompok besar mujtahidin dan para penemu. Investasi dan pengelolaan modal asing di seluruh negara tidak dibolehkan. (Taqiyuddin an-Nabhani dalam Peraturan Hidup dalam Islam). Nah, seperti itulah pendidikan yang diatur dalam Islam. Pendidikan Islam tidak akan terwujud dalam sistem kapitalisme yang ada sekarang ini. Pendidikan Islam ini hanya akan terwujuddalamDaulahKhilafahIslamiyah yang memang akan memberikan jaminan kepada warganya untuk dapat mengecap pendidikan. Karena pendidikan merupakan hak rakyat dan kewajiban pemerintah. Khilafah kini sudah menjadi kebutuhan yang mendesak. Hidup sejahtera di bawah naungankhilafahbukanlahmimpi,namun sesuatu yang pasti, karena aturan yang diterapkanlangsungdariPenciptamanusia itu sendiri yang akan membawa kebaikan, rahmat bagi seluruh alam. Wallahu ‘alam bi ash-shawab. Penulis adalah Aktivis Muslimah HTI.

Revitalisasi Peranan Guru

+6281370980427 Buat lb katorong di pondoknyo tombung H Syamsul Arifin menjawab bahawa Syamsul yang ini juga asli karane sojak muncul kadunia nih mmg itulah namonyo dikan timur,dah terjawab agakku +6282168040028 kepada BMKG. Terjadinya angin kencang dan angin beliung, benar berdasarkan suhu panas. Angin/udara berasal uapan air laut dan salju. Angin kencang, terjadi dilaut sampai kegunung. Tapi bliung terjadi jaraknya jauh dari lautan [kira-kira 15 KM Jaraknya dari laut]. Tidak selalu benar, bliung dapat dilihat dari gumpalan awan. Kerena awan tidak menempati posisi seluruhnya celah diatas. Angin berputar dari bawah, hingga atas, memasuki ujud awan itu. itu jika adan awan yang tebal diatas. Tapi jika tidak ada awan diatas[awan terjadi dari pembakaran dibumi]. Jadi angin/udara yang berputar dari bawah, hingga keatas tidak bisa jelas dilihat dengan mata. Angin kencang. Angin, sebahagian besar kedarat. sedikit lari ketengah laut. Bliung terjadi, seluruh penjuru angin datang ketempat itu. angin kencang tidak. Angin kencang digunung, akumulatip angin dalam perjalanan. Angin kencang terjadi tidak jauh dari laut. Berasal dari laut. menentukan angin kencang dan an

uang dijadikan standar penyeleksian. Mau jadi apa negeri ini? Komersialisasi pendidikankinisemakinmencuat.Bahkan para investor sekarang lebih senang menginvestasikan dananya dalam bidang pendidikan daripada saham karena prospeknya ke depan lebih jelas. Jadi wajar jika pendidikan mahal, karena investor gak akan mau rugi, mereka juga mau meraup keuntungan dari investasinya. Peran dan tanggungjawabpemerintahmenyediakan layanan pendidikan untuk rakyatnya makin hari nyaris musnah! Bagaimana jika uang yang menjadi alat penyeleksian mahasiswabaru?Nah,inibisakitabayangkan apa yang akan terjadi dengan masa depan negeri ini. Jika dari awal masuk standar sudah uang, maka untuk keluar pasti yang terpikir juga uang. Ditambah dukungan dari kurikulum pragmatis di kampus yang hanya mementingkan output daripada proses, yang penting IPK tinggi,gakpedulibagaimanacaranya.Mau mencontekkah,bahkannyogokpengawas atau dosen yang bersangkutan sekalipun. Lantas, ilmu seperti apa yang akan mereka dapatkan jika proses belajar dan mengajar seperti ini? Sesak dada jika kita menilik dunia kampus lebih dalam.Tidak seindah yang dibayangkan. Kampus adalah harapan perubahan negeri.Tapi jika kampus hanya dijadikan komoditi mencari gelar untuk bisa mendapatkan pekerjaan yang lebih baik, sungguh tak akan ada kebangkitan untuk negeri ini. Karena dari sistem pendidikan yang ada mengajarkan kita untuk menjadi orang-orang individualis yang hanya memikirkan dirinya sendiri. Kalau ditanya kepada mahasiswa kebanyakan “sudah tamat kuliah nanti mau ngapain?” Pasti yang terjawab adalah“kerja”. Sangat jarangsekaliuntukmemikirkannegerinya. Yang penting dirinya, keluarganya, sudah cukup. Gak peduli gimana orang lain di

luar sana. Inilah yang disebut individualis yang sangat membahayakan. Mau kekayaan alamnya dikuasai asing, mau rakyat miskin gak punya uang untuk makan, bukan urusannya. Bahkan bangga menjadi pekerja – budak – di perusahaan asing yang merampas kekayaan alamnya. Begitulah kira-kira bentuk pemikiran yang terset di kalangan intektual. Kita juga bisa membayangkan lulusan dari kampus yang hanya mengandalkan uang mulai dari penyeleksian, proses belajar mengajar, dan proses kelulusan dimana kuncinya adalah uang. Pasti yang terpikir mereka adalah bagaimanamerekabisamengembalikanmodalnya dalam pekerjaannya nanti. Jika dia bekerja sebagai pejabat pemerintahan, wajar jika dia korupsi mengembalikan modalnya. Jika dia bekerja sebagai dokter, maka biaya kesehatan yang cukup tinggi yang dia pasang. Jika dia sebagai pengacara, maka pikirannya bagaimana memenangkan kasus (terlepas kasusnya salah atau benar) yang dengan itu ia akan mendapatkan uang. Apalagi jika dia jadi presiden, bisa jadi dia menjual pulau-pulau kecil dan menjual kekayaan alam negeri ini. Bukan hanya gambaran, tapi itulah faktanya. Sebenarnya juga bukan salah kampus sepenuhnya. Tapi ini salah sistem yang diterapkandinegeriini.Sistemkapitalisme, paham liberalisme dan sekulerisme yang menjajah negara kita. Sistem kapitalisme yang hanya berpihak kepada para pemilik modal membuat rakyat yang kaya makin kaya dan yang miskin makin miskin, yang punya uang yang berkuasa, yang punya uang yang mampu mengecap pendidikan di perguruan tinggi. Adil? Ini adalah perbuatan dzalim! Pendidikan merupakan kebutuhan yang harus dipenuhi pemerintah terhadap rakyatnya. Pemerintah tidak boleh lepas tangan begitu saja. Pada faktanya pemerintah sudah mulai menyerahkan masalah pendidikan kepada pasar. Berarti sudah jelas negara ini memang menganut sistem kapitalismedimanakepercayaanyangkuat terhadap pasar bebas.Terlihat dari kebijakan yang ada di kampus maka memang benardantidakbisaditutupibahwanegara ini menganut sistem kapitalisme. Bangsa ini harus segera bertobat! Sekulerisme yang dijadikan asas dalam pengambilan keputusan membuat negeri

Oleh Ahmad Taufik, MPdI Harapan besar diamanahkan kepada para guru,pengawas dan kepala sekolah berpresatasi dari berbagai tingkatan.


eranan guru yang paling mendasar adalah sebagai pendidik yang menjelaskan dan mentransfer nilai sebagai dasar kehidupan manusia melalui penguatan dalam materi pelajaran. Dengandemikianhasildariprosespendidikan tidakhanyamembentukpesertadidikyang pintar, tapi juga sekaligus berkarakter. Kini dunia pendidikan mendapat perhatian dari berbagai kalangan, ditandai meningkatnya anggaran pendidikan dalam APBN menjadi 20 %. Meningkatnya anggaran tersebut memunculkan gugatan sejauhmana peningkatan anggaran dengan kwalitas peserta didik? Gugatan ini dimunculkan, karena gejala yang terlihat melalui media massa: tejadi tawuran antar pelajar, antar mahasiswa, dan kelompok geng motor. Contoh kasus meningkatnya pergaulan seks bebas ditandai banyaknya wanita yang hamil di luar nikah. Suatu survei menempatkan kota yang paling banyak siswi hamil sebelum nikah adalah Surabaya sebanyak 52% dari 10 siswi, urutan kedua Medan 53 % dan seterusnya. Gejala-gejala tersebut menjadi perhatianpemerintahmelaluiKementrian Pendidikan Nasional (Kemdiknas), ditandaipencananganpendidikankarakter olehPresidentanggal2Januari2012,disusul penguatan nilai karakter dalam pendidikan: penguatan karakter dalam kurikulum, penguatan karakter di lingkungan sekolah dan penguatan karakter di rumah. Hal ini menunjukkan pemerintah serius danprihatinmelihatmenurunnyakarakter peserta didik.

Siapakah yang bertangungjawab membentuk karakter peserta didik? Kita semua tentunya berkewajiban untuk itu (orang tua, guru, siswa, dan masyarakat). Dalam sebuah penelitian menggambarkan bahwa guru memiliki pengaruh terhadap keberhasilan peserta didik dalam belajar sebanyak 30%. Ini artinya peranan guru sangat strategis membantu keberhasilan dalam pendidikan. Revitalisasi Peranan Guru Apresiasi dan penghargaan terhadap guru, pengawas dan kepala sekolah dapat berdampak terhadap kompetisi pelaku pendidikan tersebut untuk mengoptimalkanperanannyasebagaiguru—baikdalam bidangkompetensipaedagogik,akademik, sosial dan kemasyarakatan. Dengan demikian pelaku pendidikan berlombalomba melakukan inovasi dan kreativitas dalam bidang pendidikan sehingga kualitas pendidikan diharapkan meningkat, khususnyadikalanganguru.Adabeberapa hal yang perlu menjadi refleksi penyelenggaraan lomba guru berprestasi: Pertama, belum maksimalnya penyelenggaraan di tingkat sekolah, ini disebabkan kendala biaya. Sebenarnya kepala sekolah dapat melakukan kreativitas menyelenggarakanlombaguruberprestasi pada waktu tertentu, misalnya penyelenggaraannya dalam rangka 17 Agustus dan para pemenang diproyeksi mengikuti tingkat kecamatan. Untuk mengajak guru agar respons terhadap pelaksanaan tersebut sekolah memberi apresiasi dalam

bentuk hadiah dan menjadi indikator untuk menduduki posisi-posisi jabatan di sekolah. Kedua, pemerintah daerah mensosialisasikan pelaksanaan hingga ke tingkat sekolah minimal 2 bulan sebelum pelaksanaan sehingga guru dapat mempersiapakan diri, khususnya penulisan karya tulis ilmiah, membuat kreasi pembelajaran dan inovasi pembelajaran. Ketiga, tempat pelaksanaan di tempat yangrepresentatif,tidakperlumewah,yang penting bagaimana pelaksanaan berjalan nyaman dan lancar untuk mengurangi tingginyabiayatempatpelaksanaan. Dana untuk tempat yang mewah dapat dialokasikanuntukhadiahyangrepresentatif dapat meningkatkan kewibawaan guru sehingga “memancing” guru-guru lain mempersiapkan diri bersaing memperoleh juara. Penutup Harapan besar diamanahkan kepada para guru, pengawas dan kepala sekolah berpresatasi dari berbagai tingkatan. Pasca pemilihan guru berprestai diharapkan dapat menjadi nilai tambah dan motivasi bagi guru untuk terus meningkatkan kwalitas diri. Harapan selanjutnya pemerintah dapat mengoptimalkan sosialisasi pelaksanaan jauh-jauh hari dan memberi rangsangan hadiah yang representatif sehingga memicu guru dalam jumlah yang banyak untuk mengikuti kegiatan guru berprestasi. Semoga para peserta guru, pengawas dan kepala sekolah berprestasi tahun ini yang jumlahnya berkisar 33 peserta setiap tingkatan dapat menjadi warna bagi dunia pendidikan di Sumatera Utara. Selamat berlomba dan selamat meraih kemenangan.

Hidup guru, hiduplah bangsaku! Penulis adalah Guru SMA Negeri 1 Bangun Purba.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Plt Gubsu: Sekda penentu reformasi birokrasi - Makanya harus sering merapat, he...he...he * Penertiban PKL dengan solusi manusiawi - Biar sama-sama senang! * F-PG minta dikaji DPRD pilih KDH - Bila perlu diseminarkan


D Wak


WASPADA Senin 18 Juni 2012

Surat Terbuka Kepada “Penguasa” Padangsidimpuan Para penguasa Kota Padangsidimpuan, atau siapapun yang bertanggungjawab dalam hal ini, melalui surat terbuka ini saya memohon kepada Tuan-Tuan sekalian,agar kiranya membuka mata, hati dan nurani serta mengambil hikmah dari peristiwa pembakaran kantor KPU Kota Padangsidimpuan pada hari Rabu, 13 Juni 2012. Saya pribadi turut prihatin atas peristiwa tersebut. Sebagai warga jalan Mawar/Jalan Raja Enda Mora No. 12, di mana letak tempat tinggal saya dan keluarga persis berada di sebelah kanan gedung kantor KPU Kota Padangsidimpuan. Terus terang kami sangat merasa terganggu dengan keberadaan kantor tersebut, karena kami tahu persis akan resiko yang selalu mengancam keselamatan, keamanan dan kenyamanan keluarga kami. Saya yakin, kiranya Tuan-tuan lebih tahu bagaimana dinamika Pilkada serta konsekuensikonsekuensinya. Kronologi Pemindahan Kantor KPU Pemindahan kantor KPU ke Jalan Mawar berlangsung pada hari Sabtu tanggal 28 Januari 2012. Waktu itu, sekitar pukul 11 pagi kami menyaksikan langsung proses pemindahan barang-barang KPU dari jalan Kenanga ke Jalan Mawar,yang hanya berjarak sekitar 300 meter.Tidak lama berselang, Ibu Hannum,saudara kandung pemilik rumah (pemilik rumah adalah Bapak Royhan yang berdomisili di Jeddah, Saudi Arabia dan saat itu kebetulan sedang berada di Jakarta) yang selama ini menangani urusan sewa menyewa rumah tersebut, datang menemui keluarga kami untuk memberitahukan kepada kami bahwa rumah keluarga mereka akan di tempati oleh KPU. Terus terang, sebagai calon tetangga KPU kami merasa keberatan dan shock. Orang tua kami sudah menyampaikan permohonan kepada pihak KPU dan juga pemilik rumah (via telepon) untuk membatalkan kontrak rumah tersebut.Adapun alasan yang kami sampaikan pada waktu itu adalah karena kami khawatir terjadi hal-hal yang tidak diinginkan terkait pelaksanaan Pilkada Kota Padangsidimpuan 2012, mengingat di beberapa daerah lainnya sering terjadi aksi anarkisme terkait persoalan politik, termasuk Pilkada. Toh, selama ini sebagai tetangga kami tidak pernah merasa keberatan dengan keberadaan penyewa rumah tersebut, baik itu partai politik maupun organisasi pengusaha.Namun untuk KPU,terlalu beresiko.Bahkan,kami sudah menyampaikan kepada pemilik rumah dan agennya, bahwa “Pemindahan kantor KPU ini pantas dipertanyakan, karena baru saja 2 minggu mereka pindah kantor ke jalan kenanga, tepatnya pada tanggal 14 januari 2012,mengapa sekarang pindah lagi? Pertanyaan besarnya adalah mengapa kantor KPU yang selama ini berlokasi tepat di sebelah Gedung KantorWali Kota Padangsidimpuan, dan persis berseberangan jalan dengan rumah dinas Wali Kota Padangsidimpuan harus dipindahkan? Bukankah lokasi tersebut sangat strategis? Mengapa harus ke tengah-tengah pemukiman warga? Mengapa harus menjelang Pilkada ini tiba-tiba dipindahkan?” Begitu banyak pertanyaan yang muncul di benak kami atas keberadaan kantor KPU ini. Saat kami berdialog pada tanggal 28 Januari 2012 waktu itu, ketua KPU dan Sekretarisnya, serta wakil pemilik rumah sudah sepakat bahwa KPU hanya diberi kesempatan untuk berkantor di rumah tersebut selama 1 bulan.Karena pemilik rumah sudah terlanjur menerima uang muka da-ri kontrak rumah tersebut dan tidak sanggup mengembalikannya, sembari memberikan kesempatan kepada pihak KPU mencari lokasi lain yang lebih pantas.Untuk pengembalian uang muka kontrak rumah tersebut, kami sudah menyampaikan kepada pemilik rumah bahwa kami bersedia membantu secara finansial, sebagai wujud rasa tanggung jawab kami dan bukti kesungguhan hati kami bahwa ka-mi benar-benar sangat mengkhawatirkan keselamatan, keamanan, dan kenyamanan keluarga kami. Namun hanya beberapa minggu berselang, kami menyaksikan pemasangan plank merek KPU dan atribut lainnya di halaman rumah tersebut. Kami menduga bahwa kontrak rumah tidak jadi dibatalkan. Kami sangat paham, bahwa pihak KPU telah mengalami kerugian materil, namun pernahkah Tuan-Tuan memikirkan kerugian keluarga kami? Ketenangan keluarga kami telah terusik oleh keberadaan kantor KPU. • Setiap hari kami harus mendengar suara hingar bingar dari ruang kantor yang jaraknya kurang dari satu meter dari tempat istirahat kami karena begitu banyak orang berada di dalam kantor tersebut. • Setiap hari kami harus menyaksikan parkiran kenderaan yang amburadul di depan halaman rumah kami. • Setiap hari anak-anak kami yang masih kanak-kanak bermain di halaman rumah kami sendiri dengan rasa tidak nyaman karena harus bertemu dengan orang-orang “asing”. • Dan setiap hari kami harus dihantui oleh rasa takut dan cemas jika sewaktu-waktu terjadi kekacauan dan hal- hal yang tidak diinginkan. Aksi pembakaran ini, mungkin hanya salah satu bukti kekhawatiran kami selama ini. Sebab Hari “H” Pillkada masih beberapa bulan lagi, masih panjang proses menuju ke sana dan pasca hari “H”. Dan sepanjang masa itu pulalah kami dihantui oleh rasa takut. Tuan-tuan yang berkuasa di Kota Padangsidimpuan,kami adalah warga Padangsidimpuan,rakyat Tuan,yang patut Tuan lindungi dan ayomi, dan juga berhak memperoleh rasa aman dan nyaman. Oleh karena itu kami bermohon dan mengetuk nurani Tuan-tuan sekalian agar kiranya segera memindahkan kantor KPU ke lokasi yang lebih pantas, ke lokasi yang tidak mendzolimi dan melukai hati rakyat Tuan-Tuan sekalian, dan tidak mengganggu ketenangan dan keamanan rakyat Tuan. Atas kemurahan hati Tuan-Tuan saya sampaikan terimakasih. Juni Wati Sri Rizki Warga Jl. Mawar/ Jl. Enda Mora No 12 Padangsidimpuan.


Dedi Sahputra

Pilihan Menjadi pemimpin itu sebenarnya suatu kewajaran yang mutlak. Karena setiap orangorang yang berkumpul, secara alamiah akan menimbulkan keinginan mencapai tujuan yang sama—setidaknya tujuan sebagian besar dari orang-orang itu. Maka pemimpin diperlukan untuk meramu tujuan dalam suatu konsep, menyiapkan arah yang dituju, dan membawa semua rombongan ikut serta. Jadi sebetulnya, dalam tataran filosofis, menjadi pemimpin itu sederhana saja. Tapi dia menjadi rumit pada tataran empiris. Ketika menggambarkan tentang pemimpin, Lao- Tze pada 600 sebelum masehi menulis: ”Air itu berbentuk cairan, lunak, dan mudah mengalir. Tetapi air akan mengikis habis batu karang, yang berdiri kokoh, dan tidak mudah bergeser. Sebagai kaidah, apapun yang cair, lunak, dan mudah mengalir akan menguasai apa saja yang kokoh dan keras. Ini sebuah paradoks yang lain: apapun yang lunak itu kuat...” Jadi, ketika Anda memimpin, lembut-lah, maka Anda akan kuat dengan sendirinya. Ya, semudah itu... Sekali lagi, dalam tataran filosofis memang begitu. Dia adalah suatu proses sublimasi dari nilai-nilai, juga imajinasi yang dielaborasi oleh pikiran-pikiran dan perasaan—pada saatnya membentuk kepribadian. Ini seperti mengumpulkan semua seleramu dan meramunya dalam wujud model rumahmu, seperti meracik resepmu sendiri menjadi sajian kuliner lezat, atau ketika engkau membayangkan dan merasai banyak hal sebelum engkau mulai menulis. Untuk menjadi pemimpin, nilai ini yang menjadi syarat pertamamu. Tanpanya, engkau sebetulnya sudah kalah sebelum “bertarung”. *** Rasa malu itu seringkali lebih menakutkan ketimbang rasa sakit. Untuk ini Anda bisa tanyakannya kepada Agyness Deyn, seorang top model Inggris. Ketika acara peragaan amal Cannes, semua mata menatap lenggak-lenggoknya di catwalk. Baju terusan putih, ikat pinggang melilit dan sepatu hak tinggi membuat penampilannya kelihatan rupawan. Senyumnya yang mekar menambah kesan charming. Itu sebelum ia terpeleset, sebelah kakinya tertekuk ditimpali beban tubuh yang membuatnya terjatuh di tengah keramaian itu. Saya membayangkan jenis kesakitan yang menderanya. Dia tidak langsung bangkit tapi merangkak dulu sembari meredakan sakitnya— sebelum berdiri dengan wajah memerah dan senyum yang berubah kecut. Sakit itu tentu saja mengganggunya, tetapi rasa malu lebih

mengganggunya berkali-kali. Katimbang terasa sebagai musibah, jatuh itu lebih terasa sebagai aib. Ada masalah profesionalitas, kepercayaan orang, dan masalah psikologis berupa rasa percaya diri di sini. Maka jatuh itu lebih kepada peristiwa aib ketimbang musibah. Dan karena rasa malu adalah pakaian manusia tertinggi, maka aib seperti ini bisa jadi musibah terbesar manusia. *** Lantas mengapa menjadi pemimpin itu jadi rumit pada tataran empiris? Ini antara lain karena keragaman pilihan, dan strata prioritas yang sangat variatif. Karena ketika engkau jadi pemimpin, sekuat apapun dirimu, dia akan datang menguji kepiawaianmu. Engkau akan selalu dikelilingi orang-orang dengan ragam kepentingan, ragam perilaku. Engkau akan disibukkan dengan ragam undangan dan ragam keinginan-keinginan. Di antara mereka ada kualitas loyang ada pula yang emas, ada kualitas pucuk-pucuk madu ada pula jerami, ada yang tulus ada pula yang dipenuhi syahwat. Kualitas kepemimpinanmu ditentukan oleh seberapa piawai engkau memilih mereka, seberapa tepat dirimu mendekati prioritasmu, ditambah seberapa kuat engkau menanggung risiko-risiko keputusanmu. Satu hal lagi, konsistensimu dan daya tahanmu mempertahankan sikap fair-mu. Ini juga penting. Seperti ketika engkau luput berjanji kepada temanmu, saat engkau masih seorang tukang sayur, misalnya. Besok-besok saat pertemuan tak disengaja engkau bisa dengan ringan mengatakan begini: sory ya coy... dan masalah selesai dengan sendirinya. Ini karena resistensimu terbatas dan kecil saja. Tapi berbeda ketika engkau jadi pemimpin, maka engkau punya resistensi yang luas bahkan tidak terbatas. Maka konsekuensi atas sikapmu akan jauh lebih berdampak. Jadi ini memang cukup kompleks. Sebagai pemimpin engkau tidak saja harus lulus pada tataran filosofis, tapi juga harus menyelami tataran empiris sampai palung terdalam— engkau harus memahami keragaman itu lengkap dengan segala konsekuensinya. Engkau harus mempertimbangkan segala risiko keputusanmu, engkau harus piawai memilih, dan engkau harus terus menjaga sikap fair-mu. Tanpa itu semua, engkau cuma akan memproduksi rasa malu bagi orang lain. Tanpa itu engkau bisa saja salah pilih loyang di antara emas-emas. Salah-salah, loyang pun tidak, engkau cuma bisa dapat tinja.(Vol.322,18/6/2012)

Kolom foliopini dapat juga diakses melalui


Surat Dari Tanah Suci Oleh M Ridwan Lubis Sekeras apapun hati manusia bila mengingat kematian maka semua motif tidak baik seperti sombong, dengki, khianat termasuk korupsi, penyalahgunaan kekuasaan akan hilang dengan sendirinya.


inat umat Islam untuk melakukan ibadah umrah yang sering disebut dengan haji kecil tampaknya semakin meningkat dari waktu ke waktu. Ketika penulis berada di Tanah Suci beberapa hari lalu dalam rangka ibadah umrah, sempat mengamati fenomena tersebut. Bulan Rajab, Sya’ban dan Ramadhan adalah bulanbulan sibuk umat Islam berkunjung ke Tanah Suci. Kesemarakan ibadah umrah dimulai dari kebijakan pemerintah melakukan program konversi yaitu mendorong umat Islam beralih ke pelaksanaan ibadah umrah—sebagai akibat dari tidak seimbangnya permintaan menunaikan ibadah haji dengan jatah yang tersedia. Pada beberapa daerah, jumlah daftar tunggu pendaftar haji telah semakin panjang beberapa tahun ke depan. Di satu sisi hal itu menggembirakan karena dapat menjadi salah satu indikator tingginya minat umat Islam untuk menunaikan rukun Islam yang kelima. Tetapi di sisi lain, hal itu cukup memprihatinkan mengingat minat yang demikian besar dari umat Islam dalam rangka menunaikan ajaran agamanya akan tetapi tidak terpenuhi akibat dari hambatan daya tampung di Arab Saudi. Betapapun pemerintah Arab Saudi selaku pelayan dua Tanah Suci (khadim al haramain) telah melakukan berbagai upaya untuk memberikan pelayanan untuk kenyamanan jamaah— seperti yang ditunjukkan dengan pemandangan di sekitar Masjidilharam sekarang ini dilakukan berbagai pembongkaran hotel-hotel tempat penampungan jamaah—nyatanya minat yang demikian besar itu belum terpenuhi semuanya. Oleh karena itu, dapat dipahami manakala pemerintah mengambil jalur lain yaitu mendorong umat Islam untuk beralih dari minat berhaji kepada umrah bagi yang belum memperoleh porsi untuk berangkat haji. Dalam pelaksanaan ibadah umrah tampaknya pemerintah menyerahkan sepenuhnya kepada perusahaan perjalanan yang tumbuh demikian subur ibarat cendawan di musim hujan. Perusahaan biro perjalanan itu tidak hanya berkembang di Jakarta akan tetapi juga merambah ke kota-kota kecil. Sehingga, sesuai dengan teori klasik ekonomi yaitu kaitan antara permintaan dengan penawaran. Semakin tinggi permintaan dari masyarakat maka semakin tinggi pula penawaran yang dilakukan oleh perusahaan perjalanan. Sehingga harga untuk memperoleh tiket keberangkatan umrah tergantung dari kemampuan jamaah. Bagi yang berkemampuan terbatas maka tentulah harus rela dengan tarif yang lebih rendah dengan tingkat pelayanan yang terbatas pula. Sebaliknya bagi kalangan yang memiliki kemampuan berkelebihan maka tentulah tersedia pula perusahaan lain yang menawarkan harga yang lebih tinggi dengan tingkat pelayanan yang

lebih tinggi pula. Tegasnya, minat yang semakin besar umat Islam dalam melaksanakan ibadah umrah menjadi lahan baru yang bersifat ekonomi. Proses transformasi sosial yang melahirkan moderisasi juga ikut berimbas kepada persoalan kehidupan beragama. Ibadah umrah pada masa lalu, sebagaimana halnya juga ibadah haji, dalam pandangan pragmatisme adalah identik dengan tindakan inefisiensi atau pemborosan. Biaya puluhan juta yang dikeluarkan untuk keperluan keberangkatan umrah dipandang sebagai hal yang tidak produktif. Selain dari itu, pada masa lalu peminat untuk berumrah adalah kalangan masyarakat desa atau yang berlatar belakang pondok pesantren. Ditambah lagi, umumnya mereka yang sudah berusia senja. Tetapi sekarang ini, peminat melaksanakan ibadah umrah telah mengalami diversifikasi yaitu mulai dari kalangan masyarakat perdesaan sampai menengah perkotaan, mulai dari yang tua sampai yang muda bahkan anak-anak. Memasuki masa liburan sekolah seperti sekarang ini jamaah umrah dari Indonesia bervariasi yaitu bercampur antara orangtua dengan anak-anak. Sementara pada masa sebelumnya, pilihan untuk berlibur bagi anak-anak perkotaan menghabiskan masa liburan panjang berkunjung ke pusat-pusat perbelanjaan yang terkenal di seantero jagat ini. Hal ini adalah merupakan dampak dari proses transformasi masyarakat Indonesia ketika terjadi perubahan dari masyarakat agraris menjadi masyarakat modern. Dalam perhitungan ke depan, minat untuk melaksanakan umrah karena hal itu secara tidak langsung sebagai respons terhadap gelombang modernisasi. Dalam memahami kasus pertumbuhan semangat berumrah didapati suatu prinsip baru yaitu semakin modern sebuah masyarakat maka akan semakin rindu mereka kepada tradisi spritualitas yaitu pencerahan batin. Maka selayaknya, masyarakat pengusaha dan pemerintah tidak hanya memandang perkembangan ibadah umrah sebagai gejala sosial semata akan tetapi hendaklah berupaya menangkap penting di balik proses perubahan ini untuk kepentingan pembangunan bangsa. Kesempatan melakukan perjalanan ibadah umrah adalah semata hasil kreativitas mereka. Peran pemerintah dalam hal ini terbatas pada himbauan kepada masyarakat agar tidak memaksakan diri berada dalam daftar penantian panjang untuk berangkat melaksanakan ibadah haji. Himbauan ini ternyata cukup ampuh menggugah minat umat Islam untuk memanfaatkan kesempatan berkunjung ke dua tanah haram yaitu Makkah dan Madinah. Ketika di Makkah mereka melakukan tawaf, sa’i dan selanjutnya tahallul setelah sebelumnya menjelang tiba di Makkah menggunakan pakaian ihram sejak dari Miqat. Hal itu dimulai dari titik start memulai suatu pekerjaan besar yang disebut Miqat dan berakhir

di tempat tahallul yaitu ketika mereka kembali ke dunia kehidupan sehari-hari berinteraksi dengan lingkungannya. Selama dalam berihram, mereka dihimbau tidak melakukan berbagai perbuatan, ucapan maupun sikap yang mengakibatkan cederanya niat umrah. Selama prosesi umrah, setiap umat Islam dibawa ke alam lain yaitu sesuatu yang selama ini dianggap sebagai hal yang biasa akan tetapi dengan berpakaian ihram mereka seakan didekatkan dengan kematian. Karena nasehat yang paling tinggi adalah apabila manusia diingatkan kepada kematian yang akan dihadapi setiap yang bernyawa tanpa kecuali. Tentulah sekeras apapun hati manusia namun apabila mengingat datangnya kematian maka semua motif yang tidak baik seperti sikap sombong, dengki, khianat termasuk perilaku korupsi, penyalahgunaan kekuasaan akan hilang dengan sendirinya. Apabila dipandang dari atas ketika manusia berkumpul sedang melaksanakan tawaf dengan mengelilingi Ka’bah sebanyak tujuh kali, maka arus perputaran manusia yang tawaf itu laksana pusaran air bah yang terus bergelombang sebagai bentuk gerakan yang dinamis dan saling melekat antara satu dengan yang lainnya. Hal itu memberi makna paling tidak dua hal. Adanya potensi kekuatan umat Islam yang sesungguhnya dapat melakukan perubahan terhadap tatanan dunia menuju kepada yang lebih baik. Letak kekuatan itu terletak pada etos umat yang tersimpul dalam mujahadah, ijtihad dan jihad . Selanjutnya, setiap Muslim yang melakukan tawaf tentulah selalu ingin mendekat dan merapat ke Ka’bah dan dengan sendirinya hubungan antara satu orang dengan orang lain tanpa melihat suku bangsanya menyatu dalam satu tarikan nafas yaitu persaudaraan sejagat umat Islam. Solidaritas umat Islam memiliki tujuan yang luhur yaitu untuk membawa rahmat bagi sekalian alam yang bermakna pesan kasih sayang Islam itu bersifat universal lintas etnis, geografis dan budaya. Dengan bertawaf mereka menyatu dalam satu tekad penghambaan diri sesungguhnya kepada Allah SWT. Semangat penguatan keimanan umat Islam ini semakin kentara lagi apabila mereka saling berlomba men-

dekat ke raudlah, makam Rasul serta tempat-tempat yang memiliki nilai sejarah terutama di Madinah. Hal itu membuktikan bahwa Islam bukan sebuah legenda akan tetapi suatu semangat perjuangan penegakan akidah yang terus menyala dalam hati sanubari setiap muslim sepanjang masa. Prestasi rohani yang diperoleh mereka yang berangkat menunaikan ibadah umrah dapat dipandang sebagai sebuah pengayaan rohani (spritual enrichment), pencerahan rohani (spritual enlightenment) untuk menuju kepada derajat kehidupan yang lebih baik. Kondisi seperti itulah yang dapat mengantarkan seseorang mencapai derajat kehidupan yang bahagia. Pemerintah tanpa mengeluarkan biaya sesungguhnya memiliki modal dasar bagi pembangunan bangsa dengan memanfaatkan prestasi rohani mereka yang telah berangkat haji dan umrah di tengah gejala kegersangan nilai-nilai kebaikan yang dirasakan sekarang. Gejala penyimpangan sosial yang terus terjadi di dalam kehidupan masyarakat adalah merupakan hal yang bisa dipandang sederhana karena pada akhirnya berdampak kepada kelangsungan Indonesia sebagai sebuah bangsa. Karena itu, sudah sepatutnya pemerintah memetik kesempatan ini dengan memanfaatkan potensi kecerahan batin ini sebagai modal dasar peneguhan komitmen seluruh bangsa. Umat Islam yang kembali dari ibadah umrah selayaknya dihimpun menjadi suatu kekuatan besar bagi peneguhan komitmen terhadap nilai moral. Sekarang ini yang terjadi, ibadah umrah masih bersifat pekerjaan personal belum berdampak bagi kepentingan pembangunan bangsa. Tetapi, sayangnya pemerintah masih kurang memberikan perhatian terhadap perjalanan ibadah ini baik sebelum maupun sesudah umrah sehingga kesucian rohani pasca ibadah umrah belum didayagunakan sebagai potensi pembangunan bangsa. Padahal dahulu, kolonial Belanda sangat menakuti umat Islam yang kembali dari ibadah haji karena dikhawatirkan memperkokoh semangat nasionalisme dan patriotisme melawan penjajahan. Penulis adalah Dosen UIN Syarif Hidayatullah Jakarta.

Krisis Multidimensional & Moral Pejabat Oleh Fariz Alnizar Maka, diam-diam idiologi bangsa ini adalah culturalpredestination (Qadariyah Kultural)—sebuah ideologi yang menganut paham bahwa hidup ini seperti kapas ditiup angin.


ampaknya apa yang dikatakan oleh sejarawan abad 17, Edward Gibbon dalam The History Of the decline and Fall Of The Roman Empire mulai sangat nampak di negeri ini. Ia mengatakan kemerosotan moral dengan gejala hidup mewah dan berlebihan itulah penyebab utama hancurnya sebuah negara. Gejala itu nampaknya sudah mengkristal menjadi semacam gumpalan akumulasi gejala. Jika melihat pola hidup para pejabat dan kaum elit negeri ini maka tentu yang terbayang di benak kita adalah kesan kemewahan yang sangat, gaya hidup yang lebih mementingkan libido duniawi. Betapa tidak, bagi kita tentunya sangat tidak sulit menemukan “jamur” kemewahan gaya hidup pejabat negeri ini. Logika yang mereka pakai adalah semakin tinggi fasilitas berbanding lurus dengan kualitas dan prestasi hasil kerja. Pada tataran konsepsi-teoritis memang hal itu bisa dibenarkan, tapi jika kita “bumi-kan” ia pada tataran praksis maka jawabannya akan lain. Karena banyak pejabat negeri kita yang dengan sekian lengkapnya fasilitas ia tetap “mandul”, baik produktifitas, etos ataupun elan kerjanya. Hal itu sudah jauh-jauh hari diramalkan Karl Gunnar-Myrdal bahwa bangsa kita adalah bangsa lembek (Soft -State) yakni ne-

gara yang pemerintah (pejabat) dan warganya tidak memiliki ketegaran moral sosial politik (Myrdal: 1988). Lihat saja, mestinya dengan segudang fasilitas untuk menunjang dan membantu meningkatkan kreativitas serta produktivitas, alih-alih bangsa kita malah terjerembab dalam berbagai masalah baru yang kita saja sangat sulit untuk merumuskannya. Moralitas Rendah Rendahnya moral sosial-politik sebagaimana yang dikatakan oleh Myrdal, jika kita gabungkan dengan apa yang dikatakan Gibbon membuat kita hari ini tak kunjung bisa lepas dari apa yang kita istilahkan dengan krisis multidimensional. Bahkan Nurcholis Madjid mengatakan bahwa krisis multidimensional itu adalah semacam penyakit akut yang akan terus menggrogoti kita, ia tak hanya sekedar krisis finansial-moneter sebagaimana negara-negara tetanngga kita. (Nurcholish Madjid :2003) Maka sebagaimana yang kita dapati sekarang, sementara negara-negara tetangga sudah berhasil melepaskan diri dari krisis finansial-moneter yang diidapnya, kita tetap bergelut di pekatnya endemik krisis multidimensional tesebut. Selain itu Azhar Arsyad mengatakan bahwa di samping rendah moral

sosial-politiknya negara kita juga sangat miskin akan dambaan prestasi (Need Of Achievement). Betapa tidak? Ribuan peserta didik dan penduduk negara kita “buta” dan sulit merumuskan apa yang ingin dicapainya kelak— karena seakan-akan masa depan adalah sesuatu yang mahal sebab masa depan hanya milik mereka yang dekat dengan kekuasaan. Maka, diam-diam idiologi bangsa ini adalah ideologi cultural-predestination (Qadariyah Kultural)—mak-sud saya sebuah ideologi yang menga-nut paham bahwa hidup ini seperti kapas yang ditiup angin. Semua sudah ada yang mengatur jadi kita tinggal mengikuti alur aturan yang sudah digariskan dan ditentukan oleh Tuhan saja. Negara Halaman Belakang Tanpa disadarai, hari ini kita sudah berada pada tahun keduapuluh tiga sejak pengamat negara industri Asia Timur, Louis Kraar meramalkan bahwa Indonesia duapuluh tahun ke depan akan menjadi halaman belakang (Back Yard) negara-negara Asia Timur. Indonesia akan ditinggalkan oleh negara-negara tetangganya yang berkembang menjadi negara maju semacam Singapura ataupun Malaysia. (Kraar: 1988) Kalau dianalisis lebih mendalam tentu pangkal masalah adalah terletak pada etos kerja yang lembek yang budaya korupsi. Tentu kelembekan etos kerja itu terbukti dengan adanya moratorium penerimaan Calon Pegawai Negeri Sipil sampai 2013 misalnya. Hal ini secara tidak langsung dapat disimpulkan bahwa ada yang tidak beres terkait pembagian beban dan

tugas kerja pada Pegawai Negeri Sipil. Kelembekan etos kerja diperparah dengan hobi korupsi di segala lini, korupsi budaya, korupsi waktu, korupsi uang, korupsi anggaran serta korupsi apapun. Bahkan ada satu pernyataan ekstrim bahwa kalaulah umur itu bisa dikorupsi tentu masyarakat kitalah yang paling pertama mengorupsinya. Kiranya tidak terlalu berlebihan dan salah jika dikatakan bahwa saat ini gejala negara kita sudah mulai memasuki fase transformasi menjadi negara back-yard Asia. Indonesia sudah semakin tertinggal. Juga ungkapan akan krisis multidimensional itu memang merupakan gambaran tentang kerusakan bangsa secara holistik-kolegial. Kerusakan yang dimulai dari krisis finansial 1998 itu—sebagaimana bangsa-bangsa Asia lain mengalaminya—seharusnya bisa dibatasi hanya pada wilayah ekonomi nasional saja. Tapi sebagaimana yang kita dapati sampai hari ini bangsa ini gagal membatasi krisis tersebut disebabkan oleh lemahnya Manajerial (Weak Governance) dalam urusan pemerintahan. Kenaikan Bahan Bakar Minyak yang direncakkan per-1 April 2012 kendatipun ditunda ini adalah bagian kecil dari buah lemahnya dan rendahnya manajerial pemerintahan kita. Sekali lagi, ini masalah moralitas. Wallahu A’lam Penulis adalah Peneliti Pada Lembaga Penelitian, Pengembangan dan Pengabdian Masyarakat (LP3M) Sekolah Tinggi Agama Islam Nahdlatul Ulama (STAINU) Jakarta, Aktif Di Kajian Tafsir Ibukota (KTIK).


Ekonomi & Bisnis Ekspor,ImporSumutAnjlok

WASPADA Senin 18 Juni 2012

Tinjauan Ekonomi

Jhon Tafbu Ritonga Pengamat Ekonomi

Pesan Untuk Balon Gubsu (2) Sederet nama sudah disebut. Tapi belum menyinggung kapasitas dan karakter personal. Sesekali ada yang membahas topik tertentu, misalnya “Gubsu mendatang harus visioner” atau “Gubsu mendatang harus pro-infrastruktur”. Ada yang menyatakan kesiapan menjadi Gubsu, dan mendaftar ke satu atau dua partai. Banyak orang dan sebagian media menganggap visi dan misi hanya gincu penyantik. Pemilih pemula (jika mereka tertarik) mungkin menganggapnya sebagai hal yang lumrah. Padahal, seharusnya dimulai dengan nominasi yang mengedepankan kapasitas dan karakter amanahnya. Kemudian mengevaluasi syarat visi misi, rekam jejak dan kekuatan tim kerja. Elektabilitas itu penting ketika akan memutuskan calon, dan kemudian memastikan kampanye supaya menang. Apa boleh buat, begitulah Indonesia hari ini. Serba memulai dan mencari bentuk. Sila “kerakyatan yang dipimpin oleh hikmat kebijaksanaan dalam permusyawaratan/ perwakilan” diganti dengan prinsip mayoritas. Dalam membuat keputusan politik secara mufakat musyawarah tak lagi perlu wakil pilihan, seperti ulama dan cerdik pandai. Karena beradu ramai dan kesiapan masyarakatnya masih pemula maka peran bandar lebih penting. Reformasi membuat uang dan keramaian tim sukses sebagai syarat utama. Maka promotor Lady Gaga pun dikalahkan ormas. Liberalis kemudian menuding kepolisian dikalahkan aliran keras. Di Sumatera Utara suasana yang sama sudah terasa dalam proses menuju Pilgubsu 2013. Ketika seseorang diberitakan sudah mendaftar ke partai tertentu saya mengatakan “dia punya potensi besar” ada kolega yang terbelalak heran. Pasalnya, seseorang itu seperti Ritonga tergolong marga minoritas, dibanding marga lain seperti Lubis, Nasution, dan Siregar. Dia makin kaget ketika saya mengatakan “Akan berpasangan dengan Fulan. Peluang menangnya di atas 30 persen pada putaran pertama,” karena Fulan juga tergolong minoritas. Zaman serba sakit ini calon yang baik harus senantiasa mengendalikan diri. Jangan sedikit saja terbesit nafsu berkuasa dan ingin makin kaya raya. Cepat atau lambat akan merasakan kosekuensi yang tak terbayangkan. Perhatikan

satu dekade terakhir banyak kawan dan lawan yang terjerembab, tersungkur dan masuk perangkap pemberantasan KKN. Kapasitas, sifat amanah, visi misi, rekam jejak, rencana-program strategis dan tim yang kuat akan sia-sia jika kemenangan ditempuh dengan sistem politik uang. Elektablitas karena pencitraan yang dimodali bandar atau investor niscaya membuat kemenangan seperti rumah pasir di pantai. Setelah lenyap ditelan ombakombak kecil, akan disusul kemudian oleh ombak besar yang dapat menelan perahu besar. Nanti setelah menjadi Gubsu, para kawan dan lawan akan menjadi kian berhasrat saling menjatuhkan. Sekarang Indonesia sedang bersemangat saling menghujat, tuduh menuduh dan mendorong ke perangkap KKN. Pemimpin tinggi berteriak harus bersih, padahal dirinya sendiri naik dengan main kotor. Kebanyakan melupakan tujuan bersama, membangun peradaban bangsa yang baik dan mendapat keampunan Tuhan. Kebanyakan kita sudah tahu pengalaman Rokhmin Dahuri. Di Tipikor karena melakukan kebaikan dengan cara jujur. Departemen yang dipimpinnya mengumpulkan dan menyalurkan dana nonbujeter. Namun undang-undang tak membenarkan caranya. Catatan yang lengkap dan rapi membuat dirinya dapat dibuktikan melakukan korupsi. Niat dan amal baik belum tentu hasilnya baik. Pepatah “sedangkan padi ditanam bisa tumbuh lalang” tak lagi menjadi pertimbangan mengoreksi sesama meskipun maksud dan pekerjaannnya baik. Jika bisa diperangkap dengan pasal-pasal buatan manusia, maka pasal itulah yang lebih penting. Orator mimbar religi pun mengatakan tertipikor lebih jelek daripada hipokrit. Kata mereka korupsi itu lebih buruk dibanding murtad dan munafik. Seperti pengalaman Rokhmin, dipenjara karena mengakui perbuatan baiknya. Sementara orang dan partai yang menerima dana nonbudjeter menjadi “pahlawan”. Mereka berpurapura tidak tahu status dana yang diterimanya. Mereka mengembalikan ke kas negara supaya tampak bersih. Bertindak secara hipokrit, munafik! Kira-kira begitulah sekarang era kekuasaan politik “putar balik”. Jika mencalon ikut Pilgubsu 2013, pertimbangkanlah dengan tenang. Mintalah petunjuk dan pertolongan Tuhan. Bukan bandar dan investor.

MEDAN (Waspada): Perdagangan Sumatera Utara hingga Mei 2012 masih mengalami kelesuan dibanding tahun lalu sehingga volume pengeksporan barang maupun impor mengalami penurunan cukup tajam . Kelesuan perdagangan Provinsi Sumut ini terlihat dari data kegiatan pengapalan berbagai jenis barang ke luar negeri selama periode lima bulan melalui pintu gerbang laut Belawan International Container Terminal PT Pelabuhan Indonesia I (Persero). Asisten Hukum dan Humas Belawan International Container Terminal (BICT ) H Suratman kepada Waspada Jumat (15/6) membenarkan perdagangan Sumut hingga Mei masih mengalami penurunan baik ekpsor maupun perdagangan impornya. ‘’Dari data bongkar muat barang terlihat volume 21 komoditi ekspor dan impor yang selama ini jadi unggulan teratas pengapalannya di BICT mengalami penurunan hingga Mei 2012 dibanding periode sama tahun lalu,’’ ungkap Suratman. BICT yang merupakan pintu gerbang ekonomi terbesar dalam menangani arus barang di Sumut sehingga bongkar muat arus barang di pelabuhan ini menjadi acuan penilaian perdagangan daerah ini. Dari data hingga lima bulan selama 2012 hanya berhasil melakukan ekpor sebanyak 1. 535.199 ton, jumlah ini mengalami penurunan dibanding periode sama 2011 yang telah mencapai 1.547.977 ton. Menurut Suratman, penurunan yang sama juga terjadi pada kegiatan impor, selama periode ini hanya mencapai 1.111.165 ton padahal diban-

Dari Konferensi Kakao Dunia

WASHINGTON DC (Waspada): Lebih dari 300 perwakilan dari unsur pemerintah, industri, asosiasi petani, eksportir dan lembaga perguruan tinggi dari 28 negara di Benua Amerika, Eropah, Asia dan Australia, mengikuti Konferensi Kakao Dunia di Washington DC, Amerika Serikat. Acara yang digelar World Cacao Foundation (WCF) di The Sphinx Club Franklin Square itu, membahas tentang perlunya meningkatkan kerjasama di antara mereka-termasuk lembaga donor dan organisasi non profit seluruh dunia-guna pengembangan ekonomi kakao yang berkelanjutan (sustainable cacao economy). Pertemuan yang berlangsung 13 Juni lalu, Pemerintah Aceh mengutuskan Kepala Bappeda Aceh Ir. Iskandar, M.Sc untuk menghadiri pertemuan yang dibuka oleh PresidenWCF Bill Guyton dan dihadiri Perdana Menteri Cote D’ivore (Pantai Gading), Menteri Tenaga Kerja dan Kesejahteraan Sosial Ghana, Menteri Pertanian dan Koperasi Tanzania dan pejabat dari Kementerian Pertanian Amerika Serikat. Usai acara pembukaan, Kepala Bappeda Aceh, dalam sesi “Fostering Strategic Coor-

dination for Agricultural Development” bersama perwakilan Amerika Latin (CATIE) dan Afrika (Partnership to Cut Hunger and Poverty in Africa) mendapat kesempatan untuk menyampaikan berbagai hal menyangkut Kakao. Dalam paparannya dengan judul “Strategis and Policies on Aceh Sustainable Agriculture Development” Ir. Iskandar, M.Sc menyampaikan elemen kunci dalam strategi pengembang Kakao Aceh meliputi Farmer Training and Extension Program; Seedling and Nursery Management; Strategic Development on Infrastructur; Develop Spatial Plan and Coordinated Enveronmental Management; Develop Public-private Model of Industry Partnership; innovative Models of Credit Provision; Policy Support for Efficient Supply Chains: and Improving Market Condition for Aceh Cocoa. “Diharapkan produktifitas kakao yang masih rendah, dalam dua hingga lima tahun ke depan bisa ditingkatkan sehingga pendapatan petani juga meningkat. Di sisi lain, dapat mengurangi tingkat kemiskinan,” kata Ir. Iskandar usai pertemuan itu. Lebih lanjut Kepala Bap-

peda Aceh mengungkapkan, sesuai dengan Rencana Pembangunan Jangka Menengah (RPJM) 2013-2017 yang sedang disusun, Pemerintah Aceh menempatkan penguatan ketahanan pangan dan nilai tambah produk pertanian menjadi prioritas pertama, termasuk di dalamnya komoditi kakao. Sedangkan prioritas berikut di antaranya dukungan infrastruktur yangterintegrasi dan pengembangan sumber daya manusia. “Dalam pelaksanaannya, pemerintah tentu tidak bisa berjalan sendiri, harus dilakukan secara bersama-sama dengan elemen lainnya sehingga menghasilkan sinergi saling melengkapi dan memperkuat. Fungsi pemerintah lebih kepada koordinasi, regulasi dan penganggaran yang menjamin program yanbg dilakukan dapat menyentuh langsung kepada masyarakat. Hal ini sejalan dengan visi dan misi Gubernur Aceh terpilih (dr. Zaini Abdullah dan Muzakir Manaf-red) salah satu prioritas pembangunan Aceh adalah program pemantapan swasembada pangan dan nilai tambah untuk komoditas utama, dalam rangka percepatan pengurangan angka kemiskinan dan

penciptaan lapangan kerja,” sebutnya lagi. Kepala Bappeda Aceh menambahkan, sebelum keberangkatannya ke Amerika Serikat untuk menghadiri Konferensi Kakao Dunia, Gubernur Aceh terpilih dalam arahannya kepada Kepala Bappeda Aceh menyampaikan model Aceh Development Coordination Forum (ADCF) yang melibatkan masyarakat internasional perlu dipertahankan dan ditingkatkan, karena akan menjamin terintegrasinya semua program dalam satu sistem perencanaan. Kehadiran dan presentasi Kepala Bappeda Aceh Ir. Iskandar, M.Sc pada WCF Partnership Meeting yang difasilitasi Swisscontact tidak saja suatu kehormatan bagi Aceh, tetapi lebih jauh lagi yakni meyakinkan dunia internasional bahwa Aceh merupakan daerah sangat potensial untuk pengembangan komoditas pertania khususnya kakao, sesuai Master Plan Percepatan dan Perluasan Ekonomi Indonesia (MP3I) yang menetapkan Sumatera sebagai koridor ekonomi pertanian dan pertambangan sesuai Peraturan Presiden tentang MP3I yang telah ditetapkan secara nasiona. (b05)

DPD RI Minta Menperindag Batasi Impor Jagung MEDAN (Waspada): Anggota DPD RI asal Sumut Parlindungan Purba mendesak pemerintah khususnya Menteri Perindustrian dan Perdagangan (Menperindag) untuk membatasi impor jagung, untuk memperhatikan produksi di dalam negeri khususnya petani jagung. “Petani jagung di Sumut saat ini sedang ‘menjerit’ karena harga terus anjlok disebabkan tidak dibeli pihak perusahaan yang bisa mendapatkan dari produk impor dengan harga lebih murah,” kata Parlindungan Purba di Medan kemarin. Menurutnya, kondisi tersebut para petani tidak mendapatkan perlindungan dari pemerintah. “Saya akan mendesak Menteri Perdagangan supaya membuat aturan yang menyangkut impor holtikultura. Dan saya dengar UU No.30 tahun 2012 tentang impor holtikultura yang baru, ternyata jagung tidak diatur di dalamnya. Karena ini menyangkut masa depan petani jagung,” ujarnya. Parlindungan meminta, pemerintah harus membuat harga patokan tertinggi terha-


KETUA Himpunan Petani Jagung Indonesia (Hipajagin) Jemat Sebayang didampingi Sekretaris Charlie Hutasoit dan Bendahara Budi Ginting menyampaikan keluhan para petani jagung kepada anggota DPD RI asal Sumut Parlindungan Purba. dap impor jagung. Selain itu, juga akan mengusulkan produk-produk strategis hasil bumi Indonesia harus menjadi barang-barang yang dilindungi oleh UU. “Saya juga meminta Kepala Dinas Pertanian dan Ketahanan Pangan Sumut harus proaktif terhadap masalah ini. Mereka harus duduk sama mendesain pertemuan antara pedagang,

petani, produsen pakan, pedagang perantara, importir duduk sama. Kalau memang harus impor harus berdasarkan survei sesuai kebutuhan,” ujarnya. Sementara itu, Ketua Himpunan Petani Jagung Indonesia (Hipajagin) Jemat Sebayang didampingi Sekretaris Charlie Hutasoit dan Bendahara Budi Ginting menyebutkan, sudah sepekan ini harga jagung

anjlok tinggal Rp1.700-Rp1.800 per kg dari sebelumnya masih di kisaran Rp2.200 per kg karena jagung impor semakin banyak masuk dan harga di pabrikan turun. “Harga jagung dewasa ini bukan hanya anjlok dari harga sebelumnya, tetapi sudah di bawah harga referensi daerah (HRD) jagung yang ditetapkan Pemerintah Provinsi Sumut tahun ini yang sebesar Rp2.133 per kg,” ujarnya. Petani benar-benar kesulitan dan semakin khawatir harga bakal anjlok lagi mengingat awal atau pertengahan Juli hingga September, sudah memasuki masa panen raya kedua. “Kalau di saat produksi ketat seperti dewasa ini, harga sudah anjlok, bagaimana nanti kalau panen raya. Petani benar-benar berharap, pemerintah turun tangan membantu petani,” katanya. Hipajagin berharap, katanya, Pemerinta Provinsi Sumut segera membentuk tim monitoring harga, apalagi nyatanya harga jagung di pabrikan juga turun dari Rp2.800 per kg menjadi Rp2.400-Rp2.500 per kg. (m41)

ding periode sama tahun lalu jumlahnya telah lebih tinggi mencapai 1.140.554 ton. Suratman menjelaskan, dilihat dari per komoditinya ada beberapa jenis barang yang merupakan ekspor unggulan Sumut masih mengalami kelesuan seperti karet hingga Mei hanya bisa mencapai 276.765 ton. Ekspor unggulan hasil perkebunan daerah ini ternyata masih lebih rendah dibanding periode sama 2011 yang telah naik menjadi 335.403 ton. Komoditi unggulan ekspor Sumut yang juga mengalami nasib sama adalah minyak goreng, hingga Mei hanya mencapai 123.232 ton. Jumlah ini

turun dibanding tahun lalu yang telah menempati angka 186.953 ton. Demikian juga dengan ekspor kopi hingga Mei hanya berjumlah 35.082 ton, turun dibanding ekspor tahun lalu yang telah berjumlah 43.753 ton. Coklat yang selama ini menjadi unggulan ekspor namun pada periode ini mengalami penurunan dari 22.590 ton tahun 2011, ternyata jumlahnya anjlok pada periode ini yang hanya 16.493 ton. Kondisi penurunan ekspor Sumut diperparah lagi dengan penurunan ekspor produksi hasil industri . Ini terjadi pada kertas pulp dimana pada periode ini hanya berjumlah 67.457 ton, turun dari 80.144 ton pada 2011. Sedangkan sarung tangan juga anjlok dari 31.876 ton pada tahun lalu menjadi 28.593 ton. Walau secara umum ekspor Sumut anjlok namun masih ada beberapa komoditi hasil industri masih bertahan tinggi terutama hasil produksi berbahan

baku hasil perkebunan. Dari data terlihat, komoditi masih bertahan tinggi dialami sabun yang selama bertahun tahun merupakan ekspor terbesar ke luar negeri karena mempunyai banyak bahan baku. Ekspor sabun hingga Mei telah mencapai 159.868 ton, jumlah ini naik dibanding periode sama 2011 hanya 108.751 ton. Selain itu ekspor oil masih tinggi saat ini mencapai 88.673 ton, dibanding 2011 hanya 60.891 ton. Ekspor strearic acid juga masih tinggi mencapai 110.783 ton, ekspor bahan kimia ini ternyata pada masa ini mengalami kenaikan cukup tajam dibanding 2011 yang hanya 38.458 ton. Impor Sedangkan kegiatan impor barang Sumut yang berhasil dikapalkan melalui BICT hingga Mei hanya mencapai 1.111.163 ton. Jumlah ini mengalami penurunan dibanding periode yang sama 2011 telah mencapai 1.140.554 ton.

Komoditi impor yang mengalami penurunan dialami pupuk hingga Mei ini hanya 103.330 ton sedangkan periode sama tahun lalu berjumlah 145.248 ton. Steel turun dari 28.819 tahun lalu saat ini hanya 21.252 ton. Soya bean dari 99.089 pada tahun lalu turun menjadi 60.217 ton. Fresh fruits juga turun hingga Mei hanya diimpor sebanyak 28.209 ton, sedangkan tahun lalu 37.669 ton. Direktur Impor Direktorat Jenderal Perdagangan Luar Negeri Kementerian Perdagangan Harlinda ketika ditemui Waspada di Medan, Kamis (14/6) membenarkan telah terjadi penurunan impor barang secara nasional. ‘’Secara perdagangan, kita bersyukur ternyata volume impor kita mulai mengalami penurunan dibanding tahun lalu. Penurunan ini menurutnya karena masyarakat mulai mencintai produksi dalam negeri,’’ jelas Harlinda.(m35)

Pengawasan Minim, BBM Subsidi Pedagang BBM Eceran Wajib Beli Pertamax 3 Liter Dilarikan Ke Luar Aceh IDI (Waspada): Pengawasan Bahan Bakar Minyak (BBM) bersubsidi di Aceh tergolong minim, bahkan bisa disebut tidak ada sama sekali. Sehingga tidak sedikit Stasiun Pengisian Bahan Bakar Umum (SPBU) yang kehabisan BBM bersubsidi diperkirakan karena tingginya angka penjualan ke industri. “Tidak sedikit BBM bersubsidi di Aceh diduga dilarikan ke luar daerah, seperti BBM di Aceh Timur dibawa di Aceh Utara dan seterusnya. Jadi kita harap, pengawasan BBM di Aceh bisa diperketat,” papar Koordinator Solidaritas untuk Pe d u l i A n g g a ra n ( Sa PA ) Rizalihadi kepada Waspada, Minggu (17/6) di Idi. Menurut dia, akibat minimnya pengawasan dari pihak terkait seperti kepolisian dan Pemda Aceh maka para pendistribusian BBM bersubsidi di SPBU tidak terkawal secara baik, sehingga akhirnya BBM bersubsidi di Aceh diselewengkan dengan dugaan dijual ke pihak industri di Aceh ataupun di luar Aceh.

Rizalihadi mendukung kinerja jajaran Polres Aceh Barat di Meulaboh yang berhasil menangkap 2 ton solar bersubsidi yang diperkirakan hendak dijual ke industri. “ Ta p i m a s i h p e r l u pengungkapan lain di Aceh terkait penyalahgunaan BBM bersubsidi. Jika tidak dilakukan pengawasan yang benar, maka masyarakat khu-susnya pemilik kendaraan akan terus mengeluh soal kelanggan BBM bersubsidi di SPBU di Aceh,” katanya. Rizalihadi meminta, pihak Pertamina agar memperketat pengawasan terhadap seluruh SPBU di Aceh, lebih-lebih di pantai barat dan di pantai timur Provinsi Aceh. “Banyak SPBU yang ‘bermain’ mendistribusikan BBM bersubsidi ke pertusahaanperusahaan di Aceh, padahal seharusnya industri diharusnya menggunakan BBM nonsubsidi,” tegas Rizalihadi lagi seraya menandaskan, pihaknya kerap menerima laporan SPBU kosong. (b24)

Waspada/Mursal AI

SEBANYAK 250 peserta yang terdiri dari dokter, sarjana farmasi, mahasiswa kedokteran, Akademi Keperawatan dan Kebidanan meramaikan acara penerapan Complementary Alternative Medicine (CAM) dan Akupuntur Dalam Pelayanan Kesehatan, Sabtu (16/6).

LANGSA (Waspada): Sejak berapa pekan terakhir pedagang eceran diharuskan membeli BBM jenis Pertamax, setiap kali mereka membeli BBM jenis bensin (Premium) di SPBU Harapan Langsa. Akibatnya harga premium di tingkat eceran menjadi berkisar Rp6.000 hingga Rp 7.000 per liter karena telah dicampur Pertamax. Salah seorang agen BBM eceran yang identitasnya minta tidak disebut, Sabtu (16/6) mengatakan, selama ini seluruh pedagang eceran yang setiap kalinya membeli bensin satu jerigen berukuran 35 liter di SPBU Harapan, diharuskan pihak SPBU untuk minyak pertamax sebanyak 3 liter. Hal itu telah menjadi keharusan dan syarat untuk memperoleh premium di SPBU itu. Padahal menurutnya, pertamax itu tidak mungkin laku atau terjual kepada warga, karena mereka memilih tetap menggunakan BBM jenis premium. Namun kebijakan yang diberlakukan pihak SPBU Harapan ini,

dinilai pedagang eceran sangat memberatkan mereka. Sementara itu agar mereka tidak mengalami kerugian, selama ini pertamax itu mereka campur dengan bensin agar habis terjual kepada warga. “Biasanya kami menjual premium Rp5 ribu per liter, namun karena kami campur dengan pertamax maka kami harus menjual dengan harga Rp6 ribu per liternya. Hal ini kami lakukan agar kami tak rugi, karena warga tak mau membeli pertamax itu di tingkat eceran,” imbuhnya. Humas SPBU Harapan Langsa, Andip ketika dikonfirmasi, Sabtu (16/6) sore, membenarkan selama ini pihaknya telah memberlakukan penjualan minyak pertamax 3 liter, bagi pedagang eceran yang membeli BBM bensin ukuran 35-40 liter di SPBU Harapan. Menurutnya hal itu dilakukan sebagai langkah sosialisasi pengggunaan pertamax atau BBM non subsidi pemerintah di tengah masyarakat.(m43)

Waspada/Mursal AI

SEJUMLAH produk PT Sidomuncul dipamerkan dalam acara penerapan Complementary Alternative Medicine (CAM) dan Akupuntur Dalam Pelayanan Kesehatan di RSU dr. Pirngadi Medan, Sabtu (16/6)

Bisnis Obat Herbal Mulai Diekspor LAMBAT laun permintaan masyarakat akan obat herbal di Indonesia kian meningkat. Tentu saja, ini akan menjadi peluang bisnis yang menggembirakan bagi distributor herbal. Bukan tidak mungkin, para dokter meresepkan obat herbal kepada pasiennya, jika obat herbal tersebut sudah dibuktikan atas indikasi tertentu berdasarkan penelitian. Hal ini diakui Dosen Fakultas Kedokteran Universitas Diponegoro Prof Edi Dharmono, kepada wartawan disela-sela acara penerapan Complementary Alternative Medicine (CAM) dan Akupuntur Dalam Pelayanan Kesehatan yang diadakan PT Sidomuncul bersama Perhimpunan Dokter Herbal Medik Indonesia (PDHMI), Perhimpunan Dokter Spesialis Akupuntur Medik Indonesia (PDAI) dan IDI Sumut di lantai lima RS Pirngadi, Medan, Sabtu (16/6). “Perkembangan obat herbal atau tradisional cukup bagus dan menggembirakan, mudah-mudahan masyarakat dan dunia kedokteran bisa menerimanya sebagai obat. Apalagi saat ini banyak mahasiswa kedokteran yang saya bimbing membuat penelitian tentang obat herbal ini,” kata Edi Dharmana. Menurutnya, secara empiris sudah banyak leluhur memakai obat-obat herbal untuk menyembuhkan segala jenis sakit perut, masuk angin dan sebagainya. “Hanya saja, kalau sudah ada pembuktian ilmiah maka lebih bagus. Jadi kita baru berusaha ke arah sana (pembuktian ilmiah-red),” imbuhnya. Dia juga berharap, mahasiswa kedokteran akan berubah mindset-nya untuk berani menggunakan obat herbal jika nantinya mereka lulus. Ekspor Sementara itu, Direktur Bina Pelayanan Kesehatan Tradisional Alternatif

Waspada/Mursal AI

DIREKTUR Bina Pelayanan Kesehatan Tradisional Alternatif dan Komplementer dr. Abidinsyah Siregar, DHSM, M.Kes (kanan) saat menyampaikan materi tentang kebijakan pemerintah tentang pelayanan kesehatan tradisional, Sabtu (16/6). dan Komplementer Abidinsyah Siregar mengutarakan keberadaan tanaman herbal bukan hanya berperan di Indonesia, tetapi berkontribusi ditingkat dunia. “Hal ini dikarenakan ketersediaan bahan tradisional kita terbesar dan nomor satu di dunia, bahan tradisional kita mengalahkan Brazil dan Angola. Semua itu bisa digunakan untuk kesehatan bukan hanya untuk pengobatan,” tegasnya. Sedangkan, Dokter Spesialis Akupuntur Aldrin Nelwan Pancaputra mengatakan untuk mempercepat penggunaan jamu atau obat herbal dalam pelayanan kesehatan masyarakat, tentunya tidak langsung menyentuh pada tindakan kuratif/penyembuhan

tapi sebaiknya terlebih dulu mengarah promotif dan preventif. Diungkapkannya, sah-sah saja dokter meresepkan herbal atau jamu, asalkan jamu tersebut sudah bisa digunakan atas indikasi tertentu berdasarkan satu penelitian. “Indonesia memiliki potensi besar mengembangkan sumbersumber dari tanaman obat ini,” jelasnya lagi. Bercerita tentang obat herbal Senior Public Relation PT Sidomuncul Nanik R Sunarso mengungkapkan produk mereka telah mendapat sertifikat obat herbal terstandar dari Badan POM tahun 2007. “Tolak Angin ini sudah melalui uji toksisitas bersama Tim Fakultas Sanata Dharma dan uji khasiat,” terangnya.(h02)


WASPADA Senin 18 Juni 2012


Transportasi, Lokomotif Ekonomi Aceh PEMERINTAH Aceh terus memacu pembangunan transportasi darat, laut dan udara. Hasilnya kini dapat dirasakan, bahkan grafiknya mengalami lompatan besar. Karena itu, tidak berlebihan, transportasi sudah menjadi lokomotif pembangunan ekonomi Aceh. Transportasi telah pula menggerakkan roda perdagangan dan membuka akses ekonomi dengan “dunia” luar. Sedangkan di dalam provinsi, menjadi penghubung antardaerah tertinggal ke daerah maju, dari kepulauan terisolir dengan daratan. Penjabat Gubernur Aceh Ir Tarmizi A Karim MSc me-

ngatakan pembangunan transportasi masa depan adalah transportasi terintegrasi antarmoda, darat, laut, dan udara. Baik itu untuk kepentingan massal maupun kepentingan ekonomi. Terkait dengan itu, Pemerintah Aceh telah membuka jalur terpadu Banda Aceh– Sinabang, Pulau Simeulue, pada 2008, dengan izin trayek angkutan antarkabupaten dalam provinsi (AKDP). Angkutan terpadu ini memadukan dua moda transportasi, angkutan darat dari Banda Aceh-Labuhan Haji, Aceh Selatan, dan angkutan penyeberangan La-

buhan Haji-Sinabang. Prospek angkutan terpadu ini sangat baik, dengan melihat data produksi per bulan, rata-rata load faktor mencapai 86 persen. Kemudian, pengoperasian bus berbadan besar di lintas barat selatan menuju Medan, Sumut, sejak 25 April 2010. Sebelumnya, jalur ini menggunakan jenis mini bus (L-300) Pengoperasian perdana bus ini dengan titik pemberangkatanTerminal Meulaboh, melalui Terminal Blangpidie, Terminal Tapaktuan, Terminal Sidikalang,Terminal Kabanjahe dan berakhir di Medan. Selain itu, membuka ja-

Prof Dr Ir Yuwaldi Away MSc, Kepala Dinas Perhubungan, Komunikasi, Informasi dan Telekomunikasi Aceh.

Antara Transportasi, Pelayanan Dan Keselamatan Infrastruktur merupakan kunci penting proses pembangunan di suatu daerah. Begitu juga Aceh, semakin baik infrastrukturnya, maka semakin cepat pula pembangunan di Bumi Serambi Mekkah ini. Berbicara infrastruktur, terutama transportasi, Aceh tidak kalah dengan provinsi lainnya di Indonesia. Bahkan Aceh bisa dikatakan memiliki infrastruktur yang lebih baik. Secara kapasitas, infrastruktur transportasi di Aceh bisa dikatakan melebihi. Pelabuhan laut yang over kapasitas, begitu juga udara maupun transportasi darat. “Saat ini saya lihat hampir di semuanya melebih kapasitas. Sebenarnya, harus lebih banyak kepada pelayanan dan kemudian keselamatan,” kata Kepala Dinas Perhubungan, Komunikasi, Informasi dan Telekomunikasi Aceh Prof Dr Ir Yuwaldi Away MSc. Namun, infrastruktur tersebut tidak akan berarti jika tidak dibareng pelayanan yang optimal serta mengedepankan keselamatan, terutama bagi pengguna jasa perhubungan tersebut. Saat ini, yang menjadi permasalahannya adalah angkutan umum. Di mana usaha jasa transportasi tersebut belum tertata dengan baik, terutama pelayanan dan keselamatan pengguna jasa. “Dan ini paling banyak di kabupaten/kota. Kalau infrastrukturnya memadai, tetapi masalah ini masih saja terjadi. Intinya ini terjadi karena perilaku usaha angkutan,” katanya. Terkadang perilaku tersebut mengabaikan keselamatan pengguna jasa. Padahal, keselamatan ini merupakan faktor yang harus diutamakan pengelola jasa angkutan. Banyak persepsi bahwa perhubungan dikaitkan dengan pembangunan fisik, padahal tidak. Perhubungan lebih banyak mengurusi nonfisik, terutama pengawasan. Karena itu tugas paling mendesak menyelesaikan pembangunan terminal sebagai prasarana pengawasan, pengujian kendaraan bermotor serta pemasangan rambu-rambu jalan guna memastikan keselamatan pengguna jasa transportasi. “Ini tantang kita ke depan dalam menata transportasi guna memastikan keselamatan pengguna jasa moda transportasi massal. Tantangan ini cukup berat,” katanya. Diakuinya menata sektor transportasi di Aceh lebih sulit ketimbang secara nasional. Ini karena perilaku masyarakat, di mana masyarakat Aceh hidup dalam berbagai fase sejak tiga puluh tahun terakhir. “Masyarakat kita belumnya, fase konflik, fase bencana, hingga fase damai seperti ini. Dan ini harus kita pahami dalam menata sektor transportasi tersebut,” ungkap Yuwaldi Away. ***

ringan transportasi perintis Meulaboh–Singkil pada 2010. Berdasarkan data produksi, angkutan perintis ini berdampak positif terhadap lalu lintas masyarakat. Di mana terjadi peningkatan factor miat (load factor) rata-rata dari 21,33 persen pada 2010 menjadi 27,2 persen di pertengahan tahun 2011. Angkutan Penyeberangan Selain jalur darat, Pemerintah Aceh juga tidak tinggal diam membangun infrastruktur penyeberangan. Antara 2007 hingga 2011, pemerintah telah menyelesaikan tujuh pelabuhan penyeberangan. Yaitu, pelabuhan penyeberangan Uleelheue, Balohan, Labuhan Haji, Singkil, Pulau Banyak, Sinabang, dan Lamteng. Pelabuhan penyeberangan dilayani kapal motor berkapasitas 350 hingga 1.000 GRT. Dengan load faktornya berkisar 72 hingga 80 persen per tahun. “Ini mengindikasikan terjadi peningkatan pertumbuhan perekonomian di wilayah hinterland; Aceh Barat Daya dan sekitarnya serta Simeulue,” ujar Penjabat Gubernur Aceh. Penjabat Gubernur Aceh menyebut, pembangun sektor transportasi tersebut meningkatkan akumulasi kegiatan ekonomi dan pemerataan ekonomi. “Karena itu diperlukan peningkatan akses mengakomodasikan mobilitas faktor produksi dan produk antarprovinsi dengan wilayah eksternalnya, baik dalam skala regional, nasional maupun internasional,” katanya.

Untuk antarprovinsi, kata Tarmizi, Pemerintah Aceh pada 2010 telah mengembangkan kawasan terpencil, terutama di perbatasan Aceh dengan Sumatera Utara. Pengembangan ini dengan merintis angkutan pelayaran Singkil dan Pulau Nias, seperti di masa lalu, sekitar 1830. Tujuannya, menjadikan Aceh Singkil sebagai daerah strategis perdagangan antara Kepulauan Nias dengan Medan, Sumatera Utara. Dibukanya jalur ini menjadikan Singkil sebagai kota transit dengan harapan perekonomian masyarakatnya meningkat serta memberikan dampak kepada perkembangan wilayah pantai barat selatan Aceh. Dari data produksi, angkutan penyeberangan Singkil–Gunung Sitoli, Kepulauan Nias, ini menunjukkan tren positif. Beroperasi sejak September 2010 dengan rata-rata load faktor kendaraan 13,89 persen dan meningkat menjadi 30,55 persen pada April 2011. Kemudian juga membuka angkutan laut perintis dari barat selatan Aceh ke Teluk Bayur, Sumatera Barat. Angkutan laut perintis ini merupakan program strategis menggerakkan roda perdagangan masyarakat Aceh. “Beroperasinya angkutan laut perintis diharapkan akses transportasi barang dan penumpang dari daerah tertinggal ke daerah lainnya yang telah berkembang akan semakin baik dan lancar,” paparnya. Selama ini, menurutTarmizi, pertumbuhan ekono-

mi masyarakat pantai barat selatan dan kepulauan di Aceh tidak secepat perkembangan di wilayah pantai utara–selatan. Kendala tersebut disebabkan terbatasnya sarana prasarana transportasi barang dan penumpang. Terbatasnya akses transportasi, berbagai komoditas dan produk dihasilkan tidak dapat dimobilisasi ke daerah pemasaran. “Wilayah barat selatan dan kepulauan di Aceh memiliki infrastruktur pelabuhan yang dapat disinggahi kapal dengan kapasitas relatif besar. Dan ini harus dimanfaatkan untuk kemajuan ekonomi masyarakat,” ujarnya. Pengembangan transportasi laut tersebut berawal sejak 2006 ketika Pemerintah Aceh berhasil meyakinkan pemerintah pusat untuk dapat menyediakan layanan angkutan laut perintis bagi wilayah pantai barat selatan dan kepulauan. Layanan angkutan laut perintis tersebut menggunakan kapal jenis coaster 750 GT dengan jumlah 16-18 voyage per tahun yang sumber dari dana APBN. Di awal pengembangan angkutan laut perintis tersebut terjadi kendala yang menghambat perdagangan masyarakat. Ketiadaan kapal kontainer menyinggahi pelabuhan secara reguler menyebabkan komoditas asal Aceh diekspor melalui Pelabuhan Belawan, Sumut. Diperkirakan sekitar 40 persen volume ekspor di Pelabuhan Belawan adalah merupakan komoditas asal Aceh. Ini juga menyebabkan biaya transportasi ko-

Ir Tarmizi A Karim MSc, Penjabat Gubernur Aceh moditas asal Aceh meningkat, sehingga tidak kompetitif di pasaran, katanya. Enggan kapal kontainer menyinggahi pelabuhan di Aceh karena dianggap secara bisnis tidak menguntungkan. Pengusaha angkutan beranggapan kurangnya volume angkut dari Aceh tidak cukup membiayai operasional kapal. Untuk mengatasi hal tersebut Pemerintah Aceh melalui APBA 2010 menyubsidi kapal kontainer untuk pelayaran Pelabuhan Tanjung Priok, Jakarta, dengan Pelabuhan Malahayati dan Krueng Geukuh di Aceh dan

Pelabuhan Lumut di Malaysia. Pemberian subsidi guna merangsang perusahaan pelayaran membuka trayek ke pelabuhan di Aceh. Selain itu, hadirnya kapal kontainer secara reguler memberikan kesempatan kepada pengusaha Aceh memasarkan produknya dengan harga lebih kompetitif. “Dengan demikian akan meningkatkan aktivitas perdagangan dalam dan luar negeri, sehingga mampu menjadi lokomotif dalam meningkatkan perekonomian masyarakat,” kata Tarmizi A Karim. ***

Membuka Keterisolasian Dengan Transportasi Udara RENCANA strategis SKPA Dishubkomintel Aceh di sektor transportasi udara pada 2007 hingga 2012 dititikberatkan pada pengembangan bandar udara pengumpul. Bandar udara pengumpul tersebut yaitu Bandara Sultan Iskandar Muda, Blang Bintang, Aceh Besar, bandar udara Cut Nyak Dhien, Meulaboh, dan bandar udara Malikussaleh, Lhokseumawe. “Bandar udara Cut Nyak Dhien dirancang untuk wilayah pesisir barat serta Malikussaleh untuk wilayah pesisir utara dengan tetap membenahi kelemahan operasional dari bandar udara pengumpan,” kata Kepala Dishubkomintel Aceh Prof Dr Ir Yuwaldi Away MSc. Pengembangan tersebut untuk menyelaraskan dengan kebijakan sistem transportasi nasional (Sistranas) dan kesesuaian dengan Rencana Induk Nasional Bandar Udara pada KM Perhubungan Nomor 11Tahun 2010 tentang tatanan kebandarudaraan nasional. Kebijakan pengembangan tersebut didukung operasional sejumlah bandar udara di Provinsi Aceh yang dua di antaranya masih dalam pembangunan, yakni bandar udara Syeh Hamzah Fanshuri-Singkil dan ban-

dar udara Blangkejeren. (Lihat tabel) Tidak dapat dipungkiri, keberadaan bandar udara tersebut mampu mengatasi masalah keterisolasian wilayah. Apalagi Pemerintah Aceh telah membuka angkutan udara perintis. “Angkutan perintis ini mendapat subsidi dari pemerintah pusat. Angkutan ini mampu mengatasi keseimbangan percepatan pembangunan daerah dan diprioritaskan dalam persiapan penanggulangan bencana,” kata Prof Yuwaldi. Adapun bandara menjadi rute penerbangan perintis bersubsidi kurun waktu 2007 hingga 2011 di Aceh tersebut, yakni Bandara Lasikin, Sinabang, Bandara Cut Nyak Dien, Meulaboh. Kemudian, Bandara Maimun Saleh, Sabang, Bandara Alur Buluh, Kutacane, Bandara Kuala Batu, Blangpidie, Bandara Teuku Cut Ali, Tapaktuan, Bandara Syekh Hamzah Fansuri, Singkil, dan Bandara Rembele, Takengon. ”Rute penerbangan perintis tersebut secara reguler dievaluasi setiap akhir tahun anggaran guna menjamin kelayakan pemberian subsidi angkutan udara perintis,” ujarnya. Penerbangan perintis ini guna memberikan dukungan terhadap angkutan udara dengan pesawat berbadan besar di Bandara Sultan Iskandar Muda diprioritas-

Bandara di Aceh Tahun 2011 No

Bandar Udara

Status Pengelolaan


1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11.

Sultan Iskandar Muda Cut Nyak Dien Teuku Cut Ali Lasikin Rembele Maimun Saleh Alas Lauser Kuala Batu Syekh Hamzah Fansuri Malikussaleh Point ‘A’

PT. Angkasa Pura II UPT Pusat UPT Pusat UPT Pusat UPT Pusat UPT Pusat dan TNI AU UPTD UPTD UPTD PT. ARUN Exxon Mobil Oil Inc

Internasional Regional, Haji Domestik Domestik Domestik Domestik Internasional Regional Domestik Domestik Domestik

Sumber: Dishubkomintel Aceh kan sebagai bandara pengumpul. Untuk Bandara Sultan Is-kandar Muda, kata Prof Yuwaldi, berbagai investasi dilakukan, antara lain perpanjangan landasan pacu atau runway dari 2.500 meter menjadi 3.000 meter. Perpanjangan landasan ini untuk menambah kapasitas pelayanan bandara, sehingga bisa didarati pesawat berbadan besar seperti B747 seri 400 atau setara. Indonesia sebagai anggota International Civil Aviation Organization (ICAO) wajib menyediakan persyaratan minimum pelayanan angkutan dan keselamatan penerbangan. Kewajiban tersebut seperti meningkatkan kapasitas Bandara Sultan Iskandar Muda menjadi bandara internasional yang dikelola PT Angkasa Pura II. Sebagai bandara inter-

Publikasi ini hasil kerjasama Dishubkomintel Aceh.

nasional telah menjadikan Bandara Sultan Iskandar Muda sebagai gerbang rute penerbangan dalam dan luar negeri di wilayah paling ujung barat Pulau Sumatra tersebut. Saat ini, penerbangan internasional Banda Aceh– Kuala Lumpur dilayani Maskapai Air Asia yang mulai beroperasi November 2007 dan Banda Aceh–Penang, oleh Maskapai Firefly sejak Oktober 2008. “Seiring pertumbuhan perdagangan internasional di masa mendatang, diharapkan akan terbuka rute penerbangan internasional lainnya dari Bandara Sultan Iskandar Muda ke Asia Pasifik,” katanya. Investasi Bandara Sultan Iskandar Muda juga untuk mendukung penerbangan haji embarkasi dan debarkasi Banda Aceh yang selama ini dilayani Airbus A330.

Pesawat ini hanya mampu membawa 325 penumpang. “Pada umumnya, angkutan haji dilayani pesawat berbadan besar. Hal ini diharapkan akan mampu diatasi dengan tersedianya perpanjangan landasan,” katanya. Selain itu, PT Garuda Indonesia, operator penerbangan haji, telah menyetujui Bandara Sultan Iskandar Muda sebagai bandar udara transit pengisian bahan bakar pesawat atau refuelling angkutan haji pada 2010. “Sultan Iskandar Muda sebagai transit refuelling haji menambah pendapatan bagi daerah. Pesawat dari Embarkasi Banjarmasin melakukan refuelling di Bandara Sultan Iskandar Muda dalam melayani penerbangan haji pada 2010 silam,” kata Prof Yuwaldi. ***



WASPADA Senin 18 Juni 2012

Lhokseumawe Peringkat I, Langsa Peringkat II Nilai UAS-BN Se-Aceh

29 Siswa MIN Paya Bujok Rangking Tertinggi UN 2012 LANGSA (Waspada): Para siswa MIN Paya Bujok, Kecamatan Langsa Baro kembali mengukir prestasi dalam memperoleh hasil UN 2012. Untuk tingkat Provinsi Aceh nilai kelulusannya menempati rangking tiga dan untuk tingkat Kota Langsa mendapat posisi rangking satu. Kepala MIN Paya Bujok Langsa, Muzakkir, SPd.I kepada Waspada, Sabtu (16/6) mengatakan, dominasi nilai tertinggi bagi seluruh siswa MI yang ada di Kota Langsa juga berhasil disabet anak didiknya. BerdasarkanpengumumanyangdiperolehpihaknyadariDinas Pendikan Kota Langsa, kata dia, seluruh siswa MIN Bujok Langsa lulus 100 persen. Bahkan nomor urut 1 kelulusan sampai nomor urut 29 semua di tempati para siswa MIN Paya Bujok, baru pada nomor urut 30 jatuh kepada siswa dari sekolah yang lain. (b20)

Matang Pineung Gelar Dakwah Akbar IDI CUT (Waspada): Dalam rangka memperingati Nisfu Sya’ban dan menyambut bulan suci Ramadhan 1433 hijriyah/ 2012 masehi, masyarakat Gampong Matang Pinueng, Kecamatan Darul Aman, Kabupaten Aceh Timur rencananya akan menggelar dakwah akbar sekaligus penyantunan anak yatimpiatu 1 Juli 2012. Kegiatan sosial dalam rangka memperkuat ukhwah islamiyah akan di pusatkan di Meunasah Gampong Matang Pineung Idi Cut. “Anak yatim piatu yang sudah terdata sekitar 30 orang. Acara yang sebelumnya rutin dilaksanakan di tingkat kecamatan kini kita akan melaksanakannya di tingkat desa,” kata Ketua Panpel Nazaruddin kepada Waspada, Minggu (17/6). Dia menyebutkan, penyantunan dan kenduri akan dilaksanakan Minggu (1/7) disertai Tausiah dan Penyantunan Anak Yatim Piatu. “Sementara dakwah akbar akan digelar malam hari dengan pendakwahnya yakni Tgk. Muliadi dari Lhokseumawe,” sebut Nazaruddin seraya meminta seluruh warga Matang Pineung yang berada di luar Aceh Timur agar ikut memeriahkan penyantunan itu. Nazaruddin mengakui, untuk kegiatan sosial yang pertama digelarnya akan menghabiskan dana mencapai Rp20.000.000. “Dana yang sudah kita musyawarahkan dengan masyarakat bersumber dari swadaya masyarakat. “Tapi dana yang sudah terkumpul masih jauh dari target, jadi dalam hal ini Panpel masih menunggu masukan dana dari berbagai donatur lain yang sifatnya tidak mengikat,” tandas Nazaruddin. (b24)

Santri Komplek BTN Buket Teukueh Peringati Isra’ Mikraj BIREUEN (Waspada): Para santri Komplek BTN Buket Teukeuh, Kecamatan Kota Juang, Bireuen, Sabtu (16/6) malam, menggelar peringati Isra’ Mikraj Nabi Muhammad SAW 1433 Hijriah, di mushala setempat. Kegiatan yang diikuti para puluhan santri dan orang tuanya menghadirkan dai muda kondang Tgk Mustafa dari Sawang Aceh Utara. “Acara peringatan Isra’ Mikraj dilaksanakan atas inisiatif anak-anak yang tergabung dalam kelompok pengajian bersama di mushala komplek ini,” kata Kepala Dusun BTN Buket Teukueh, H Azhari, SP kepada Waspada usai kegiatan. Acara tersebut, kata Azhar, diselenggarakan, selain untuk memperingati hari besar Islam, juga untuk menampilkan ekspresi kreatifitas anak yang seluruh rangkaian kegiatan mulai dari membawa acara, membaca ayat suci Alquran, saritilawah dan pemandu shalawat. “Menurut anak-anak peringatan Isra’ Miraj dilaksanakan untuk mengingat sejarah Nabi khususnya tentang shalat lima waktu,” katanya. Tgk Mustafa dalam ceramahnya, menjelaskan sejarah Nabi menerima shalat lima waktu juga menyampaikan berbagai pesan moral sebagaimana dicontohkan Rasulullah. Pada saat itu para santri mengikuti dan menyimaknya dengan baik, sesekali mereka tertawa lepas ketika mendengar ceramah dengan bahasa agak sedikit kocak. “Rasulullah menerima perintah shalat dari Allah setelah naik buraq. Peristiwa bersejarah itu, patut selalu diingat untuk memotivasi umat melaksanakan shalat fardhu dan momen peringatan Isra’ Miraj ini kita harapkan dapat mencerahkan hati dan fikiran. Apalagi sekarang ini sudah dekat dengan Ramadhan bulan penuh berkah serta pengampunan,” katanya. (cb02)

Rumah Janda Tiga Anak Terbakar LAPANG (Waspada): Satu rumah panggung berkontruksi kayu milik Nursapiah, 45, janda tiga anak di Desa Geulanggang Baro Kec. Lapang, Aceh Utara, musnah terbakar, Sabtu (16/ 6) sore sekitar pukul 15:00. Tak ada korban jiwa. Namun hampir seluruh isi rumah, termasuk perabot dan pakaian hangus dilalap api. Kerugian ditaksir puluhan juta rupiah. Sementara penyebab kebakaran diduga akibat hubungan pendek arus listrik. “Saat kejadian, rumah sedang kosong. Saya dan anak-anak beradadirumahtetangga.Kamitahurumahterbakarsetelahmelihat kepulan asap di udara dan langsung berteriak minta tolong,“kata Nursapiah menjawab wartawan, Minggu (17/6). Sejumlah warga, sambung Nursapiah sempat berusaha memadamkan api dengan peralatan seadanya. Tapi, kobaran api baru padam total setelah dua mobil pemadam kebakaran didatangkan ke lokasi. “Ketika api padam, seisi rumah sudah hangus. Yang tersisa cuma baju di badan,” imbuh Nursapiah. Camat Lapang, Drs Maksum, yang dihubungi terpisah, mengatakan, Nursapiah kini terpaksa mengungsi ke rumah kerabat. Muspika sudah menyalurkan bantuan masa panik dan membuat laporan ke Dinas Sosial Aceh Utara, untuk proses pemberian bantuan lebih lanjut.(b19)


SISWA SD Negeri 3 Kota Langsa ketika melihat papan pengumuman hasil UAS-BN TA 2011/2012 di sekolahnya, Sabtu (16/6).

Tgk Darwis Djeunib

Tangkap Pengibar Bendera GAM BIREUEN (Waspada): Ketua KPA/PA Kabupaten Bireuen, Tgk Darwis Djeunieb, memerintahkan kepada seluruh jajarannya maupun anggotanya untuk menangkap pihak-pihak yang sengaja mengibarkan bendera Gerakan Aceh Merdeka (GAM) pada saat prosesi pelantikan Gubernur Aceh 25 Juni mendatang sebagaimana isu yang mencuat selama ini. “Tangkap dan bila perlu pukuli hingga babak belur pelaku pengibaran bendera, lalu serahkan ke pihak kepolisian untuk ditindak dan dihukum sesuai ketentuan. Ini perintah yang sanggup saya pertanggungjawabkan,” tegasnya dalam pertemuan tim pemenangan H Ruslan HM Daud-Ir Mukhtar Abda, MSi di Hotel Bireuen Jaya, Sabtu (16/6) sore yang disambut aplaus massa pendukung PA saat itu. Menurut mantan Panglima Prang Wilayah II Batee Iliek itu, pelaku atau pengibar bendera

bulan bintang sebagai simbol perjuangan rakyat Aceh sebelum adanya qanun wali nanggroe berlaku di Aceh, maka pengibaran bendera tersebut masih dianggap ilegal. Makanya, dia memerintah seluruh jajaran KPA/PA untuk menciduk pelakunya, karena itu adalah provokator yang sengaja memancing di air keruh dan itu dianggap musuh bersama rakyat Aceh, karena hal itu bukan perintah dari pihak jajaran KPA/PA Pusat maupun di daerah. “Perang sudah berakhir di Aceh, kini seluruh elemen KPA/ PA harus menyatu bersama rakyat untuk melanjutkan perjuangan membangun masa depan. Khususnya usaha memperbaiki kehidupan melalui jalur politik di bawah payung PA,” tegasnya lagi. Dalam kesempatan itu, Darwis juga mengingatkan kepada para mantan kombatan untuk selalu mengikuti jalur perjuangan. “Siapapun yang mengaku eks combatan dan pejuang GAM, akan selalu mengikuti jalur garis perjuangan dengan bersatu dalam PA sebagai parpol bentukan GAM pasca MoU Helsinki. Bukan terus mengumpat dan membuat pengakuan yang me-

nyesatkan masyarakat,” himbaunya. Para kandidat independen dalam kampanye, tambahnya, juga tidak menggunakan simbol perjuangan GAM. Seperti yang dilakukan pasangan lain, karena itu selain tidak lah relevan lagi dan termasuk pembohongan publik. “Saya minta kepada anggota PA/KPA untuk memotong foto Wali yang terpasang di baliho Nurdin AR. Sedangkan balihonya biarkan saja dan jangan ada aksi perusakan, karena itu hak setiap kandidat menggunakan media sosialisasi untuk memperkenalkan diri,” ujarnya. Tambahnya, lagi, perjuangan PA murni untuk kepentingan rakyat, maka bila pasangan calon bupati Bireuen kalah dalam pilkada mendatang dirinya siap mengundurkan diri dari jabatan Ketua PA/KPA. “Semua yang kita lakukan bukan untuk kepentingan dan ambisi pribadi saya, bila tidak dipercaya lagi dalam pilkada ini, mengundurkan diri saya kira lebih terhormat karena hanya dengan dukungan rakyat, PA mampu bekerja maksimal seperti selama ini,” ungkapnya. (cb02)

Debat Kandidat Cabup/Cawabup Bireuen Diikuti Tujuh Pasangan BIREUEN ( Waspada) : Tahapan debat kandidat Pilkada Bireuen diselengarakan KIP di Aula Hotel Bireuen Jaya minggu (17/6) pagi diikuti tujuh pasangan Cabup/Cawabup berlangsung tertib, lancar dan aman. Sementara satu pasangan nomor urut 5, H Ruslan M DaudMukhtar Abda (Harus Muda) berhalangan hadir Hadir dalam acara debat kandidat, Kapolres Bireuen AKBP Yuri Karsono SIK, Dandim-0111/Bireuen Letkol Inf Muhammad Arfah, Asisten I Setdakanb Drs Murdani, Ketua KIP Alibasyah Puteh SP, Ketua Panwaslih Mursal Ridha,SE, dan ratusan timses dari ketujuh pasangan kandidat yang memadati ruang Aula hotel Bireuen Jaya. Penyelengaraan debat kandidat Cabup/Cawabup Bireuen mendapat pengawalan super ketat aparat kepolisian. Di seputar hotel Bireuen Jaya dan se-

panjang jalan kuburan terlihat aparat Polres dan satuan Lantas mengatur kelancaran lalu lintas. Sementara di pintu masuk Hotel Bireuen aparat Polres melakukan pemeriksaan secara santun menggunakan alat detektor terhadap para tamu undangan yang masuk ke tempat acara debat kandidat Ketujuh pasangan Cabup/ Cawabup yang mengikuti debat kanbdidat masintg-masing nomor urut 1, Azhari Sos MM – Drs IskandarYusuf MM, nomor urut 2, Ir Saifuddin Muhammad – Dra Hj Rosnani Bahruny A pt, nomor urut 3 Drs H Hamdani Raden – Murdani Yusuf,SE, nomor urut 4, H Husaini Ilyas – Ir Razuardi Ibrahim, MT, nomor urut 6 Drs Nurdin Abdul Rahman – Zakwan SP.MSi, nomor urut 7, H Munawar Yusuf – Drs Hasan Basri A Djalil, MSi, dan nomor urut 8, DR Amiruddin Idris, SE. MSi – Drs Muanmmad Arif.

Acara debat kandidat usai dibuka Ketua KIP Bireuen Alibasyah Puteh SP, langsung masuk acara debat kandidat tiga pakar masing-masing Prof DR Nazaruddin Kadis Syari’at Islam Provnsi Aceh, Mawardi Ismail,SH MH dan Drs Syamsuddin Aziz M Pd dosen Unsyiah. Ketiga pakar mengajukan pertanyaan sercara bergilir kepada ketujuh pasangan kandidat untuk menyampaikan program kerjanya jika terpilih menjadi Bupati/Wakil Bupati Bireuen lima tahun ke depan diberi limit waktu tiga menit. Ketua KIP Bireuen Alibasyah Puteh, SP dan Komisioner KIP Muchtaruddin,SH.MH. menjawab pertanyaan Waspada tentang halangan ketidak hadiran pasangan nomr urut 5, dalam debat kandidat mengatakan belum diketahui lantaran tidak ada pemberitahuan dari yang bersangkutan, ujar Muchtaruddin. (b12)

Enam Ratusan Santri Belajar Menulis Novel Bersama Tere-Liye Waspada/Musyawir

NURSAPIAH diantara puing sisa kebakaran rumahnya. Foto dijepret, Minggu (17/6).

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


LHOKSEUMAWE (Waspada): Tidak kurang dari 600 siswa dan santri yang berasal dari dayah dan sekolah, belajar bersama Tere-Liye, penulis novel Hafalan Shalat Delisa, di aula Sekolah Sukma, Lhokseumawe, Minggu (17/6). Sejumlah santri itu berasal dari Dayah Modern Arun, Dayah Terpadu Ulumuddin, dan siswa-siswi Sekolah Sukma. Pada pukul 07:00, para peserta sudah mendatangi aula, sekalipun acara baru dimulai pukul 09:00-14:00. Begitulah antusiasnya sejumlah pelajar untuk mempelajari penulisan novel bestseller asal Sumatra Selatan yang bernama asli Darwis ini. Penulis ini dilahirkan 21 Mei 1979 dan berasal dari keluarga petani telah menghasilkan 14 novel, di antaranya Hafalan Shalat Delisa (telah dilayarlebarkan), Daun yang Jatuh tak Pernah Membenci Angin, Pukat, Moga Bunda Disayang Allah, dan Bidadari-bidadari Surga.

Belajar menulis langsung bersama Tere-Liye itu dikemas dalam seminar dan workshop menulis nasional I, dengan tema “Yang Muda Bekarya”. Dia memaparkan cara-cara menulis yang baik secara praktis, serta memotivasi dengan peran aktif langsung para peserta untuk membuat tugas dan memeriksanya. Cara ini dianggap lebih efektif daripada mengajarkan teori-teori yang kaku dan rumit. Melihat hasil tulisan peserta secara langsung dapat segera menilai bakat dan kemampuan mereka.“Dari dulu sampai sekarang itu novel sama saja, yang membedakannya hanyalah sudut pandang. Penulis yang baik adalah yang punya sudut pandang spesial,” tegasnya. Sekalipun pelatihan ini cukup serius, tetapi diselingi dengan humor manakala membaca hasil tulisan para peserta yang memang lucu, menyimpang, dan kadang keliru. Na-

mun, banyak juga yang segera paham, terutama mereka yang telah melatih diri menulis jauh hari. Sementara itu Wakil Direktur Dayah Terpadu Ulumuddin, Tgk Kafrawi, SPd dalam sambutannya mengatakan, acara pelatihan ini sangat baik untuk belajar menulis yang benar dan betul. “Masalahnya, menulis yang baik itu belum tentu betul, dan yang betul itu belum tentu baik,” tegasnya. Tujuan acara ini adalah untuk melatih siswa dan santri yang berbakat untuk menulis secara berkualitas. Dan sebuah karya yang baik itu, lanjutnya, harus memiliki pesan-pesan dakwah. Dan uniknya, acara ini baru pertama kali diselenggara-kan oleh pihak dayah, yang be-rarti pendidikan agama di Aceh sudah membuka diri untuk lebih maju lagi menerima perkembangan ilmu pengetahuan.(b14/b13)

LANGSA (Waspada): Hasil Nilai Ujian Akhir Sekolah Berstandar Nasional (UAS-BN) SD/ MI Tahun Ajaran 2011/2012 Kota Langsa berhasil meraih rangking kedua setelah Kota Lhokseumawe disusul dengan Kabupaten Aceh Tengah, Kabupaten Bener Meriah dan Pidie Jaya di peringkat kelima. Hal itu diutarakan Kepala Dinas Pendidikan Kota Langsa Drs Mustafa, MPd didampingi Kabid Pendidikan Dasar & Menengah Marzuki Thaib dan Kasi Kurikulum SD Drs Muzzakir kepada wartawan, Sabtu sore (16/6).“Kota Langsa berhasil memperoleh total nilai 23,09 dengan jumlah nilai rata-rata per bidang studi B. Indonesia 7,59, Matematika 7,72, dan Ilmu Pengetahuan Alam (IPA) 7,78,” katanya. Sementara 3 siswa dari SD Negeri 5 Kota Langsa berhasil meraih nilai tertinggi UAS-BN SD/MI TA 2011/2012 tingkat Provinsi Aceh, ranking I diraih Mujahid Afif AE dengan total nilai 28,60 yakni B. Indonesia 9.10, matematika 9,80, IPA 9.70, disusul Muhammad Rizky Naufal berada diposisi kedua berasal dari SD Negeri 5 Kota Langsa dengan total nilai 28,40 yakni B. Indonesia 8.90, Matematika 9,80 dan IPA 9,70 dan Miftahul Jannah, dengan total nilai 28.30 yakni B. Indonesia 8.80, Matematika 9,80 dan IPA 9,70. Sedangkan untuk MI Negeri, tiga siswa mendapat ranking tertinggi untuk tingkat Provinsi Aceh berasal dari MIN Paya Bujok atas nama Akli Maulana dengan total nilai 27,90 yakni B. Indonesia 9,10, Matematika 9,70 dan IPA 9.10. Sementara Dista Ismaridha berada di posisi ketiga dengan total nilai 27.80 yakni B. Indonesia 8.50, Matematika 9,80 dan IPA 9.50 dan Aidil Budi Maulana berada diposisi kelima dengan total nilai 27.70 yakni B. Indonesia 9.00, Matematika 9.50 dan IPA 9.20. “Jika dinilai berdasarkan jumlah nilai UASBN untuk tingkat Provinsi Aceh dipegang SD Negeri 5 Langsa dengan total nilai 27.46 yakni B. Indonesia 8,56, Matematika 9,54 dan IPA 9.36. Sementara untuk MI Negeri/Swasta MIN Paya Bu-jok berada diperingkat ketiga dengan total nilai 24.39 yakni B. Indonesia 7,83, Matematika 8,40 dan IPA 8.16, sedangkan diperingkat kelima dipegang MIS Paya Bujok Tunong dengan total nilai 24,19 yakni B. Indonesia 8.30, Matematika 7,95 dan IPA 7,94,” sebut Mustafa. Dijelaskan Mustafa lagi, sedangkan untuk 10 sekolah dinilai berdasarkan jumlah nilai UASBN SD/MI tingkat Kota Langsa, SD Negeri 5 berhasil menduduki ranking I, disusul dengan SD Negeri 1 Langsa, SD Negeri 12 Langsa, SD Negeri Bukit Ara, SD Negeri 14 Langsa, SD Negeri 1 Paya Bujok Tunong, SD Negeri 11 Langsa, SD Negeri 3 Langsa, SD Negeri Bukit Rata dan

SD Negeri 2 Karang Anyar. Sementara untuk MIN/MIS, rangking I diraih MIN Paya Bujok, disusul MIS Paya Bujok Tunong, MIS Al Ashriyah, MIS Gampong Meutia, MIS Geudubang Aceh, MIN Sungai Pauh, MIN Langsa dan MIN Sukarejo. “Sedangkan untuk jumlah nilai tertinggi hampir keseluruhan dipegang SD Negeri 5 Kota Langsa dan SD Negeri 14 Langsa ada beberapa, begitu juga dengan MI/MIS dipegang MIN Paya Bujok dan MIS Al Ashriyah,” pungkas Mustafa. PSB Dibuka Mustafa juga menambahkan, dengan berakhirnya pengumuman UAN SMA/SMA-LB/ MA, kemudian SMP/SMP-LB, MTs dan terakhir untuk tingkat UAS-BN SD/MI, serta diakhir dengan pembagian raport TA 2011/2012, secara umum penerimaan siswa baru (PSB) TA 2012/ 2013 Kota Langsa telah dibuka sejak Senin 18 Juni 2012. Khusus penerimaan siswa SD di 62 sekolah yang ada di Kota Langsa, demikian Mustafa lebih lanjut, faktor usia hendaknya menjadi pertimbangan. Umur 8 tahun menjadi perioritas baru kemudian 7 dan 6 tahun. Dalam penerimaan tersebut, masalah testing masuk tidak diwajibkankarenamasalahseleksiinibukansyarat, baik tingkat SD, SMP maupun SMA dan SMK. Dalam kesempatan itu, Kepala Dinas Pendidikan Kota Langsa Mustafa juga menerangkan kepasitas daya tampung siswa baru tahun 2012/ 2013 pada 10 SMA dan SMK Negeri di Kota Langsa berjumlah 2.354 siswa, atau 1.144 di lima SMA dan 1.210 di lima SMK Negeri. Dijelaskan, tiga Sekolah Dasar masing-masing SD Negeri 1, 5 dan 11 yang merupakan Sekolah Standar Nasionbal (SSN), diberikan kewenangan untuk mengumumkan lebih cepat tentang siswa-siswa yang diterima. Dengan demikian, siswa yang tidak tertampung dapat mendaftar ke SD lain. Rincian daya tampung di SMA Negeri-1 Langsa yang memiliki 14 rombongan belajar (lokal) berjumlah 448 siswa, SMAN 2 (7 lokal) berjumlah 252 siswa, SMAN 3 (4 lokal) 144 siswa, SMAN 4 (6 lokal) 192 siswa dan SMAN 5 (3 lokal) berjumlah 108 siswa. Sedangkan SMK Negeri 1 (8 lokal) 288 siswa, SMK 2 (16 lokal) 448 siswa, SMK 3 (6 lokal) 150 siswa, SMK 4 (5 lokal) 144 siswa dan SMKN 5 (6 lokal) berjumlah 180 siswa. Mustafa kembali menegaskan bahwa jumlah siswa baru yang diterima untuk setiap rombongan belajar (lokal) tingkat SD berkisar 28 sampai 36 orang. Demikian pula di tingkat SMP. Sedangkan SMA 32 sampai 36 siswa perlokal dan SMK 28 sampai 32 siswa. (m43/b21)

PMI Kota Langsa Dukung Aksi Satu Dekade Keselamatan Jalan Raya LANGSA (Waspada): Guna mendukung aksi satu dekade untuk keselamatan jalan raya 20112020 yang diinisiasi WHO dan didukung Federasi Internasional Palang Merah dan Bulan Sabit Merah (IFRC), PMI Langsa akan menggelar kampanye penyadaran masyarakat dalam tata tertib lalu lintas, Senin (18/6) di sepanjang Jalan Ahmad Yani, Kota Langsa. Menurut Ketua PMI Kota Langsa T Iskandar Faisal, rangkaian kegiatan kampanye aksi keselamatan jalan raya telah dimulai Jumat (15/6) dengan kegiatan Talkshow di Radio Global FM dengan narasumber dari Satlantas Polres Kota Langsa diwakili Armen Siregar, Kepala Urusan Pembinaan Operasional dan Ahmad Ilham, SH, AAAIK selaku Kepala Cabang Jasa Raharja Kota Langsa serta dari perwakilan PMI Zatul Fadhli, Kepala Markas PMI Kota Langsa. “Aksi nantinya akan dibuka secara resmi PjWalikota Langsa Drs Bustami Usman, SH.MSi dan diikuti dengan sosialisasi tata tertib lalu lintas kepada relawan dan PMR Kota Langsa dengan narasumber dari Satlantas Langsa yang dikemas menarik dalam konsep mini workshop selama satu jam di tribun lapangan merdeka Kota Langsa,” katanya. Kegiatan dilanjutkan dengan penandatanganan sepuluh komitmen PMI dalam aksi keselamatan jalan raya oleh seluruh undangan yang terlibat dan penyerahan penghargaan kepada Polres Langsa dan PT Jasa Raharja atas kerjasama keterlibatan dalam mendukung aksi satu dekade untuk keselamatan jalan raya ini. Penyerahan ini diberikan oleh Pj Walikota dan disaksikan oleh undangan dan segenap

Pengurus Kota Langsa dan relawan. Sebanyak 150 orang peserta kampanye akan dilepas Walikota Langsa dan pengurus untuk melakukan aksi teaterikal di sepuluh titik di sepanjang Jalan AhmadYani yaitu dimu-lai dari persimpangan Kodim 04 Kota Langsa/Stadion sampai dengan Persimpangan Tugu Lantas Kota Langsa. Relawan juga akan mem-bagikan brosur dan stiker di Persimpangan Lampu Lalu lintas di depan Kantor Pos dan Rumah Sakit Umum Daerah Langsa. 10 Komitmen bersama dalam Aksi Keselamatan Jalan Raya, kata Iskandar yaitu, menggunakan safety belt/ sabuk pengaman, aelalu memakai helm, mengendarai dengan kecepatan dan jarak aman, tidak berkendaraan dalam pengaruh narkoba atau alkohol, tidak menggunakan HP pada saat berkendaraan, terlihat sebagai pengendara sepeda atau pejalan kaki, tahu dan patuh pada rambu lalu lintas, selalu merawat kendaraan saya dalam keadaan baik, memiliki izin dan terlatih untuk berkendaraan, tahu apa yang harus dilakukan pada saat terjadi kecelakaan. “Kegiatan ini akan menjadi awal bagi relawan Langsa untuk merangkai program kegiatan kemanusiaan yang melibatkan pihak eksternal seperti polisi dan Jasa Raharja,” pungkasnya. Momen ini juga dilaksanakan untuk memperingati Hari Donor Darah Sedunia yang jatuh pada tanggal 14 Juni, jadi bagi masyarakat yang ingin donor darah dipersilahkan untuk hadir pukul 08:00 sampai dengan pukul 13:00 di Tribun Lapangan Merdeka Kota Langsa, demikian Iskandar Faisal.(m43)

WH Lhokseumawe Ringkus 19 Remaja LHOKSEUMAWE (Waspada): Satpol PP dan WH Kota Lhokseumawe saat melakukan razia rutin selama dua malam menjelang Ramadhan berhasil meringkus 19 remaja nakal di tempat gelap. Ketika merazia malam minggu, WH menangkap pasangan pincang di kafe pinggir Sungai Cunda, Mon Geudong, Lhokseumawe, Sabtu (16/6) malam. Razia dilakukan Satuan Polisi Pamong Praja dan Wilayatul Hisbah (Satpol PPWH) jelang memasuki bulan suci Ramadhan 1433 Hijriah Waspada/Mustafa Kamal sekitar 20 Juli mendatang. Dalam razia dua malam itu KASI Pembinaan WH Karimuddin sedang membina para remaja menangkap 19 remaja, ma- pelanggar syariat. Mereka terjaring razia di waduk Puosng lam pertama menjaring 12 Lhokseumawe saat duduk di tempat gelap dan terpisah. Foto remaja dan malam kedua direkam, Sabtu (16/6) malam. karena akan memasuki bulan suci Ramadhan tujuh remaja, satu remaja laki-laki kabur. Kepala Satpol PP Drs Azwar di kantornya sebulan lagi. Razia itu akan rutin dikakukan mengatakan, malam pertama kebanyakan ke depan. Mengingat di Lhokseumawe pelangberstatus mahasiswa dan siswa umumnya dari gar Qanun nomor 14 tahun 2003 tentang meAceh Utara seperti inisial KR, 22, mahasiswa sum semakin meningkat. Kendatipun malam asalTanah Pasir, SF, 24, mahasiswa asalTanah Luas, razia itu tidak ditemukan pasangan yang melaZH, 20, mahasiswi asal RawaTungkop, RK, 18, siswi kukan hubungan layaknya suami istri, tapi mereka SMAasalGeudong,RN,19,siswiSMAasalGeudong umumnya sudah melakukan hal-hal tidak wajar sesama lain jenis di tempat terpisah dan gelap. dan FT, 19 siswi asal Geudong. Bahkan kata Azwar, di HP wanita peremSelanjutnya MY, 20, eks siswi asal Geudong dan DY, 21, siswi asal Blang Jruen. Sedangkan puan ditemukan sejumlah film biru (pornodari Lhokseumawe seperti inisial AL, 16, siswi red). Kemudian HP itu disita dan hapus film asal Kandang, SP, 25, mahasiswa asal Kampung dan dikembalikan kepada orang tuanya masingJawa dan AB, 23, pengangguran asal Blang Ma- masing. Begitu juga, banyak perempuan berngat. Kemudian Bireuen hanya KS, 22, maha- keliaran tidak berpakain islami di siang atau malam hari, ini juga menjadi sasaran razia. siswi asal Jangka, Bireuen. Razia yang dimulai pukul 10:00-12:00, petuMalam kedua atau malam minggu diamankan AH, 55, pengangguran asal Aceh Jaya, IQ, gas merazia ke tempat mencurigai seperti 17, siswa asal Cunda Lhokseumawe, BS, 19, siswa waduk keliling, kafe remang-remang jalan staasal Lhoksukon, Aceh Utara. Sedangkan perem- dion dan cafe dekat eks Cunda Plaza, Lapangan puan semua asal Lhokseumawe seperti FT, 37, Hiraq dan Taman Riyadhah. Setelah ditangkap, asal Hagu, AY, 15, asal Cunda, YL, 18 asal Hagu mereka dibawa ke Kantor Satpol PP-WH, kemudian dibina dan diserahkan kepada keluarga Teungoh dan JN, 19, asal Keude Aceh. Intensnya razia dilakukan, menurut Azwar, serta aparat desa. (cmk)


WASPADA Senin 18 Juni 2012

Pembangunan Dermaga Ujong Pie Dinilai Lamban

Malam Ini, FKGM Gelar Dialog Pemuda Aceh BANDA ACEH (Waspada): Forum Komunikasi Generasi Muda (FKGM) akan mengelar dialog Pemuda Aceh di Hotel Hermes Palace, Senin (18/6) malam, guna mencari ideide baru tentang perdamaian dan pembangunan Aceh sebagai masukan bagi Pemerintah Aceh yang baru dan Pemerintah Pusat. Menurut Humas Inisiator FKGM, Teuku Alfiansyah Banta, forum diskusi ini akan mengundang 200 peserta lebih mulai dari para tokoh Aceh dan berbagai organisasi kepemudaan yang ada di Provinsi Aceh. Forum ini menargetkan ada format baru tentang menjaga perdamai di Aceh. “Terkomendasikan ide-ide pemuda di semua sektor; sosial politik dan keamanan. Ini harus menjadi refrensi semua pihak untuk mewujudkan Aceh yang lebih baik,” ujar Teuku Alfiansyah Banta di Banda Aceh, Minggu (17/6). Perdamaian, kata dia, merupakan harapan semua semua masyarakat Aceh, termasuk harapan pemerintah pusat, sehingga pemerintah Aceh perlu menampung ide-ide baru dari pemuda dan semua pihak tentang merawat perdamain yang sudah berlangsung ini. “Harapan kami, dialog ini bisa muncul ide-ide baru dari pemuda Aceh terkait perdamaian di Aceh,” sebut Alfian seraya menambahkan, dialog pemuda Aceh ini mengundang pakar komunikasi politik nasional Dr Fachry Ali, MA, sebagai narasumber utama dan rencananya akan dibuka oleh Pj Gubernur Aceh Ir. Tarmizi A. Karim, MSc. (b04)

Sahabat Walhi Pungut Sampah Di Pantai Ulee Lheue BANDA ACEH (Waspada): Sekitar seratusan remaja yang tergabung dalam Sahabat Walhi (SAWA) dan anggota Unit Kegiatan Mahasiswa (UKM) Putroe Phang melakukan aksi membersihkan sampah di pantai seputaran Taman Kuliner, Ulee Lheue Banda Aceh, Sabtu (16/6). Aksi ini dilakukan memperingati Hari Lingkungan Hidup Sedunia yang jatuh pada 5 Juni 2012 lalu. Dalam kegiatan ini turut serta Duta Lingkungan Kota Banda Aceh, Ledy Iksarina, yang merupakan siswi kelas I SMU negeri 4 Banda Aceh. Direktur Eksekutif Walhi Aceh, T. Muhammad Zulfikar mengatakan kegiatan ini diharapkan bisa menjadikan Banda Aceh sebagai kota yang bersih. “Apalagi Banda Aceh sudah mendapat Adipura, walau masih ada kekurangan disana-sini namun kita harapkan bisa menjadi kota Adipura sejati,” ucapnya. Peserta aksi bersih pantai dibekali masing-masing satu kantong plastik merah besar sebagai tempat mengumpulkan sampah. Selain itu, peserta dibagi menjadi kelompokkelompok dimana tiap kelompok kembali dibekali plastik hitam ukuran supere jumbo untuk menampung sampah dalam plastik merah. Agar peserta bersemangat mengumpulkan sampah, maka panitia memberikan hadiah doorprize kepada kelompok yang paling banyak memungut sampah. Tak ayal, hadiah doorprize membuat peserta berlomba-lomba mengutip sampah. Mereka menyusuri Taman Kuliner yang memiliki luas setengah lapangan sepakbola, mengumpulkan sampah yang terlihat. Kepala Dinas Kebersihan dan Pertamanan (DKP) Kota Banda Aceh, T Iwan Kesuma, yang diberi kehormatan untuk menyampaikan sambutan menyambut baik kegiatan tersebut. “Saya senang dengan kegiatan ini dan saya berharap semoga kegiatan ini dapat dilaksanakan terus pada tempat-tempat lain,” ujarnya. DKP sendiri turut mengerahkan personil dan mobil operasional pengangkut sampah untuk mendukung kegiatan bersih-bersih pantai. Tak kurang terkumpul 50 kg sampah dari berbagai jenis pada aksi itu. (b07)

Waspada / Arman Konadi

DUA pekerja memasang besi baja di dermaga Ujung Pie Kec Muara Tiga Kabupaten Pidie. Meski telah dilanjutkan paska terhenti dan rubuh, proses pengerjaannya dinilai lamban. foto direkam, Sabtu (16/6).

Warga Bongkar Irigasi Rambayan SIGLI (Waspada): Ratusan warga Kecamatan Simpang Tiga, meliputi beberapa desa membongkar saluran irigasi Rambayan, Kecamatan Mutiara, Kabupaten Pidie, Minggu (17/6) sekira pukul 12:00. Aksi ini merupakan puncak kekesalan ratusan petani Simpang Tiga, setelah sekian lama sawah mereka mengalami kekeringan. Selama ini bagunan irigasi tersebut ditutup untuk menghalagi aliran air masuk ke sawah-sawah. Mustafa, 37 salah seorang petani asal Desa Raya Paya, Kecamatan Simpang Tiga, kepada Waspada, Minggu (17/6) mengungkapkan, selama ini aliran air bersumber dari irigasi tersebut diarahkan ke kawasan

persawahan di Desa Teungoe, Kecamatan Simpang Tiga. Hal ini menyebabkan ratusan hektar sawah-sawah yang terletak di kawasan Kemungkiman Bungie dan sekitarnya tidak lagi mendapatkan air yang dapat dialiri ke sawah-sawah. Lukman, petani asal Simpang Tiga, Pidie lainnya mengaku sejak beberapa tahun belakangan ini ratusan petani di Kecamatan Simpang Tiga sudah sering mengeluhkan tanaman padi mereka rusak karena kekurangan air, akibat saluran irigasi yang melintasi pemukiman warga sudah semakin menyempit, dan terjadi pendangkalan. Hal senada juga diungkapkan Ramli, salah seorang petani di asal Desa Gampong Blang, Kecamatan Simpang Tiga. Ramli sendiri mengaku sudah beberapa kali gagal panen karena

tanaman padi miliknya rusak akibat kekurangan air. Bahkan menurut dia, akibat banyak sawah yang mengalami kekeringan, sebahagian petani terpaksa menggali sumur dan mengaliri air ke sawahnya dengan mesin penyedot. Mestinya cara-cara seperti itu tidak perlu dilakukan apabila para petani lainnya tidak menyerobot air yang ada dalam tali air dengan menutup pintu irigasi. “ Air adalah sumber kehidupan. Begitu pun bagi kami para petani di Kecamatan Simpang Tiga,Pidie. Ketika aliran irigasi ditutup, maka kami mengamuk. Sebab kami sudah sering dikerjain, meskipun kami sudah laporkan ke dinas terkait maupun kepada masyarakat yang menutup pintu irigasi, namun tidak diperhatikan. Jadi langkah terakhir kami terpaksa membongkar irigasi ini” katanya. (b10)

10 TK Tingkat Seunagan Diwisuda NAGAN RAYA (Waspada) : Sebanyak 250 orang siswa TK sekecamatan Seunagan diwisuda dalam pelepasan pelajar di tingkat Seunagan itu Ke 10 TK itu adalah Pembina, TK Mahfirah, TK Dw, Al furqan Alue Tho, Bustanul Affan Nigan, Dharma Wanita Persatuan, An Nur, Harapan Bunda Cok Kumbang , satu atap dan TK Jeuram. Pada acara wisuda juga dihadiri Ketua PKK Nagan Raya Ny Hj Jafnimar Jakfa dilaksanakan di Balee Duk Pakat Jeuram Ketua Pelaksana Ainon Marziah kepada Waspada, Sabtu (16/6) mengatakan, pihaknya sudah melakukan berbagai perlombaan. Selain itu juga menyerahkan ijazah raport serta tropi yang di serahkan secara simbolis oleh perwakilan Dinas Pendidikan setempat.(cb07)

Pemilih Di Nagan Berkurang 117 NAGAN RAYA (Waspada) : Daftar Pemilih Tetap (DPT) Pilka-da putaran kedua Nagan Raya berkurang sebanyak 117 orang, hal tersebut disampaikan T Abdul Rasid, Ketua Komisi Indepen-den Pemilihan (KIP) Nagan Raya seusai rapat pleno yang digelar Sabtu (16/6) di gedung KIP. “Jumlah DPT untuk putaran kedua berkurang sebanyak 117 orang dari jumlah sebelumnya “ kata T Abdul Rayid. Dari jumlah DPT pada pemilihan putaran pertama sebanyak 104.079 jiwa menjadi 103.962. Pengurangan sejumlah pemilih dikatakan Ketua KIP Nagan Raya berdasarkan perbaikan data yang dilakukan pihaknya. “Berkurang setelah kita lakukan perbaikan data, ada yang meninggal, pencoretan yang ganda serta ada beberapa perbaikan data baru,” kata Abdul Rasyid. Selain ada yang berkurang di beberapa kecamatan juga dirincikanya ada yang bertambah, namun pertambahan tidak lebih banyak dari yang berkurang, Total penambahan sebanyak 364 jiwa sedangkan berkurang sebanyak 481 jiwa sehingga terjadi kekurangan dari sebelumnya menjadi 117 jiwa. (cb07)

Pembakaran Sarana Objek Wisata Genting Buya Harus Diusut TAPAKTUAN( Waspada):) Koordinator Solidaritas Masyarakat Anti Korupsi (SOMASI) Aceh Selatan, Saiful Bismi mendesak penegak hukum mengusut tuntas penyebab terjadinya aksi pembakaran sarana ObjekWisata Genting Buya, Gampong Pasie Lembang, Kecamatan Kluet Selatan. “Selain merugikan keuangan daerah dan negara, aksi pembakaran ini juga telah menghilangkan alat bukti penyelidikan pihak berwajib, atas dugaan penyelewengan dan terlantarnya proyek tersebut, “kata Saiful kepada wartawan Minggu (17/6) di Tapaktuan. Aksi pembakaran fasilitas kelengkapan Objek Wisata Genting Buya, di lintasan jalan negara Tapaktuan-Medan yang terjadi 12 Mei 2012 lalu, disebut-sebut dilakukan Orang Tak Dikenal (OTK) dan kasusnya masih dalam taraf pengembangan aparat berwajib. Saiful mempertanyakan jika proyek tersebut masih bermasalah atau tidak diterima masyarakat, kenapa harus dilanjutkan pelaksanaanya, sehingga tidak menimbulkan kerugian keuangan daerah dan negara. Sementara Kadisbudtapora Aceh Selatan, Drs Syarifuddin M melalui Sekretarisnya, Jasmani yang dikonfirmasi secara terpisah membenarkan beberapa sarana pendukung proyek pengembangan objek wisata Genting Buya telah musnah dibakar OTK. “Kita mengetahuinya berdasarkan surat pemberitahuan Camat Kluet Selatan, Rustam, namun sejauh ini belum diketahui motif dan pelakunya,” sebut Jasmani singkat.(b30)


Waspada/Muhammad Zeinizen

SUASANA sosialisasi pembangunan pabrik minyak goreng di Subulussalam yang dilaksanakan Kementerian Perindustrian, melalui Direktorat Jenderal Industri Agro di Hotel Emerald Garden, Jumat (15/6). Hadir Faiz Achmad, Sesditjen Industri Makanan, Hasil Laut dan Perikanan, Kepala Biro Perencanaan, Kementerian Perindustrian, Inspektur II Kementerian Perindustrian,Wali Kota Subulussalam Meurah Sakti, SH.

2013, Subulussalam Punya Pabrik Minyak Goreng Wali Kota Meurah Sakti: Potensi CPO Aceh Luar Biasa MEDAN (Waspada): Diperkirakan akhir tahun 2013, Kota Subulussalam akan memiliki pabrik minyak goreng. Hal itu akan direalisasikan pihak Kementerian Perindustrian, melalui Direktorat Jenderal Industri Agro pada rapat koordinasi dengan pihak terkait dari Pemko Subulussalam di Hotel Emerald Garden. ‘’Insya Allah 2013, Kota Subulussalam akan memilikinya (pabrik minyak goreng),’’ ungkap Faiz Achmad, Sesditjen Industri Makanan, Hasil Laut dan Perikanan dalam pertemuan yang digelar di Medan, Jumat (15/6). Hadir dalam pertemuan itu selain Fais, juga hadir Kepala Biro Perencanaan, Kementerian Perindustrian, Inspektur II Kementerian Perindustrian, Wali Kota Subulussalam Meurah Sakti, SH, Ketua DPRD Kota Subulussalam, Ketua Komisi B DPRK Subulussalam Syarifuddin Marzuki, Kepala Dinas Perindustrian dan Perdagangan Kota Subulussalam, Kabag Program dan Evaluasi Setditjen Industri Agro, Kasubdit Program dan Evaluasi Laporan Dit IMHLP, Doyo Sudaryat, ahli teknologi, Suharto, SH, ahli hukum, Edy Endar Sriono, M Iqbal Kara-

na, Erlina Hasibuan dan para Kasubdit di lingkungan Dit. Industri Makanan, Hasil Laut dan Perikanan. Untuk memberhasilkan program itu, Subulussalam diminta menyediakan lahan lebih kurang 5 Ha dan sudah bersertifikat. Selain itu juga diminta membangun pabriknya senilai Rp 15 miliar. Hal itu ternyata direspon olehWali Kota Meurah Sakti dan persyaratan segera dipenuhi. ‘’Untuk tahap awal lahan sudah kita dapatkan di luar kota, tepatnya di Jalan Lintas menuju Tapaktuan, kemudian anggaran pembangunan dimasukkan dalam APBK,’’ terang Meurah Sakti. Tahap pekerjaan akan dimulai dengan pembangunan bak limbah yang sesuai dengan ketentuan baku mutu lingkungan dan selama setahun pengerjaan akan selesai. Disebutkan, manfaat dari pembangunan pabrik minyak goreng itu adalah bagaimana Aceh selama ini masih bergantung dari luar daerah khususnya dalam pasokan sembilan bahan pokok khususnya minyak goreng. Anehnya, sebut Meurah Sakti, CPO banyak keluar dari

Aceh mengingat luasnya lahan kebun sawit di Aceh khususnya di sepanjang Pantai Barat Aceh. CPO itu kemudian diolah di luar daerah dan hasilnya kembali dijual ke Aceh. Diharapkan Meurah Sakti, dengan keberadaan pabrik dengan kapasitas 100 ton CPO per hari, akan mampu menjaga stabilitas stok minyak goreng di wilayah Aceh.’’Tentunya kawasan pantai barat Aceh akan menjadi pasar potensial dan produk itu nantinya memakai merek Subulussalam yang dengan sendirinya akan membawa nama Aceh ke permukaan,’’ terang Meurah Sakti. Untuk tahap awal nantinya pabrik itu hanya untuk menghasilkan minyak curah dan ini merupakan satu-satunya pabrik yang ada di Aceh.’’Kita berharap pabrik itu mampu menampung potensi CPO Aceh yang sesungguhnya luar biasa. Ke depan bukan lagi minyak curah, namun produk-produk turunannya akan kita usahakan dikerjakan di Subulussalam sehingga Aceh tidak lagi bergantung dari luar namun sudah mampu berdiri di atas kaki sendiri,’’ terang Meurah Sakti. (m14)

SIGLI(Waspada):Sejumlah nelayan Gampong Ujong Pie Kec, Muara Tiga Kab, Pidie mengeluhkan lambannya pembangunan dermaga di daerah mereka. Meski bersyukur telah kembali dikerjakan paska terhenti beberapa tahun lalu namun proses pengerjaannya dinilai sangat lamban. Usman, 40 nelayan Ujong Pie mengatakan sejak dibangun paska tsunami dermaga telah berusia sekitar 10 tahun namun hingga kini belum dapat dirasakan manfaatnya oleh nelayan setempat. “Kita bersyukur karena pembangunannya telah dilanjutkan tapi sepertinya lamban sekali prosesnya,”kata Usman kepada Waspada, Minggu (17/6). Menurut Usman, sebelumnya dermaga itu dibangun Badan Rehabilitasi dan Rekonstruksi Aceh namun karena tak sesuai keinginan nelayan, dermaga tak digunakan nelayan. Bahkan lanjut Usman, dermaga sempat roboh karena dibangun tidak sesuai bestek. “Kami bersyukur telah dilanjutkan tapi sejak dilanjutkan, sepertinya pekerja di lapangan tidak sesuai dengan pekerjaan. Hanya beberapa orang yang terlihat bekerja,”katannya. Di sisi lain meski mengaku akan mengajak

nelayan setempat memanfaatkan dermaga jika selesai, Usman, meminta pihak terkait berkordinasi bila membangun berbagai fasilitas untuk nelayan. “Kalau seperti sekarangkan kesannya mubazir. Makannya ke depan kita berharap pihak terkait berkordinasi, karena nelayan tentu lebih paham kondisi dilapangan,”ujarnya. Menurut Usman, keengganan nelayan menambatkan kapalnya karena khawatirkan boatnya akan pecah terantuk dermaga. Pasalnya dermaga tersebut dibangun terlalu dekat dengan pesisir pantai. “Posisinya sangat dangkat, karena dibangun terlalu dekat dengan daratan ,” ungkap Usman. Dihubungi terpisah, Kepala Dinas Perhubungan Komunikasi dan Informasi (Dishubkominfo), Kabupaten Pidie Muti’in, S.IP mengakui jika dermaga tersebut tidak sesuai dengan keinginan nelayan. Namun kata Muti’in itu merupakan perencanaan sebelumnya. Selain itu Muti’in juga menyebutkan pihaknya tidak mengetahui banyak tentang proyek dimaksud karena langsung ditangani Pemerintah Provinsi.“Kita tidak tahu banyak termasuk dananya. Tapi yang jelas dari APBA dan semuannya ditangani provinsi,”pungkasnya. (cb06)

Muhammad Nasir,SE Ketua PDP Aceh BLANGPIDIE (Waspacayakan kepada Muhammad da) : Pimpinan Kolektif NaFahrial, dan Bendahara dipesional (PKN) Partai Demokgang Agustamin Sianturi. rasi Pembaruan (PDP) mela“Dengan keputusan itu, lui Ketuanya H.Roy BB Janis, maka partai ini masih eksis dan SH.MH dan Sekretaris siap menjadi bahagian dari maKRHT H Didi Supriyanto, syarakat Aceh demi membaSH.MHum pada tanggal 1 ngun iklim demokrasi yang Juni 2012 lalu secara resmi lebih baik. Kita berharap dapat menetapkan Muhammad memberikan kontribusi terhaNasir,SE sebagai ketua PDP dap pembangunan di Aceh Provinsi Aceh menggantikan khususnya melalui jalur politik Almarhumah Cut Nurimah yang akan kita tawarkan dengan Hasan yang meninggal Waspada/Sudarmansyah dunia pada Februari lalu. KETUA Partai Demokrasi Pem- strategi yang berbeda dan tentu Keputusan tertuang baruan (PDP) Provinsi Aceh sesuai dengan khazanah masyarakat Aceh,” papar Muhamdalam surat keputusan PKN Muhammad Nasir,SE . mad Nasir dalam statemen PDP bernomor 1.664/01/ politiknya sebagai ketua PDP Skep/PKN-PDP/VI/2012 tertanggal 1 Juni 2012 menetapkan struktur, komposisi dan personalia Provinsi Aceh kepada Waspada Minggu (17/6). pimpinan dan pelaksana harian PDP Provinsi Adapun strategi politik yang akan ditawarAceh. Dalam keputusan itu Muhammad Na- kan PDP Aceh menurut Muhammad Nasir diyasir,SE yang saat ini juga berposisi sebagai ang- kininya akan mampu diterima oleh masyarakat gota DPRK Abdya ditetapkan sebagai ketua pe- AcehsehinggaakanmenjadikanPDPsebagaipartai laksana harian, sementara Sekretaris diper- nasional yang memiliki karakter Aceh. (cb05)

Sambut HUT Bhayangkara, Polres Abdya Gelar Berbagai Kegiatan BLANGPIDIE (Waspada) : Sejumlah personil Polres Aceh Barat Daya sejak beberapa hari terakhir terlihat begitu membaur dengan terjun ke berbagai lokasi di tengah-tengah masyarakat dengan beberapa agenda sosial dan olahraga. Kegiatan langsung diikuti Kapolres setempat AKBP Eko Budi Susilo beserta para perwira dan jajarannya menyambut HUT Bhayangkara ke-66 yang akan jatuh pada 1 Juli mendatang. Waspada/Sudarmansyah Aksi sosial seperti donor ANGGOTA Polres Aceh Barat Daya saat melaksanakan kegiatan darah, pembersihan lingJumat Bersih belum lama ini. kungan dan sarana ibadah, serta sejumlah kegiatan olahraga dengan melakukan aksi sosial pembersihan sarana melibatkan berbagai elemen masyarakat, dinilai ibadah di Masjid NurulYakin, Desa Keude Siblah cukup memberikan dampak yang sangat positif Kecamatan Blangpidie yang dipimpin Kasat terhadap keberadaan polisi di tengah masya- Lantas AKP M Saifuddin, Minggu (17/6). Disebutkan Kapolres, sekecil apapun tugas rakat. Namun demikian, menurut Kapolres AKBP Eko Budi Susilo kondisi itu diharapkan yang dibebankan kepada personil kepolisian akan terus dipertahankan oleh seluruh personil khususnya di wilayah Polres Abdya bilamana kepolisian di jajaran Polres Abdya sehingga akan berhubungan dengan masyarakat secara langtercipta sebuah ikatan kerjasama yang kuat baik sung maka sudah seharusnya dilakukan dengan penuh keiklasan serta bertanggungjawab, oleh secara kemitraan maupun aktifitas lainnya an- karenanya setiap personil di polres Abdya harus tara personil Polres Abdya dengan masyarakat. memiliki sikap dan perilaku sesuai dengan tri “Polisi akan dikategorikan dia sukses bila- brata polri sehingga mampu memberikan yang mana keberadaannya disenangi oleh masya- terbaik bagi masyarakat. rakat, karena bagaimanapun masyarakat adalah “Jika kita berbuat dengan iklas dan bertangpemilik utama dari lembaga ini, sehingga sudah gungjawab, tentu hasilnya akan lebih baik, ke sepatutnya setiap personil polisi di jajaran ini depan kita berharap keberadaan polisi khususharus memiliki paradigma (pemikiran) untuk nya di wilayah Abdya ini benar-benar memiliki memberikan yang terbaik bagi masyarakat,” peran serta mampu memberikan pelayanan ungkap Kapolres Abdya AKBP Eko Budi Susi- yang terbaik bagi masyarakat,” ujar Kapolres lo,SIK kepada Waspada saat istirahat usai Eko Budi Susilo. (cb05)

Retribusi Kebersihan Dikeluhkan Pedagang Di Sigli SIGLI(Waspada): Sejumlah pedagang di Sigli mengeluhkan tingginya kutipan retribusi yang dikenakan Dinas Kebersihan setempat kepada mereka. Pedagang berharap kutipan ditinjau dan diklasifikasikan kembali sesuai jenis daga-ngan sehingga tidak memberatkan. “Kami berharap kutipannya disesuaikan antara warung kopi, restoran dan pedagang kaki lima. Karena sampah maupun limbah yang dihasilkan berbeda,” kata Bustami pemilik warung di Jalan Iskandar Muda Pidie kepada Waspada, Sabtu (16/6). Selain masalah kutipan yang dinilai membe-ratkan, Bustami juga mengeluhkan ketiadaan tempat sampah di sepanjang warung milik pedagang. Hal itu membuat sampah berserakan terutama saat ditiup angin. “Kesannya kotor karena tidak ada tong sampah, apalagi kalau di sehingga merusak dan dikorek binatang yang berkeliaran di kota seperti kambing,” kata Bustami.

Menurut Bustami ketiadaan tong sampah membuat pedagang hanya membungkus sampah dalam kertas plastik agar mudah diambil saat petugas datang. Meski demikian seluruh sampah terlanjur berserakan karena tidak diletakkan pada tong sampah. Bustami menyebutkan, kutipan dikeluhkan pedagang karena selama ini qanun (peraturan daerah) tentang kebersihan tidak disosialisasikan. Selain itu petugas pengutip retribusi hanya datang sekali dalam setahun. “Ini yang sebenarnya terasa memberatkan karena mereka datang sekali dalam setahun sehingga jika ditotal menjadi ratusan ribu,” ungkapnya. Bustami merincikan, setiap bulannya ia harus membayar uang kebersihan sebesar Rp 30.000 . “Jadi kalau petugas datang setahun sekali inikan jadi membengkak. Kita berharap minimal setiap bulan petugas datang agar tidak terasa membratkan,”harapnya. (cb06

e-KTP Yang Sudah Siap Segera Dibagikan BIREUEN (Waspada) : Asisten Pemerintahan Setdakab Bireuen Drs Murdani minta semua e-KTP yang sudah dikirim ke dinas agar dapat segera dibagikan kepada pemiliknya. Hal ini untuk memotivasi warga lain yang belum mengurus e-KTP di kecamatan masingmasing karena hingga saat ini sekitar 17 ribu warga Kabupaten Bireuen kurang peduli untuk mengurus pembuatan e-KTP. Demikian Asisten I Drs Murdani mengemukakan kepadaWaspada di ruang kerjanya Jumat (15/6). Dinas Kependudukan dan Pencatatan Sipil diminta e-KTP yang sudah siap segera

diserahkan ke kecamatan untuk dibagikan kepada masyarakat dan jangan ditunda lagi. pinta Murdani. Ditempat terpisah Kepala Dinas Kependudukan dan Pencatatan Sipil Bireuen Muzakir Aziz menjelaskan, tahun 2009 warga yang sudah wajib KTP di Kab. Bireuen sebanyak 251.420 orang. Hingga akhir tahun 2011 e-KTP yang sudah diproses di 17 kecamatan sebanyak 234.420 orang. Dikatakan, e-KTP yang sudah selesai dicetak diJakartadansudahdikirimkeDisdukcapilBireuen sebanyak 140.661 lembar (70 persen) dari jumlah warga yang sudah membuat e-KTP (b12)


B12 LANGSA (Waspada): Keberadaan khatib, imam dan muazin di gampong-gampong dalam wilayah Kota Langsa sekarang ini mulai terancam krisis. Jika tidak segera dilakukan pengkaderan, bukan tak mungkin beberapa tahun ke depan akan ada masjid yang harus mengimpor khatib atau imam dari gampong lain ketika hendak melaksanakan shalat jumat. Kekhwatiran itu mulai dirasakan Kepala Dinas Syariat Islam Kota Langsa Drs H Ibrahim Latif, MM yang diungkapkan dihadapan para peserta pembekalan dan pelatihan tentang pemantapan Syariat Islam di aula Kantor Bapeda Aceh Timur, Jumat (15/6). Peserta pembekalan dan pelatihan berjumlah 132 orang terdiri dari Ketua dan Sekretaris Remaja Masjid se- Kota Langsa. Kepada merekadiharapkandapatmengantisipasisejakdinisupayaancaman krisis khatib, imam dan muazin itu bisa cepat teratasi. Gejala ke arah itu, menurut Ibrahim Latif, sekarang sudah mulai terlihat. Di mana sejumlah masjid di gampong-gampong hanya memiliki satu orang khatib sekaligus merangkap sebagai imam. Bahkan kadang-kadang juga harus berperan sebagai muazin karena tidak ada orang lain yang mau melaksanakan tugas tersebut. Yang lebih memprihatinkan lagi, tambahnya, orang itu sudah berusia uzur. Bagaimana seandainya dia meninggal siapa yang akan menggantinya, demikian kata Ibrahim Latif dalam nada bertanya untuk menggugah peserta pembekalan dan pelatihan tentang Syariat Islam tersebut. (b20)

LANGSA (Waspada): Mahasiswa jurusan dakwah prodi Komunikasi Penyiaran Islam (KPI) Sekolah Tinggi Agama Islam Negeri (STAIN) Cot Kala Langsa studi banding ke redaksi media massa dan TVRI di Banda Aceh. Ketua Jurusan Dakwah Abdullah AR, MA, Minggu (17/6) mengatakan, studi banding yang dilaksanakan dari tanggal19 sampai 21 Juni 2012 mendatang itu guna melihat dari dekat mekanisme kerja di kantor redaksi media massa dan TVRI serta kerja percetakan koran yang merupakan salah satu mata kuliah yang diajarkan pada prodi KPI. “Program studi banding ini berguna untuk lebih mendekatkan para mahasiswa dengan objek bahasan yang telah mereka diskusikan di ruang kelas, sehingga mereka dapatmelihat langsung aplikasinya di lapangan,” ujar Abdullah. Dia menambahkan, di TVRi mahasiswa akan melihat proses pengambilan gambar serta proses pembuatan berita di media audio visual tersebut sekaligus melakukan praktek di tempat tersebut. Kunjungan ke lapangan itu merupakan kegiatan tahunan prodi KPI, sebelumnya kegiatan ini dilaksanakan di Medan, Sumatera Utara, pemilihan Kota Banda Aceh sebagai lokasi studi banding tahun ini karena ingin melihat cara kerja cetak jarak jauh yang dilaksanakan salah satu media massa di Banda Aceh. (b22/ b20)

Mapala STAIN Cot Kala Persiapan Ekspedisi Ke Glee Mendom LANGSA (Waspada): Mahasiswa Pecinta Alam (Mapala) Sekolah Tinggi Agama Islam Negeri (STAIN) Cot Kala Langsa melaksanakan persiapan ekspedisi ke Glee Mendom di Kabupaten Aceh Besar, Minggu (17/6). Ketua Mapala STAIN Nurdiana mengatakan, ekpedisi ke Glee Mendom di kawasan perbukitan yang lebih dikenal dengan julukan tripel M itu sebagai bagian dari tahapan akhir pendidikan anggota muda yang dilaksanakan Mapala STAIN. “Ekpedisi akan diikuti lima anggota muda anggota Mapala STAIN sebagai tahapan akhir pendidikan sebelum mereka dilantik menjadi anggota tetap Mapala Cot Kala,” ujarnya. Dia menambahkan ekspedisi akan dilaksanakan pertengahan Juli mendatang, sebelum melaksanakan pendakian para anggota muda itu akan melakukan pendidikan tambahan di Mapala GAINPALA IAIN Ar-Raniry Banda Aceh. Nurdiana menambahakan saat ini kelima anggota muda itu sedang melaksanakan latihan fisik serta pemantapan materi yang dilaksanakan di lingkungan kampus STAIN di Gampong Meurandeh, Kota Langsa.(b22)

Warga Peureulak Ditemukan Jadi Mayat Di Banda Aceh BANDA ACEH (Waspada):Warga menemukan sesosok mayat laki-laki, Minggu (17/6) pagi, di sebuah lahan kosong milik Pemerintah Kota Banda Aceh di kawasan Desa Lamteh Kec.Ulee Kareng Kota Banda Aceh dengan kondisi luka bacok. Korban meninggal bernama Ridwan Ahmad,48 warga Jalan Bangka Rimueng Peureulak, Kabupaten Aceh Timur. Mayat kini berada di RSUZA untuk dilakukan otopsi. Menurut Samsudin warga yang pertama kali menemukan mayat tersebut mengaku melihat posisi mayat telungkup dengan kondisi luka bacok dibagian kepala dan tangan kiri. Saat ditemukan mayat tergeletak di semak belukar tidak jauh dari kandang sapi miliknya yang berlokasi di dalam areal lahan yang sudah dibebaskan oleh Pemkot untuk dijadikan pembangunan perumahan rusunawa. “Saat ke kandang sapi saya terkejut melihat ada mayat tergeletak di kebun, lalu saya memberitahukan kepada warga setempat,” terangnya. Menurut informasi dari sumber di sekitar TKP, korban sudah sekitar empat hari menumpang minta izin tinggal tidur di gubuk/kandang sapi milik Samsudin. Polisi kini masih mendalami kasus tersebut. Polisi juga telah mengamankan barang bukti diduga milik korban yang ditemukan di TKP di antaranya sebilah rencong, selembar bendera Partai Aceh dan tas berisi pakaian. (cb01)

Waspada/Mahadi Pinem

KAMPANYE perdana pasangan Sanu-Ali Basrah, Sabtu (16/6), di Stadion H Syahadat, sebagai barometer keberhasilan calon Bupati-Wakil Bupati Agara. Tampak pasangan Sanu –Ali Basrah dihadapan puluhan ribu pendukung mereka tanpa menghiraukan terik mentari siang itu.

Potong Tangan, Alternatif Hukum Pelaku Pencurian Di Aceh LANGSA (Waspada): Drs Muhammad Natsir, SH.MH, staf pengajar Fakultas Hukum Universitas Samudera dan STAIN Zawiyah Cot Kala Langsa menyampaikan gagasannya berupa alternatif hukuman bagi pelaku pencurian di Aceh. Gagasan itu dihadirkannya dalam bentuk sebuah karya berupa buku yang berjudul “Kebijakan pidana potong tangan dalam sistem pemidanaan di Aceh”. Dalam buku setebal 105 halaman ini, Muhammad Natsir

mengintisarikan tentang gagasan penerapan hukum potong tangan sebagai hukum alternatif bagi pelaku jinayah pencurian di Aceh. Hal ini tentu saja merupakan satu paradigma baru untuk mendobrak tradisi KUHP warisan kolonial Belanda yang hanya tertumpu pada tiga bentuk hukuman yaitu hukuman mati, penjara dan denda. Sedangkan yang paling banyak dilaksanakan di Indonesia selama ini adalah hukuman penjara. Kepada wartawan, Sabtu (16/6) Muhammad Natsir menjelaskan buku yang dikarangnya itu memuat kajian tentang pidana potong tangan. Memang dalam KUHP jenis hukuman tersebut tidak ditemukan, kata dia, namun di Aceh telah dirancang

mengingat norma norma hukum Islam harus dijalankan. Namun untuk pelaksanannya harus memenuhi kriteria dasar kekuatan hukum yang berlaku. Keberadaan hukum Islam selama ini, menurut dia, tidak banyak dipahami secara benar dan mendalam oleh masyarakat awam. Yang banyak diketahui orang hanya hukum pidana dengan qishash, rajam dan potong tangan bagi pelaku pencurian serta hukum cambuk ataupun dera bagi pelaku maisir dan zina. Sementara tata cara pelaksaannya masih banyak umat Islam yang belum paham, maka dalam buku ini semuanya dikupas secara tuntas terutama tentang pidana potong tangan. Buku ini diterbitkan oleh USU Press 2012.(b20)

Yayasan Advokasi Rakyat Aceh (YARA) pekan lalu menelusuri rumahnya yang berada di Gampong Baroe Idi Cut. Saat tiba disana, sungguh memprihatinkan keluarga Rita yang hidup bersama dua anaknya, salah satunya yakni Saifullah, penyandang gizi buruk sejak lahir. Setelah mewawancarai sang ibu dari Saifullah, Direktur Eksekutif YARA, Safaruddin, SH menyatakan komit mendampingi Saifullah untuk proses pengobatan. Lembaganya yang bergerak di bidang kesehatan dan pendidikan serta hukum dinyatakan siap membantu sesuai mekanime pengobatan Saifullah ke Rumah Sakit (RS). “Kita akan mendapingi keluarga korban jika bersedia berobat,” kata Safaruddin. Safaruddin menyesalkan sikap Dinas Kesehatan Aceh dan Dinkes Aceh Timur yang diduga sengaja membiarkan penyandang cacat di Aceh. “Seharusnya tindakan medis harus cepat, kalau penyandang gizi buruk masih ada di Aceh, untuk apa pemerintah mengontrak tenaga tenaga medis untuk disebarkan ke seluruh Aceh, Puskesmas juga tersebar diseluruh kecamatan di Aceh, tapi kenapa masih ada penyandang gizi buruk di Aceh,” kata Safaruddin dengan nada kesal. Rita mengisahkan, anak

KUTACANE (Waspada) : Kampanye terbuka pasangan calon Bupati-Wakil Bupati Aceh Tenggara, digelar serentak mulai Sabtu (16/6). Hari pertama, pasangan H Hasanuddin B – H Ali Basrah, langsung diuji dengan mendapat lokasi kampanye yang menjadi barometer semua kandidat calon Bupati Agara, yakni Stadion H Syahadat. Pantauan Waspada, pasangan nomor urut 2 ini sukses mengakiri masa kampanye hari pertama yang dimulai pukul 14:00. M Salim Fakhri,SE.MM, ketua tim pemenangan pasangan calon Bupati-Wakil Bupati nomor urut 2 ini, yakni Sanu – Ali Basrah, menyampaikan, membeludaknya massa pendukung pasangan SABAR (Sanu-Ali Basrah), ini membuktikan rakyat masih menginginkan kembaliHHasanuddinBtampilmemimpinAgara bersama calon wakilnya dari generasi muda. Sanu-Ali Basrah, dihadapan puluhan ribu massa, yang mengelu-elukan pasangan nomor urut dua ini, senada menyampaikan, agar massa pendukung pasangan yang didukung 12 partai politik, yaknipartai Golkar, Demokrat, Partai Aceh,Hanura, PPP, PKS, parta PKPI, PPPI, partai patriot, PDP serta Partai PKB. Sanu mengingatkan massa hingga berakhirnya masa kampanye hingga pencoblosan, jangan terpancing untuk hujat menghujat. “Tujuan kita adalah untuk membangun Aceh Tenggara lebih bermartabat, bukan untuk saling hujat, kemenangan pasangan nomor urut 2 adalah kemenangan rakyat Agara” ujar Hasanuddin B, calon Bupati 2012-2017. M Amin, dari DPR Aceh dari DPD Partai Golkar Aceh, dalam orasi politiknya menyampaikan, rakyat Agara, jangan terpancing buaian jargon politik yang indah di saat kampanye saja. ‘’Lihat buktinya, uji ucapannya. Kandidat lain masih berjanji, pasangan Sanu- Ali Basrah justru telah terbukti berbuat telah teruji kemam-

puanya didalam meningkatkan pembangunan di Agara,’’ kata M Amin. Ditegaskan, puluhan ribu rakyat yang hadir di Stadion H Syahadat, pantas mendukung pasangan Sanu – Ali Basrah, dengan nomor urut 2 untuk memenangkan terpilih menjadi pasangan Bupati Wakil Bupati Agara priode 2012 – 2017. Raidin-Muslim Ayub Sementara itu, pasangan kandidat nomor 1, Raidin Pinim – Muslim Ayub, di hari pertama kampanye, dilaksanakan di lapangan Biak Muli, Kecamatan Bambel. Kampanye dimulai pukul 14:00. Pasangan calon Bupati-wakil Bupati nomor urut 3, Rajidin-Sarim Sembiring, di hari pertama, tidak melakukan kampanye terbuka sesuai jadwalnya di Kecamatan Badar, namun pasangan ini, Sabtu (16/6) pagi itu, melaksanakan zikir di Masjid Badar. Pasangan Calon nomor urut 4, pasangan H Armen Desky – Tgk Appan Husni, menggelar kampanye terbuka di Lapangan Kuta Tengah di Kecamatan lawe Sigala-Gala. Pasangan kandidat nomor urut 5 pasangan H Marthin Desky – Hj Kamasiah mengisi acara kampanye terbuka hari pertama pasangan ini menggelar pertemuan di Kecamatan ketambe. Sedangkan pasangan kandidat nomor urut 7, pasangan Ridwan,- Erwin Sihombing, sebagaimana disampaikan Kabag Ops Polres Agara selaku penanggungjawab lapangan dari Polres terkait kegiatan kampanye terbuka ini, membenarkan pasangan kandidat nomor urut tujuh ada pemberitahuan pasangan ini tidak memanfaatkan jadwal kampanye hari pertama mereka,sesuai jadwal di Kecamatan Darul Hasanah. Kapolres Agara AKBP Triso R melalui Kabag Ops Kompol Nazli, SAg, mengatakan, situasi kampanye hari pertama Pemilukada Agara, berlangsung damai dan terkendali. (b25)

Kapolda Didesak Usut Kasus Dugaan Penganiayaan Remaja IDI (Waspada): Kapolda Aceh Irjen Pol Iskandar Hasan didesak mengusut hingga selesai kasus dugaan penganiyaan terhadap Munawir oleh anggota Polsek Idi Rayeuk di Mapolsek setempat pekan lalu. Korban mengaku dianiaya ketika diperiksa empat personil polisi akibat tertangkap mencuri sepatu bola milik keponakan polisi. “Kasus Munawir sudah dilaporkan ke polisi orangtuanya ke Polres dan ikut didampingi tiga kuasa hukumnya dari Banda Aceh. Jadi kita minta Kapolda Aceh untuk menyelesaikan kasus ini dan proses hukum dijalankan terhadap empat anak buahnya di Mapolsek Idi,” papar Kuasa Hukum Munawir, Safaruddin, SH kepada Waspada, Jumat (17/8). Dia meminta Kapolda Aceh untuk memberikan perhatian khusus terhadap kasus dugaan penganiayaan remaja di bawah umur di Aceh Timur. “Jika benar Munawir salah karena mencuri sepatu keponakannya polisi kenapa disiksa hingga harus dira-

wat di Rumah Sakit (RS). Kasus pencurian bisa diproses secara hukum tindak pidana,” sebut Safaruddin. Keluarga Munawir, lanjut Safaruddin, adalah keluarga miskin yang sehari-hari ayahnya bekerja sebagai buruh nelayan dan ibunya sebagai ibu rumah tangga (IRT). “Kehidupan keluarga Munawir sangat memprihatinkan. Rumahnya yang seperti pondok membuat kita semua iba. Jadi, benar-benar memprihatinkan keluarganya yang tergolong duafa itu,” kata Safaruddin lagi. Ibu Munawir, Farnida, 37, mengatakan, anaknya kini sudah dalam kondisi membaik namun masih dalam perawatan. Dia mengaku belum mengetahui kapan anaknya diperbolehkan pulang, karena dokter tidak masuk dikarenakan hari libur umum. “Kondisinya sudah mulai membaik pak, tapi kami tidak mungkin bertahan terus di Rumah Sakit (RS) karena biaya menjaga Munawir besar. Bukan

biaya pengobatan dia (Munawir—red), tapi biaya makan minum yang menjaganya di RS,” sebut Farnida. Farnida mengaku, suaminya yang bekerja sebagai buruh nelayan membuat pahit kehidupannya sekarang, namun dia berdoa dan berharap agar kekuatan tetap diberikan untuk keluarganya semua. “Kami keluarga miskin yang tidak memiliki apapun. Untuk berobat ini kami menggunakan Jaminan Kesehatan Aceh (JKA),” sebut Farnida. Sebagaimana diketahui, empat remaja tanggung diamankan petugas kepolisian Polsek Idi, Aceh Timur, Rabu (13/6) malam setelah masyarakat menyerahkan keempatnya diduga mencuri sepantu bola milik keluarga petugas Polsek Idi. Setelah diperiksa petugas, keempatnya dibebaskan. Namun Munawir, salah satu dari mereka harus dirawat secara intensif di RSUD Idi, karena sakit dibagian dada yang diduga akibat dipukuli dan dianianya petugas Polsek Idi. (b24)

Saifullah, Sejak Lahir Alami Gizi Buruk GIZI BURUK adalah penyakit yang menjadi perioritas pemerintah di bawah Kementrian Kesehatan. Di daerah, penyakit gizi buruk dibawah pengawasan Dinas Kesehatan, begitu juga dengan penyandang gizi buruk di Aceh Timur menjadi tanggungjawab Dinas Kesehatan setempat. Selama ini, pemberitaan tentang balita ataupun anakanak yang mengalami gizi buruk sepi bukan berarti di Aceh tidak ada penyandang gizi buruk. Buktinya, di Desa Gampong Baroe, Kecamatan Darul Aman— Idi Cut, Kab. Aceh Timur masih terdapat seorang bocah berusia 9 tahun yang mengalami gizi buruk sejak lahir. Akibat faktor kemiskinan ditambah kepedulian pemerintah yang belum berpihak terhadapnya, anak pertama dari pasangan Abdullah – Rita itu hingga kini harus menanggung resiko kesehatan yang tidak baik. Saifullah kini sudah berusia 9 tahun. Seharusnya dia sudah berada di Kelas III Sekolah Dasar (SD). Tapi, kesehatan yang tidak bersahabat dengan membuat Saifullah tidak bisa berbicara, dan kondisi badannya sangat memprihatinkan. Kini, Saifullah hanya bisa duduk, tidur dan makan seadanya. Waspada bersama tim dari

Senin 18 Juni 2012

Kampanye Perdana Sanu – Ali Basrah Sukses

Langsa Krisis Khatib, Imam Dan Muazin

Mahasiswa Cot Kala Studi Banding Ke Redaksi Media Massa Dan TVRI


pertamanya mengalami gizi buruk sejak lahir. Dia tidak mengetahui rahasia apa dibalik ujian yang diberikan untuk keluarganya, tetapi konsultasi dengan pihak medis di Puskesmas Darul Aman anak saya mengalami gizi buruk. Meski dikasih obat, tapi badannya tetap seperti ini, termasuk kaki dan tangannya juga kecil sekali, padahal umurnya sudah 9 tahun pak,” kisah Rita dengan nada sedih. Ibu dari Saifullah mengatakan, pihak Puskesmas Darul Aman juga memberikan rujukan untuk pengambilan obat ke Rumah Sakit Umum Daerah (RSUD) Idi di Idi Rayeuk, “tapi karena tidak ada ongkos angkutan ke Idi, sehingga resep obat itupun tidak berarti. Kami keluarga miskin pak,” sebut Rita lagi dengan air mata yang membasahi pipinya. Melihat Rita dengan anak digendongannya menangis, Direktur Eksekutif YARA, Safaruddin merasa ikut bersedih. Sejumlah wartawan yang datang dengan sejumlah tim dari YARA ikut merasakan kesedihan disaat Rita mencgisahkan Saifullah. “Sangat memprihatinkan sekali. Diusia kemerdekaan negeri ini hampir 67 tahun masih ada penyandang gizi buruk. Anehnya, perhatian juga belum memihak untuknya,” kata Safaruddin.

Waspada/Muhammad H. Ishak

DIREKTUR Eksekutif YARA, Safaruddin, SH (baju kuning bercamata) saat melihat Saifullah yang sudah berusia 9 tahun yang mengalami gizi buruk di Gampong Baroe, Kecamatan Darul Aman, Kab. Aceh Timur. Foto diambil pekan lalu. Untuk itu, Safaruddin berharap Pemerintah Aceh ke depan agar memperhatikan kondisi kesehatan masyarakat Aceh. Hal itu dianggap paling mutlak dilakukan untuk proses pencerdasan selanjutnya. “Bagaimana kita mencerdaskan rakyat, sementara rakyat masih sakit,” sebutnya. Rita sangat mengharapkan,

agar pemerintah bisa mengobati anaknya Saifullah yang kini masih menyandang gizi buruk. “Meski saya tinggal di gubuk (pondok—red) saya tidak pernah minta rumah, tapi berikan kesehatan untuk anak saya agar bisa sekolah dan merasakan rahmat kemerdekaan negeri ini,” pinta Rita. Muhammad H. Ishak

Waspada/Syahrul Karim

KEPALA SMK Negeri 2 Langsa Drs Makmur Lingga, MPd ketika meluncurkan alat penghemat BBM mobil yang disebut WaVe++SMK kepada Wali Kota Langsa Zulkifli Zaionon ketika itu di Jalan Jendral Ahmad Yani, Paya Bujok Seulemak Kota Langsa.

Restorasi SMK Negeri 2 Langsa, Kompetensi Tahun 2020 AWAL berdirinya SMK Negeri 2 Langsa di Aceh saat itu dengan sebutan sangat familiar dulunya adalah STM Negeri Langsa. Semasa kepemimpinan Machram Rangkuti merupakan kelas filial dari STM Negeri Banda Aceh. Awal pembukaan kelas jauh (filial) dari STM Banda Aceh terdiri dari jurusan Bangunan tahun 1970, sehingga saat itu sempat muncul rumor, Machram Rangkuti sebagai bapak pengembang teknologi di Aceh dan tempat belajar menumpang di SMAN 1 Langsa belajar siang hari, yang konon beliau juga sebagai pemrakarsa pendirian STM Banda Aceh. Menurut Kepala SMK Negeri 2 Langsa Drs. Makmur Lingga, MPd, perjalanan SMKN 2 Langsa (STM) sangat berkembang dan maju, dengan dorongan yang sangat kuat dari masyarakat Aceh Timur saat itu juga rekomendasi Pemerintah Provinsi Daerah Istimewa Aceh sehingga pada tahun 1975 oleh Menteri Pendidikan Nasional di bawah kepemimpinan Prof Dr M Syarif Thaib resmi dinegerikan, sehingga kelas jauh (filial) dihapus. Perkembangan STM Langsa (SMKN 2) Langsa pasca penegerian terdiri dari tiga jurusan yaitu, Bangunan, Listrik dan Mesin, yang pada perjalanannya lulusan STM saat itu sangat kualifaid dapat diandalkan, biarpun saat itu dapat dikatakan tenaga pengajarnya kebanyakan di bawah sarjana muda dan sangat jarang tenaga sarjana (S1), tapi lulusannya the best karena siswanya giat belajar. Seiring dengan perkembangan teknologi saat itu, dengan kebijakan Menteri Pendidikan dalam hal ini pemerintah pusat dengan sebutan berdirinya STM 80, adanya bantuan Asian Development Bank (ADB) dan dilanjutkan pergantian kepemimpinan STM (SMKN 2) dari Machram Rangkuti kepada Ir Sofyan. Demikian juga perubahan dan perkembangan konsep tatanan STM saat itu maka STM Langsa dengan sebutan BELMO, (Bangunan, Elektronika, Listrik, Mesin dan Otomotif ). Sesuai dengan perkembangan pasar dan kebutuhan kerja di lapangan kerja bersamaan dengan kepemimpinan Ir Sofyan, saat itu jurusan bangunan dikembangkan menjadi Bangunan Gedung dan Gambar Bangunan. Jurusan Bangunan Gedung membelajarkan kepada siswa agar mampu merencanakan, rencana anggaran biaya dan menghitung berbagai jenis fondasi bagi pembangunan bertingkat sampai kepada bangunan jalan dan jembatan. Perancangan terhadap gedung-gedung sederhana dan bertingkat agar lebih compatible, maka munculnya jurusan Gambar Bangunan yang

mengarah kepada rancang bangun atau lebih konkrit disebut jurusan Arsitektur. Demikian halnya Elektronika juga dikembangkan dengan sebutan Elektronika Komunikasi dan Elektronika Industri. Karena keterbatasan pemahaman guru saat itu dan belum berkembangnya teknologi di Aceh secara spesifik, maka dikembangkan hanya Elektronika Komunikasi, padahal konsep pengembangan individu adalah Elektronika Industri dan pada akhirnya tahun 2005 Elektronika Komunikasi ditutup secara nasional, karena tidak sejalan dengan perkembangan pasar, sebut Makmur. Pengaruh perkembangan lingkungan dan situasi perkembangan di bidang kelistrikan maka dibuka Pengembangan Jaringan Listrik, maka STM Langsa saat itu listrik dibagi menjadi 2 jurusan dengan sebutan Listrik Instalasi dan Listrik Pemakaian & Alat Rumah Tangga. Selanjutnya yang tidak mengalami perubahan sampai kepada perubahan kepemimpinan dari Ir Sofyan ke Drs Abdul Razak juga kepada Drs Ahmad As’adu sampai tahun 1999, SMKN 2 Langsa terdiri dari 7 jurusan, yakni Bangunan Gedung (BG), Gambar Bangunan (GB), Listrik Instalasi (LI), Listrik Pemakaian (LP), Mesin Produksi (MP), Elektronika Komunikasi (EK) dan Otomotif (O), yang pada tahun 1986 sebutan BELMO. Dari pengalaman perjalanan pendidikan kejuruan atau teknologi, yang juga sejalan dengan perubahan perkembangan teknologi di Aceh yang pengembangannya mulai tahun 1976, saat itu juga lulusan-lulusan STM Aceh yang konon saat itu STM di Aceh hanya ada di Banda Aceh, lalu berdiri di Langsa, kemudian berdiri STM Bireuen dan STM Meulaboh. Maka lulusan STM Aceh saat itu hanya ada empat dalam provinsi Aceh, sehingga laku di wilayah Aceh maupun di luar Aceh sampai tahun 1994 semua lulusan dapat bekerja. Adapun terjadi penurunan lulusan tidak bekerja mulai tahun 1995. Hal ini dipengaruhi oleh jumlah lulusan tidak sebanding dengan perkembangan industri di Aceh, juga banyak lulusan STM menjadi pegawai negeri, seperti di Departemen Pekerjaan Umum dan Jasa Konstruksi Jalan dan Jembatan, Kelistrikan dan berkembangnya instalatur dan konsultan dengan pembangunan LNG Lhokseumawe dan Mobil Oil, maka jurusan mesin dan otomotif sangat laku di masyarakat dan industri perkantoran. Dilematisnya, lulusan STM (SMK) hanya 10 persen lulusan yang mendapat tempat baik di dunia usaha maupun di pemerintahan. Syahrul Karim/DJ Rendra

Waspada, Senin 18 Juni 2012  

Waspada Daily

Read more
Read more
Similar to
Popular now
Just for you