Issuu on Google+

Prakiraan Cuaca Jumat (17/7) Medan 24-330C

Berastagi 18-27 0 C

R. Prapat 23-330C

Parapat 19-28 0C

P. Siantar 20-290C

Sibolga 22-32 0 C Hujan guntur

Berawan

BMKG Polonia

JUMAT, Legi, 17 Juli 2009/24 Rajab 1430 H

WASPADA Demi Kebenaran Dan Keadilan

www.waspada.co.id

No: 22854 Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman

Harga Eceran: Rp 2.500,-

Abdillah Lega Putusan MA Tetap Pada Pasal 3 UU Tipikor Dia Berencana Pulang Ke Medan Tahun Depan MEDAN (Waspada): Putusan Mahkamah Agung (MA) yang menolak kasasi Jaksa Penuntut Umum ( JPU) Komisi Pemberantasan Korupsi (KPK) membuat Walikota Medan (non aktif) Drs Abdillah Ak, MBA, lega. Meski tidak mensyukuri dalam kasus yang menimpanya sejak 1 tahun 7 bulan ini, Abdillah menyatakan, putusan MA merupakan suatu penegakan keadilan terhadap dirinya. Sejak awal vonis Pengadilan Khusus Tindak Pidana Korupsi di Jakarta pada Senin 22 September 2008 lalu, Abdillah tidak terbukti melakukan tindak

pidana korupsi sebagaimana diatur dalam primer Pasal 2 Undang-Undang Tipikor. Dia hanya dikenakan subsider pasal 3 UU Tipikor—dinya-

takan bersalah karena lalai dalam menjalankan tugas sehingga terjadi tindak pidana korupsi di Pemko Medan yang dipimpinnya. Hal inilah membuat Abdillah dinyatakan bersalah dalam subsider pasal 3 UU Tipikor dengan hukuman 5 tahun kurungan dan harus membayar uang pengganti senilai Rp17,83 miliar. Sedangkan JPU KPK menuntut Abdillah dengan hukuman 8 tahun kurungan dan uang pengganti sebesar Rp 28 miliar. Atas putusan Tipikor, JPU

yang tidak puas atas putusan tersebut kemudian mengajukan banding ke Pengadilan Tinggi DKI Jakarta. Lagi-lagi hasil putusan banding Pengadilan Tinggi menurunkan hukuman Abdillah menjadi 4 tahun dari 5 tahun yang diputuskan oleh Pengadilan Tipikor. Namun pengembalianuangpenggantiyangharus dibayar Abdillah naik menjadi Rp 23 milyar. Begitu juga pasal yang dituduhkan kepada Abdillah, hanya subsider pasal 3 UU Tipikor. Lanjut ke hal 2 kol. 4

Antasari Juga Diperiksa Untuk Kasus Dugaan Korupsi Di KPK JAKARTA (Waspada): Polisi telah melakukan pemeriksaan pada Ketua KPK non aktif Antasari Azhar untuk kasus lain. Materi pemeriksaan ditengarai mengenai isu dugaan suap yang disebut-sebut melibatkan oknum di KPK. Data ini berdasarkan rekaman yang ditemukan polisi dari laptop Antasari.

“Saya hanya melihat dari jauh (pemeriksaannya), dan saya tidak punya kuasa untuk kasus itu. Saya hanya diberi kuasa untuk kasus lain (Nasrudin),” kata pengacara Antasari Azhar, Ari Yusuf Amir saat dihubungi melalui telefon, Kamis (16/7). Ari enggan berkomentar

BACA DI HALAMAN DALAM MES Sumut Kucurkan Pembiayaan Ibu RT Masyarakat Ekonomi Syariah (MES) Sumut mengucurkan pembiayaan untuk 20 orang ibu rumah tangga senilai Rp19,5 juta. 13

Shalat Qabliyah Jumat Atau Qadha Shalat? Tanggal 13 Juli lalu, MUI Sumut memprakarsai ceramah agama yang dilangsungkan di aula MUI Sumut. Penceramah dipercayakan pada Syekh Muhammad Nuruddin Merbau Banjar Al Makki, MA. Ceramah ini akan berkaitan masalah tarawih (23 rakaat atau 8), witir, tahajjud, tasbih, qadha shalat, shalat qabliyah Jumat dan hal lain, yang masih berkaitan dengan shalat. Opini-12

AS: Makin Sulit Hadapi Taliban Panglima militer Amerika Serikat memperingatkan bahwa para gerilyawan Taliban di Afghanistan semakin lebih keras dan terorganisasi lebih baik dalam tahun-tahun belakangan ini. 3

Model Memilih Boediono Diterapkan Untuk Kabinet Ketua DPP Partai Demokrat Anas Urbaningrum menegaskan, cara berfikir Susilo Bambang Yudhoyono saat memilih Boediono sebagai calon pendampingnya di pilpres akan diterapkan untuk membentuk kabinet pemerintahan mendatang. 28

Jaksa Pelaku KDRT Bisa Dipecat Jaksa pelaku kekerasan dalam rumah tangga (KDRT) Poedji Rahardjo bisa dipecat setelah majelis hakim PN Jakarta Selatan menjatuhkan vonis dua tahun penjara. 5

Sidang Kasus Demo Maut Ricuh Dua terdakwa kasus demo maut massa pendukung Provinsi Tapanuli (Protap) pingsan saat melakukan aksi protes di dalam sel sementara PN Medan. 9

Dua Pasien AIDS Meninggal Dua pasien pengidap HIV/AIDS di RSUP H. Adam Malik Medan meninggal dunia di ruang Rindu A1. Keduanya meninggal secara beruntun Selasa (14/7) dan Rabu (15/7) malam. 11

Muslim Sulit Masuk Al Aqsa Wartawan Waspada beserta rombongan tour dari Siar Haramain baru-baru ini melakukan kunjungan ke masjid Al Aqsa seusai melaksanakan ibadah umroh. Mereka merupakan warga Indonesia pertama dalam tiga tahun ini yang berhasil masuk Al Aqsa— tempat take off Nabi Muhammad SAW ke Sidratul Muntaha dalam peristiwa Isra’ Miraj. Sulit masuk ke sana. Penguasa Israel menjaga wilayahnya secara ketat meskipun hanya warga dari tiga negara saja yang diizinkan mengunjungi masjid suci bersejarah bagi umat Islam itu. Bagaimana pengalaman mereka? Ikuti catatan perjalanan Wapemred Waspada, Azwir Thahir, Senin 20 Juli mendatang.

lebih jauh. Menurutnya yang perlu dipahami kondisi dan situasi Antasari yang kini sedang berada di tahanan. “Kasus itu tidak terkait dengan pembunuhan. Ada pihakpihak yang memanfaatkan untuk kepentingan lain. Kami juga tidak ikhlas,” jelasnya. Antasari sebelumnya dita-

han setelah dijadikan tersangka pembunuhan Direktur Utama PT Putra Rajawali Banjaran (PRB) Nasrudin Zulkarnaen. Motif kasus pembunuhan ini sementara diduga karena cinta segitiga antara Antasari, Nasrudin dan Rhani Juliani.

Lanjut ke hal 2 kol. 7

Waspada/Edoard Sinaga

AKSI DORONG: Massa yang menolak pemindahan SMA Negeri 4 dan SD Negeri 122350 terlibat dorong-dorongan dengan petugas Satpol PP Pemko dan pihak kepolisian, Kamis (16/7).

Massa Masuki Lokasi SMA Negeri 4 P. Siantar P.SIANTAR (Waspada): Para siswa, guru, komite sekolah, alumni, LSM dan berbagai elemen akhirnya berhasil masuk ke dalam lokasi SMA Negeri 4 di Jalan Pattimura, Kota Pematang Siantar, pada hari keempat masuk sekolah, Kamis (16/7).

Pemondokan Haji Siap, Arab Saudi Tidak Sediakan Transportasi JAKARTA (Waspada): Sekretaris Direktorat Jenderal Penyelenggaran Haji dan Umroh Abdul Ghafur Djawahir mengatakan Departemen Agama telah menyediakan pemondokan untuk jamaah haji di Arab Saudi. Dia mengatakan kisruh pengadaan pemondokan pada musim haji tahun lalu, tidak akan terulang. Hanya Ghofur mengakui masih mengalami kendala soal transportasi untuk jamaah. “Yang masih menjadi kendala saat ini adalah transportasi,” kata Ghofur, di Jakarta, Rabu (15/7). Menurutnya, pihak Arab Saudi tidak mau menyediakan transportasi meski RI telah sudah menyiapkan dana untuk penyediaan kendaraan. “Dalam hal ini, Depag akan melibatkan Dirjen Perhubungan Darat, Departemen Perhubungan untuk

penyediaan kendaraan selama pelaksanaan haji,” tandasnya. Sementara itu, mengenai paspor hijau, Ghofur menyatakan, pihak imigrasi telah menyiapkan stok paspor sebanyak 230.000 buah. Paspor sebanyak 12 lembar dipastikan tidak akan digunakan. Belum jelas apakah paspor dengan 24 atau 48 lembar yang akan digunakan. Paspor 24 dan 48 lembar, masing-masing dikenakan biaya Rp150.000 dan Rp270.000. Pemerintah dan DPR mendukung pembuatan paspor hijau dan membuat tim yang terdiri dari Depag dan Depkumham untuk menyusun Perpu pengganti UU nomor 13/2008 tentang pelaksanaan haji dan umrah. Saat ini ada dua UU yang melarang jamaah haji menggunakan paspor lain, selain pas-

por coklat. Nantinya diharapkan jamaah tidak akan mengalami kesulitan soal paspor. Segera Teliti Vaksin Pemerintah Arab Saudi segera meneliti kebenaran vaksin haji (vaksin meningitis) berindikasi mengandung enzim babi. “Kini pihak Arab Saudi mulai memahami keresahan umat Islam Indonesia terhadap vaksin meningitis,” kata Plh Kepala Bidang Penyelenggaraan Haji Zakat dan Wakaf Kanwil Depag Bengkulu, Zahdi Taher di Bengkulu, Kamis(16/7). Mengenai teknis vaksinasi meningitis, dilaksanakan Dinas Kesehatan sepenuhnya. Sebab itu secara teknis terserah apakah pihak Dinkes provinsi mendatangi daerah calon jamaah haji atau diserahkan ke Dinkes kab/ kota masing-masing.(mch/ant)

Mereka menerobos masuk sesudah pertemuan antara Walikota RE Siahaan dengan para delegasi siswa, guru, komite sekolah, alumni, LSM dan beberapa elemen peduli SMA Negeri 4 dan SD Negeri 122350 di ruang rapat Mapolres Simalungun gagal mencapai kesepakatan. Walikota tetap mempertahankan pemindahan SMA Negeri 4. Walikota didampingi ketiga Asisten Jonson Simanjuntak, Djumadi dan Marihot Situmorang, Kadis KCS Esron Sinaga, Kadis Pendidikan Surung Siallagan dan lainnya bersama Muspida terdiri Kapolresta AKBP Andreas Kusmaedi , Dandim 0207/Simalungun Letkol Kav A. Rahman Made, Kajari Nelson Sembiring, Ketua Pengadilan Negeri Sultoni. Sedang pihak yang menolak pemindahan SMA Negeri 4 dan SD Negeri 122350 di antaranya Jansen Napitu, Coky Pardede, Octavianus Rumahorbo dan lainnya. Pada saat itu, pihak yang menolak pemindahan meminta agar pihak DPRD turut hadir dalam pertemuan itu selaku wakil rakyat dan pihak yang memberi izin prinsip lokasi SMA Negeri 4 dan SD Negeri 122350 diruislagh. Kapolresta Bolehkan Siang harinya, mulai pukul 12:10 massa berkonsentrasi dan

nia dalam satu pernyataan, bersama dua warga Georgia, termasuk seorang staf kedutaanbesar negara Kaukasus di Yerevan. Armenia Kamis mengumumkan satu hari berkabung untuk menandai tewasnya warganegara itu dalam kecelakaan tersebut, demikian menurut kantor berita Rusia, ITAR-Tass. Kejatuhan pesawat Iran itu merupakan rangkaian terakhir bencana penerbangan dalam

Menkes Batal Ke Arab Saudi

Oleh H Syarifuddin Elhayat Sabda Rasul,”Ketika islam mula-mula lahir (orang menganggapnya) aneh, dan satu saat akan datang waktunya islam itu juga dianggap aneh,—namun berbahagialah (beruntunglah) orang yang dianggap aneh itu,(mereka adalah), orang-orang yang mereka itu memperbaiki apa yang sudah dirusakbinasakan manusia.

Lanjut ke hal 2 kol. 1

NEW YORK (CNN) : Suatu kekacauan teknis telah mengakibatkan beberapa pemegang kartu kredit pra-bayar Visa terkejut ketika melihat tagihan sebesar AS$23.148.855.308.184.500 pada kertas tagihan mereka. Angka itu kira-kira 2.007 kali utang negara. Josh Muszynski, 22, dari Manchester, New Hampshire, AS, adalah salah seorang pelanggan Visa, terperanjat ketika mengetahui tagihan 17 digit atas rekeningnya. Sebagai tambahan dari keterkejutannya itu, dia juga dikenakan biaya overlimit AS$15. Ada penjelasan yang sama sekali tidak dipahami konsumen, padahal seingat Muszybksi dia hanya pernah belanja dengan bilangan yang tidak diperhatikannya di sebuah stasiun pompa bensin di mana dia selalu melakukan perhentian untuk membeli

MEDAN (Waspada): Gubernur Sumatra Utara H Syamsul Arifin meminta Pemerintah Kota Pematang Siantar tidak gegabah menggusur SMAN 4 dan SDN 122350 Pematang Siantar karena akan membuat proses belajar-mengajar menjadi terlantar. “Kalau bisa jangan dulu digusur, mari kita carikan solusi yang bijak,” katanya ketika menjawab wartawan di Kantor Gubernur Sumut di Jalan Diponegoro Medan, Kamis (16/7). Gubsu mengaku sudah memanggil Walikota Pematang Siantar dan sejumlah pihak terkait untuk mendapatkan penjelasan seputar rencana ruislah (tukar guling) terhadap gedung SMA 4 dan SDN122350 Pematang Siantar. “Mereka kita panggil besok

(Jumat, 17/7). Kita akan memintapenjelasanbaiksecaralisan maupun tertulis,” ujar Gubsu. Kasus ruislah gedung SMAN 4 Pematang Siantar mengemuka pada hari pertama sekolah, Senin (13/7), ketika para siswa mendapati gedung sekolah mereka sudah dipagari sehingga mereka tidak bisa lagi belajar di tempat itu. Akibatnya, ratusan siswa kemudian berunjuk rasa dan merobohkan pagar yang terbuat dari seng yang sudah menutupi gedung sekolah mereka. Mereka menolak dipindahkan belajar ke gedung baru di Jalan Gunung Sibayak Pematang Siantar, apalagi sebelumnya sama sekali tidak ada pemberitahuan sekolah mereka akan dipindahkan. Lanjut ke hal 2 kol. 7

han. Dari Kota Tanjung Balai, dia menumpang salah satu feri tujuan PelabuhanTeluk NibungPort Klang Malaysia dengan ongkos Rp 1,4 juta. Agar keberadaannya tidak diketahui petugas keamanan, dia bersama 1 orang TKI lainnya, disembunyikan awak feri di dalam fiber ikan yang terletak di bagian bawah feri tersebut. “ Kami naik dari gudang atau tangkahan milik agen pelayaran feri itu, dan dari sana kami

Lanjut ke hal 2 kol. 7

Pedagang Kulit Harimau Ditangkap Di Pasar Sibolga Waspada/Surya Efendi

POTONGAN KULIT HARIMAU SUMATERA: Tim SPORC Brigade Macan Tutul Sumut memperlihatkan barang bukti potongan kulit harimau berusia 3 tahun setelah berhasil ditangkap di Pasar Nauli Sibolga, Kamis (16/7).

Pemegang Kartu Visa Terkejut, Tagihan Capai 17 Digit Aneh

Lanjut ke hal 2 kol. 4

Gubsu: Pemko Jangan Gegabah Gusur SMAN 4

TANJUNGBALAI ( Waspada) : Pengiriman TKI ilegal ke Malaysia melalui Kota Tanjung Balai kini memakai modus baru. Jika sebelumnya hanya memanfaatkan jasa kapal ikan atau tongkang dan paspor pelancong, maka kini menggunakan jasa angkutan kapal cepat atau feri, dengan modus disembunyikan di dalam fiber ikan atau kamar mesin. Seperti pengakuan salah seorang mantan TKI ilegal, Syaiful, 20, warga Desa Punggulan, Kec Air Joman, Kabupaten Asa-

Lanjut ke hal 2 kol. 7

MEDAN (Waspada): Bertambahnya kasus flu babi terutama yang menyerang warga Indonesia setelah melakukan perjalanan dari luar negeri, membuat Menteri Kesehatan RI Siti Fadilah Supari membatalkan keberangkatannya ke Arab Saudi. “Seyogianya ibu Menkes atau pak Sekjen Depkes Lanjut ke hal 2 kol. 4

Namun, pihak peduli SMA Negeri 4 kalah tenaga dan terdorong mundur. Sesudah beristirahat beberapa saat kembali massa peduli SMA Negeri 4 bergerak hendak

TKI Ilegal Disembunyikan Di Dalam Fiber Ikan Feri

Dua Kotak Hitam Pesawat Iran Ditemukan, Salah Satu Rusak TEHERAN, Iran (AP): Para penyelidik telah menemukan dua dari tiga kotak hitam pesawat Iran buatan Rusia yang jatuh tidak lama setelah lepas landas dari Teheran, demikian menurut radio pemerintah Iran Kamis (16/7). Seluruh penumpang dan awak pesawat Caspian Airlines yang berjumlah 168 orang yang terbang menuju Yerevan, Armenia, tewas. Laporan radio itu mengutip kepala tim penyelidik Ahmad Majidi seperti mengatakan salah satu dari dua kotak hitam yang ditemukan itu berada dalam keadaan rusak. Kotak hitam itu — perekam suara cockpit dan data penerbangan — akan dikirimkan ke pabrik pesawat Rusia untuk dianalisa.Pencarian untuk kotak hitam ketiga masih dilanjutkan, kata Majidi. Mayat para korban akan dibawa ke Teheran Kamis siang untuk diidentifikasi, katanya menambahkan. Sebagian besar penumpang adalah warga Iran, 11 anggota tim judo junior nasional Iran. Lima warga Armenia termasuk di antara korban tewas, kata Kementerian Luar Negeri Arme-

mengatur barisan hendak menerobos pagar betis petugas Satpol PP dengan pihak kepolisian. Sesudah mendapat abaaba melalui pengeras suara, massa dari pihak yang peduli SMA Negeri 4 segera bergerak dan terjadi dorong-dorongan.

rokok kesenangannya Camel.”Sangat, sangat memanikkan,” dia melompat ke dalam mobilnya dan melarikannya dengan cepat ke stasiun pompa bensin itu. Dia berharap mendapat penjelasan atas tagihan ‘yang menggusarkan’ itu dan dia segera bertanya pada kasir di stasiun tersebut. Wanita itu kemudian memeriksa rekaman yang dibuatnya. Namun tidak ada. Muszynski amat heran dan bertanya barang apa yang telah dibelinya dengan harga yang astronomis itu. “Dapatkah saya membeli Eropa di stasiun pompa bensin 4?” Dia kemudian menghubungi Bank of America, bagian penerbitan kartu kredit Visa pra-bayar. Setelah menunggu

Lanjut ke hal 2 kol. 7

MEDAN (Waspada): Tim Satuan Polisi Kehutanan Reaksi Cepat (SPORC), Kamis (16/7), berhasil menggagalkan perdagangan kulit harimau Sumatera di Pasar Nauli Sibolga. Seorang tersangka dan sejumlah barang bukti langsung diboyong hari itu juga ke Markas SPORC di Jl. Karya, Desa Mariendal, Kab. Deli Serdang. Ketua Tim Operasi SPORC Brigade Macan Tutul Sumut, Sofyan Siregar didampingiWakil Ketua Tim Musriadi kepada Waspada mengatakan penangkapan perdagangan satwa langka dan dilindungi ini terungkap berkat patrol rutin tim yang telah lama dan mensinyalir kawasan Sibolga merupakan pusat perdagangan satwa langka terutama harimau mati ini untuk Sumut. ‘’Tim berhasil menangkap Amon Alfon Simatupang, 56, warga Sibolga yang berprofesi sebagai pedagang satwa langka di kawasan Pasar Nauli Sibolga berikut sejumlah kulit harimau

Sumatera yang telah terpotongpotong, beberapa lembar kulit rusa dan kuku biawak. Potongan kulit harimau Sumatera ini dijualnya seharga Rp50 ribu untuk potongan kecil hingga Rp1 juta lebih untuk potongan besar,’’ sebut Sofyan. Kepada tim, Amon Alfon Simatupang mengaku telah lama berprofesi sebagai pedagang satwa langka yang telah mati. Dia mengaku semua jenis satwa langka tersebut diperolehnya

Lanjut ke hal 2 kol. 4

erampang Seramp ang - Pemondokan siap tapi disuruh jalan kaki? - He...he...he...


Berita Utama

2 KPK Tahan Mantan Dirjen JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK), Kamis (16/7), menahan mantan Direktur Jenderal Pembinaan Hubungan Industrial (PHI) Depnakertrans, Musni Tambusai terkait kasus dugaan korupsi pengelolaan aset Yayasan Dana Tabungan dan Pesangon Tenaga Kerja Sektor Migas. “Hari ini (Kamis) KPK melakukan upaya penahanan terhadap tersangka MT,” kata Juru Bicara KPK, Johan Budi di Jakarta. Musni dimasukkan ke mobil tahanan sekira pukul 17.30 WIB. Musni yang mengenakan kemeja putih tidak memberikan keterangan sedikitpun kepada wartawan. Rencananya, Musni akan ditahan di rumah tahanan Cipinang, Jakarta Timur. Menurut Johan, Musni diduga terlibat dalam dugaan korupsi pengelolaan aset Yayasan Dana Tabungan dan Pesangon Tenaga Kerja Sektor Migas pada 2003 sampai 2008. KPK menduga penyelewengan dana tenaga kerja migas tersebut telah merugikan negara sekira Rp107 miliar dan 328 ribu dolar AS. Atas perbuatannya, Musni kemungkinan dijerat dengan pasal 2 ayat (1) atau pasal 3 atau pasal 5 ayat (2) atau pasal 12 huruf e atau pasal 11 UU Pemberantasan Tindak Pidana Korupsi. Yayasan Dana Tabungan dan Pesangon Tenaga Kerja Sektor Migas adalah yayasan milik Depnakertrans yang telah dilikuidasi sejak

tahun 2000. Proses likuidasi berlangsung dua tahun, hingga 31 Desember 2002. Pada tahun 2002, Musni diangkat sebagai penanggung jawab aset yayasan melalui Surat Keputusan Menteri No 225 tahun 2002. Tim penanggungjawab aset seharusnya menyetor aset yayasan yang bernilai Rp134,4 miliar kepada negara. Namun, Musni diduga menggunakan aset secara melawan hukum. Dalam kasus itu, KPK telah memeriksa mantan Menteri Tenaga Kerja, Cosmas Batubara dan mantan Menteri Menteri Pertambangan dan Energi, Ginanjar Kartasasmita. Cosmas mengakui telah terjadi pungutan terhadap pekerja sektor minyak dan gas (migas) untuk membentuk Yayasan Dana Tabungan dan Pesangon Tenaga Kerja Sektor Migas. Menurut Cosmas, yayasan tersebut dibentuk dengan modal dari Pertamina sebesar Rp10 juta dan pungutan dari pekerja migas. Tiap pekerja wajib menyerahkan 8,33 persen dari upah mereka. “Iuran itu diserahkan melalui perusahaan pemborong,” kata Cosmas. Dia menjelaskan, yayasan dibentuk berdasar surat keputusan bersama antara Menteri Tenaga Kerja dan Menteri Pertambangan dan Energi pada 1989. Cosmas dan Ginanjar mengaku menandatangani surat keputusan bersama pembentukan yayasan tersebut.

Komisi III DPR Akan Panggil Kapolri BANDUNG (Antara): Komisi III DPR RI segera memanggil Kapolri terkait laporan masyarakat atas tindakan Kepolisian Daerah (Polda) Jabar yang dinilai melanggar HAM dalam proses penanganan proses hukum untuk Dirut PT Metro Garment berinisial GG. Wakil Ketua Komisi III DPR RI, Suripto mengatakan, Kamis (16/7), pihaknya akan memanggil segera Kapolri atau akan lebih baik, DPR yang akan mendatangi Polri terkait masalah ini. “Kita menilai, kepolisian, khususnya Polda Jabar, telah melecehkan HAM dan tindak-tanduknya sangat memalukan, apalagi terjadi saat aparat menjalankan tugas yang seharusnya tetap mengacu norma dan etika,” ujarnya. Hal itu membuktikan bahwa reformasi Polri yang didengungkan tidak berjalan sesuai harapan masyarakat. Polri yang diharapkan menjadi pelindung dan pengayom masyarakat, justru cenderung mengedepankan kekerasan terhadap masyarakat. “Itu menunjukkan, polisi tidak menjalankan tugas pokoknya sesuai fungsinya. Bagaimana cara memproses satu perkara, dan memberikan perlindungan kepada masyarakat,” ucapnya. Komisi III DPR RI secara resmi menerima laporan tertulis terkait GG yang ditangkap serta diperlakukan seperti seorang teroris pada

malam tanggal 15 Mei 2009. Dalam isi laporan resmi itu, tambah Suripto, saat penangkapan GG, petugas Ditreskrim Polda Jabar tidak disertai surat penahanan. “Sebelum ditangkap paksa, GG selalu kooperatif menjalani pemeriksaan. Tindakan polisi seperti ini juga pernah terjadi di Jawa Timur, dan terakhir di Semarang Jawa Tengah,” ungkapnya Dia menegaskan, masalah ini akan menjadi salah satu bahasan utama di Komisi III DPR RI. Suripto berpendapat, seharusnya institusi Polri, bisa menerapkan sanksi internal terhadap anggotanya yang terbukti menyalahi prosedur hukum dalam menjalankan proses hukum. Sebelumnya, GG yang merupakan Dirut PT Metro Garment di Jalan Dayeuhkolot Kabupaten Bandung terlibat perselisihan keluarga dalam kepemilikan saham di perusahaan itu pada 28 November 2008. Masalahnya, penangkapan dan penahanan Dirut PT Metro Garment yakni GG, tidak prosedural. Kasus yang semula dijerat dengan Pasal 406 KUHP Tentang Perusakan kepada GG pada November 2008, namun pada Mei 2009, diubah menjadi Pasal 170 KUHP Tentang Perusakan Disertai Penganiayaan Secara Bersama-sama.

Pemerintah Ingin Presiden Bisa Diwakili Dalam Interpelasi JAKARTA (Antara): Pemerintah tetap ingin agar presiden bisa diwakili oleh menteri atau pimpinan lembaga pemerintah nondepartemen dalam menyampaikan sikap atau jawaban pemerintah jika DPR mengajukan hak interpelasi . “Kami melihat bahwa perlu dibuka peluang agar presiden dapat diwakili,” kata Dirjen Otonomi Daerah Departemen Dalam Negeri Sodjuangon Situmorang kepada pers di Jakarta, Kamis (16/7) petang. Sodjuangon memberikan keterangan tentang pembahasan RUU Susudan dan Kedudukan (Susduk) MPR, DPR, DPD dan DPRD dalam posisinya selaku Ketua Panitia Kerja (Panja) Pemerintah. Dalam jumpa pers ini, Sodjuangon didampingi Kepala Pusat Penerangan Depdagri Saut Situmorang. Sodjuangon mengatakan materi RUU ini sudah banyak yang disepakati antara pemerintah dengan DPR. Rapat Kerja Pansus RUU Susduk ini akan dilakukan tanggal 2 Juli dan diharapkan RUU ini bisa disetujui menjadi undangundang pada tanggal 3 Agustus dalam sidang yang disebut menjadi rapat paripurna khusus. Masalah jawaban atas hak interpelasi ini belum disepakati oleh pemerintah dengan DPR. Selama tahun 2004-2009, DPR telah beberapa kali mengajukan hak interpelasi dan Presiden Susilo Bambang Yudhoyono sudah berulang kali diwakili para menterinya.. “Hak interpelasi diajukan kepada pemerintah, bukan hanya kepada presiden,” kata Sodjuangon. Pemerintah juga berpendapat bahwa karena para menteri dan pimpinan lembaga peme-

rintah adalah orang-orang yang menguasai masalah teknis maka adalah pantas jika menteri dan pimpinan lembaga pemerintah itulah yang memberikan jawaban atas hak interpelasi itu walaupun presiden juga harus memahami masalah teknis yang ditanyakan DPR itu. Sodjuangon mengatakan pula bahwa Tata Tertib DPR juga memberikan peluang kepada seorang presiden untuk menunjuk seorang menteri atau pejabat tinggi lainnya guna memberikan penjelasan pemerintah tentang masalah penting yang ingin ditanyakan kepada pemerintah. “Pemerintah optimis bahwa DPR akan bisa memahami posisi pemerintah,” kata Dirjen Otonomi Daerah sambil menyebutkan bahwa selayaknya seorang presiden bisa diwakili pembantu seniornya karena tugasnya yang begitu banyak dan berat. Sodjuangon mengatakan pula bahwa selain masalah hak interpelasi yang belum disepakati pemerintah dengan DPR, maka ada beberapa masalah lain yang belum disepakati kedua pihak. Sodjuangon memberi contoh bahwa pemerintah ingin agar judul RUU ini adalah tetap menggunakan kata-kata susunan dan kedudukan, sedangkan DPR tidak menginginkan adanya kata-kata itu. Masalah lain yang belum disepakati adalah tentang pembentukan fraksi-fraksi di MPR karena ada beberapa alternatif misalnya fraksi dibentuk dengan minimal 50 anggota serta fraksi dibentuk oleh partai politik yang memenuhi ambang batas perolehan suara kursi di DPR atau parliamentary threshold.

Al Bayan ...

gup menyebut dirinya sebagai agama terakhir didunia ini. Wes—— titik Namun begitu kadang ketika kita melihat-lihat keadaan disekeliling kita hari ini, kitapun melihat aneh-aneh yang dilakukan dan dipercayai orang-orang muslim,—afwan— jangan tersinggung. Akhir-akhir ini kitapun sering terperanjat melihat siaran di televisi, betapa ada seorang yang memakai simbol Islam menyebut dirinya sebagai Ustazd cinta serta membuka nomor Reg mampu menunjukkan jodoh yang bagus bagi seseorang. Adalagi orang yang bisa ‘mengubah takdir’ seseorang dari nelayan ‘disulap’ jadi pegawai kantor, bahkan nama yang sudah ditabalkan saat kekahanpun (aqiqah) bisa diubah jadi yang lain, karena alasan tak cocok dengan dirinya meskipun dia juga sudah mengkekahkan (istilah bagi Aqiqah) cucu-cucunya. Hari ini ada sementara saudara-saudaraku yang muslim,— tanpa sungkan,—membukakan aib keluarganya di depan kamera ‘Curhat’ bersama Anjasmara,— pukul-pukulan, jambak menjambak, saling membuka kelemahan dan itu disaksikan ,—mungkin— jutaan pasang mata. Ada kegandrungan orang hari ini untuk memunculkan mistik dan tahyul, bersunglap,—bahkan mungkin bagaikan sihir menyihir dilayar kaca “The master’ hingga sikecilpun tak luput dari teriakan, hebbaat tu orang, gimana caranya agar aku bisa seperti dia. Ah— antahlahhh,—orang aneh,—. Tapi menurut pesan di atas ditengah keanehan itulah sebagai seorang muslim kita muncul sebagai sianeh pengubah aneh sehingga akan kita memperoleh kebahagiaan. Caranya Ncek,—kembali ‘kebumi’ Islam,— selamatkan diri, anak, keluarga, masyarakat bahkan anak bangsa ini dengan aqidah, syariah dan ibadah dari aneh dunia itu agar bisa ‘mi’raj’ menuju arasy.—Ilahi Anta Maqshudi Wa ridhoka Mathlubi, A’thini ma’rifatika wa mahabbatika— —,Ya Tuhanku hanya Engkaulah yang menjadi tujuanku, dan RidoMulah yang aku cari, (karena itu) beri aku (jalan untuk lebih mengenal-Mu dan lebih mencintaiMu. Aneh harus memberantas Aneh,—ya aneh,—afwan— -ambe hanya sekadar menyadur sabda.

Pernyataan Rasul diatas meskipun terlihat singkat, namun sarat dengan pesan dan dalam dengan makna filosofi. Aneh,— Islam dianggap aneh,—dan akan datang satu saat Islam dianggap aneh. Di tengah percaturan dunia arab quraisy yang ketika itu sarat dengan berbagai sembahan dan tradisi nenek moyang orangpun menuhankan roti yang dia buat sendiri untuk kemudian –saat dia lapar,— lantas roti yang dia sembah itu dia makan agar perutnya kenyang, disitulah rasul datang dengan ‘membawa’ Islam menyebutkan tidak ada tuhan yang wajib disembah kecuali Allah. Orangorangpun kemudian menganggap rasul Muhammad jadi orang yang aneh bahkan sebagai seorang gila. Ketika rasul sedang ditimpa berbagai rintangan dan masalah untuk mengembangkan Islam,(provokasi Abu Jahal dan Abu Lahab menantang Muhammad semakin menjadi-jadi, isteri tercintanya Khadijah meninggal dunia, dan paman yang memeliharanya dan membelanya juga dijemput Allah) lantas Allahpun ‘mengundangnya’ untuk bertemu dan ‘bertamu’ kehaderatNya untuk menerima petunjuk solusi yang mampu memecahkan itu semua (solat), maka perjalanan isra dan mi’rajnya juga disebut sebagai sesuatu yang aneh. Ketika Rasul mendakwahkan agama ini dengan lemah lembut penuh kesantunan, Rasul Muhammad juga dianggap bersikap dan bertingkah polah yang aneh-aneh,- Begitulah seterusnya,— hingga hari ini,—Islam dianggap aneh-aneh dan keanehan itu bagaikan sengaja dicari-cari, -seperti Islam disebut sebagai agama yang memaksakan kehendak, Islam dianggap agama yang tidak toleran, Islam dinilai sebagai agama yang mengungukung dan mengkerangkeng pemeluknya sehingga tidak bebas berkembang membuka cakrawala pemikirannya. Ah—— poko e anehlah, padahal sebenarnya bukanlah aneh, -tapi ane aja yang aneh melihatnya sebagai aneh. Tidak ada agama samawi yang lebih lengkap sempurna di dunia ini kecuali Islam, -kalau bukan Islam tidak agama yang sempurnya diapun tak sang-

Menkes Batal ... meresmikan rumah sakit Islam khusus untuk jamaah haji Indonesia di Arab Saudi. Namun rencana itu dibatalkan karena banyak sekali warga Indonesia terserang flu babi setelah pulang dari luar negeri,” kata Kepala Pusat Promosi Kesehatan (Promkes) Departemen Kesehatan RI dr. Abidinsyah Siregar, DHSM, MKes kepada Waspada di Medan, Kamis (16/7) sore. Menurut Abidinsyah, keputusan Menkes membatalkan kunjungan ke Arab Saudi untuk mencegah kemungkinan terinfeksi virus H1N1. Seharusnya, pertimbangan seperti ini dicontoh oleh masyarakat Indonesia. Jika tidak ada keperluan yang penting, maka jangan pergi ke luar negeri. “Sebaliknya, jika pulang dari luar negeri, maka dipastikan bahwa kita tidak demam dan tidak terinfeksi virus H1N1. Karena, banyak warga Indonesia yang terserang flu babi se-

Pedagang Kulit ... dari para pemburu. Lebih lanjut, Sofyan mengatakan Amon Alfon Simatupang menjualnya secara sembunyi-sembunyi di sebuah kios di Pasar Nauli Sibolga. Sofyan juga mengatakan, menurut UU no.5 tahun 1990 pasal 2 ayat 2 yang antara lain berbunyi barang siapa yang menangkap, melukai, me-

Abdillah Lega ... Meski demikian, JPU KPK kurang puas atas putusan banding Pengadilan Tinggi tersebut, kemudian kembali mengajukan kasasi ke MA (bukan Abdillah yang mengajukan kasasi sebagaimana diberitakan kemarin, yang dikutip dari Kompas.com-Red.). Oleh MA, Rabu (15/7), menolak kasasi yang diajukan oleh JPU KPK dan mengeluarkan putusan terhadap Abdillah sebagai tidak terbukti melakukan tindak pidana korupsi sebagaimana primer pasal 2 UU Tipikor. Dalam putusan MA tersebut, Abdillah hanya dikenakan subsider pasal 3 dengan hukuman kurungan 4 tahun dan diwajibkan mengembalikan uang pengganti sebesar Rp12,1 milyar. Atas putusan MA inilah, Abdillah yang ditemui wartawan Waspada Hasriwal AS di Rumah Tahanan Polda Metro Jaya, Kamis (16/7), menyatakan, putusan MA yang menolak kasasi JPU menunjukkan dirinya tidak melakukan korupsi sebagaimana primer pasal 2 UU Tipikor yang dituntut JPU kepadanya. “Setidaknya ada rasa syukur dan keadilan atas putusan MA ini. Selain subsider pasal 3 yang dituduhkan kepadanya membuktikan bahwa saya tidak terbukti dan tidak pernah melakukan korupsi sebagaimana primer pasal 2,” tutur Abdillah. Mengenakan pakaian kemeja hijau dan celana panjang batik, Abdillah menegaskan, apa yang dilakukannya selama

Massa Masuki ... menerobos masuk. Ketika massa peduli SMA Negeri 4 berhasil didorong, ratusan siswa yang berada di sebelah kanan segera bergerak menerobos hingga saat itu terjadi kericuhan akibat beberapa siswa terkena pukulan dan tendangan dari beberapa oknum tanpa seragam. Pihak kepolisian segera melerai hingga kericuhan terhenti. Kemudian Kapolresta memanggil Ketua Poros Kota Imran Simanjuntak dan mengizinkan mereka masuk ke dalam lokasi SMA Negeri 4. Waka Polresta Kompol ES. Silalahi langsung mengumumkan melalui pengeras suara persetujuan Kapolresta membolehkan massa masuk ke dalam lokasi SMA Negeri 4. Akhirnya pintu gerbang dibuka dan massa dengan bersorak-sorak masuk ke dalam lokasi SMA Negeri 4. Di dalam lokasi SMA Negeri 4, massa mengadakan doa bersama, upacara nasional penaikan bendera dan mendapat upah-upah dari tokoh masyarakat DM. Ater Siahaan. Kapolresta yang dihubungi sesudah massa masuk ke dalam lokasi SMA Negeri 4 menyebutkan agar semua senang dan atas pertimbangan di lapangan dengan harapan di dalam jangan anarkis. Ketika didesak, Kapolresta menyebutkan atas pertimbangan Muspida hingga pihak yang menolak pindah SMA Negeri 4 dan SD Negeri 122350 boleh masuk ke dalam lokasi SMA Negeri 4. Menjawab pertanyaan, Kapolresta menyebutkan masalah lokasi SMA Negeri 4 dan SD Negeri 122350 itu akan ditindaklanjuti dengan DPRD. “Yang mempunyai kewenangan dan keputusan di situ DPRD dan Pemko dan akan diupayakan mediasi antara pihak yang menolak pemindahan SMA Negeri 4 dan SD Negeri 122350 dengan DPRD dan Pemko. Soal sekolah di SMA Negeri 4 itu urusan Pemko.” Mengenai 13 orang dari pihak peduli SMA Negeri 4 dan SD Negeri

telah ke luar negeri,” ujarnya. Hingga Kamis (16/7) sore, Departemen Kesehatan RI melaporkan secara kumulatif sebanyak 157 orang terserang flu babi. Terakhir dilaporkan adanya pertambahan 15 kasus flu babi yang berasal dari Jakarta 10 orang, Medan 1 orang berinsial YM, 20, Yogyakarta 1 orang, Surabaya 1 orang, Bali 1 orang dan Bandung 1 orang. Bahkan empat di antara pasien flu babi tersebut memiliki riwayat pergi ke luar negeri yaitu ke Malaysia 1 orang, Australia 2 orang dan China 1 orang. Harus dipisah Mengenai kemungkinan bersatunya virus H1N1 dan H5N1, Abidinsyah mengatakan, banyak pakar yang memperkirakan hal itu bisa terjadi. Alasannya, ada persamaan yakni sama-sama berasal dari grup H dan grup N. Kondisi ini memungkinkan virus tersebut bertemu di grup H atau di grup N. Karena itu, lanjut Abidinsyah, Menkes telah mengingatkan seluruh rumah sakit melihara satwa yang dilindungi baik dalam keadaan hidup atau mati akan di penjara 5 tahun dan denda Rp100 juta. ‘’Saat ini tersangka sedang kita proses,’’ tuturnya. Sebagaimana diketahui, kult harimau khususnya harimau Sumatera ini sangat berharga tinggi. Kulitnya ini bisa dijadikan ramuan obat-obatan untuk sebagai jenis penyakit bahkan untuk jimat.(h03)

agar memisahkan penanganan pasien flu burung dengan virus H5N1 dan pasien flu babi dengan virus H1N1. “Kita mencegah kemungkinan yang rasional tadi, yakni bergabungnya virus H5N1 dan H1N1 jika pasien flu burung dan flu babi dirawat di ruang yang sama. Prosedur tetap pemisahan pasien flu burung dan flu babi ini harus dijalankan oleh semua rumah sakit,” tambahnya. Soal anggapan ketua Ikatan Dokter Indonesia (IDI) bahwa pasien flu babi tidak perlu diisolasi, Abidinsyah berpendapat, sepanjang belum diketahui penyebabnya, maka pasien yang memiliki gejala panas di atas 39 derajat Celcius, sesak nafas, batuk, bersin, terkadang diikuti dengan nyeri sakit kepala harus segera diisolasi. Sebab, gejala seperti ini tergolong unik untuk kelompok penyakit influenza. “Kalau gejalanya agak unik dan belum ada konfirmasi tentang penyebab penyakit, maka pasien itu harus diisolasi. Karena pasien tersebut punya kesempatan untuk menyebarkan virus kepada orang lain,” tambahnya. Tapi, kalau gejalanya ringan dengan temperatur tubuh masih 38 derajat Celcius, mungkin bisa ditangani sendiri di rumah. Misalnya, banyak mengkonsumsi makanan bergizi, cukup minum dan istirahat dan tidak keluar rumah,” demikian Abidinsyah.(m26)

menjadi Walikota Medan merupakan amanah masyarakat dan amanah itu selalu dipegangnya sampai kini. Meski berada di dalam Rutan Polda Metro Jaya sejak 2 Januari 2008, Abdillah tidak pernah melupakan kebaikan masyarakat kota Medan yang sampai saat ini selalu mengunjungi dan menanyakan khabar dirinya. Kembali ke Medan Dalam perbincangan dengan Waspada, Abdillah sempat meminta pendapat, apakah sebaiknya setelah lepas menjalani hukuman yang meski dia tidak pernah terbukti melakukan tindak pidana korupsi itu harus tetap berada di Jakarta atau kembali ke kota Medan yang memang sangat dia cintai. Setelah mendengar berbagai pendapat, Abdillah menyatakan akan kembali ke Medan dan akan terus berbuat untuk pembangunan dan kebaikan masyarakat Medan khususnya dan Sumut pada umumnya. “Insya allah masyarakat kota Medan dan Sumut masih seperti dulu, mau menerima saya dan keluarga,” tuturnya perlahan. Abdillah yang tampak sehat dan tidak terlihat gemuk apalagi kurus dalam menjalani aktivitasnya di Rutan, lebih lanjut menyatakan, rasa syukur atas keadilan yang diterimanya. “Putusan MA yang menyatakan saya tidak terbukti korupsi membuat saya kuat untuk kembali ke Medan,” ucapnya tanpa ingin melontarkan program-progam atau aktivitas apa yang akan dilakukannya pada tahun 2010 di

Medan. Karena dua pertiga hukuman telah dijalaninya (bisa mengajukan bebas bersyarat, Red), Abdillah mengatakan, hanya rindu kota Medan dan kebersamaan dengan masyarakat Medan. “Terus terang kerinduan yang mendalam dengan Medan dan masyarakat, membuat saya tenang dan tidak henti-hentinya berdoa untuk tetap kuat dalam menjalani hukuman ini,” ujarnya. Abdillah juga menyampaikan terimakasih dan apresiasinya yang mendalam atas sikap dan pengertian dari masyarakat serta tidak henti-hentinya selalu mendoakan dirinya. “Banyak pengajian, baik bapak-bapak maupun kaum ibu yang tengah mengaji, memberikan semangat dan doa kepada saya. Tidak hanya dari masyarakat kota Medan, tapi juga dari Labuhanbatu, Binjai, Sidikalang dan daerah lain di Sumut,” katanya. Abdillah yang kini masih berada di Rutan Polda Metro Jaya yakin, dirinya masih dapat diterima masyarakat Kota Medan dan Sumut, sekembalinya menjalani hukuman. Hal ini dikarenakan dirinya tidak satu sen rupiah pun melakukan tindak pidana korupsi, sebagaimana putusan kasasi MA yang menyebutkan dirinya tidak terbukti melakukan tindak pidana korupsi sebagaimana primer pasal 2 UU Tipikor. Sebagaimana diberitakan kemarin, pihak KPK menyatakan segera melaksanakan eksekusi hukuman terhadap Abdillah menyusul keputusan Mahkamah Agung tersebut. (j02)

122350 yang ditangkap pagi harinya ketika masuk ke dalam lokasi SMA Negeri 4 dengan memanjat pagar, Kapolresta melalui Pabungpen AKP Muslim menyebutkan mereka ditangkap akibat bertindak anarkis, melakukan pelemparan seng pagar dan merusak dari dalam lokasi SMA Negeri 4. “Mereka bisa dikenakan Pasal 160 yo Pasal 511 KUH Pidana dan bila unsur-unsur pasal itu terpenuhi meraka akan ditahan atau dilepas bila ada menjamini.” Sementara, Ketua DPRD Lingga Napitupulu yang muncul sesudah bisa masuk ke dalam lokasi SMA Negeri 4 membenarkan sudah dihubungi Kapolresta melalui telefon selular, namun dia tidak mau menghadiri pertemuan di ruang rapat Mapolres Simalungun. Ketua DPRD tidak memberi alasan tidak hadir. Sedang Coky Pardede yang dihubungi menyebutkan belum ada tindak lanjut sesudah bisa masuk ke dalam lokasi SMA Negeri 4 itu. “Sementara menguasai dulu. Soal siswa tidak belajar apa boleh buat.” DPD RI Tanya Pemko Anggota DPD RI Parlindungan Purba yang baru tiba di Pematang Siantar pukul 16:00 dari perjalanan dinas ke Tapanuli Tengah menyebutkan kehadirannya atas perintah Ketua DPD RI, namun pertemuannya dengan Wakil Walikota Imal Raya Harahap tidak jadi, karena Wakil Walikota beralasan ada tugas lain hingga anggota DPD RI itu menemui Kadis Pendidikan dan mempertanyakan masalah penolakan pemindahan SMA Negeri 4 dan SD negeri 122350 itu. Menurut Kadisdik, KBM dipindah ke gedung Jalan Gunung Sibayak dan Jalan Pane serta pemindahan terjadi saat liburan hingga ketika siswa masuk sekolah dan melihat sekolahnya sudah dipagar menjadi keberatan. “Kami sebenarnya sudah meminta agar Kepala SMA Negeri 4 dan SD Negeri 122350 mengumumkan pemindahan itu.” Anggota DPD RI yang baru mengetahui

sudah ada pengganti gedung sekolah baru mengatakan pemindahan itu sebenarnya sudah pas dan mungkin proses ruislagh yang tidak pas. Pada kesempatan itu, anggota DPD RI itu menghubungi Kapolresta dan hasil pembicaraan mereka menyebutkan tidak akan ada penahanan terhadap 13 orang dari pihak yang menolak pemindahan SMA Negeri 4 dan SD Negeri 122350. Mengenai proses ruislah dan pemindahan SMA Negeri 4 serta SD Negeri 122350, anggota DPD RI meminta Walikota membuat laporan tertulis melalui Sekda. Sementara, situasi lokasi tempat pemindahan SD Negeri 122350 di Jalan Pane pada pukul 09:00 terlihat belum ada suasana KBM, beberapa siswa terlihat berjalan-jalan di sekitar lokasi sekolah. Kadis Pendidikan saat itu sedang berada di lokasi, namun pertanyaan yang diajukan dibalas dengan jawaban agar memaklumi posisinya yang hanya melaksanakan perintah. Sama halnya dengan lokasi pemindahan SMA Negeri 4 di Jalan Gunung Sibayak pagi itu terlihat beberapa siswa terlihat duduk-duduk. Kepala SMA Negeri 4 Drs. Mauruddin Sitohang yang baru dilantik 10 Juli 2009 menyebutkan sampai hari itu masih melakukan pendekatan persuasif kepada siswa maupun guru yang menolak pemindahan SMA Negeri 4. “Tindakan persuasif itu paling lama dua minggu. Soal sanksi yang dikenakan bila lewat dua minggu, masih dipikirkan dan mungkin sanksi administrasi ringan” Menurut Sitohang, perbedaan pendapat harus dihargai agar situasi tidak semakin keruh dan keberatan mereka mungkin dari sisi lokasi di Jalan Gunung Sibayak, dimana transportasi mungkin terganggu sedikit. Mengenai sembilan guru SMAN 4 yang dimutasi, Sitohang belum bisa berkomentar, karena baru dilantik dan agar situasi kembali normal, dia akan mencoba memberdayakan semua pihak dan menjelaskan permasalahan yang ada. (a14)

WASPADA Jumat 17 Juli 2009

KPK Diancam Bom JAKARTA (Antara): Gedung Komisi Pemberantasan Korupsi (KPK), Kamis(16/7), menerima ancaman bom dari seseorang tidak dikenal. “Ancaman kami terima sekitar pukul 11.30 melalui telefon,” kata Juru Bicara KPK, Johan Budi di Jakarta, Kamis sore. Pada pukul 16.15 WIB,

Tim Gegana Polda Metro Jaya datang di gedung KPK. Sedikitnya sepuluh anggota Tim Gegana yang dilengkapi dengan sejumlah peralatan langsung memeriksa beberapa ruangan dan lapangan parkir di sekitar gedung tersebut. Tidak ada ditemukan bom di sekitar gedung KPK.

TKI Ilegal ... langsung dimasukkan ke dalam fiber ikan,” ungkap Syaiful kepada Waspada, Kamis (16/7). Setelah melewati Pelabuhan Teluk Nibung, atau tepatnya feri telah memasuki wilayah laut, maka fiber itu baru dibuka, dan Syaiful diizinkan bergabung dengan penumpang lainnya yang memiliki dokumen lengkap serta tiket resmi. Dan, sebelum tiba di Pelabuhan Port Klang, tepatnya di Pulau Cary Malaysia, Syaiful kembali dimasukkan ke dalam fiber. “ Kami diperkenankan keluar dari fiber setelah feri meninggalkan Pelabuhan Port Klang Malaysia menuju gudang atau tangkahan swasta,” ungkap Syaiful. Berbeda jika kembali dari Malaysia ke Pelabuhan Teluk Nibung. Menurut Syaiful, ketika kembali ke tanah air, dia bersama 61 TKI ilegal lainnya disembunyikan di kamar mesin feri yang sama, dengan ongkos RM 800. “ Sebulan lalu, saya kembali dari Malaysia dengan memanfaatkan jasa angkutan fery yang sama, namun bedanya, saya bersama 61 TKI ilegal lainnya disembunyikan di kamar mesin,” ungkap Syaiful. Ingin Kembali Ke Malaysia Meskipun pemerintah menghentikan sementara pengiriman TKI ke Malaysia, khususnya pembantu rumah tangga, namun Syaiful tetap ingin kembali ke negara serumpun itu. Bedanya, jika keberangkatannya yang pertama tanpa dokumen, maka kini dia berencana menggunakan paspor pelancong. Hanya saja, keinginannya itu terpaksa tertunda, karena majikan menolak kehadirannya. “ Nggak tau aku mau kemana, ya terpaksa ditunda dulu,” ujar Syaiful. Lebih lanjut dikatakan Syaiful, saat ini para TKI ilegal di Malaysia, termasuk yang berasal dari kampungnya, berencana pulang ke tanah air karena ketatnya pengamanan di Malaysia. “ Selain mau lebaran, para TKI di Malaysia akan ramai-ramai kembali ke Indonesia, kemungkinan mereka menggunakan jasa angkutan fery,” ungkap Syaiful. Terkait penghentian sementara pengiriman TKI ke Malaysia, Kepala Dinas Tenaga Kerja Kota Tanjung Balai, Halmayanti mengatakan, belum ada TKI legal yang bekerja sebagai PRT dikirim melalui Kota Tanjung Balai. Dan, jelas Halmayanti, pihaknya juga menerima surat resmi tentang penghentian sementara pengiriman TKI ke Malaysia. Di tempat terpisah, Danlanal Tanjung Balai Asahan Letkol Laut (P) Adriansyah menegaskan, pihaknya telah meningkatkan pengamanan dan pengawasan mencegah keluar masuknya TKI ilegal. “ Kita tetap berupaya mempersempit ruang gerak para TKI ilegal dengan meningkatkan pengamanan dan pengawasan,” tegas Danlanal. (a37)

Dua Kotak Hitam ... beberapa tahun terakhir yang menyorot berbagai kesulitan yang dihadapi Iran dalam merawat armada pesawatnya yang telah tua. Beberapa perusahaan penerbangan Iran, termasuk milik pemerintah, mengalami kesulitan dana dan masalah perawatan pesawat mengalami kemacetan, kata para pakar. Saksimata mengatakan ekor pesawat terbakar sebelum jatuh, menghunjam ke tanah sehingga menimbulkan bekas lobang besar dan dalam di perladangan di luar desa Jannat Abad dan pesawat meledak jadi berkeping-keping. Seorang pekerja kemanusiaan, berdiri di sisi kantong mayat, mengatakan tidak ada satu potongan tubuh pun yang bisa diidentifikasi.” Mostafa Babashahverdi, seorang petani setempat, mengatakan pada kantor berita Reuters: “Kami menemukan kepala yang luka parah, potongan jari dan paspor para penumpang. Saya melihat pesawat itu menghunjam ke tanah. Ledakannya menimbulkan suara keras. Seperti gempa bumi,” Ali Akbar Hashemi mengatakan pada AP. (m07)

Pemegang Kartu Visa ... selama hampir dua jam dan selama masa itu dia berpikir mungkin terjadi suatu yang tak beres. Dia juga merasa ketakutan bahwa dia serta anak cucu dan cicitnya akan menanggung beban hutang berkepanjangan. “Kalau begini, tak ada anak cucuku yang punya uang.” Akhirnya, seorang perwakilan bank memberitahunya bahwa tagihan AS$23.148.855.308.184.500 itu — dan tambahan biaya AS$15 — akan dihapus dari rekeningnya. Muszynski membandingkan hutang raksasanya itu seperti menerima ‘satu kartu menakjubkan permainan Monopoli.’ “Tetapi ini suatu kekeliruan.” Dalam satu pernyataannya, Visa mengatakan tagihan ‘nakal’ itu telah ‘mempengaruhi lebih dari 13.000 transaksi pra-bayar’ dan terjadi akibat ‘kesalahan program di bagian Prosesing Pelayanan Debit Visa... yang menyebabkan beberapa transaksi menjadi tidak akurat dikirimkan kepada sejumlah kecil rekening pra-bayar Visa.’ Perusahaan itu meyakinkan para pelanggannya bahwa problem itu telah diatasi dan semua biaya yang salah yang telah dikeluarkan telah dibatalkan. (m07)

Gubsu: Pemko ... Di lokasi SMAN 4 itu rencananya akan dibangun hotel berbintang, sementara lokasi baru yang disediakan pihak ketiga dinilai siswa dan sebagian guru sangat tidak layak. Menurut Gubernur Syamsul Arifin, kasus ruislah gedung SMAN 4 dan SDN 122350 Pematang Siantar harus dapat diselesaikan secara bijak. “Tidak ada yang boleh dirugikan dalam persoalan itu, apalagi sampai harus menelantarkan anak didik. Ini masalah pendidikan dan itu merupakan visi kita di Sumut,” tegasnya. Namun begitu gubernur mengaku masih harus menunggu laporan dari Walikota dan Muspida Kota Pematang Siantar. “Saya sudah panggil mereka dan kita tunggu laporan lisan dan tertulisnya besok,” ujarnya. (m19)

Antasari Juga ... Namun polisi mengembangkan kasus lain setelah memegang data yang diambil dari laptop Antasari. Kapolri Jenderal Pol Bambang Hendarso Danuri membenarkan pengembangan kasus lain ini. Saat ditanya wartawan saat ulang tahun Polri pada 1 Juli lalu dia menyebutkan pihaknya melakukan penyidikan-penyidikan lain. Terakhir berkembang isu Kejagung dan Polri akan melakukan gelar perkara untuk membahas kasus korupsi di KPK. Namun isu ini dibantah Jaksa Agung Hendarman Supandji. Terima SPDP Kejaksaan sudah menerima Surat Perintah Dimulainya Penyidikan (SPDP) dari penyidik kepolisian terkait kasus dugaan suap Komisi Pemberantasan Korupsi (KPK). Hal itu dikatakan Ketua Komisi III DPR, Trimedya Pandjaitan, seusai acara penandatanganan kesepahaman (MoU) antara Kejagung dan Mahkamah Agung (MA), di Jakarta, Kamis (16/7). Trimedya menyatakan jaksa agung tidak secara eksplisit mengatakan seperti itu, hanya bilang apa yang diajukan kepolisian masih kurang buktinya. “Kata-kata itu, itu sudah SPDP. Bagi kita yang mengerti hukum acara, itu sudah SPDP,” katanya. Dikatakan, SPDP itu merupakan komunikasi awal antara polisi dan jaksa. “Ini bukan soal pembunuhan, salah satunya, soal Masaro,” katanya. Sementara itu, Jaksa Agung, Hendarman Supandji, menyatakan, pihaknya belum menerima dari pihak kepolisian mengenai SKDP tersebut. “Pasti saya sampaikan kalau sudah diterima,” katanya. Seperti diberitakan, kasus tersebut diduga terkait pengadaan Sistem Komunikasi Radio Terpadu (SKRT) di Departemen Kehutanan (Dephut), yang saat ini ditangani oleh KPK. Rekanan yang memasok SKRT itu, yakni, PT Masaro yang direktur utamanya saat ini sudah ditetapkan sebagai buron. Diduga dalam kasus itu, uang suap mengalir ke oknum KPK. (dtc/ant)


Luar Negeri

WASPADA Jumat 17 Juli 2009

3 Australia: 6.000 Warga Dapat Mati Akibat Flu Babi SYDNEY, Australia (AP): Badan kesehatan memperkirakan lebih 6.000 warga Australia bisa matiakibatflubabidalam‘skenariokasusterburuk’ selama musim dingin yang mulai melanda negara dibelahanselatanbumiini,katamenterikesehatan negara itu Kamis (16/7). Namun, jumlah tersebut kemungkinan akan terjadijikatidakdiambiltindakanuntukmencegah virustersebut,sepertimenggunakanobatantivirus dan vaksin, kata Menteri Kesehatan Nicola Roxon kepada radio ABC.

Australia telah memesan 21 juta dos vaksin, yang diharapkan pihak terkait mulai digunakan Oktober mendatang. Rata-rata terjadi 2.000 sampai 3.000 kematian akibat flu di Australia pada setiap musim flu, kata Departemen Kesehatan itu. Australia merupakan negara yang paling parah dilanda flu babi di kawasan Asia-Pasifik, di mana terjadi 24 kematian akibat flu babi dan 11.194 kasus virus tersebut, menurut data terakhir dari Departemen Kesehatan negara itu.(m18)

Israel Ujicoba Sistem Anti-Roket

BANJIR AKIBAT HUJAN LEBAT DI BUSAN, KORSEL

The Associated Press

Warga Korea melihat sejumlah kendaraan yang rusak setelah terseret banjir akibat hujan lebat yang melanda Busan, Korea Selatan (Korsel), Kamis (16/7).

AS: Makin Sulit Hadapi Taliban LONDON, Inggris (Antara/AFP): Panglima militer Amerika Serikat, Kamis (16/7) memperingatkan bahwa para gerilyawan Taliban di Afghanistan semakin lebih keras dan terorganisasi lebih baik dalam tahun-tahun belakangan ini, dan pasukan menghadapi “perang yang sangat sulit” ke depan. Militer AS menghadapi satu pertempuran penting 18 bulan untuk membantu menstabilkan negara itu untuk rakyat Afgha-

nistan dan mencegah tergelincirnya tiga tahun keamanan, kata KepalaStafGabungan,Laksamana Michael Mullen. Mullen mengatakan tidak jelas berapa lama itu akan berlangsung untuk memperbaiki situasi keamanan, tetapi tahap terbaru operasi di provinsi Helmand, Afghanistan Selatan, hanya ‘baru awal,’ dalam satu wawancara dengan stasiun televisi BBC berbahasa Arab. Dia juga mengatakan pada akhirnya adalah rakyat Afghanistan sendiri yang akan membantu mengalahkan gerilyawan itu. “Orangmenanyakankepadasaya ‘berapalama?’dansayatidaktahu berapa lama,” kata Mullen. “Saya tahu (keamanan) negara itu bertambah buruk dalam tiga tahun, tiga setengah tahun sejak tahun 2006,” katanya di Pangkalan Udara Bagram,

Myanmar Sita 762 Kg Heroin YANGON,Myanmar(AP):Polisianti-narkobadibagiantimurlaut Myanmarberhasilmenyita762KgheroindekatperbatasanThailand, satupenangkapannarkobaterbesardinegaraitu,katasatusuratkabar negara Kamis (16/7). Polisi juga menyita 340.000 tablet metamfetamin 10 Juli lalu dari enam roda truk pada pos pemeriksaan di kota perbatasan Tachilek, sekitar 550 km dari Yangon, kota terbesar Myanmar. Suratkabar Myanmar Ahlin mengatakan truk itu berasal dari Mong Hsat di Shan, 67 km sebelah utara Tachilek. Pihak berwenang tangkap tiga orang yang berada di truk itu, kata suratkabar itu. Myanmar, yang juga dikenal sebagai Burma, memproduksi sekitar 410 ton opium tahun 2008, cukup untuk menghasilkan 40 ton heroin, menurut data PBB. Negara yang dipimpin militer itu merupakan penghasil narkoba terbesar kedua di dunia setelah Afghanistan. Myanmar juga menjadi sumber utama metamfetamin. Kebanyakan di antaranya diperdagangkan di Thailand di mana penggunaan narkoba merajalela.(m18)

dekat Kabul. “Dan Taliban jauh lebihbaik,merekajauhlebihkeras, mereka lebih terorganisasi dan perang akan terus berlangsung melawan mereka.Pada akhirnya, jika kita dapat merebut hati rakyat Afghanistan, rakyat Afghanistan akan melepaskan diri dariTaliban dan itu adalah jawaban dalam melawan pemberontakan”. Mullenmengatakandiayakin kini ada sumber yang cukup di provinsi Helmand untuk menguasai daerah-daerah yang direbut pasukan dari gerilyawangerilyawan. Sekitar 400 Marinir AS, ribuan tentara Inggris dan pa-

sukan keamanan Afghanistan sedang bertempur untuk merebut pangkalan-pangkalangerilyawan yang paling berbahaya di Helmand. Korban di kalangan militer meningkat dalam pekan belakangan ini saat pasukan berusaha membersihkan daerah-daerah dari para gerilyawan untuk memungkinkan rakyat Afghanistan memberikansuaramerekadalam pemilihan presiden dan dewandewan provinsi yang menurut rencana akan diselenggarakan 20 Agustus. “Operasi khusus itu baru

dimulai beberapa hari lalu,” kata Mullen. “Tetapi kami memiliki cukup pasukan di sana sekarang untuk menguasai wilayah itu agar gerilyawan Taliban tidak dapat pulangkembali,tetapikamibarus memulai dan itu akan memerlukan waktu”. Diajugamengatakanmelatih lebih banyak militer dan polisi Afghanistan penting untuk menjamin keamanan. “Kami harus membantu keamanan dan melatih pasukan keamanan Afghanistan untuk terciptanya keamanan yang berkelanjutan secepat mungkin.”

Pemimpin Sementara Honduras Nyatakan Bersedia Mundur TEGUCIGALPA, Honduras (AP): Pemimpin sementara Honduras mengatakan dia bersedia mundur untuk membantu menyelesaikan krisis politik di negara itu, namun hanya jika Presiden terguling Manuel Zelaya tidak kembali berkuasa. Roberto Micheletti juga menuduh beberapa kelompok membagikan senjata dan merencanakan pemberontak bersenjata, dan pemerintahnya kembali memberlakukan jam malam. Tindakan itu dilakukan sehari setelah Zelaya menyerukan pemberontakan di Honduras. Micheletti,mantanpemimpin kongres yang dipilih anggota

parlemen untuk menyelesaikan enam bulan terakhir masa jabatan Zelaya, mengajukan permohonan pengunduran diri sebagai jalan untuk mengakhiri kekacauan yang telah berlangsung hampir tiga minggu lamanya setelah terjadi kudeta militer di Honduras. Presiden sementara itu mengatakandiabersediamundur “jika memang keputusan itu dibutuhkan untuk menciptakan perdamaian dan ketenangan di negaraitu,tapitanpakembalinya, saya tekankan, tanpa kembalinya mantan Presiden Zelaya.” Tawaran itu diajukan lewat seorang delegasi Honduras ke-

pada Organisasi Negara Amerika (OAS), kata Micheletti kepada wartawan di Tegucigalpa. Tidak jelas apakah OAS telah menerima usul tersebut. Jika Micheletti mundur, berdasarkan hukum Honduras, jabatan kepresidenan akan diserahkan pada Kepala Mahkamah Agug Jorge Rivera. Sementara, MA adalah pendukung kudeta tersebut. Zelaya menegaskan dia bersikeras kembali sebagai presiden, dan mengatakan hal itu tidak untuk dirundingkan. Selasa, dia mengatakan warga Honduras punya hak untuk melancarkan pemberontakan terhadap pemerintahan Micheletti yang dikucilkan internasional.(m18)

Ribuan Pemrotes Di Thailand Mantan Presiden Korsel Kritis Tolak Tuduhan Terorisme SEOUL, Korea Selatan (Antara/Reuters); Mantan presiden Korea Selatan Kim Dae-jung, yang mendapat Hadiah Nobel Perdamaian karena memprakarsai pertemuan pertama para pemimpin Korea yang terbelah dua, kini kondisinya kritis di sebuah rumah sakit di Seoul, kata media dalam laporannya Kamis (16/7). Kim,85tahunadalahbekastahananpolitikdantokohterkemuka di negara itu dalam memperjuangkan demokrasi. Ia menderita gangguan pernafasan, kata berbagai penerbitan mengutip pernyataan para pejabat rumah sakit. Kim menjabat sebagai presiden mulai 1998 sampai 2003 dan dikenal luas atas prakarsanya dalam pertemuan puncak dengan pemimpin Korea Utara Kim Jong-il pada 2000, yang menghasilkan cepat kembali menghangatnya hubungan kedua negara, yang belum resmi mengakhiri perang mereka pada 1950-53.

B A N G KO K , T h a i l a n d (Antara/AFP): Ribuan pemrotes ‘BajuKuning’Thailandmelakukan unjukrasadiBangkok,Kamis(16/ 7) menolak tuduhan terorisme terhadap kelompok mereka yang memblokade bandara tahun lalu. Menteri Luar Negeri Kasit Piromya terdapat di antara 36 pendukung Aliansi Rakyat untuk Demokrasi (PAD) yang menghadapituduhan,yangdapatdikenakan hukuman mati, setelah kelompok itu menduduki bandara

Bangkok selama sembilan hari akhir tahun 2008. Sebagian besar tuduhan itu menurut rencana akan dilaporkan kepada polisi, Kamis tetapi ditolak dengan alasan bahwa tuduhan terorisme terlalu berlebihan. “Tidak seorangpun datang hari ini karena kami sedang melakukan protes terhadap tuduhan-tuduhan polisi itu,” kata pengacara PAD Suwat Apaipak

di hadapan ribuan orang yang berkumpul dekat Klub Polisi nasional di pinggiran utara Bangkok. Kelompok itu tidak memprotes tuduhan-tuduhan lain termasuk berkumpul tanpa izin dan melanggar undang-undang penerbangan,tetapimenegaskan blokade-blokade atas bandara internasional Suvarnabhumi dan bandara domestik Don Muang tidakmelanggarundang-undang.

JERUSALEM (Antara/Xinhua-OANA): Israel menuntaskan serangkaian ujicoba sistem pertahanan rudal Iron Dome, (Kubah Besi) yang dirancang untuk mempertahankan Israel dari serangan rudal dan roket jarak dekat, kata Kementerian Pertahanan Israel. Sejumlah roket dicegat dalam ujicoba sistem tersebut selama beberapa hari belakangan, demikian laporan kantor berita lokal, Ynet, dengan mengutip keterangan beberapa pejabat pertahanan Rabu (15/7). Sistem Iron Dome, yang dikem-bangkan oleh perusahaan negara, Rafael Defense Systems, terdiri atas radar, sistem pemantauan, peluncur dan pencegat. Kementerian Pertahanan menyatakan semua bagian sistem itu bekerja dengan baik dalam ujicoba. Penembakan roket telah lama menjadi ancaman utama keamanan bagi negaraYahudi itu,yangbagianutaranyamenjadisasaranserangan dari Lebanon dan bagian selatannya seringkali diserang oleh roket dari Jalur Gaza. Iron Dome diduga beroperasi pada 2010, dan Pasukan Pertahanan Israel telah membentuk

batalion khusus guna mengoperasikannya, yang akan menjadi bagian dari Angkatan Udara Israel (IAF), demikian laporan harian lokal Jerusalem Post. “Sistem pertahanan banyak tingkat adalah sasaran strategis bagi Negara Yahudi dan akan menyediakan lapisan perlindungan terhadap roket jarak dekat,” kata Menteri Pertahanan Ehud Barak sebagaimana dikutip. “Ini akan memungkin-kan IDF memenuhi kewajibannya melindungi Israel dengan cara terbaik yang dapat dilakukan-nya.” Seorang komandan senior IAF mengatakan pada suatu konferensi akademis pada Mei bahwa Israel akan memiliki sistem pertahanan rudal yang beroperasi pada tiga tingkat yang berbeda. Sistem Iron Dome akan beroperasi dan digelar di sepanjang perbatasan pada 2010. Sistem kedua, David’s Sling, yang dirancang untuk mencegat roket jarak menengah, akan beroperasi dalam waktu empat tahun. Tak lama setelah itu, Arrow 3, versi canggih sistem rudal jarak jauh saat ini yang dioperasikan IAF, akan dinyatakan beroperasi penuh.

Serikat Pekerja Minyak Kecam Tuntutan Sosialis Di Venezuela CARACAS, Venezuela (AP): Para pemimpin serikat minyak di Venezuela Rabu (15/7) mengecam peringatan yang dikeluarkan Menteri Perminyakan bahwa para pekerja haruslah seorang sosialis atau akan dicurigai sedang bekerjasama menentang pemerintah. Perusahaan minyak negara Petroleos de Venezuela SA, atau PDVSA, mengikuti arus yang sangat pro-Chavez sejak aksi mogok di tahun 2002-2003 yang tidak berhasil menyingkirkan Chavez dan malah ribuan orang dipecat dari perusahaan itu. Para pemimpin serikat pekerja itu sekarang menuduh pemerintah tidak meng-hormati hak pekerja akan pandangan politiknya.

Dalam pidato yang disiarkan lewat televisi, Menteri Perminyakan Rafael Ramirez mengatakan karyawan yang tidak bergabung dengan kelompok sosialis yang dibentuk partai berkuasa akan dicurigai ‘tengah merencanakan revolusi’. Pernyataan Ramirez yang menyatakan dia tidak akan merundingkan kontrak kerja‘dengan setiap musuh Chavez’ memancing reaksi marah dari beberapa pemimpin serikat. “Itu pernyataan yang tidak bertanggungjawab,” kata ketua serikat Froilan Barrios, yang bergabung dengan penantang Chavez. Dia mengatakan para pekerja sedang merencanakan pertemuan guna menetapkan tanggapan. “Kami tidak akan menerima.”(m18)

Bentrokan Baru Di Lembah Swat Tewaskan 14 Orang PESHAWAR, Pakistan (Antara/AFP): Bentrokan-bentrokan mematikan di lembah Swat Pakistan menyulut kekhawatiran baru mengenai memburuknya keamanan ketika pemerintah memulangkan ribuan warga sipil yang mengungsi akibat ofensif militer. Pakistan menyatakan Rabu (15/7), 13 militan dan satu prajurit tewas di Swat dalam kurun waktu 24 jam meski pemerintah mengumumkan bahwa militan telah dikalahkan dan banyak dari 1,9 juta orang yang mengungsi akibat perang melawan Taliban merasa khawatir. “Saya khawatir keadaan keamanan akan memburuk di Swat kapan pun,” kata Gul Ahmad Khan kepada AFP dari Barikot, dua hari setelah pulang kembali ke Swat selatan dalam sebuah konvoi yang diatur oleh pemerintah. Khan, yang berprofesi sebagai seorang juru masak, mengatakan, dia senang bisa meninggalkankamppengungsiyangpadatdidaerahdataran rendah yang sangat panas, namunia tidak mengesampingkan kemungkinan Taliban kembali ke daerah Swat yang dulu dijuluki sebagai Swiss Pakistan itu. Militer mengatakan bahwa 13 militan, termasuk seorang tersangka “pemimpin teroris” yang sebelummya tidak dikenal, tewas selama tembakmenembakdiSwat,dimanaTalibanmengobarkan perang dua tahun untuk memberla-kukan hukum Islam. Bentrokan paling mematikan dilaporkan terjadi di dekat markas lama militan Kabal di wilayah utara dimana militer mengatakan bahwa delapan militan, termasuk dua warga asing, dan seorang prajurit tewas dalam tembak-menembak. Tersangka pemimpin militan tewas di Peochar, sebuah pangkalan lain di Swat — yang dulu diyakini sebagai

markas kepemimpinan lokalTaliban dan tempat pasukan lintas udara terlibat dalam pertempuran mematikan musim panas ini. Pemerintahtelahmenyatakanbahwapasukan akan tetap berada di Swat dan segala upaya dilakukan untuk melindungi warga sipil ketika mereka berusaha membangun lagi kehidupan mereka. Rabu adalah hari kedua beturut-turut dimana militer melaporkan pembunuhan di Swat setelahmengumumkankematiansembilanorang pada Selasa pasca masa tenang. Pekan lalu pemerintah menyatakan bahwa militer telah “melenyapkan” militan di kawasan tersebut. Daerah suku Pakistan, khususnya Lembah Swat, dilanda konflik antara pasukan pemerintah danmilitanTalibandalambeberapawaktuterakhir ini. Sekitar 1.700 militan dikabarkan tewas dalam ofensif yang diluncurkan di distrik-distrik Lower Dir pada 26 April, Buner pada 28 April dan Swat pada 8 Mei. Ofensif itu mendapat dukungan dari AS, yang menempatkan Pakistan pada pusat strateginya untukmemerangial-Qaida.Swatdulumerupakan daerahdenganpemandanganindahyangmenjadi tempat tujuan wisata namun kemudian menjadi markas kelompok Taliban.


Agenda

4

WASPADA

Jumat 17 Juli 2009

Kecelakaan, Awal Michael Jackson Kecanduan Obat Tanggal 27 Januari 1984 adalah salah satu hari paling gelap dalam sejarah hidup King of Pop, Michael Jackson, demikian The Rolling Stone online dalam rilis terbaru Kamis.

Michael Jackson/wordpress.com

Dalam satu kecelakaan sering menjadi bahan pergunjingan tetapi tidak pernah ada kesaksian, Michael menderita luka bakar yang parah pada muka dan kulit kepala saat “shooting” iklan Pepsi, di depan ribuan penggemarnya di Shrine Auditorium, Los Angeles. Untuk pertama kalinya setelah 25 tahun tak pernah terekspos, US Weekly menayangkan secara eksklusif video kecelakaan terjadi setelah mercon pertunjukan dinyalakan terlalu dini pada pengambilan gambar keenam “shooting” iklan itu. Dari tayangan video, mercon menyala lebih awal dan me-

ledak dekat Michael saat dia membelakangi kamera, lalu kilatan api menyambar untuk kemudian membakar rambut si Raja Pop. Michael tidak menyadari rambutnya terbakar dan terus melanjutkan penampilannya sampai kemudian belasan penjaga panggung berhamburan menyelamatkannya dan dengan cepat memadamkan api. Setelah alat pemadam api kosong dan keributan mereda, tampak jelas kulit kepala Michael telah terbakar dengan plester menutupi kepalanya yang telah gundul padahal beberapa detik lalu masih berambut. Michael segera dilarikan ke rumah sakit, tetapi sebelumnya 3.000 penonton diyakinkan bahwa Michael baik-baik saja. Menurut sejumlah laporan, sejak insiden itu dan pulih dari terbakar, Michael menjadi kecanduan penenang dan obatobatan yang kemudian diklaim menjadi penyebab munculnya serangan jantung yang menewaskannya pada 25 Juni 2009.

Perawat sekaligus pakar nutrisi pribadi Michael mengatakan bahwa sang biduan kecanduan obat penenang Propofol yang ganas di pembuluh darah, sementara para pengawal pribadinya bersaksi kepada polisi bahwa Michael mengonsumsi 3040 pil Xanax dalam sehari selama tahun 2004. Bahkan Keluarga Jackson memprihatinkan penggunaan obat-obatan sang penyanyi dimana Janet sang adik dilaporkan telah berupaya, namun kemudian gagal, menghindarkan kakaknya itu dari kecanduan obat. Setelah insiden tahun 1984 itu, Michael dan Pepsi menuntaskan kasus di pengadilan dan mendapatkan kompensasi. Namun, Michael memang terkenal dermawan, menyumbangkan kompensasi 1,5 juta dolar AS dari Pepsi itu kepada Brotman Memorial Hospital di Culver City, California, yang kemudian mendirikan Michael Jackson Burn Center for Children. (ant/rtr)

wan Krisna Mukti. Namun sebelum memasuki materi gugatan PN Kendari akan menunjuk hakim mediasi yang akan memfasilitasi dua belah pihak untuk berdamai. “Kalau penggugat dan tergugat tidak bisa berdamai maka proses sidang gugatan akan dijalankan,” katanya. Pengacara Yoyon Rasmono, Baron Harahap Saleh, SH mengatakan besaran gugatan wanprestasi terhadap Krinas Mukti adalah Rp370.900.741. “Klien saya menggugat karena menilai Krisna Mukti tidak memiliki itikad baik untuk mengembalikan uang yang dipinjam sejak sejak Februari 2007 silam hingga jum-

lahnya mencapai Rp370.900. 741,” kata Baron Harahap. Krisna Mukti mendekam dalam rumah tahanan negara (Rutan) Punggolaka Kendari karena terbelit masalah hukum pidana dalam kasus yang lain. “Krisna Mukti dan Yoyon Rasmono (tergugat dan penggugat) adalah rekan bisnis yang sudah saling percaya sehingga Yoyon tidak ada keraguan untuk meminjamkan uang,” kata Baron. Namun waktu berjalan hingga sekitar dua tahun penggugat curiga bahwa Krisna Mukti tidak berniat baik untuk mengembalikan uang pinjaman dimaksud sehingga menempuh jalur hukum. (ant)

Krisna Mukti

Sarah Aulia Rela Jadi Gembel

Sarah Aulia

07.00 Kuis Siapa Lebih Berani 09.00 Musik Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 Sergap 13.00 Boombastis 14.00 Hits 15.00 Cek & Ricek 15.30 OB Shif 2 16.00 Duit Kaget 16.30 Bedah Rumah 17.00 Seputar Indonesia 17.30 Tarzan Cilik 18.00 Nikita 19.00 Cinta Dan Anugerah 20.00 Dewi 21.00 The Master Final Season 4 00.00 Seputar Indonesia Malam 00.30 Film Tengah Malam

CATATAN

07.30 Musik Inbox 09.30 Hot Shot Seru 10.00 Gala Keluarga 12.00 Liputan 6 Siang 12.30 Kasak Kusuk 13.00 Cinta Monyet 14.00 Play List 16.00 Kepompong 17.00 Liputan 6 Petang 17.30 Gala Sinema Spesial 19.00 Melati Untuk Marvel 21.00 Terlanjur Cinta 22.00 Gala Cinema 00.00 Liputan 6 Malam 00.30 Buser 01.30 Musik Playlist

DI Benak artis Sarah Aulia belakangan ini hanya satu tekad mengkristal yakni sukses di dunia seni peran. Karenanya demi sukses memerankan tokoh utama wanita dalam Film Punk In Love besutan Sutradara Ody C Harahap harus rela menjadi gembel. Melengkapi tampilan semrautnya – rambut dicat Ungu panjang di depan dan bagian belakang dipangkas se leher, membuat tindik serta tato dadakan, peran anak Punk bernama Almira pun membuat kulit mulus mantan Gadis Sampul 2005 ini terbakar. ”Harap maklum, baru kali ini saya mendapat peran utama dalam film layar lebar. Jadi, demi totalitas akting sebagai anak Punk saya harus rela dan bahagia menjadi Gembel. Lengkap

07.00 Cerita Pagi 08.00 Maquarade 09.00 Grand Prix Del Verano 11.00 Kribo (Kriminal Heboh) 11.30 Sidik 12.30 Go Show 13.00 Legenda 15.00 1001 Cerita 16.00 Casper 17.00 Pitung The Master 18.00 Ben 7 19.00 Sinema Bollywood 23.00 Sinema Malam 01.00 Layar Tengah Malam 02.30 Cerita Dinihari

Resmi Menjanda, Rossa Stop Nangis Penyanyi Rossa resmi bercerai denganYoyok ‘Padi’ pada 14 Juli lalu. Seperti lagunya, ‘Tegar,’ Rossa pun tak mau lagi mewarnai harinya dengan air mata. Ia pun siap kembali cuap-cuap di atas panggung. “Nangis, ya udah selesai. Sekarang saya fokus road tour saja,” ujar pelantun ‘Nada-nada Cinta’ itu saat ditemui di studio Antv, Cawang, Jakarta Timur, Kamis (16/7). Rossa mengaku sudah memendam dalamdalam kesedihannya. Teman duet Pasha ‘Ungu’ itu tak mau masalah perceraiannya jadi penghalang karir menyanyinya. “Segala macam keadaan harus diputuskan dan dijalani. Jangan gara-gara masalah ini membuat aku tertekan,” jelasnya. Meskipun sudah resmi bercerai, Rossa masih menjalin komunikasi dengan sang mantan suami. Hal itu pun ia lakoni demi kebaikan anaknya yang kini berusia tiga tahun. Musibah Rossa berusaha tegar untuk menyandang

Krisna Mukti Digugat Ganti Rugi Rp370 Juta Artis Krisna Mukti digugat ganti rugi atau wanprestasi oleh rekan bisnisnyaYoyon Rasmono Suryo Prabowo di Pengadilan Negeri Kendari, Sulawesi Tenggara (Sultra). Sekretaris panitia PN Kendari, Hj. Else Mangindaan di Kendari, Rabu, mengatakan gugatan wanprestasi Yoyon Rasmono yang saat ini mendekam di Lembaga Pemasyarakatan (Lapas) Kendari diwakili dua orang pengacaranya Nur Ramadhan, SH dan Baron Harahap Saleh, SH. Pengadilan sudah menunjuk Muh Yusuf, SH sebagai hakim ketua akan menyidangkan gugatan Yoyon Rasmono mela-

Rossa/dth

dengan konsekwensi logis menanggung resiko kulit saya tak terlindungi busana bakal terbakar saat syuting marathon Punk In Love (PIL) di delapan kota antara Malang - Jakarta,” papar Sarah Aulia kepada Waspada menjelang preview film produksi Multivision Plus di Jakarta, baru-baru ini. Lebih membahagiankan lagi, lanjut kekasih aktor dan Sutradara Thomas Nawillis ini, pemutaran film PIL dimulai 10 Juli – masih dalam suasana perayaan ulang tahunnya ke-18. “Saya sangat bahagia lantaran mendapat kado ultah istimewa berupa pemutaran film menampilkan saya sebagai pemeran utama wanitanya,” tandas cewek kelahiran Jakarta, 6 Juli 1991 yang akrab disapa Aul ini.

07.00 Pororo The Little Penguin 07.30 Land Before Time 08.00 Star Kids 09.00 Espresso 10.00 Cagur Naik Bajaj 11.00 Made In Action 11.30 Topik Siang 12.00 Klik! 13.00 Transformer 15.00 Second From Disaster 16.00 Buka Kartu 16.30 Topik Petang 17.00 Salah Alamat 17.30 Mantap 18.30 Kena Deh 19.00 Bajaj Pake Solar 21.00 Tawa Sutra Bisaa Aja 22.30 Wild Born Killer 23.30 Fakta 00.00 Topik Malam 00.30 Lensa Olahraga Malam

07.00 KISS Vaganza 08.30 Halo Polisi 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 Intan 15.30 Naruto 16.00 Impian Sang Putri 17.00 Kasih dan Amara 18.00 Tangisan Isabella 19.00 Mualaf 20.00 Inayah 21.30 Take Me Out Indonesia 23.00 Sinema Malam 01.00 Fokus Malam

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Terlibat dalam film PIL antara lain dibintangi Vino Bastian, Yogi Finanda dan Andhika Pratama, memang bukan perkara gampai bagi Aul. Selain sebagai satu-satunya wanita, karakter Almira sangat jauh dari kehidupan nyata sehari-hari. Apalagi semua pemain pendukung film, diwajibkan melakukan sesi penjemuran badan setiap hari agar kulitnya menjadi Coklat. ”Untungnya saya bukan tipe wanita yang mudah jijik terhadap sesuatu, terutama terhadap lingkungan kumuh dan kenyataan jarang mengganti pakaian saat perjalanan syuting,” tandas Aul sebelumnya sukses berakting menjadi adik Titi Kamal dalam film Drop Out (DO) itu. * (AgusT)

07.05 Indonesia This Morning 07.30 Metro Xin Wen 09.05 Election Update 09.30 Market Review 10.00 Dunia Kita 10.30 Chat Club 11.05 Oprah Winfrey 12.05 Metro Siang 13.05 Sport Club 13.30 Just Alvin! 14.30 Election Update Sore 15.05 Bisnis Hari Ini 15.30 Public Corner 16.05 Inside 17.05 Discover Indonesia 17.30 Metro Hari Ini 19.05 Suara Anda 20.30 Special Dialog 21.05 Top Nine News 21.30 Kick Andy 23.05 Secret Operation 23.30 Metro Sports 00.05 Metro Malam

predikat sebagai seorang janda. Mantan istri Yoyok ‘Padi’ itu pun menganggap statusnya tersebut sebagai sebuah musibah. “Status janda kedengarannya nggak enak tapi mungkin harus dilihat sebagai musibah, ini kenyataan harus dihadapi,” ujarnya. Saat ini Rossa hanya bisa menjaga diri di depan publik. Ia tak mau kesendiriannya itu menjadi sebuah fitnah di masa mendatang. Rossa resmi bercerai dengan Yoyok pada 14 Juli lalu. Tidak seperti pasangan selebriti kebanyakan, proses perceraian antara Rossa dan Yoyok berjalan mulus. Meskipun sudah resmi bercerai, Rossa mengaku tidak akan melupakan hubungannya dengan sang mantan suami. Menurutnya, banyak pasangan yang semakin dekat setelah berpisah. “Perasaan cinta dan sayang mudah-mudahan tidak akan lekang oleh waktu, mungkin cinta bukan sebagai pasangan tapi sebagai keluarga,” jelasnya.(dth)

Trio Pianka Kejar Peruntungan Di Negeri Sendiri BANYAK jalan bagi penyanyi menggapai ketenaran. Seperti yang tengah dilakoni dan diperjuangkan trio vokal Pianka. Lewat mini album bertajuk Oh My God produksi KRU Music Malaysia mengandalkan dua singel Datanglah Kekasih dan Mau yang Besar, popularitas biduanita Nita – Pipit dan Sherine cukup membumbung di negri Jiran bahkan sampai ke Singapura. Sebaliknya, di negeri sendiri ketiganya belum banyak dikenal penikmat musik. “Sudah menjadi suratan takdir, babakan karir nyanyi profeTrio Pianka sional trio Pianka lebih dulu terjaring lebel rekaman Malaysia hingga bisa eksis dan berkibar di negeri Jiran. Tapi, seiring sukses mini album Oh My God lansiran November 2008 silam di blantika musik Malaysia, sekarang giliran kami bertiga bahu-membahu berjuang gigih mengejar peruntungan di negeri sendiri,” papar Pipit personel trio Pianka termuda kepada Waspada di Jakarta, baru-baru ini. Menurut instruktur vokal di Elfa’s Music School Jakarta bersama grup paduan suara mereka berulang kali memenangkan Grand Champion Olympic Choir tingkat dunia ini menambahkan, per-kembangan pesat bisnis musik di Indonesia ditandai dengan pergeseran cara penjualan dari format konvensional menjadi Virtual seperti mengunduh (download) dari internet atau penjualan berbentuk RBT, membuka jalan lebar bagi trio kami untuk eksis dan berkibar di tanah air sendiri. * (AgusT)

07.00 Bioskop Indonesia 09.00 Derings 10.30 Jelang Siang 11.00 Insert 12.00 Reportase 12.30 Missing Lyrics 14.00 D Show 16.00 Insert 16.30 Orang Ketiga 17.00 Reportase Sore 17.30 Kado Istimewa 18.00 Suami Suami Takut Istri 19.00 Bioskop Trans TV Spesial 21.30 Bioskop Trans TV 23.00 Bioksp Trans TV 01.00 Reportase Malam

09.00 Kabar 9 09.30 Kabar Pasar 10.00 Pariwara Diknas 11.00 Opini 12.00 Kabar Siang 13.00 Keliling Indonesia 13.30 Expose 14.00 Documentary 15.00 Kabar 15 15.30 Kabar Pasar 16.00 Telusur 16.30 Kabar Warga 17.00 Kabar Pemilu 17.30 Kabar Petang 19.00 Negeri Impian 21.00 Apa Kabar Indonesia Malam 22.00 Jalur 259 23.00 Bukan Rahasia

08.00 Dora The Explorer 09.00 Obsesi Pagi 10.00 MTV Gaya Bebas 11.00 MTV Ampuh 12.00 Abdel & Temon 13.00 Global Siang 14.00 Transformers Animated 15.30 Bukan Sinetron 16.30 Berita Global 18.00 Eureka 19.00 Ayahku Hebat 20.00 Big Movies 22.00 Gudang Garam International 23.00 MTV Special 01.30 MTV Insomnia

07.30 I Gosip Pagi 08.00 Selamat Pagi 09.00 Ngelenong Yuk 10.00 TKP Siang 10.30 60 Minutes 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 13.30 Jalan Sesama 14.00 Cita Citaku 14.30 Dunia Air 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 I Gosip News 18.30 On The Spot 21.00 OKB 22.00 Ups Salah 23.00 Black In News 23.30Begadang

**m30/B


Nusantara

WASPADA Jumat 17 Juli 2009

5

KPK Periksa Anggota DPR Terkait Dugaan Suap JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK) memeriksa anggota DPR RI periode 2004-2009 Teuku Muhammad Nurlif dalam kasus dugaan suap terkait pemilihan Deputi Gubernur Senior Bank Indonesia (BI) pada 2004. “Hari ini kita meminta keterangan saudara Teuku Muhammad Nurlif,” kata Juru Bicara KPK Johan Budi di Jakarta, Kamis (16/7). Menurut Johan, Nurlif dimintai keterangan sebagai saksi dalam kasus dugaan suap itu. Nurlif diperiksa dua jam sampai pukul 12:00. Setelah menjalani pemeriksaan, politisi Partai Golkar itu langsung meninggalkan gedung KPK dan tidak memberikan keterangan kepada wartawan. KPK telah menetapkan empat tersangka dalam kasus itu. Mereka adalah, anggota DPR Dudhie Makmun Murod, Endin Soefihara, HamkaYandhu, serta mantan anggota Badan Pemeriksa Keuangan (BPK) Udju Djuhaeri. Kasus aliran cek itu berawal dari laporan mantan anggota DPR Agus Condro. Politisi PDIP tersebut mengaku menerima cek senilai Rp500 juta setelah pemilihan Deputi Gubernur Senior BI pada 2004 yang dimenangkan Miranda S. Goeltom. Menurut Agus, sejumlah anggota DPR juga menerima cek serupa.

Pria Terjun Dari Lantai 6 Metro Tanah Abang

Antara

JAMBORE TEKNOLOGI. Seorang anak mengamati sebuah rudal Exocet mm-38 yang diapajang pada Jambore Teknologi 2009, di area Pusat Rekreasi dan Promosi Pembangunan (PRPP), di Semarang, Jateng, Kamis (16/7). Jambore yang diikuti berbagai lembaga pemerintah, swasta, sekolah menengah kejuruan (SMK) dan perguruan tinggi yang akan berlangsung hinga 19 Juli itu antara lain bertujuan untuk memberikan informasi kepada masyarakat tentang temuan dan inovasi teknologi.

Ajudan Presiden, Wapres Jadi Wakapolda Kombes Pol. Syafrudin Wakapoldasu

Presiden Harus Berani Tentukan Menterinya JAKARTA (Waspada): Calon presiden terpilih Susilo Bambang Yudhoyono (SBY) harus berani dan tegas menentukan dan penempatan menteri untuk jabatan strategis, seperti Menteri Keuangan, Mendagri, Kementerian BUMN, Menteri Pekerjaan Umum, Menteri Pertahanan, Menteri Kesehatan, Menteri Pertanian, Menteri PAN dan Menteri Pendidikan. “Untuk jabatan strategis itu, jika SBY sudah resmi terpilih setelah pengumuman KPU, maka harus tegas menggunakan hak prerogatifnya secara penuh. Karena jabatan-jabatan strategis itu sangat menentukan masa depan bangsa,” ujar praktisi dan pelaku bisnis Sanggam Hutapea

kepada wartawan di Jakarta, Rabu (15/7). Dia menilai sikap tegas dan keberanian SBY telah diperlihatkan ketika menentukan pasangannya dari luar partai politik. Dia tetap pada pendiriannya sekalipun dikecam berbagai kalangan. “Saya harap SBY juga bersikap demikian dalam menentukan jabatan strategis kementerian,” tegas Sanggam. Sanggam berpendapat, untuk posisi jabatan strategis, SBY harus menetapkan kriteria, jangan hanya berpikir mengakomodasi kader-kader parpol yang disodorkan koalisinya. “Kalau parpol-parpol itu tidak dapat memenuhi kriteria, maka presi-

den berhak menempatkan pilihannya sendiri atau parpol koalisinya mencari figur dari kalangan professional,” ujar dia. Karena itu parpol-parpol mitra koalisi tidak boleh sembarangan mengajukan kadernya untuk duduk di kabinet. “Para menteri mendatang harus memiliki kapabilitas, totalitas dan memiliki perjuangan yang sama dengan presiden. Tidak boleh ada lagi menteri ‘berkaki dua’ seperti selama ini,” tegasnya Ditanya apakah ketegasan itu nanti tidak memicu konflik dari [arpol koalisi kemitraan, Sanggam yakin konflik itu bisa diatasi dengan mengedepankan kepentingan bangsa dan negara,

Jaksa Pelaku KDRT Dipecat JAKARTA (Antara): Jaksa pelaku kekerasan dalam rumah tangga (KDRT) Poedji Rahardjo bisa dipecat setelah majelis hakim Pengadilan Negeri (PN) Jakarta Selatan menjatuhkan vonis dua tahun penjara. “Jaksa Poedji bisa langsung dipecat, karena menurut undang-undang apabila jaksa dijatuhi hukuman pidana dan melakukan tindak pidana langsung dipecat,” kata Jaksa Agung Muda Pengawasan (Jamwas), Hamzah Tadja di Jakarta, Kamis (17/7). Dia mengatakan, pihaknya masih menunggu salinan putusan PN Jaksel. Saat ini kata dia, Poedji Rahardjo menjabat sebagai jaksa fungsional di Pusdiklat Kejagung. “Dia juga tidak pernah masuk kantor selama sembilan bulan, itu melanggar peraturan pemerintah nomor 32/ 1979 tentang pemberhentian pegawai negeri sipil,” katanya. Dikatakan, dari laporan Kapusdiklat Kejagung, Jaksa Poedji

Rahardjo tidak pernah masuk kerja sejak dipindah dari Gorontalo. “Dia bisa dikenakan PP Nomor 30/1980 (tentang peraturan disiplin PNS) dan PP nomor 32/ 1979,” katanya. Sebelumnya terdakwa dilaporkan istri keduanya Nazwita Indra dan anak tirinya Mas Agung Barsyah karena melakukan KDRT pada 22 November 2008. Poedji memukul Mas Agung Barsyah hinggga anak tirinya itu mengalami luka sobek sepanjang satu cm pada bibir atas dan bawah. Kemudian Nazwita dan Mas Agung melaporkan tindakan kekerasan dilakukan Poedji kepada pihak berwajib. Selain dijatuhi hukuman dua tahun, majelis hakim memerintahkan agar JPU segera menahan terdakwa setelah pembacaan putusan itu, dan terdakwa dibebani bayar biaya proses perkara sebesar Rp2.000. Pada persidangan pukul

16:40 hingga 17:45, majelis hakim mengungkapkan hal yang memberatkan terdakwa yakni melakukan kekerasan kepada orang yang seharusnya dijaga. Sedangkan hal meringankan, menyesali melakukan KDRT, belum pernah dihukum dan punya tanggungan menghidupi keluarganya. Sementara Poedji menegaskan, pihaknya akan melakukan banding terhadap putusan majelis hakim PN Jaksel itu. “Masalah pemberian harta kepada Nazwita dan Mas Agung tidak ada kaitannya dengan yuridis yang menguatkan adanya pertalian hubungan keluarga,” kata Poedji. Dia mengatakan, pihaknya sudah melaporkan juga Nazwita dan Mas Agung Barsyah kepada Polda Metro Jaya terkait tindakan pencurian barang yang bukan menjadi haknya dan upaya pengeroyokan terhadap dirinya.

bukan untuk kepentingan parpol.” Dia juga mengimbau parpol bisa memahami persoalan yang satu itu (jabatan strategis) dan parpol harus berubah untuk kepentingan yang lebih besar. “Saya pikir ke depan siapapun yang menjadi presiden setelah kepemimpinan SBY pada 2009-2014 juga bisa bersikap tegas seperti itu,” kata dia. Soal keberadaan Partai Golkar, Sanggam tidak menepis bahwa SBY akan mengakomodir kader-kader Golkar yang memang sudah ‘mumpuni’ dalam berbagai persolan politik, baik di DPR maupun di kabinet. “Ini juga untuk membentuk tim pemerintahan yang kuat,” tandasnya Sebagai politisi, pengamat dan praktisi bisnis, Sanggam mengatakan bahwa pelaku bisnis saat ini sedang menunggu kebijakan pemerintahan SBY yang dapat meningkatkan perekono-

JAKARTA (Antara): Seorang pria diduga stres terjun dari lantai 6 gedung Food Court lantai enam Pusat Grosir Metro Tanah Abang (PGMTA) Jl. Fahrudin, Tanah Abang, Jakarta Pusat. Kanit Reskrim polsek Tanahabang Iptu Sutrisno, Kamis (17/7) mengatakan, ada seorang ibudanputrinyamengakusebagai keluarga pria yang langsung tewas seketika itu setelah meloncat dari lantai enam gedung itu. “Mereka menduga pria itu keluarganya yang akhir-akhir ini memang menderita stres,” ujarnya di lokasi kejadian. Dia mengatakan, ibu itu mengaku bernama Lili warga Kebon Kacang, Tanahabang, mengaku telah membawa kerabatnya itu ke psikiater beberapa hari lalu. “Lili mengajak korban jalan-jalan di Metro. Namun setelah 2 jam tidak pulang-pulang ke rumah. Maka dia langsung menuju ke sini untuk mengetahui apa itu saudaranya atautidak.Kitamasihmelakukan interogasi,” kata Sutrisno. Korban bercirikan tinggi 160 cm, mengenakan kaos biru muda, celana panjang abu-abu, tidakmengenakanalaskaki.“Pria itusamasekalitidakmengantongi kartuidentitas,” katanya.Sementara Lili mengaku mengenal korban yang ternyata adiknya dari sandalyangditemukanpembantunya disekitar mayat korban. Petugas kemanan gedung menjelaskan, sebelum diketahui ada korban terjatuh dia sempat mendengar teriakan serta suara benturan keras yang berasal dari belakang gedung.

mian nasional. “Karena itu SBY memang harus menempatkan menteri yang tetap dibidang perekonomian.” Pendapat senada disampaikan pengamat dan pakar hukum tatanegara, Irman Putrasidin. Dia mengusulkan agar anggota kabinet SBY-Boediono lebih banyak dari kalangan profesional. “Pengalaman menunjukkan menteri dari kader parpol tidak fokus menjalankan program pemerintah, karena kontrasinya terbagi mengurus kepentingan partai,” kata dia. Berdasarkan hitungan perolehansementarahasilpilpresversi hitungan cepat, SBY mempunyai modal dukungan sangat besar. Artinya legitimasi rakyat terhadap SBY-Boediono sangat kuat. “Karena itu SBY sebagai calon presiden terpilih bisa memperkuat sistempresidensialdansebaiknya mengabaikan tarik-menarik kepentinganparpolkoalisiberebut kursi kabinet.”(aya)

Indonesia Butuh Hakim Reformis YOGYAKARTA (Antara): Indonesia membutuhkan hakim yang bukan saja berintegritas tinggi, tetapi juga berani proaktif melakukan transformasi dan reformasi peradilan. “Untuk itu diperlukan hakim yang concern (peduli) dengan nilai-nilai suci dan luhur seperti pesan Nabi Muhammad Saw,” kata Ketua Komisi Yudisial Busyro Muqoddas pada seminar membangun budaya antikorupsi di Universitas Islam Indonesia (UII) Yogyakarta, Kamis (16/7). Menurut dia, pesan Nabi Muhammad itu, semulia-mulianya manusia adalah mereka yang paling berfaedah untuk sesamanya dan tangan di atas lebih utama dari pada tangan di bawah. “Lebih mulia memberi yakni memberikan putusan yang progresif dan mampu mentransformasikan bangsa yang sedang dilanda budaya permisifisme,” katanya. Dia mengatakan, peradilan dengan unsur utama pada hakim memiliki peran strategis dan mengandung nilai esensial berupa pembebasan, keadilan, kebenaran, kesetaraan, keseimbangan dan kemanusiaan dalam setiap putusan hakim. “Tugas hakim memerlukan iklim yang kondusif, yakni iklim politik dan budaya yang menempatkan hakim dan jajaran peradilan pada posisi yang imparsial dan independen,” katanya. Satu putusan bersifat profesional jika lahir dari hakim yang hidup dalam suasana budaya yang bersih, jujur, dan jauh dari pengaruh simbol-simbol budaya elitisme dan materialisme, jelasnya. Dia mengatakan, konsep bersih pada peradilan bukan saja terbatas pada perilaku moral keseharian di luar tugas hakim mengadili perkara, namun juga hakim yang berkemampuan dan integritas serta ilmu yang komprehensif.

JAKARTA (Waspada): Ajudan presiden dan wakil presiden dari kepolisian menempati posisi baru sebagai wakil kepala kepolisian daerah (wakapolda). Ajudan Presiden Susilo BambangYudhoyono, Kombes Pol. Putut Eko Bayuseno akan menempati pos barunya sebagai Wakpolda Metro Jaya, sedangkan ajudan Wakil Presiden M Yusuf Kalla, Kombes Pol. Syafrudin menempati pos barunya sebagai Wakapolda Sumatera Utara. Keduanya yang berpangkat tiga melati akan mendapat kenaikan pangkat menjadi Brigadir Jenderal (bintang satu). Kepala Bidang Penerangan Umum (Kabid Penum) Divisi Humas Polri Kombes Pol. Ketut Untung Yoga Ana di Jakarta, Rabu (15/7) mengatakan, adanya sejumlah pergantian jabatan di lingkungan Polri termasuk pergantianWakapolda Metro Jaya dan Sumatera Utara hanya tinggal menunggu pelantikan dari Kapolri. “Kemarin Telegram Rahasia (TR) pengangkatannya sudah keluar dari Mabes Polri,” kata Ketut. Putut Eko yang mendapat pos baru akan menggantikan Brigjen Pol. Jasir Karwita yang menjadi perwira tinggi (Pati) Mabes Polri dalam rangka persiapan untuk mendapatkan jabatan di luar Polri. Sedangkan Syafrudin akan menggantikan Wakpoldasu Brigjen Pol. Edward Raymond Pakasi. Selanjutnya Edward ditempatkan dibagian Logistik Polri dengan jabatan Kepala Biro Perbekalan Umum Deputi Logistik Polri. Sebelum menjadi ajudan wapres, Syafrudin sebelumnya bertugas sebagai Kapolres Metro

Jakarta Timur, dan sebelum menjabat Kapolres Metro Jakarta Timur dengan pangkat AKBP, Syafrudin menjabat Kabag Regident Direktorat Lalulintas Polda Metro. Selain kedua ajudan yang dipromosikan menjadi Wakpolda, Kapolri Jenderal Pol. Bambang Hendarso Danuri juga mengganti Kapolda Bali Irjen Pol. Asikin Husein yang akan memasuki masa pensiun. Asikin akan diganti Irjen Pol. Sutisna yang sebelumnya staf ahli Kapolri. Sedangkan Wakapolda Jawa Barat, Brigjen Pol. Momon Rusmana digantikan Brigjen Pol. Martin Samudera Ritonga yang sebelumnya Kepala Biro Organisasi dan Tata Laksana Deputi Sumber Daya Manusia Polri. Momon yang akan menempati pos barunya sebagai Widyaiswara Utama Sespim Polri akan menjadi jenderal bintang dua. Selanjutnya Direktur Tindak Pidana Tertentu Badan Reserse Kriminal Polri Brigjen Pol. Boy Salamuddin diangkat sebagai Direktur Eksekutif Jakarta Center for Law Enforcement Education Center (JCLEC) Deputi Operasi Kapolri. Posisi Boy digantikan Brigjen Pol. Suhardi Alius, sebelumnya Direktur Akademik Perguruan Tinggi Ilmu Kepolisian (PTIK). Direktur Tindak Pidana Korupsi dan White Collar Crime Badan Reserse Kriminal Polri Brigjen Pol. Jose Rozal digantikan Kombes Pol Yovianes Mahar. Jose Rozal selanjutnya pensiun, sedangkan Yovianes sebelumnya Kepala Unit I Direktorat Keamanan dan Trans Nasional Bareskrim Polri.(j02)

PAN Saat Ini Penuh Dinamika Soetrisno: Kongres Dilakukan 2010 JAKARTA (Waspada): Ketua Umum Partai Amanat Nasional (PAN) Soetrisno Bachir menyatakan kondisi PAN saat ini penuh dinamika, sehingga menjadi perhatian publik. “Kalaupun ada perbedaan pendapat di interen PAN, itu hal biasa dalam politik. Namun dinamika itu jangan menimbulkan dendam diantara kita,” ujar Soetrisno, sebelum memimpin rapat DPP PAN di Jakarta, Rabu (15/7) malam. Mas Tris, begitu panggilann akrabnya menyatakan, dinamika yang terjadi di tubuh PAN akan terus terjadi, seperti adanya pertemuan Amien Rais dengan sejumlah pengurus PAN dan banyaknya isu mengenai kader PAN yang akan duduk dalam kabinet mendatang, sampai isu bakal terjadi kongres luar biasa PAN. “Siapapun kader PAN yang dilihat cocok oleh presidenterpilih,sayapersilahkan.Mengenaikongres PAN mungkin paling cepat Januari 2010. Jadi masih ada persiapan menjelang kongres,” katanya. Meskipun masih dalam tahap penyembuhan

pasca operasinya di Singapura, Mas Tris menunjukkan konsistensinya dan kecintaannya pada PAN. “Saya hadir disini sebagai tanggung jawab dan kecintaan saya dengan partai, kendati kondisi saya masih dalam tahap penyembuhan dari sakit,” sebut dia. Disinggung desakan konggres dipercepat, dia meminta hal itu jangan dipermasalahkan. “Kita harap tidak terjadi demi keutuhan partai, tetapi jika dilakukan harus sesuai aturan dan keputusan partai yaknidilakukan 2010, agar pergantian pimpinan disertai AD/ART nya, sehingga tidak terkesan terburu-buru dan serampangan,” ungkapnya. Soetrisno Bachir juga mengatakan, tetap akan menjalankan tugas dan amanat partai hingga masa kepengurusan 2005-2010 berakhir. “Namun DPP tetap menerima, mempertimbangkan manfaat dan mudaratnya, serta menyelidiki desakan atau masukan dari DPW untuk melakukan konggres luar biasa.”(j07)

Istri Munir Tagih Janji Yudhoyono

Antara

DEMO KASUM: Istri mendiang pejuang HAM Munir, Suciwati, melakukan orasi saat unjuk rasa oleh Komite Aksi Solidaritas Untuk Munir (KASUM) di depan gedung Mahkamah Agung, Jakarta, Kamis (16/7). KASUM menuntut Peninjauan Kembali (PK) vonis bebas Muchdi PR.

JAKARTA (Anatara): Istri aktivis Hak Asasi Manusia (HAM) Munir (alm) Suciwati menagih janji Presiden Susilo Bambang Yudhoyono untuk menyelesaikan kasus pembunuhan suaminya_salah satu terdakwanya Muchdi Pr dibebaskan Mahkamah Agung dari tuntutan hukum. “SBY telah berjanji menuntaskan kasus pelanggaran HAM, salah satunya kasus pembunuhan terhadap Munir. Sudah saatnya kami menagih janjinya,” kata Suciwati dalam orasinya saat unjukrasa bersama Komite Aksi Solidaritas Untuk Munir (KASUM) di Gedung Mahkamah Agung (MA) Jakarta, Kamis (16/7). Menurut dia, kasus pelanggaran HAM saat ini belum satupun diselesaikan secara baik oleh para penegak hukum. Sebab itu presiden terpilih agar menyelesaikan kasus hukum pelanggaran HAM di Indonesia. Suciwati mengatakan, SBY bisa menggunakan mandat barunya melanjutkan pengusutan kasus Munir dengan meminta Jaksa Agung Hendarman Supandji mengajukan upaya hukum luar biasa lewat Peninjauan Kembali (PK) serta meminta Kapolri Bambang Hendarso Danuri mengaktifkan kembali Tim Kasus Munir. “Karenanya, institusi seperti MA harus direformasi karena banyak sekali `parasit-parasit` hukum sebagai alat kejahatan,” tuturnya.

Antara

SOSIALISASI FLU BABI. Dokter paru, Ratna Lusiawati dari RS Moewardi mencontohkan pemasangan masker kepada seorang siswi saat berlangsungnya sosialisasi flu babi di SMA 7, Solo, Selasa (15/7). Sosialisasi tersebut merupakan langkah antisipatif untuk menangkal beredarnya flu babi yang mulai menyerang di Indonesia.


Sport

6

WASPADA Jumat, 17 Juli 2009

Terry Tetap Biru LONDON (Waspada): Kapten Chelsea John Terry tetap akan menjadi komandan pasukan Biru, tak peduli berapapun tawaran yang diajukan Manchester City untuk membelinya. “Kami tidak akan menjual John. Jadi dipandang dari sudut itu, maka benar-benar tidak relevan tawaran yang diajukan klub lain,” tegas Ketua Eksekutif Chelsea Peter Kenyon dalam Sky News, Kamis (16/7). “Saya tidak tahu apa yang mereka (City) tawarkan. Tetapi saya yakin, John akan tetap bersama kami. John adalah azimat, dia jantung Chelsea,” tambah Kenyon. The City yang sudah sukses memboyong striker Argentina CarlosTevez dengan nilai transfer 25,5 juta pound (41,79 juta dolar AS) telah menawar kapten Inggris berusia 28 tahun itu dengan iming-imingsangatmenggiurkan. Terry sempat terpengaruh, tapi The Blues dengan tegas menolaknya. “Diaterlalupentingbagikami. Kami juga sangat yakin bahwa dia akanmemimpinkamiselama bertahun-tahun mendatang,” optimisme Kenyon.

Reuters

John Terry (kiri) dan Didier Drogba tetap dalam satu tim. PerekrutanTevez dan Roque Santa Cruz telah memperkuat garis serang Citizens, sehingga pelatih Mark Hughes mulai fokus memperkokoh barisan pertahanannya sebagai persiapan untuk bisa lolos ke Liga Champions musim mendatang. Terry pun menjadi sasaran Hughes, namun Kenyon menambahkan bahwa daripada menjual, Si Biru lebih baik mendatangkan pemain baru pada

bursa musim panas ini. “Anda akan selalu mempertimbangkanuntukmendapatkan sedikit kesegaran dan musim ini tidak berbeda. Pelatih sendiri barangkali suka mempengaruhi cara kami bermain dengan pemain lainnya,” katanya lagi. Drogba, Bosingwa Selain kepastian menahan Terry, London Blues pun mendapat berita gembira bahwa

UEFA mengurangi hukuman striker Didier Drogba dan bek sayap Jose Boswinga, menyusul pernyataan naik banding yang dilakukan Si Biru pada Rabu. Hukuman kedua ‘terpidana’ dikurangi satu pertandingan. Pernyataan dalam laman www.uefa.com, Kamis (16/7) menyatakan, Drogba menjalani hukuman tidak boleh turun dalam lima laga, dua di antaranya merupakan hukuman percobaan dalam tiga tahun ini. Penyerang Pantai Gading itu dihukum karena menghina wasit Norwegia Tom Henning Ovrebo setelah kekalahan Chelsea pada semifinal Liga Champions di markas Barcelona. BekkananPortugalBosingwa diskors larangan tiga pertandingan,namunhukumanterakhir juga merupakan percobaan dalam tiga tahun. Boswinga dihukum karena mengeluarkan komentar yang tidak pada tempatnya setelah selesai duel lawan Barca yang berkesudahan 1-1 di Stamford Bridge. Biru juga sempat naik banding atas denda sebesar 100.000 pound (163.900 dolar AS) yang dijatuhkan UEFA karena sikap buruk pemainnya ditambah ulah pendukungmerekayangmelemparkan benda keras ke lapangan. Namun denda itu tetap mesti dibayar, setelah klub London itu menarik upaya bandingnya. (h01/sky/ant/rtr/uefa)

Barca Beli Maxwell

Reuters

MADRID (Waspada): Barcelona membeli pemain sayap

kiri Inter Milan asal Brazil, Maxwell. Pernyataan dalam laman

www.fcbarcelona.com yang dikutip Kamis (16/7) menyebutkan, bayaran pemain itu sebesar 4,5 juta euro (6,32 juta dolar AS) dankemungkinanbisanaikhingga lima juta euro. Maxwell yang meraih tiga gelar liga bersama Inter, kehilangan tempat musim lalu karena posisinya digantikan pemain remaja Davide Santon. Dia kemudian dijual, setelah pelatih Jose Mourinho mengatakan I Nerazzurri kelebihan pemain. Bila setuju dengan kontrak secara pribadi serta lolos tes medis, maka pemain berusia 27 tahun itu akan bersaing dengan pemain Perancis Eric Abidal untuk menempati posisi bek kiri El Catalan, menyusul keluarnya Silvinho dari Nou Camp. Namun Maxwell punya nilai plus, sebab mantan pemain Cruzeiro dan Ajax Amsterdam itu juga dapat bermain sebagai gelandang kiri.

Selain gabungnya newcomer, El Barca pun diancam oleh pemainnya.GelandangAleksandr Hleb yang mengultimatum akan meninggalkan klub raksasa Spanyolituakhirtahunini,kecuali bila dia dimainkan secara reguler oleh pelatih Josep Guardiola. Kepada harian Rusia, SportExpress, Hleb menegaskan; “Saat ini saya masih sebagai pemain Barca. Saya akan mencoba yang terbaik, tetapi bila situasi saya di klub tidak membaik, maka saya harus mencari klub lain.” Gelandang Belarusia berusia 28 tahun itu didatangkan Los Azulgranas dari Arsenal tahun lalu dengan nilai transfer 15 juta euro (21,07 juta). Namun kesempatan main Hleb amat terbatas, padahalmusimlaluagendaBarca sangat padat dengan merebut tiga gelar dari arena Liga Champions, La Liga Primera, dan Copa Del Rey. (h01/barca/rtr)

AP

Para pemain Estudiantes pesta mengangkat tropi juara Copa Libertadores di Belo Horizonte, Brazil, Kamis (16/7) pagi WIB, setelah secara mengejutkan mampu mempecundangi Cruzeiro.

Finalis 30 Tahun Terakhir: 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009

Nacional Flamengo Penarol Gremio Independiente Argentinos Juniors River Plate Penarol Nacional Atletico Nacional Olimpia Colo Colo Sao Paulo Sao Paulo Velez Sarsfield Gremio River Plate Cruzeiro Vasco da Gama Palmeiras Boca Juniors Boca Juniors Olimpia Boca Juniors Once Caldas Sao Paulo Internacional Boca Juniors LDU Quito Estudiantes

Internacional Cobreloa Cobreloa Penarol Gremio America America America Newell’s Old Boys Olimpia Barcelona Olimpia Newell’s Old Boys Universidad Catolica Sao Paulo Atletico Nacional Club America Sporting Cristal Barcelona Deportivo Cali Palmeiras Cruz Azul Sao Caetano Santos Boca Juniors Atletico Paranaense Sao Paulo Gremio Fluminense Cruzeiro

Mahkota Kejutan Estudiantes RIO DE JANEIRO (Waspada): EstudiantesLaPlatamerebutmahkota Piala Libertadores untuk keempat kalinya dan yang pertama sejak 1970, setelah secara mengejutkan mengalahkan Cruzeiro 2-1 pada final leg kedua di Mineirao di Belo Horizonte, Brazil Kamis (16/7) pagi WIB. Klub Argentina yang telah merebut tiga tropi Libertadores secara beruntun mulai tahun 1968 sampai 1970, menang agregat 2-1 setelah bermain imbang 0-0 di kandang sendiri di La Plata pekan lalu. Cruzeirounggullebihdahulumenit ketujuh babak kedua, saat Henrique melepaskan tembakan dari jarak 25 metersetelahmenguasaibolapentalan dari bek Leandro Desabato. Estudiantes menyamakan kedudukan lima menit berselang ketika Gaston Fernandez memanfaatkan umpan silang dari Cristian Cellay. Sundulan Mauro Boselli menjadi

penentukemenangantimtamumenit 73 pasca menerima umpan sepak pojok dari kapten Juan Sebastian Veron. KemenangandikandangCruzeiro itusekaligusmengakhiricatatanburuk Estudiantes yang tak pernah menang dalam lima lawatannya ke Brazil di arena Copa Libertadores. Estudiantes pun berhak mewakili Amerika Latin pada Piala Dunia Antar Klub bulan Desember mendatang, yang juga diikuti Barcelona sebagai jawara Liga Champions. Khusus bagi kapten Veron, gelar juarakaliiniterasasangatspesial.Sebab gelandang veteran Argentina yang pernah membela Lazio dan Manchester United itu berhasil mengikuti jejakayahnyaJuanRamonyangsukses mempersembahkan tiga gelar Copa Libertadores kepada Estudiantes. (h01/ant/rtr/ap)

Beckham Berharap Pinjaman Lagi NEW YORK (Antara/Reuters): David Beckham berharap mendapatkan lagi persetujuan pinjaman lagi setengah tahun menjelang Piala Dunia 2010, agar dia bisa masuk dalam rencana pelatih Inggris Fabio Capello untukmaindiAfrikaSelatantahun depan. Selama liburan musim Liga Utama Amerika Serikat (Major League Soccer), Beckham mengisinya dengan menjadi pemain pinjamanACMilan.Diapuningin dapat persetujuan serupa tahun depan. “Menjelang Piala Dunia, pelatih Inggris menjelaskan bahwa saya perlu bermain di tingkat Eropa,” beber Beckham dalam temu pers di New York, Kamis (16/7) pagi WIB, menjelang laga LA Galaxy melawan NY Red Bulls. “Jadi saya akan melakukan segalanya yang mungkin dan

memberikankesempatankepada diri saya sendiri untuk terlibat dalam hal itu. Saat ini prioritas sayaadalahterusberusahamasuk skuadInggrisdanmewakilinegara saya. Ke depan sudah barang tentu saya ingin terlibat di Piala Dunia, saya tidak menyembunyikan fakta itu,” tegasnya. Perpanjangan pinjaman Beckham dengan Milan sempat mengejutkan banyak orang, bahkan rekan satu timnya Landon Donovan sampai mempertanyakan komitmennya kepada Galaxy. Tapi pelatih Galaxy Bruce Arena mengaku, tidak khawatir dengan gangguan tersebut. “Saya kira Beckham berada ditiminisebagaiasetbesar.Sedikit aneh proses pinjaman itu, tetapi sepenuhnya dalam persyaratan kontrak. Kami sepenuhnya menyetujui, kami tahu baik buruknya David pergi berdasarkan pinjaman,” bela Arena.

AP

Bintang LA Galaxy David Beckham (kanan) memberikan keterangan pers dengan didampingi pelatih Bruce Arena di W Hotel, Hoboken, New York, Rabu (Kamis WIB).

Juve Menang Melo

AFP

ROMA (Waspada): Juventus akhirnya mengontrak gelandang Fiorentina Felipe Melo selama lima tahun, setelah memenangkan perburuannya melawan Arsenal. The Old Lady membayar 20,5 juta euro (28,80 dolar AS) plus pemainsayapMarcoMarchionni yang berusia 26 tahun kepada La

Violauntukmendapatkanbintang baru Brazil tersebut. “Saya amat percaya dengan klub ( Juve) ini. Kami akan membangun harapan untuk mengalahkan saingan kami dan mendapatkansemuapialadiItalia dan Eropa,” tekad Melo dalam media Juve, Kamis (16/7). Melosebenarnyatelahmem-

perpanjang kontrak dengan Fiorentina, tetapi Si Nyonya Tua berhasil membajaknya atas persetujuan personal sang pemain. LaViolayangmendatangkanMelo dari UD Almeria tahun lalu, sebelumnya mengaku The Gunners merupakantimterbaikyangakan membeli Melo bila bek Arsenal Emmanuel Eboue termasuk dalam bagian transfer tersebut. Melo mengalami masalah disiplinketikaFiorentinamenempati urutan keempat Liga Seri A musim lalu, tetapi dia berhasil membuatdirinyasebagaipemain inti dalam tim Brazil yang bulan lalu menjuarai Piala Konfedeasi 2009 di Afrika Selatan. Kontrak Melo terjadi, setelah Juve gagal memboyong gelandang Italia GaetanoD’AgostinodariUdinese. Super Juve asuhan Ciro Ferrara sebelumnya juga sudah membeli playmaker Werder Bremen asal Brazil Diego Ribas da Cunha dan memulangkan

kembali bek veteran Italia Fabio Cannavaro dari Real Madrid. Khusus mengenai Melo, Presiden Fiorentina Andrea Della Valle mengaku tidak dapat menolak tawaran Juve, karena nilainya begitu besar.“Kami tidak dapat mengatakan tidak kepada Juve,” tegas Della Valle. “Tawaran sebesar itu cuma datangdariJuve.Sayamemahami alangkah berartinya klub ini bagi fan Fiorentina, tapi saya tidak dapat menahan pemain dengan kenaikanbayarannya,”dalihDella Valle dalam Channel4. Dia pun meminta tifosi La Viola jangan kecewa dan marah, karenauangpenjualanMeloakan digunakan untuk merekrut pemain baru. “Uang dari penjualan Melo akan diinvestasikan ulang secepat direktur olahraga Pantaleo Corvino menemukan opsi tepat,” janjinya. (h01/chan/ant/afp)

1


Sport

WASPADA Jumat, 17 Juli 2009

Masih Tersisa 7000 Tiket JAKARTA (Antara): Panitia lokal (LOC) akan menjual sekitar 7000 tiket Manchester United vs Indonesia All Star dari kategori I hingga III ke publik pada Sabtu (18/7) di tiket box kawasan Stadion Utama Gelora Bung Karno, Jakarta. Koordinator event LOC Tur MU, Djoko Driyono kepada wartawan di Jakarta, Kamis mengemukakan, ada sekitar 7000 tiket yang mayoritas dari kategori I hingga III yang akan dilepas ke masyarakat pada Sabtu (18/7). “Ketersediaan 7000-an tiket ini dimungkinkan dengan menariknya dari pihak ketiga yang sudah memesan jauh-jauh hari namun belum melakukan pembayaran hingga waktu yang ditentukan,” katanya. Ia mengatakan, 7000-an tiket ini akan dilepas di beberapa loket penjualan di kawasan Senayan, dan hanya pada Sabtu itu. “Tiket yang dilepas pada Sabtu itu sudah dalam bentuk tiket fisik, bukan voucher lagi,” kata Djoko. Sementara penukaran tiket akan dilaksanakan mulai 10.00 pagi. Tur MU ke Indonesia merupakan yang terlama dari lawatan resmi Asia-nya pada 2009 ini. Sebelumnya, MU hanya akan berada dua hari di Kuala Lumpur dan di Indonesia sendiri akan tinggal selama empat hari sebelum laga persahabatan melawan Seoul FC pada 24 Juli.

7

Suanty, Eddi ML Juara Graded Boling Piala Flexi MEDAN (Waspada): Suanty (SBC) tampil dengan performa terbaik sekaligus menjuarai nomor ladies graded pada Kejuaraan Boling Piala Flexi VI/2009 di Lintasan Super Bowl Perisai Plaza Medan, Selasa (14/7) malam. Peboling berusia 52 tahun itu berhasil menorehkan 2217 poin dalam 12 game. Posisi kedua diduduki Poppy S setelah membukukan 2210 poin. Pemuncak klasemen kualifikasi, Ling Ling, kali ini harus puas tampil di urutan ketiga dengan torehan 2096 poin. “Sebagai peboling yang sudah tidak muda lagi, saya bersyukur masih dapat bersaing dengan peboling yang usianya lebih muda. Awalnya saya juga tidak memasang target juara,” ujar Suanty yang pernah menjuarai Master Open Waspada Cup pada 1994 dan 1995 itu. Beda dengan Suanty, Poppy mengaku masuk tiga besar merupakan targetnya di kejuaraan tersebut. “Saya bersyukur karena mampu mencapai target,” katanya. Peboling langganan juara, Ade ‘Nana’ Ratna harus puas tanpa gelar setelah tampil kurang maksimal dan hanya menduduki peringkat kelima atau juru kunci dengan 1991 poin. Posisi keempat dihuni Ewi (2085). Gelar juara pada nomor mens graded yang finalnya digelar

bersamaan ladies graded, direbut Eddy ML. Suami peboling PON Sumut Angelina itu tampil juara setelah mencatat angka pantastis 2450. Posisi kedua diraih Antonius setelah menorehkan 2407 poin. Harta Susanto yang memiliki peluang besar lolos ke babak final master open, menduduki posisi ketiga dengan mengumpulkan 2319 poin. “Setelah menyelesaikan nomor graded, kejuaraan kali ini tinggal menyisakan kategori grade B dan master open. Untuk final grade B, akan digelar Kamis (16/7) malam ini,” jelas Ketua Panpel Nazaruddin. Hingga Rabu (15/7) malam, Budi Halim masih tetap memimpin klasemen kualifikasi master open dengan torehan 1583 poin. Budi disusul Harta Susanto (1493), Rudy Rusli (1479), Eddie MC (1465), Edi Ong (1448), Nazaruddin (1448) dan Eddy ML (1419). Babak final master open digelar Minggu (19/7). (m42)

Juara ladies graded Boling Piala Flexi, Suanty (kiri) diabadikan bersama runnerup Poppy, Rabu (15/7).

Waspada/Dediriono

PIMNAD Memprihatinkan BANDA ACEH (Waspada): Satu-satunya klub basket peserta Kobatama asal Aceh, PIMNAD, menyatakan siap bertarung di ajang Liga Kobatama 2009 Seri I yang dijadwalkan berlangsung di GOR Pasific Surabaya, 17-21 Juli mendatang.

“Meski dalam kondisi prihatin, terutama menyangkut masalah dana, kita tetap siap untuk menampilkan yang terbaik di ajang tersebut,” ungkap Manajer sekaligus Pelatih PIMNAD, dr

Lukman Hasibuan, di Bandara SIM Blang Bintang sebelum bertolak ke Surabaya, Kamis (16/7). Lukman menyebutkan, saat ini PIMNAD berada dalam krisis keuangan yang cukup berat. Hal ini disebabkan berlarut-larutnya pencairan dana, sehingga membuat manajemen PIMNAD harus mencari pinjaman guna menutupi biaya latihan, termasuk mengikuti Seri-I Liga Kobatama 2009 ini. “Begitu pun, kita berharap kondisi ini tidak mempengaruhi penampilan anak-anak. Seperti halnya musim kompetisi lalu, pada musim ini kita mentargetkan dapat menembus final four. Dengan materi pemainpemain muda, kami berharap mampu menjaga performa terbaik de-ngan belajar dari setiap

pertan-dingan,” papar Lukman. Menyangkut persiapan, Lukman menyebutkan lebih dititikberatkan pada menjaga peak performance. Sebab, belum lama ini PIMNAD baru saja mengikuti dua turnamen, yaitu Piala Walikota Surabaya danWalikota Pekanbaru. “Kondisi ini tentunya menjadi perhatian serius, disamping persiapan taktik dan strategi defense maupun offense,” katanya. Mengingat beratnya tugas yangdiembandandemimenjaga semangat bertanding anak-anak PIMNAD meraih prestasi di tengah kondisi prihatin, Lukman mengharapkan perhatian, dukunganmorildanbantuandari pihak terkait untuk membantu mereka dalam hal pendanaan.

“Kami juga tak lupa mohon doa restu dari seluruh masyarakat,insanolahragadanpencinta bola basket Aceh, agar dapat mempertahankan supremasi Aceh di kancah bola basket nasional,” tambah Lukman. Untuk musim ini, Liga Kobatama akan digelar dengan sistem setengah kompetisi. Seri I akan diikuti sembilan tim, yaitu PIMNAD, Go Skate Surabaya, Halim Kediri, Sahabat Semarang, Bogor Raya, Aliansi Biangbola Jakarta, Muba Hangtuah Sumsel, NSH-GMC Jakarta dan tuan rumah Pasific Caesar Surabaya. PIMNAD berada di Grup A bersama Halim Kediri, NSHGMC, Sahabat dan Pasific. Grup B berisikan Go Skate, Bogor Raya, Aliansi Biangbola dan Muba Hangtuah. (b07)

Racer Aceh Tamiang Boyong 3 Gelar

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: mudah (**). Jawaban di kolom 8.

5

1

2

6 9 5 4 6 3 5 8 4 5 7 8 3 6 4 8 9 7 3 4 1 8 9 5 4 2 7 3 2 4 7 8 1 7

Tunggal putra lainnya yang tumbang pada putaran kedua adalah Marcus fernaldi Gideon yangdikalahkanpemainMalaysia Misbun Ramdan Mohmed Misbun 21-16, 16-21, 13-21. Sedangkan tiga ganda campuranmembukukantempat pada putaran ketiga setelah berhasil menyisihkan lawanlawan mereka pada putaran kedua. Pasangan Kevin Alexander/ Suci Rizki Andini menang atas Jeffrey Wong/Chen Jia Yuan 2113, 21-11 untuk bertemu pasangan Jin Yong Hoon/Kim Chan Mi pada putaran ketiga.

2 1 9 6 4 7 3 5 8

Angka Tunggal Bersilang (Sudoku)

ini saya anggap sebagai suatu apresiasi bagi atlet berprestasi kami,” tutur Netty. Ketika disinggung apakah turnamen amatir tersebut menjadi bagian target untuk menjaring para pegolf yang akan diikutkan dalam SEA Games Laos mendatang, Netty mengatakan, “Bukan seperti itu.”

berlangsung selama 42 menit. Pelatih Pelatnas pratama Ronny Agustinus mengatakan Ary yang pada dua pertandingan nomor beregu tidak pernah kalah itu, bermain tegang sehingga banyaklakukankesalahansendiri. “Terlepas dari musuh yang memang lebih bagus, Ary-nya masih agak sedikit tegang mainnya, jadi serba ragu-ragu dan kurang lepas, sehingga terlalu banyak melakukan kesalahan sendiri,” kata Ronny.

3 4 8 1 5 2 9 7 6

“Ini merupakan turnamen prestasi amatir pertama dari Perkumpulan Golf Bintaro, dan kami berharap ini akan berlanjut untuk tahun-tahun selanjutnya, melalui perebutan piala bergilir,” tambahnya. Kompetisi golf tersebut menjadi bagian dari kegiatan HUT ke-13 Perkumpulan Golf Bintaro, yang juga akan menyelenggarakan Bintaro Golf Open 2009 serta event pendukung golf termasuk “golf talk”. Ketua Bidang Pertandingan PB PGI Netty Hariadi, yang hadir pada pertemuan dengan wartawan tersebut, menyatakan menyambut gembira dengan diselenggarakannya turnamen amatir yang diikuti para pegolf terbaik baik lokal maupun mancanegara tersebut. “Ini suatu pembinaan yang baik bagi para pegolf kami, kami berharapinibisaditeruskanuntuk masa mendatang dan bisa menjadi kalender tahunan PGI. Kami sangat berterima kasih atas undangan bagi para pegolf kami,

JAKARTA (Antara): Salah satu tunggal putra andalan Pelatnas pratama, Ary Trisnanto, langsung tersingkir pada pertandingan pertamanya dalam nomor perorangan Kejuaraan Asia Remaja di bawah usia 19 tahun (U-19) yang berlangsung di Kuala Lumpur, Malaysia. Ary yang mendapat bye pada putaran pertama, kalah dari unggulan kelima asal Taiwan Hsieh Ping Hsuan 21-12,15-21, 14-21padapertandinganputaran kedua, Kamis (16/7), yang

6 5 7 3 9 8 1 4 2

JAKARTA (Antara): Sejumlah pegolf amatir berprestasi putra dan putri akan bersama-sama menguji kebolehan dalam kompetisi Amateur Golf Invitational (IAGI) 2009, yang akan berlangsung 3-8 Agustus di padang golf Imperial Karawaci, Tangerang, Banten. Selain para pegolf lokal yang mempunyai peringkat di PB PGI (Pengurus Besar Persatuan Golf Indonesia) tersebut, dalam turnamen itu juga akan tampil beberapa pegolf terbaik luar negeri termasuk dari Malaysia, Thailand dan Singapura untuk saling bersaing pada turnamen baru amatir tersebut. Menurut Ketua Panitia IAGI 2009 Syamsul Alam, pegolf lokal yang ikut kompetisi itu merupakan pegolf undangan. “Kami memilih atau mengundang mereka berdasarkan prestasi ataupun peringkat mereka yang ada di PB PGI, jadi tidak mungkin menyertakan seluruh pegolf amatir,” kata Syamsul Alam kepada wartawan di Jakarta, Kamis (16/7).

Ary Langsung Tersingkir

4 7 5 8 3 1 2 6 9

Pegolf Amatir Bersaing Dalam IAGI

pagi. Sesi latihan Minggu pagi ini direncanakan mulai pukul 10.00 danbolehdisaksikanparapenontonyangsudahmembelitiketdari kategori VVIP hingga kategori I. Sebelum sesi itu, perwakilan dari Setan Merah akan lebih dulu melakukan tanya-jawab dengan wartawan media cetak dan elektronikdalamacarakonferensi pers di Hotel Ritz Carlton. Dari pihak MU, diharapkan hadir CEO David Gill, manajer Sir Alex Fergusson dan salah seorang pemain teras MU. Tim IAS sendiri akan diwakili manajer tim Andi Darussalam Tabusalla serta Bambang Pamungkas. Agenda lain, David Gill dan pemain MU serta perwakilan dari tim IAS akan menuju kawasan Senayanuntukmengikutikegiatan pendukung program penanamansejutapohonyangdicanangkan oleh pemerintah. (m33/ant)

1 2 3 9 6 5 4 8 7

nesia All Star (IAS) di laga persahabatan pada Senin (20/7) mulai pukul20.00WIBdiStadionUtama Gelora Bung Karno (SUGBK). Rombongan Red Devils direncanakan menginap di Hotel RitzCarlton,MegaKuningan.Pada Minggu (19/7) pagi, para pemain MU akan langsung menjajal lapangan SUGBK pada latihan

Bobby yang sudah direncanakan mengikutieventpada26Julinanti dalam Kejuaraan OMRYamaha di Lanud Medan. ”Semoga saja aku juga bisa tampil bagus dan menang lagi,” harap pembalap yang sudah pernah dinobatkan sebagai pembalap terbaik Kejuaraan SandaraHondaRoadRaceII2005 di Medan silam.(b24)

9 8 6 7 2 4 5 1 3

(foto) dan kawan-kawan merupakanrangkaianturmereka ke Asia. Sebelumnya ke Jakarta, mereka menjalani laga persahabatan pertama dalam Tur Asia 2009merekamelawantimMalaysia, kata Tubagus Adi, Humas PSSI, di Jakarta, Kamis (16/7). Tim utama Si Setan Merah akan bertemu dengan tim Indo-

2007 di Surabaya, Bobby menduduki peringkat 19 dari total 45 racer. ”Aku akan terus meningkatkan prestasi supaya bisa menjuarai balapan di tingkat nasional. Tentu saja untuk mencapainya bukan pekerjaan gampang atau semudah membalikkan telapak tangan, namun perlu latihan tekun dan percaya diri,” ujar

7 9 1 5 8 3 6 2 4

JAKARTA (Waspada): Jawara Liga Premier, Manchester United, menurut rencana akan tiba dengan pesawat sewaan di Bandara Halim Perdanakusuma Jakarta, pada Sabtu (18/7) malam dengan berkekuatan 90 orang yang terdiri atas pemain dan ofisial, serta manajemen tim. Kedatangan Wayne Rooney

mereka yang telah membantu karirku baik di tingkat daerah maupun nasional,” ujar Bobby yangmengakutidakdiperhatikan dari pemerintahan Kab Aceh Tamiang. Sebelumnya, Bobby juga pernah tampil di berbagai arena balap di Aceh, Medan dan sebagainya. Ketika tampil pada Kejurnas

8 6 4 2 1 9 7 3 5

Setan Merah Tiba Sabtu Malam

KUALASIMPANG ( Waspada): Bobby Febrianda Putra, 15, pembalap remaja dari Kabupaten Aceh Tamiang yang membawa bendera timYamaha TAN’S Motor Medan tampil mengesankan di Kejuaraan Daerah (Kejurda) OMR 2009 se Sumatera di Rantau Prapat, Labuhan Batu, 12 Juli lalu. Bobby didampingi ibunya, BebiVeronica, kepada Waspada di Karang Baru, Kabupaten Aceh Tamiang, Kamis (16/7) menyatakan, dirinya pada kejuaraan yang diikuti racer dari Medan, Aceh, Pekanbaru, Bengkulu dan kota lain se Sumatera itu, berhasil memboyong tiga gelar juara. Pembalap kelahiran 6 Februari 1994 ini tampil dominan dan tidak mampu diimbangi racer-racer yang berlaga di nomor Motor Prix(MP) 3, MP 4 dan MP 5. Atas keberhasilannya, Bobby mendapat hadiah uang, trofi dan piagam. ”Tim Yamaha TAN’S Motor Medan yang telah membesarkan aku di arena balap. Aku sangat berterima kasih atas perhatian

5 3 2 4 7 6 8 9 1

Reuters


Sport

8

WASPADA

Jumat 17 Juli 2009

Rossi Kejar Rekor Agostini SACHSENRING, Jerman (Waspada): Rekor demi rekor terus diburu Valentino Rossi (foto). Kini, “The Doctor” mengincar rekor sepanjang masa milik pembalap legendaris Italia, Giacomo Agostini, yang selama berkarier paling banyak naik podium, yakni 159 kali. Untuk rekor yang satu ini, Rossi tampaknya bisa menyamakan, bahkan sangat mungkin melewatinya. Pasalnya, saat ini pebalap Fiat Yamaha tersebut sudah 158 kali naik podium, menyusul hasil di Sirkuit Laguna Seca, Amerika Serikat, dua pekan lalu. Waktu itu, Rossi finish di urutan dua, di belakang rider Repsol Honda Dani Pedrosa. Hasil tersebut mem-

buat Rossi mencatat prestasi 158 kali naik podium sepanjang kariernya di semua kelas MotoGP. Dengan demikian sang juara bertahan hanya perlu satu kali naik podium lagi untuk menyamakan rekor Agostini. GP Jerman akhir pekan ini mungkin menjadi momen pembalap berusia 30 tahun tersebut untuk menyejajarkan dirinya dengan sang legenda.

Bourdais Tinggalkan Toro Rosso FAENZA, Italia (Waspada): Berakhir sudah jalinan kerjasama antara Toro Rosso dan Sebastien Bourdais (foto). Pembalap asal Perancis itu telah resmi didepak dari kursi pembalap dan akan digantikan pembalap ketiga Jaime Alguersauri. Rumor bakal didepaknya Bourdais dari balik kemudi Toro Rosso memang telah mencuat sejak beberapa pekan lalu. Meski sempat membantah, pembalap 30 tahun itu akhirnya resmi dipecat setelah dianggap gagal memberikan kontribusi maksimal bagi STR sepanjang musim ini. “Dalam dua tahun kerjasama dengannya, Bourdais tak mampu memenuhi ekspektasi. Untuk itu, kami putuskan untuk memutuskan hubungan kerjasama. Di GP Hungaria nanti, Bourdais sudah takkan ada di balik kemudi STR,” beber bos tim Toro Rosso, Franz Tost, Kamis (16/7). Dengan kabar ini, posisi yang ditinggalkan Bourdais diprediksi bakal diisi pembalap ketiga Toro Rosso, Jaime Alguersuari. Pembalap muda Spanyol itu menjadi favorit utama yang akan turun di F1GP Hungaria mendampingi Sebastian Buemi mengemudikan STR4. Catatan rekor pembalap asli didikan Toro Rosso itu memang cukup mengesankan. Sebelum menjadi pembalap ketiga, Alguersuari merupakan juara bertahan F3 Inggris. Jika nantinya tampil mendampingi Buemi, maka pembalap 19 tahun itu akan tercatat sebagai pembalap termuda di ajang F1 musim ini.(m33/vvn)

Safin Mulai Bosan BASTAD, Swedia (Waspada): Mantan petenis nomor satu dunia Marat Safin tumbang di turnamen Swedia Terbuka, Kamis (16/7), setelah kalah dari petenis Spanyol Nicolas Almagro 63, 7-6 pada putaran pertama. Usai kekalahannya, Safin pun langsung mengatakan sedang memperhitungkan kehidupannya terbebas dari raket dan bola tenis. Safin, akan pensiun akhir tahun ini, masih akan tampil dalam delapan turnamen berikutnya musim ini. “Saya sudah lelah berkelana terus, capek tinggal di hotel dan penat melakukan perjalanan...saya kira sudah cukup sekarang,” kata petenis Rusia itu. Ditanya kemungkinan beralih karir menjadi pelatih, Safin menjawab sudah lelah berkaitan dengan raket dan bola serta ingin melakukan sesuatu yang berbeda. Safin sekarang memiliki catatan kekalahan 0-3 atas Almagro, semua kekalahan itu terjadi di atas lapangan tanah liat. Sementara itu, petenis Spanyol Tommy Robredo mengawali harapannya untuk meraih gelar ketiga kalinya ketika dengan mudah mengalahkan petenis Australia Peter Luczak 6-2, 6-3. Robredo, pemenang di tempat sama tahun lalu dan pada 2006, pada pertandingan delapan besar bertemu dengan petenis asal Rusia, Teimuraz Gabashvili. Petenis Swedia Robin Soderling mengalahkan petenis Belgia Kristof Vliegen 6-2, 6-3 pada putaran kedua. (m33/ant/rtr)

Daftar pembalap terbanyak naik podium MotoGP: Giacomo Agostini 159: 122 (I), 35 (II), 2 (III) Valentino Rossi 158: 100 (I), 39 (II), 19 (III) Angel Nieto 139: 90 (I), 35 (II), 14 (III) Phil Read 121: 52 (I), 44 (II), 25 (III) Mike Hailwood 112: 76 (I), 25 (II), 11 (III) Max Biaggi 111: 42 (I), 41 (II), 28 (III) Loris Capirossi 99: 29 (I), 34 (II), 36 (III) Jim Redman 98: 45 (I), 33 (II), 20 (III) Mick Doohan 95: 54 (I), 31 (II), 10 (III) Luigi Taveri 89: 30 (I), 33 (II), 26 (III)

Balapan di Sachsenring, Minggu (19/7), juga bakal menjadi hari bersejarah bagi Rossi. Selain berusaha meraih kemenangan ke-101 dan menyamakan rekor naik podium milik Agostini, dia juga berpeluang besar menjadi pembalap yang membuat rekor tak pernah absen di MotoGP. Ketika tampil di Laguna Seca, Rossi telah menyamakan rekor pembalap Brasil Alex Barros yang selalu ikut balapan selama 158 kali tanpa putus. Dengan demikian, keikutsertaannya akhir pekan ini akan membuat Rossi sebagai rider yang paling rajin tampil di balap motor paling bergengsi di dunia. Sebelumnya, Rossi juga telah mencatat rekor 100 kali menjadi juara semua kelas di MotoGP. Itu dia raih ketika memenangkan balapan yang penuh dramatis melawan rekan setimnya, Jorge Lorenzo, di Assen (Belanda) pada 27 Juni. Artinya, Rossi perlu 22 kemenangan lagi untuk menyamakan rekor sepanjang masa milik Agostini.(m33/ap)

Pasang Iklan

4528431 HP. 081370328259 Email:

iklan_waspada@yahoo.co.id

AP

PANGGILAN Untuk dan atas nama serta kepentingan Hukum Klien kami, Perkebunan PT. SRI RAHAYU AGUNG, Alamat Jl. Pemuda No.11 Medan, Kebun Kotarih, Kec. Kotarih, Kab. Serdang Bedagai. Dengan ini diminta kepada yang namanya tersebut di bawah ini :

Nama Umur Jabatan Alamat

: : : :

Sugiono 47 Tahun Asisten Afd-2 Perkebunan PT. SRA Desa Sidodadi Batu-8, Kec. Pagar Merbau, Kab. Deli Serdang

Agar datang ke Kantor Klien kami, PT. SRI RAHAYU AGUNG, untuk menyelesaikan masalah Penyimpangan/penyelewengan hari kerja (HK) Karyawan selambat lambatnya 7 (tujuh) hari kerja sejak panggilan ini diterbitkan. Apabila dalam batas waktu yang ditentukan panggilan ini juga belum dipenuhi maka untuk selanjutnya akan diambil upaya Hukum Pidana maupun Perdata. Selanjutnya dimohon kepada Masyarakat/Khalayak ramai/Instansi Swasta, maupun Pemerintah apabila ada melihat orang tersebut di atas dan nama yang sama agar dapat menghubungi kami. Medan, 17 Juli 2009 Kuasa Hukum

PT. SRI RAHAYU AGUNG dto.

Osdiman Tampubolon, SH

PENGURUS BALAI WARTAWAN KABUPATEN ACEH SINGKIL Mengucapkan

Keluarga Besar

DPRD Kabupaten Mandailing Natal Mengucapkan: Kepada :

Bapak H. AMRU DAULAY, SH Bupati Mandailing Natal Atas Keberhasilannya Dalam Menerima

PENGHARGAAN / TANDA KEHORMATAN

“SATYA LENCANA PEMBANGUNAN” Diserahkan Oleh : Presiden RI Bapak Susilo Bambang Yudhoyono Pada Rabu, 15 Juli 2009 di Samarinda, Kalimantan Timur

“Semoga Penghargaan Diterima Semakin Memotivasi Kita Dalam Memberdayakan Ekonomi Kerakyatan Di Daerah Madina” Dari:

H. MISBAHUDDIN BATUBARA AS. IMRAN KHAYTAMI DAULAY, SH Wakil Ketua

Ketua

Drs. M. YUSUF, Msi

H. AFLAN, SH Wakil Ketua

Sekretaris Dewan

Kepada

BAPAK MAHYUDDIN DESKY, BE SEBAGAI KEPALA DINAS PEKERJAAN UMUM KABUPATEN ACEH SINGKIL YANG DILANTIK DAN DIAMBIL SUMPAHNYA

OLEH BUPATI ACEH SINGKIL BAPAK H. MAKMURSYAH PUTRA

PADA SELASA, TANGGAL 14 JULI 2009 BERTEMPAT DI OP-ROOM SETDAKAB ACEH SINGKIL

“SEMOGA SELALU MENDAPAT LINDUNGAN DARI ALLAH SWT DALAM MENJALANKAN TUGAS DAN PENGABDIAN DI ACEH SINGKIL” DARI

FADLI HAKIM

ROSTANI

KETUA

SEKRETARIS

Kepada :

Bapak : H. AMRU DAULAY, SH Bupati Mandailing Natal Atas Keberhasilannya Dalam Menerima

PENGHARGAAN / TANDA KEHORMATAN

“SATYA LENCANA PEMBANGUNAN” Diserahkan Oleh :

Presiden RI Bapak Susilo Bambang Yudhoyono Pada Hari Koperasi Ke- 62 Tahun 2009, Rabu 15 Juli 2009 Di Stadion Madya Sempaja Samarinda Kalimantan Timur

“Semoga Penghargaan Diterima Semakin Memotivasi Kita Dalam Memberdayakan Ekonomi Kerakyatan Di Daerah Madina” Dari :

PT. PALMARIS RAYA PT. RENDI PERMATA RAYA

Atas Peresmian

KANTOR CABANG PEMBANTU SIBUHUAN Jl. KH. Dewantara No. 50 - Sibuhuan Telp. (0636) 421335, 421336, 421337 Fax. (0636) 421786 Pada hari Jumat, tanggal 17 Juli 2009 / 24 Rajab 1430 H Dari: H. MUSA ICHWAN SHAH ANIF & KELUARGA JAKARTA

PT. ANUGERAH TETAP CEMERLANG (IR. M. HABIB NASUTION, MBA)

CV. KHALISHA GROUP DEVELOPER PROPERTY MEDAN

UD. PUTRA SURYA JAYA PADANGSIDIMPUAN

H. TK. SUTAN OLOAN HARAHAP & KELUARGA SIBUHUAN

PT. MAZUMA AGRO INDONESIA MEDAN - INDONESIA

PT. KARYA AGUNG SEJAHTERA MEDAN - INDONESIA

PONPES MUSTAFAWIYAH PURBA BARU - MADINA

PT. SUMATERA BERLIAN MOTOR KANTOR PERWAKILAN PADANGSIDIMPUAN

IHDINA NIDA MARBUN, SH NOTARIS & PPAT MEDAN H. TK. MHD. PARUHUM HSB SIBUHUAN

CV. ANGKOLA BERLIAN MOTOR FRANS ADRIAN BATUBARA PADANGSIDIMPUAN

UMTS

PADANGSIDIMPUAN

CV. TAXI KITA BERSAMA H. HASBULLAH SIREGAR & KELUARGA

CV. SIMPATI EIGON DALIMUNTHE & KELUARGA

MISBAHUDDIN, SH NOTARIS & PPAT PADANGSIDIMPUAN

PT. ASURANSI JASINDO PADANGSIDIMPUAN

PT. ASURANSI PAROLAMAS PADANGSIDIMPUAN

H. FAHMI ANWAR NASUTION & KELUARGA SIBUHUAN

UD. MITRA PRIMA MOTOR PADANGSIDIMPUAN

CV. TIGA SAUDARA H. TADI SIREGAR / SSS PADANGSIDIMPUAN

KOPALINO PT. PLN (PERSERO) SIBOLGA

MEDAN PHOTO STUDIO DAPOT DIPAINTEE PADANGSIDIMPUAN

MASCOTA COM - BT/BS “BIMA” PADANGSIDIMPUAN & PANYABUNGAN

PT. ASURANSI TAKAFUL INDONESIA

TK. MAS GEMBIRA BARU H. AHMAD SYAHWALI HRP PADANGSIDIMPUAN

UD. RAJA MOTOR/RATU MOTOR H. PARADA SUTAN HARAHAP PADANGSIDIMPUAN

HOTEL MARWAH H. AMINUDDIN HASIBUAN SIBUHUAN

H. MHD. RIDO HARAHAP SIBUHUAN

ROSMINAR RANGKUTI, SH NOTARIS & PPAT PADANGSIDIMPUAN

UD. MAK ADEK H. MHD. ARIS NASUTION PADANGSIDIMPUAN

H. DRS. JAMALUDDIN HASIBUAN PADANGSIDIMPUAN

TOKO FADHILLAH ASWIN HAMIDI HASIBUAN SIBUHUAN

PT. ASURANSI BUMI PUTERA SYARIAH CABANG PADANGSIDIMPUAN

AKBID DHARMAIS YAYASAN GONGONAN PADANGSIDIMPUAN

H.M. SYUKUR NIKMAT HASIBUAN & KELUARGA AEK GODANG

PERUM JAMINAN KREDIT INDONESIA CABANG MEDAN

DINAS KOPERASI MANDAILING NATAL H. YUSPI NAZRAD MANDAILING NATAL

NISA COMPUTER PADANGSIDIMPUAN

IR. SAMSON FAREDDI HASIBUAN & KELUARGA SIBUHUAN

AKBID SENTRAL PADANGSIDIMPUAN

MELVI FLORIST & SALON IWAN LUBIS PADANGSIDIMPUAN - MADINA

Ir. LELO HARAHAP & KELUARGA PADANG LAWAS UTARA

H. MATHEIS SAHERTIAN PADANGSIDIMPUAN

TOKO UTAMA ILHAM SOLEH TANJUNG SIBUHUAN


Medan Metropolitan

WASPADA Jumat 17 Juli 2009

9

Sidang Kasus Demo Maut Protap Ricuh Dua Terdakwa Dilarikan Ke Poliklinik MEDAN (Waspada): Dua terdakwa kasus demo maut massa pendukung Provinsi Tapanuli (Protap) pingsan saat melakukan aksi protes di dalam sel sementara Pengadilan Negeri Medan, Kamis (16/7). Kedua terdakwa, Ungkap SihombingdanHeriSitepudievakuasi polisi dan pegawal tahanan kepoliklinikyangadadiPNMedan untuk pertolongan medis. Ketegangan terjadi karena para terdakwa menilai pengamanandilakukanpolisiterhadapmereka terlalu berlebihan. Bahkan para terdakwa menuding salah seorang anggota polisi melakukan pemukulan terhadap salah satu dari mereka. Situasi semakin tegang ketika para terdakwa serentak berteriak keras mengeluarkan kata-kata tidak sopan kepada polisi dan melakukan pelemparan botol air mineral ke arah petugas dan menggoyang-goyang jeruji besi

dan pintu sel sementara PN Medan. Dalam kondisi memanas itu, dua orang terdakwa bernama Ungkap Sihombing dan Heri Sitepu tiba-tiba jatuh pingsan tanpa diketahui penyebabnya. Namun, setelah mendapat perawatan medis, keduanya kembali pulih dan dimasukkan lagi ke dalam sel sementara yang terletakdisalahsaturuanganbelakang PN Medan. Pantauanwartawan,sebelum kericuhan terjadi, salah seorang terdakwa menunjukkan gelagat yang kurang baik dengan berbicara keras kepada polisi yang menggiringnya masuk kembali ke sel sementara usai sidang.

Melihat sikap para terdakwa itu, polisi memperketat pengawalan terhadap terdakwa baik saat dibawa ke luar dan masuk ruang sidang. Diduga tindakan itulah yang mereka nilai berlebihan,hinggamemicuprotespara terdakwa. Puncaknya, para terdakwa melakukan aksi protes di dalam sel sementara dengan menggoyang-goyang jeruji dan pintu sel sementara PN Medan itu dan melakukan pelemparan ke arah petugas. Melihat aksi para terdakwa itu, separuh kekuatan polisi yang diturunkan mengawal proses persidangan difokuskan di ruang sel sementara PN. Situasi kembali terkendali, setelah sejumlah polisi dan pengawal tahanan menenangkan mereka. Kapoltabes Medan, Kombes Pol Imam Margono saat dikonfirmasi wartawan terkait kericuhan itu mengatakan, tidak benar ada anggotanya melakukan pemukulan terhadap salah seorang terdakwa. “Anggota saya hanya melakukan pengamanan sebagaimana mestinya, hal ini guna mengantisipasi hal-hal yang tidak diingini, jadi tidak ada yang namanya pemukulan,” tegas Imam Margono. Kata dia, tudingan terdakwa

ada ditendang dan dipukul polisi, tidak benar. “Anda lihat tadi. Kedua terdakwa yang pingsan kita bawa dengan baik-baik usai persidangan,” katanya. Tertunda Sementara itu, sidang lanjutankasusProtap75persentertunda karena sebagian besar kuasa hukum para terdakwa tidah bersedia hadir dan menyatakan boikotsementaraterhadapproses persidangan. Menurut Akhyar Adardam, kuasa hukum terdakwa demo maut dari Otto Hasibuan Low Office di luar persidangan, merekatidakmenghadirisidangkarena menganggap tuntutan JPU selama 7 tahun penjara kepada 6 terdakwa kasus Protap pada sidang sebelumnya dinilai tidak memenuhi rasa keadilan. “Kami protes atas tuntutan JPU karena dinilai mencederai keadilan, kami akan melakukan rapat sesama tim advokasi Protap untuk menetukan sikap selanjutnya,” katanya. Secara terpisah Direktur Lembaga Anti Kekerasan dan Terorisme Sumut, Afrizon Alwi, SH yang dihubungi wartawan mengatakan, apa yang dilakukan para advokat itu dianggap telah menyalahi kode etik advokat

contempt of court (menghina peradilan). Dirinya meminta lembaga advokat memeriksa mereka. Sebab boikot terhadap sebuah persidangan dapat dikatagorikan menggangu jalannya proses persidangan. Menurutnya, jika para advokat yang mendampingi terdakwa merasa keberatan dengan tuntutan jaksa, mereka bisa melakukan pembelaan dan yang lainnya. “Ini bukti ketidakprofesionalisme mereka. Persidangan bisa terganggu, terdakwa yang dibela akan dirugikan karena proses sidang ditunda. Jika lembaga advokad bisa membuktikan, maka pengacara yang memegang perkara itu bisa dicopot sebagai pengacara,” katanya. PantauandiPNMedan,sebagian besar sidang para terdakwa akhirnya ditunda majelis hakim hinggapekandepankarenahampir semua terdakwa tidak didampingi kuasa hukumnya. Sejumlah ketua majelis hakim mengingatkan kepada terdakwa, jika pada sidang selanjutnya kuasa hukum terdakwa juga tidak hadir, maka sesuai KUHAP,sidangtetapakanmereka lanjutkan meski mereka tidak didampingi pengacaranya. (h05)

DPRDSU Tertipu Disnaker Dan PT CGGC Waspada/Surya Efendi BATAL SIDANG: Tersangka yang mengenakan gelang hitam sewaktu meninju Ketua DPRDSU pada peristiwa 3 Februari 2009 batal mengikuti persidangan dan digiring petugas menuju mobil tahanan dari PN menuju Rutan Tanjung Gusta, Kamis (16/7).

Segerakan Medan Sebagai Kota Metropolitan MEDAN (Waspada): Semua pihak agar tak beranjak dari konsep dan visi untuk menjadikan Medan sebagai kota metropolitan yang modern, madani dan religius. Ini penting, mengingat konsep itu seolah-olah hanya sedap dibaca namun minus aktualisasinya. “Mudah-mudahan ini jadi renungan pemimpin kota Medan yang akan datang,” sebut Ketua DPD PAN Kota Medan, Ahmad Arif, SE, kepada wartawan, Rabu (15/7), saat disinggung soal semakin dekatnya pergantian pelaksana tugas Walikota Medan. ArifbilangsiapapunyangakanmenggantikanPltWalikotaAfifuddin Lubis, harus memahami konsep dan visi yang tertuang dalam rencana pembangunan kota Medan itu. “Seharusnya, pergantian pimpinan bukan berganti kebijakan, melainkan melanjutkan program dan visi yang telah ditetapkan,” sebut anggota DPRD Medan ini. Hal ini, menurut dia penting, mengingat perjalanan aktualisasi menuju Medan yang madani, modren dan religius ini nyaris tersendat. “Bukankah mewujudkan kota Medan sebagai kota jasa, perdagangan, keuangan dan pendidikan yang siap bersaing secara regional dan global dengan sistem lalu lintas keuangan yang efisien, kompetitif itu suatu bentuk keinginan yang mulia?” tanya Arif. Apalagi cita-citanya adalah untuk mendukung infrastruktur sosial ekonomi yang lengkap, pondasi perekonomian yang kuat, serta pembangunan yang berfokus pada peningkatan kesejahteraan rakyat. “Hemat saya, semua ini masih tersendat-sendat dilakukan oleh Pemko Medan, dan ini merupakan tanggung jawab semua pihak,” ujarnya. Arif mengingatkan agar pelaksana tugas Walikota Medan untuk tidak terjebak dengan hal-hal klasik dan birokrasi, sebaik nantinya menjabat di Medan. Banyak hal yang perlu diteruskan dan diberi semangat, terutama soal pelayanan publik, penanganan banjir dan perbaikan infrastruktur di kota Medan. “Masyarakatmasihmenginginkansisteminformasidanpelayanan kepada masyarakat secara langsung, singkat dan efisien. Segerakan prosedur pelayanan satu atap yang sudah ada,” anjur Arif. (m08)

MEDAN (Waspada): Komisi E DPRDSU tertipu aksi PT. China Gezhouba Group Corporation (CGGC) dan Disnakertrans Pemprovsu, dalam menyelesaikan persoalan pembayaran upah lembur buruh perusahaan yang mengambil tender proyek PLTA Asahan I diTobasa itu. Akibatnya sekitar 31 buruh kebanyakan masyarakat Tobasa terlantar di DPRDSU. Awalnya, Rabu (15/7) sekitar pukul 11:00, puluhan buruh PT CGGC berunjukrasa kembali di gedung DPRDSU, karena pihak perusahaan tidak menepati janji untuk membayar upah mereka, sesuai kesepakatan dalam pertemuan yang di mediasi Komisi E DPRDSU pada 1 Juli 2009 lalu. Dimana dalam pertemuan itu, PT CGGC berjanji akan menyelesaikan segala permasalahan dengan 31 buruh pada 13 Juli 2009 melalui staf Disnakertrans Provsu, Bilman Nainggolan. Surat kesepakatan itu ditandatangani oleh anggota Komisi E,

2009-2014. Dimana penanggulangan kemiskinan menjadi agenda dan prioritas utama untuk menurunkan angka kemiskinan yang telah menjadi komitmen global dalam millenium development goals di tahun 2015 nanti. Kemiskinan, lanjut Gubsu, wajibuntukditanggulangisebagai tanggungjawab negara terhadap kesejahteraan rakyatnya. Melalui rapat koordinasi ini, diletakkan kembali tugas dan fungsi masingmasing instansi/SKPD sesuai PP No. 38 tahun 2007 dan PP No. 41 tahun 2007 dimana Bappeda wajib mengkordinasikan perencanaan monitoring dan evaluasi seluruh program penanggulangan kemiskinan. Sebelummengakhirisambutannya, Gubsu memberikan beberapa langkah strategis yang perludilaksanakanbersamauntuk memperkuat dan mengoptimalkan kelembagaan TK-PKD provinsi dan kabupaten/kota, yakni sebagai tindak lanjut dari Perpres No. 13 Tahun 2009 akan segera dikeluarkan pedoman mengenai pembentukan tugas, susunan keanggotaan, kelompok kerja, sekretariat dan pendanaan TK-PKDprovinsidankabupaten/ kota. Agar penanggulangan kemiskinan dapat berjalan efektif dan efisien. Selainitu,melakukanpenguatan kapasitas manajerial penge-

Kadisnakertrans, Ketua Komisi E DPRDSU langsung menyuruh buruh untuk bersabar. Dia juga sempatmengkritikaksiunjukrasa buruh dengan menilai mereka tidak sabar menunggu upahnya dibayar. “Kadisnaker sudah berjanji upah kalian akan dibayar hari ini juga,” kata Budiman kepada para buruh. Namun pantauan Waspada, sampai pukul 18:00, upah yang sudah dijanjikan itu masih juga belum dibayar. Puluhan buruh PT CGGC tersebut masih terduduk lesu di halaman gedung DPRDSU. Anehnya, staf Disnakertrans Provsu, Bilman Nainggolan, yang awalnya dikatakan sudah membawa uang dari perusahaan dari Tobasa ke Medan, ternyata tidak benar. Dia hanya mengaku pihak perusahaan tidak bersedia membayar upah para buruh tersebut. Sejumlah buruh sendiri saatinimengakusudahkehabisan uang untuk ongkos kembali ke Tobasa.(h11)

Gubsu Datang Ke Kejati MEDAN (Waspada): Gubernur Sumatera Utara (Gubsu), H. Syamsul Arifin, SE datang Kejaksaan Tinggi Sumut (Kejatisu), Kamis (16/7). Rumor berkembang di sana, kedatangan orang nomor satu di Sumut itu, diduga terkait kasus dugaan korupsi penanganan relokasi banjir bandang Bahorok senilai Rp50 miliar yang sedang ditangani Kejatisu. Namun, hal itu dibantah Kasi Penkum/Humas Kejatisu, Edi Irsan Tarigan Kurniawan, SH, M.Humsaatdikonfirmasi Waspada. “Tidak benar Gubsu datang karena terkait kasus korupsi, be-

RPJMN 2009-2014 Prioritas Utama Penanggulangan Kemiskinan MEDAN (Waspada): Gubsu, H Syamsul Arifin, SE yang diwakili Asisten I Pemprovsu, Hasiholan Silaen, membuka Rapat Koordinasi Penanggulangan Kemiskinan Daerah (TK-PKD) Provsu Tahun 2009diRoyal PerintisHotel Medan,Selasa(14/7).Hadirdalam kesempatan itu, istriWagubsu Ir Gatot Pujonugroho dan sejumlah undangan lainnya. Gubsudalampidatonyayang dibacakan Hasiholan Silaen menyampaikan, hingga Maret 2009 penduduk Sumut hidup serbakekuranganmencapai23,01 persen. Sebagaimana diketahui bersama bahwa jumlah penduduk Sumut yang masih hidup dalam serba kekurangan berdasarkan data BPS (Tahun 2008) sebanyak 1.613.800 orang atau 12,55 persen dan Maret 2009 pendudukmiskindidaerahpedesaan sebesar 11,56 persen dan di daerah perkotaan sebesar 11,45 persen dari jumlah penduduk Sumut. Syamsul mengatakan, penanggulangankemiskinansebagai salah satu upaya meningkatkan kesejahteraan masyarakat merupakan amanat UUD 1945 yang dituangkandalamberbagaiagendapembangunannasionalantara lain, melalui rencana pembangunan jangka menengah nasional (RPJMN) tahun 20042009 yang segera berakhir dan akan dilanjutkan dalam RPJMN

DisnakerProvsu,DisnakerTobasa, PT CGGC dan pihak buruh. Namunketikaburuhmendatangi Kantor Disnakertrans Provsu pada tanggal yang disepakati tersebut, ternyata pihak perusahaan dan staf Disnakertrans, BilmanNainggolan,tidakadayang hadir. Bahkan ketika dihubungi, telefon mereka tidak ada yang aktif. Buruh yang merasa dibohongi langsung berunjukrasa ke DPRDSU, Selasa (14/7). Ketua Komisi E DPRDSU, Budiman Nadapdap,dansejumlahanggota Komisi E lainnya yang menerima aksi buruh tersebut langsung memanggil Kadisnakertrans Provsu, Rapotan Tambunan, untuk memberikan penjelasan kepada buruh. Dihadapan buruh, Kadisnakertrans mengatakan saat ini stafnya, Bilman Nainggolan, sedang dalamperjalananmenujuMedan sambil membawa uang upah buruh dari perusahaan. Mendengar penjelasan

lolaansekretariatTK-PKDmelalui berbagai pelatihan, sehingga TKPKD provinsi dan kabupaten/ kota dapat terdukung dalam meningkatkan koordinasi dan pengendalian program penanggulangan kemiskinan, pengalokasiananggarandariAPBDuntuk kelembagaan dan operasional TK-PKDprovinsidankabupaten/ kota. Dia juga menambahkan, TKPKD perlu membentuk unit pengaduan masyarakat sebagai wadah pengaduan pelaksanaan berbagai program penanggulangan kemiskinan. Melalui rapat itu, Tim TK-PKD provinsi dan kabupaten/kota dapat merumuskan program kerja maupun jumlah desa/kelurahan yang akan dibina sampai 2013 dan dapat menganggarkan dana khusus Taskin untuk desa/ kelurahan tertinggal di kabupaten/kota dari dana APBD Provinsi Sumut tahun 2010 yang akan datang. Sementara itu, panitia Soleha dalam laporannya menyampaikan tujuan acara ini adalah mengadakan komunikasi dengan cepat agar dapat dipercepat pencapaian target pengurangan kemiskinan daerah di pedesaan dan perkotaan. Adapun jumlah peserta yang hadir mencapai 91 orang yang berasal dari provinsi dan kabupaten/kota di Sumut. (m19)

liau hadir di Kejatisu hanya bersilaturrahim,” pungkas Tarigan. MenurutTarigan, Gubsu bersama rombongan tiba di Kejatisu sekitar pukul 12:00, dan langsung menuju ruangan Kajatisu, Sutiyono. “Saya hadir dalam pertemuan antara Kajati dan Gubsu itu. Jadi tidak betul kehadirannya terkait soal kasus korupsi, itu salah,” demikian Tarigan. Isu gubsu datang ke Kejatisu terkait kasus dugaan korupsi berhembus karena saat ini Kejatisu tengah melakukan penyelidikan atas kasus dugaan korupsi dana bantuan Departemen Sosial RI senilaiRp50miliaruntukpenanggulangan banjir bandang di Desa Bukit Lawang, Kec, Bahorok Kab Langkat tahun 2003. Saatperistiwabanjirbandang Bahorok itu, terjadi Gubsu menjabat sebagai Bupati Langkat. Kasus ini sendiri dibuka kembali setelah Kepala Kejatisu yang baru Sutiyono, SH dilantik di mana pimpinanterusmenginstruksikan agardilakukanpendalamankasus dugaan korupsi lama yang sem-

pat terhenti. Seperti diketahui, banjir bandang yang berasal dari hulu sungai Bahorok di Kab. Langkat tersebut telah memporakporandakankawasanpemukimanpenduduk dan kawasan wisata Bukit Lawang, serta menelan korban yang diperkirakan sedikitnya 150 orang tewas dan 104 lainnya dinyatakan hilang. Kerugian tersebut belum termasukkerugianhartabenda,baik kerusakan maupun kehilangan harta benda. Hasil investigasi Departemen Kehutanan RI, menyebutkan, penyebabnya penebangan hutan di Kawasan Taman Nasional Gunung Leuser. Dari data Departemen Kehutanan menyebutkan bahwa luas hutanIndonesiayangrusakmencapai43jutahektardaritotal120,35 hektar. Rp50 miliar anggaran APBNmelaluiDepartemenSosial RI pasca bencana dikucurkan untuk relokasi tempat tinggal 354 rumah masyarakat sekitar yang telah hancur dan sejumlah item lainnya. (h05)

Waspada/Andi Aria Tirtayasa

TERBAKAR: Pabrik marqisa Pyramid Unta terlihat tinggal puing setelah dilalap si jago merah, Kamis (16/7) sekira pk 13:30. Kerugian diperkirakan mencapai ratusan juta rupiah.Warga meminta agar Pemko Medan meninjau kembali keberadaan pabrik yang berlokasi di pemukiman padat penduduk tersebut.

Pabrik Markisa Terbakar MEDAN (Waspada): Pabrik markisa Pyramid Unta yang berlokasi di Jalan Sei Kera Gang Rezeki B, Kelurahan Sei Kera Hulu, Kec. Medan Perjuangan, Kamis (16/7) sekira pk 13:30, musnah dilalap si jago merah. Tidak ada korban jiwa dalam musibah tersebut namun kerugian diperkirakan mencapai ratusan juta rupiah. Informasi yang diperoleh di lokasi kejadian menyebutkan, sekira pk 13:00, para karyawan yang berjumlah 20 orang sedang istirahat makan siang. Tiba-tiba saja para karyawan terkejut karena melihat api membesar di bagian belakang. Beberapa karyawan spontan berusaha memadamkan kobaran api, namun sia-sia karena api terus membesar dan menyambar semua benda-benda yang rentanterbakar. Kobaranapiyang diwarnai suara ledakan drumdrum dan botol-botol tersebut membuat suasana semakin hiruk-pikuk, apalagi mobil Dinas Pencegah dan Pemadam Keba-

karan terlambat tiba di lokasi kebakaran. Setengah jam kemudian, barulah mobil Pemadam Kebakaran tiba lokasi dan berhasil memadamkanapi,sehinggatidak merembes ke rumah-rumah pemukiman penduduk. Pantauan Waspada di lokasi kejadian, pabrik syrup tersebut sudah dua puluh tahun lebih beroperasi di tengah-tengah pemukiman penduduk, namun warga tidak mengetahui persis siapa pemilik pabrik tersebut, apalagi karyawan pabrik bukan warga setempat. Humas pabrik marqisa, Rajab, yang yang ditemui di lokasi kebakaran mengakui pabrik kecil tersebut memang benar memproduksi syrup Pyramid Unta, sedangkan pemiliknya Suwandi Onggo kini masih berada di Jakarta. Mengenai sumber api, Rajab belum bisa mengetahuinya, karenasaatkejadiantersebutpara karyawan sedang istirahat makan siang dan tiba-tiba melihat

kobaran api. Sementara itu, Kapolsekta Medan Timur, AKPYatim Syahri Nasution, saat ditanya Waspada belum mengetahui penyebab kebakaran tersebut. “Petugas masih melakukan penyelidikan penyebabkebakarandansumber api,” jelasnya. Beberapa warga yang berlokasi di sekitar pabrik itu meminta agar Pemko Medan meninjau ulang kembali keberadaan pabrik tersebut karena letaknya di tengah-tengah pemukiman penduduk. “Kami juga tak mengetahui siapa pemilik pabrik tersebut karena pemiliknya selalu berganti-ganti,” sebut seorang warga. Jangankanwarga,kepalalingkungansetempatjugatakmengetahui persis siapa pemilik pabrik tersebut. “Saya tak tau persis siapa pemilik pabrik karena selalu berganti-ganti. Kalau pun datang ke pabrik ini hanya karena mengantar surat pembayaran PBB aja,” ujar ibu kepling seraya pergi meninggalkan wartawan. (cat)

Kompol PP Terancam Pecat MEDAN (Waspada): Terkait telah bebasnya oknum Komisaris Polisi (Kompol) PP menjalani hukuman1tahunpenjaradariRutan TanjungGustaMedan,tersangkut kasuspencabulandanpemerasan terhadap ibu rumah tangga berinitial H br S, warga Jalan Pabrik Tenun Medan, Propam Poldasu tinggal menunggu penyerahan dari atasan oknum itu untuk sidang kode etik. Kapoldasu, Irjen Pol Drs Badrodin Haiti, melalui Kabid Propam, Kombes Pol Drs Junimar Aritonang Rajagukguk, saat dikonfirmasi, Kamis (16/7), mengatakan, apabila Kompol PP sudahmendapatkeputusantetap dan telah menjalani hukuman (tahanan), Propam tinggal menunggu penyerahan (permohonan) atasannya untuk sidang kode etik. Kabid Propam menjelaskan, setiap anggota Polri yang telah menjalani tahanan selama satu tahun di Rutan terancam pemberhentian secara tidak hormat darikesatuantugasnya.“Biasanya kalau sudah menjalani hukuman satu tahun terancam pecat,” jelasnya. Menurut Kabid Propam, hingga saat ini pihaknya belum menerima permohonan dari atasan Kompol PP untuk sidang kode etik. Secara terpisah Kepala Kantor Depkum dan HAM Sumut, Drs. Mashudi, BcIP, MAP saat dikonfirmasi, membenarkan Kompol PP telah habis menjalani tahanan di Rutan Tanjung Gusta

Medan. “Terdakwa mendapat cuti bersyarat. Persyaratan untuk mendapatkan cuti bersyarat Narapidana yakni yang dipidana 1 tahun ke bawah dan telah menjalani 2/3 dari masa pidananya serta besarnya cuti bersyarat paling lama 3 bulan,” jelasnya. Sebagaimana diberitakan sebelumnya, pada masa Kapolri, Jendral Pol Drs Bambang Hedarso Danuri, MM menjabat sebagai Kapoldasu,pernahberjanjidalam rapat dengan Komisi A DPRD Sumut, bila Kompol PP telah terbukti bersalah dengan mempunyaihukumtetapakandipecat dari keanggotaan Polri. Perkara ini berawal dari pengaduan suami korban, B.Sibarani ke Direktorat Reskrim Poldasu 14 Februari 2006 lalu. Dalam laporannya disebutkan bahwa Kompol PP yang tinggal di Perumnas Simalingkar Medan itu, telah memperdaya korban dengan cara memasukkan pil penenang ke dalam segelas air minum sehingga berhasil mencabulinya di salah satu hotel di Jalan Ir. Juanda Medan. Selain mencabuli korban, PP juga mengambil foto bugil H br S dengan menggunakan ponsel miliknya. Foto itu selalu digunakannya untuk memeras korban dan selalu melakukan pengancaman dengan pistol jika menceritakan peristiwa tersebut kepada suaminya atau siapapun. Akibat perbuatan tersebut, terpidana divonis oleh Pengadilan Negeri (PN) Medan dengan

nomor putusan, No:3718/Pid.B/ 2006/PN.Mdnpada13Desember 2006 dengan hukuman 8 bulan penjara. Kompol PP tidak terima dengan vonis tersebut, lalu mengajukan banding ke Pengadilan Tinggi (PT) Sumut, namun di PT vonis terpidana dikuatkan sesuai dengan tuntutan Jaksa Penuntut Umum (JPU) yakni menjadi 1 tahun penjara dengan nomor putusan No : 30/Pid/2007/PT pada tanggal 13 Februari 2007. Lagi-lagi terpidana tidak terima dengan putusan PT, maka Kompol PP mengajukan Kasasi ke Mahkamah Agung (MA). Akan tetapi, Kasasi yang di ajukan tersebutditolakMAdenganalasan bahwa terpidana telah terbukti melakukan perbuatan pidana sehingga PT Sumut menghukum terpidana 1 tahun penjara. Berdasarkanhalitu,makaMA menolak kasasi Kompol PP yang tertuang dalam salinan putusan MA dengan No: 1260 K/Pid/2007 dibacakan dalam rapat permusyawaratan MA pada 25 Januari 2008, Majelis Hakim MA yang diketuai German Hoediarto, SH. Berdasarkan Mahkamah Agung tersebut, Rabu (10/12) sekira pukul 10:00, Kompol PP bersama dengan kuasa hukumnya datang ke Kejaksaan Negeri (Kejari)Medan,untukmemenuhi panggilanJaksaPenuntutUmum (JPU) selaku eksekutor dalam melakukan eksekusi terhadap terpidana karena perkara tersebut telah berkekuatan hukum tetap. (m39)


Medan Metropolitan

10

WASPADA

Jumat 17 Juli 2009

Calhaj Jangan Panik Soal Paspor Hijau MEDAN (Waspada) : Terkait keputusan pemerintah Arab Saudi tentang penggunaan paspor hijau bagi para calon jamaah haji (Calhaj), Kakandepag Medan, Drs H Abdul Rahim, MHum menghimbau agar tidak terjadi kepanikan di tengah masyarakat. “Apalagi proses pengurusan paspor akan ada pengaturan secara baik dan tidak akan dipungut bayaran atau gratis, sehingga jangan ada yang mengurus dengan menggunakan jasa calo,” katanya, Kamis (17/7), terkait penerapan paspor hijau oleh pemerintah Arab Saudi pada pelaksanaan haji tahun ini. Dikatakannya, dalam surat Kakanwil Depagsu bernomor: KW.02/4-c/Hj.00/2219/2009 tertanggal15Juli2009berdasarkan surat dari Dirjen Penyelenggara Haji dan Umroh Depag RI No. DJ.VII/3/Hj.00/1520/2009 tanggal14Juli2009yangditujukan kepada seluruh Kakandepag kabupaten/kota di Sumut menyebutkan, selain tidak dipungut biaya dalam pembuatan paspor internasional itu, surat itu juga menjelaskan, pembuatan paspor internasional bagi jamaah Calhaj di Kantor Imigrasi terdekat di mana jamaah Calhaj berdomisili. Sedangkan dalam pengurusannya, lanjut H Abdul Rahim, jamaah Calhaj diimbau tidak

menggunakan jasa pihak-pihak lain. Sementara persyaratan yang harus dipenuhi jamaah Calhaj, yakni memfotokopi KTP dan Kartu Keluarga serta menunjukkan Akta Kelahiran/Surat Kenal Lahir/ Surat Nikah/ijazah. “Jika salah satudaridokumen itu tidak ada, maka jamaah Calhaj diharuskan mengurus surat keterangan dari Kakandepag kabupaten/kota. Sedangkan jadwal pengurusan paspor jamaah dan pemvisaannyaakandisampaikan lebih lanjut,” sebutnya. Dia menambahkan, meski tidak bisa dipungkiri bahwa saat pembuatan paspor, para jamaah dari tempat terpencil apalagi diusia yang tidak muda lagi tentu memerlukan waktu khusus dan tenaga yang tidak sedikit untuk bisa membuat paspor. Tetapi dalam hal ini, pemerintah akan memberikan kemudahan dengan pengurusan paspor gratis dan cara pengurusan yang akan disesuaikandenganlokasitinggaljamaah setidaknya di kabupaten/kota. “Intinya, paspor hijau bagi calon jamaah haji jangan sampai

Tirtanadi Dinilai Terus Gunakan Kekuatan Monopoli MEDAN (Waspada): Perusahaan Daerah Air Minum (PDAM) Tirtanadi milik Pemprovsu dinilai terus menggunakan kekuatan dengan kekuasaan yang monopolistik untuk mengeluarkan kebijakan kenaikan tarif air. “Dengan kekuatan monopoli yang dimiliki, pemerintah daerah dengan gampang mengeluarkan kebijakan seperti menaikkan tarif air, sedangkan konsumen yang hanya bergantung kepada PDAM Tirtanadi tidak punya pilihan lain dan mau tidak mau, harus mengikuti kebijakan itu,” kata seorang pengamat Prof. H. Aldwin Surya, SE, M.Pd, Ph.D kepada Waspada, Kamis (16/7), menanggapi rencana Pemprovsu akan melakukan penyesuaian tarif air sebesar 35 persen. Aldwin menyebutkan, seperti kebijakan sebelumnya PDAM Tirtanadi mengeluarkan kebijakan kutipan Rp3.000 untuk biaya administrasi, meskipun rakyat menolak, tetap saja kebijakan tersebut terus dijalankan, karena tidak ada pilihan lain. Menurut Aldwin, hukum ekonomi ketika permintaannya semakin tinggi, sementara mereka satu-satunya penawarannya, kita tidak bisa berbuat apa-apa, karena PDAM sifatnya monopolistik. Oleh karena itu dari segi customer service action (kepuasan pelayanan), beban biaya yang ditanggung dengan tingkat kepuasan yang dimiliki tidak sesuai. Aldwin yang juga rektor Universitas Dian Nusantara (Udnas) ini menilai, ada indikasi PDAM Tirtanadi dan Pemprovsu diduga memanfaatkan kesempatan di ujung masa tugas DPRD dengan membuat kebijakan-kebijakan untuk menaikkan tarif air agar disetujui anggota dewan karena sudah tidak mempunyai waktu lagi untuk mengurusi permasalahan itu dan sibuk berkemas-kemas meninggalkan kursi dewan. (m41)

Lurah Sei Kera Hilir II Pertahankan Kepling Arogan MEDAN (Waspada): Lurah Sei Kera Hilir II enggan berpihak kepada masyarakatnya terkait tuntutan warga agar mengganti Kepling XIV karena dinilai menyulitkan berbagai urusan. “Terbuktilurahhanyamemberikanperingatanpertama,kemudian jika bermasalah dilakukan peringatan kedua dan begitu seterusnya,” kata Abu Bakar salah seorang warga di sana. Menurut Abu Bakar, sebagai pimpinan seharusnya dapat mengayomi masyarakat bukan sebaliknya menyengsarakan dengan cara mempersulit pengurusan oleh warganya. Sementara itu, Lurah Sei Kera Hilir II Vianti Dewi Nasution menyatakan, pihaknya sudah memperingati kepling terkait. “Jika dalam tempo sebulan prilakunya tidak juga berubah kepada warganya, kita akan berikan Surat Peringatan ke-2,” tegasnya. Penegasan itu telah disampaikannya kepada sejumlah perwakilan dari puluhan kepala keluarga (KK) yang siang itu datang menagih janjinya untuk memberikan jawaban soal tuntutan warga agar kepling mereka diganti. Alasan warga menuntut diganti, karena kepling mereka bertindak arogan dan mempersulit warga dalam berbagai urusan, termasuk dalam hal mendapat bantuan pemerintah seperti beras miskin (raskin) dan bantuan langsung tunai (BLT). Tuntutan warga itu tertuang dalam surat pernyataan sikap yang diteken 50-an warga Lingkungan XIV di Gang Mandor Suro dan Gang Toke Umar. Meski lurah telah memberikan alasan itu, perwakilan warga, di antaranya, HM Yusuf, Aprilyono, Binsar Tambunan, Abdul Muin, dan Rusman mengaku sangat kecewa terhadap lurah yang terkesan melindungi yang salah. Padahal, keluhan warga terhadap prilaku kepling itu sudah lama disampaikan.(m38)

membuat panik apalagi hingga menimbulkan konflik, sebab keputusan ini diatur oleh pemerintah Arab Saudi sehingga mereka yang tidak menggunakan paspor hijau tidak akan mendapatkan visamenunaikanibadahhaji.Pertukaran paspor dari coklat kepada yang hijau bukan menjadi masalah karena pemerintah akan menindaklanjuti secara arif. Sedangkan jamaah yang sudah memiliki paspor tentu saja tinggal menyesuaikan waktu masa berlakupaspornya,”kataRahimsembari menyebutkan pembuatan

paspor tidak dipungut biaya. Segera Daftar Diamengatakan,sejak13Juli12 Agustus merupakan waktu pelunasan Biaya Perjalanan Ibadah Haji (BPIH/ONH) bagi jamaah Calhaj yang mendapatkan porsi haji tahun ini. Karena itu, jika Calhaj sudah melunasi BPIH agar segera mendaftar ke Kandepag Medan Cq Seksi PB Haji dan Umroh Jalan Sei Batugingging No.12 untuk pendataan jamaah dalam penyusunan Kloter selambatnya seminggu setelah pelunasan BPIH nya.

“Jika sampai batas waktu ditentukan,adajamaahCalhajyang tidak melunasi BPIH nya, maka Calhaj itu dianggap mengundurkandiri.Selamauangnyatidak ditarik dari bank, maka statusnya sebagai jamaah masih masuk “daftartunggu”(waitinglist)untuk berangkattahunberikutnya,”jelas HAbdul Rahimsembarimenambahkan , jumlah jamaah Calhaj Kota Medan untuk tahun 1430 H/2009 ini sekitar 3.000 orang. Sedangkan hingga kini ada 10.000 orang yang masuk daftar tunggu hingga tahun 2013. (m36)

Aksi Ngelem Anak Jalanan Memprihatinkan Belum Ada Penanggulangan Dari Pemko, Pemprovsu MEDAN (Waspada): Aksi ngelem semakin terang-terangan dilakukan anak-anak jalanan di Kota Medan. Menghirup bahan kimia yang bisa merusak jaringan syarafotakmanusia,tidakmengenalwaktudantempat.Fenomena sosial itu menjadi pemandangan setiap hari, siang dan malam, di perempatan lampu merah. Pantauan Waspada,kemarin, modusnya berpura-pura duduk. Kedua tangan menutup mulut dan hidung. Setelah dilihat lama dari jarak dekat, ternyata di tangan mereka menggenggam lem kaleng kecil dibungkus kantong plastik kemudian dihirup hingga mata layu dan menerawang. Setelah ngelem , anak jalanan itu tertidur, bernyanyi dan sebagianadayangkembalimenghampiri pengendara di lampu merah dengan mata layu dan berair. Taman-taman kota menjadi lokasi operasi mereka. Bahkan anakanak jalanan itu membuat ayunan kain diikat di pohon palm dan menggelar lapak, seperti di taman perempatan Jalan Ir H Juanda-Brigjen Katamso, Jalan AH Nasution-Brigjen Zein Hamid, Jalan Gatot Subroto Bundaran Majestik, Jalan Jamin GintingNgumban Surbakti, Jalan Sisingamangaraja-Halat. Selain itu, pos-pos Polantas, satpam dan sudut-sudut ruko yang tidak berpenghuni juga dijadikan lokasi empuk.Titik-titikitusaatiniminim penerangan lampu jalan, membuat aksi mereka kian marak. Terkadang aksi mereka berhenti ketika sadar arah mata pengendara menyoroti. Seketika

mereka melepaskan tangan yang menempel kuat di hidung dan menyembunyikan bungkusan berisi lem itu. Sebagian menyelinapketempatlain.Merekamelanjutkanaksiitusetelahpengendara melaju saat lampu hijau. Seorang anak jalanan berusia 13 tahun asal Tanjung Morawa, menepis dikatakan ngelem. Namunketikadidesak,Selasa(14/ 7) malam, dia akhirnya mengakui mengelem bersama temannya di taman yang mendekat perempatanJalanJuanda-SultanMa’mun Alrasyid.“Mengelemuntukmenghilangkan suntuk, bang,” katanya ketikausaimenghampiripengendaradilampumerahJalanJuanda. Anak jalanan kelompok rentan yang didahului coba-coba ini, mengaku sudah sebulan mengelem di taman-taman dan emperan ruko. Uang membeli lem dari hasil mengamen seharian. Kata anak yang hidup di jalanan bersama orangtuanya itu, teman-temannya nekat mengelem dua kali sehari. “Satu lem kaleng kecil untuk satu orang terkadang secara bergantian,” katanya yang enggan menyebutkan namanya. Sesalkan Sementara itu, Ketua Komisi Perlindungan Anak Indonesia Daerah Sumatera Utara (KPAIDSU) M. Zahrin Piliang, mengaku prihatin dan menyesalkan pemerintahdaerah,PemkoMedandan Pemprovsu belum juga menangani persoalan sosial ini. Padahal, lanjutnya, KPAID Sumut telah memberikan masukansoalpenanganananakjalanan dalam Musrenbang baru-baru

ini. Tetapi belum ada tindakan konkret sampai sekarang. Begitu juga Pemprovsu belum mengimplementasiPerdaNo4tahun2008 tentang penanggulangan gelandangan dan pengemis. “Mana upaya penanggulangan Pemko dan Pemprovsu, kenapa anak jalanan terus dibiarkan terlantar dengan ngelem,” ujarnya. Menurut Zahrin, penanggulangan anak jalanan harus dilakukan melalui pendekatan responsif bukan penertiban represif selama ini dilakukan Satpol PP. Setelah ditangkapi dan dipukili kemudian dilepas. Dalam Musrenbang Pemko Medan, baru-baru ini, lanjutnya, KPAID telah memberikan masukanagarPemkosegeramelakukan pendekatan responsif untuk menanggulangi problem sosial itu. Harus ada pekerja sosial mendampingi aparat pemerintah untuk berdialog dengan anakanak jalanan. Setelah persoalannya teridentifikasi, lanjutnya, Pemda harus duduk bersama dengan pihak-pihak terkait untuk melakukan tindakan. Zahrin mengatakan, berdasarkan pantauan KPID, anak jalanan itu memiliki spesifik sehingga penanganannya juga harus spesifik. Ada yang hidup bersama keluarganya di jalanan dan ada anak yang terputus dengan orangtua. Atas dasar itu dengan upaya responsif yang digalakkan akan bisa menghubungkan kembali anak yang terputus dari orangtua/keluarganya dan menanggulangi anak beserta keluarganya yang hidup di jalan. (m15)

Disbudpar Tidak Lakukan Pengawasan

Warga Protes Restoran Traders MEDAN (Waspada): Usaha tempat hiburan yang tidak memperhatikanlingkunganterjadilagi. Kali ini warga kompleks Perumahan Taman Pati Indah, memprotes keberadaan Restoran Traders yang terletak di Jalan Patimura, Kelurahan Darat, Kecamatan Medan Baru. 21Warga kompleks PerumahanTaman Pati Indah, membuat surat keberatan atas dua hal dari keberadaan usaha yang memiliki izin restoran itu. Surat itu telah mereka layangkan ke berbagai instansi. Waspada memperoleh copysuratkeberatanitudariSekretaris Komisi C DPRD Medan Zulkifli Husein, SE, Kamis (15/7). Warga membuat surat keberatantanggal13Juli2009,ditujukan kepada camat Medan Baru.Tembusannya disampaikan kepada Gubsu, Kapoldasu,Walikota Medan, DPRD Medan, Kapoltabes, DinasPariwisataMedan,Kapolsek Medan Baru dan Lurah Kelurahan Darat. Dalam suratnya, warga meminta instansi terkit menertibkan Restoran Traders, karena meng-

anggu ketenangan mereka. Dari restoran itu setiap malam terdengarsuaramusikyangsangatkeras hinggalarutmalam.Halitu mengganggu ketentraman warga. Selainsuarabising,wargajuga mengeluhkan bau busuk hasil limbah Restoran Traders yang tidak mengalir di parit. Pihak restoran tidak pernah membersihkan saluran parit yang mengandung limbah itu. Kata warga, mereka tahu izin yang diberikan Pemko kepada pengelolaTradersadalahrestoran. Tapi praktiknya restoran itu menampilkanjugamusikdengan suarasangatkeras.Wargamenduga musik diputar untuk tamu-tamu tertentuyangtidaklagidatanguntuk menikmati makanan. Di antara warga yang menandatangani surat keberatan adalah Apin, penghuni rumah no 142, Sumardi, penghuni rumah no 145 A, Dr Jansen (no 145 B), Budi (no 145 C), Amei (no 145 D), dan seterusnya hingga penghuni rumah no 145 T. Menanggapi masalah ini, Sekretaris Komisi C DPRD

Medan Zulkifli Husein, SE, minta, Pemko segera merespon pengaduan warga. Menurutnya, Dinas Kebudayaan dan Pariwisata (Disbudpar) sudah seharusnya memantauseluruhkegiatanusaha yang berkaitan dengan hiburan, karena disinyalir banyak yang melanggar. Seperti masalah Restoran Traders, menurut Zulkifli Husein, terjadi karena lemahnya pengawasan dari Disbudpar. Setelah menerbitkanizin,instansiinitidak lagi melakukan pemantauan hingga terjadi pelanggaranpelanggaran. Walau mengaku belumturunkelapangan,namun Zul Husein, mengaku keberatan masyarakat itu benar. “Karena tidak mungkin masyarakat ingin mencari masalah,’’ katanya. Komisi C sendiri akan mengundang berbagai pihak terkait untuk menyelesaikan masalah ini. Yakni Disbudpar, pengelola RestoranTradersdanmasyarakat. ‘’TapisebaiknyaDisbudparsegera menyelesaikanmasalahini,hingga tidak menimbulkan masalah berkepanjangan,” katanya. (m17)

400 Warga Polonia Berobat Gratis MEDAN (Waspada): Memperingati Hari Bhakti TNI Angkatan Udara ke-62, diadakan bhakti sosial pengobatan massal lebih kurang 400 warga Jl. Starban Ujung, Kelurahan Polonia, Kecamatan Polonia, Kamis (16/7). PersonilTNIAUmemilihbhaktisosialdikawasanpadatpenduduk, kebetulan Kelurahan Polonia kawasan ujung Bandara tergolong padat penduduk memerlukan perobatan gratis. Mayor Kes Drg S. Harmoko, Kepala Rumah Sakit Dr Abdul Malik TNI AU Medan yang juga Ketua panitia pelaksana ketika dikonfirmasi membenarkan, kegiatan ini dalam rangka Hari Bhakti TNI AU ke-62. Bahkan, menurut Harmoko, program ini mengacu kepada Undang-Undang nomor 34/2004 tentang TNI, bhakti sosial merupakan operasi militer selain perang (OMSP). Hadir pada kesempatan itu antara lain Panglima Hanudnas III, Marsma TNI Chaerudin Ray, SE, Dan Lanud Medan, Kol. Pnb Tata Endrataka, pengurus PIA Ardhya Garini dan keluarga besar TNI AU. Harmoko menegaskan, puncak kegiatan Hari Bhakti TNI AU ke-62 biasanya pada 29 Juli 2009, antara lain dilakukan bhakti sosial pengobatan massal secara gratis, donor darah di RS. Abdul Malik Medan, anjangsana ke sejumlah panti asuhan di kawasan Medan, karya bhakti dilingkungan masyarakat, ziarah ke Makan Taman Pahlawan (TMP)dan berbagai kegiatan olah raga. Kepala RS. Abdul Malik yang didampingi Pentak Lanud Medan, Kapten Sudjarwoto, membenarkan, sebagaimana tahun-tahun sebelumnya, jajaran TNI AU mengadakan bhakti sosial dua kali setahun. Dalam kegiatan ini melibatkan tujuh dokter, empat bidan dan belasan perawat dari RS Dr Abdul Malik Medan. Sementara tahun 2009, April sudah dilakukan kegiatan di kawasan padat penduduk Kelurahan Karang Sari Medan, dan 16 Juli 2009 di Kelurahan Polonia, termasuk khitanan massal kepada anak-anak warga yang kurang mampu. (m32)

Waspada/Abdullah Dadeh

PENGOBATAN GRATIS:Warga Kelurahan Polonia Medan, ramai-ramai datang ke Posko pengobatan gratis Hari Bhakti TNI Angkatan Utara ke-62.

Waspada/Surya Efendi

SISA POHONTUMBANG: Pekerja dari Dinas Pertamanan Kota Medan, Rabu (15/7), membersihkan sisa pohon tumbang di Jl. Letjen Djamin Ginting, Padang Bulan Medan, setelah diterpa hujan deras dan angin kencang, kemarin. Jika tidak dirawat dengan baik, pohon-pohon dipinggir jalan dikhawatirkan akan memakan korban.

Penyaluran Raskin 2010 Berlanjut Pemko Medan Dinilai Cukup Baik MEDAN (Waspada): Program pemerintah mengentaskan perekonomian rakyat kepada keluarga miskin melalui penyaluranberasmiskin(raskin)dengan harga murah diperkirakan tidak akansemurahtahun2009,karena pemerintah berencana akan menaikan harga tebus menjadi Rp2.000 per kg dari saat ini Rp1.600 per kg. Demikian juga jumlah keluarga miskin yang mendapatkannya akan berkurang. Rencana akan adanya kenaikan harga untuk program berasbagikeluargamiskin(raskin) terungkap dalam rapat monitoring dan evaluasi program raskin oleh tim koordinasi raskin Provinsi Sumut, dihadiri Ketua Tim Program Raskin Pusat dan Raskin Bulog Pusat di Balai Kota Medan, Kamis (16/7). Ketua Tim Monitoring Program Raskin Kementerian Kesejahteraan Rakyat dan Sosial Dr Adam Setiana dalam pertemuan itu menjelaskan, program raskin hingga tahun 2010 masih adadanpemerintahberketetapan untuk melanjutkannya. Program raskin itu terbukti sangat membantu dan sangat diharapkan masyarakat ekonomi lemah, tetapipemerintahmerencanakan akan menaikan harga tebus dari saat ini Rp1.600 per kg menjadi Rp2.000perkg,sedangkanjumlah beras yang diterima tetap 15 kg per rumah tangga sasaran (RTS)

dibagikan selama 12 bulan. Rencana kenaikan ini kata Deputi Menko Kesra dan Sosial, merupakan rencana dari Departemen Keuangan. ‘’Bukan harganyasajayangberubah,tetapi jumlah pagunya juga akan berkurang,’’ ujarnya. Namun pihaknya berharap dan akan berusaha untuk menambah jumlah pagunya minimal hargainitidaknaik sama dengan tahun 2009. Ketua Tim Monitoring Program Raskin Kementerian Kesejahteraan Rakyat dan Sosial Dr Adam Setiana mengatakan, apakahrencanakenaikaniniakan dilaksanakan, masih tergantung dengan keputusan DPR RI. Karena rencana ini pada tahun sebelumnyajugatelahdiajukannamun gagal karena ditentang dewan. Mengenai jumlah yang dibagikanmelebihiyangdiberikan pemerintah pusat 15 kg/keluarga. Menurut Setiana, hal itu bisa saja dilakukan oleh pemerintah daerah masing masing yang diperoleh dari APBD-nya Kepada Asisten Ekbang Pemko Medan Harmes Joni, camat dan lurah, Setiana menjelaskan, jumlah pagu raskin seluruh Indonesia pada tahun 2010mendatangsudahdiperoleh pemerintah,yakni17.500.000RTS. Jumlah ini berkurang dibanding tahun 2009 yang mencapai 18.500.000. RTS. Mengapa jumlah RTS malah

berkurang, menurut Adam, masalah ini memang dilematis karena jumlah ini bergantung dataBadanPusatStatistikdimana updating data ini dilakukan BPS setiap tiga tahun sekali. Ketua tim Raskin Bulog Pusat Bakri dalam pertemuan itu menjelaskan, program raskin yangtelahditetapkanpemerintah dilanjutkan hingga tahun 2010 ini akan mengalami perbaikan administrasi, di mana setiap keluarga miskin akan mendapat kartu raskin. Program ini diharapkanakanmenjaminterjadinya tertib administrasi. Sedangkan Kepala Divre Bulog Sumut yang baru, Muhammad Muchtar, dalam pertemuan itu mengatakan, penyaluran dan pembayaran raskin di Medancukupbaikatau92persen. “Ini artinya telah menyamai prestasi nasional.” Kepada camat dan lurah, Kabulogsu mengingatkan agar pembayaran raskin diselesiakan dengan baik karena uang raskin ini adalah uang negara. Asisten Ekbang Pemko Medan Harmes Joni kepada ketua tim monitoring dan evaluasiraskinpusatmenjelaskan, masyarakat miskin yang menerima raskin di Medan berjumlah 86.323 RTS dan dibagikan ke 148 titik kelurahan dengan jumlah raskin yang telah disalurkan sebanyak 7 putaran (bulan ke 7). (m35)

Sesalkan DPRD Tak Tanggap Ternak Babi MEDAN (Waspada): Warga Medan Denai menyesalkan sikap anggota DPRD Medan terutama dari fraksi partai Islam dan berbasis Islam, karena tidak menyuarakan keluhan mereka menyusul terjadinya ternak babi bersebelahan dengan masjid. “Kami prihatin melihat keberadaan anggota dewan di Medan terutama dari fraksi partai Islam,” kata tokoh masyarakat Medan Denai, Usman, Jakfar dan Ikhyar kepada Waspada di Medan, Selasa (14/7). Kata Usman, harusnya fraksi partai Islam peka dan tanggap untuk menyuarakan aspirasi dan keluhan masyarakat Medan Denai yang terzalimi dengan munculnya ternak babi bersebelahan dengan rumah ibadah. Keresahanmasyarakatsudah berlangsung lama yakni tiga hingga lima tahun setelah hadir, tumbuh dan berkembangnya ternakbabidikawasanitu.Sejumlah pengaduan baik lisan dan tulisan sudah juga disampaikan ke Pemko dan DPRD Medan. Bukan hanya itu, kata Jakfar,

dua tahun lalu warga juga sudah melakukan aksi unjuk rasa damai dengan nama Masyarakat Anti Ternak Babi (MATI), meminta Pemko dan DPRD Medan menertibkan ternak babi di kawasan itu. Herannya, aksi damai yang dilakukan masyarakat tersebut tidak pernah disambut hangat oleh partai Islam di lembaga legislatif untuk ikut memperjuangkan bagaimana agar ternak babi yang merupakan sumber keresahan itu ditertibkan. Padahal,kataIkhyar,paracaleg dari partai Islam dan berbasis Islam termasuk dari partai nasional ketika melakukan reses dan kampanye pileg, selalu menjanjikan akan memperjuangkan keiginan masyarakat dari wilayah itu. “Ketika itu, kami hanya minta tertibkan ternak babi,” tegas Ikhyar. Saat ini, keresahan umat di kawasan Kecamatan Medan Denai, sudah berada pada posisi puncak, bahkan memprihatinkan setelah adanya ternak babi disebelah tempat suci yakni mas-

jid di Jalan Tangguk Bongkar. Namun,keresahanitusamasekali tidak mendapat sambutan para anggota dewan terutama dari partai Islam. Harusnya, sebagai wakil rakyat apalagi dari daerah pimilihan Kecamatan Medan Denai, timpal Usman, tanpa diminta mereka harus menyikapi dan memperjuangkannya di lembaga legislatif dan eksekutif. Tapi itu yang tidak terjadi. Tak satu pun fraksi partai Islam secara maksimal membantu perjuangan umat Islam di kawasanKecamatanMedanDenai,untuk menertibkan ternak babi. Kalau pun ada hanya separuh hati. Dalamkonteksini,mengingat sudah menyangkut masalah akidah, harusnya para anggota dewan dari lintas partai berazaskan Islam menyatu, bagaimana agar keresahan warga karena ternak babi bisa diselesaikan. “Para anggotadewanjanganlagimelihat kepentingankelompok,tapiharus mengedepankan kepentingan umat dan mempertahankan akidah,” kata Ikhyar. (m14)


Medan Metropolitan

WASPADA Jumat 17 Juli 2009

11

Dua Pasien AIDS Meninggal MEDAN (Waspada): Dua pasien pengidap HIV/AIDS di RSUP H. Adam Malik Medan, yakni MAL, 24, dan MS, 30, meninggal dunia di Ruang Rindu A1. Keduanya meninggal secara berurutan yaitu Selasa (14/7) dan Rabu (15/7) malam. “MS meninggal hari Selasa sore sekitar pukul 22.15WIB. Sementara MAL meninggal hari Rabu sekitar pukul 22.15WIB, keduanya positif AIDS,” kata Kasubbag Humas, Sairi M. Saragih, Dcn, Mkes Kamis (16/7), di ruang kerjanya. Saragih mengatakan, pasien yang berinisial MAL berasal dari Rutan Tanjung Gusta. MAL dikirim atau masuk ke RS. Adam Malik,Selasa(14/7),danmeninggal Rabu (15/7). Sedangkan MS adalah warga Simalungun, masuk ke RS. Adam Malik, Senin (13/ 7), meninggal Selasa (14/7). “Keduanya hanya satu hari mendapatkan perawatan di RS ini. Kemungkinan penyakit

keduanya sudah komplikasi atau sudahparahbarudikirimkemari,” ujar Saragih. Berdasarkan data yang diperoleh Waspada di lapangan, RSUP HAM kini merawat 13 pasien baik yang suspect HIV/AIDS dan yang sudah positif HIVAIDS. Satudiantaraketigabelastersebut adalah wanita. Seluruh pasien yang dirawat tersebut rata-rata berumur dibawah tiga puluh tahun. Dan, rata-rata pengguna narkoba. Pantauan Waspada di Ruang Rindu A1, seluruh pasien suspect HIV/AIDS maupun positif berbaringditempattidurnyamasingmasing. Semuanya terlihat kurus. Salah seorang pasien HIV/AIDS

Jadwal Sertijab Wakapoldasu Belum Diketahui MEDAN (Waspada): Jadwal serah terima jabatan Wakil Kepala Kepolisian Daerah (Wakapolda) Sumut belum diketahui, namun surat mutasi sudah dikeluarkan Kapolri yang tertuang dalam telegram rahasia (TR) No. Pol: TR/340/VII/2009 tertanggal 14 Juli 2009. “TR Kapolri untuk pergantian jabatan Wakapolda sudah kita ketahui, tetapi saya belum tahu kapan pelaksanaan sertijabnya,” kata Plh Bid. Humas Polda Sumut AKBP MP Nainggolan, Kamis (16/7), ditanya sertijab Wakapoldasu. Kata dia, dalam TR Kapolri itu, selain jabatan Wakapoldasu, ada 39 perwira tinggi dan perwira menengah lainnya yang direposisi, seperti promosi jabatan dan yang akan memasuki masa pensiun. Dalam TR itu,Wakapoldasu Brigjen Pol. Edward Raymond Pakasi akan diserahterimakan kepada perwira menengah Kombes Pol. Syafruddin, Taruna Akademi Kepolisian (Akpol) 1985 yang saat ini ajudan Wakil Presiden Jusuf Kalla. Sedangkan Brigjen Edward Raymond Pakasi Taruna Akpol 1974 yang sejak Februari menjabat Wakapoldasu selanjutnya menjabat Kepala Biro Perbekalan Umum Staf Deputi Logistik Polri. Selain itu, seorang perwira menengah Poldasu juga dimutasi dalam rangka promosi yakni, Karo Ops Kombes Pol. Sigit Sudarmanto. Dia akan diangkat sebagai Direktur Akademik Sekolah Staf Pimpinan (Sespim) Polri. Jabatan Sigit selanjutnya diisi Kombes Pol. Anang Pratanto, sebelumnya penyidik utama Direktorat (Dit) IV Narkoba Bareskrim Polri. (m11)

Dzikir Dan Tausiyah Di Masjid Raya 19 Juli MEDAN (Waspada): Az-Zikra Sumatera Utara, Minggu (19/ 7) pukul 07.30, menggelar zikir dan doa di Masjid Raya Al Mashun Medan dengan menghadirkan penceramah asal Medan Ustadz H. Sutan Syahrir Dalimunthe. Ketua Az-Zikra Sumut H Rizal Mahaputra, kemarin, mengatakan, acara itu akan diawali dengan pembacaan ayat suci Al Quran oleh qori/hafiz HM Saleh Daulay dan dilanjutkan doa. Sedangkan zikir langsung dipimpin Ketua Az-Zikra Sumut H. Rizal Mahaputra. Sementara itu, Rizal Mahaputra mengimbau seluruh kaum muslimin dan muslimat juga dapat menghadiri acara yang sama sore harinya, ba’da Ashar, bersama Majelis Dzikir Anni’sa Umul Khairot dari Kota Batam pimpinan Mualimah Hj. Suaidah Hajar di Masjid Namiroh Asrama Haji Pangkalan Masyhur Medan. Rizal mengutip firman Allah SWT dalam Al Quran: “Sesungguhnya kematian yang kamu lari daripadanya, maka sesungguhnya kematian itu akan menemui kamu. Kemudian kamu akan dikembalikan kepada (Allah), yang mengetahui yang ghaib dan yang nyata, lalu dia beritakan kepadamu apa yang telah kamu kerjakan.” (QS. Al-Jum’ah [62] : 8). Firman Allah SWT ini, lanjutnya, terkait kematian yang tidak bisa dihindari. Hal ini juga menjadi kajian atau ceramah dalam tausiyah pada acara zikir di Masjid Raya Al Mashun. Rizal mencontohkan, narapidana yang menjalani hukuman mati mungkin baik karena dia tahu kapan dijemput malaikat maut. Dan seorang yang berjuang mengangkat senjata di jalan Allah adalah lebih baik lagi karena dia tahu pilihan di hadapannya kematian yang mulia. (rel)

Waspada/Ist

BERSAMA: Ketua Majelis Zikir Az-Zikra Sumatera Utara H. Rizal Mahaputra , foto bersama Ustadz H. Sutan Syahrir Dalimunthe yang akan memberi tausiyah di Masjid Raya Al-Mashun, Minggu 19 Juli 2009.

Tiga Pencuri Kabel Diringkus MEDAN (Waspada): Tiga spesialis pencuri kabel dan baterai tower milik Telkom diringkus petugas Polsekta Percut Seituan dari Jalan Perhubungan, Desa Lau Dendang, Kec. Percut Seituan, Kamis (16/7) sekira pk 03:00. Ketigatersangkamasing-masingRiswanSiregar,31,wargaKomplek UKA, Kelurahan Sungai Mati, Medan Labuhan, Rudi Sitanggang, 36, Lorong Veteran Bagan Deli, Kecamatan Medan Belawan dan Andrian Surambogo, 25, warga Lingkungan X, Kelurahan Pekanlabuhan, Kecamatan Medan Labuhan. Polisi menyita barang bukti berupa 1 tang besar pemotong besi, dua kunci pas, 3 obeng, 2 kunci letter L dan satu unit mobil Kijang warna hijau BK 1389 DH yang digunakan untuk membawa barang-barang hasil curian. Kapolsekta Percut Seituan, AKP Edi Bona Sinaga, mengatakan, ketiga tersangka ditangkap ketika sedang beraksi hendak memotong jaringan kabel dan baterai milikTelkom di kawasan Jalan Perhubungan. “Tersangka Ridwan dan Rudi merupakan pelaku utama sedangkan seorang lagi bernama Andrian hanya sebagai supir,” jelas Sinaga seraya menambahkan ketiga tersangka disinyalir sudah lama melakukan aksi pencurian jaringan kabel dan baterai karena peralatan yang digunakan untuk mencuri sangat lengkap. Ketiga pencuri tersebut kini dijebloskan ke dalam sel Polsekta Percut Seituan. “Polisi masih melakukan pengembangan karena diduga ada sindikat yang sama dalam kasus pencurian jaringan kabel Telkom,” jelas Kapolsek. Pada hari yang sama, petugas Polsekta Percut Seituan menjaring 24 sepeda motor karena tidak dilengkapi surat tanda nomor kendaraan dan BPKB. Sedangkan pemilik kendaraan yang tak memiliki SIM dikenakan surat tilang. Menurut AKP Edi Bona Sinaga, razia kenderaan bermotor tersebut bertujuan untuk mengantisipasi aksi pencurian sepeda motor di wilayah hukum Polsekta Percut Seituan dengan menggunakan sistem hunting dan stasioner di beberapa titik yang rawan. “Razia tersebut dilakukan secara rutin sesuai atensi Kapoltabes MS, Kombes Drs Imam Margono,” sebutnya. (cat)

berinisial J yang ditemui Waspada di Ruang Rindu A1 juga mengaku dariRutanTanjungGusta.Dirinya terlibat kasus pencurian. “Saya dikirim ke Adam Malik, Selasa kemaren,” jawabnya. Sementara itu, Koordinator VCT RSUP HAM, Rahmat Nur Kurniawan, S.Psi menyarankan, agar penderita HIV/AIDS yang berada di LP maupun di rutan segera dikirim secepatnya ke RS. Adam Malik, jangan tunggu sampai penyakitnya parah baru

dikirim. “Seperti MAL meninggal akibat menderita tuberlukosis paru (TB Paru) dan jamur di mulut.Sehinggadayatahantubuhnya menurun. Mungkin keadaannya waktu dikirim ke RS. Adam Malik sudah parah. Seharusnya pasien HIV/AIDS dikirim ke RS ini secepatnya, jangan tunggu sampai parah baru di bawa kemari.” Dalam menanggulangi dan mencegah penularan HIV/AIDS, Rahmat yang juga ketua konselor

HIV/AIDS Sumut mengingatkan, agar KPA (Komisi Penanggulangan Aids) harus lebih sering melakukan penyuluhan tentang apa itu HIV/AIDS, bagaimana pencegahannyakesekolah-sekolahdan tempat-tempat yang termasuk resiko tinggi HIV/AIDS. Rahmat juga meminta agar KPA juga melakukan kerjasama dengan klinikVCT-VCT yang ada. “Sampai sekarang, KPA Sumut belum pernah melibatkan VCT RS.AdamMalik,” sesalnya. (cmai)

Kadis Rangkap Jabatan

Dinkes Medan Kurang Tanggap Terhadap Flu Babi MEDAN (Waspada):Walaupunjumlahpasienyangterjangkit flu babi terus bertambah di Kota Medan, namun Dinas Kesehatan (Dinkes) Kota Medan kurang serius menanggapinya. Pasalnya, sampai saat ini belum terlihat adanyaupayasosialisasiterhadap masyarakat seperti mendirikan poskodimasing-masingkelurahan. “Kepala Dinas Kesehatan Kota Medan dr Edwin Effendy, MSc merangkap jabatan sebagai Direktur RSU Dr Pirngadi Medan, sehingga mengakibatkan kurang konsentrasi terhadap flu babi. Selain itu, sudah menjadi budaya bagi Pemko selalu terlambat dalam mengatasi masalah-masalah dimasyarakat,”kataanggotaDPRD MedanIkrimahHamidy,STkepada Waspada, Kamis (16/7). Dia mengatakan, Pemko Medan harus bekerja keras untuk melakukan sosialisasi antisipasi terhadap flu babi. Jadi, jangan menunggukasusinimenjadibesar baru sibuk melakukan tindakan. “Sampai sekarang Pemko belummaksimaldalamantisipasi flu babi. Mungkin mereka merasa tidak penting terhadap flu babi karena kasusnya belum besar,”

ucapnya. Dalam hal ini, Ikrimah dengantegasmengatakanDinkes Medan harus waspada dan sigap serta kerjakeras dalam mengantisipasi penyebaran flu babi. Karena virus tersebut bukan hal biasa. Jadi, sangat perlu sosialisasi seperti membuat spandukspanduk di tempat masyarakat. Secara terpisah, Kepala Dinas Kesehatan Kota Medan dr Edwin ketikadikonfirmasiterkaitdengan virus flu babi mengatakan, pihaknya sudah melakukan pengamatan di setiap kelurahan dan membuat sosialisasi kepada masyarakat yakni dengan memberitahu warga bila mengalami demam-demam segera ke klinikklinik yang disediakan oleh Pemko. “Petugaskesehatankitaselalu siap siaga untuk melayani masyarakat. Kalau ada yang mengalami gejala demam, maka langsungdibawakeklinikterdekat. Selain itu, masyarakat jangan panik dan cemas terhadap flu babi,” kata Edwin. Dia menambahkan, masyarakat tidak perlu khawatir dengan virus flu babi. “Masyarakat Kota

Medan jangan takut dan cemas dengan flu babi.Yang penting bila ada merasakan demam-demam atau flu segera ke klinik untuk melakukanpemeriksaan,”ucapnya. Sementara itu, diketahui kasus flu babi di Kota Medan terus bertambah, setelah Departemen Kesehatan RI kembali mengumumkan hasil pemeriksaan sample darah serta swab (cairan) hidung dan tenggorokan milik pasien suspect flu babi dari sejumlah daerah. Kadis Kesehatan Sumut dr. Candra Syafe, SpOG membenarkan adanya pertambahan kasus flu babi baru di Kota Medan. “Penderita flu babi ini termasuk penumpang yang satu pesawat dengan penderita flu babi yang pertama kali dirawat di RSUP H. AdamMalik,” ujarnya. Total penderita flu babi di Kota Medan sebanyak 7 orang. Mereka dinyatakan suspect flu babi setelah melakukan perjalanan dari Thailand – Malaysia – Indonesia. “Jadi, seluruh kasus flu babi di Kota Medan ‘diimpor’ dari luar negeri. Belum ada kasus flu babi yang berasal dari daerah ini,” ujar Candra. (h10)

Jumlah Pasien Suspect Flu Babi 48 Orang 29 Diobservasi Di Rumah, 19 Dirawat MEDAN (Waspada): Sejak Rabu (1/7) sampai Kamis (16/ 7), RSUP H. Adam Malik telah memeriksa sebanyak 48 pasien suspect flu babi atau H1N1. 19 orang diantaranya dirawat di Ruang Isolasi RSUP. H. Adam Malik dan 29 orang lainnya diobservasi di rumah. “Tapi hari ini yang dirawat tinggal empat orang, yakni Sy, 27, SS, 31,YM, 20, dan Ar, 60, mereka belum dipulangkan karena hasil swab dan darahnya belum keluar dariPusatPenelitiandanPengembangan Kesehatan Jakarta, suhu tubuh mereka hari ini normal, “ ujar Kasubbag Humas, Sairi M.

Saragih Dcn, Mkes kepada Waspada,Kamis(16/7)diJl.Bungalaw Medan. Sementara yang telah dipulangkan, yakniWKC, 9, CK, 14,Vi, 20, Er, 36, Ca, 17, DA,7, Iv, 9, Mi, 36, TGS, 42, Gu, 39, Ag, 41, RAL, 11, Eu, 7, El dan 37. Enam dari mereka yang dipulangkan sebelumnya dinyatakan positif flu babi, tapi setelah pemeriksaan ulang, hasilnya negatif. “Makanya mereka diperbolehkan pulang.” Sementara itu, Rabu (15/7) malam, RSUP HAM kembali memeriksa dua pasien suspect flu babi, yakni NAS, 33, dan IH, 9. Keduanya adalah ibu dan anak

warga Raya Menteng Medan. “Mereka baru pulang dari Malaysia, karena takut terkena flu babi keduanyamemeriksakandiriTapi hanya diobservasi di rumah.” Dengan bertambahnya dua lagi pasien yang diobservasi di rumah, jadi jumlah yang diobservasi di rumah sebanyak 29 orang. Enam dari mereka yang diobservasi di rumah hasilnya negatif, yakni Se, 8, MM, 7, NT, 8, RH, 5, CB, 12, dan Su, 37. “Keseluruhan pasien yang memeriksakan diri ke Adam Malikmemilikilatarbelakangpernah mengunjungi daerah-daerah terjangkit,” ujar Sairi. (cmai)

BKOW, FE USU Adakan Penyuluhan Kewirausahaan MEDAN (Waspada): Badan Kerjasama Organisasi Wanita (BKOW) Sumut bekerjasama dengan Fakultas Ekonomi Universitas Sumatera Utara (USU) mengadakan kegiatan penyuluhan kewirausahaan kepada masyarakat Dusun Tanah Persil Desa Bagan Percut Kecamatan Percut Sei Tuan Kabupaten Deli Serdang, Rabu (15/7). Kegiatan penyuluhan yang menjadi salah satu program kerja Bidang Ekonomi/Koperasi BKOW Sumut serta dipadu dengan program pengabdian masyarakat FE USU tersebut bertujuan untuk memotivasi warga agar dalam menekuni dunia usaha sekecil apapun tetap prospek dan dapat menjadi andalan keluarga guna menghidupi rumah tangga.

Tampil sebagai narasumber Prof Dr Rismayani, MS dengan topik “Mengelola Pemasaran Usaha Kecil”, Drs Nakman Harahap, MSi tentang “Modal Kerja” dan Raja Bongsu Hutagalung terkait “Manajemen Usaha Kecil dan Mengenal Potensi Sumberdaya Manusia”. Kegiatan penyuluhan yang dihadiri Ketua BKOW Sumut Ny Zakaria Siregar, Wakil Ketua Bidang Ekonomi/Koperasi Ny Ulfah Marzuki MS dan sejumlah unsur Pengurus BKOW Sumut lainnya itu mendapat tanggapan positif dari warga. “Jarang kami yang warga dusun mendapat penyuluhan cara mengelola usaha langsung dari seorang profesor dan ahli ekonomi,” ungkap salah seorang peserta. Ketua BKOW Sumut Ny

Zakaria Siregar menjelaskan, pihaknya secara terjadwal tetap melakukan pembinaan kepada rakyat kecil di sejumlah dusun maupun desa di Sumatera Utara terutama dengan sasaran kaum perempuan. Tidak hanya terkait bidang ekonomi, tapi juga menyangkutmasalahpendidikan, kesehatan dan sebagainya. “Hal ini dimaksudkan agar kaum perempuan dapat bangkit dan maju sejajar dengan pria di berbagai bidang. Apalagi peran perempuan sebagai ibu di rumah tangga menjadi penentu berkualitas tidaknya generasi yang dilahirkan. Dengan kemapanan kaum perempuan di setiap rumah tangga diharapkan menjadi sokoguru bagi kebaikan bangsa dan negara ke depan,” papar Ny Zakaria Siregar. (rel/m08)

Waspada/Ist

PENYULUHAN: Suasana kegiatan penyuluhan kewirausahaan kepada warga Dusun Tanah Persil Desa Bagan Percut Kecamatan Percut Sei Tuan Kabupaten Deli Serdang diselenggarakan BKOW Sumut dan Fakultas Ekonomi USU, Rabu (15/7).

Waspada/Surya Efendi

DIKHAWATIRKAN HANYUT: Sejumlah anak asyik mandi di aliran sungai Deli pinggiran Jl. Sei Deli Medan, Rabu (15/7). Pemukiman warga disekitar bantaran sungai itu dikhawatirkan hanyut diterjang banjir.

Gubsu: Syukur Alhamdulillah Jika Rahudman Jadi Pj Walikota Medan MEDAN (Waspada): Gubsu H Syamsul Arifin masih menutup rapat nama yang diusulkan sebagai PjWalikota Medan menggantikan Drs H Afifuddin Lubis yang pensiun 22 Juli ini. Bahkan ketika disinggung bahwa SK dari Mendagri sebenarnya sudah turun dan dipegang penjabat yang dihunjuk, Gubsu malah balik bertanya. “Apa benar SK-nya sudah keluar ? Karena saya belum tahu. Dan kalau belum ada, mana berani saya menyembunyikannya,” ucap Syamsul sambil berkelakar kepada wartawan, Kamis (16/7). Disinggung ada sejumlah usulan agar nama RahudmanlahyangdipilihmenjadiPjWalikota Medan.Gubsumalahmenanggapinya dengan enteng. “Syukur Alhamdulillah kalau Pak Rahudmanyangakhirnyadipilihmenjadi Pj Walikota Medan,” katanya. Sosok Penjabat (Pj)Walikota Medan periode 2009-2010 sepertinya sudah mengerucut kepada nama Drs H Rahudman Harahap. Mantan Sekda Tapanuli Selatan yang kini menjabat Asisten Administrasi dan Aset SetdaprovSumutitu,dinilaipaling tepatdibandingduacalonlainnya untuk melanjutkan kepemimpinan Drs H Afifuddin Lubis.

Dukungan terhadap Rahudman untuk menduduki kursi Pj Walikota Medan, memang terus mengalir deras. Jika sebelumnya, empat fraksi DPRD Medan, yakni PDIP, Partai Golkar, Partai Demokrat dan Partai Damai Sejahtera melalui wakil masing-masing sudah memberikan dukungan, kini giliran tokoh pemuda Sumut juga memberikan dukungan. Dukungan tokoh pemuda Sumut itu datang dari Sekretaris Ikatan Pemuda Karya (IPK) Indonesia, Drs H Darwin Samsul dan Ketua Komite Nasional PemudaIndonesia(KNPI)Sumut H Yasir Ridho Lubis. Ditemui secara terpisah di Medan, Kamis (16/7), keduanya secarategasmenyatakandukungan terhadap Rahudman untuk posisi Pj Walikota Medan. “Pak Rahudman itu seorang birokrat tulen dan orang yang juga kenyang dalam keorganisasian pemuda.Jadi,kalaumenurutkita, dia sangat pantas duduk di posisi PjWalikota Medan,” ucap Darwin Samsul. Darwin sebagai salah satu unsur pemuda Sumut sangat berharap, masuknya nama Rahudman dalam bursa PjWalikota Medan bersama Ir Djaili Azwar (Asisten Ekonomi dan Pembangunan Setdaprov Sumut), serta

Ir Randiman Tarigan (Kepala Dinas Pendapatan Medan), akan bisa mengoptimalkan pekerjaanpekerjaan rumah yang selama kepemimpinan Afifuddin belum terlaksana. “Persoalan-persoalan seperti perbaikan kerusakan sejumlah ruas jalan di seputar Kota Medan, penanganan masalah sampah dan banjir, serta persoalan KTP gratis danlainnya, kita yakiniakan mampu dijawab dan dituntaskan Rahudman bila dipercayakan untuk memimpin Kota Medan. Karena itu, kita sangat berharap Rahudmanlah yang menjadi Pj Walikota Medan,” tegas Darwin. Optimisme Darwin bahwa di tangan Rahudman kelanjutan pembangunan Kota Medan menuju kota metropolitan, religius dan madani akan bisa dilajutkan,setelahdasar-dasarnya diletakkan walikota nonaktif, Abdillah. HalsenadadiutarakanHYasir Ridho Lubis. Menurut hematnya, track record Rahudman di bidang kepamongan sudah dirintis sejak menjadi camat di Kota Pematang Siantar, Sekda di Tapsel dan terakhir menjadi asisten di Pemprov Sumut.Tak hanya itu, Rahudman juga pernah menduduki posisi Ketua KNPI Tapsel. (m19)

Polisi Berjanji Tangkap Oknum Satpol PP Amoral MEDAN (Waspada): Kapolsekta Medan Sunggal, AKP Faisal FNapupulu,SH,SIK,mengatakan, pihaknya hanya menunggu tanggal mainnya saja untuk menangkap beberapa oknum Satpol PP Pemko Medan, yang tersandung kasus amoral terhadap seorang wanita. “Siapa-siapa pelakunya sudah diketahui. Untuk lebih lengkap lagi, polisi sudah melakukan pemeriksaan terhadap beberapa orang saksi dan kini tinggal satu orang lagi saksi akan diperiksa dan korbannya seorang janda juga harus divisum. Bila semua nanti kelop, pelaku terlibat kasusitupastitidakberkutikketika ditangkap petugas,” janji Faisal kepada Waspada, Selasa (14/7) sore. Menurutnya, kasus ini merupakan antensinya harus terungkap. Dia mengatakan, untuk menangkap pelaku terlibat kasus kejahatan bukan sembarangan tangkap, terlebih dulu kita harus melengkapi barang bukti, keterangan saksi dan lainnya. Setelah itu, bersangkutan bisa ditangkap dan itupun lihat kasusnya mana yang ditangkap dan mana dilakukan pemanggilan melalui surat panggilan. Itupun, bila pemanggilan I dan II, yang bersangkutan tidak mengindahkan panggilan tersebut, kita baru terbitkan surat untuk membawanya secara paksa. “Kalau hal ini tidak dilengkapi, bisayangbersangkutankomplain dan mengadu ke Propam,” katanya. Dalam kasus amoral itu, kor-

ban ST sudah melaporkan kasus itu ke Polsekta Medan Sunggal tanggal 15 Mei 2009 sesuai No.Pol.: LP/1149/V/2009 TBS Sunggal, semasa Kapolsekta MedanSunggal,AKPMarsdianto, SIK dan Kanit Reskrimnya yang menjabat sampai saat ini adalah Iptu Anthoni Simamora. Awalnya, ST, 27, (janda) bekerja sebagai pembantu rumah tangga(PRT),Jumat(15/5)malam lalu, ditangkap petugas Satpol PP yang sedang melancarkan razia wanita Pekerja Seks Komersial (PSK) di Jalan Iskandar Muda dekat swalayan. Sedangkan, korban malam itu menunggu angkot menuju pulang ke rumahnya di kawasan Marelan. Ketika menunggu angkot itu, korban diangkut mobil patroli Satpol PP dan membawanya ke kantor di Jalan Pinang Baris, Sunggal. Setiba di kantor Satpol PP, korbandiinterogasioknumSatpol PP dengan tindakan berlebihan. Korban disuruh menghitung petugasyangadadiruanganyang berjumlah 13 orang, lalu kepada korban oknum Satpol PP mengatakan apa sanggup melayani semuanya. Seterusnya korban digiring ke lantai dua untuk melakukan perbuatan amoral, tetapi permintaan itu langsung ditolak. Karena kesal, mereka membawa korban menggunakan mobil patroli dengan alasan untuk diantar pulang ke rumahnya. Dalam perjalanan, korban disuruhmemegangbagiansensitif

dua oknum Satpol PP dan beberapa oknum lainnya mengikuti dari belakang mengendarai sepeda motor. Setiba di Jalan Ngumban Surbakti, korban dibawa ke salah satu hotel dan diancam akan dibawa ke Brastagi, apabila tidak memenuhi permintaan oknum tersebut. Akhirnya korban dilepas setelah keinginan oknum Satpol tidak semua dipenuhi, kemudian korban membuat pengaduan ke Polsekta Medan Sunggal, atas tindakan oknum Satpol PP tersebut. Sebelumnya, Kepala Satpol PP Kota Medan, Mursaddat, ketika Waspada konfirmasikan kasus ini melalui telefon selular mengatakan, kegiatan rutin yang dilakukan personelnya terus dilakukan dengan sasaran PSK liar. Menurutnya, korban yang ditangkap dibawa ke kantor di Jalan Pinang Baris, Sunggal. Disanadiadisuruhmembuatsurat penyataan agar tidak terulang lagi. Setelah itu, semua personel dan komandan Satpol PP yang melakukan razia meninggalkan kantor dan pulang ke rumah masing-masing. Kalaupun ada kejadian seperti itu tidak kaitan dengan dinas, karena PSK dan personel yang melakukan razia sudah pulang semua. Dalam hal ini, kata Mursaddat, kita serahkan sepenuhnya masalah ini kepada pihak kepolisian yang menanganinya. “Apabila ada anggota yang nakal, pasti ditindak,” tuturnya. (m31)


12

WASPADA Jumat 17 Juli 2009

ShalatQabliyahJumatAtauQadhaShalat? Oleh Dr. Arifin S. Siregar

T TAJUK RENCANA

Rakyat Kecewa Pada PDIP Dan Golkar ...

S

etelah mengalami kekalahan telak dalam Pilpres 8 Juli lalu, sejumlah tokoh Golkar ingin merapat ke SBY (Demokrat) dengan harapan mendapatkan sejumlah kursi menteri. Setidak ada empat nama yang disebut-sebut bakal dijadikan menteri dalam kabinet mendatang, yaitu Aburizal Bakrie, Muladi, Theo Sambuaga, dan Agung Laksono. Keempat nama itu santer disebut-sebut di tengah semakin menghangatnya Munas Golkar dalam waktu dekat mengganti ketua umum Jusuf Kalla. Sudah tiga nama muncul sebagai calon Ketua Umum DPP Partai Golkar: Aburizal Bakrie, Surya Paloh, dan Yuddy Chrisnandi. Tentu saja rakyat bakal kecewa, khususnya pemilih Jusuf Kalla (JK) dalam Pilpres lalu, karena mereka mengharapkan kalau JK kalah seharusnya Golkar beralih menjadi oposisi. Awalnya, peran oposisi itu banyak diamini oleh tokoh Golkar, namun belakangan ini berubah ingin tetap bergabung dalam pemerintahan SBY lagi dengan argumentasi, ‘’bukan kebiasaan Golkar menjadi oposisi.’’ Memang sejak era Orde Baru hingga Reformasi bergulir pun tokoh-tokoh Golkar tetap eksis dalam pemerintahan. Mereka sepertinya sudah keenakan sebagai tokoh yang memerintah dan berkuasa, sedangkan peran oposisi dirasakan sangat tidak enak, karena tidak terbiasa dan yang pasti tidak mau menderita. Padahal, menjadi oposisi merupakan suatu kewajaran, tetap bisa mengabdi pada negara demi kesejahteraan bangsa dan negara tercinta, bila peran oposisi itu dapat dijalankan dengan baik (optimal). Oleh karena itu, konsekuensi dari kegagalan dalam Pilpres sudah sepatutnya Golkar menjadi partai oposisi. Hal yang wajar terjadi di semua negara yang alam demokrasinya sudah berkembang. Rasa kecewa rakyat yang menginginkan oposisi kuat semakin tebal bila saja PDIP pun bergabung dalam pemerintahan SBY, sehingga tidak ada lagi oposisi di pemerintahan republik ini. Kalau saja betul informasi yang menyatakan Taufik Intisari Kiemas (TK) meminta DPP PDIP untuk merapat ke pemerintahan SBY, maka dapat mati sudah sistem demokrasi Peran oposisi sangat dikatakan pemerintahan di negeri kita ini. Semuanya penting menjaga keseim- ingin mendapatkan bagian, bagi-bagi kue bangan dalam sistem pe- kekuasaan, sehingga rakyat pasti akan semakin terabaikan/menderita. merintahan dan demoDPP PDIP sudah seharusnya menjelaskan kepada masyarakat terkait beredarnya krasi yang sehat. SMS yang tak mengenakkan itu. Hingga kemarin PDIP belum memutuskan apakah partai tetap menjadi oposisi atau merapat ke pemerintah SBY karena PDIP masih menunggu pengumuman pemenang Pemilu Presiden (Pilpres) oleh Komisi Pemilihan Umum (KPU). PDIP tidak mempercayai hasil hitung cepat (quick count) sejumlah lembaga survei yang memberikan kemenangan 60 persen sehingga Pilpres hanya berlangsung satu putaran saja. Hemat kita, capres terpilih SBY dalam posisi sulit bila harus mengakomodir calon menteri dari Golkar dan PDIP. Apalagi jauh sebelumnya, koalisi besar yang memenangkan SBY - Boediono sudah bereuforia, membayangkan sejumlah posisi menteri buat kader-kader PKS, PPP, PKB, PBB dan puluhan Parpol lainnya. Kalau saja masuk orang-orang Golkar dan PDIP yang menjadi lawan dalam Pilpres pastilah akan berkurang jumlah menteri buat mereka. Dan bukan tidak mungkin koalisi besar yang dibangun Demokrat mengalami keretakan/pecah bila SBY memberi angin segar kepada Golkar apalagi PDIP. Masalahnya, yang berjuang menyukseskan kemenangan SBY - Boediono adalah koalisi besar. Jadi, sangat tidak rasional kalau SBY sampai memprioritaskan kader Golkar dan PDIP dalam penyusunan kabinetnya mendatang. Kalau melihat jumlah suara SBY - Boediono begitu besar dalam Pilpres lalu seharusnya SBY bisa memutuskan komposisi kabinetnya dengan lebih terbuka kepada masyarakat (rakyat). Apalagi, menyusun kabinet dan menentukan menteri merupakan hak prerogatif presiden terpilih. Dus, SBY bisa menjalankan roda pemerintahan dengan sistem presidensial tanpa takut dirongrong oleh siapa pun juga. Kalau pada periode pertama lalu posisi SBY masih belum solid, kinilah saatnya SBY berani menunjukkan jati dirinya sebagai presiden pilihan rakyat langsung, tanpa ada kekhawatiran pemakzulan dari lawan-lawan politiknya. Dengan demikian SBY bisa menentukan siapa saja menterinya dari kalangan tokoh partai maupun profesional. Sebagai partai besar, baik Golkar maupun PDIP perlu memikirkan kembali niatnya untuk bergabung dengan pemerintahan SBY. Sebab, hal itu melawan suara konstituennya. Jangan gara-gara keinginan pragmatis sejumlah tokoh partai, masa depan partai semakin suram. Yakinlah, Golkar dan PDIP akan semakin kerdil pada Pemilu 2014 bila tidak mau melakukan introspeksi diri. Bila elite partai masih didominasi orang-orang yang ‘’gila kekuasaan’’ semata dengan mengerdilkan kehadiran tokoh-tokoh mudanya.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksiwaspada@gmail.com KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm

anggal 13 Juli lalu, MUI Sumut memprakarsai ceramah agama yang dilangsungkan di aula MUI Sumut, penceramah dipercayakan pada Syekh Muhammad Nuruddin Merbau Banjar Al Makki, MA berasal dari Kalimantan, bermukim di Bogor, jebolan Timur Tengah (7 tahun di Makkah, 8 tahun di Mesir). Bertindak sebagai moderator dan sekretaris adalah Prof DR Ramli Wahid, MA dan KH Zulfikar Hajar, Lc. Moderator mengatakan, ceramah ini akan berkaitan masaalah tarawih (23 rakaat atau 8), witir, tahajjud, tasbih, qadha shalat, shalat qabliyah Jumat dan hal lain, yang masih berkaitan dengan shalat. Moderator mengatakan selesai ceramah akan dibuka kesempatan bertanya, mengoreksi, dsb. Qadha Shalat Dalam ceramahnya ustadz Syekh Muhammad Nuruddin MB Al Makki menyatakan shalat wajib yang sengaja ditinggal dapat diqadha. Untuk itu saya tanggapi, dengan mengajukan argumentasi bahwa apa guna Allah swt memberikan batasan waktu untuk setiap pelaksanaan shalat fardhu, kalau masih boleh mengqadha (mengganti) shalat yang sengaja ditinggal. Lalai mengerjakan shalat pada waktunya maka seseorang berdosa. Saya tanya pada penceramah, apa ada petunjuk Nabi SAW/sahabat boleh mengqadha shalat fardhu yang sengaja ditinggal ? Setahu kita yang boleh diqadha karena lupa dan ketiduran (ada hadistnya). Saya kemukakan pada penceramah, suatu kaidah usul Fiqih : “Sesungguhnya ibadah itu haram sampai ada petunjuk yang membolehkannya”. Sesuai kaidah di atas, agar qadha shalat yang ditinggal sengaja menjadi tidak haram, maka saya minta pada penceramah mana petunjuk Rasul SAW yang membolehkannya ? Penceramah menjawab dengan alasan yang berputar-putar, menggunakan qiyas, fatwa ulama anu, dsb, tidak dapat menunjukkan petunjuk Nabi SAW. Kalaulah bisa shalat sengaja ditinggal bisa diqadha, kenapa harus ada shalat jama’ qasar atau jama’? Kenapa di dalam mobil, di pesawat terbang di mana wudhu’ dan tempat sempit, tapi dipaksakan tetap shalat? Atau ketika tidak ada air, supaya shalat tetap ditegakkan, maka wudhu’ dengan tayammum? Kenapa tidak qadha shalat saja? Inilah beberapa argumentasi, untuk tidak membolehkan shalat yang ditinggal dengan sengaja dapat diqadha. Ketimbang mengqadha shalat yang tinggal 10 thn, 5 thn, 1 thn, dsb, lebih bagus mengamalkan shalat sunat diperbanyak (di mana penceramah ada mengatakan shalat fardhu yang tidak dikerjakan 10 thn, dapat diqadha dengan mengangsur setiap hari). QS Al-Ma’un: Celaka (neraka) bagi

orang yang shalat (karena melalaikan: waktunya, maupun tidak mengamalkan makna shalat). Jelas Allah SWT benci pada orang yang melalaikan waktunya (dengan sengaja melalaikan/tidak shalat pada waktunya). Shalat di luar waktu, itu bukan shalat lagi namanya dan tertolak. Tentu anda berkomentar : kenapa kalau karena lupa atau tertidur shalat di luar waktu (qadha) tidak tertolak ? Jawabnya : Ada petunjuk Nabi SAW yang membolehkannya. Sadarilah, shalat fardhu ditinggal dengan sengaja lalu diqadha dengan 1000 kali, tetap berdosa (tidak selesai utangnya). Takut dosa maka jangan lalaikan. Meyakini qadha shalat ditinggal dengan sengaja bisa diterima Allah SWT, inilah bid’ah (dholalah) dalam aqidah. Karena meyakini tanpa petunjuk. Shalat Qabliyah Jumat Kemudian untuk pertanyaan selanjutnya saya tanya penceramah, apa dalilnya shalat qabliyah Jumat ? Nabi SAW dan para sahabat dan Imam Syafii tidak melakukannya. Buktinya: Suatu riwayat diterangkan dalam kitab “Az Zad I/117 : “Dan adalah Nabi SAW, bertangguh pada hari Jumuat hingga berkumpul manusia. Maka keluarlah Nabi SAW sendirian dengan tidak ada pengiringnya. Apabila beliau telah masuk ke dalam masjid, beliau mengucapkan salam kepada para jamaah, lalu naik ke mimbar dan menghadap kepada (sidang Jumat), dan memberi salam (sekali lagi), dan tak ada azan pada masa itu selain dari satu kali saja. Apabila telah selesai Bilal dari azannya, berdirilah Nabi SAW, lalu berkhutbah dengan tak ada perselang (peluang) antara azan dan khutbah dan tak ada seorang pun (dari para jamaah, pun) yang berdiri untuk mengerjakan dua rakaat shalat. “(Pedoman Shalat oleh Prof.DR.Hasbi Ash Shiddiqqi, hlm 412). Juga riwayat lain menerangkan : Dulu Rasulullah SAW ke luar dari rumahnya pada hari Jumat.Lantas beliau naik ke atas mimbar. Kemudian muadzdzin mengumandangkan azan. Ketika muadzdzin selesai mengumandangkan azan, Rasulullah SAW mulai berkhutbah. (Lihat di dalam kitab Fathul Baari (II/426), Nailul Authaar (III/312), Fatwaa Ibnu Taimiyah (I/136), Mishbaahuz Zujaajah fii Zawaaid Ibnu Majah (I/377), al Diinul Khaalish (IV/299), al Ajwibatun Naafi’ah halamn 26 dan al Baa’its ’alaa Inkaaril Bid’ah wal Hawaadits hlm 93). Dari riwayat di atas terbukti tidak ada menerangkan bahwa Nabi SAW pernah melakukan shalat qabliyah Jumat, karena sesudah Nabi SAW naik ke mimbar lalu azan (hanya 1 kali) selesai langsung Nabi SAW khutbah. Selesai khutbah, qamat dan shalat fardhu Jumat 2 rakaat.

Di Indonesia supaya shalat qabliyatul Jumat dapat ditegakkan, maka dilakukan orang azan pertama sesudah masuk waktu dan di masjid (azan Ustman RA : di menara Zaura di pekan dan sebelum masuk waktu Jumat). Berarti yang di Indonesia tidak meniru Ustman RA, juga tidak meniru Nabi SAW. Ternyata pada shalat Jumat, shalat qabliyatul Jumat tidak dilakukan Nabi SAW, sahabat, maupun Imam Syafii, karena tidak ada celah (waktu) untuk menempatkannya, di mana setelah azan selesai, langsung Nabi SAW khutbah. Maka sesuai H.R Muslim: “Barang siapa melakukan amalan (ibadah/aqidah) tak ada dalam agama kami (petunjuk Nabi SAW/Al-Quran) maka amalan itu tertolak”. Atau kaidah usul fiqih berbunyi : “Sesungguhnya ibadah itu adalah haram, sampai ada petunjuk (Nabi SAW) yang membolehkannya”. Atau H.R Muslim : “Seburuk-buruknya perbuatan adalah yang mengada-ada (menambah-nambah), setiap yang mengada-ada adalah bid’ah dan setiap bid’ah adalah sesat dan setiap yang sesat itu ...dst”. Dari 3 argumentasi di atas, dipertanyakan apakah anda berpendapat bahwa shalat qabliyatul Jumat itu hukumnya tidak haram atau tidak tertolak, atau tidak bid’ah ? Kalau tidak, tolong para ulama berikan argumentasinya/dalilnya. Penceramah ada menyampaikan sebuah riwayat yang menyatakan bahwa Nabi SAW ada shalat 4 rakaat sebelum Jumat dan 4 rakaat sesudah Jumat (sebenarnya hadis ini dhaif, dinyatakan oleh imam Bukhari, diakui penceramah). Saya katakan pada penceramah, bahwa hadis ini bukan bukti Nabi SAW ada melakukan shalat qabliyah Jumat, karena shalat qabliyah itu dilakukan setelah azan (masuk waktu). Adalah Nabi SAW setelah naik ke mimbar lalu Bilal azan, selesai azan langsung Nabi SAW khutbah. Bukti Nabi SAW tidak melakukan shalat qabliyah Jumat. Masalah Furu’iyah /Khilafiyah Moderator dan sekretaris moderator menegor saya, supaya tidak membicarakan yang berhubungan dengan masaalah furu’iyah/khilafiyah, misalnya masalah shalat taraweh 23 rakaat, shalat fardhu dengan sengaja ditinggal dapat diqadha, atau pengkajian mengenai shalat qabliyahl Jumat, dsb. Sungguh moderator dan sekretaris sebagai ulama tidak jujur dan tidak adil. Karena topik ceramah saja, dinyatakan membicarakan masaalah 23 rakaat shalat taraweh dsb. Bila penceramah boleh membicarakan masaalah itu, tapi kenapa kalau saya yang menanggapinya dilarang (atau apakah karena saya dengan argumentasi yang kuat membuat mereka mulai terdesak/tersudut) maka mereka berkomentar agar jangan membicarakan itu karena itu masaalah furu’iyah/khilafiyah tak boleh dibicarakan ?! Timbul pertanyaan, apakah mereka akan mencari

kebenaran atau mempertahan ketaqlikan? Di luar dugaan, ulama jebolan Timur Tengah bertanya pada saya : Apakah dokter tau kalau Nabi SAW tidak melakukan shalat qabliyatul Jumat di kamarnya sebelum datang ke masjid? Saya jawab : Saya tau Nabi SAW tidak melakukannya, alasannya : Kalaulah itu ada seharusnya shalat qabliyatul Jum’at dilakukan setelah azan masuk waktu Jumat. Sedangkan azan baru ada setelah Nabi SAW naik ke mimbar. Selesai azan langsung khutbah. Kalau Nabi SAW yang melakukan shalat qabliyatul Jumat di kamarnya, tentu ada riwayat yang menerangkannya. Suatu ibadah dianggap ada, tunggu keterangan (contoh). Tidak ada contoh (keterangan) jangan kerjakan (jangan yakini ada) nanti terjebak bid’ah (dholalah). (Kaidah Ushul Fiqih). Kemudian penceramah menyatakan pada saya bahwa ibadah yang dilakukan ulama-ulama itu semua benar. Kata penceramah, ibarat obat, bisa banyak macam obat bisa menyembuhkan penyakit (artinya semua obat benar).Saya jawab : berbeda obat dengan ibadah. Obat rujukannya adalah beberapa profesor, dsb, yang membuatnya. Tapi ibadah rujukannya hanya satu yaitu Nabi SAW. Kalau ada ulama yang mengamalkan ibadah bukan berasal dari petunjuk Nabi SAW, maka ibadah itu jadi tidak benar (bukan obat, tapi racun) dan tertolak. Mendengar jawaban saya, penceramah terdiam, pucat. Moderator mengatakan berbeda pendapat itu wajar. Untuk itu saya katakan ‘’kami jangan dibodohi’’. Berbeda pendapat dengan “dibodohi“ berbeda. Beda pendapat timbul karena penafsirannya terhadap suatu hukum/masaalah berbeda. Misalnya: apa magna dari kata quru’ pada QS AlBaqarah apakah “suci“ atau “haid“, sehingga berakibat seorang perempuan boleh dikawini apakah setelah selesai 3 kali masa suci (antara haid dengan haid: satu suci) atau apakah setelah selesai 3 kali haid. Tapi “dibodohi“ ialah di mana si penceramah tau, kalau azan pertama di masa Ustman RA di pekan (menara Zaura) dan sebelum masuk waktu Jumat. Dan penceramah tau, azan pertama shalat Jumat di Indonesia dilakukan setelah masuk waktu Jumat dan di masjid. Penceramah membandingkan seolah-olah azan pertama di Indonesia, sama dengan azan pertama di masa Ustman RA. Dan shalat sunat 2 rakaat dilakukan setelah azan pertama di Indonesia (yang sudah masuk waktu), sehingga dianggap itu shalat qabliyah Jumat. Padahal sangat berbeda (tidak serupa) pelaksanaan azan pertama shalat Jumat di zaman Ustman RA dengan azan pertama shalat Jumat di Indonesia. Maka saya katakan, jangan kami “dibodohi”. Penulis adalah pengamat sospol dan keagamaan

Yusuf El-Qordhawi Menghalalkan Enzim Babi ? Oleh Muhammad Arifin El-Jahari, Lc

M

ungkin kita terperanjat dengan judul di atas. SeorangYusuf elQordhawi, pimpinan ulama dunia yang kapabelitas keilmuannya tidak lagi kita ragukan, bahkan beliau dijuluki pembaharu abad ini, pernah menulis di salah satu bukunya; halalnya enzim babi. Mungkin hal ini yang menjadi pijakan – dibeberapanegara–menggunakanvaksin meningitismengandungenzimbabi,yang kabarnya dapat mencegah penyakit berbahaya dan menular; radang selaput otak saat dmelaksanakan ibadah haji. Subhânak, mâ khalaqta hâzâ bâthilâ. Maha suci Engkau Ya Allah, tidak ada yang Engkau ciptakan di dunia ini sia-sia. Namun, yang menjadi pertanyaan, walau memiliki manfaat tinggi, halalkah vaksin meningitis yang mengandung enzim babi dikonsumsi? Kalau jawabannya “Ya”, alasan atau dalil apa yang mendukung kehalalan itu? Namun, kalau dijawab “Tidak”, bagaimana dengan fatwa kehalalan enzim babi yang diusung oleh ra’îsul ulamâil âlam; Yusuf el-Qordhawi yang kapabelitas keilmuannya tidak lagi kita ragukan? Dengan segala keterbatasan, penulis coba untuk mengurainya. Dalam bukunya Fî Fiqhil Aqalliyyâtil Muslimah; Hayâtul Muslimîna Wasthal Mujtama’âtil Ukhrâ, Dr.Yusuf el-Qordhawi menjawab sebuah pertanyaan tentang enzim babi. Beliau menuliskan:“Tidaklah semua enzim yang berasal dari tulang atau lemak babi itu haram secara pasti (qath’i), sebagaimana disangka oleh banyak orang. MenurutJumhurUlamaFiqih:bahwanajis apabila berubah wujut, maka berubah hukumnya. Sebagaimana perubahan khamarmenjadicuka,ataunajisyangterbakar berubah menjadi abu ... Maka dalam hal ini, telah berubah sifat dan nama serta hukumnya.Karenahukumdapatberubah bersamaan dengan ada atau tiada ‘illat (sebab)nya,al-hukmuyadûruma’a‘illatihi; wujûdan wa ‘adaman. Dari sini kami berpendapat: sesung-

guhnya kita tidak dapat menghukumkan sesuatu dari sebab asalnya. Karena asal khamar adalah anggur atau bahan lain yang menurut syariat adalah halal. Ketika bahan ini berubah menjadi zat yang memabukkan, maka kita tetapkan keharamannya. Namun, apabila berubah lagi menjadi cuka, maka kita hukumkan kesucian dan kehalalannya. Banyak barang yang berasal dari babi yang telah berubah menjadi zat kimiawi. Dan itu tidak terhitung najis dan tidak tegolong hukum babi … Para ilmuan, di antaranya Dr. Muhammad el-Hawâri, mengatakan bahwa zat itu telah berubah menjadi zat kimiawi. Dan masih banyak lagi sebenarnya, barang-barang yang diproses melalu proses kimiawi berasal dari babi, seperti sabun, odol gigi dll. Namun, sifat ke-babi-annya telah hilang.” Begitulah penjelasan Doktor jebolan Al-Azhar ini. Kalau kita kaji, seakan tidak punya alasan untuk membantah argumen-argumen beliau. Mungkinkah pendapat beliau ini kita terapkan di Negeri kita: Indonesia? Apalagi, seolah kita dipaksa untuk mengonsumsi vaksin tersebut, atau sama sekali tidak berangkat menunaikan rukun islam yang kelima itu! Belum lagi pemerintahankitalemahuntukmengadakan solusi vaksin halal. Sebuah kaidah ushul fikih menyatakan, mâ lâ yutimmul wâjib illâ bihî fahuwa wâjib, yang artinya “Sesuatu yang tidak sempurna kewajiban kecuali karenanya, maka itu adalah wajib”.Beberapa argumen di atas menjadi pertimbangan sementara ulama dan jamaah haji Indonesia untuk tetapmelaksanakanibadahhajiwalaupun mesti mengosumsi vaksin yang mengandung enzim babi tersebut. Karena, mungkin bagi mereka, tidak berangkat haji kalau tidak mendapat vaksin halal, bukanlah sebuahsolusi.Karenakitatidaktahu,kapan ajal akan menjemput kita, kalau keberangkatan haji terus kita tunda. Penulis maklumi apalagi keharaman

enzim babi menjadi perbincangan dan perdebatan antar ulama. Namun, bukan serta merta kita langsung menerima pendapat yang menyatakan kehalalan enzim babi tesebut. Penulis setuju dengan statementYusuf el-Qordhawi:“enzim babi halal”. Karena ternyata masalah ini tidak tergolong dalam masalah qath’i; pasti halal haramnya. Tidak ada satu dalil pun yang menerangkan secara jelas keharaman enzim babi, sekali lagi enzim dalam formula kimiawi.Yang ada hanyalah pengharamandagingbabi(lahmukhinzîr),yang ulamasepakatmenafsirkannya babisecara umum; daging, tulang, kulit, lemak, bulu dll yang belum berubah wujud (QS. AlBaqarah: 173, QS. Al-Ma’idah: 3, QS. AnNahl: 115 dan QS. Al-An’am: 145), bukan babi yang telah berubah wujud, dalam hal ini adalah zat kimiawi. Rasul bersabda: alhalâlu baiyyin wal harâmu baiyyin, halal itu jelas dan haram itu jelas. Maka dalil penghalalandanpengharamanmestijelas dan qath’i.Oleh karena tidak ada dalil yang menjelaskankeharamandankehalalannya secara qath’i, maka hal ini tergolong dalam masalah dzanni, yang di dalamnya membutuhkanijtihad-ijtihadulamadanihtiyâth (kehati-hatian).Wajar, kiranya, ulama pun berbeda pendapat tentang keharaman enzim tersebut. Walaupun penulis setuju dengan statement itu, namun, tidak untuk diterapkan di Indonesia. Karena, Dr.Yusuf elQordhawi sendiri, dengan kejeniusannya, tidak sembarangan meletakkan sub pembahasan ini di sembarang bukunya. Pembahasan ini beliau letakkan khusus di bukunya Fî Fiqhil Aqalliyyâtil Muslimah; Hayâtul MuslimînaWasthal Mujtama’âtil Ukhrâ, versi Indonesianya; Seputar Fikih Islam Minoritas; Kehidupan Muslimin Di Tengan Masyarakat Non Muslim, atau di buku yang bertajuk sama. Iniartinya,secaratidaklangsung,Yusuf el-Qordhawi ingin menjelaskan bahwa ini hanya boleh diterapkan di negara yang umat Islamnya minoritas, sehingga sulit untukmendapatkanbahanmakananyang halal secara qoth’i. Sama halnya seperti bunga bank, memberikan selamat pada

hari besar agama lain, dll. Dengan fleksibelitas hukum Islam,Yusuf el-Qordhawi memberanikandiriuntukmemilihpendapat-pendapat yang – mungkin dipandang – tidak ihtiyâth. Ini semua dilakukan demi image Islam, demi kemudahan ajaran Islam dan demi Islam adalah rahmatal lil ‘âlamîn. Indonesia, bukan negara minoritas Islam, tapi justru mayoritas Islam. Seharusnya, solusi makanan dan perobatan halal secara qath’i, dalam hal ini adalah vaksin meningitis, sudah dapat tersedia. Usaha ulama-ulama Indonesia, melalui MUI, dengan memfatwakan keharam enzim tersebut adalah langkah positif dan sikap ihtiyâth. Apalagi vaksin meningitis yang salah satu unsurnya adalah enzim babiuntukjamaahhajiIndonesia,tidaklah termasuk dalam kategori ikrâh (paksaan) atau darurat. Penulis adalah alumni Jurusan Tafsir dan Ilmu-ilmu Al-Quran Al-Azhar University CairoEgypt dan Direktur Institut Qur’an Islamic Internationaal School Darul Ilmi Murni – Medan.

SUDUT BATUAH * Empat tokoh Sumut diusulkan jadi menteri - Wah sudah bisa berandai-andai nich! * DPRD didesak tolak kenaikan tarif air - Tolak-tolak-an, he...he...he * Tiga calon Pj Walikota diajukan ke Mendagri - Jangan lupa syaratnya pernah mandi di Sei Deli

oel

D Wak

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Nanggroe Aceh Darussalam: Rizaldi Anwar. Redaktur WASPADA Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (NAD), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD).

Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril (Limapuluh), H. Abu Bakar Nasution, Nurkarim Nehe, Iwan Hasibuan, Bustami Chie Pit (Kisaran), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Parlindungan Hutasoit (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Nanggore Aceh Darussalam: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


Ekonomi & Bisnis MES Sumut Kucurkan Pembiayaan Ibu RT 13

MEDAN (Waspada): Masyarakat Ekonomi Syariah (MES) Sumut, Kamis (16/7), mengucurkan pembiayaan untuk 20 orang ibu rumah tangga senilai Rp19,5 juta. Ketua MES Sumut Gus Irawan Pasaribu menyerahkan uang itu di kantor organisasi tersebut Jl. Gagak Hitam Medan. Duduk kembang sila di lantai tiga bersama 20 ibu rumah tangga, Gus Irawan mendorong ibu-ibu tersebut untuk meningkatkan pendanaan. Dia mengatakan MES berbuat dan berkontribusi untuk umat secara umum. “Ibu-ibu ini merupakan penyangga ekonomi rumah tangga. Saya dua pekan lalu baru ke Nias. Di sana Bank Sumut sudah menjalankan konsep ini dengan nasabah 3.165 orang.” Semua yang ada di sana berkembang dan mampu meningkatkan usahanya, kata dia. “Kalau di sana saja bisa berkembang tentu saya ingin Medan dengan pendanaan di bawah BMT MES syariah juga ikut,” tuturnya. Gus kembali menjelaskan di Graha MES syariah ada tiga

lantai yang sudah punya tujuan masing-masing. “Di lantai tiga ini merupakan sarana pelatihan untuk yang bergiat mendorong ekonomi syariah. Lantai dua tempat pembiayaan dan lantai satu merupakan MESS Mart syariah untuk berbelanja dan memasarkan produk usaha kecil,” tegasnya. Menurut dia, usaha yang dirintis ibu-ibu ini kuncinya disiplin. “Saya tegaskan uang yang kita salurkan ini tak cukup membeli BlackBerry satu unit per orang. Tapi yakinlah kalau kita kasi satu ikat sekarang mudah-mudahan tahun depan masing-masing kita sudah memiliki tiga ikat,” tuturnya. Program pendanaan tersebut memberi bunga 2,5 persen selama 90 hari kepada ibu rumah tangga yang berada di sekitar kantor MES Sumut. “Kalau di Medan saya berkeinginan ada kelompok-kelompok usaha. Jadi nanti tiap kelompok usaha bisa bertalian dan berhubungan untuk memenuhi kebutuhan satu dengan yang lain.” Kalau sudah begitu, Gus

menyatakan akan muncul sinergi ekonomi kerakyatan yang kuat seperti yang digagas Muhammad Yunus di Bangladesh. “Tapi itu tadi, kuncinya disiplin. Kalau memang kita sudah sepakat harus bertemu sekali seminggu ya kita harus bertemu. Tidak ada tarik ulur.” Lalu hal kedua, kalau mengkaji perbankan yang membuat kredit bisa macat karena ada over financing (kelebihan pembiayaan), jelasnya. “Misalnya kebutuhan ibuibu hanya Rp500 ribu kemudian dikasi bank Rp1 juta. Ini membahayakan. Jadi sebaiknya dihindari. Kalau bank memberi lebih silakan kasi tahu kalau ibu tidak perlu sebanyak itu,” ungkapnya. Sebab akan ada kredit macat kalau pembiayaan yang berlebihan diteruskan, katanya. Gus menegaskan ibu rumah tangga yang mereka biayai terdiri dari berbagai usaha seperti penjual lontong, pakaian dan sayur mayur. Menurut Gus, strategi memberikan pembiayaan kepada kelompok akan lebih mudah. “Itu sebabnya pem-

biayaan kepada beberapa orang. Jadi ada tanggungjawab kelompok. Malah kalau di Nias yang saya tahu ketika ada anggota kelompok yang terlambat ketika ada pertemuan rutin mingguan kena denda Rp5.000.” Jadi kebersamaan sangat penting di sini, tegasnya. “Untuk mendorong pembiayaan kita juga meminta mereka yang sudah sukses berbagi cerita merintis usaha. Sementara yang gagal juga kita sarankan begitu untuk mencegah yang lain mengalami hal serupa.” Lalu kenapa ibu rumah tangga yang dipilih? Gus mengatakan belajar dari berbagai pengalaman termasuk di Bangladesh peran mereka sebenarnya sangat penting. “Bukan berarti menggantikan tugas kepala rumah tangga tapi ada potensi yang bisa mereka hadirkan untuk meningkatkan ekonomi. Ke depan kita masih akan memberikan pembiayaan kepada kelompok. Hasilnya paling tidak akan sama seperti Nias,” tuturnya.(m13)

Ekonomi 2010 Dibayangi Dampak Buruk El Nino JAKARTA (Antara): Kondisi cuaca dan iklim pada 2010 diperkirakan kurang menggembirakan sehingga akan berdampak buruk terhadap perekonomian nasional. “Tahun depan badai El Nino diprediksi akan berkepanjangan sehingga perlu persiapan menghadapinya,” kata Menneg Perencanaan Pembangunan Nasional/Kepala Bappenas Paskah Suzetta sebelum rakor membahas sumber daya air di Kantor Menko Perekonomian Jakarta, Kamis (16/7).

Tampak hadir pula dalam rapat itu Plt Menko Perekonomian/Menkeu Sri Mulyani Indrawati, Mentan Anton Apriyantono, Mendagri Mardiyanto, Menteri PU Djoko Kirmanto, dan Menteri Perindustrian Fahmi Idris. Menurut Paskah, berbagai upaya mengantisipasi dampak buruk el nino akan menyebabkan adanya pembengkakan defisit APBN 2010. “Kebutuhan dana sedang kita hitung, itu menyebabkan mungkin defisit 2010 menjadi

lebih besar dari 1,5 persen,” katanya. Dia mengungkapkan adanya perkiraan badai el nino pada 2010 nanti akan sama dengan terjadi pada 1997. Ini akan melanda Asia dan Australia. Sebelumnya keterangan resmi Depkeu juga menyebutkan Indonesia akan berupaya menyelaraskan kebijakan ekonomi dengan perubahan iklim sehingga pembangunan yang dilaksanakan akan berkelanjutan. “Bekerja sama dengan ins-

tansi terkait, Depkeu saat ini sedang mengembangkan ‘green paper’ atau dokumen hijau yang berfokus kepada ekonomi dalam kebijakan perubahan iklim,” kata Kepala Biro Humas Depkeu Harry Z. Soeratin. Menurut dia, dokumen itu akan memuat saran-saran tentang pembangunan ekonomi jangka panjang berkelanjutan dan dengan platform perubahan iklim sehat serta opsi kebijakan spesifik dapat diterapkan Indonesia dengan cepat.

Rupiah Cenderung Stabil JAKARTA (Antara): Kurs rupiah terhadap dolar AS di pasar spot antarbank Jakarta, Kamis (16/7) sore cenderung stabil, setelah Bank Indonesia (BI) masuk pasar menjaga mata uang Indonesia agar bergerak tidak begitu cepat. Nilai tukar rupiah terhadap dolar menjadi Rp10.105Rp10.110 per dolar dibanding penutupan hari sebelumnya Rp10.107-Rp10.115 atau naik dua poin. Pengamat pasar uang, Farial Anwar di Jakarta, mengatakan, rupiah sebenarnya dapat bergerak naik lebih tinggi,

namun kenaikan itu agak tertahan oleh masuknya BI ke pasar uang. BI tidak menginginkan rupiah naik terlalu cepat, karena akan menimbulkan reaksi oleh eksportir merasa kesulitan untuk harga jual produknya di pasar ekspor, katanya. Farial Anwar mengatakan, posisi rupiah saat ini dinilai aman karena berada dalam kisaran antara Rp10.000 sampai Rp10.200 per dolar. Karena rupiah untuk sementara diharapkan tidak akan menguat lebih jauh, mes-

Sampoerna Luncurkan Varian Gold MEDAN (Waspada) : Rasio net operating income dengan net sales PT HM Sampoerna Tbk meningkat 16,4 persen pada 2008 dibanding tahun sebelumnya dengan total keseluruhannya mencapai sekitar Rp34,7 triliun. Manager Public Relations PT HM Sampoerna Tbk Yudi Rizal, di Medan, Rabu (15/7) menyatakan dengan peningkatan net sales tersebut diikuti naiknya jumlah volume 9,6 persen dengan total keseluruhan mencapai 73,3 miliar batang. “Hal ini menunjukkan pertumbuhan PT HM Sampoerna terus berusaha meningkatkan sales dan efisiensi sehingga profitabilitas mengingat dengan cara memperluas market share melalui meluncurkan varian baru mengikuti perkembangan pasar,” ujarnya. Pada peluncuran Dji Sam Soe Gold di Sumatera Utara sebagai kota kedua setelah Surabaya, Yudi Rizal menyatakan dari total keseluruhan variansi, 33,2 persen nya adalah sigaret kretek tangan (SKT) selebihnya adalah empat jenis varian seperti sigaret kretek mesin (SKM), SKM Law Tar Nikotin (LTN), dan Sigaret Putih Mesin (SPM). Untuk saat ini, lanjutnya pihaknya telah meluncurkan varian baru dengan target pasar di usia dewasa mulai 25 s/ d 35 tahun dengan kadar lebih ringan dibandingkan varian sebelumnya. “Ini merupakan permintaan pasar yang menginginkan varian dari Dji Sam Soe dikemas sesuai selera peminat dengan model berbeda dari se-

belumnya. Jika sebelumnya dibuka melalui tengah, kini dari samping atas dengan warna berbeda pula,” ujarnya. Yudi Rizal mengakui, dipilihnya Sumatera Utara sebagai kota ke dua diluncurkannya varian terbaru, setelah Surabaya, mengingat pasar di daerah ini dianggap sebagai salah satu kekuatan pasar rokok kretek, tidak hanya nasional tetapi juga bagi varian Dji Sam Soe,” ungkapnya didampingi Regional Marketing Manager Sumbagut, Harry Wibisono. “Salah satu kekuatan pasar PT HM Sampoerna, terutama untuk varian sigaret kretek tangan (SKT) berada di wilayah Sumut. Diharapkan, dengan keluarnya varian terbaru ini dapat menjamah seluruh lapisan penikmat sigaret kretek tangan,” lanjutnya kembali. Varian terbaru ini, lanjutnya, diracik sesuai resep orisinil Fatsal 5, yang dikembangkan pendiri Sampoerna 90 tahun lalu. Dengan komposisi berbeda, Dji Sam Soe Gold merupakan sigaret kretek tangan varian terbaru di keluarga Dji Sam Soe yang menawarkan tarikan lebih halus, serta mengedepankan karakter rasa dan keunggulan merek. “Untuk target share dengan keluarnya varian terbaru ini, PT HM Sampoerna Tbk menargetkan sebanyak-banyaknya,” ujarnya. Pasca krisis ekonomi global terjadi akhir 2008, PT HM Sampoerna mengaku terkena imbas namun hal ini tidak berlangsung lama karena semakin membaiknya pertumbuhan ekonomi Indonesia.(m38)

ki ada laporan dari Eropa dan Amerika Serikat bahwa keduanya mengalami defisit anggaran, katanya. BI, menurut dia mengharapkan rupiah tidak naik dengan cepat. Naik boleh saja namun posisi jangan sampai meliwati angka Rp10.000 per dolar. Karena itu, dengan keberadaan BI di pasar, maka rupiah akan masih bergerak dalam kisaran sudah ditetapkan, ucapnya. Apabila rupiah bisa menembus angka Rp10.000 per dolar, lanjut dia maka rupiah akan terus menguat hingga

menjauh angka Rp10.00 per dolar. Peluang rupiah untuk naik lagi, menurut dia sampai Jumat masih tinggi, karena laporan Badan Pusat Statistik (BPS) menunjukkan laju inflasi 2009 akan berada di bawah angka empat persen. Hal ini yang mendo-rong p e la ku lo ka l da n a sing membeli rupiah setelah menyadari faktor positif pasar masih tingi. Apabila kondisi seperti ini didukung oleh perbankan maka pertumbuhan akan semakin baik, ujarnya.

Antara

KACANG MERAH: Seorang warga memisahkan Kacang Merah dari kulitnya dengan cara dipukul-pukul di Tlahab, Temanggung, Jateng, Rabu (16/7). Kacang Merah biasa ditanam petani setempat di sela-sela tanaman utama seperti Jagung dan Tembakau, harga Kacang Merah saat ini mencapai Rp7.000 per kilogram padahal sebelumnya hanya laku Rp2.500 per kilogram.

Harga Emas Turun Ke Level Rp305 Ribu Per Gram MEDAN ( Waspada): Harga emas kualitas 99,99 persen di perdagangan lokal turun menjadi Rp305 ribu per gram setelah terciptanya kestabilan politik usai pemilihan presiden (Pilpres). Sedangkan emas di perdagangan internasional tidak mengalami penurunan, malah dalam tiga hari terakhir harga emas di pasaran luar negeri mengalami kenaikan diantaranya dari 928 dolar AS menjadi 938 dolar AS per ounce saat ini. Menurut Rizal, pedagang emas Singgalang Indah, Kamis (16/7), harga emas di per-

dagang lokal mengalami penurunan drastis khususnya usai pemilihan presiden, dari ratarata Rp310 ribu sebelum Pilpres 8 Juli menjadi Rp305 ribu. Sementara itu harga emas di pasaran internasional terus mengalami kenaikan dalam tiga hari terakhir tidak mampu mempengaruhi harga emas di perdagangan lokal yang tertopang oleh menguatnya nilai rupiah terhadap mata uang asing, sebutnya. Mata uang rupiah saat ini menguat hingga Rp10.100 per dolar AS, sementara itu sebelum Pilpres mata uang lokal tersebut selalu berada di atas

mina Achmad Faisal di Hotel Sari Pan Pasific, Jakarta. Faisal menjelaskan ekspor tersebut akan dilakukan mengingat saat ini adanya stok minyak tanah yang berlebih. “Stok minyak tanah Pertamina mencapai 47,2 hari sementara stok normalnya kan 25 hari,” jelasnya. Menurut Faisal, ekspor ini dilakukan mengingat adanya over stok minyak tanah sebagai dampak program konversi minyak tanah ke elpiji. “Saat ini penyaluran minyak tanah hanya 15.000 KL per hari, padahal sebelumnya penyaluran minyak tanah sekitar 23.000-26.000 KL,” paparnya. Faisal menambahkan saat ini pihaknya telah mengajukan izin ekspor ke pemerintah. “Izin ekspornya sedang diproses,” tandasnya. Harga minyak Sementara harga minyak naik di perdagangan Asia, Kamis, setelah kenaikan panjang yang besar di bursa AS memberi harapan awal dari pemuli-

Harga Emas Di Medan Jenis

Kadar

Harga

London Murni London 24 Karat Emas Putih 22 Karat Suasa

99% 97% 90 s/d 93% 75 % 70% 20 s/d 35%

Rp310.000 Rp296.000 Rp260.000 Rp225.000 Rp165.000 Rp100.500

Rp10.500 per dolar AS tetapi hanya mampu mempengaruhi harga emas hingga Rp310 ribu per gram, katanya. Kestabilan politik usai Pilpres mampu mengurangi tekanan dari kondisi ekonomi di pasaran luar negeri terhadap mata uang rupiah, sehingga harga emas lokal tidak terpengaruh naiknya emas luar negeri dari 928 dolar AS menjadi 938 dolar AS per ounce saat ini, katanya. Omset Sementara itu omset pedagang emas saat ini masih sepi akibat banyaknya kebutuhan masyarakat untuk menghada-

pi tahun ajaran baru dan adanya aksi sebagian besar masyarakat menahan emas miliknya karena harga turun. Beberapa pedagang emas di Pusat Pasar mengatakan omset pedagang emas saat ini mengalami penurunan hingga mencapai 30 persen akibat sepinya transaksi setelah meningkatnya kebutuhan masyarakat untuk keperluan sekolah. Sedangkan omset dari aksi jual emas milik masyarakat ke pedagang juga mengalami penurunan akibat harga emas mengalami penurunan drastis khususnya setelah Pilpres berakhir.(m40)

Menpera Desak Pemda Bentuk Perda RSh SURABAYA (Antara): Menteri Perumahan Rakyat (Menpera) Mohammad Yusuf Asyari mendesak, pemerintah daerah segera membentuk peraturan daerah (perda) tentang pengadaan Rumah Sederhana Sehat (RSh) bagi rakyat miskin, mengingat pembangunan rumah di daerah kurang optimal. “Belum optimalnya pengadaan rumah di daerah karena terkendala sertifikasi dan perizinan pembebasan lahan oleh pemda setempat. Setelah perda itu terbentuk segala macam perizinan dan sertifikasi semakin mudah, serta biayanya relatif terjangkau,” katanya, saat membuka Rapat Kerja Daerah (Rakerda) I DPD Asosiasi Pengem-

bang Perumahan dan Permukiman Seluruh Indonesia (Apersi) Jatim di Surabaya, Kamis (16/7). Dia menyarankan, seluruh pemerintah daerah segera memberikan kemudahan dalam perizinan. Jika izin pembangunan ini dipersulit justru mengambat laju pertumbuhan pembangunannya. “Tolong, izin pembangunan RSh jangan dijadikan sumber PAD. Namun, harus dipercepat, dipermudah, dan ringan. Ini agar harga bisa terjangkau oleh masyarakat bawah,” katanya. Dia menambahkan, kebutuhan rumah saat ini sudah semakin besar. Terlebih di daerah perkotaan akibat dari derasnya urbanisasi terjadi. Bahkan, 50 persen dari pendu-

Ditjen Migas Izinkan Pertamina Ekspor Minyak Tanah JAKARTA (Waspada): Direktorat Jenderal Minyak dan Gas (Ditjen Migas) telah mengizinkan Pertamina untuk melakukan ekspor minyak tanah selama tiga bulan. “Saya sudah tanda tangani surat rekomendasi ekspor minyak tanah kepada Pertamina untuk 3 bulan,” ujar Dirjen Migas Evita Legowo di sela-sela perayaan ulang tahun BP Migas, di Gedung Patra Jasa, Jalan Gatot Subroto, Jakarta, Kamis (16/7). Evita menyatakan Pertamina juga sudah menentukan negara yang menjadi tujuan ekspor tersebut. “Ada, tapi saya lupa kemana, volume dan negaranya saya lupa,” jelasnya. Seperti diketahui, Pertamina mengajukan izin untuk ekspor minyak tanah pada 7 Juli lalu. Ekspor ini dilakukan mengingat adanya over stok minyak tanah sebagai dampak program konversi. “Saat ini kita tengah mencari pasarnya,” ujar Direktur Pemasaran dan Niaga Perta-

WASPADA Jumat 17 Juli 2009

han ekonoi dunia, kata kalangan analis. Kontrak utama berjangka untuk minyak jenis light sweet crude di New York untuk pengiriman Agustus naik 15 sen menjadi 61,69 dolar per barel. Sementara harga minyak Laut Utara Brent untuk pengiriman Agustus bertambah enam sen menjadi 63,15 dolar. Kontrak pengiriman untuk Agustus akan berakhir Kamis (16/7) malam. Kalangan analis mengatakan harga minyak telah naik semalam karena lonjakan di Wall Street dan proyeksi bank sentral AS bahwa perekonomian negara itu akan meningkat sehingga memberikan dorongan tambahan. “Saham teknologi dan keuangan melonjak di Wall Street kemudian meluber ke pasar saham Asia,” kata Victor Shum, senior principal of energy consultants Purvin and Gertz yang berkedudukan di Singapura. Ini mendongkrak harga minyak lebi tinggi, katanya menambahkan.

“Sentimen pasar minyak diperkuat oleh kenaikan pasar saham AS,” kata Commonwealth Bank of Australia dalam laporannya. Wall Street ditutup menguat, Rabu, didorong oleh hasil mencengangkan dari raksasa teknologi Intel dan peningkatan kinerja Federal reserve bagi perekonomian terbesar di dunia itu. Bank sentral AS memunculkan kilasan pandangannya untuk 2009 dan 2010 memproyeksikan pemulihan di semester kedua 2009 akan mengubah kontraksi ekonomi untuk satu tahun menjadi antara 1,0 dan 1,5 persen. Pasar di seluruh dunia mengawasi dengan ketat kesehatan perekonomian AS karena peranannya sangat penting bagi pertumbuhan dunia. Perekonoian dunia kuat berarti permintaan minyak untuk menggerakkan industri dan aktivitas ekonomi lainnya lebih besar, membuat harga lebih tinggi.(dtc)

Valuta Asing Di Medan

Mata Uang Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

Jual 10.110 8.225 9.664 16.748 1.389 110,43 7.230 14.523 3.300

Beli 10.105 7.925 9.287 16.305 1.283 105,88 7.000 14.123 3.000

duk nasional berada di perkotaan. Jumlahnya mencapai 147 juta atau 1,5 kali penduduk pedesaan. “Untuk itu, harus ada solusi wadah kelembagaan perumahan disetiap kabupaten kota sebab selama ini hanya ada di tingkat provinsi,” katanya. Padahal, kata dia, dengan

adanya otonomi daerah, permasalahan tersebut seharusnya menjadi tanggung jawab daerah juga. “Jika tidak ada kelembagaan jelas di daerah, mana ada yang memikirkan program yang jelas dan berapa kebutuhan rumah di daerah,” lanjutnya.

Pameran Medan Mega Bazar Berakhir MEDAN (Waspada): Pameran Medan Mega Bazaar yang diselenggarakan Kodim 0201 BS/Medan bersama Pemerintah Kota Medan dan Trans Kreasindo Production selaku event organizer di Lapangan Benteng Medan berakhir sukses, Minggu (12/7). Event yang digelar dalam rangka memperingati HUT Kota Medan dan HUT Kodam I Bukit Barisan ini berhasil dalam menfasilitasi kebutuhan masyarakat. Medan Mega Bazaar 2009 diselenggarakan 12 Juni – 12 Juli 2009 dengan menghadirikan berbagai atraksi keluarga. Mulai lumba-lumba, kompetisi musik diramaikan ratusan stand pameran dari perusahaan otomotif, elektronik, furniture, fashion, makanan dan minuman, handy craft, aksesoris dan lain-lain. Dievent ini juga ditampilkan peralatan dan perlengkapan milik TNI. Pejabat Walikota Medan Afifuddin Lubis berkesempatan hadir dalam acara Panggung Prajurit 4 Juli bersama personil Kodam I BB. Afifuddin menyatakan sangat bangga dengan pelaksanaan event yang mampu menjadi pilihan masyarakat dalam pemenuhan kebutuhan rekreasi bersama keluarga.

Kodim 0201/BS Medan , Letnan Kolonel Kav Yotanabey AM DS didampingi Direktur Utama Trans Kreasindo Production Didit Mahadi Kadar kepada wartawan, Selasa (14/ 7) mengucapkan terima kasih kepada seluruh stakeholders yang telah berpartisipasi dan mendukung kesuksesan even Medan Mega Bazaar 2009. Selama event ini berlangsung, masyarakat Sumatera Utara dan kota Medan khususnya dapat menikmati rekreasi bersama keluarga dan sahabat sambil menikmati kebutuhan belanja aneka produk yang ditawarkan. Sehingga apa yang menjadi tujuan dari pelaksanaan event ini, kata Yotanabey sebagai ajang untuk memperkuat persatuan silahturhami antara semua pihak dan rekreasi masyarakat dari seluruh lapisan dapat tercapai. Didit Mahadi Kadar menambahkan, Medan Mega Bazaar 2009 ini akan menjadi agenda even yang nantinya akan diselenggarakan setiap tahun. Suksesnya pelaksanaan pameran ini merupakan wujud dari konsep pelaksanaan even secara profesional dan juga partisipasi dari berbagai pihak yang telah terlibat dan mendukung kegiatan ini.(m13)

Waspada/ist

PENUTUPAN: Didit Mahadi Kadar (kanan), Afifuddin (tengah) dan Yoyanabey saat penutupan Medan Mega Bazar.


Mimbar Jumat

14

WASPADA

Jumat 17 Juli 2009

Tafsir Ayat Kauniyah Dan Peradaban Islam 10 Keuntungan Silaturahmi

(Catatan Perjalanan Tim Tafsir Yayasan Syekh H. Abdul Halim Hasan II)

D

ua hari lamanya dari tanggal 1-2 Juli 2009 Tim Khusus Penulis Tafsir LSaQYayasan Syekh H. Abdul Halim Hasan mengikuti workshop Tafsir Ayat-Ayat Kauniyah di Lembaga Ilmu Pengetahuan Indonesia (LIPI) Jakartal. Menarik, menakjubkan, tapi waktunya sangat singkat. Itulah kesan yang dirasakan seluruh peserta. Seluruh peserta yang terdiri dari 12 orang penulis dengan serius mengikuti workshop tersebut. Tidak ada yang melewatkan satu sesipun karena pentingnya informasi yang diberikan nara sumber. H. Amru Daulay selaku Pembina LSaQ memutuskan untuk menunda berbagai kegiatan di Jakarta hanya untuk mengikuti acaratersebut,dariawal sampai akhir. Bagaimana tidak,Tim tafsir ayatayat kauniyah LIPI menjelaskan berbagai ayat sains dan memahaminya dari aspek sains. SedangkanTim Tafsir Sumut mencoba memahami ayat dengan pendekatan bahasa dan tafsir murni. Perdebatan justru terjadi ketika dua pendekatan tersebut didialogkan. Salah satu kesimpulan yang tidak tertulis adalah, betapa umat Islam, dalamwaktuyangcukuppanjangtelah melupakan ayat-ayat kauniyah. Akibatnya, umat Islam tidak dapat mengambil manfaat yang besar dari ayatayat tersebut. Jika hari ini umat Islam jauh tertinggal dari bangsa-bangsa lain, padahal di sisi kita ada kitab yang agung dan mulia; Al-Qur’an, itu tidak lain karena kesalahan kolektif kita sebagai umat karena melupakan ayat kauniyah. Tentu saja jika umat Islam ingin maju dan menjadi kampiun peradaban dunia, perhatian terhadap ayat-ayat kauniyah harus ditingkatkan. Tentu saja dengan tetap mengkaji dan menggali makna yang dikandung ayatayat syar’iyyah. Artikel ini sekedar ingin berbagi pemikiran kepada ummat. Syukursyukur dapat menjadi wacana ilmiah tentang bagaimana sejatinya kita menyikapi ayat-ayat kauniyah dan selanjutnya menterjemahkannya ke dalam bentuk yang lebih konkrit. Misalnya dalam proses pendidikan kita sejak SD, SMP, SMU bahkan perguruan tinggi, ayat-ayat kauniyah harus diberi tempat yang proporsional. Adalah penting untuk menanamkan sejak awal pada anak didik kita bahwa didalamIslam,ilmupengetahuantidak terpisah dengan agama. Hal ini penting agar kita tidak mengalami nasib yang sama seperti yang terjadi pada agama lain. Ketika ilmu Pengetahuan dipisahkan bahkan saling diperhadapkan dengan agama, maka pada saat itu agama akan jauh tertinggal. Ayat Kauniyah

Azhari Akmal Tarigan

Dalam kajian Al-Qur’an secara garis besar ayat-ayat Al-Qur’an diklasifikasikan secara berbeda sesuai dengan sudut pandangnya. Ditinjau dari sisi turunnya, ayat Al-Qur’an dibagi kepada ayat makkiyah dan ayat madaniyyah. Dari sisi kejelasan dilalahnya(tunjukanmaknanya),ayatayat Al-Qur’an dibagi kepada ayatayat muhkamat dan ayat-ayat mutasyabihat. Dari sisi muatannya, ayat Al-Qur’an umumnya dibagi kepada; ayat-ayat hukum (ayat al-ahkam), ayat-ayat aqidah, dan ayat-ayat akhlak. Satu pembagian lain yang tidak boleh diabaikan adalah ayat-ayat al-qasas atau ayat-ayat yang mengungkapkan tentang kisah masa lalu atau khabar pada masa depan. Kita hampir tidak menemukan penjelasanyangmemuaskanberkaitan denganayat-ayatkauniyah.Setidaknya di dalam buku-buku teks ulum alQur’an, tidak ditemukan pembagian sepertiinisecarajelas.Padahaldidalam Al-Qur’an lebih kurang 750-800 ayat bercerita tentang proses penciptaan langitdanbumisertaisinya,penciptaan manusia, benda-benda angkasa raya, bulan, matahari, bintang-gemintang dan sebagainya. Inilah yang dimaksud dengan ayat-ayat kauniyah. Agus Purwanto, ahli fisika teoritis alumni Universitas Hiroshima Jepang, menyebutnya dengan Ayat-Ayat Semesta. Pemerhati lain menyebutnya dengan ayat-ayat sains. KendatididalamAl-Qur’anjumlah ayat-ayat sains cukup banyak, bahkan lebih banyak dari ayat hukum, tidak berarti al-Qur’an dapat dikatakan sebagai kitab ilmiah. Sebagaimana layaknya buku ilmiah, jelas bahwa AlQur’an tidak sistematis. Menyebut AlQur’anbukankitabilmiah,tidakberarti merendahkan Al-Qur’an. Posisinya di atas kitab apapun di muka bumi ini. Al-Qur’an cukup jika kita menyebutnya hanya kitab petunjuk (hudan), penjelas (bayyinat) dan pembeda

(furqan). Disebabkan Al-Qur’an sebagai kitab petunjuk, maka Al-Qur’an cukup hanya memberikan isyarat-isyarat ilmiah. Bagaimana menyingkapnya, semuanya terserah kepada manusia sebagai makhluk yang berakal. AlQur’an hanya menginspirasi pembacanya untuk menggali pesan-pesan ilmiah. Apakah inspirasi yang diberikan Al-Qur’an diterje-mahkan ke dalam proyek penelitian, pengkajian, semuanya terserah manusia. Namun yang pasti, keberadaan ayat-ayat kauniyahdi dalamAl-Qur’an mengandung misi suci yang hebat. Masalahnya, apakah umat Islam terpanggil untuk meng-galinya atau tidak. Sayainginmenunjukkanbeberapa buku terakhir yang secara spesifik berbicara tentang ayat-ayat kauniyah. Pertama bukunya Agus Purwanto Ayat-Ayat Semesta: Sisi-Sisi Al-Qur’an yang Terlupakan. Kedua, karya Bambang Pranggono, Mukjizat Sains dalam Al-Qur’an: Menggali Inspirasi Ilmiah. Ketiga, Agus Haryo Sudarmojo, Menyibak Rahasia Sains Bumi dalam Al-Qur’an. Keempat, Dyayadi MT, Alam Semesta Berthawaf: Keajaiban Sains dalam Al-Qur’an.Tentu masih banyak buku-buku lainnya. Di dalam buku tersebut kita akan menemukanjudul-judulsubbahasanseperti, Islamisasi sains, Astronomi yang didalamnya di bahas, Bumi Pusing, Malam dan Siang, Bumi Melayang, Kalender Qamariyah, Kunci Langit dan Bumi, Rekreasi ke Bawah Tanah. Selanjutnya masalah Relativitas dan Kosmologi yang didalamnya dibahas, Supernova, Alam Semesta Balon dan dunia lain. Berikutnya tentang Mekanika Kuantum. Kajiannya adalah Dunia Mikro yang dinamis, Tuhan terus men-cipta, teleportasi kuantum, dan hierarki alam. Dengan versi yang sedikit berbeda, seperti pada buku kedua, sub judul buku dibagi ke dalam tujuh pokok bahasan yaitu, angkasa, buana, samudra, flora-fauna, kota, manusia dan ilmu.Yangmenarikadalah,setiapkajian diawali dengan pemaparan ayat AlQur’an.Adajugayangpembahasannya menekankan pada aspek tertentu. Misalnya pada buku ketiga yang fokus pada masalah bumi sedangkan buku yang terakhir lebih memfokuskan pembahasannyapadamasalahangkasa raya. Jauh sebelum buku tersebut, Ahmad Baiquni telah menerbitkan buku yang cukup baik tentang, Al-Qur’an, Ilmu Pengetahuan dan Tekhnologi.

Pada tahun 1994 telah berlangsung Seminar Internasional, “Mukjizat Al-Qur’an dan Sunnah tentang IPTEK.” Makalah-makalah tersebut telah diterbitkan oleh GIP menjadi dua buku yang judulnya sama dengan judul Seminar. Apakah pembahasan mereka, termasuk penulis-penulis lain tentang ayat-ayat sain dapat dikategorikan sebagai tafsir. Jawabannya tergantung pada pemahaman kita terhadap tafsir. Apa bila tafsir dikembalikan kepada maknageneriknyasebagaipenjelasan, menyingkap arti, maka penjelasan mereka terhadap ayat-ayat sain itu disebut tafsir. Namun jika tafsir dipahami secara mekanistik, dengan syarat-syarat yang relatif kaku, maka banyak pihak yang keberatan menyebutnya sebagai tafsir. Dalam sejarah Islam kontemporer, memang ada perdebatan yang hangat berkaitan dengan tafsir ayatayat Sains. Adalah Syekh Jauhari Tantawi (1870-1940) yang menulis Tafsir Al-Jawahir mencoba untuk menyingkap ayat-ayat sains secara lebih luas dan dalam. Untuk lebih memperjelas arti, turut dicantumkannya berbagai macam gambar sesuai dengan pembahasan. Namun apa yang terjadi. Banyak ulama yang mengkritik apa yang dilakukan oleh Syekh Jauhari. Diantaranya adalah Syekh H. Mahmud Syaltut, Amin Al-Khuli dan Syekh AL-Maraghi. Me-nurut Al-Maraghi Al-Qur’an pada dasarnya hanya memuat prinsip ilmu pengetahuan bukan detailnya. Dengan prinsip umum Al-Qur’an menjadi lebih abadi. Lepas dari itu, point penting yang hendak dikemukakan adalah, umat Islam harus menyadari bahwa AlQur’an memuat cukup banyak ayatayat sains. Memahami ayat sains tentu tidak dapat dilakukan hanya mengandalkan kebahasaan, asbab al-nuzul, munasabah dan alat-alat tafsir konvensional lainnya. Namun harus dicatat, penjelasan sains atau penemuan sains tidak otomatis dapat dijadikan sebagai satu-satunya kebenaran atau penjelasan tunggal dari sebuah ayat kauniyah. Ilmu dengan sifatnya relative sangat memungkinkan untuk berubah. Tidaklah mengherankan ada teori yang sudah dianggap benar, karena penemuan baru dinyatakan tertinggal. Oleh sebab itu, salah satu implikasi pendekatan sain terhadap tafsir ayat kauniyah, adalahkesadaranuntukterusmenerus mengupdate tafsir tersebut agar informasinya tidak tertinggal. � Azhari Akmal Tarigan. Koordinator Tim Penulis Al-Qur’an ALKarim Karya Ulama Tiga Serangkai.

Reaktualisasi Isra’ Mi’raj Dalam Kehidupan

S

epanjang sejarah peradaban manusia belum pernah terjadi suatu peristiwa yang menakjubkanmelebihiIsra’Mi’rajyangdialami RasulullahSaw.Peristiwatersebuttidak sajamenggoncangkanduniaArabpada saatitu,tetapidibelahanmanapundapat dipastikan dengan kapasitas teknologi tidak secanggih dewasa ini, tentu sulit untukdapatmempercayaikejadianbesar itu.padakonteksinilahsebenarnya umat Islamharusmampumenangkappesanpesan isra’ mi’raj tersebut Namun cukup disayangkan, pemaparan Isra’ Mi’raj yang selalu disampaikan para penceramah terbatas deskriptif saja dan tidak memberikan perubahanyangberartibagiumatIslam yangmemperingatinya.Olehsebabitu, tulisaninimencobauntukmenawarkan reaktualisasipemahamanterhadapIsra’ Mi’raj sehingga dapat diteladani umat secarauniversal.Jadi,tidakterjebakpada acara-acara seremonial, tetapi masuk pada hal yang lebih substansial. Setidaknya, Isra’ Mi’raj merupakan duakatayangdisematkanpadaperistiwa perjalananRasulullahSaw dariMasjidil Haram sampai ke Sidratul Muntaha dalam waktu relatif singkat. Perjalanan beliau dari Masjidil Haram ke Masjid al-Aqsa pada disebut dengan Isra’. Selanjutnya perjalanan dari Masjid al-

Oleh Watni Marpaung, MA

Aqsa ke Sidratul Muntaha disebut dengan Mi’raj. Dalam perjalanan yang dilakukan beliauternyatabanyaksekalipengalaman yang didapatkan untuk selanjutnya disampaikan kepada umat. Pada saat isra’beliaumengalamiberbagaimacam peristiwa di antaranya, ada orang yang memotonglidahnyalalukembaliseperti semula,adayangmemanenpadi,tetapi tumbuh lagi, dan banyak lagi peristiwa lainyangsulitdanheranbagiRasul.Tetapi pada hakikatnya bahwa serangkaian pemandanganyangdiperlihatkankepada

Konsultasi Al-Quran

Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah (IPQAH Kota Medan) KONSULTASI AL-QURAN adalah tanya jawab sekitar Al-Quran, yang meliputi: tajwid, fashohah, menghafal Al-Quran, Ghina (lagu) Al-Quran, Hukum dan ulumul Al-Quran. Kontak person. 08126387967 (Drs. Abdul Wahid), 081396217956 (H. Yusdarli Amar), 0819860172 (Mustafa Kamal Rokan).

Assalamu’alaikum Wr.Wb. Ustadz, saya mau bertanya, apakah sah sholat imam dan makmum, jikadalamberjamaah,imamtidakmembaca basmalahpadasaatmembaca fatihah dalam sholat berjamaah? Mohon penjelasan. Dari Hamba Allah Jawab : Terimakasih atas pertanyaanya, Dalam Fiqh Sunnah karangan Sayyid Sabiq halaman 115 disebutkan ada tiga pendapat dalam permasalahan ini: 1. Karena basmalah merupakan bahagian dari surat Al-fatihah, maka hukum membaca basmalah sesuai dengan hukum membaca Al-fatihah, ringkasnya wajib membaca basmalah dalam keadaan jahr (membaca kuat) maupun keadaan sirr (membaca pelan). Ini pendapat Imam Syafi’i, Imam Ahmad, Abu Tsaur dan Abu Ubaid . 2. Hukum membaca basmalah hanya Jaiz (boleh) dan dalam keadaan jahr dihukumkan Sunat. Ini pendapat Imam Malik. 3. Hukum membaca basmalah adalah makruh, baik dalam keadaan sirr maupun jahr, atau juga dalam shalat fardhu maupun sunnat. Ini pendapat Imam Abu Hanifah. 4. Untuk pertanyaan di atas jawabnya adalah bagi golongan Imam Syafi’i shalatnya Tidak sah, sedang bagi Imam Malik dan Imam Abu Hanifah shalatnya sah. 5. Untuk penelusuran pendapat-pendapat diatas, dapat di lihat, Muhammad Ali As-Sais, Tafsir Ayat Ahkam,jilid I hal 5. Ibnu Rusy, Bidayatul Mujtahid, Jilid I, hal 254. Tafsir Al-qurthubi, jilid I hal 248. Wallahu A’lam. Al-Ustadz H. Ismail Hasyim, MA

Rasul merupakan ganjaran terhadap orang yang berbuat baik dan berbuat jelek pada saat di dunia. Sementaraitu,padasaatbeliauturun dariSidratulMuntahadenganmembawa perintahshalatwajibyangpadaawalnya sebanyak50kaliseharisemalam.Tetapi, pada akhirnya perintah shalat hanya tersisa 5 kali sehari semalam setelah bertemudengannabi-nabisenioryang memberikan nasehat kepada beliau untukmengurangikewajibantersebut. Setelahbeliaukembalikebumidan menyampaikanpengalamanspiritualnya selama Isra’ Mi’raj.Tetapi dakwah yang disampaikan mendapatkan sambutan yang tidak menguntungkan bagi Rasul, bahkansebaliknyamembawamusibah besarbagidiriRasuldankaummuslimin. Tidak menguntungkan bagi Rasul dankaummusliminbahwadiharapkan denganperistiwaitumemberikanstimulus kepada kafir Quraisy untuk masuk ke dalamIslam,namunternyatatidakbenar, bahkanyanglebihfatalumatIslambanyak yangmurtad.Secarasederhanakitaakan berfikirbahwakaburnyakeyakinankaum muslimin dengan peristiwa itu merupakan hal yang wajar melihat sulitnya untukmengakuiperjalananyangdialami Rasulullah Saw. Hanya Abu Bakar saja yangmembenarkanberitayangdisampaikan Rasul kepada masyarakat Arab. Begitu tragisnya perkiraan masyarakat ArabsampaiAbuJahalmendorongRasul pada saat berpidato menyampaikan perjalanan spritualnya tersebut. Reaktualisasi Isra’ Mi’raj Isra’mi’rajmerupakansuatuperistiwayangsangatmenakjubkan,perjalanan yang melewati batas kemampuan akal pikiran manusia untuk dapat mencernanya. Hingga detik ini isra’ mi’raj tetap sebagaisesuatuperistiwayangmisterius yangperludikajilebihmendalamuntuk mendapatkan kearifan-kearifannya. Secarahistoristidakdapatdidustakan bahwa isra’ mi’raj peristiwa yang luar biasa, namun perlu ditegaskan secara substansial pada hakikatnya kita juga dapatmelakukannya.Alasannya,adalah bahwaRasulullahisra’mi’rajbukansuatu peristiwayangterlepasdarilatarbelakang, miliukondisiyangmengitarinya,sebab dan tujuan tertentu. Dalam berbagai literatur sejarah dijelaskan bahwa pada saat Isra’ mi’raj terjadi disebut dengan ‘am al-huzni atau tahun kesedihan yang ditandai dengan meninggalnya dua pembela setia Rasul yaitu isterinya Khadizah danpamannyaAbuTalib.Atasmusibah ini beliau bersedih dan hampir putus asa melihat pembangkangan kafir Quraisy yang semakin keras, di tambah lagi meninggal dua orang pembelanya.

Melihatkondisiyangdialamibeliau maka Allah mengisra’kannya dengan berbagai pemandangan yang mempunyai makna sebagai renungan yang dapatmemberikankontribusiterhadap dalammembangunkembalisemangat perjuangan beliau. Dengan demikian, seharusnyaumatIslamdapatmenangkap substansi Isra’ Mi’raj dan mengamalkannya dalam hidup. Mengapa demikian? Karena kita semua hidup di dunia ini tidak pernah lepasdariberbagaipersoalankehidupan yangserbasulitmaupunmudah.Bahkan, tidak sedikit orang menjadi stress disebabkanmasalah-masalahyangselalu sajabertambahdanharusdicarikanjalan keluarnya. Dalam kondisi sekarang, kebutuhanhidupyangserbatinggidan sulitnyamendapatkanpekerjaantanpa dibarengi keimanan rasanya akan berpeluangbesarumatinimasukkepada hal-hal yang dilarang Allah. Apabila kondisi demikian sudah terjadi, pada hakikatnya kita dapat saja melakukan isra’ dengan mengadakan perjalanan wisata spritual. Setidaknya, cara yang dilakukan dengan mendatangi tempat-tempat yang sifatnya menggugahkeimanandanketakwaan, seperti tadabbur alam, tempat bersejarah, bahkan bagi yang punya kemampuan umroh ke tanah suci, atau juga ke tempat-tempat wisata lainnya, yang kita dapat menangkap dan menerjemahkannya untuk mengokohkan dan memperkuat keimanan. Dengan kata lain, perjalanan yang diperuntukkan Allah kepada Nabi MuhammadSawadalahbentukwisata spritual dalam rangka meneguhkan pendirian dan keistiqomahan serta kesabaran beliau dalam menghadapi berbagai tantangan dan kecaman kafir Quraisy pada saat itu. Oleh sebab itu, perlu lagi ditegaskan, bahwa kita juga dapat melakukan halyangsamadalammaknasubstansinya pada saat menghadapi berbagai persoalan dengan melakukan rekreasi dan wisata spritual untuk mengokohkan keimanandanketakwaansehingga lebih tegar dan siap menghadapinya. Penutup Isra’ Mi’raj harus dapat dipahami lebihluasdansecarasubstansi.Jaditidak sajaterjebakpadaperjalananRasulullah yang misterius dari Masjid al-Haram ke Masjid al-Aqsa dan selanjutnya ke Sidratul Muntaha, tetapi masuk pada wilayahtujuanesensisehinggakitajuga dapat melakukannya dalam rangka melakukan perubahan- perubahan kepada yang lebih baik. � Penulis adalah: Tim Tafsir AlQur’anAl-KarimUlamaTigaSerangkai SumateraUtara &KetuaDivisiLitbang Forum Kajian Islam. Dan Masyarakat (FKIM). Email. Watni_Marpaung. yahoo.com

’’Hablum Minallah’’ dan ’’Hablum Minannas’’. Bertakwa kepada Allah SWT dengan menjalankan segala perintahNya, namun jangan lupa menjalin hubungan persaudaraan sesama manusia selaku makhluk sosial beragama. Dalam konteks ’’Hablum Minannas’’ maka kita perlu menjalin silaturahmi yang sangat dianjurkan dalam Islam. Bahkan, silaturahmi yang kita jalankan mengandung banyak manfaat, seperti dikutip dalam haditshadits. Sedikitnya ada 10 keuntungan bagi orangorang yang menjalin silaturahmi, yaitu: 1. Memperoleh keridhaan Allah karena silaturahmi itu diperintahkan oleh-Nya. 2. Menggembirakan sanak kerabatnya karena pebuatan yang paling utama adalah menggembirakan orang yang beriman. 3. Para malaikat merasa gembira karena mereka bergembira bila ada orang yang bersilaturahmi. 4. Mendapat pujian yang baik dari segenap kaum muslimin. 5. Menyedihkan iblis yang terkutuk. 6. Menambah/memanjangkan umur. 7. Menambah berkah dalam rezeki. 8. Menyenangkan orang-orang yang telah meninggal dunia, karena nenek moyangnya merasa senang dengan adanya silaturahmi yang dilakukan oleh anak cucunya. 9. Menambah kasih sayang. 10. Menambah pahala setelah ia mati, karena mereka akan tetap mendoakannya walaupun ia telah mati selama mereka ingat kebaikan yang ia lakukan buat mereka. (Abu Laits As Samarqandi,Terjemah Tanbihul Ghafilin, penerbit PT Karya Toha Putra, 1993, Semarang).

Nilai-nilai Ilmiah Dan Imaniah Dalam Peristiwa Isra’ Mi’raj “Mahasuci Allah yang telah memperjalankan hamba Nya pada malam hari, dari masjidil Haram ke masjidil Aqsha, yang telah kami berkahi sekelilingnya agar Kami perlihatkan kepadanya sebagian tanda-tanda kebesaran Kami. Sesungguhnya Dia Maha Mendengar lagi Maha Mengetahui ”. Q.S.al Isra ayat 1.

Oleh H. Fachrurrozy Pulungan, SE

S

esuatu yang empiris adalah hal-hal yang bisa diukur, bisa dilihat dengan panca indra, bisa dilacak secara material, dan tidak ghaib, dan itu yang juga disebut masuk akal,pada mulanya perjalanan Isra’ dan Mi’raj ini ditentang oleh banyak orang, karena tidak masuk akal-sesuatu yang tidak empiris. Bagaimana tidak, perjalanan yang seharusnya ditempuh dalam waktu tiga bulan, ditempuh hanya dalam waktu delapan jam. Perjalanan dari kota Mekkah menuju Palestina (Baitulmaqdis) kemudian dilanjutkan perjalannan menembus batas planet bumi menuju langit, tentu suatu perjalanan yang tidak bisa diterima secara rasional (akal). Apalagi di masa itu belum dikenal adanya ilmu pengetahuan moderen (sceince). Orang juga menyebut sesuatu tidak masuk akal, karena menyimpang dari rata-rata. Padahal di dalam ilmu statistik, ada yang disebut ‘kurva bel’, yaitu data yang tidak umum, yang menyimpang dari rata-rata. Dan yang menyimpang dari rata-rata itu, bukan berarti tidak masuk akal. Sebab yang masuk akal itu bukan hanya yang rata-rata atau yang umumnya. Misalnya, orang yang rata-rata beratnya 100 kg akan mampu mengangkat barbel seberat 130 kg. Tetapi ada orang yang beratnya cuma 90 kg bisa menarik truk yang beratnya satu setengah ton hanya dengan tambang biasa, dan masuk dalam ‘Guiness Book of Records’. Hal semacam ini bukan tidak masuk akal, tetapi menyimpang dari rata-rata atau kebiasaannya. Lihat saja apa yang disajikan salah satu stasiun TV kita tentang the masters-sesuatu sajian yang tak lazim dilakukan oleh manusia moderen. Disamping itu, ada orang yang menyebut tidak masuk akal, karena ia tidak memahaminya. Untuk itu jangan menggeneralisir akan sesuatu tidak masuk akal, tidak logis, atau tidak rasional, karena kita tidak memahaminya. Setelah menempuh perjalanan dari Makkah ke Palestin (dari Masjidil Haram ke Masjidi Aqsha) kemudian Nabi SAW Mi’raj ke langit (ke Sidratul Muntaha). Kedua perjalannan itu dilakukan Nabi dalam keadaan sadar penuh, bukan dalam keadaan tidur sebagaimana banyak dibicarakan para ahli agama. Ungkapan ‘tasbih’ (subhanallah) seperti ayat pembuka di atas, dalam bahasa Arab hanya digunakan ketika menghadapi peristiwa besar, suatu perkara yang spektakuler. Dengan demikian, jika Isra’ dan Mi’raj terjadi dalam mimpi, berarti bukan merupakan perkara yang besar dan tentu tidak dianggap menakjubkan. Selain itu kata ‘abdihi (hamba/manusia) merupakan unsur ciptaan yang terdiri dari ruh dan badan. Maka hal ini pun menunjukkan korelasi (hubungan) antara manusia dengan alat/sarana perjalanan yang menyam-paikan pada tujuan, yaitu Buraq, sebagaimana dinyatakan dalam hadis-hadis shahih bahwa kenderaan Nabi Muhammad SAW ketika Isra’ dan Mi’raj adalah Buraq. Jika Allah memperjalankan Muhammad dengan ruhnya, tentu kenderaan seperti Buraq tidak diperlukan. Disamping itu ayat 12 surah an Najm, kata ‘ma yara’ menjelaskan tentang Muhammad SAW menyaksikan rupa asli Jibril as dan segala sesuatu yang ada di langit dengan mata kepalanya, mengingat kemustahilan terjadinya penglihatan tanpa badan. Sedangkan badan tanpa ruh mustahil terjadinya penglihatan. Karena ruh merupakan substansi penglihatan pada mata, sebagaimana juga ruh merupakan substansi kehidupan bagi badan. Isra’ dan Mi’raj Nabi Muhammad SAW pada malam 27 Rajab pada gilirannya memberikan suatu inspirasi pada dunia ilmu pengetahuan moderen. Science telah membuktikan suatu kenyataan yang mengagumkan tentang hal ihwal benda-benda langit, juga kecepatan perjalanan serta volumenya yang besar. Diketahui, bahwa perjalanan cahaya bintang mencapai 300.000 kilometer perdetiknya. Begitu

juga perjalanan gelombang tanpa kawat. Perkembangan ilmu pengetahuan atau science sejak sekitar 50 tahun terakhir ini telah banyak membantu dalam menyingkap misteri tentang alam semesta yang selama ini bagi kalangan ilmuan muslim hanya diketahui lewat ayat-ayat al Qur’an. Sejak umat Islam punya peranan penting dalam ilmu Falak, maka perkembangan lensa teleskop untuk meneropong bintang makin bertambah pesat. Melalui lensa-lensa itu para ilmuan mengenal adanya galaksi di luar galaksi kita. Di alam semesta ini kira-kira terdapat 100 miliyar galaksi, dimana setiap galaksi menghimpun seratus juta bintang. Pengetahuan tentang galaksi-galaksi itu membuka mata para ilmuan yang puluhan tahun yang lalu tidak mempunyai gambaran yang jelas tentang alam semesta ini. Bahkan mereka menganggap bahwa alam semesta ini akan tetap ada dan tidak akan lenyap, sehingga para ilmuan tidak pernah mencari siapa yang menciptakan alam jagad raya ini. Akan tetapi al Qur’an, mengimformasikan, bahwa Allah SWT akan memperlihatkan tanda-tanda kekuasaan Nya di sepenjuru permukaan bumi dan dalam diri tiaptiap manusia. Kemajuan ilmu pengetahuan memungkinkan manusia bisa memperkirakan bagaimana alam semesta ini pertama kali diciptakan. Umur galaksi yang bertebaran itu lima belas milyar tahun yang berdasarkan firman Allah, bahwa semua langit dan bumi itu masih bersatu, kemudian Allah memisahkan dengan kekuatan Nya dan menebarkannya menjadi begitu banyak galaksi. Dan dalam teori ilmu pengetahuan moderen, peristiwa itu disebut ‘big bang’, yaitu ledakan yang amat dahsyat. Selanjutnya tabir mistri alam makin terbuka sehingga orang semakin mengerti adanya alam lain yang hukumnya tidak sama dengan alam kita, sehingga bisa saja dipahami secara sience, bahwa perjalanan Rasulullah Muhammad SAW yang demikian jauh bisa ditempuh. Dan itu telah dibuktikan oleh para ilmuan moderen dewasa ini, dimana mereka mampu menembus batas planet bumi memasuki planet-planet lain dengan menggunakan pesawat ruang angkasa . Peristiwa Isra’ Mi’raj bisa kita terima dengan akal karena memiliki nilai-nilai ilmiah, akan tetapi menerima dengan akal saja tidaklah cukup. Untuk sampai bisa menghayati benar-benar peristiwa besar itu, kita harus melakukan riyadhah, yaitu suatu pembelajaran keyakinan (keimanan) akan ke Maha Kuasaan Allah yang dapat melakukan apa yang dikendaki Nya bagi hamba Nya. Allah memperlihatkan kepada Rasul Nya tandatanda keagungan dan kebesaran yang terdapat pada alam semesta, baik bumi maupun langit, agar semua yang diperlihatkan itu menjadi pelajaran praktis dengan mengajari Muhammad SAW lewat pemandangan dan penyaksian langsung. Sebab pengajaran lewat penyaksian langsung adalah cara mengajar yang paling efektif, sehingga Nabi tak perlu pergi kesuatu sekolah atau duduk dihadapan seorang guru atau pergi ke luar negri untuk naik ke langit dengat pesawat hasil temuan ilmiah. Karena Allah menjamin dari semua itu dengan memperlihatkan diantara tanda-tanda kekuasaan Nya yang Maha Besar, dengan memberikan kesempatan kepada Nabi SAW untuk menyaksikan alam jagad raya ini, dan kemudian mengajarkannya kepada kita yang wajib kita imani. Sebab pada dasar nya pikiran kita pun tidak akan pernah sampai pada hakikat dari perjalanan ini, karena keterbatasan ilmu yang ada pada kita. “Wama utitum minal ‘ilmi illa qolila ”. Dan tidaklah kamu diberi ilmu pengetahuan melainkan hanya sedikit. Q.s. al Isra ayat 85. Wallahu a’lam.


Mimbar Jumat

15 Etika Politik Sahabat Nabi

WASPADA Jumat 17 Juli 2009

Nabi SAW, Jibril, Hak Tetangga Abu Hurairah ra meriwayatkan dari Nabi Muhammad SAW bahwasanya beliau bersabda: ’’Jibril selalu berpesan kepadaku mengenai tetangga, sehingga aku menyangka bahwa tetangga itu akan diberi hak waris.’’ Dalam hadits lainnya disebutkan, seseorang datang kepada Nabi SAW dan berkata: ’’Wahai Rasulullah, apakah hak tetangga atas tetangganya itu?’’ Rasulullah bersabda: ’’Apabila ia mau berutang kepadamu maka utangilah; apabila ia memanggilmu maka jawablah; apabila ia sakit maka jenguklah; apabila ia minta tolong kepadamu maka tolonglah; apabila ia ditimpa musibah maka hiburlah; apabila ia mendapatkan kesenangan maka ucapkan selamat; apabila ia mati maka antarkanlah jenazahnya; apabila ia pergi maka jagalah (rumah dan keluarganya); dan janganlah kamu mengganggunya dengan bau masakanmu, kecuali bila ia diberi masakan itu.’’ Dalam hadits yang lain lagi ada tambahan dari sembilan hal tersebut di atas, di mana yang kesepuluh adalah: ’’Janganlah kamu meninggikan bangunan rumahmu melebihi bangunan rumahnya, kecuali dengan adanya kerelaan daripadanya.’’ Dari penjelasan hadits di atas maka kita bisa menarik pembelajaran bahwa tetangga merupakan orang yang ’’wajib’’ dihargai, disayangi, dan dibina kerukunannya sehingga kedekatannya bisa melebihi saudara kandung. Biasanya, kalau terjadi apa-apa dengan seseorang maka yang lebih dulu memberi bantuan, sibuk, adalah para tetangga kita. Oleh karena itu perbaiki hubungan dengan tetangga bila selama ini kita ada masalah. Samarqandi, Terjemah Tanbihul Ghafilin, penerbit PT Karya Toha Putra, 1993, Semarang).

Kebenaran Filosofis Isra’ Mi’raj Oleh Sugeng Wanto, MA

M

anusia hidup dalam tiga dimensi waktu : masa lalu, masa sekarang, dan masa yang akan datang. Masa lalu adalah kenangan, masa sekarang ialah kenyataan, dan masa yang akan datang merupakan harapan, impian, atau cita-cita. Orang yang baik adalah orang yang pandai mengambil pelajaran di masa lalu untuk menentukan sikap hari ini dan merencanakan masa depan, sehingga hari ini bisa lebih baik dari hari kemarin dan besok bisa lebih baik dari hari ini. Dalam konteks itulah Isra’ Mi’raj yang merupakan salah satu peristiwa terbesar dan luar biasa yang pernah dialami oleh Rasulullah Saw. pada masa lam-pau masih tetap relevan untuk kita jadikan acuan hidup di era kini. Kebenaran Peristiwa Isra’ Mi’raj Perjalanan nabi Muhammad Saw. dari Mekkah ke bait al-Maqdis, kemudian naik ke langit sampai ke Sidratil Muntaha, bahkan melampauinya sampai ke Bait alMakmur, serta sampai kembali ke Mekkah dalam waktu yang sangat singkat, merupakan tantangan terbesar sesudah Alquran disodorkan oleh Tuhan kepada umat manusia. Peristiwa ini membuktikan bahwa ‘ilm dan qudrat Tuhan meliputi dan menjangkau, bahkan mengatasi, segala yang finite (terbatas) dan infinite (tidak terbatas) tanpa memiliki batas waktu dan ruang. Alquran merekam peristiwa ini. Dan istimewa sekali, bahwa untuk mengisahkan peristiwa Isra’ Mi’raj Allah memulai ayat-Nya dengan kalimat tasbih. Allah berfirman : “Maha suci Allah yang telah memperjalankan hamba-Nya pada suatu malam dari masjidil Haram sampai ke masjidil Aqsha yang telah kami berkahi sekelilingnya, untuk kami perlihatkan tanda-tanda kebesaran Kami.” (Q.S. al-Isra’ : 1). Dalam peristiwa isra’ mi’raj Allah memakai kalimat tasbih, tentulah bukan suatu kebetulan. “Subhanalladzi” (Maha Suci Allah). Maha suci Allah dari segala kelemahan. Maha suci Allah dari segala kekurangan. Maha suci dari segala kesia-siaan. Allah mempertaruhkan kesucianNya untuk menjamin kebenaran peristiwaIsra’ Mi’raj. Namun, kebenaran ini bisa saja digugat bila melihat peristiwa ini dengan melepaskan diri dari bimbingan wahyu Tuhan, seperti yang dilakukan oleh orang-orang yang beraliran empirisis dan rasionalis. Bagaimana mungkin kecepatan, yang bahkan melebihi kecepatan cahaya ini dapat terjadi? Bagaimana mungkin lingkungan material yang dilalui oleh Muhammad Saw. tidak mengakibatkan gesekan-gesekan panas yang merusak tubuh beliau sendiri?. Inilah beberapa pertanyaan yang dilontarkan mereka untuk menggugat kebenaran peristiwa Isra’ dan Mi’raj ini. Bila pendekatan ini yang digunakan dalam melihat kebenaran peristiwa besar ini maka tidak nyambung, sebab peristiwa ini memang bukan peristiwa biasa tapi luar biasa. Pendekatan yang paling tepat untuk memahaminya adalah pendekatan imaniy lewat proses Rabbaniy. Ini berarti bahwa peristiwa Isra’ Mi’raj merupakan skenario Tuhan (tadbir Robbaniy) yang tidak bisa diakalakalkan. Pendekatan inilah yang ditempuh oleh Abu bakar Al-shiddieq, ketika pertama sekali mendengar berita tentang peristiwa tersebut, seperti tergambar dalam ucapannya : “Apabila Muhammad yang memberitakannya, pasti benarlah adanya.” Filosofis Kebenaran Isra’ Mi’raj Peristiwa ini tidak hanya berbekas di masa lalu saja, namun ia masih tetap relevan untuk dinuansakan dengan kondisi hari ini. Ada banyak hal yang merupakan nilai substansial terkandung dari peristiwa tersebut yang harus diharmoniskan dengan kondisi kekinian. Salah satu nilai substansial yang bisa diambil adalah penyadaran terhadap adanya satu kekuatan yang bersifat suprarasional (sesuatu yang tidak mampu terjangkau oleh akal manusia memikirkannya). Peristiwa isra’ mi’raj bukanlah peristiwa yang harus dipaksakan untuk dirasionalisasikan, dan ia juga bukan irrasional (tidak masuk akal), tapi ia merupakan bagian dari suprarasional. Ini menunjukkan bahwa bila Allah berkehendak maka tidak ada suatu yang mustahil di dunia ini. KISARAN Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari Al-Husna Simpang 6 Kel. Kisaran Barat Nurul Yaqin Jl. K.H. Agus Salim Pasar Lama Nurul Huda Jl. Malik Ibrahim No. 37 LABUHAN BATU Baiturrahman Kamp. Masjid Kec. Kualuh Hilir L.Batu

Tuhan tidak mengenal waktu untuk mewujudkan sesuatu. Hari ini, esok, juga kemarin, adalah perhitungan manusia, perhitungan makhluk, Tuhan sama sekali tidak terikat kepadanya, sebab Dia adalah yang maha menguasai masa. Karenanya Dia tidak membutuhkan batasan untuk mewujudkan sesuatu. Sebagaimana Firman-Nya : “Maka perkataan Kami kepada sesuatu, apabila kami menghendakinya, kami hanya menyatakan kepadanya “kun” (jadilah), maka jadilah ia.” (Q.S. 16 : 40) Proses sebab akibat (causalitas) yang menyebabkan terjadinya sesuatu di dunia ini bukan merupakan sebab yang hakiki. Bila dikatakan sebab mendahului akibat (sesuatu) itu adalah benar, namun kedahuluan ini tidaklah dapat dijadikan dasar bahwa ialah yang mewujudkannya. “Cahaya yang terlihat sebelum terdengar suatu dentuman meriam bukanlah penyebab suara tersebut dan bukanlah penyebab terlontarnya peluru,” kata David Hume. “Ayam yang selalu berkokok sebelum terbit fajar bukanlah penyebab terbitnya fajar,” kata Al-Ghazali jauh sebelum David Hume lahir. Dengan demikian ada sebab hakiki yang mewujudkan sesuatu itu ada. Einstein, lebih tegas lagi menyatakan bahwa semua apa yang terjadi diwujudkan oleh “superior reasoning power” (kekuatan nalar yang superior). Atau, menurut bahasa Alquran, “Al-‘Aziz al-‘Alim, yaitu Tuhan. Inilah yang ditegaskan oleh Tuhan : “Kepada Allah saja tunduk segala apa yang di langit dan di bumi, termasuk binatang-binatang melata, juga malaikat, sedangkan mereka tidak menyombongkan diri. Mereka takut kepada Tuhan mereka yang berkuasa atas mereka dan mereka melaksanakan apa yang diperintahkan (kepada mereka). (Q.S. 16 : 49-50). Paparan ini menunjukkan bahwa dalam kehidupan ini kita jangan sampai kehilangan kendali. Merasa bahwa diri kita adalah segalanya (superioritas). Diberi jabatan tinggi bukan untuk bermegah-megahan, tapi untuk menjadi pelayan dan pengayom rakyat. Memiliki harta yang banyak bukan untuk berpoya-poya sendiri, tapi disalurkan untuk membantu orang lain. Menjadi penegak hukum bukan untuk memperjual belikan keadilan, tapi untuk menegakkan supremasi hukum dalam rangka mewujudkan keadilan dan ketentraman masyarakat. Tidak ada yang kuat di dunia ini, yang maha kuat hanyalah Allah. Tidak ada yang kaya di dunia ini, yang maha kaya adalah Allah. Bila Allah sudah punya kehendak maka sebagai makhluk-Nya yang lemah tidak akan mampu berbuat apa-apa. Jabatan akan bisa lengser kalau Allah berkehendak, harta akan habis bila Allah berkehendak, nyawa pun akan melayang bila Allah sudah menetapkan ajal kita. Jadi, tidak ada kesombongan dalam hidup ini. Deskripsi ini bukan menyuruh kita apatis (fatalism), hanya sekedar berpangku tangan kepada Allah tanpa adanya usaha (ikhtiyar). Ini mengarahkan kepada kita semua bahwa jangan sampai apa yang sudah kita punyai hari ini menjadikan kita sombong kepada Allah, dan kepada makhluk-Nya. Sombong kepada Allah berarti kita lalai dari mengingat-Nya. Sombong kepada makhlukNya berarti kita enggan bergaul secara baik dengan orang lain. Hidup ini harus betul diwarnai dengan penuh makna. Luruskan niat, kuatkan ikhtiyar dan tawakkal kepada Allah Swt. Penutup Peristiwa isra’ mi’raj ini merupakan murni skenario Tuhan kepada nabi Muhammad saw., yang tidak akan mampu terjangkau oleh akal pemikiran manusia, sebab sudah memasuki wilayah yang suprarasional (Allah Qadirun ‘ala Kulli Syai’in). Nilai substansialnya adalah ada sebuah kekuatan yang tidak tertandingi yaitu kekuatan Tuhan. Hal ini mengindikasikan bahwa manusia harus menyadari siapa dirinya dan bagaimana manusia harus mengerti Tuhannya. Sehingga ia tidak akan menyombongkan dirinya dan senantiasa akan mendekatkan diri kepada Allah Swt. Wallahu a’lamu. � Penulis adalah Dosen Fak. Ushuluddin IAINSU Medan, Peserta Program Doktor (S3) PPs. IAINSU Medan-Konsentrasi Agama dan Filsafat Islam dan Ketua Umum Pusat Ikatan Da’i Muda Cendikiawan (IDAMAN Centre). H. Usman Effendi, Lc Drs. H. Sofy Karim, Lc H. Zulkhaidir P., S.Ag, S.Pd.I H. Usman Darus KA. Kua Kec. Kualuh Hilir

P

olemik politik di kalangan para sahabat sudah mulai muncul pasca wafatnya Rasulullah. Isu sentral yang bergulir ketika itu ialah siapa sosok yang paling pantas menggantikan Rasulullah untuk mengurus agama dan negara. Sosok-sosok yang paling santer dibicarakan ketika itu adalah Abu Bakar, Umar, Ali bin Abi Thalib dan beberapa sahabat yang lain. Munculnya polemik ini bukan karena faktor syahwat kekuasaan akan tetapi lebih dominan karena faktor menjaga persatuan dan kesatuan. Oleh karena itu, jika polemik ini karena orientasi kekuasaan maka dapat dipastikan bahwa sahabat sudah bertanya kepada Rasulullah tentang sosok penggantinya ketika beliau masih hidup, akan tetapi mereka tidak pernah menanyakannya. Tidak adanya syahwat kekuasaan dalam dunia perpolitikan para sahabat dapat dilihat dari sikap Abu Bakar dan Ali bin Abi Thalib yang tidak pernah menonjolkan diri. Abu Bakar adalah sosok yang ditunjuk oleh Rasulullah yang menggantikannya sebagai imam sholat, sedangkan Ali bin Abi Thalib tidak pernah menyetir hadits yang menyatakan bahwa kedudukannya dengan Rasulullah seperti Harun dengan Musa. Sekiranya kedua sahabat ini menyetir kelebihan masing-masing maka dapat dipastikan adanya syahwat kekuasaan sehingga terjadi dua kubu yang saling berebut pengaruh. Meskipun ada intrik-intrik yang seperti ini tapi datangnya tidak dari kedua pribadi yang bersangkutan kecuali ada beberapa kelompok yang dengan sengaja mencoba meniupkannya dengan tujuan yang sulit diprediksi. Moral Politik Para Sahabat Kuat dugaan bahwa salah satu faktor pemakaman jenazah Rasulullah tertunda karena belum terpilih sosok yang pantas menggantikannya. Hal ini disebabkan bahwa Rasulullah tidak pernah menunjuk seseorang untuk menggantikan posisinya. Adapun penunjukan Abu Bakar sebagai imam shalat untuk menggantikan Rasulullah belum kuat dijadikan alasan bahwa Abu Bakar otomatis layak sebagai pengganti Rasulullah. Tidak adanya sosok yang ditunjuk Rasulullah sebagai peng-

Oleh Achyar Zein

gantinya maka masing-masing sahabat mengambil inisiatif. Di kalangan orang-orang Anshar telah terjadi kesepakatan bahwa sosok yang paling pantas menggantikan Rasulullah adalah Sa’ad bin Ubadah. Penunjukan Sa’ad ini dilakukan melalui musyawarah internal orang-orang Anshar di balai Bani Tsaqifah. Kejadian ini didengar Umar bin Khattab sehingga dia langsung mendatangi orang-orang Anshar dengan ditemani Abu Bakar dan Abu Ubaydah. Umar ketika itu memprediksi bahwa pengangkatan Sa’ad bin Ubadah adalah inkonstitusional karena dilakukan secara sepihak tanpa melibatkan masyarakat secara kesuluruhan. Selain itu, cara yang seperti ini dapat membahayakan persatuan dan kesatuan umat. Negosiasi yang dilakukan oleh Abu Bakar, Umar dan Abu Ubaydah berhasil mewujudkan suatu kesepakatan bahwa pengganti Rasulullah diserahkan kepada kaum Muslimin. Abu Bakar sebagai sahabat senior- mengusulkan dua nama calon yaitu Umar bin Khattab dan Abu Ubaydah, sedangkan Abu Bakar sendiri sama sekali tidak menyebut dirinya dalam pencalonan. Umar tidak serta merta mengamini usulan calon yang dikemukakan oleh Abu Bakar dan bahkan mengundurkan diri dari pencalonan. Pada saat yang bersamaan, Umar berbalik mengusulkan Abu Bakar menjadi pengganti Rasulullah dengan dasar prinsip senioritas. Usulan Umar ini disetujui oleh peserta musyawarah sehingga Abu Bakar terpilih secara aklamasi menggantikan Rasulullah. Ucapan selamat mengalir ke-

pada Abu Bakar termasuk dari orang-orang yang tadinya terlibat dalam penunjukan Sa’ad bin Ubadah. Adapun Sa’ad bin Ubadah sendiri tidak ditemukan datanya apakah turut mengucapkan selamat kepada Abu Bakar atau tidak. Meskipun data tentang Sa’ad ini tidak diketemukan namun sejarah tidak pernah mencatat jika Sa’ad melakukan oposisi kepada Abu Bakar. Adapun tokoh yang tidak memberikan ucapan selamat kepada Abu Bakar adalah Fathimah, tetapi sikap ini bukan karena bisikan politik atau benci kepada Abu Bakar akan tetapi lebih didominasi faktor perasaan yaitu masih dalam suasana berkabung. Oleh karena itu, membicarakan pengganti Rasulullah belum saatnya karena jenazahnya belum lagi disemayamkan. Ali bin Abi Thalib -pada awalnya- tidak ikut memberikan ucapan selamat kepada Abu Bakar kecuali setelah Fathimah wafat. Hal ini dilakukan oleh Ali hanya semata-mata menghormati perasaan Fathimah yang merasa tidak etis membicarakan pengganti Rasulullah. Pasca wafatnya Fathimah maka Ali turut memberikan ucapan selamat kepada Abu Bakar yang sudah terpilih menjadi khalifah. Prilaku politik yang ditunjukkan oleh para sahabat Nabi baik Umar maupun Ali mencerminkan bahwa kepentingan moral lebih mereka prioritaskan dari pada kepentingan politik. Sikap yang seperti ini muncul karena mereka memahami bahwa sosok Abu Bakar pantas menggantikan Rasulullah dan karenanya perlu didukung untuk mencapai tujuantujuan dari programnya. Tanpa memprioritaskan moral maka Umar memiliki kesempatan dan peluang emas untuk menggantikan Rasulullah karena posisinya sudah menjadi calon yang terkuat ketika itu. Adapun Abu Ubaydah -yang juga diusulkan oleh Abu Bakar- hanyalah sebatas pelengkap karena reputasi Umar jauh lebih populis bila dibanding dengan Abu Ubaydah. Kesempatan emas ini tidak dipergunakan oleh Umar karena melihat bahwa Abu Bakar adalah

sosok yang lebih pantas dari dirinya. Demikian juga halnya Ali bin Thalib, meskipun punya basis pendukung fanatik dari ahl al-bayt namun kesempatan ini tidak dipergunakannya. Kuat dugaan bahwa kesempatan ini tidak digunakan oleh Ali karena melihat sosok ketokohan Abu Bakar. Prilaku Umar dan Ali ini merupakan keteladanan yang sangat tinggi dalam budaya dan moral politik karena muncul dari seorang agamawan dan negarawan yang sejati. Bagi keduanya, kepemimpinan bukan merupakan kesempatan emas untuk memperkaya diri dan kehormatan akan tetapi merupakan amanah yang sangat memberatkan sehingga keduanya tidak berupaya untuk mendapatkannya. Pengakuan Umar dan Ali terhadap sosok Abu Bakar muncul secara bersama karena ketiganya menjunjung nilai-nilai sportipitas. Nilai-nilai sportipitas dimaksud adalah tidak menjadikan jabatan untuk memperkaya diri bahkan mereka miskin karenanya. Hal ini dapat dilihat dari kesederhanaan pola hidup Abu Bakar demikian juga Umar dan Ali padahal mereka punya peluang untuk melakukannya. Kebesaran jiwa Umar dan Ali dapat juga dilihat dengan kesungguhan mereka membantu Abu Bakar dalam menjalankan roda pemerintahan. Keduanya berperan aktif memberikan masukanmasukan kepada Abu Bakar dan bahkan mereka terlibat langsung dalam mengambil keputusan. Meskipun demikian, keduanya tidak segan-segan memberikan kritik jika yang mereka sampaikan adalah untuk kebaikan. Penutup Sikap para sahabat senior di atas sangat kontras dengan orangorang yang tidak mau mengakui kekalahan dirinya dan kemenangan orang lain dalam pemilihan pemimpin. Dengan demikian, tipe orang-orang yang seperti ini adalah merupakan gambaran dari sikap pengecut yang hanya siap menang dalam pertarungan tapi sama sekali tidak pernah siap untuk menerima kekalahan. � Penulis adalah dosen Fak. Tarbiyah IAIN-SU, pengurus elMisyka Circle dan anggota penulis tafsir Ulama Tiga Serangkai.

Syekh Nuruddin Al-Makky Kembali Bertausiah Di MUI

P

Dari Ibnu Mas’ud ra, Rasul SAW bersabda : Tiada boleh iri hati kecuali dalam dua perkara pertama: seseorang yang dikaruniakan harta oleh Allah lalu diberi kemampuan kepadanya untuk menghabiskannya pada jalan kebenaran, kedua : seseorang yang diberi ilnu kebijaksanaan oleh Allah lalu ia mengenalkannya dan mengajarkannya. (HR. Bukhari - Muslim).

ada prinsipnya iri hati (hasad) adalah sifat yang tercela yang dapatmerugikanpelakunyasendiri,karenadapatmendatangkankerusakan dari sisi agama dan kehidupan. Darisisiagama,irihatibeartimengingkari kepastian(ketentuan)dankeadilanAllah SWT yang telah memberikan nikmat kepada orang lainyang berhak. Darisisi kehidupan,irihatimenyebabkanpelakunya selalu merasa sakit karena melihat nikmatyangadapadaoranglaindengan melupakan nikmat yang diterimanya. Paraulamamembagiirihati(hasad) menjadi tiga tingkatan, Pertama : seseorang mengharapkan terlepasnya nikmatyangdiperolehoranglainseraya mengharapagarnikmattersebutberalih kepadanya.Kedua:seseorangmengharapkan terlepasnya nikmat dari orang lain walaupun ia tidak berharap memperolehnya. Ketiga : seseorang tidak mengharapkan hilangnya nikmat dari oranglaintetapiiatidakrelajikaterungguli darisegikeberuntungandankedudukan. Akan halnya kedatangan Syekh MuhammadNuruddinAl-Makkyyang kedua kalinya ke Sumatera Utara dan memberikantausiahdiberbagaitempat, diantaranya Majelis Ulama Indonesia (MUI) Sumatera Utara adalah suatu isyaratkecintaanparaustad-danpenggemarnya terhadap keluasan ilmu pengetahuanyangdimilikiolehbeliau.Hal itu nampak jelas dengan bertahannya para audiensselamaberjam-jambahkan ada yang tidak kebagian tempat duduk untuk menyimak, menimba ilmu pengetahuanyangmengalirtakputusnya bagaikan mata rantai yang merangkai satu sama lain. Semua itu dilakukan agar nikmat ilmuyangdimilikiolehSyekhNuruddin dapatberpindahkepadaaudiensmelalui prosesbelajar,sehinggakeunggulanyang adapadabeliaudapatpulamengaliratau beralih kepada ustad dan murid-muridnya di Sumatera Utara khususnya Medan.Praktekyangdilakukaniniadalah iri hati, yang dikecualikan oleh baginda Rasul SAW, karena iri hati terhadap seseorangyangdiajarkannyatidakmerusak agama dan kehidupan. Oleh sebab itu Rasul SAW membolehkannya. Diakui memang bahwa keluasan

Oleh H.M. Nasir, Lc, MA

ilmu yang diberikan Allah SWT kepada Syekh Nuruddin Al-Makky membuat kitatermotivasiuntukmenambahilmu pengetahuan,kedhabitandankelihaian beliaumemahaminash-nashQurandan hadis, ditambah lagi kelancarannya berbahasa Arab membuat kita seperti tidak punya apa-apa dibandingkan dengan ilmu beliau. Maha Benar Allah SWT yang telah berfirman : Wa fauqo kulli zi ilmin alim (di atas orang yang berilmu ada yang lebih berilmu lagi). (QS. Yusuf : ) Materiyangdibahasdidalammajelis yang terhormat itu adalah hal-hal yang sudah kita dengar dan dipelajari, seperti amalan-amalan Ramadhan, shalat Tarawih, shalat Qadha, Tasyrik anniyat (menggabungkan niat), shalatWitir dan masalah-masalah kontemporer yang sedang hangat dibicarakan seperti vaksin babi yang disuntikkan kepada jamaah haji dan umroh. Yang menarik dalam pertemuan tersebut adalah adab beliau terhadap majelisilmupengetahuandanpenghargaanyangtinggiterhadapilmuitusendiri, sehingga dalam tausiah yang sedang berlangsung jika ada suara yang dapat mengalihkan perhatian orang banyak seperti suara Handphone dan suara berisik, beliau tidak segan-segan menegur danmenyuruhkeluarorang-orangyang merasa ada keperluan di luar majelis itu. Kondisi seperti ini jarang ditemukan di majelis-majelis taklim di Medan ini, dimana adab-adab mejelis ilmu kurang

Daftar Khatib Shalat Jumat BATU BARA Jami’ Al Mukhlisin PT. Moeis Kel. Perk. Sipare-Pare Nurul Huda Desa Tanah Tinggi Kec. Air Putih Syuhada Sukaraja Desa Sukaraja Kec. Air Putih PEMATANG SIANTAR

S.M. Ruslan Sueb Ratno H. Nahar Syam

mendapat penghargaan, di saat ustad menyampaikan ilmu para jamaahnya tidak diarahkan untuk beradab kepada majelis tersebut, kerap kali kita melihat disaatmajelisilmusedangberlangsung terdengarsuaraberisik,suaraHandphone, bahkan makanan dan minuman ringan (mamiri) pun turut disajikan, sehingga ustad terlihat kaku jika tidak menyampaikan lawak-lawak segarnya untukmendapatperhatianjamaahnya. Tidak heran jika Syekh Nuruddin mempunyaisifathormatkepadamejelis ilmusepertiapayangdipaparkandiatas, karenabeliaumendapatkannyadariguruguru secara bertalaqqi di tanah haram sangat konservatif dengan moralitas. Hal menarik dari tausiah Syekh Nuruddin,beliautidakmentarjihpendapatpendapat ulama yang dipaparkannya terutama masalah shalat Tarawih. Pendapat tersebut mengalir dan berkembang, terserah pendapat mana yang maudiamalkan,denganmengutiphadis shahih : Man qama Ramadhana imanan wahtisaban ghufira lahu ma taqoddama min zanbihi (Siapa shalat malam dibulanRamadhankarenakeimanandan keikhlasan,diampunkandosadosanyayang telah lalu. (Muttafaqun ‘alaihi). Zaman Nabi SAW, meskipun Tarawihberjamaahsudahdilakukanpada waktu itu selama 2 malam Ramadhan dan pada malam ketiga Nabi SAW tidak datang lagi ke mesjid, dengan alasan dikhawatirkan shalatTarawih dianggap wajib oleh kaum muslimin, karena antusias para para sahabat meramaikan mesjid sampai memenuhi halaman mesjid.Namundemikianbilanganraka’at yangdilaksanakanolehNabitidakdiketahui.DisisilainSyekhNuruddinmenjelaskanbahwabilangan20raka’atTarawih bukan hanya dilaksanakan pada masa Khalifah Umar bin Khattab, akan tetapi sudah berlaku sebelum Khalifah Umar, bahkansudahberlakupadazamanRasul SAW.AdapunpengakuanAisyahrabahwa Nabi SAW tidak pernah lebih 11 raka’at melakukan shalat malam di bulan Ramadhan maupun di luar Ramadhan,

tidakdapatdijadikandalilshalatTarawih, tetapi apa yang dituturkan Aisyah ra adalah sebagai dalil pelaksanaan shalat Witir. Jika Aisyah ra tidak pernah melihat RasulSAWshalatmalamlebihdari11raka’at, tidak menolak kemungkinan bahwa Nabi SAW pernah melaksanakan shalat malam lebih dari 11 raka’at tanpa sepengetahuanAisyahra.Bandingannya AisyahratidakpernahmelihatRasulSAW buangaitkecilberdiri,tapididalamhadis Bukhori diriwayatkan bahwa Rasul SAW pernah buang air kecil di dekat tumpukan sampah dalam keadaan berdiri. Keterangan ini memperkuat bahwa ada kemungkinanRasulSAWmelaksanakan shalat malam Ramadhan lebih dari 11 raka’at. Kuat dugaan bahwa apa yang dilaksanakan oleh Umar bin Khattab mengumpulkan kaum muslimin shalat Tarawih berjamaah dengan jumlah 20 raka’at punya hubungan yang erat dengan apa yang dilakukan oleh Nabi SAW dan para sahabat. Olehsebabitutarawihyangdilakukan Khalifah Umar bin Khattab ketika itutidakmendapatbantahandarisiapapun,makashalatTarawih20raka’atsudah merupakanijma’sukuti.DengandemikiandapatditarjihbahwashalatTarawih itu20raka’atadalahpendapatyangterkuat, lagipulaTarawihadalahmerupakanciri khas Ramadhan. Sedangkan shalat malam11raka’at,diluarRamadhandan dalamRamadhanpundapatdikerjakan. Namun11raka’atdiluarRamadhantidak bolehdiniatkanTarawih.Yangmembuat penasaran penulis, Syekh Nuruddin tidak mentarjih pendapat mana yang terkuat, ditambah lagi memang moderator tidak mengarahkan majlis yang terhormatituuntukmentarjihsalahsatu pendapat yang berkembang dan lebih membuat meriahnya acara tersebut adalahkehadiran“Ahlisunnah”saudara ArifinSaktiSiregaryangbegitusemangat menyampaikan argumenargumen khasnya. Wallahua’lam. � Penulis adalah : - Pimp. Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batu Bara. - Pembantu Rektor IV Universitas Al Washliyah (UNIVA) Medan. - AnggotaKomisiFatwaMUIMedan.

Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba RANTAU PRAPAT Al-Qodar Jl. Torpisang Mata Atas D A I R I

Hisbullah Chan, S.Ag, S.Pd.I

Al-Muhajirin Perumnas Kalang Simbara Telaga Zam-zam Kecamatan Sidikalang

Alwin, S.Ag H.M. Thaher Nasution, SH

Drs. H. Sofyan Sauri, SH


16 MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Al-Ihsan Jl. Bromo Gg. Sukri No. 2 Kel. Tegal Sari II Al-Ikhwanul Wathan Jl. A.R. Hakim Gg. Langgar Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib Nol 15 Al-Makmur Jl. A.R. Hakim Gg. Langgar No. 25 Al-Misbah Jl. A.R. Hakim Gg. Langgar/Dame No. 27 Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Istiqlal Jl. Halat No. 53 Jamik Jl. M.A. Selatan No. 289 Kel. Surakamai-I Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Jami’ Darul Ikhlas Jl. Batu No. 13 Jami’ Taqwa Jl. A.R. Hakim Gg. Langgar No. 8A Khairiyah Jl. Rahmadsyah Gg. Subur 192 Muslimin Jl. Selam II No. 47 Muslimin Jl. Dr. Sun Yat Sen No. 71 Kota Matsum I Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Silaturrahim Jl. Emas No. 10 Silaturrahim Jl. Bromo Gg. Silaturrahim Kel. T.S. III Syekh Hasan Maksum Jl. Puri Gg. Madrasah Taqwa Jl. Bromo Gg. Taqwa No. 11 Taqwa Jl. Megawati Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No.240AR Taqwa Jl. Demak No. 3 Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8

Daftar Khatib Shalat Jumat Drs. Umar Khatib Ahmad Ridwan, BA Mahmuddin, BA Drs. H. Kamidin Selian Drs. H. Ahmad Halawani Drs. Abdul Razak Hasibuan Ruskhan Nawawi Drs. Badruddin Munthe, SH Drs. Basyiruzzaman Hasibuan Al-Zuheri Lubis, S.Ag Drs. H. Muslim Putra H.M. Hafiz Yazid, BA Drs. H. Azizi, A.M. H. Arief Muhammad, S.Pd.I Drs. H. Amrin Siregar DR. H. Agus Taher Nasution H.A. Rahman Sofyan, Lc,SE,MA Fery Al Banzari, S.Sos.I Muchlis Muaz, S.HI H.M. Silahuddin, S.Pd.I Drs. H. Zainal Abidin Zein Drs. H. Syahminan Hasibuan Drs. Alimuddin Syah H.M. Thohir Ritonga, Lc Drs. Samidi, M.Pd Irwan Syahputra, S.Ag, MA Drs. Efnedi Arief, MA Drs. Tagor Muda Lubis, MA Drs. Yunus Daulay

MEDAN AMPLAS Amaliyah Jl. K.H. Rivai Abdul Manaf Nasution No. 83 Drs. H.M. Idris Yusuf Al-Hidayah Mapolda SU Jl. S.M.Raja Km.10,5 No.60 H. Ngatman Azis, S.Ag, M.Pd Al-Hilal Asrama Widuri Eks Brigif 7 Jl. S.M. Raja Drs. Darussalam Hutabarat Al-Muhajirin Jl. Bajak II H Gg. Nasional No. 100-D Ahmad Ilyas, S.Ag Al-Waqif Jl. Sempurna Kel. Sudirejo I Drs. Sofyan Daulay Hijratur Ridho Jl. Selamat Ujung Gg. Subrah No. 12 H. Burhanuddin Nur, Lc Ikhwanul Muslimin Jl. Swadaya Lingk. XVI Marindal M. Sahlan, S.Ag Jami’ Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Drs. M. Thalib Harahap Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA Muhayan, SHI, S.Pd.I Nurul Islam Jl. M. Nawi Harahap Drs. H.A. Tausik Lubis Nurul Iman Jl. S.M. Raja Km. 09 Timbang Deli Drs. Ali Asri Nurul Barkah Jl. Selambo IV No. 29 Drs. M. Andres Nurun Nabatiyah Jl. S.M.Raja Komp.Kantor Kehutanan Drs. Badu Amin Nasution Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Mex Jainis Chan Salman Jl. STM. Kel. Sitirejo II Drs. Azwani Lubis, M.Ag Raya Taqwa Jl. S.M.Raja Km.5,5 No.1 Kel.Harjo Sari Drs. Asrizal Tanjung Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1 B Gunawan, S.Pd.I MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 Dr. H. Asren Nasution, MA Al-Amanah Komplek GKN Jl. P.Diponegoro No. 30-A H.M. Akhyar, Lc, MA Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Sakir Menik, S.Ag, S.Pd.I Al-Ikhlas Jl. Sei Padang No. 129 Hasnan, S.Ag Dakwah Jl. Dr. Hamzah No. 2 Kampus USU H.M. Hanafi Ismet, Lc, MA Prof.Dr.H.T. Hasballah Thaib,MA Muslimin Jl. Batang Serangan No. 93 Nurul Muslimin Jl. DR. TD. Pardede No. 42 Drs. Hayat Harahap Nurul Huda Jl. Djamin Ginting Km. 8 Kwala Bekala Kamidal Wirya, S.Ag Nurul Huda Jl. Sei Serayu No. 38 Drs. Affan Suaidy Nurul Huda Jl. K.H. Wahid Hasyim Asrama Brimob Drs. H.M. Selian Taqwa Kampus II Jl.Setia Budi No.79-B/Jl.Sei Serayu Prof. Dr. Hasyimsyah Nst., MA MEDAN BARAT At-Taqwa Jl. Puteri Hijau No. 14 Drs. H. Mustamir Al-Furqan Jl. Karya II Kompleks Ex Kowilham Kel.K.B. Drs. Nurman Al-Hasanah Inna Dharma Deli Jl. Balaikota Drs. H. Abidin Azhar Lubis Al-Istiqomah Jl. Putri Hijau No. 01 Komp. Deli Plaza Irwan Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Amal JP Pasaribu, S.Ag Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul H. Najib S. Lubis, Lc Al-Massawa (Arab) Jl. Temenggung (Arab) No. 2,4,6 Dedy Syahputra, M.Ag Baitus Syifa RS. Tembakau Deli PTP Nusantara-II Thamir Siregar, S.Pd.I Haji Maraset Jl. Sei Deli No. 139 H. Heri Adlin, Lc Jami’ Jl. Merdeka No. 3 Pulo Brayan Kota Drs. H.M. Ridwan Jami’ Jl. Kejaksaan Ujung H. Jamaluddin Juned, Lc Jami’ Ash-Shalihin Jl. S.M. Raja No. 178-A Drs. H. Azwardin Nasution Nurul Hidayah Jl. Danau Singkarak Gg.Masjid Lingk. I Drs. Labib Maulana Nurul Islam Jl. Karya Lk.VIII No. 203 Kel.K.Berombak Surianda Lubis, S.Ag Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan H. Choliluddin Muhid Rabithatul Muslimin Lingk. 14 Kel. Glugur Kota Drs. Ky. Ahmad Yani Syuhada Komp. Trikora Jl. Danau Toba No. 2 H. Perdana Indra, Lc, MA Taqwa Jl. Karya Gg. Madrasah No. 24 Drs. Mario Kasduri, MA MEDAN BELAWAN Al-’Aqabah Jl. Taman Makam Pahlawan G. Arang Mansyur, S. Jami’ Belawan Jl. Selebes Belawan Drs. M. Yusuf, AG MEDAN DELI Amalyatul Huda Jl. Nusa Indah No.22-A Kel.Tg.Mulia M. Syahri Ar-Ridho Komplek TNI AL Barakuda Tg. Mulia Hilir Sarman Ar-Rakid Jl. Kol. Laut Yos Sudarso Iqrar Anshori As-Sa’adah Jl. Aluminium IV Gg.Tawon Tg. Mulia Ahmad Thamrin, MA Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg.Mulia Rijal Sabri, M.Ag Al-Ikhlas Jl. Aluminium III Kel. Tg. Mulia Drs. H. As’ad Marlan, M.Ag Al-Ikhlas Complek Deli Raya Kel. Titi Papan Drs. Sayuddin Sagala Al-Munawwarah Jl. Pulau Batam No. 1 Syahruddin, S.Pd.I Al-Mustaqiem Kel. Tg. Mulia H. Parmohonan Nasution Al-Syarifah Jl. Metal Gg. Rukun Ling. 18 Tg. Mulia Edi Susanto Jamik Jl. K.L. Yos Sudarso Km. 6,2 Drs. H. Sangkot Saragih Jami’iyyatush Shoolihiin Jl. Almunium I Lk. XIII Waizul Qarni, MA Nurul Iman Jl.Sidomulyo Ujung Lingk. XXVI Tg.Mulia Radiaman S., S.Pd.I MEDAN DENAI ‘Arafah Jl. Boromo Ujung/Jl. Selamat Gg.Mulia No.3 Drs. H. Jahiruddin Nasution Ar-Ridha Jl. Camar 18 Perumnas Mandala M. Iqbal Siregar, SHI Al-Ansor Jl. Raya Tenggara Gg. Ansor H. Nazaruddin, Lc Al-Fajar Jl. Harapan Pasti No. 50 Kel. Binjai Drs. H. Nurman Almy Al-Hidayah Jl. Menteng Indah VI H Blok D7 Drs. H. Syahlan HR Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Drs. H. Amir Khatib Siregar Al-Hasanah Jl. Merpati I No. 1 Kel. Kenangan Baru Drs. Syawal Harahap Al-Mukhlishin Jl. Bromo Ujung/Jl.Selamat Kel. Binjai Drs. H. Indra Harahap Al-Mukhlishin Jl. Enggang I Perumnas Mandala Drs. Helmy Walid Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg.Kurnia Drs. H. Baharuddin Nst., Lc Al-Quba Jl. Denai/Rawa No. 233B Kel. Tegalsari I Drs. Ibnu Hajar Harahap Baiturrahman Jl. Medan Tenggara VII No. 42 M. Rusli Ismail, S.Ag Jannatul’alim Jl. Pancasila/Rawa Cangkuk IV No. 1 Rustam Efendi Hasibuan, S.Ag Nurul Iman Jl. Rawa Lr. Sedar Drs. H. Fandi Filham Lubis Nurul Hidayah Jl. Tangguk Bongkar II No. 28 Abdul Hamid Harahap, S.Ag Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Drs. Jamaluddin Taqwa Jl. Bromo Gg. Aman Drs. M. Zainuddin Taqwa Jl. Mandala By Pass No. 140 Drs. Adri, K. Taqwa Jl. Pancasila Gg. Masjid No. 1 Kel. T.S.M.III Rafdinal, S.Sos. M.AP MEDAN HELVETIA As-Syarifah Jl. Pembangunan Komp. Pondok Surya H.M. Yasin Hanafiah Attholibin Husni Jl. Veteran Gg. Utama Pasar 5 Drs. H. Ilyas Halim, M.Pd Al-Amal Jl. Banten Gg. Amal Dusun X Drs. A. Majid Syam Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Drs. Idris Ginting Al-Falah Jl. Palem Raya Perumnas Helvetia Drs. H. Marasonang Siregar Al-Furqoan Jl. Kemboja Raya No. 02 Perum Helvetia Thamrin Butar-butar, S.Ag Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Burhanuddin Harahap, S.Ag Al-Ikhlas Jl. Klambir Lima Gg. Bahagia Nasrun Al-Ikhlas Jl. Pembangunan Gg. Melati No. 16 Damri Tambunan, S.HI Al-Ikhlas Jl. Jongkong No. 1A Komp. Dolog H.M. Rokib Mas Al-Ikhlas Jl. Teratai II Blok 18 Perumnas Helvetia Drs. Abd. Hadi Hasibuan Al-Ishlah Jl. Kapten Muslim No. 54-A Drs. H. Ali Amnar Tambunan Al-Jihad Jl. Veteran Pasar 8 Helvetia Manunggal Drs. A. Mu’in Al-Mustaqim Jl. Kapten Muslim No. 226 Drs. H. Muchtar Baijuri Al-Mukhlisin Jl. Bakti Utara No. 21 Tg. Gusta Bustami, H.S. Al-Muhajirin Perumahan Bumi Asri Helvetia I DR. Achyar Zein, MA Al-Masturah Jl. Binjai Km 7,8/Jl. Sekolah No. 29 Drs. Mhd. Serawi Muhamzist Darussalam Jl. Asrama No. 11 Drs. Syaukani, M.Ag Istiqomah Jl. Amal Luhur No. 86 Drs. Abdul Wahab, K. Nurul Iman Jl. Bambu No. 37 Pasar IV Ahmad Rivai, SH Ubudiyah Jl. Klambir Lima Lingk II Tg. Gusta Drs. Amran Tanjung Shilaturrahmi Jl. Gaperta Gg. Sekolah, 120 H. Suhaidi, Lc Taqarrub Jl. Darussalam No. 24 Muhammad Shalihul Amri Taqwa Sukadono Jl. Pemasyarakatan Gg. M.Taqwa Syahrul, AS Taqwa Tanjung Gusta Jl. Setia No. 30 Asrizal Tanjung Taqwa Helvetia Jl. Kamboja Raya no. 319 Blok 4 Drs. H. Azhar Razak Lubis Taqwa Jl. Kapten Sumarsono, Gg. Safar M. Nasir, S.Ag Taqwa Jl. Kapten Muslim Gg. Jawa Drs. Matsyeh, M.G MEDAN JOHOR Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Fakhrurrozi, S.Pd.I Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Drs. Tuah Sirait Amaliyah Perumahan Citra Wisata M. Arifin Umar Assyafi’iyah Jl. Suka Tari No. 9 Drs. H. Hafiz Ismail Ar-Raudhah Komplek Risva I Blok V Fachruddin Rokan, S.Ag Ainul Iman Jl. Eka Warni I Kel. Gedung Johor M. Nasir Anshori, SHI Annazhirin Jl. Karyawisata Gedung Johor Drs. Ali Imron Rokan Al-Amin Jl. Eka Surya Gg. Eka Kencana Drs. H.M. Rusli, MR Al-Badar Jl. Karya Dharma No. 19 Kel. Pkl. Masyhur Drs. M. Thahir Al-Hidayah Jl. Karya Jaya Gedung Johor Drs. H. Khaidir Tanjung Al-Huda Jl. Eka Surya Psr V Gg. Sidodari Ged. Johor H. Muchtar Syarif Al-Ikhlas Jl. STM Suka Ikhlas H. Maulana Andi Surya, Lc, MA

Waspada/M.E. Ginting

Masjid Al-Muhajirin PTP Nusantara IV Jl. Letjend. Suprapto No. 2 Kecamatan Medan Maimun

Baiturrahman Komp Perum Johor Indah Permai I Drs. H. Arso, SH, M.Ag Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor Mhd. Yusuf Marpaung, SH Al-Ikhlas Jl. Karya Tani Lingk. VIII Pkl. Masyhur Drs. H. Hamid Mashudi Al-Issyah Hakim Jl. Karya Jaya/Namo Rambe Psr IV Drs. Yusuf Arhad Al-Muslimin Jl. Suka Luhur Kel. Suka Maju Drs. H. Ahmad Sofyan Al-Muhsinin Jl. Pintu Air Simp. Pos Ahmad Junaidi Al-Muharram Jl. Eka Budi Gedung Johor Alfan Abrar, S.Pd.I Al-Mahmudiyah Jl. Brigjen Hamid Km.5 Kel. T.Kuning Drs. Syarifuddin Sinda Baitul Iman Jl.Karya Jaya Asrama Arhanud P.Masyhur Drs. H. Syamsul Basri, T. Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur Drs. H. Burhanuddin Parinduri Baitussholihin Jl. Karya Bakti No. 71 DR. Hamdani Khalifah, MA Fajar Ramadhan Komplek Perum.Johor Indah Permai II H. Sugianto, Lc Muslimin Jl. Karya Jaya No. 120 Kel. Pkl. Masyhur Azman, SHI Muslimin Jl. Eka Surya Pasar V Drs. Alimuddin Siregar, SH Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Drs. H. Zahiruddin Nasution Namiroh Asrama Haji Embarkasi Medan Drs. H. Azhar Anwar Nurul Aldys Jl. Karya Bakti No. 34 Pkl. Masyhur Drs. Sariman Al Faruq Nurul Falah Jl. Eka Rasmi 42 Kel. Gedung Johor Drs. Alamsyah Ahmad Silaturahmi Jl. Brigjen Zein Hamid Ling. XVI G.Wakaf Syaifuddin Noor, S.Ag Sunnah Rabithah Jl. Karya Darma Pkl. Masyhur Mawardi MEDAN KOTA Al-Hidayah Jl. Saudara Kel. Sudirejo-II Drs. Zainal Arifin Gunawan, MP Al-Hasanah Jl. Tanjung Bunga II Kel.Sudirejo II Sakholid Nasution, MA Drs. H. Darwansyah Simanjuntak Al-Huda Jl. Kemiri III No. 28 Al-Ikhlas Jl. Salak No. 09 Drs. Sunaryo Al-Mashun Medan Deli Jl. Sisingamangaraja Prof. DR. H.M. Hatta Baiturrahim Jl. Pelajar Timur Gg. Darmo No. 5 Drs. Rahmad Nasrun Da’wah Jl. Sakti Lubis Gg. Amal No. 5 Kel. Sitirejo-I Drs. H.M. Basyir Yahya Muslimin Jl. Air Bersih Lingk. III Kel. Suderejo I Pamonoran Siregar, S.Pd.I Mua’llimin Jl. S.M. Raja Kp. Keluarga No. 33 H. Roni Syafrizal, Lc Prof.DR.H.Ramli Abd. Wahid,Lc,MA Ma’ul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 Islamiyah Jl. Jati 3 No. 85 Teladan Timur Drs. Sofyan Ahmad Jami’ Teladan Jl. Teladan/Gembira No. 2 Drs. H. Muniruddin, M.Ag Jamik Jl. Air Bersih Gg. I Kel. Sudirejo-I Drs. B. Amin Nasution Pahlawan Muslim Jl. Pencak H. Yusri Indrfa, Lc Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Drs. Hamzah Harahap, SH Raya Pusat Pasar H. Hasrat Efendi Samosir, S.Ag Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Drs. H. Darwis Nasution Setia Amal Jl. Sakti Lubis Gg. Pegawai Kel.Sitirejo H. Abd. Karim Rangkuti Taqwa Jl. Mahkamah K. 36-C Kel. Masjid Drs. Askolan Lubis, MA Tarbiyah Simpang Limun Drs. M. Yazid Syamsuddin, Lc Thawalib Jl. S.M. Raja Gg. Isa No. 7 Drs. Yabir MEDAN LABUHAN Ash-Shobirin Jl. Pancing V Lingk. III Kel. Besar Drs. Nurjaya Al-Husein Jl. Raya Griya Martubung Kel. Besar Zulkarnain Husein Al-Mukarramah Kampung Besar Darat Kel. Martubung Drs. M. Syafi’i, MS Baitul Ikhwan Jl. T. Lestari 12/198 Griya Martubung H. Irwansyah, SH Nurul Ikhwan Jl. Helvetia By Pass Gg. Masjid No.234 Nasrun Saragih, BA Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Drs. H. Azhari Tanjung Nurul Khairiyah Jl. Veteran Ujung Pasar X Drs. H.M. Fauzi MEDAN MAIMON ACC Jl. Palang Merah No. 2 Drs. H. Armiya Yusuf Abidin Jl. Brigjen Katamso Km.III No.420 Kel.Kp.Baru H. Darwis, Lc Al-Husna Jl. Teratai Musa Abdul Roni, S.Ag Al-Muhajirin Jl. Letjend. Suprapto No. 2 Drs. H. Ade Fifan Al-Mujtahidin Jl. Brigjen Zein Hamid Gg.Lori Kp.Baru Rahim M., S.Pd.I Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Drs. Rustam Harahap Jami’ Ash-Sholihin Jl. Brigjen Katamso No. 208 Drs. H. Anwar Sayuti Jami’ Kamp. Baru Medan Jl.Brigjen Katamso No.53 Drs. Marjan An Noor Jami’ ‘Aur Jl. Kampung Aur Kel. Aur Drs. Yahya Indra Muslimin Jl. Brigjen Katamso Lingk. II Pantai Burung Zulmorado Siregar PT.Bank Negara Indonesia (Persero) Jl. Pemuda No.12 Drs. Armyn Pane Thoyyibah Jl. Multatuli Lingk. V No. 64 Drs. H. Mansyur Aziz MEDAN MARELAN Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Drs. Yusril Fuad Ar-Ridha Jl. Platina Raya Lingk. 21 Kel. Rengas Pulau Hendra, S.Pd.I Taqwa Jl. Marelan Raya Pasar 3 Timur Drs. Hisyam Dalimunthe MEDAN PERJUANGAN Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 Drs. Munosip Siregar Al-Amin Jl. Prof. H.M. Yamin SH, 482 Prof. Basaruddin, MA Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Drs. H. Abusomah Pulungan Al-Falaah Jl. Ibrahim Umar No. 3 Drs. H.M. Yahya Zakaria Al-Huda Jl. Malaka No. 117 H.Sutan Syahrir Dalimunthe, S.Ag Al-Ikhlas Jl. Setia Jadi Gg. Masjid Drs. Zakaria Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 DR. Nawir Yuslim, MA Al-Muslimin Jl. Gerilya No. 1 Drs. H. Abdul Rahman Kasbi Al-Majidiyah Jl. Prof.H.M. Yamin SH Gg. Belimbing Jumanah, SE Hidayatul Ihsaniyah Jl. Sentosa lama Gg. Aman No. 5 Drs. H. Akhiruddin Muhid Istiqomah Jl. Bambu Runcing/Pahlawan Drs. H. Ade Fifan Ikhwaniyah Jl. M. Yacub No. 3 Drs. Lisman Lubis, SH, MH Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir-I Drs. Azhari Ibnu Sina RSU DR.Pirngadi Jl. Prof.H.M.Yamin No. 47 Drs. Fahmi Ahmad Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Drs. Ishak Ibrahim Jami’ Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Supriadi, S.Ag Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Drs. Saparuddin, MA Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan Drs. Sugiono Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Drs. H. Fahruddin Nasution MEDAN PETISAH Annas Komplek Diskes Jl. Ibus Raya/Jl. Rotan Drs. H. Ulumuddin Siraj Ar-Ridhwan Jl. Abd. Hamid No.28 Kel. S.P. Tengah Drs. H. Muhammad Yahya Zakaria As-Syahaadah Jl. Sikambing Belakang No. 18 Drg. Asfan Bahri Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Drs.H. Muchtar Effendi Lubis Al-Hidayah Jl. Periuk Gg. Masjid No. 2 H. Usman Lubis Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Drs. H. Sokon Saragih, M.Ag Al-Mukaram Jl. Sikambing Gg. Citarum No. 58 Drs. H. Marasalim Hasibuan Nurul Hidayah Jl. Tinta No. 69 Kel. Sei Putih Barat Ir. Bahrul Jamil, M.Si Nurul Haq Jl. Listrik No. 12 Drs. Bahron Nasution Istiqamah Pasar Petisah Drs. M. Syafii Nasution Istiqomah Jl. Abdul Hamid No. 70 Drs. Hasanul Arifin Raya Aceh Sepakat Jl. Mengkara No. 2 Prof. DR. H. Basyaruddin, MSc Ubudiyah Jl. Kebun Bunga/Jl. Jend. S. Parman Drs. M. Yamin Lubis MEDAN POLONIA Amaliyah Jl. Balai Desa Gg. Amal No. 43 Drs. Syamsuri Al-Hidayah Jl. Starban Kel. Sari Rejo Fatahillah, Sip Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel.Sari Rejo Kamal Ibrahim, SE H.M. Bambang Irawan, S.Ag Baitussalam Kosek Hanudnas III Bakti Jl. Mongonsidi Baru I No. 11 H. Harianto Efendy, BA Dirgantara Lanud Jl. Imam Bonjol No. 52 Drs. H. Hamdan Yazid Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Drs. Muntaqo Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo M. Syukur Dalimunthe Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D Drs. Nurdin Muhammad MEDAN SELAYANG Al-Arif Kompl. Tm.Setia Budi Indah II Blok III No.136 Drs. H. Khairuman Arsyad,M.Hum Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Mahfudz Al-Ghufron Jl. Suka Baru No. 21 Kel. P.Bulan Drs. Solihin Dalimunthe Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari A. Hasbullah, S.Ag Al-Ikhlas Pasar VII, P. Bulan Drs. Alimurdin Nasution Al-Muttaqin Jl. Setia Budi Gg. Tengah No. 11 Drs. H. Nasib Selmi Al-Muhtadun Jl. Karya Sembada No. 179 Drs. H. Kamaruddin Sagala Jami’ Jl. Psr I Lingk. VIII Tg. Sari Drs. H. Fahruddin, MA Muslimin Jl. Setia Budi Kel. Tg. Sari Saiful Asro, MA Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan Drs. Tarmidi Nurul Mukmin Jl. Bunga Mawar No. 46 H. Daud Yakub Nurul Mukminin Jl. Kenanga Raya No. 10 Tg. Sari Drs. Umar Hasibuan Nurussalam Jl. Bunga Cempaka No. 53 P.B.S. II Drs. Hasanul Arfin Nasution Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Dr. H. Ahmad Zuhri, Lc, MA Salamiyah Jl. Bunga Wijaya Kesuma, 58 D Pasar IV Sugito Kelana, S.Ag Taqwa Jl. Setia Budi Pasar I/Abd. Hakim No. 2 Drs. Agus Tahir Taqwa Jl. Bunga Wijaya Kesuma Psr IV Gg. M.Taqwa M. Yusuf Taqwa Jl. Sembada No. 25/33 Drs. Kayat

WASPADA Jumat 17 Juli 2009

MEDAN SUNGGAL Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Drs. H. Mukhtar Baijuri Ar-Ridha Jl. Darussalam No. 52-A Kel. Babura Drs. Amrin Yunus Ar-Ridha Jl. Tut Wuri Handayani Perkamp.Kodam I/BB Drs. Isman Rambe Al-Basyir Jl. Garuda No. 78B Sei Sikambing B Drs. H. Machmudin Sirait Al-Badar Jl. Binjai Km. 6,8 Medan Nazrial Amin, S.Ag Al-Falah Jl. Murni No. 27 Tg. Rejo Drs. H. Chairil Anwar Al-Hasanah Jl. Stasiun No. 4 Dusun I Tg. Gusta Mukhsin Nasution, S.Ag Al-Huda Jl. Perjuangan No. 44 Tg. Rejo H. Abd. Rahman Yakub Al-Hikmah Jl. Kiwi No. 7 Sei Sekambing B. Drs. H. Adhlan Rifai Sirait Al-Hafiiz Jl. Pinang Baris No. 142 Drs. Lisman Lubis Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Sariman, SPd. Al-Ikhwan Eks Komplek PTP III Desa Lalang Drs. Ahyaruddin Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Diski Drs. H. Nurba’in TH, Lc Al-Istiqomah Jl. Raya Medan-Binjai Km. 11,5 Dusun I Zulkarnaidi Shomad Al-Irma Jl. Rajawali Sei Sikambing-B Drs. Ramli Nasution Al-Jihad Jl. Sunggal No. 129 Drs. Mahyuddin Daulay Al-Jariah Jl. Gagak Hitam No.117 Sei Sikambing-B Falahuddin, S.Ag Al-Muttaqin Jl. Hanura No. 10 Kel. Tanjung Rejo Nur Azmi Hamyar Al-Muttaqin Jl. Masjid No. 51 Lingk. II Helvetia Drs. Juanda Sirait Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Edi Purnomo, S.Ag Al-Muhajirin Kompl. BBLKI Jl. Gatot Subroto Km.7,8 Drs. Ardiansah Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Drs. H. Romsil Harahap Al-Mu’awanah Jl. Puskesmas I/Jl. Seroja Drs. H. Azhar, AS Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Drs. Asman Ali Nur Harahap Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Drs. Tohiruddin Pohan Istiqomah Jl. Binjai Km. 7.2/Perwira No. 20 Zulmuradi Siregar, S.S. H. Sutan Syahrir Dlt., MA Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Isti’adah Jl. Amal No. 4 Kel. Sunggal Drs. Hakimuddin Jamik Jl. Pinang Baris No. 19 Kel. Lalang Dahlir Akbar, SE, HHC Jamik M.Jayak Jl. Gatot Subroto Km. 5,5 No. 184 Drs. H. Syaiful Aziz Lubis Mukhlisin Jl. Darussalam/ Sei Rokan Drs. H. Legimin Sukri Nurul Huda Jl. Garuda No. 29 Sei Sikambing-B Saiful Asro, MA Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B Drs. Adlan Rifai Sirait Nurul Amaliyah Jl. Jend. Gatot Subroto Km. 9 Khairul Anwar, MA Riyadussholihin Lingk. XIV Kel. Sei Sikambing-B Drs. Irham Hasibuan Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo DR. H. Amiur Nuruddin, MA Syuhada Jl. Balam Lingkungan XIII Sei Sikambing-B Drs. H. Haris Fadillah Silaturrahim Jl. Perintis Kemerdekaan D.SeiSemayang Drs. Hamdan Lubis Taqwa Jl. Merpati Gg. Mushollah Sei Sikambing-B M. Nurdin, S.Ag Taqwa Jl. Garuda Sei Sikambing-B Drs. Khaidir Sulaiman Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Drs. Khalidin Musa MEDAN TIMUR Amal Jl. Ngalengko Lr. Saudara No. 11 Drs. Syawaluddin Harahap Amal Ridha Jl. Cemara P. Brayan Bengkel Baru Drs. H.T. Yusuf Amaliyah Jl. Perwira II Pulo Brayan Bengkel Drs. Ali Mulkan Arrahim Jl. Purwosari Gg.Puskesmas P.Brayan Bengkel K.H. Moh. Abd. Syukur Ash-Sholah Jl. Pendidikan No. 39 Kel. Glugur Darat I Drs. Ahmad Dairabi Butar-butar Al-A’la Jl. Pembangunan I No.46 Krakatau Kel.Glugur Dr. Hasanuddin, S.Ag Al-Barkah Jl. Setia Jadi Kel.Glugur Barat I Drs. Darfikri Al-Furqoan Jl. Asahan No. 78 Kel. Sidodadi Drs. H. Bayanuddin Harahap Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Drs. Sudirman Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.B. Drs. Hamdan Manurung Al-Ikhwan Jl. Prajurit No. 28 Gg.Bali Kel.Glugur Darat Drs. Maghribi Al-Ihsan Jl. Jemadi No. 34 Sarman, S.Ag Al-Ikhlas Hubdam-I/BB Jl. Timor No. 23 Drs. H. Abd. Halim Siregar, MA Al-Ikhlas Jl. Umar No. 71 Kel. Glugur Darat I Drs. Syahrinal Azhar Lubis Al-Ikhlash Jl. Madiosantoso No. 197 Lingk. 14 Drs. Sofyan, MS Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Syarwan Nasution, S.Ag Al-Mukhlishin Jl. G.B. Josua No. 8 Ibrahim Lubis Al-Ma’ruf Jl. Sidorukun/Wartawan No.99 P.B.Darat II Drs. H.M. Yusuf Said, MA Al-Waritsiin Jl. Bilal No. 71 Kel.Pulo Brayan Darat I Drs. H. Abdurrahman Al-Quddus Jl. Pukat Harimau d/h Jl. Aksara No. 136 H.A. Rajab Siregar Baiturrahman Jl. Gaharu Komplek PTPN-II H. Muhammadin Angkasa, Lc Bustanul Huda Jl. Perwira I Lingk. VIII Drs. M. Labib Maulana Daarul Ma’arif Jl. Damar Raya No. 8 Sidorukun H.M. Hasyim Muttaqin Jl. Pasar III No. 40 Glugur Darat I Drs. Juliardi Nurul Yaqin Jl. Bukit Barisan I No. 74 Sugianto, SHI, S.Pd.I Nur Chadidjah Komp.Wartawan Jl. Letter Press No.51 Marhamin Tanjung, S.Ag Syuhada Jl. Budi Pengabdian No. 03 P. Brayan Damril Pasaribu, S.Pd.I Taqwa Jl. Sutomo Ujung Gg. A No. 47 Kel. Durian Drs. H. Muslim Wahid Siregar Taqwa Kampus UMSU III Jl. Kapt.Mukhtar Basri No.3 Drs. H. Sarwo Edi Taqwa Jl. Rakyat/Lr. Maninjau No.6 Sidorame Timur Faisal Lubis Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.B. Darat II Drs. H. Suprapto Taqwa Jl. Pelita II No. 3/5 Sidorame Barat Drs. Satiman Taqwa Jl. Mustafa No. 1 Glugur No. 1 Kp. Dadap Prof. DR. A.Y. Matondang, MA Taqwa Ubudiyah Jl. Bambu III Kel. Durian DR. Faisa Ananda, MA MEDAN TEMBUNG Akbar Baitus Sujud Jl. Metrologi Raya Gg.Karya No.1 Drs. Isa Anshori Ar-Ridho Jl.Tuasan Gg.Sukun No.10 Kel.Sidorejo Hilir Jumiran Abdi, S.Ag Ar-Ramli Jl. Sidorukun Ujung/Jl. Surya Lingk. XII Drs. Zakaria Batu Bara Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel.Bantan Fahmi Hts, S.Pd.I At-Tawwabin Jl. Pimpinan No. 1 Drs. D. Syamsul Rizal Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih H. Pangulu Abd. Karim, Lc, MA Al-Falah Jl. Pukat Banting IV No. 10 Haryono Fahmi, S.Ag Al-Hidayah Jl. Letda Sujono No. 62 Kel. Bdr. Selamat Drs. H. Effendi Batu Bara Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5B Drs. T. Syarifuddin Al-Huda Jl. Tuasam Gg. Aman Suheri, S.Ag Al-Ikhlas Lingkungan II Kel. Bandar Selamat Drs. H.M. Yahya Zakaria Al-Ikhlash Jl. Pukat V Kel. Bantan Timur Muktaruddin, M.Ag Al-Istiqomah Komplek Veteran Medan Estate Drs. H.M. Fahmi El Fuad Al-Ijtima’iyah Jl. Letda Sujono No. 152 Nazaruddin Nasution Al-Muhajirin Jl. Garuda II Kel. Kenangan Baru Drs. Ahmad Syukran Al-Muslimun Jl. Pertiwi No.94 Drs. Anwar Nasution Al-Muqorrobin Jl. Pukat II No. 52 Bantan Timur H. Ali Sati Nasution, Lc Al-Muhtadin Jl. Bantam No. 15-A Lingk. III Syahrilluddin, S.Pd.I Baiturrahman Jl. Willem Iskandar Psr V Medan Estate Drs. H.T. Baharuddin Siregar Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Amir Shaleh Nasution Ikhwaniah Jl. Tuamang No. 47 Kel. Sidorejo Hilir Drs. H. Ismail Hasyim, MA Jami’ Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo H. Fahrurrozi, Pulungan, SE Nurul Iman Jl. Pertiwi Ujung Kel. Bantan Ihsan Asri Raya Muslimin Jl. Pukat I No. 9 Kel. Bantan Timur Drs. H. Burhanuddin Nasution Ubudiyah Jl. Mandala By Pass No. 110 Dahler Efendi Hasibuan, S.Ag Ulul Albab Jl. IAIN No. 1 IAIN-Sumatera Utara Dr. H. Hasan Mansur Nst., MA Taqwa Jl. Belat No. 76B Shodikin S.Ag Taqwa Jl. Tangkul II No. 128-A Drs. Suprapto Taqwa Jl. Enggang Raya No. 85 Junaidi, S.Pd.I, MSi Taqwa Jl. Kolam No. 01 Kampus I Medan Estate Dr. H. Ahmad Zuhri, MA MEDAN TUNTUNGAN Ar-Rahman Griya Nusa Tiga Lingk. 03 Tg. Selamat Khairul Fatah, SH Al-Amin Jl. Pala Raya Perumnas Simalingkar Prof. dr. H. Achmad Effendi Al-Hasanah Jl. Teh 10 Perumnas Simalingkar H.M. Qosim, Lc Al-Ikhlash Jl. Nilam 11 No. 1 Perumnas Simalingkar Drs. H. Aminullah Simandjuntak Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Drs. Ali Imron Nasution Al-Muhtadin Jl. Kemiri Raya I No. 1 Blok-G Mukhtar, S.Pd.I Al-Muhajirin Jl. Kopi Raya II Blok A Drs. Rosyidin Bina Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat M. Nurdin Nasution S., Pdi Iklab Jl. Letjend. Jamin Ginting Km. 12,5 No. 100 Arwansyah Dalimunthe, S.Ag Baitul Rahman Jl. Rami II Simalingkar Aminuddin, SH, S.Pd.I Nurul Hayat Kel. Kemenangan Tani Drs. Nazaruddin Siregar Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Dasuki Aljawawi Silaturrahim Jl. Kapas 13 No. 49 Perum. Simalingkar Drs. Asril Arifin Taqwa Jl. Sawit Raya Perumnas Simalingkar Drs. Ma’ruf Lubis DELI SERDANG Amal Islamiyah Kel. Lubuk Pakam Pekan Suwito, S.Pd.I Ainul Yaqin Jl. Pembangunan IV No. 30 Drs. Aidil Mawar Nst., S.Ag Al-Furqon Perumahan Bumi Tuntungan Sejahtera DSC Ahdar Muslim, S.Pd.I Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Drs. Slamet Hamzah, S.Pd.I Al-Hafiz Desa Hamparan Perak Kec. Hamparan Perak H. Zulkarnain Al-Iskhlas (YAMP) Komp. Perkant. Pemkab L. Pakam Ali Ahmad Harahap, SH Al-Muttaqin Jl. S.M.Raja Km.12 Gg.Rasmi T.Morawa Awaluddin, Spd. SS Al-Muttaqien Gg. Kolam Deli Tua A.Fuad Sinaga, SHI Baiturrahman Jl. Merica Raya Blok F Kec.Pancur Batu Drs. A. Ghazaly Lubis, BA Baitussalam Dagang Kerawan-Tg. Morawa H. Mudawali, S.Pd.I Baitul Mukmin Jl. Medan-Binjai Km.15,5 Kec.Sunggal Drs. Mohd. Yusuf AR Jami’ Jl. Pantai Labu Dusun Masjid Desa Beringin Risan, S.Pd.I Jami’ Asysyakirin Delitua Jl. Medan-Delitua Km.11,5 Drs. Basyaruddin Lubis Jami’ Jl. Irian No. 79 Kel. Pekan Tanjung Morawa H. Akhiruddin, Lc Khairul Fatihin Dusun II Tg. Morawa-A Ibnu Ali, AS Nurul Ikhwan Jl. H.A. Dahlan No. 38 Muslim Nursa’adah Jl. Medan-Tg. Morawa, Km. 12 Drs. Ismail Yahya Raya Lubuk Pakam Jl. T. Raja Muda No. 26 Usman Al-Fatah, S.Ag Taqwa Jl. Diponegoro No. 1 Lubuk Pakam Drs. H. Munawar Kholil TEBING TINGGI Amal Muslimin Kampung Rao Suyetno Ash-Sholihin Jl. Badak Lingk. I Kel. Bandar Utama Mahyudin Ry An-Namirah Perum.Griya Prima Ling.II Kel.Tg.Marulak Drs. Hidayatullah Al-Falah Jl. Ksatria Kodim-0204/DS H.M. Syamsi Al-Falah Jl. Ir. H. Juanda Lingk. I Kel. Karya Jaya Fahri Syam Al-Hidayah Kel.Tg.Marulak Hilir Lingk.03 (Kp.Keling) Darwin Purba Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Salaman Rasyidi, SE, MA Al-Hasanah Jl. Kartini No. 16-A Drs. H.M. Ghazali Saragih Al-Mukhlis Jl. A. Yani/Sakti Lubis H. Bainuddin Harun, BA Al-Muthmainnah Lingk. I Kel. D.Sundoro H. Wijaya, D. Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung M. Ilyas, S.Ag Al-Musyawarah Jl. Abd. Rahim Lubis No. 48 A Sofyan Mansur, A.Ma Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir A. Yasin De Frasong Darul Jannah Jl. Bhakti LKMD Lingk. I Kel. Lalang Drs. Burhan Faisal Farida Jl. H. Ahmad Bilal Kel. Damar Sari Mhd. Syafi’i, S.Ag Jami’ Jl. Batu Bara Kel. Satria Zulkarnain, S.Ag Nurul Hidayah Jl. G.Martimbang II Kel. Rantau Laban Parlin Syuhada Jl. Iskandar Muda No. 70 Drs. A. Yasir Nainggolan Taqwa Jl. Prof. H.M.Yamin Kel. Sri Padang Kp.Keling Bustami


Sumatera Utara

WASPADA Jumat 17 Juli 2009

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:33 12:46 12:34 12:41 12:40 12:37 12:34 12:29 12:36

‘Ashar 15:58 16:11 15:59 16:06 16:06 16:02 15:59 15:55 16:01

Magrib 18:43 18:59 18:44 18:53 18:52 18:44 18:43 18:38 18:46

‘Isya

Imsak

Shubuh Syuruq

Kota

19:57 20:14 19:58 20:08 20:06 19:57 19:57 19:52 20:00

04:51 05:00 04:51 04:56 04:56 04:59 04:52 04:48 04:54

05:01 05:10 05:01 05:06 05:06 05:09 04:52 04:58 05:04

Langsa 12:36 L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan12:31 P. Siantar 12:31 Balige 12:31 R. Prapat 12:28

06:21 06:31 06:22 06:26 06:27 06:29 06:23 06:18 06:25

Zhuhur ‘Ashar 16:01 16:04 15:57 15:57 16:08 15:56 15:57 15:57 15:53

17

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:47 18:52 18:42 18:42 18:54 18:37 18:40 18:39 18:36

20:01 20:06 19:56 19:55 20:08 19:51 19:54 19:53 19:49

04:52 04:54 04:50 04:49 05:00 04:52 04:50 04:51 04:49

05:02 05:04 05:00 04:59 05:10 05:02 05:00 05:01 04:59

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:46 12:33 12:32 12:34 12:44 12:37 12:34 12:40 12:29 12:39

19:00 18:40 18:40 18:43 18:44 18:44 18:44 18:52 18:38 18:48

20:14 19:53 19:53 19:56 19:58 19:58 19:57 20:06 19:51 20:02

05:00 04:54 04:53 04:53 04:57 04:57 04:51 04:56 04:48 04:57

05:10 05:04 05:03 05:03 05:07 05:07 05:01 05:06 04:58 05:07

Tarutung 12:32 T.Tinggi 12:31 Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:30 Parapat 12:32 GunungTua 12:29 Sibuhuan 12:29 Lhoksukon 12:38

06:22 06:25 06:20 06:19 06:30 06:22 06:21 06:22 06:19

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

16:11 15:58 15:58 15:59 16:02 16:02 15:59 16:05 15:54 16:04

06:31 06:24 06:24 06:23 06:27 06:27 06:22 06:27 06:18 06:28

Zhuhur ‘Ashar 15:57 15:56 15:54 16:01 15:59 15:55 15:57 15:54 15:54 16:04

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:39 18:41 18:35 18:42 18:43 18:39 18:40 18:36 18:35 18:51

19:53 19:54 19:48 19:55 19:56 19:53 19:54 19:49 19:48 20:05

04:52 04:49 04:52 04:59 04:54 04:48 04:51 04:51 04:51 04:54

05:02 04:59 05:02 05:09 05:04 04:58 05:01 05:01 05:01 05:04

06:23 06:20 06:22 06:29 06:24 06:19 06:21 06:21 06:21 06:24

Melayu Pesisir Harus Bangkit Gubsu Resmikan SMP Ar-Rahman Percut PERCUT SEITUAN (Waspada) : Masyarakat pesisir Melayu diajak untuk terus bangkit. Warga Melayu juga diingatkan untuk bisa melawan pameo masyarakat Melayu pemalas, pengantuk dan lainnya.

Waspada/dede

TANDATANGAN: Gubernur Sumatera Utara H Syamsul Arifin mendatangani prasasti Perguruan SMP Ar Rahman disaksikan Ketua Yayasan Hajjah Rachmah Nasution Abdul Manan Muis, Direktur Pembinaan SMP Direktorat Jenderal Manajemen Pendidikan Dasar dan Menengah Depdikans RI Didi Suhardi, SH.MSi, Kadis Pendidikan Provsu Bahrumsyah dan Kadis Pendidikan, Pemuda dan Olah Raga Kab. Deli Serdang Sofian Marpaung, Kamis (16/7).

Bupati Langkat Ultimatum Peternak Babi 7 x 24 Jam STABAT (Waspada): Dalam rapat lanjutan membahas keberadaan lokasi ternak babi ilegal di kawasan ibukota kabupaten yang sejak beberapa tahun terakhir menjadikan masyarakat resah, akhirnya Bupati Langkat Ngogesa Sitepu (foto) mengultimatum peternak untuk mengosongkan kandang dan memindahkan peliharaan mereka 7 x 24 jam. Jika dalam kurun waktu itu peternak masih mengabaikannya, Pemkab Langkat akan mengeksekusi. ‘’Saya tegas menindak,’’ ujar Bupati kepada Waspada usai rapat berlangsung di ruang kerjanya, Kamis (16/7). Dijelaskan, langkah penggusuran semata-mata demi menegakkan Perda Tata Ruang Ibukota, sebab keringanan waktu 30 hari yang diberikan Pemkab sebelumnya tidak ditanggapi. Selain itu mengacu Perda No 13 tahun 2005, wilayah ibukota kabupaten bukan merupakan zona peternakan (usaha besar/ komunitas). Selain itu izin peternakan babi juga tidak pernah dikeluarkan sebagaimana mengacu Keputusan Menteri Pertanian No. 402/KPTS/2002 tentang pedoman perizinan dan pendaftaran usaha peternakan. Dalam keputusan itu dijelaskan untuk ternak babi diwajibkan mendaftarkan usahanya jika populasinya mencapai 20 - 125 ekor dan wajib mengurus izin jika populasinya diatas 125 ekor. Sedangkan lokasi ternak yang kini akan digusur, karena sudah ada lokasi legal di kawasan Kec. Sei Bingai. Peserta rapat diantaranyaWakil Bupati Budiono, Kapolres AKBP Dodi, Dandim 0203/Lkt Letkol A Dimyati, mewakili pihak Kejaksaan dan Pengadilan Negeri serta aparatur tim gusur terdiri dari

Asisten Ekbangsos Amir Hamzah, Kadis Peternakan M Tambeng, Kakan Satpol PP Edi Syahputra dan Camat Stabat Rudi Kinandung. Musyawarah memang tertutup untuk wartawan, namun sejumlah peserta rapat ketika dimintai tanggapannya merasa gembira dan salut dengan ketegasan Bupati yang mengatakan tetap akan menggusur lokasi demi menuntaskan masalah dan penegakkan peraturan, meskipun dalam rapat ada semacam perbedaan pendapat agar lokasi itu tidak jadi digusur. Namun Bupati tetap tegas akan meng-

gusur. Selain itu ditambahkan Asisten Ekbangsos, Pemkab Langkat secepatnya mengantarkan surat kepada 37 peternak babi yang terdata di Kel. Perdamaian, Kec. Stabat prihal hasil rapat. Hal itu untuk menghindari alasan peternak yang kemungkinan berdalih tidak mengetahui ultimatum. Secara terpisah Kakan Satpol-PP Langkat Edi Syahputra juga mengaku siap mengeksekusi setelah adanya ultimatum Bupati. ‘’Personil telah standby dan menyiapkan segala sesuatunya,’’ kata Edi. Sementara Kadis Peternakan M Tambeng bersama jajarannya kini sedang menyiapkan lokasi penampungan hewan sementara menyusul eksekusi puluhan kandang. ‘’Lokasi penampungan telah ada, tim sedang menyiapkannya,’’ kata Kadis yang enggan menyebut lokasi dimaksud. Saat rapat anggota DPRD Langkat Kirana S berkomentar langkah penggusuran yang ditempuh sangat tepat, sebab hal itu menyangkut kewibawaan Pemkab dan DPRD dalam mengawal Perda yang telah ditetapkan. (a38)

Tanpa Etika Takkan Ada PNS Profesional TEBING TINGGI (Waspada): Pegawai Negeri Sipil Yang profesional harus mengedepankan etika dalam melaksanakan tugasnya. Karena tanpa etika seorangPNStakkanbisadikatakansebagaiprofesional. Itu sebabnya PNS juga memiliki kode etik yang berlaku dalam pekerjaan mereka. Mantan Kepala Balai Latihan dan Kependidikan Prov. Sumatera Utara Umar Zunaidi Hasibuan, Kamis (16/7), mengatakan hal itu, saat menjadi pembicara diacara“SarasehanSehari“PNSProfesionalTingkatkan Pelayanan Publik,” yang dilaksanakan Bagian Humas dan Protokoler PemkoTebingTinggi. Acara itu, merupakan rangkaian kegiatan Memperingati Hari Jadi Kota Tebing Tinggi Ke 92. Turut sebagai pembicara H. Asren Nasution, Kapendam I/BB. Dikatakan, selain etika yang harus dimiliki PNS, profesionalitas juga diukur dari capaian keberhasilan yang dilakukan dengan keilmuan yang ada, demikian juga sebaliknya. Atas dasar capaian keberhasilan itu pula PNS berhak mendapatkan gaji dari hasil kinerjanya. Selain itu, berdasarkan PP No.42/2004 Pasal 6, PNS memiliki nilai-nilai dasar yang harus dijunjung tinggi, meliputi takwa pada ThanYME, setia dan taat padaPancasiladanUUD1945,semangatnasionalisme, mengutamakan kepentingan Negara di atas kepentingan pribadi. Kemudian, taat pada hukum dan perundang-undangan, hormat pada HAM, professional, netral, bermoral tinggi dan semangat jiwa korps. Kapendam I/BB Asren Nasution yang tampil sebagai pembicara kedua, menyoroti persoalan lemahnya sumber daya manusia Indonesia. Ada 10 macam kelemahan SDM Indonesia, yakni memandang kerja sebagai beban. Malas, ogah-ogahan dan cari 10001 alasan mangkir. Bekerja harus diawasi dan dimandori, produktif kalau dipaksa. Minat pada upah dan libur semata, hubungan kerja bersifat antagoni,banyaktuntutan,disiplinrendah,prodktifitas

rendah dan kualitas kerja rendah. Untuk menghilangkan kelemahan itu, Asren memberiresepberupa,pembinaankecerdasanqalbu, kecerdasan akal dan kecerdasan nafsu. Ketiga itu, terwujud dalam motivasi, kearifan dan kontrol transedental. Kemudian, perencanaan, metodologi, teknis, terampil, mahir dan ahli. Demikian pula dengan kontrol dan kehandalan serta kematangan pribadi. Kegiatan itu dihadiriWalikota, Sekdako dan jajaran pimpinan SKPD sekira 200 orang, diselingi dengan humor segar oleh pembicara. Tidak Kompeten Sementara itu, acara yang digawangi Bagian Humas dan Protokel itu, ternyata mendapat penilaian miring anggota DPRD Kota Tebing Tinggi. Ketua Komisi II Pahala Sitorus, menilai acara itu tidak kompeten. Pasalnya, kata dia, ada dua hal yang telah dilanggar Bagian Humas dan Protokoler, yakni penyelenggara acara dan kapasitas pembicara dalam kegiatan itu. Dikatakan, jika kegiatan itu menyangkut peningkatan kapasitas PNS, semestinya Badan Kepegawaian Daerah yang layak sebagai penyelenggara dan bukan Bagian Humas dan Protokoler. “Saya sampai buka buku APBD ada tidak anggaran di Humas untuk kegiatan itu, ternyata tak ada,” ungkap Pahala. Dari anggaran Humas Rp592 juta tidak ada mata anggaran untuk kegiatan itu, sehingga tak jelas sumber pendanaannya, kata dia. Demikian juga dengan pembicara, semestinya dari Kementerian Pemberdayaan Aparatur Negara atau paling tidak dari BKD provinsi. Hal itu dibantah Kabag Humas dan Protokoler Khairil Anwar. Dia, mengatakan pembicara sudah sesuai dengan kapasitasnya, karena Umar Zunaidi Hasibuan merupakan mantan Ka. Diklat Provsu. “Jadi kapasitas beliau sebagai pembicara, jelas ada,” tegas Anwar. Namun Anwar tidak menyinggung soal dari mana asal dana yang digunakan untuk kegiatan itu. (a08)

Pengawas Internal PD Pembangunan Binjai Bingung BINJAI (Waspada): Pengawas internal PD PembangunanBinjaibingungdengansistemkeuangan PD Pembangunan. Keterangan dari staf pengawas internal PD Pembangunan Binjai, Kamis (16/7) menyebutkan, mekanisme PD Pembangunan pengawas dilakukan dengan Sistem Pengawas Internal (SPI) yang dipimpin Amrin. Ternyata Amrin selaku pimpinan SPI bingung dengan pembukuan PD Pembangunan, sebab tidak punya buku catatan pemasukan dan pengeluaran yang otentik. Pemko Binjai sejak 2006 sudah memberikan modal secara bertahap melalui APBD mencapaiRp19,6miliar.Namuntidakjelaspenggunaannya. Anggota DPRD Binjai sudah berulang ketika pemandangan umum meminta hasil audit PD Pembangunan tidak pernah diberikan. Seperti dijelaskan Daniel Sitepu Kamis, anggaran PD Pembangunan tahun 2009 ketika APBD disahkan hanya Rp1,5

Mternyata bisa berubah menjadi Rp4,5 M. Sekretaris Lembaga Sosial masyarakat (LSM) Penyelamatan Harta Negara Kota Binjai T.Dahlan menyebutkan, BPK, BPKP dan Inspektur Pemko Binjai harus mengaudit keuangan PD Pembangunan Binjai. Menurut Dahlan, dana Rp.19,6 M yang dikeluarkan Pemko Binjai tidak sebanding dengan aset yang ada. Dahlan menyebutkan, usaha PD pembangunan unit perumahan di Payarobah jelas bukan aset PD pembangunan, sebab kredit perumahan bekerja sama dengan BTN Medan. Berarti tanah perumahan sudah dibayar pemilik rumah melalui kredit BTN Medan.Sementara nasib pendirian Bank Syariah Muamalat juga belum terealisasi. Direktur Keuangan dan Umum PD PembangunanBinjaiHeruRamadhanmengakuiizinoperasional bank belum diperoleh dari Bank Indonesia. Heru menyebutkan izin pabrik air mineral sudah selesai, dan siap dipasarkan. (a03)

“Saya pun mendapatkan jabatan gubernur, bukan diberikan orang begitu saja tapi berawal dari ditendang orang di tengah lapangan dan kerja keras,” tutur Gubernur Sumatera Utara H Syamsul Arifin saat meresmikan gedung SMPArRahmandiDesaPercutSeiTuan, Kab. Deli Serdang, Kamis (16/7). Gubernur Sumatera Utara yang baru memperoleh Gelar Dato’Seri dari Negeri Pulau Pinang, Malaysia itu didampingi Direktur Pembinaan SMP Direktorat Jenderal Manajemen Pendidikan Dasar dan Menengah Depdiknas RI Didi Suhardi, SH, MSi. Hadir Kadis

Pendidikan Provsu Bahrumsyah, Bupati Deli Serdang diwakili Kepala Dinas Pendidikan, Pemuda dan Olahraga SofianMarpaung,CamatPercutSeiTuan beserta unsur Muspika lainnya dan para undangan. Gubsu menyatakan, kehadiran Perguruan Ar-Rahman ini merupakan cikal bakal dari kebangkitan kembali masyarakat pesisir Melayu. Pria yang bergelar Datuk Sri Lelawangsa Hidayatullah itu menilai, dapat dibayangkan di tengah-tengah kemiskinan dan kesunyian di daerah pesisir ini sudah ada sekolah baik. Banyak orang kaya di Indonesia belum mampu membangun dunia pendidikan seperti yang dilakukan Abdul Manan Muis ini. Sementarabanyakrakyataslitidakberbuat apa-apa hanya sibuk dengan berbicara Budhanisasi,Kristenisasi,sementarakita lupa mengislamisasi daerah kita sendiri. Untuk itu, Gubsu berfirasat dengan kehadiran Perguruan Ar Rahman ini menjadi kebangkitan masyarakat MelayudiSumateraUtara.“Marijadikan sekolah ini sebagai tempat pendidikan berbasis Islam dan saya akan berbicara kepada Kepala Dinas Pariwisata supaya daerah pesisir ini harus dijadikan cagar

budaya,” cetusnya. Ketua Yayasan Hajjah Rachmah Nasution dalam sambutannya mengucapkanterimakasihkepadaGubsuyang meresmikan gedung SMP Ar-Rahman. ‘’Kehadiran bapak kami rasakan sebagai motivasi yang luar biasa untuk terus mengabdikan diri dalam bidang pendidikan guna mencerdaskan generasi muda,’’ terangnya. Abdul Manan Muis menilai, kepedulianGubsuterhadapduniapendidikan sangat luar biasa. Untuk itu dalam kesempatan ini kami menyatakan akan berada dalam barisan terdepan untuk menyukseskan visi dan misi Gubsu yakni, rakyat tidak bodoh dan dakyat tidak lapar. “Pembangunan SMP Ar-Rahman Percut ini adalah satu wujud upaya kami mendukungvisidanmisiitudalambidang pendidikan,” terangnya lagi. Lebih lanjut Manan menyatakan, memang secara fisik pembangunan SMP Ar Rahman Percut sudah rampung 100 persen.Namununtukmembangunsekolahyangberkualitastidakadakatarampung 100 persen, tentu selalu ada kekurangan. Hal itu tentu menjadi cambuk bagi kami untuk terus menyempurnakan fasilitas ini agar menjadi sebuah sekolah

yang berkualitas. “Kami berharap dengan diresmikannya gedung ini dapat memicu perkembangan dunia pendidikan di Kab. Deli Serdang, khususnya Kecamatan Percut Sei Tuan,” sebutnya lagi. Sebagai putra daerah, Manan mengaku berkewajiban membantu pemerintah membangun sumber daya manusia berkualitas di tanah kelahirannya. ‘’Kita harus memberikan pemahaman kepada masyarakat Desa Percut, hanya dengan SDM yang berkualitaslah daerah Percut ini bisa maju dan berkembang sesuai denagn perkembangan zaman,” katanya. Dalam kesempatan itu, Gubsu berkesempatan menerima tengkuluk berupa pakaian kebesaran adat Melayu disusul dengan penandatanganan prasasti disaksikan Ketua Yayasan Hajjah Rachmah Nasution Abdul MananMuis,DirekturPembinaanSMP Direktorat Jenderal Manajemen Pendidikan Dasar dan Menengah Depdikans RI Didi Suhardi, SH.MSi, Kadis Pendidikan Provsu Bahrumsyah dan Kadis Pendidikan, Pemuda dan Olah Raga Kab. Deli Serdang Sofian Marpaung. (m43)

MAN Batangkuis Hendak Ditutup, Orang Tua Siswa Protes LUBUK PAKAM ( Waspada) : Rencana penutupan sekolah Madrasah Aliyah Negeri (MAN) Dusun I, Desa Batangkuis Pekan, Kecamatan Batangkuis mendapatan protes dari kalangan orang tua murid. Sebagai aksi protesnya, kemarin sejumlah orang tua murid bersama-sama mendatangi DPRD Deli Serdang, guna mengadukan situasi yang harus mereka alami nantinya. “Kami selaku orang tua murid tidak setuju bila sekolah itu ditutup,” tandas salah seorang wali siswa, Saiful,40, dalam dengar pendapat yang digelar Komisi D DPRD Deli Serdang menyikapi hal itu. Pasalnya, rencana

itu akan diikuti juga pemindahan kegiatan belajar mengajar (KBM) bagi puluhan siswa kelas 11 dan kelas 12 MAN ke MAN Lubuk Pakam. Menurut mereka, kondisi itu akan semakin memberatkan mereka para orang tua murid. Sebab, harus mengeluarkan biaya tambahan yang tidak sedikit. “Dari mana lagi dicari untuk menutupi biaya transport tiap harinya. Dari Batangkuis ke Lubuk Pakam khan cukup jauh,” keluh mereka. Alhasil, rencana itu dituding sebagai aksi semena-mena pengelola sekolah yang tidak memikirkan dampak yang harus ditanggung mereka, selaku orang tua murid. Rencana yang segera

direalisasikan ternyata belum ada persetujuan dari pihak orang tua murid. Pertemuan yang digelar mendadak itu tidak menghasilkan apapun keputusan. Karena pada kesempatan itu tidak satupun jajaran Departeman Agama (Depag) Kabupaten Deli Serdang, maupun pihak pengelola sekolah yang hadir. Meski begitu, Syarifuddin Rosa salah seorang anggota Komisi D DPRD Deli Serdang dari Partai Bintang Reformasi menjanjikan, pihaknya akan menyampaikan aspirasi orang tua murid ke instansi terkait. Syarifuddin Rosa menyebutkan, Marliana selaku Kasek MAN mengakui adanya rencana

tersebut. Dengan alasan, sejak 14 tahun lalu beroperasi KBM di sekolah itu masih menumpang di sekolah lainnya. Selain itu, tambah Syarifuddin lagi, pihak sekolah beralibi untuk tahun ajaran 2009-2010, sekolah itu tidak lagi mendapatkan murid. Namun begitu, Syarifuddin menyayangkan rencana pihak pengelola sekolah untuk menutup kegiatan KBM sekolah berbasis agama itu. Terkait masalah itu, Komisi D DPRD Deli Serdang pun menyatakan keseriusannya untuk menindaklanjuti perkara itu. (a05)

Bus Gratis Berhenti Operasi, Ratusan Siswa Terlambat Masuk TEBINGTINGGI (Waspada): Pasca demo sopir angkutan kota ke DPRD Kota Tebing Tinggi, dua bus gratis milik DinasPendidikan,Kamis(16/7),berhenti beroperasi. Akibatnya ratusan siswa terlambat masuk, karena tak mengetahui penghentian itu. Dari pantauan, puluhan siswa yang seyogianya diangkut bus bantuan Departemen Perhubungan RI itu, ternanti-nantidisepanjangruteperjalanan. Seorang siswa SMKN 1 di Jalan Letda Sujono, mengaku terlambat masuk. Siswa berasal dari Kel. Tj. Marulak itu mengatakan, biasanya bus gratis telah sampai sekira pukul 06:45, tapi hingga pukul 07:00 kendaraan yang ditunggu tidak datang. “Terpaksa naik angkot, tapi terlambat, karena sekolah masuk

07:15,” kata Mhd. Syahputra. Salah seorang sopir bus gratis itu, mengaku mulai hari itu tidak beroperasi dan belum mengetahui kapan bisa beroperasi kembali. Menurut sopir itu, bus gratis yang baru beberapa hari beroperasi, hanya mengangkut siswa dua trip per hari, yakni pagi hari saat pergi sekolah dan siang hari saat pulang. Rute kedua bus, berangkat dari terminal Bandar Kajum, kemudian tiba di simpang empat. Satu bus menuju arah Jalan KF Tandean hingga SMPN 05 di batas kota. Satu lagi menuju arah Jalan Suprapto, Pahlawan, Deblot Sundoro, Bani Hasyim, Syech Beringin dan berhenti di SMPN 07 batas kota, terang dia. Sopir bus gratis itu, mengatakan dalam satu trip, jumlah siswa yang

diangkut hanya sekira 200 orang saja. Proses pengangkutannya pun dilakukan selektif,dimanasiswayangmendapatkan surat pengantar dari sekolah masingmasing yang bisa naik. “Meski belum ada kartu, tapi tak semua siswa bisa diangkut,” kata sopir itu. Anggota DPRD kota Tebing Tinggi Pahala Sitorus, saat dikonfirmasi, mengaku tidak mengetahui adanya penghentian mendadak operasi bus gratis itu. Menurut dia, hasil kesepakatan dalam pertemuan dengan sopir angkot, bus itu tetap beroperasi. “Jadi waktu pertemuan itu tak ada kesepakatan penghentian,” tegas dia. Pahala Sitorus mengatakan, tujuan dari pengadaan mobil gratis itu baik.Tapi,

karena sistem yang dibangun tak jelas menimbulkan dampak yang besar. Ini menyangkut persoalan tata kelola dan bisa jadi pelajaran niat baik saja tak cukup,tapiharusdidukungsistemyang baik, kata anggota DPRD yang bakal duduk kembali di periode 2009-2014 dari Partai Golkar itu, di kantin Pemko. Sehari sebelumnya, puluhan sopir angkot mendatangi DPRD KotaTebing Tinggi. Mereka meminta agar operasi bus gratis itu dihentikan. Alasannya, operasi bus itu telah mengurangi penghasilan mereka. Bahkan, sopir angkot itu menuding Pemko Tebing Tinggi arogan, karena membuat kebijakan menyangkuthajathiduporangbanyak, tanpa sosialisasi lebih dahulu. (a08)

Empat Remaja Spesialis Penjambret HP Digulung P.BRANDAN (Waspada): Empat remajaspesialispenjambrethandphone (HP), Kamis (16/7) dinihari, ditangkap Reskrim Polsek P.Brandan. Satu dari tersangka, AF alias Togar, sempat dikepung warga, Rabu (15/7) malam, setelah korbannya, Arianti, 28, berteriak. Menurut keterangan, malam itu pelaku, AF bersama temannya, PSS, 17, membuntuti korban, Arianti, warga Gg Setia, Desa Pelawi Utara, Kec. Babalan, mengendaraisepedamotorYamahaVega BK7477PV.SetibanyadiGg.Ilyas,tersangka langsung menjambret HP korban. Aksi penjambretan itu spontan membuat Arianti menjerit. Mendengar jerita korban, warga segera melaporkan peristiwaitukepolisisekaligusmelakukan pengepungan. AF, berhasil ditangkap sedangkan temannya, PSS, kabur dan sempat penumpang Betor pulang ke rumahnya di Pangkalansusu. Hasil pemeriksaan dari, AF, polisi

mendapatkan alamat rumah pelajar SMK itu. Sekira pukul 01:00, petugas berhasil menangkap, PSS, dari rumahnya. Dari tersangka, petugas menemukan barang bukti satu unt HP merek Motorola dan uang hasil rampasan sebesar Rp80 ribu. Kepada Waspada, PSS mengaku, ia sudah empat kali merampok HP dan dua di antaranya gagal. Tersangka mengaku, HP hasil kejahatan ia jual kepada salah satu counter HP di Jalan Dempo seharga Rp500 ribu. Adapun uang hasil penjualan diakui tersangka untuk mentraktir pacarnya. Pengembangan dari kedua tersangka, polisi berhasil menangkap dua pelaku berbeda, MI, 19, warga Lorong Kurnia, desa Batu Seratus dan Hen, 19, wargaDesaSei.Siur,Kec.Pangkalansusu. Dari kedua tersangka, disita dua unit HP Nokia dan Motorola termasuk sepeda motor Suzuki Shogun SP BK

2319SPyangdigunakansebagaitransport. Kedua HP milik Saidah, warga Gg. Setia Kompleks PT Pertamina di kawasan Pelawi, yang dirampok tersangka saat korbanmelintasdiJalanSutomopersisnya di depan Puskesmas. Hen, yang berstatus mahasiswa salah satu Akper di Stabat mengaku, ia diberi temannya itu uang Rp350 ribu dengan catatan kedua HP

untuk MH. Kapolsek P.Brandan, AKP Zulkarnain melalui Kanit Reskrim, Iptu Josef Edward Purba ketika dikonfirmasi Waspada, Kamis (16/7) membenarkan penangkapan keempat remaja spesialis penjambret HP. Menurut dia, para tersangka sedang dalam proses pemeriksaan. (a02)

Kejari Lubuk Pakam Tahan Mantan Ketua Panitia Pembebasan Lahan LUBUKPAKAM ( Waspada): Setelah menahan mantan kakan PBB Lubuk Pakam BS pada Kamis 18 Juni bulan lalu, kini Kamis (16/7) Kejari Lubuk Pakam kembali menahan TS, 45, yang kini menjabat sebagai Kepala Seksi Pelayanan Pajak Medan Polonia. Penahanan TS ini terkait pengembangan kasus dugaan korupsi pembelian lahan kantor PBB sebesar Rp 1.013.180.000, yang terletak di Desa Wonosari, Kecamatan Tanjung Morawa. TS di masa itu menjabat sebagai ketua panitia pembebasan lahan. TS didampingi rekan kerja dan sanak keluarganya datang ke Kejari Lubuk Pakam pada Kamis (16/7) berdasarkan surat panggilan. Setelah diperiksa secara marathon selama lebih kurang 8 jam di ruang Kasi Pidsus, sekira pukul 17 : 20, TS langsung digiring ke Rutan Lubuk Pakam.

Kajari Lubuk Pakam, Tambok Nainggolan, SH, didampingi Kasi Pidsus Ricky Septa Tarigan, SH mengatakan, penahanan TS atas pengembangan dugaan mark up atas pembelain lahan seluas 5546 m2. “Ini perhitungan secara manual dan belum berdasarkan audit BPK, dan kerugian negara berkisar Rp1 miliar,” jelasnya. Nainggolan menambahkan, pihaknya telah melakukan pemerik-saan terhadap 12 saksi dan tidak tertutup kemungkinan tersangka akan bertambah, “kami melakukan pemeriksaan sangat hati-hati sekali,” tandasnya. Kejahatan ini dijerat pasal 2 dan 3 UU tentang tindak pidana korupsi tahun 1999. Akan tetapi dalam kasus ini pihak kejaksaan akan menetapkan beberapa orang lagi tersangka baru, karena perbuatan tidak dikerjakan satu orang saja.(a06)

Waspada/Eddi Gultom

SERAHKAN KARTU: Bupati Serdang Bedagai HT Erry Nuradi didampingi Kadis Sosial Herman Sitorus, SH,Dewi Iriani dan Camat Pantai Cermin Pribadi Perangin-Angin memberikan kartu Pelayanan dan Jaminan Sosial Lanjut Usia (PJSLU) Tahun 2009 kepada 60 orang Lansia yang mendapat bantuan di kecamatan ini. Pemberian itu dilakukan secara simbolis kepada tiga orang Lansia di Desa Pantai Cermin Kiri, Kec.Pantai Cermin, Kab.Serdang Bedagai, Kamis (16/7) sore. Ketiga Lansia yang menerim kartu itu adalah Upik,70, Bais,78 dan Azhari,80. Menurut Bupati mereka sudah bisa mencairkan uangnya hari ini, Jumat (17/7) dengan jumlah Rp2.100.000 per orang, sebab bantuan per bulannya mendapat Rp300 ribu, sedangkan berlaku sejak bulan Januari hingga Juli 2009. Bantuan PJSLU itu berasal dari Departemen Sosial yang diberikan kepada 120 orang Lansia untuk dua kecamatan yakni Kec. Pantai Cermin dan Teluk Mengkudu yang dianggap hidupnya terlantar. Turut mendampingi Bupati Kepala Kantor Pos Kec.Pantai Cermin, Dailan dan Kades Pantai Cermin Kiri Elizar serta para anggota Karang Taruna.


18

Sumatera Utara

ABK Prima Lestari 2 Jam Terapung Di Laut Tak Kapok Jadi Nelayan TANJUNGBALAI (Waspada): Bambang, 24, warga Dusun VI, Desa Punggulan, Kec. Air Joman, Kab. Asahan bersama 21 ABK Prima Lestari lainnya selamat setelah terombangambing hampir 2 jam di perairan Selat Malaka atau 45 mil utara Kota Tanjung Balai. Mereka terombang-ambing di laut akibat kapal yang mereka tumpangi tenggelam setelah ditubruk Tanker FV. ChenYu No. 7 berbendera Taiwan di di jalur pelayaran internasional pada posisi 03 drt - 45 mnt - 50 dtk BT dan 99 drt - 55 mnt - 00 drt LU, Sabtu (11/7) pagi lalu. Bambang menceritakan, sebelum kejadian, mereka berencana pulang ke Kota Tanjung Balai karena katrol pukat atau jaring KM Prima Lestari mengalami kerusakan. “ Aku tidak tahu pasti bagaimana awal kejadian itu, sebab kami tertidur di salah satu ruangan kapal. Dan, tiba-

tiba saja, ketika sadar aku sudah berada di laut dengan kedalaman 10 meter,” ujar Bambang kepada Waspada di rumahnya, Kamis (16/7). Dalam situasi gelap dan ombaktinggi,Bambangberupaya naik ke permukaan laut, namun tidak berhasil. “ Sudah berulang kali aku mencoba naik ke permukaan laut, tapi seperti ada yang menarikkudaribawah,danketika aku teringat sama keluarga, khususnya anakku, barulah aku berhasil naik ke permukaan laut dan mengapung dengan berpegangan pada tong milik kapal kami yang tenggelam,” jelas Bambang. Tidak ada yang mampu dilakukan Bambang saat itu, kecuali berdoa dan membayangkan wajah anaknya. “ Aku sudah pasrah, namun terus berdoa, hingga setelah2jamterombang-ambing, akhirnya aku diselamatkan awak tankeryangmenabrakkapalkami. Dan, di dalam tanker itu kulihat ada mesin pendingin dan ikan tuna, serta panjang kapalnya 125 meter,” ujar Bambang. Berbeda dengan nasib Alang Aseng, 37, warga DusunVII, Desa Kapias Batu VIII, Kec. Tanjung Balai,KabupatenAsahan.Diadan lima ABK lainnya, sempat

2008 Pertumbuhan Ekonomi Asahan Naik 4,82 Persen KISARAN (Waspada) : Pertumbuhan ekonomi 2008 yang diukur berdasarkan kenaikan Produk Domestik Regional Bruto (PDRB) mengalami pertumbuhan 4,82 persen, untuk pertumbuhan tertinggi dicapai pada sektor industri pengolahan 7,10 persen, disusul sektor perdagangan, hotel dan restoran 6,30 persen, jasa-jasa dan bangunan masing-masing 5,87 persen, sedangkan 5 sektor perekonomian yang lainnya hanya berhasil tumbuh di bawah 5 persen. Hal itu dijelaskan Kepala Badan Pusat Statistik Kabupaten Asahan Dwi Prowoto melalui Kasi NeracaWilayah dan Analisis ImeldaYasmin kepada Waspada, Kamis (16/7) di ruang kerjanya. Menurutnya, besaran PDRB atas harga berlaku mencapai Rp 9.551,08 miliar, sementara harga konstan 2000 Rp 4.896,03 miliar. “Terhadap pertumbuhan ekonomi Asahan 2008 sebesar 4,82 persen dan industri pengolahan 2,13 persen, disusul sektor pertanian 1,04 persen, perdagangan, hotel, dan restoran 0,94 persen, jasajasa 0,32 persen, dan lima sektor lainnya,” ujar Imelda. Sedangkan struktur ekonomi Asahan, kata Imelda, didominasi oleh sektor pertanian sebesar 37,80 persen, industri pengolahan 29,71 persen, sektor perdagangan, hotel dan restoran 16,36 persen. “ PDRB perkapita di Asahan menurut harga berlaku tahun 2008 sebesar Rp 13,87 juta, lebih tinggi dari 2007, sebesar Rp 12,15 juta,’’ paparnya. Ditambahkannya, perekonomian Asahan meningkat meskipun dengan cara perlahan. (csap)

Pembongkar Rumah Diringkus INDRAPURA (Waspada) : Polsek Indrapura meringkus dua tersangka pelaku pencurian dengan modus pembongkaran rumah yang ditinggal pemiliknya Rabu (15/7) sore. SumberWaspada di Polsek Indrapura mengatakan, dua tersangka itu IP,30, warga Dusun V, Desa Kuala Tanjung, Kec. Sei Suka dan Ir,35, warga yang sama. Keduanya diringkus dari kediaman masingmasing. Satu lagi tersangka,D, sempat kabur dan kini masuk dalam DPO. Ketiganya merupakan tersangka pelaku pencurian dengan modus pembongkaran rumah saat ditinggal pemiliknya.Terakhir aksi mereka, dilakukan terhadap rumah Napitupulu di Dusun Alai, KualaTanjung. Pengakuan tersangka, aksi serupa sudah empat kali mereka lakukan terhadap beberapa rumah warga di Kuala Tanjung. Barang-barang elektronik dan berharga lainnya menjadi sasaran aksi kawanan pencurian ini. Kedua tersangka kini mendekam di sel tahanan Polsek Indrapura guna pengusutan selanjutnya. (a25)

terkurung di kamar haluan kapal. “Ketikakamihendakpulang,tibatiba saja tanker itu menubruk bagian kanan badan kapal kami,” ujar Alang. Peristiwa itu mengakibatkan posisi KM Prima Lestari tegak lurus meluncur ke dasar laut. “ Kami terkurung di kamar haluan kapal, dan semuanya sudah pasrah karena tak ada jalan keluar menyelamatkan diri,” jelas Alang. Akan tetapi, sebelum kapal tenggelam seluruhnya, mereka berhasil keluar dari kamar haluan setelah merusak salah satu pintu. “Saya,IrwansyahdanSyahrial Tanjung, berhasil selamat, sedangkanduarekannyatidaksempat keluar dari kamar karena kapal meluncur cepat ke dasar laut,” jelas Alang. Alang Aseng, Irwansyah dan Syahrial Tanjung, juga terombang-ambing kurang lebih 2 jam di permukaan laut, hingga akhirnya diselamatkan awak tanker dan dibawa ke Singapura. Selama di negara itu, mereka menginap di hotel, dan selanjutnya dipulangkan ke Kota Tanjung Balai dengan menggunakan pesawat melaluiBandaraSingapura,Kuala

Namun kekayaan yang maha besar itu, khususnya di Labuhanbatu dirusak demi memuaskan keserakahan sehingga membawa degradasi lingkungan yang berdampak merugikan manusia secara luas. Di sisi lain, kebijakan pemerintah pun dimanfaatkan untuk mengeksploitasi kawasan tertentu dengan cara yang tidak partisipasitif dan transparan. Berkaitan dengan itu, Bupati Labuhan Batu HT Milwan melaluiWakil Bupati H Sudarwanto S, SP, Kamis (16/7) pada Upacara Hari Lingkungan Hidup Sedunia Tingkat Kab. L.Batu di SMA Negeri 2 Rantau Selatan, memaparkan, untuk melawan laju perusakan lingkungan, penguatan pemahaman dan kesadaran harus terus dilakukan sebagai langkah awal membangun generasi muda berwawasan lingkungan. Dalam pendidikan formal, pengetahuan lingkungan hidup sudah terintegrasi dengan materi pendidikan lainnya, tetapi secara substansi akar permasalahan lingkungan tidak terjabarkan dalam mata pelajaran tersebut. Pendidikan nonformal di luar sekolah mungkin menjadi salah satu alternatif dalam memahami dan menambah wawasan para siswa untuk mengerti arti lingkungan dimaksud. Tindak lanjut dari kegiatan

nonformal ini menjadi langkah awal strategis mengerucutkan suatu gambaran yang abstrak menjadi terfokus sehingga pendidikan lingkungan bisa menjadi mata pelajaran khusus dalam dunia pendidikan. Beranjak dari pemikiran itu, pelajar maupun mahasiswa harus berperan aktif dalam upaya pengelolaan lingkungan hidup dengan baik, karena secara nyata berkontribusi besar mengatasi dampak perubahan iklim dengan membuat gerakan menanam dan memelihara pohon. Menyertakan siswa dan mahasiswa dalam penanaman pohon ini juga dapat merangsangkan pengetahuan mereka tentang permasalahan lingkungan hidup, keseimbangan ekosistem, ekologi manusia, keanekaragaman hayati, pelakupelaku perusak lingkungan, hubungan manusia dengan lingkungan, program pemerintah dalam bidang lingkungan hidup, pengelolaan sumber daya alam/ pemanfaatan pekarangan dan upaya-upaya penanganan kerusakan lingkungan. Dengan demikian, tambah Sudarwanto, diharapkan akan lahir pendidikan lingkungan yang informal. Meningkatkan pengetahuan dan wawasan siswa dan mahasiwa di bidang lingkungan hidup, khususnya kondisi dan ancaman lingkungan hidup. Meningkatkan minat baca para siswa mengenai masalah lingkungan hidup. Membangun kepedulian para siswa melestarikan dan memanfaatkan lingkungan yang terdapat di sekitarnya dan meningkatkan pemahaman pelayanan untuk mengaktualisasikan dan mengimplementasikan serta penyebaran informasi lingkungan hidup kepada masyarakat secara luas dan massif. Yang paling utama, tandasnya, melalui kegiatan penanaman pohon yang berkesi-

Lumpur dan Polonia Medan. Di Polonia, mereka dijemput pemilik KM Prima Lestari dan diantar ke rumahnya masingmasing. “ Selama di Singapura, kami dilayani dengan baik, mulai biaya hotel sampai tiket pesawat, seluruhnya ditanggulangi pihak tanker yang menubruk kapal kami,” ujar Bambang.

Meskipun nyaris kehilangan nyawa, Bambang mengaku tidak akan beralih profesi. “ Saya hanya trauma jika mengingat peristiwa itu saja, sebab banyak kawankawan saya yang meninggal, namun ke laut saya tidak pernah jera, karena memang saya adalah pelaut dan punya darah pelaut,” ujarnya. (a37)

untuk kepentingan visum, lalu diserahkan ke keluarganya masing-masing. Demikian Kapolres Tanjung Balai AKBP Mestron Siboro melalui Kasat Pol Air Iptu RM Tumanggor kepada Waspada. Kasat Pol Air menambahkan, dengan ditemukannya 3 jenazah itu, maka sampai hari ini, dari 10 ABK KM Prima Lestari yang dinyatakan hilang, 5 telah ditemukan. Diduga Sengaja Ditubruk Sementara, Komisi A DPRD Kota Tanjung Balai menyatakan, KM Prima Lestari sengaja ditubruk oleh FV. ChenYu No. 7 berbenderaTaiwan, karena khawatir ketahuanmencuriikandiperairan Indonesia. “ Berdasarkan informasi dari awak KM Prima Lestari yang

selamat, di dalam FV Chen Yu, banyakditemukanIkanTunadan alat pendingin. Jadi, kita menyimpulkan, kapal berbendera Taiwan itu berjenis kapal ikan dan dia sengaja menubruk KM Prima Lestari karena takut ketahuan mencuri ikan di perairan Indonesia,” ujar Ketua Komisi A Datmi Irwan dan anggota Syarifuddin Harahap, Rolel Harahap dan M Syukur seusaipertemuandengan Danlanal Letkol Laut (P) Adriansyah dan Kapolres Tanjung Balai AKBP Mestron Siboro terkait pengusutan peristiwa tubrukan tersebut, Kamis (16/7). Mereka mendesak Kapolda Sumut untuk mengusut tuntas kasus itu, dengan melibatkan Interpol Mabes Polri. (a37)

Jumat 17 Juli 2009

Hamil Tiga Minggu Diusir Dari Rumah RANTAUPRAPAT(Waspada): Terlalu muda menjadi ibu rumah tangga sudah kodrat yang harus diterima Nurima, postur tubuhnya hanya sekira 140 cm dan berat badannya sekira 30 kg. Kalau melihat sekilas orang tak percaya kalau Nurima telah mempunyai momongan. Akibat perbuatan seorang pengusaha panglong di desanya H Askah Hasibuan, Nurima harus menanggung beban yang cukup berat. Anak hasil hubungan yang dilarang menurut undang-undang, karena saat dinikahi Nurima masih tergolong anak di bawah umur. ”Saya dinikahi saat berumur 12 tahun,” terangnya Rabu (15/7) di ruang tunggu Pengadilan Negeri Rantauprapat. Maksudnya datang ke pengadilan memenuhi panggilan Jaksa Penuntut Umum yang akan mendengar keterangannya seputar kasus yang cukup menarik perhatian masyarakat. “Saya menemani Nurima untuk menghadiri persidangan,” terang Suryani dari PKPA (Pusat Kajian Perlindungan Anak) yang sejak awal menjadi pendamping Nurima. Kasus ini sangat me-

nyita waktu korban, kalau masalah ekomoni Nurima yang hidup berdua dengan ibunya cukup miris.” Nurima masih sangat butuh perhatian dari pemerintah. Tapi Pemkab Labuhan Batu sendiri belum pernah menunjukan kepedulian, “ ungkap Suryani yang membidangi Kajian Hukum dan Investigasi di PKPA. Perbincangan terhenti, Anak Nurima yang baru berusia 8 bulan menangis dan seketika itu Nurima mencari tempat yang agak jauh dari lokasi warga yang prihatin melihatnya. Nurima memberikan ASI kepada bayi mungilnya. Tangis bayi itupun terdengar mulai reda. “Saya akan besarkan Riana, meski kami hidup pas-pasan,” ungkapnya perlahan. Tak pernah terlintas di benaknya untuk menyerahkan Riana kepada H Askah. Meski pernah dulu bayinya diambil keluarga Askah, tapi setelah dilaporkan ke polisi, bayinya dikembalikan. Sebenarnya dia tak ingin mengingat masa kelamnya, tapi karena keharusan menghadiri persidangan ini secara langsung kesaksian nya dibutuhkan. ‘’Aku

nggak sanggup mengingat semau perjalanan pahit hidupku bang, apalagi saat kejadian dulu, usia kandunganku baru berjalan tiga minggu, aku disuruh pergi dari rumah H Askah,’’ urainya. Abang H Askah memintanya meninggalkan rumah meski kondisinya lagi hamil.”Tanpa balas kasihan, abang H Askah menyuruh kami pergi,” tuturnya mengenang masa sulit waktu itu. Saya tak habis pikir tambahnya, saat pengusiran itu H Askah tidak berada di rumah, tapi Nurima yakin masalah pengusiran itu H Askah pasti mengetahuinya Saat persidangan dimulai, tidak ada tegur sapa dan saling pandang antara keduanya. Terdakwa bahkan memalingkan muka seakan menaruh rasa kurang senang. Tangis bayi Nurima pun tak membuat terdakwa berusaha untuk menoleh. Nurima hanya memandang lantai ubin pengadilan. Proses persidangan cukup menarik minat warga. Pledoi yang diajukan penasehat hukum terdakwa ditolak majelis dan sidang dilanjutkan untuk mendengarkanketerangansaksi.(c01)

Bangunan Sekolah Rusak Total 3 Mayat ABK Prima Lestari Kembali Ditemukan Diterpa Angin Kencang TANJUNGBALAI (Waspada): Nelayan kembali menemukan 3 mayat ABK KM Prima Lestari yang tenggelam akibat ditubruk tanker di perairan Selat Malaka, Kamis (16/7). Ketiga jenazah ABK itu, yakni Hazarul Aswad, 55, Desa Kapias BatuVIII, Kec.Tanjung Balai, Kab. Asahan dan Usman Sirait, 34, warga Jalan Sipori-pori, Kec.Teluk NibungdanUcokaliasAbdulMuthalib Sihotang, 38, warga Dusun II, Desa Air Joman, Kec. Air Joman, Kab. Asahan, ditemukan nelayandalamkeadaanterapungapung di perairan Selat Malaka. Dari lokasi penemuan, jenazah ketiga ABK itu, dibawa menuju Pelabuhan Panton Bagan Asahan, dan selanjutnya dikirim ke RSUD Kota Tanjung Balai

RANTAUPRAPAT (Waspada): Akibat terpaan angin kencang yang terjadi Rabu (8/7) lalu, mengakibatkan sebuah bangunan sekolah yang baru selesai dibangun, berada di SMP Negeri 1 Sei Sanggul, Kecamatan Panai Hilir, menjadi rusak total. Selain merusakkan bangunan sekolah yang baru selesai dikerjakan lebih kurang dua bulan lalu dengan sumber dana APBD tahun 2008 sekitar Rp 439 juta itu, dua unit rumah penduduk tertimpa pohon serta 5 rumah lainnya juga mengalami rusak berat.

Salah seorang warga Sei Berombang, Kecamatan Panai Hilir, Sofian Nusuri, Rabu (15/ 7) di Rantauprapat menuturkan, akibat terpaan angin kencang seperti angin puting beliung, itu mengakibatkan sebuah bangunan sekolah rusak serta 5 rumah warga ikut rusak berat. Menurutnya, kejadian itu terjadi, sekira pukul 02:00 dini hari dan tidak ada merenggut korban jiwa. Namun, kerugian akibat kejadian itu diperkirakan mencapai ratusan juta rupiah. Bangunan sekolah yang rusak tersebut memang belum diper-

gunakan, karena baru selesai dikerjakan lebih kurang dua bulan lalu. Camat Panai Hilir Mukhsin Matondang, SH saat dihubungi wartawan, melalui telefon selular membenarkan telah terjadi tiupan angin kencang di daerahnya pada Rabu lalu. Dalam kejadian itu, tidak ada korban jiwa, hanya sebuah bangunan sekolah rusak berat, yakni dua bangunan ruang kelas dan satu ruang amblas ke tanah serta rumah-rumah penduduk yang terbuat dari papan mengalami kerusakan. (a27)

DPRD Dapat Minta Bantuan Yudikatif Hadirkan Eksekutif LIMAPULUH (Waspada): DPRD Batu Bara dapat meminta bantuan kepada yudikatif sepanjang eksekutif tidak menunjukkan sikap baik dalam upaya menyelesaikan persoalan yang terjadi khususnya yang dinilai krusial dan mendesak. “Kita melihat Kadis PU tidak menunjukkan sikap baik untuk menyelesaikan persoalan dengan mengutus stafnya ke dewan,” sebut salah seorang tokoh pemuda yang juga aktivis mahasiswa, Ramadhan, kepada Waspada, Kamis (16/7). Dia mengemukakan itu

Generasi Hijau, Lawan Berat Perusak Lingkungan Hidup di Masa Depan INDONESIA merupakan satu dari tiga negara yang memiliki keanekaragaman hayati terbesar. Negeri ini memiliki potensi dalam memenuhi kebutuhan pangan, sandang, papan dan obat-obatan yang dapat diandalkan sebagai tulang punggung pengembangan ekonomi termasuk industri.

Waspada/Rahmad F Siregar

DI LAUT : Salah satu awak KM Prima Lestari, Bambang, 20, warga Dusun VI, Desa Punggulan, Kec. Air Joman, Kab Asahan, selamat setelah terombang-ambing selama kurang lebih 2 jam di Perairan Selat Malaka. Foto direkam, Kamis (16/7).

WASPADA

nambungan dalam jangka panjang akan menciptakan ‘generasi hijau’ (green generation). Generasi hijau akan mengkampanyekan penyelamatan lingkungan kepada keluarganya, masyarakatnya dan bangsanya dan para perusak lingkungan akan mendapat lawan berat di masa depan. Kegiatan yang dihadiri Ketua TP PKK L.Batu Hj.Adlina T Milwan itu juga diselingi dengan penyerahan piagam penghargaan sekolah peduli dan berbudaya lingkungan kepada MIN Padang Bulan, MTs Negeri Rantauprapat serta SMP Negeri 3 Rantau Utara. Penyerahan bibit penghijauan dan pupuk organik kepada sekolah-sekolah dan perguruan tinggi di Rantauprapat. Kemudian, penyerahan pot bunga dan tempat sampah dan penaman pohon penghijauan di lingkungan sekolah SMA Negeri 2 Rantau Selatan oleh Sudarwanto, Hj Adlina T Milwan, unsur Muspida dan Kepala Bapedalda Drs Edi Erwin yang disaksikan Kepala SMA Negeri 2 Rantau Selatan Drs Trisno. Dalam kesempatan itu Hj. Adlina T Milwan berpesan kepada ratusan pelajar itu untuk lebih giat belajar dan mencintai lingkungan, karena dengan rajin belajar, anak-anak akan lebih pintar sehingga mempunyai modal dasar untuk nantinya menimba ilmu di Perguruan Tinggi. Dengan mencintai lingkungan anak-anak paling tidak bisa hidup lebih sehat, karena lingkungannya bersih dan asri. Sebagai tanda dan kenangkenangan untuk para pelajar SLTA yang kelahiran tahun 1992, Hj Adlina secara pribadi akan memberikan KTP gratis, “Biaya pengurusan KTP kan Rp.22.000 per orang, untuk pengurusan atau biayanya nanti saya yang membayar,” kata Hj Adlina. (a27/a26/c01)

menanggapi ketidakhadiran Kadis PU memenuhi panggilan DPRD Batu Bara terkait pembangunan kantor Bupati Batu Bara yang hingga kini realisasinya dipertanyakan. Sedangkan biayanya telah tercantum sejak APBD 2008 sampai kepada rekanan kontraktor sudah ada dan menjadi persoalan saat ini.”Ini kewenangan kita dapat meminta bantuan pihak kepolisian untuk menghadirkan pihak eksekutif jika tiga kali tidak memenuhi panggilan dewan,” tambah Ketua Komisi A Sahari Zakaria

SH sembari menyatakan kewenangan mereka itu diatur dalam perundangan yang berlaku. Sesalkan Ketua DPRD Batu Bara Surya menyesalkan ketidakhadiran Kadis PU dan mengangkangi instruksi bupati sebagaimana surat Sekdakab Batu Bara No.005/3799 tanggal 14 Juli 2009 ditandatangani Asisten I Sakti Alam Siregar untuk menindaklanjuti surat DPRD Batu Bara No.005/916 tanggal 10 Juli 2009 perihal mohon menghadirkan. (a11)

Waspada/Sahril Ilham

AKRAB : Tampak Pj Bupati Labura H Daudsyah bincang akrab dengan Camat Aeknatas Harris Topan Hasibuan, SH, usai acara pelantikan Kepala Desa di kantor Camat Aeknatas. Foto direkam, Kamis (16/7).


Jumat 17 Juli 2009

ABK Horas Samosir Cruise Terbakar SAMOSIR (Waspada) : Anak Buah Kapal (ABK) Horas Samosir Cruise (HSC) nyaris tewas akibat sekujur tubuhnya mengalami luka bakar saat kapal pesiar itu sandar di bibir pantai Danau Toba tepatnya di Hotel Dumasari Tuktuk, Kec. Simanindo, Kamis (17/7). ABK itu Penro Silalahi, 25, honorer Dinas Perhubungan Kab. Samosir, saat kejadian mengeluarkan air dari palka kapal pesiar dengan menggunakan pompa yang dihubungkan dengan baterai. Diduga tangki minyak Kapal Pesiar mengalami kebocoran sehingga saat ABK menghubungkan kabel baterai tiba-tiba timbul percikan api. Korban yang mengalami luka bakar di sekujur wajah, tangan, kaki dilarikan ke RS Hadrianus Pangururan. Pengadaan kapal pesiar merupakan bantuan dari Kementerian PDT tahun 2007 dan dioperasikan 2008. Di tempat terpisah, Kapolsek Simanindo AKP B. Naibaho, mengatakan, sudah menurunkan tim untuk menyelidiki sebab kejadian. (c10)

Dua Rumah Di Pansurnapitu Taput Hangus Terbakar TARUTUNG (Waspada): Dua pintu rumah di Desa Pansurnapitu, Kec. Siatasbarita, Tapanuli Utara, hangus terbakar. Peristiwa terjadi, Kamis (16/7) sekira pukul 02:00 dini hari, kerugian ditaksir puluhan juta rupiah. Tidak ada korban jiwa dalam peristiwa itu. Keterangan yang diperoleh, menyebutkan kedua rumah yang terbakar masing-masing milik P Simangunsong dan H. Hutagalung. Sementara kejadian sudah ditangani pihak berwajib. Menurut saksi mata api diduga berasal dari rumah milik PS. Ini diperkuat karena kondisi rumah yang terbuat dari bahan kayu keseluruhan hangus terbakar, sementara rumah milik Hutagalung yang hangus terbakar tidak separah rumah Simagunsong. Namun rumah milik Hutagalung tetap tidak bisa digunakan lagi. Pihak pemadam kebakaran Tarutung tiba di tempat untuk melakukan upaya pemadaman setelah mendapat informasi dari masyarakat. Petugas pemadam kebakaran dibantu warga dengan maksimal melakukan upaya pencegahan agar api tidak merembes ke rumah warga lainnya. Sumber di Polres Tapanuli Utara membenarkan, kejadian tersebut dan telah meminta keterangan dari warga dan kepala desa setempat. Sementara petugas telah memasang police line di lokasi kebakaran. (a13/c12)

Maling Diringkus Korbannya KABANJAHE (Waspada) : CP,19, warga Perumahan Sri Gunting Blok 24 No. 36 Sunggal, Deli Serdang tersangka pelaku pencurian barang bekas berupa seng dan ternak, Kamis (16/7) sekira pukul 08:00, diringkus korbannya sendiri B. Tarigan ,52, warga Desa Singgamanik, Kec.Munthe di kawasan Berastagi . Selain meringkus tersangka, korban yang juga mengamankan mobil Daihatsu Esspas pick-up BK 9458 BI yang berisikan barang berupa 68 lembar seng, 1 goni terong, 1 unit sepeda,8 buah kursi plastik, ayam 14 ekor dan entok sebanyak 4 ekor. Keterangan yang dihimpun di Mapolres Tanah Karo di Kabanjahe, tersangka bersama dua temannya yang melarikan diri melakukan aksi pencurian di kawasan Desa Munte dengan memanfaatkan mobil jenis pick-up. Masyarakat yang mengetahui adanya aksi pencurian segera memburu di sekitar desa hingga ke Kecamatan Berastagi, saat dilakukan pengejaran korban B Tarigan sampai ke Berastagi dan melihat ada mobil Daihatsu Espass pick-up BK 9458 BI yang mengangkut barang hasil curian mogok akibat kehabisan bensin. Korban berupaya menangkap ketiga tersangka, namun dua di antaranya kabur sedangkan seorang lagi berhasil diringkus dan diserahkan ke kepolisian. Kapolres Tanah Karo AKBP Agus Pranoto melalui Kasat Reskrim Polres Karo AKP Lukmin Siregar dan Kanit Idik Aiptu J.Sinuraya membenarkan. (a17)

Posisi Pekerja Lemah BERASTAGI (Waspada ):Peranan dewan pengupahan dalam pembahasan dan pengusulan UMP/UMK sangat menentukan besar upah yang akan diterima pekerja. Hal ini merupakan upaya dalam meningkatkan kesejahteraan pekerja dan keluarganya dengan memperhatikan ketahanan dan kemajuan perusahaan. Hal itu disampaikan Kepala Dinas Tenaga Kerja dan Transmigrasi (Kadis Naker Tran) Provinsi Sumut Rapotan Tambunan dalam pembukaan pembinaan dan pemberdayaan Dewan Pengupahan Kab/Kota se Provinsi Sumut di Grand Mutiara Berastagi, Selasa (14/7) malam. Pembicara, Kasubdishub Industrial Naker Trans Sumut Jaminuddin Marbun menyampaikan topik ‘Tugas Dewan Pengupahan Kab/Kota’, Mohd. Syaufii Syamsuddin dengan topik ‘Pokok-Pokok Ketentuan Normatif Perundang-Undangan Ketenaga Kerjaan’, Sukardi dari BPS Provinsi Sumut topik ‘Tata Cara Pelaksanaan Survey dan Pengolahan Data Survey’. Hadir dalam acara itu Kepala Seksi Syarat-Syarat Kerja Nyito Suprayogi, Panitia Bintek Panusunan Lubis dan 32 peserta dari sejumlah pejabat eselon di lingkungan Kab/Kota se- Sumut. Rapotan mengatakan, UU Nomor 13 Tahun 2003 tentang ketenagakerjaan, pemerintah terus berupaya meningkatkan kesejahteraan pekerja ke arah pencapaian kebutuhan hidup layak sebagai amanat dari UUD 1945. Untuk melaksanakan kewajiban, akan dilakukan penetapan upah minium provinsi dan kabupaten sebagai jaring pengaman agar upah pekerja tidak berada pada level rendah yang merugikan pekerja. (a17)

Tidak Diberi Uang, Anak Aniaya Ibunya P. SIANTAR (Waspada): Hanya gara-gara tidak diberi uang oleh orang tuanya, seorang anak, MTS, 36, warga Jalan Tongkol, Kel. Pardomuan, Kec. Siantar Timur, Kota Pematang Siantar tega menganiaya ibunya hingga babak belur. Berbagai keterangan dihimpun dan pengaduan korban di Polresta menyebutkan, Kamisa Nainggolan, 56, dipukul MTS di dalam rumahnya sendiri, Selasa (14/7) pukul 06:00. Pagi itu, MTS mendatangi rumah ibunya dan meminta sejumlah uang. Saat itu, korban mengatakan “ayolah ke pajak (pasarred) di sananya uang kita.” Mendengar perkataan ibunya, MTS langsung marah dan mengatakan ibunya tidak bisa mengambil istrinya dan ibunya senang melihat kondisinya. Selesai berucap, MTS langsung memukul ibunya menggunakan kedua kepalan tangan dan menendang ibunya dengan kaki kanan dua kali. Kapolresta AKBP Andreas Kusmaedi saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap di Mapolresta, Rabu (15/7) membenarkan. (a14)

Berbicara Dengan Ibu Sendiri Jadi Korban Pemukulan P. SIANTAR (Waspada): Gara-gara berbicara dengan ibu sendiri tentang plank, Sandy Siregar, 20, warga Jalan Medan, Km 5,5, Simpang Karangsari, Kel. Pondok Sayur, Kec. Siantar Martoba, Kota Pematang Siantar menjadi korban pemukulan oleh RS. Berbagai keterangan dihimpun di Polresta, Selasa (14/7) menyebutkan, RS memukul Sandi di rumahnya sendiri di Jalan Medan, Km 5,5, Kel. Pondok Sayur, Minggu (12/7) pukul 23:30. Malam itu, korban menemui ibunya Intan Sihombing, 45, dan mengabarkan plank yang terbuat dari besi bergambar salah satu calon legislatif tumbang dan bertanya apakah ibunya mau besi itu. Namun, ibu korban melarang karena bisa ditangkap polisi. Pembicaraan antara korban dan ibunya itu ternyata membuat RS yang mendengarnya menjadi emosi dan langsung melempar korban dengan keranjang. Mendapat lemparan itu, korban berdiri dan saat itu juga RS mendatangi korban sehingga terjadi perkelahian. Ibu korban berupaya memisahkan mereka, namun terkena pukulan RS. Kesempatan itu digunakan korban pergi ke dapur dan mengambil cangkul. Ketika korban kembali ke depan, ibunya langsung mencegah korban dengan memegang cangkul. RS saat itu turut memegang cangkul hingga terjadi tarik menarik antara ibu korban dengan RS. Saat terjadi tarik menarik itu, gagang cangkul dari kayu membentur tangan kanan ibu korban. Akibatnya si ibu mengalami luka di bibir atas dan luka di pinggang kanan.(a14)

19

Sumatera Utara

WASPADA

Komite Sekolah SMAN 1 P. Siantar Tolak Penggantian Kepsek DPK: Sangat Ironis P.SIANTAR (Waspada): Komite Sekolah SMA Negeri 1 Kota Pematang Siantar menolak penggantian kepala sekolah dengan mengajukan resolusi kepada Pemko. Sementara, Dewan Pendidikan Kota (DPK) menyatakan penggantian itu sangat ironis. “Komite Sekolah SMA Negeri 1 menyampaikan resolusi atau pernyataan sikap atas surat keputusan (SK) walikota nomor 820/1379/VII/Wk-Thn 2009 tanggal 9 Juli 2009 tentang penggantian Kepsek SMA Negeri 1,” sebut Ketua Komite Sekolah SMA Negeri 1 Dame Pandia-

ngan, SH, Rabu (15/7). Pandiangan menyebutkan, resolusi yang ditandatangani delapan dari 10 anggota Komite Sekolah menyatakan, menolak pergantian Kepsek dari Drs Risbon Sinaga kepada Robertson Hutagaol. Kemudian, lanjut Pandiangan, Komite Sekolah juga menolak dilakukannya serah terima jabatan Kepsek, karena pergantian Kepsek itu sudah bertentangan dengan peraturan yang berlaku. Pandiangan menyebutkan, salinan resolusi itu juga disampaikan kepada Gubsu, Kadis Pendidikan Pematang Siantar, Kadis Pendidikan Sumut, Ketua PGRI Pematang Siantar, Ketua PGRI Sumut dan Ketua PB PGRI Pusat. Secara terpisah, Ketua DPK Drs. HM. Nasir Armaya Siregar menyatakan, pergantian Kepsek SMA Negeri 1 sangat ironis,

karena belum cukup masa jabatannya sudah diganti. “Kalau pergantian itu dengan alasan penyegaran tidak masuk diakal, nanti bisa dilakukan suka-suka. Misalnya, baru tiga bulan dilantik bisa langsung diganti. Kalau alasan dipromosikan jadi pengawas sekolah pun, itu termasuk dibuat-buat, padahal sama saja dengan buangan.” Menurut Siregar, pergantian Kepsek itu harus memiliki alasan yang jelas dan masuk diakal serta sesuai ketentuan. Antara lain, masa jabatannya sudah habis atau melakukan pelanggaran. Begitu pula dengan pergantian Kepsek SMA Negeri 4, Siregar turut mempertanyakannya, karena dinilai agak janggal dari guru SMP negeri dilantik menjadi Kepsek SMA Negeri 4.“Walikota perlu memberi penjelasan tentang hal itu dan DPK akan mempertanyakannya.”(a14)

Korupsi Kegiatan Desa Rp300 Juta TA 2006, PPTK Bagian Tapem Tobasa Tersangka BALIGE (Waspada): Kasus dugaan korupsi dalam pelaksanaan kegiatan aparat pemerintahan desa sebesar Rp.300 Juta pada APBD Tahun Anggaran (TA).2007, Pejabat Pelaksana Teknis Kegiatan (PPTK) Bagian Tapem Pemkab Tobasa Junat Marpaung sudah ditetapkan Kejari Balige sebagai tersangka. Kegiatan pelatihan untuk aparat pemerintahan desa yang berbau tindak pidana korupsi ini terlaksana sewaktu KabagTapem masih dijabat Ombang Siboro, namun telah berpindah tugas kedaerah Kab.Samosir dengan jabatan Asisten I Bidang Pemerintahan di sana. “Setelahmelaluipemeriksaan saksi-saksi dari aparat pemerintahan desa maka kejaksaan untuk tindak lanjut proses hukum,pertamamenetapkanPPTK BagianTapem sebagai tersangka terhitung Maret 2009 namun

Kasus Asuransi DPRD Tobasa, Dua Tersangka Ditahan BALIGE (Waspada): Dugaan korupsi yang terjadi atas kasus penyelewengan dana asuransi DPRDTobasa sebesar Rp.750 juta pada tahun anggaran 2006 lalu, pihak Kejaksaan Negeri (Kejari) Balige dalam proses hukumnya sudah dua tersangka ditahan. “Sejak menjabat Kepala Kejaksaan Negeri (Kajari) Balige telah melakukan penahanan dua tersangka yakni mantan Ketua DPRDTumpal Sitorus dan mantan Sekretaris DPRD Rekson Simanjuntak “ kata Kajari Balige Timbul Pasaribu menjawab Waspada, Rabu (15/7). Mantan Ketua DPRDTobasa yang pertama kali dilakukan penahanan karena diduga mengintervensi pelaksanaan kegiatan proyek asuransi dan terlibat proses pencairan dana proyek namuntidakdiberikanseluruhnya kata Timbul, kepada perusahaan asuransihanyamenerimasetoran Rp250 juta. Keterlibatan mantan Sekretaris DPRD Tobasa dalam kasus ini disebabkan sebagai Kuasa Pengguna Anggaran (KPA) yang berwewenang mencairkan dana proyek, kata Timbul, ditambah lagi ternyata ikut juga mendapatkanasuransinyapadahalhanya diperuntukkan bagi anggota dewan. Ditanya apa kemungkinan bisa bertambah lagi tersangka, Kajari Balige dengan diplomatis mengatakan,’’ marilah kita lihat perkembangan proses hukumnya nanti, apakah semakin bertambah atau tidak.’’ (a33)

Pos Bantuan Sosial Pemkab Taput Dapur KKN TARUTUNG (Waspada): Pos bantuan sosial di dinas/bagian Pemkab Tapanuli Utara tahun anggaran 2008 lalu terkesan bagaikan dapur untuk drama KKN. Sebab sangat tidak etis jika bantuan sosial yang diposkan pada pada APBD Taput 2008 sebesar Rp8. 244. 076. 488 ditambah dengan PAPBD tahun 2008 Rp 1. 003. 357. 500. Angka Rp1 miliar lebih di PAPBD 2008 itu sangat fantastis hanya untuk kegiatan bantuan sosialsajadandalamkuranwaktu pelaksanaanya hanya satu bulan saja. Hal itu diungkapkan oleh anggota DPRD Taput Ottoniyer Simanjuntak baru baru ini. Kata dia, diberbagai unit SKPD masih juga terdapat kegiatan dalam bentuk pengadaan yang pada pelaksanaanya berwujud bantuan. (c12)

penahanannyabelumdilakukan” kataKajariBaligeTimbulPasaribu melalui Kasi Pidsus Nelson SembiringmenjawabWaspada,Kamis (16/7). Dugaan korupsi yang terjadi itupadapelaksanaanpengelolaan keuangan kepala desa dan sekretaris desa sebesar Rp170 juta dan manajemen pemerintahan desa sebesar Rp130 juta, kata Nelson, secara pasti kerugian negara yang ditimbulkan akibat

penyimpangan proyek belum diketahui karena masih menunggu tim audit. Selain kasus itu, kejaksaan jugasudahmenetapkantersangka kepadaEsponSimanjuntakselaku PPTK proyek simpus berbasis komputerpuskesmaspadaDinas Kesehatan Pemkab Tobasa dan Arnol Simanjuntak selaku Kabag Keuangan PemkabTobasa terkait kasus asuransi DPRD Tobasa TA.2006, kata Nelson. (a33)

Buntut Sengketa Masyarakat Dan TPL, Polisi Ciduk Tiga Warga DOLOKSANGGUL (Waspada):Dituduhmembakarkayudan merusak dua alat berat milik PT Toba Pulp Lestari (TPL), Polres Humbang Hasundutan (Humbahas) menangkap paksa tiga warga Desa Pandumaan, Kec. Pollung. Ketiganya ditangkap secara terpisah, Rabu (15/7) di Desa Pandumaan, Humbahas. Menurut keterangan, ketiga warga ditangkap tanpa sepengatahuan warga lain dan penangkapan terjadi saat warga melakukan aktivitas sehari-hari. “Kami sangat terkejut atas tindakan polisi yang menangkap warga tanpa menunjukkan surat penangkapanresmi,’’ujarseorang warga mengaku bernama M Nainggolan di Doloksanggul, Rabu (15/7). Kejadian itu, katanya, selain menimbulkankemarahanwarga, juga kepolisian dinilai tidak berpihakkepadarakyat. Ketikahutan kemenyan milik warga dibabat

PT TPL , polisi sama sekali tidak melakukan tindakan apapun. Tetapi kepada warga Polres Humbahas bertindak kejam dengan menangkap paksa. “Akibatnya, pasca kepergian polisi dari Desa Pandumaan, warga langsung unjuk rasa ke Polres Humbahas. Ratusan warga berunjuk rasa ke Polres, warga juga memutuskan untuk menginap di kantor Polres dengan tuntutan agar ke tiga warga Pandumaan yang ditangkap segera dibebaskan. Wakapolres Humbahas Kompol Siregar mengatakan, tidak akan ada penangkapan terhadapwarga.Sementaraketika ditanyakan tentang adanya penambahanjumlahpersoniluntuk melakukan sweeping dan penangkapan terhadap warga, Siregar mengaku tidak ada. “Untuk sementara tidak ada penangkapan dan juga tidak ada penambahan personil dari Polres lain,” terang Siregar.

WargaDesaPandumaanmengaku sangat terkejut dan trauma dengan penangkapan ini, karena selain menangkap secara paksa, polisi juga mengambil paksa 14 unit mesin pemotong milik TPL yang telah diamankan warga beberapaminggulalu.Mesindiambil paksa dengan membongkar kamar tempat penyimpanan selamainiyaknirumahmilikKersi Sihite. Maratal Lumban Batu, 55, warga Pandumaan mengatakan, polisi merusak gembok kamar tempat penyimpanan dan membawa barang tersebut ke Polres. Diajugamenambahkan,sebelumnya polisi juga melakukan sweepingkerumahwargayangdicurigai menjadi tempat persembunyian beberapa orang yang menjadi target polisi, katanya. Ketiga warga yang ditangkap James Sinambela, 49, Biner Lumbang Gaol, 56, dan Mausin Lumban Batu, 60, ditangkap saat pulang dari pesta keluarga. (a13)

Perampok Bergumul Dengan Korban Akhirnya Babak Belur Dihajar Massa LABUHANRUKU (Waspada) : Dua tersangka perampok MHs, 32 warga LingkunganVIII, Seberang Perdagangan, Kab. Simalungun ,NSp,25 warga yang sama mengalami nasib sial babak belur dihajar massa ketika beraksi merampok korbannya Murni,27 warga Dusun III, Teratak, Desa Perkebunan Sei Bejangkar, Sei Balai, Batu Bara, Rabu (15/7) Menurut Murni didampingi suaminya Selamat,di Polsek Labuhan Ruku, Rabu (15/7) peristiwa perampokan terjadi sekira pukul 15.40 berawal korban naik sepeda motor membon-

ceng adiknya Nurmita ,16, anaknya Rodi 3,5 belanja ke toko kelontong tidak jauh dari rumahnya. Ketika pulang korban berpapasan dengan dua orang pria mengendarai sepeda motor Suzuki Satria BK 4497 KB. Kemudian kedua pria tadi berbalik arah mengikuti dari belakang. Di tempat agak sepi sepeda motor korban dipepet langsung menarik baju Murni hingga koyak dan korban jatuh Saat itu salah seorang perampok bertubuh besar langsung menangkap korban mau merampas kalung emas dipakainya. Ternyata korban memberikan

perlawanan sempat bergumul sampai akhirnya kalung mas 7 gram melilit leher korban dirampas. Merasa berhasil pelaku coba lari naik sepeda motor temannya menunggu saat yang sama korban berupaya menjerit minta tolong, warga mengejar pelaku. Akhirnya pelaku mengaku bernama MHS berhasil ditangkap massa sekaligus menghajarnya babak belur dan NSP mengalami tidak separah temannya. Kapolsek Labuhan Ruku AKP Mijer melalui Kanit Reskrim Aiptu R.Tambunan, Kamis (16/7) membenarkan. (a30)


Sumatera Utara 20 SMPN 2 Hutaraja Tinggi Kekurangan Sejumlah Desa Di Padang Guru Dan Mobiler Lawas Masih Terisolir SIBUHUAN (Waspada): Sejumlah desa di kawasan Luat Sihapas, Kec. Barumun Tengah, Kab. Padang Lawas terisolir dari daerah luar, infrastruktur jalan menuju wilayah yang berbatas langsung dengan Kab. Padang Lawas Utara itu belum tersentuh pembangunan. Hal itu terlihat saat Waspada menyusuri jalan sepanjang 16 kilometer dari Jalan Lintas Provinsi Simpang Marenu menuju Desa Padang Kasior, Rabu (15/ 7), bersama rombongan Bupati PadangLawasBasyrahLubisyang melakukan kunjungan kerja dan silaturahim dengan Pengajian Amaliyah Akbar di balerong Pekan Minggu, Desa Padang Kasior. Padahal desa yang masih terisolir akibat kondisi sarana perhubunganitu memilikipotensi Sumber Daya Alam (SDA) yang begitu besar khususnya di sektor pertanian, baik tanaman pangan hortikultura maupun tanaman perkebunan terutama kelapa sawit yang sudah mengeluarkan produksi sedikitnya 200 ton per putaran (2 mingu) dan karet 20 ton tiap minggu. Badanjalanyangdilaluimasih tanahliatyangbelum mengalami pengerasan ataupun perbaikan. Hampirdisetiapbukujalanterdapat lubang besar dan gundukan tanah karena badan jalan tidak mempunyai parit, kemudian bekasrodakendaraanyangmelintas dimusim hujan mengakibatkan permukaan jalan tidak rata, sehinggasangatsulitdilaluikendaraan terutama roda empat. Jembatan kerangka Baja sepanjang 100 M di atas Sungai Barumun yang dibangun sekira 2003 lalu di Desa Marenu dalam keadaan rusak dan sudah sangat menghawatirkan, karena lantai

PADANG LAWAS (Waspada): SMP Negeri 2 Hutaraja Tinggi, Kab. Padang Lawas kekurangan guru dan mobiler untuk sarana belajar. Sehingga untuk mendukung program pemerintah dalam meningkatkan kualitas pendidikan tidak maksimal. Menurut warga dan Ketua Komite Sekolah SMP 2 Hutaraja Tinggi Rosnila Rambe, Rabu (14/ 8), kondisi SMP 2 di Desa Ujung Batu III, Kec. Hutaraja Tinggi yang dibangun sejak tahun 1990

Waspada/Syarif Ali Usman

RUSAK: Bupati Padang Lawas Basyrah Lubis Bersama Sekretaris Camat Barumun Tengah Hamzah Nasution saat meninjau infra struktur jalan ke kawasan Luat Sihapas , Rabu (15/ 7). Kerusakan jembatan rangka baja berlantai kayu di atas Sungai Barumun yang melintas di Desa Marenu salah satu penyebab kawasan itu terisolir. jembatan yang masih terbuat dari kayu mulai rapuh dan sebagian telah patah. Selain itu, jembatan Aek Sioli-oli yang terbuat dari pokok kelapa juga masih sangat sulit dilalui. Prioritas Dalam kesempatan acara yangdihadirisedikitnya700warga pengajian itu Bupati Padang Lawas Basyrah Lubis mengatakan, jalanmerupakansaranayang sifatnya sangat vital dalam menunjang pertumbuhan ekonomi masyarakat, Pemkab Padang Lawas akan memprioritaskan pembangunan jalan tersebut hingga selesai. “Bilabelumselesaidalamsatu tahun anggaran maka tahun berikutnya akan kita anggarkan kembali sehingga arus lalu lintas ke luat Sihapas ini tidak terkendala,” ujar Bupati.

Secara terpisah, Ginda Maratua Harahap, 42, warga Desa Padang Kasior, kepada Waspada mengatakan,bilamusimkemarau seperti sekarang ini, kendaraan roda empat dapat melewati Sungai Sihapas dan langsung ke Pekan Minggu yang berada di Padang Kasior Lombang. Namun bila musim hujan tiba, lanjut Ginda, kendaraan yang mengangkuthasilpertanian dan perkebunan hanya menunggu di seberang sungai. Untuk membawa hasil bumi, warga harus memundak atau mengangkut dengan sepeda kayuh melewatititigantungyangberada di Desa Silenjeng, Sedangkan kendaraan yang mampumenjadiangkutan harus gerdang dua karena tanah di badan jalan licin dan lengket, Akibatnya biaya pengangkutan me-

pertumbuhan ekonomi Madina dapat dilihat dari PDRB, di mana pada tahun 2008 atas dasar harga berlaku sebesar Rp3.085.119,38 atau meningkat 15,60 persen dari tahun 2007 sebesar Rp 2.603. 792,06danPDRBperkapitatahun 2008 sebesar Rp7.281.016,11 atau meningkat 14,36 persen dari tahun2007sebesarRp6.235.282,56 dengan laju inflasi sebesar 15,36 persen. Laju pertumbuhan ekonomi yang dicapai pada tahun 2008 lanjut bupati, sebesar 6,50 persen atau mengalami peningkatan 0,4 persen dari tahun 2007 sebesar 6,46 persen. “Berdasarkan harga konstan tahun 2000, sektor pertanian masih tetap sebagai penyumbang terbesar perekonomian Madina yaitu 46,36 persen,” ungkapnya.

Menurut bupati, hal itu menunjukkan adanya pergeseran tahap demi tahap terhadap struktur perekonomian, di mana masing-masing sektor semakin menunjukkan peningkatan yang signifikan,initidakhanyadidominasi oleh sektor pertanian akan tetapi sudah merambah ke sektor lainnya. Amru Daulay pada sidang paripurnadewandipimpinpelaksana Ketua As Imran Khaitamy Daulay, SH juga menyampaikan beberapa keberhasilan dicapai Madinasebagaibagianyangtidak terpisahkan dari keberhasilan secara bersama-sama dalam penyelenggaraanpemerintahandan pelaksanaan pembangunan. Keberhasilantersebutberupa penghargaan Pamong Award

maupundidalampemerintahan, dalam mensukseskan program kerja dan pembangunan serta kebijakan Bupati Tapsel Ongku P Hasibuan. Kakan Tibum dan Satpol PP PemkabTapsel, Batara Hasibuan mengatakan itu dalam amanatnya pada upacara itu. Menurutnya, mutasi di jajaran pemerintahanadalahhallumrahdanbiasa dilaksanakan. Selain untuk penyegaran dan peningkatan etos kerja pegawai, juga untuk perputaran roda organisasidanpeningkatankarir.Jabatan yang diemban adalah satu amanah yang mesti dijalankan

dan dipertanggungjawabkan. Satpol PP, terangnya, merupakan salah satu alat negara dan khususnya pemerintah daerah yang memiliki peranan strategis menjalankan fungsi stabilitas dalampenyelenggaraanpemerintahan di daerah. Apaun 10 personil Intelkam yang dilantik itu, Alinur Hanafiah Lubis sebagai Komandan Intelkam, Mukmin Siregar wakil Komandan Intelkam. Kemudian R Mangapul Simatupang, Amin, Samaruddin Harahap, Salman, Sunardi, Suandi, Ahmad Suryadi dan Aminuddin Lubis sebagai anggota. (a20)

Gubsu Buka Synode Am XVI GKPA P.SIDIMPUAN (Waspada): Gubernur Sumtaera Utara, Samsul Arifin diwakili Kadis Kelautan Perikanan Yosef Siswanto, secara resmi membuka Synode Am (kerja) XVI Gereja Kristen Protestan Angkola (GKPA) di P. Sidimpuan, Rabu (15/7). Rapat evaluasi kerja itu mengangkat tema “Peran dan Fungsi Gereja Dalam Menghadapi Krisis Global dan Era Modernisasi”. GFKPA sendiri merupakan satu-satuanya gerja dunia yang berkantor pusat di wilayah Angkola. Synode itu membahas tiga masalah yang muncul akibat keserakahan manusia. Yakni krisis global, pemanasan global, dan munculnya berbagai macam penyakit. Bupati Tapsel Ongku P Hasibuan juga mengungkapkan rasa bangganya pada pembukaan synode tersebut. Karena GKPA satu- satunya gereja yang berkantor pusat di daerah Angkola. Walikota P. Sidimpuan Zulkarnain Nasution diwakili Asisten III Khairul Almasyah Nasution mengharap peran

kini telah mencapai 178 siswa, sedang bantuan mobiler dari pemerintah sesuai pertambahan murid tidak ada. Untuk itu para orangtua murid bersama pihak komite sekolah sangat berharap agar pemerintah Kab. Padang Lawas di bawah pimpinan Bupati Basyarah Lubis danWakil Bupati H Ali Sutan Harahap sesuai dengan visi misinya diharap memberi perhatian serius terkait masalah kekurangan guru di daerah ini. (a32)

Email: iklan_waspada@yahoo.co.id

Kakan Satpol PP Tapsel Lantik 10 Personil Intelkam P.SIDIMPUAN (Waspada): Kepala Kantor Ketertiban Umum dan Satuan Polisi Pamong Praja PemkabTapanuli Selatan, Batara Hasibuan, melantik 10 personil Intelkam baru dan memutasi 4 personil lama menjadi staf biasa. Pelantikan berlangsung dalam satu upacara yang berjalan sederhana dan khidmat di halaman kantor Jalan Tapian Nauli, Padang Sidimpuan, Rabu (15/ 7). Pembentukan satuan Intelkam ini sangat penting dalam membantu tugas pimpinan kantor itu. Yakni sebagai ‘mata’ dan ‘telinga’ kepala kantor, baik di luar

memberikan bantuan pengadaan meja kursi untuk siswa baru, katanya. Kepala SMP N 2 Hutaraja Tinggi, Rusianto, SPd membenarkan kondisi sekolah yang dipimpinnya itu masih membutuhkan guru dan mobiler. Kondisi ini diakibatkan terjadinya peningkatan siswa dari tahun ke tahun, setiap kali penerimaan murid baru. Sejak tahun 2006 menjabat sebagai kepala SMP N 2 Hutaraja Tinggi, jumlah siswa masih 120 orang,

Jumat 17 Juli 2009

Pasang Iklan Hub. 4528431 HP. 081370328259

lonjak sehingga hasil pertanian dan perkebuanan dari kawasan itu anjlok. Sebenarnya, kata Ginda, ada enam jalan pintu masuk menuju Kawasan Luat Sihapas tersebut, yakni, dari Kecamatan Sosopan di Desa Banua Tonga dan dari Simpang Marenu, selain itu bisa juga dari Kab. Padang Lawas UtarayaitudariDesaPadangGarugur, Naga Saribu, Poken Salasa dan Portibi. Namun, kata Ginda, seluruh jalan yang menjadi pintu masuk ke kawasan Sihapas masih dalam kondisi belum dibangun, baru merupakanbadanjalankalaupun sudah tembus . Adapun desa yang masih terisolir tersebut yakni Desa Gulangan, Aek Goti, Silenjeng, Tanjung Morang, Simaninggir, Ujung Gading dan Padang Kasior serta beberapa desa lainnya. (crif)

Sektor Pertanian Penyumbang Terbesar Perekonomian Madina PANYABUNGAN(Waspada): Bupati Madina H Amru Daulay, SH mengatakan, sektor pertanian masihtetapsebagaipenyumbang terbesar perekonomian di Kab. Mandailing Natal yaitu sekira 46,36 persen. Sektorinidiikutisektorperdagangan/hotel dan restoran,jasajasa,bangunan,pengangkutandan komunikasi, industri, keuangan/ persewaan dan jasa perusahaan, pertambangan dan penggalian serta listrik/gas serta air minum. Hal itu disampaikan Amru Daulay diwakili Wakil Bupati Hasim Nasution dalam Laporan Keterangan Pertanggung Jawaban (LKPJ) dan pertanggungjawaban pelaksanaan APBD TA 2008 pada sidang paripurna DPRD Madina, Kamis ( 16/7). Dikatakan, secara umum

hingga sekarang tidak pernah terlepas dari masalah kekurangan guru. Begitu juga halnya dengan saran belajar seperti meja dan kursi yang juga masih kekurangan, sedang kondisi murid setiap tahunnya meningkat, maka tidak heran sampai sekarang masih kekurangan meja kursi untuk satu lokal yang berisikan 40 murid. Tetapi mengingat kebutuhan mendesak, maka para orngtua murid bersama pihak komite sekolah

WASPADA

GKPA dalam pembangunan semakin dikembangkan. Khususnya pembangunan keimanan warga jemaatnya. Parlindungan Purba anggota DPD RI asal Sumut, pada kesempatan itu mengatakan, pimpinan itu adalah pelayan. Sebagai pelayan harus mampu berkomunikasi dengan warga,

berkomunikasi dengan diri serta harus mampu komunikasi dengan Tuhan. Turut menyampaikan sambutan mewakili Gereja Mencanegara yaitu Mariche dari Swiss. Mariche menonjolkan masalah perlunya konservasi lingkungan dan budaya, khususnya ulos Batak. (a20)

Waspada/Sukri Falah Harahap

ULOS: Ketua panitia Synode Am XVI GKPA disaksikan BUpati Tapsel Ongku P Hasibuan dan anggota DPD RI Parlindungan Purba, menyematkan ulos kepada Kadis Kelautan Perikanan Sumut Yosef Siswanto, Rabu (15/7).

tahun 2008 diserahkan Mendagri kepadaAmruDaulaypada18November 2008diJakarta,CitraPelayanan Prima dari Menteri Pendayangunaan Aparatur Negara pada 13 Oktober 2008 di Jakarta serta Anugerah Aksara Tingkat Madya diserahkanWakil Presiden RI pada 8 September 2008 di Denpasar Bali. Rapat paripurna DPRD Madina itu akan dilanjutkan, Selasa (21/7) guna mendengarkan pandangan umum babak pertama fraksi-fraksi atas LKPJ dan pertanggungjawaban pelaksanaan APBD TA 2008 itu. (a24)


Jumat 17 Juli 2009

Komisi AMinta Pemerintah Perhatikan Pengamanan Di Pelabuhan KISARAN (Waspada): Komisi A DPRD Kabupaten Asahan minta Pemkab membenahi pengamanan di Pelabuhan Panton Bagan Asahan, serta meningkatkan kewaspadaan terhadap dermaga-dermaga kecil yang tersebar di wilayah Asahan. “ Asahan memiliki pelabuhan dan dermaga tikus yang ada di wilayah ini, sehingga tidak menutup kemungkinan, jaringan narkoba internasional menggunakan pelabuhan dan der-

maga itu untuk pintu masuk mereka “ Ujar Sekretaris Komisi A DPRD Asahan Syamsul Qodri Marpaung kepada Waspada, Rabu (15/7). Oleh sebab itu, kata Marpaung, diharapkan pemerintah dan seluruh jajarannya, memperhatikan tingkat pengamanan yang ada di pelabuhan, serta mengawasi dermaga-dermaga kecil yang ada di Asahan, terkait banyaknya pengedar narkoba internasional tertangkap di

wilayah hukum Polres Asahan. “ Mereka yang tertangkap, karena menggunakan pelabuhan sebagai pintu masuk, tidak tertutup kemungkinan ada yang lolos dari mereka karena menggunakan dermaga kecil,” jelas Marpaung sekaligus ketua Fraksi PKS DPRD Asahan. Pintu Masuk Penyakit Selain pintu masuk narkoba, jelas Marpaung, pelabuhan juga sebagai pintu masuk berbagai penyakit dari luar negri, sehingga

perlu adanya perhatian khusus terhadap masalah itu. “ Pelabuhan yang ada di Batu Bara dan Kota Tanjung Balai belum mempunyai alat pendektesi suhu tubuh (body clean disinfectan) bagi penumpang yang datang dari luar negri, sehingga besar kemungkinan penyakit dari luar negri masuk di Asahan, Batu Bara dan Kota Tanjung Balai, lebih baik mencegah dari p a d a m e n g o b a t i ,” j e l a s Marpaung. (csap)

Proyek Normalisasi Dinas Pengairan Sumut Dinilai Mubazir BILAH HILIR (Waspada): Proyek normalisasi air Dinas Pengairan Sumatera Utara sepanjang 2.500 meter serta pembangunan satu unit pintu klep yang menelan biaya sekitar Rp 350 juta TA 2008 di Dusun Sei Kasih Dalam, Desa Sei Kasih, Kec. Bilah Hilir, Kab. L. Batu dinilai mubazir. Salah seorang tokoh masyarakat Bilah Hilir Osnel Manik menyampaikan itu kepada wartawan, Selasa (14/7) di kediamannya. Menurutnya, proyek nor-

malisasi bertujuan mengatur debit air guna meningkatkan hasil pertanian tanaman padi masyarakat suatu daerah tertentu. Namun fakta di lapangan menunjukkan, areal persawahan hanya tersisa 10 hingga 15 hektare saja. Sebab, saat ini warga setempat jauh lebih tertarik memilih menanam kelapa sawit ketimbang menanam padi di sawah. Selain bangunan pintu klep yang sudah retak-retak di dua bagian, titik letak bangunan juga terlalu dekat dengan anak sungai

di mana areal sawah yang akan dialiri berjarak 2 km lagi, semuanya ini menggambarkan perencanaan yang kurang matang, ungkapnya. Dikatakan, pembangunan yang baru beberapa bulan dilaksanakan namun sudah retak-retak, hal ini termasuk pembodohan kepada masyarakat. “Kualitas bangunan tidak sesuai dengan besarnya anggaran, jelas pembodohan kepada masyarakat,” terangnya. Kepala Dusun Sei Kasih Dalam Surianto, saat ditemui

wartawan, di lokasi bangunan pintu air membenarkan areal persawahan di dusunnya berkisar 10 hingga 15 ha saja. “Proyek ini dikerjakan akhir 2008, namun pintu klepnya sudah retak-retak,” ujarnya sembari mengangkat jemarinya menunjuk dua titik bangunan yang sudah retak menganga. KTU UPT Kualuh Barumun Amir Bonif Saragih, ketika beberapa kali dihubungi melalui selular tentang proyek normalisasi, ponselnya tidak aktif. (a27)

Paluta Daerah Beriman Dan Beradab, Terganjal Pakter Tuak BAGAIMANA mewujudkan Padang Lawas Utara yang beriman dan beradab, jika warung tuak atau pakter ruak saja bebas ‘berkeliaran’. Padahal penduduk daerah ini hampir 90 persen muslim. Jikasebelumnyawarungatau pakterminumankerastradisional itu berada di sudut-sudut kampung. Sekarang malah makin berani di pinggir jalan dan malah ditengah-tengahperkampungan. Keberadaan pakter tuak di Paluta, sudah di sembarang tempat.Tidakmengindahkankaidahkaidah yang berlaku dalam masyarakat, apalagi rasa malu. Paluta memang terkenal denganminumancuka-nya(sejenis tuak, tapi kadar alkohol lebih rendah). Masyarakat di sana, mulaiyangtuasampaianak-anak hampir sebagian besar pernah meneguk cuka dan apalagi di hari raya. Minuman khas itu merupakan warisan turun temurun dan jadi bagian kecil budaya di sana. Cuka rasanya manis, minum satu teko di siang hari, mabuknya baru terasa di malam hari. Itupun mabuk sikit atau ‘tenggen manis’. Tapi sekarang di Paluta cuka sudah ‘ditingkatkan’ penjualnya menjadi tuak yang kadar alkoholnyalebihtinggi.Pakternyapun terang-terangan didirikan di pinggir jalan lintas umum dan tengah pemukiman penduduk. Berarti dari segi minuman keras, telah terjadi urbanisasi cita rasa masyarakat Paluta, dari cuka berkadar alkohol ringan ke tuak yang alkoholnya lebih tinggi. Hal ini dikhawatirkan merusak generasi penerus di wilayah itu menjadi generasi pemabuk. Pimpinan Ponpes Gunung

21

Sumatera Utara

WASPADA

Waspada/Sori Parlah Harahap

PAKTER TUAK: Saat ini pakter tuak kini mudah ditemukan di Paluta. Daerah ini punya minuman khas sejenis bernama cuka, tapi sekarang sudah beralih ke tuak dengan kadar alkohol lebih tinggi. Pada gambar, pakter tuak didirikan di tengah pemukiman warga. Foto direkam beberapa waktu lalu Raya, Desa Gunung Baringin, Kec. Portibi Amir Mahmud Hasibuan menilai persoalan ini harus segera diatasi. Tujuannya demi pembangunan generasi penerus yang insani dan pergerakan pembangunan bangsa yang rabbani. Pembentengan individu, katanya,haruslebihdidahulukan. Yakni dengan melakukan penghindaran dari sumber maksiat seperti pakter. Perbaikan pergaulan,perilakusosial,danmelaksanakan kewajiban yang ditetapkan-NYA. “Kita akan mencegah kelakuan munkar, salah satunya minum minuman keras seperti tuak, yang penjualannya ‘merajalela’ di Paluta. Kemudian mendesak pemerintah segera membuat peraturan daerah tentang pelarangan peredaran minuman keras,” ujarnya. Sementara itu Malintang Hasibuan, SAg, seorang guru, menakutkan jika kebebasan

berjualan minuman keras seperti tuak dibiarakan di Paluta. Akan menimbulkan kendala dalam pembinanaan generasi ke depan. Hal senada diungkapkan Kabid Kesejahteraan Rakyat DPD Partai Keadilan Sejahtera (PKS) Paluta, Risnawati Siregar. Dia melihat keberadaan pakter tuak telahbanyakditemukandisepanjang pinggiran jalan Paluta. “Kita telah menerima berbagai keluhan masyarakat dan keresahan para orang tua, utamanya yang memiliki anak di atas 15 tahun. Yakni tentang bebasnya penjual minuman keras tradisional di Paluta,” katanya. Pihaknyajugaakanmendesak pemerintah daerah untuk segera membuat peraturan daerah dan mengaplikasikannya dengan intens di lapangan. Karena tuak bisa menimbulkan perbuatan munkar dan malah menjurus pidana. “Kami melihat sebagian masyarakat Paluta saat ini telah

menjadikan tuak sebagai kebutuhan sehari-hari. Pantauan kita, hampir tiap hari pakter tuak di Paluta ramai pengunjung,” katanya. Dimintanya kepada pemerintahdaerahdanseluruhelemen masyarakat, agar segera dan bersama-sama mengatasi persoalan ini. Yakni dengan melakukan tindakan bermanfaat. Demi tercapainya masyarakat Paluta yang harmonis, sejahtera, beriman, dan beradab. Sukri FH/ Sori Parlah Harahap

Seleksi Calon Taruna Baru STP Di Batu Bara LABUHANRUKU (Waspada): Sebanyak 49 peserta mengikuti seleksi calon taruna baru program diploma IV Sekolah Tinggi Perikanan (STP) Jakarta RayonBatuBaradiSMKN1Talawi di Desa Mesjidlama, Kab. Batu

Bara, Selasa-Sabtu (14-18/7) . Seleksi langsung ditangani pelaksana dari STP Jakarta, Ir Soeharto,MSi,TitikPrasetiyoRahayu, MPD, Ani Lai lani, MSi dibantu empat orang alumni STP. Soeharto didampingi Kepala

SMKN 1Talawi Aladin, Rabu (15/ 7) mengatakan, seleksi calon taruna baru program diploma IV STP tahun akademik 2009/2010 dilaksanakanserentak27rayonseIndonesia dan 1 rayon pusat di STP. Untuk Sumut seleksi diada-

kan3rayon,Sibolga,P. Sidimpuan, Batu Bara. Khusus rayon Batu Baradiikuti49pesertaterdirisiswa lulusan SMKN, SMA, MA dari Medan, Tapsel, Madina, Asahan, Tanjung Balai, Rantauprapat dan Aceh.(a30)


22 13 Pelajar Asal L. Batu Belajar Gratis Ke Darul Ilmi Murni RANTAUPRAPAT(Waspada): Sebanyak 13 pelajar asal Labuhan Batu yang telah lulus tes masuk sekolah ke Islamic International School Darul Ilmi Murni Medan, yang dibiayai pendidikannya selama tiga tahun baik itu di tingkat SMP maupun SLTA, dengan biaya pribadi HT Milwan dan Hj. Adlina, Rabu (15/7) dilepas keberangkatannya dari Pendopo Kabupaten Labuhan Batu. HT Milwan pada kesempatan itu berpesan kepada para siswa, untuk belajar dan belajar. Anak-anak ke depan harus menjadi pemimpin masa depan.’’Kalaupun gagal kami dan juga orang tua kamu akan ikut bersedih. Untuk itu kamu harus berhasil dan setelah lulus nantinya dari Perguruan Darul Ilmi Murni, anak-anak sudah punya bekal untuk melanjutkan ke Perguruan Tinggi,’’ kata Milwan mengingatkan. Kadis Pendidikan Labuhan Batu Heriyanto pada kesempatan itu mengatakan, dari hasil seleksi yang diselenggarakan di Rantauprapat pada tanggal 22 Juni 2009 lalu dengan jumlah peserta keselu-ruhannya sebanyak 384 orang, terdiri dari siswa SD untuk masuk SMP sebanyak 357 orang dan siswa SMP untuk masuk SLTA sebanyak 27 orang telah lulus seleksi sebanyak 19 orang, untuk tingkat SMP sebanyak 13 orang dan tingkat SLTA sebanyak 6 orang. Dari 13 siswa SD yang akan memasuki SMP tersebut ada empat orang yang tidak mau melanjutkan ke perguruan Darul Ilmi Murni dengan alasan tidak bisa pisah dengan orang tua, sedangkan siswa SMP yang masuk SLTA, ada dua orang yang tidak melanjutkan ke perguruan bertaraf internasional itu dengan alasan sudah masuk dan diterima di salah satu SMA Plus, jelas Heriyanto. Sebelum acara salam-salaman dan foto bersama, Hj. Adlina T Milwan secara spontan memberikan uang tali asih kepada masing-masingsiswauntukbekaldiperjalananmenujuPerguruan Darul Ilmi Murni Medan. (c01)

Sumatera Utara Anggota DPRDSU Minta Aktifitas Truk Balok Dihentikan RANTAUPRAPAT (Waspada): Anggota DPRDSU A.Ikhyar Hasibuan selaku Ketua Tim Reses DPRD Sumut meminta Pemerintah Provinsi Sumatera Utara menghentikan operasional truk balok yang melintas di Jalinsum dari Garingging Kabupaten Padang Lawas Utara (Paluta) menuju Dermaga Tanjung Sarang Elang, Kecamatan Panai Hulu, Kabupaten Labuhan Batu setiap jika kontribusinya tidak jelas ke pihak Pemerintah Provinsi Sumatera Utara. Hal itu diungkapkannya didampingi anggota Zaki Abdullah. Efendi Naibaho, Adman Daulay di Negeri Lama, Kecamatan Bilah Hilir Kabupaten Labuhan Batu, Jumat, (10/7)

Penghentian itu diusulkan, karena ratusan truk mengangkut logging mapun kayu jenis akasia menuju dermagaTanjung Sarang Elang sarat dengan tonase yang berlebihan yang tidak sesuai dengan ketentuan. Akibatnya, selain jalan provinsi akan semakin hancur. Sementara Zaki Abdullah menyatakan pengusulan, anggaran perbaikan jalan provinsi khususnya ke daerah penghasil karet dan sawit ini akan sangat lama, di mana harus masuk daftar antri dari 33 kabupaten dan kota yang ada di daerah ini. “Anggaran Rp2,5 miliar per tahun untuk pemeliharaan Jalinsum di Labuhan Batu, apakah itucukup?”ungkapZakiAbdullah.

Bantuan Eks Banjir Diberikan P. BRANDAN (Waspada): Guna meningkatkan mutu dan prestasi anak didik, siswa berprestasi SMPN 2 Babalan Langkat diberikan bantuan baju dan tas bantuan eks banjir. Demikian Kasek SMPN 2 Eddy, SPd kepada Waspada, baru-baru ini. Untukpenerimaanmuridbaru(PMB)diSMPN2diterimasebanyak delapan ruangan per kelas 32 siswa dan sementara bea siswa diterima sebanyak70orangdansaatiniparasiswamenerimasebanyakRp560.000 dibayar dua kali, ujarnya. Kasek SMPN 2 Babalan dan sebelumnya Kasek SMPN 1 Besitang ditahun 2009 telah menilai para siswa yang berprestasi sebanyak dua orang dan tiga siswa berbakat, tandasnya. (c02)

Untuk itu katanya lagi, pihak PT Sumatera Riang Lestari (SRL) selaku investor harus memikirkan kontribusi yang jelas ke Pemerintah Sumatera Utara. Humas PT Sumatera Riang Lestari (SRL), Ansari ketika dihubungi melalui selularnya, Senin (13/7) terkait kontribusi perusahaan pengangkutan logging serta akasia terhadap pemprovsu mengatakan, perusahaan tempatnya bernaung mengadakan MoU dengan pengelola dermaga Tanjung Sarang Elang hitungan jam. “Kontraknya hitungan jam, persisnya saya tidak tahu, kebetulan lagi cuti 2 minggu pak,” ungkapnya. Syahbandar Tanjung Sarang Elang J. Gultom ketika dikonfirmasi, Selasa (14/7) mengatakan tidak ada semacam MoU dengan pihak PT SRL “Pengelola Dermaga Tanjung Sarang Elang hanya bersifat jasa penyedia tempat,” ungkapnya. (c01)

WASPADA Jumat 17 Juli 2009

Camat Deli Tua Resmikan PAUD Al-Hidayah DELITUA (Waspada): Camat Deli Tua Citra Effendi Capah meresmikan Pendidikan Anak Usia Dini (PAUD) Al-Hidayah binaan PKK Desa Kedai Durian di Jalan Damai, Dusun II, Desa Kesai Durian, Selasa (14/7). Hadir dalam peresmian Kacabdis Pendidikan Deli Tua, Ka Kua Deli Tua, Kades Mekar Sari, Kades Suka Makmur dan Kades Kedai Durian Zainul Ahyar, ketua tim penggerak PKK Desa KedaiDurianSuarniZainulAhyar, ibu-ibu dan undangan lainnya. Camat Deli Tua dalam sambutannya mengatakan, dengan peresmian PAUD Al-Hidayah ini maka sudah ada lima PAUD yang ada di Kecamatan DeliTua sekaligus mewujudkan gerakan CERDAS yang dipelopori Bupati Deli Serdang Drs. Amri Tambunan. “Namun dari semua ini hanya PAUD Al-Hidayah yang namanya cukup islami. Artinya ada pintu yang terbuka untuk kebenaran,” jelas Capah. Menurut Capah, PAUD yang barudibukainisudahmempunyai anak didik mencapai 94 orang yang berusia 5 tahun ke bawah. Capah juga menjelaskan, kalau PAUD ini sama dengan Play

Waspada/Rudi Arman

Camat Deli Tua Citra Effendi Capah didampingi Kades Kedai Durian Zainul Ahyar foto bersama ibu-ibu PKK dan calon murid PAUD Al-Hidayah usai peresmian, Selasa (14/7). Group,TKA,RA.“Yangbedahanya namanya saja. DiharapkanPAUD yang baru diresmikan ini bisa berkembang cukup baik,” harap Camat Deli Tua. Ketua PKK Desa Kedai Durian Suarni Zainul Ahyar mengatakan, PKK Desa Kedai Durian merasa terpanggil untuk mendirikan PAUD Al-Hidayah walaupundenganusahasendiridandapat dukungan Kades Kedai Durian. Sedangkan Kades Kedai

DurianZainulAhyarmengatakan, PAUD ini bisa menampung anak usia 5 tahun ke bawah yang orang tuanya kurang mampu. “Karena untuk biaya pendaftara PAUD ini pihakorangtuahanyamembayar Rp 10 ribu,” jelasnya. Berdirinya PAUD yang diprakarsai ibu-ibu PKK Desa Kedai Durian ini lanjutnya, untuk mewujudkan program CERDAS dari Bupati Deli Serdang Amri Tambunan. (m39)


WASPADA, Jumat 17 Juli 2009

23


24

Aceh B. Aceh, Sigli, Bireuen, Lhokseumawe

Harris Dan Vivi Duta Wisata Aceh Tahun 2009 BANDA ACEH (Waspada): Harris Siddiq dari Lhokseumawe dan Vivi Anggraini dari Aceh Utara dinobatkan menjadi Duta Wisata Aceh Tahun 2009, setelah menyisihkan 34 peserta dari berbagai kabupaten/kota. Di babak tiga besar, Harris dan Vivi menyisihkan dua pasangan lainnya setelah meraih nilai tertinggi dari sejumlah materi yang diberikan tim juri. Keduanya dinobatkan sebagai Duta Wisata Aceh Tahun 2009 oleh Wagub Muhammad Nazar di Taman Budaya Aceh (TBA), Rabu (15/7) malam. Dalam sambutannya, Wagub menyatakan acara ini merupakan inisiatif yang sangat strategis dan konstruktif, di mana saat ini Pemerintah Aceh juga sedang melakukan upaya membangun citra (image) Aceh melalui berbagai kegiatan dalam mensosialisasi kondisi damai Aceh pasca konflik dan tsunami. “Acara ini juga menjadi wahana penting untuk mempromosi Aceh, khususnya keunggulan dan daya tarik pariwisata daerah kepada masyarakat di luar Aceh, sekaligus membangun kesadaran generasi muda Aceh untuk terus menjaga dan melestarikan budaya asli daerah,” papar M. Nazar. Duta Wisata Aceh, kata dia, memiliki peran dan posisi strategis sebagai ujung tombak, sekaligus memiliki kemampuan mengemban fungsi advertensi dan jiwa marketing dalam menyebarluaskan pesona pariwisata dan sejarah Aceh kepada seluruh masyarakat di nusantara dan mancanegara. Karena itu, para Duta Wisata Aceh harus terus membekali diri dengan berbagai kapasitas, serta penguasaan kebudayaan dari suatu daerah tujuan wisata. Kadis Kebudayaan dan Pariwisata Aceh, Drs. H. Mirzan Fuadi, MM, menyebutkan, lomba Duta Wisata Aceh Tahun 2009 ini diikuti 36 peserta dari 18 kabupaten/kota di Aceh. Sedangkan materi yang diuji meliputi kebudayaan, pariwisata, Bahasa Inggris, penampilan/pengembangan kepribadian, pengetahuan umum (sosial politik, agama, presentasi, dan atraksi).(b07/b32)

Hutan Pidie Masih Tergolong Baik SIGLI (Waspada): Hutan di wilayah pegunungan Kab. Pidie masih tergolong baik, dibanding daerah lain di Provinsi Aceh. “Kendati begitu kita harus selalu menjaga dan waspada terhadap kerusakan hutan,” kata Kadis Perkebunan dan Kehutanan Kab. Pidie, Ir. H. M. Amin Afan, Msi usai menghadiri pembukaan pendidikan dan pelatihan pengamanan hutan tingkat dasar di Wisma Safira, Blang Paseh, Kota Sigli, Kamis (16/7). Menurut dia, semua komponen masyarakat di daerah itu berkewajiban menjaga kelestarian hutan dan lingkungannya, supaya tidak berdampak buruk bagi masa depan anak, cucu kita di masa datang. Selama ini, kata M. Amin, akibat kerusakan hutan telah terjadi perubahan iklim dan efek rumah kaca yang dapat menimbulkan pemanasan global di permukaan bumi. Selain itu kelestarian hutan penting dijaga dalam upaya mempertahankan kesinambungan ketersediaan air di sejumlah Daerah Aliran Sungai (DAS), sehingga para petani tidak kesulitan memperoleh air di sawah. Kepada Waspada, ia mengakui perambahan hutan telah terjadi di beberapa wilayah pegunungan, namun aksi itu dapat dicegah petugas dengan melakukan pendekatan kepada masyarakat, serta melakukan sosialisasi terhadap pentingnya menjaga hutan. Kab. Pidie yang memiliki hutan seluas 134.328 ha terdiri dari hutan lindung seluas 61.086 ha, dan hutan produksi 73.242 ha, tentu membutuhkan tenaga Polhut profesional. Saat ini, kata dia, jumlah Polhut yang dimiliki Dinas Kehutanan dan Perkebunan Kab. Pidie 14 orang. Jumlah ini dirasa masih sangat kurang dibanding luas kawasan hutan yang dimiliki Pidie. Sebelumnya di tempat sama, Bupati Pidie Mirza Ismail pada Pembukaan Pendidikan dan Pelatihan Pengamanan Hutan Tingkat Dasar di Wisma Safira Blang Paseh, Kota Sigli menegaskan, polisi hutan yang merupakan salah satu unsur dari pemerintah daerah dituntut dapat memberi yang terbaik bagi masyarakat sesuai fungsi dan tugas.(b20)

Jumat 17 Juli 2009

Dinkes Sebar 9.300 Obat Flu Babi

Rekanan Proyek Jalan Strategis Tampilkan Data Misterius ALUE IE PUTEH, Aceh Utara, (Waspada): Rekanan proyek jalan strategis (Multiyears) di Aceh Utara, menampilkan data misterius di papan nama (plank proyek) paket X. Jalan itu menghubungkan eks trans Unit V, Kec. Baktiya – Gampong Buket Jrat Manyang, Kec. Tanah Jambo Aye, Aceh Utara. Panitia khusus (Pansus) VI Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Utara, menemukan akal-akalan rekanan proyek jalan multiyears (tahun jamak) itu, dalam kunjungannya ke Kec. Baktiya, Selasa (14/7). Pada papan nama di bagian ujung proyek jalan ini hanya dicantumkan nama proyek, tanpa nama badan usaha rekanan pekerja, volume proyek, masa kontrak dan nilai anggaran biaya. Oknum rekanan dinilai anggota Pansus VI, H. Hamdani AG, S.Pdi tidak transparan, sehingga menyuliskan pihak-pihak yang ingin melakukan sosial kontrol di lokasi. Hasil evaluasi Komisi D DPRK Aceh Utara, 7 Juli 2009 diketuai H. Ismed Nur AJ. Hasan, S.Sos dan Sekretaris Komisi, HT Thamrin Mahmud alias Ampon Wen, paket X proyek jalan multiyears eks trans Unit V – Gampong Buket Jrat Manyang baru dikerjakan 3 kilometer, dari volume 8.750 meter x 6 meter dengan biaya Rp13,8 miliar. Perkembangan pekerjaan pada tingkat urugan pilihan, material kelas C, tulis Komisi D dalam laporannya. Pekerjaan ini dinilai sangat lamban, sementara kontrak sudah berjalan sekitar enam bulan. Jalan ini merupakan urat nadi perekonomian yang sangat urgen bagi puluhan ribu masyarakat eks transmigrasi Unit V dan Unit VI, dalam hubungan antar dua kecamatan, yaitu Kec. Baktiya dan Kec. Tanah Jambo Aye (Pantonlabu). Kabid jalan/jembatan di Dinas Bina Marga Aceh Utara, Ir. Syamsuddin Bentara yang dihubungi Waspada, Rabu (15/7), membenarkan, pada umumnya pekerjaan rekanan proyek multiyears di Aceh Utara, lamban. “Kami sudah memberi teguran beberapa kali, agar pekerjaan di lapangan dapat dikebut. Begitu pun tidak masalah yang penting mereka dapat merampungkan pekerjaan pada akhir masa kontrak, per 31 Desember 2009,” ujarnya. Menjawab pertanyaan menyangkut data misterius, Syamsuddin Bentara mengatakan, pihaknya akan mencek papan nama tersebut. Jika benar pihak rekanan membuat data plank proyek tidak lengkap, kita akan tegur supaya dilengkapi, untuk memudahkan pihakpihak yang akan melakukan sosial kontrol, kata dia.(b10)

WASPADA

BANDA ACEH (Waspada): Dinas Kesehatan Provinsi Aceh menyebar 9.300 kapsul obat flu babi ke dinas kesehatan dan rumah sakit di Kabupaten/kota. Kadis Kesehatan Provinsi Aceh, T.M Thaib dalam keterangannya Rabu, (15/7) siang menyebut obat flu babi juga disiapkan di Dinkes Prov. Aceh sebanyak 8.900 kapsul. “Kita siap mengahadapinya,” kata Thaib. Dua rumah sakit di Aceh, yakni RSU Cut Meutia, Lokseumawe dan RSU Zainal Abidin Banda Aceh juga disiapkan sebagai rumah sakit

rujukan flu babi. “Di Aceh belum ada yang kena, tapi kita tetap harus waspada,” kata Thaib. Namun demikian, kata Thaib, masyarakat tidak perlu khawatir dengan ancaman flu babi, sebab tingkat kematian sangat kecil, lagi pula perawatan flu babi tidak seperti penderita flu burung. Thaib menyebut, penderita flu burung harus dirawat inap sedangkan flu babi dapat dilakukan dengan rawat jalan. “Karenanya prilaku hidup bersih harus ditingkatkan,” ungkap Thaib.(b32)

Gubernur Minta Sukseskan Program Jamsostek

Waspada/Irham Hakim

DEMO DPRK: Puluhan massa menamakan diri Aliansi Mahasiswa Bireuen melakukan demo di depan kantor Dewan Perwakilan Rakyat, Kamis (16/7).

Demo AMB Minta DPRK Kembalikan Dana TKI BIREUEN (Waspada): Massa mengatasnamakan Aliansi Mahasiswa Bireuen (AMB) mendatangi pendopo bupati dan kantor DPRK (Dewan Perwakilan Rakyat Kabupaten (DPRK), Kamis (16/7) sekira pukul 10:00. Dalam orasinya mereka minta anggota DPRK mengembalikan dana TKI (Tunjangan Komunikasi Intensif), dan menolak adanya uang turun serta peng-DEM-an tiga unit mobil untuk para wakil rakyat. Lantaran hampir setengah jam bupati tidak menemui mereka, massa akhirnya melakukan aksi demo serupa di depan kantor DPRK Bireuen. Di dua tempat terpisah tersebut mereka mendapat pengawalan belasan anggota polisi dan Satuan Polisi Pamong Praja. Di dua tempat itu pendemo menyampaikan pernyataan sikap, sambil mengusung sepanduk serta sejumlah poster yang intinya tidak sepakat adanya korupsi di Bireuen. Aksi massa menjadi perhatian warga yang melintas sehingga arus lalulintas di depan kantor DPRK sempat macet. Massa juga menyebarkan selebaran antara lain bertuliskan, ‘menjelang berakhirnya masa jabatan DPRK Bireuen, berbagai masalah dan kebijakan yang tidak memihak kepada rakyat terus bermunculan ke permukan, seperti tidak berhati nurani para anggota dewan terus saja mengangkangi aturan dan perundang-undangan yang berlaku demi

kepuasan ‘nafsu serakah’. Bupati Bireuen yang sempat diharapkan menjadi top leader yang mampu memperjuangkan kepentingan rakyat, tidak mampu berbuat apa-apa, seolah-olah sang negosiator terjepit di antara dua kepentingan. Beliau dengan berbagai dalih, seolah mengamini apa pun yang diminta pendemo. Tahun anggaran 2008-2009, DPRK masih menganggarkan dana TKI untuk pimpinan dewan dan anggota senilai Rp1,7 miliar lebih. Padahal dalam PP No. 20 tahun 2007 pasal 29 ayat 1 dan Permendagri No. 21 tahun 2007 pasal 14 sudah dengan sangat jelas melarang penganggaran dana tersebut, malah uang sudah terlanjur diambil diperintahkan dikembalikan. Namun sampai sekarang dana TKI tak juga dikembalikan. DPRK juga menganggarkan uang jasa pengabdian. Porsi untuk masing-masing anggota, ketua Rp21 juta, wakil ketua Rp20 juta, dan anggota lainnya Rp19 juta per orang. Diakhir masa jabatan para pimpinan dewan juga mengusulkan penghapusan tiga unit mobil dinas untuk diperuntukkan secara pribadi. Ketiga mobil itu adalah Kijang Crysta Super BL 30 Z, Kijang Crysta Super BL 9 Z, dan Kijang Crysta Super BL 10 Z. Ke tiga mobil keluaran tahun 2003. Bupati mengizinkan penghapusan aset daerah tersebut dengan dalih tidak bertentangan dengan undang-undang. Dalam mengambil keputusan, bupati berpegang pada

Permendagri No. 17 tahun 2007, di dalam aturan tersebut dijelaskan kendaraan dinas yang berumur lima tahun lebih dapat dihapus dari daftar inventaris barang milik daerah. Namun dalam kondisi ini, bupati dan anggota DPRK lupa kondisi Bireuen hari ini dalam keadaan krisis anggaran. Bayangkan, APBK Bireuen devisit sampai Rp50 miliar, rakyat miskin menurut data statistik tahun 2008 berjumlah 21.138 KK (Kepala Keluarga). Penduduk tidak tamat SD 13.999 orang, sektor kesehatan masih jalan di tempat, pembangunan belum berjalan, lapangan kerja belum tersedia, dan permasalahan lain yang masih membekap kabupaten ‘kripik pisang’. Melihat permasalahan itu, layakkah anggota DPRK meminta uang Jasa dan DEM mobil dinas? Jawaban yang pasti, TIDAK….!!!!!!. Bupati dan anggota dewan tidak menggunakan hati nurani dalam membuat keputusan. Masihkah kita diam…? apakah kita akan membiarkan ini terjadi…? padahal hari ini rakyat sedang dijajah oleh manusia berkedok ‘Pemimpin’. Pantauan Waspada di gedung DPRK, massa terus menyampaikan aspirasi melalui alat pengeras suara. Hingga pukul 12:00 para anggota dewan yang diminta menemui mereka, ternyata tak satu pun yang muncul. Massa juga mengancam, bila para dewan terhormat tersebut tidak menemui mereka, mereka akan melakukan aksi lanjutan, hingga para dewan mau menemui mereka.(cih)

Anggota Pansus VI DPRK Aceh Utara:

Oknum Pengawas Jangan Bonceng Kepentingan Kepada Kontraktor SAMPONIET, Aceh Utara, (Waspada): Oknum pengawas proyek jalan multiyears dari Dinas Bina Marga Aceh Utara jangan membonceng kepentingan kepada kontraktor. “Kesan ini saya rasakan, saat melemparkan pertanyaan kepada oknumoknum pengawas proyek jalan multiyears dari Dinas Bina Marga Aceh Utara. Alasan teknis seperti dibuat-buat, ujung-ujungnya membela rekanan pekerja (kontraktor pelaksana-red),” tandas anggota Pansus VI DPRK Aceh Utara, H. Hamdani AG, S.Pdi menjawab Waspada di lokasi proyek jalan strategis (multiyears) di jalan negara Medan – Banda Aceh, ke eks trans UnitV, Kec. Baktiya Barat, Aceh Utara, Kamis (16/7). “Saya harap mereka jangan mainmain, apalagi membonceng kepentingan sesaat. Sebab, anggaran daerah untuk proyek jalan multiyears di Aceh Utara sangat besar dengan harapan proyek jalan tahun jamak (multiyears) yang dibangun itu bermutu tinggi dan dapat

rampung sesuai skedul kontrak, serta kontruksinya harus sesuai spek kon-trak,” tegas H Hamdani. Kamis (16/7) kemarin, tim Panitia khusus (Pansus) VI meninjau ruas pro-yek jalan multiyears Jl Negara Medan – Banda Aceh, menghubungkan Simpang Samponiet – Eks Trans-migrasi Unit V, Kec.Baktiya Barat. Panjang jalan ini mencapai 10,3 kilo-meter x 6 meter, dibangun dengan dana Anggaran Pendapatan dan Be-lanja Kabupaten (APBK) Aceh Utara, Tahun Anggaran (TA) 2008 dan TA/ 2009 bernilai Rp20,3 miliar. Menurut Hamdani, salah satu temuan Pansus di lapangan, yaitu tanah labil di lokasi Gampong (Desa) Matang Teungoh (Kec. Baktiya Barat) tidak dibuang, lalu ditimbun dengan material kelas C. “Yang dibuang hanya lumpur cair, sedang lapisan tanah labil di bawahnya disnyalir dibiarkan, disinyalir pula untuk me-

Pengurus Al-Washliyah Sabang Dilantik SABANG (Waspada): Jajaran Pengurus Daerah Jam’iyyatul Al-Washliyah Kota Sabang periode 2009 – 2014 dilantik Sabtu malam di Masjid Agung Babussalam. Pelantikan diawali zikir bersama dipimpin Tim Zikir Al-Washliyah Kabupaten Aceh Tamiang. Komposisi pengurus yang dilantik antara lain Adam Ibrahim (Ketua), Emk Muntadhir (Sekretaris), Rulliansyah (Bendahara). Pimpinan Wilayah Al-Washliyah Ibrahimsyah Fansuri minta pengurus yang baru dapat bermitra dengan pemerintah Kota Sabang dalam mengem-

bangkan dakwah dan pendidikan. Dikatakan, Al-Washliyah sejak didirikan bukanlah sebagai organisasi politik, tetapi lebih fokus bekerja untuk mengembangkan pendidikan dan amal sosial keislaman. Pada kesempatan sama Walikota Munawar Liza Zainal menyebutkan peran Al-Wasliyah di Indonesia sudah cukup lama. Terutama peran di sektor pendidikan, bahkan di era 7080-an sejumlah perguruan Al-Washliyah sudah cukup dikenal di Sumatera Utara.(b29)

ngejar bobot pekerjaan.” Tapi apa yang diungkapkan anggota Pansus VI DPRK Aceh Utara, dibantah oleh Kasi jalan/jembatan Dinas Bina Marga, M, Jamil ketika dihubungi terpisah, Kamis. Proyek jalan multiyears yang dimaksudkan ini pekerjaannya baru tahap pembenahan lokasi, alias belum sampai tahap penimbunan material kelas C. “Bobot pekerjaan di tahap ini (pembenahan lokasi-red) memang belum tampak secara signifikan, tapi hal itu akan terlihat naik secara drastis setelah penimbunan bahan material subbase,” jelas M. Jamil. Sementara kontraktor pelaksana, Taufiq yang menangani proyek ini ketika dimintai keterangan, mengklarifikasi, bagian pekerjaan yang disinyalir bermasalah oleh tim Pansus VI itu, yaitu Gampong Matang Teungoh, semua lumpur dan tanah labil sedang dalam tahap penggalian untuk dibuang. Dari panjang jalan 10,3 kilometer, penggalian tanah labil baru dikerjakan 4 kilometer dan sepanjang 3,2 kilometer sudah ditimbun. “Kita komit dengan spek kontrak dan setiap tahap pekerjaan diamati oleh pengawas lapangan dari Dinas Bina Marga Aceh Utara,” tandas pengusaha yang memakai badan usaha PT Wanita Mandiri Joint Operasional (JO) dengan PT Karya Sakila Group tersebut. Diakui, bobot kinerjanya empat bulan terakhir belum begitu signifikan, karena faktor lokasi material yang terpaut lumayan jauh dari lokasi, dilengkapi dengan paket pekerjaan yang ditangani ada beberapa lokasi.(b10/cmus)

BANDA ACEH (Waspada): Pemerintah Provinsi Aceh kembali meminta semua pihak untuk bersama-sama mensukseskan program Jamsostek dengan mengikutsertakan tenaga kerjanya. “Kami harap tidak ada lagi pengusaha atau pemberi kerja berdalih atau menghindar memberikan hak normatif tenaga kerjanya dalam program Jamsostek dengan berbagai alasan,” tandas Gubernur Aceh Irwandi Yusuf, dalam sambutannya usai penandatangan MoU antara PT Jamsostek (Persero) Kanwil I dengan PT BPD Aceh, di Gedung Serbaguna Kantor Gubernur Aceh, Kamis (16/7). Penandatangan MoU dilakukan Kakanwil I PT Jamsostek (Persero) Dr. H. Mas’ud Muhammad MM dan Direktur Pemasaran PT BPD Aceh Ismet Yoesoef, disaksikan Direktur Umum dan Personalia PT Jamsostek (Persero), Djoko Sungkono dan Gubernur Aceh diwakili Asisten Keistimewaan Aceh, Pembangunan dan Ekonomi Sekda Aceh Ir. HT. Said Mustafa. Gubernur menegaskan, Pemerintah Aceh sudah memberi komitmen pelaksanaan Jamsostek sesuai Ingub No. 04/INSTR/2008. Untuk tenaga kontrak/honorer sudah diberi pengarahan melalui surat No. 560/39174 tanggal 11 September 2008. Sedangkan untuk tenaga kerja borongan, musiman dan harian lepas yang bekerja pada proyek APBD/APBA harus mendapat perlakuan yang sama dan sudah diatur dalam Keputusan Gubernur No. 8 tahun 2004. “Kami minta perhatian para Kepala SKPA/pimpinan proyek agar

mensyaratkan kewajiban ikut program Jamsostek dalam dokumen kontrak sehingga masalah kecelakaan kerja di proyek dapat teratasi,” pinta Irwandi seraya menambahkan, siapa pun pekerja yang tertimpa kecelakaan, meninggal saat bekerja otomatis terproteksi dalam program Jamsostek. Menurut dia, penandatanganan MoU yang mengisyaratkan agar nasabah PT BPD Aceh untuk mengikuti program Jamsostek sesuai maksud UU No. 3 tahun 1992, harus diaplikasikan secara menyeluruh dan merata di lapangan, sehingga tercipta perlindungan jaminan sosial bagi segenap lapisan masyarakat. Irwandi juga mengharapkan agar PT Jamsostek mempertahankan pelayanan terbaik selama ini dan telah menjadi harapan semua tenaga kerja. Sementara kepada PT BPD Aceh, agar terus melakukan program inovatif perbankan untuk mempercepat proses pemberdayaan ekonomi rakyat Aceh. Sementara Direktur Umum dan SDM PT Jamsostek (Persero), Djoko Sungkono, mengatakan kepesertaan program Jamsostek yang terdaftar tercatat sebanyak 26 juta tenaga kerja, dengan peserta aktif sampai dengan Juni 2009 sebanyak 8,4 juta tenaga kerja. Pada kesempatan itu, Direksi PT Jamsostek (Persero) mengucapkan terimkasih dan menyampaikan Apresiasi yang tinggi kepada Pemerintah Aceh yang sudah memberi komitmen sungguh-sungguh untuk kesejahteraan seluruh masyarakat tenaga kerja khususnya dan masyarakat Aceh umumnya.(b07)

Menyimpan Ganja, Dua IRT Diamankan Polisi BIREUEN (Waspada): Dua Ibu Rumah Tangga (IRT) diamankan aparat Polres Bireuen karena kedapatan menyimpan ganja kering di rumahnya. Demikian disampaikan Kapolres Bireuen AKBP T. Saladin, SH melalui Kasat Reskrim, AKP Trisna Safari, Rabu (16/7) di Mapolres. Trisna menyebutkan, dua IRT yang kini mendekam di sel yakni Nur Binti A, 30, warga Desa Meunasah Tunong Kecamatan Peudada dan Nov Binti MD, 32, penduduk Desa Keude Aceh Kecamatan Sam-alanga. “Di rumah tersangka masingmasing kita dapatkan barang bukti 3,5 kilogram dan satu kilogram ganja kering,” ucap Trisna Safari seraya menyebutkan, tersangka Nur Binti A ditangkap Minggu (5/7) di rumahnya, dan Nov Binti MD ditangkap Senin (13/7), juga dari kediamannya. Penangkapan Nur, kata Trisna, menyusul adanya informasi masyarakat melalui SMS tentang dugaan adanya tarnsaksi ganja di rumah tersangka. Dalam penggerebekan ditemukan ganja kering siap edar.

“Namun saat penggerebekan, suami tersangka yaitu oknum PNS yang bertugas di Kantor Camat Simpang Mamplam kabur,” ucapnya seraya menyebutkan, berdasarkan keterangan tersangka, yang mengedarkan ganja tersebut adalah suaminya. Sedangkan penangkapan Nov, jelas Trisna, menyusul terjadinya penangkapan terhadap Kam, 30, warga Desa Pante Rheng Kecama-tan Samalanga yang terperogok menghisap ganja dengan Tim Elang (Tim Lapangan Polres Bireuen—red). Menurut tersangka, jelas Trisna lagi, ia memperoleh ganja itu dari suaminya, AS Bin M, 40. “Dari informasi ini kita gerebek rumahnya dan kita temukan ganja kering satu kilogram,” ucap Trisna seraya menyebutkan, saat itu AS tidak berada di rumah. “Saat kita gerebek, Nov berada dalam rumah dan berusaha menyembunyikan ganja tersebut dengan memasukkannya dalam tas dan digantung di kamar mandi ditutup kain,” ucap Trisna.(cb03)

Waspada/Amiruddin

DUA IRT: Kapolres Bireuen AKBP. T. Saladin, SH didampingi anggotanya mewawancarai dua IRT tersangka kasus ganja, bersama barang bukti yang berhasil diamankan polisi, Rabu (16/7) di aula Mapolres.

Pelayanan Puskesmas Minta Ditingkatkan ACEH UTARA (Waspada): Keluarga korban DBD (Demam Berdarah Dengue) dari Kecamatan Meurah Mulia, Aceh Utara mengharapkan pelayanan kesehatan dimaksimalkan. Pasalnya selama ini ketika korban terserang penyakit berbahaya itu, harus dilarikan ke Lhokseumawe. Harapan tersebut di antaranya diungkapkan Dekdin, 30, warga Desa Teungoh, Rabu (15/7). Menurutnya, baru-baru ini enam warga terpaksa dilarikan ke RSUD Cut Mutia di Lhokseumawe karena Pus-

kesmas tidak sanggup me-nangani penyakit DBD. Keluarga korban sangat kewalahan karena secara tibatiba harus dilarikan ke Lhokseumawe. Menurut Dekdin, sepekan terakhir sejumlah anggota keluarganya menjadi korban DBD dan Cikunguya. Terakhir Zulkifli, 32, terpaksa dilarikan ke RSUD Cut Mutia. Begitu juga dengan Syafrizal, 21, juga dari Desa Teungoh mengalami hal sama. Sedangkan Nasruddin, kemudian diketahui menderita Cikunguya.(b17)


WASPADA Jumat 17 Juli 2009

Langsa, Kualasimpang, Kutacane, Singkil

Kejari Musnahkan 340 Kg Ganja Dan 14,66 Gram SS

Wakil Bupati Buka Pameran Buku Dan Foto Bersejarah PEUREULAK (Waspada): Wakil Bupati Aceh Timur Tengku Nasruddin Abubakar, S.Pd.I membuka pameran buku dan foto bersejarah di lapangan Bola Kaki Tgk. Chik Hadi Thayeb, Rabu (15/7). Pameran yang diberi motto Aceh Membaca, Aceh Berjaya, dan Tiada Hari Tanpa Membaca itu diselenggarakan Badan Arsip dan Perpustakaan Kabupaten Aceh Timur, rencananya berlangsung empat hari sejak pembukaan. Maksud diadakannya pameran untuk menggalakkan masyarakat jadi pembaca agar membuka cakrawala ilmu, memperkaya informasi dan pengetahuan dalam mewujudkan perubahan yang nantinya akan mencerdaskan kehidupan bangsa dan masyarakat sesuai Pembukaan UUD 1945. Dalam sambutannya Wakil Bupati Nasruddin Abubakar menyatakan, penyelenggaraan pameran buku dan foto-foto bersejarah merupakan bentuk tanggungjawab pemerintah guna memberikan pengetahuan tentang perkembangan kehidupan bangsa kepada masyarakat. Sehingga masyarakat

dapat mengetahui berbagai peristiwa sejarah kehidupan bangsa. Wakil Bupati juga berharap, pameran ini bisa menjadi fasilitator dan mediator bagi masyarakat agar dapat membangkitkan budaya membaca. Sehingga pustaka dapat dijadikan tempat pengembangan potensi diri, wadah penambahan pengetahuan masyarakat untuk menjadi manusia berilmu, beriman, berakhlak mulia, kreatif serta dapat berpikir positif dalam segala masalah. Sementara itu Kepala Badan Arsip dan Perpustakaan Provinsi Aceh, Drs. Kamaruddin H.Husein, M.Si mengatakan, dalam kesempatan pameran kali ini, Badan Arsip dan Perpustakaan Aceh menyediakan kurang lebih 7.000 koleksi buku/3.500 judul dan kurang lebih 50 judul arsip visual sebagai wujud pelayanan kepada masyarakat. Selain itu Badan Arsip dan Perpustakaan Provinsi Aceh bekerjasama dengan seluruh Kantor Perpustakaan dan Arsip di seluruh Proivinsi Aceh akan merealisasi pengadaan perpustakaaan di Puskesmas yang punya ruang rawat inap.(b22)

40 PNS Ikut Bimbingan Analisis Beban Jabatan LANGSA (Waspada): Pemerintah Kabupaten Aceh Timur melalui Bagian Organisasi dan Kepegawaian Sekdakab mengadakan Bimbingan Teknis Analisis Beban Kerja Bagi Aparatur di lingkungan kerja masingmasing. Kegiatan itu untuk memberi bekal dan keterampilan bagi aparatur dalam menganalisis, mengukur, menentukan dan menerapkan pelayanan umum, sehinga diharapkan dapat menghasilkan standarisasi, dalam melaksanakan tugas serta mampu menyususn rasionalisasi antara beban kerja dan jumlah tenaga yang dibutuhkan pada suatu unit organisasi. Ketua Penyelenggara, Abdul Hamid, SP yang juga Kabag Organisasi dan Kepegawaian Sekretariat Kabupaten Aceh Timur menjelaskan jumlah peserta 40 orang dari masing-masing Bagian pada Sekretariat Daerah, Kantor Camat, Dinas-Dinas serta Badan dan

Kantor. Bimbingan teknis analisis beban kerja ini berlangsung 3 hari, 15 sampai 17 Juli 2009 di Hotel Ramille Langsa dengan materi yang disajikan berupa analisis perhitungan beban kerja, analisis perhitungan kebutuhan pegawai, tehnik perhitungan beban kerja dan tehnik perhitungan kebutuhan pegawai. Sementara pemateri berasal dari Biro Organisasi Sekretariat Aceh dan Bagian Organisasi Sekretariat Daerah Kabupaten Aceh Timur. Sementara Bupati Aceh Timur, Muslem Hasballah diwakili Asisten III Bidang Administrasi, Abdul Munir, SE mengharapkan peserta tidak menyia-nyiakan kesempatan baik ini untuk menyerap berbagai ilmu pengetahuan yang diberikan para narasumber dan instruktur. Sebab dengan telah mengikuti bimtek peserta mendapat keterampilan dalam menganalisis beban kerja di masing-masing unit organisasi.(b22)

MOS, Tradisi Awal Tahun Ajaran LANGSA (Waspada): Tahun pelajaran 2009-2010 sudah berjalan beberapa hari. Demikian pula di SMA Negeri 1 Langsa. Seperti biasa, setiap awal tahun ajaran, sekolah ini menggelar kegiatan Masa Orientasi Siswa (MOS). Tujuannya, kata Kepala Sekolah Drs HA. Samad Hasan, MBA, Kamis (16/7), bukan hanya sekedar meneruskan tradisi, tetapi lebih dari itu. Selain merupakan kegiatan prosesi pengenalan antar siswa baru dengan seniornya, juga upaya membentuk kesiapan mental mereka. “Ini awal dari momen panjang yang akan dilalui selama tiga tahun masa pendidikan,” tutur Samad Hasan, yang memantau langsung MOS setiap saat dari tiga hari yang

dilaksanakan. Menurut dia, MOS adalah bagian dari uji disiplin siswa. Lewat program ini akan terlihat apakah siswa baru benar-benar seorang siswa yang memiliki disiplin belajar atau tidak. MOS tidak begitu melekat namanya di kalangan siswa. Istilah tersebut hanya sebatas terlintas. Namun demikian, nama itu mendadak populer di kalangan siswa manakala sudah sampai awal tahun ajaran baru. Namun MOS itu seakan-akan menjadi penting yang menggiring perhatian khusus bagi seniornya. MOS adalah awal dari profesi persahabatan yang akan mendorong minat belajar. Menurut A. Samad, MOS di sekolahnya diikuti 350 siswa baru.(b26)

Waspada/ Muhammad Hanafiah

BARANG BUKTI: 340 Kg ganja dan 14,66 gram sabu-sabu (SS) yang merupakan barang bukti dalam kasus narkotika dan psikotropika telah dimusnahkan Kejari Kualasimpang. Barang bukti tersebut dibakar Kajari Basyar Rifai, SH, Kapolres Aceh Tamiang, AKBP Drs. Hariyanta dan unsur Muspida di halaman kantor Kejari, Rabu ( 15/7) .

BANDA ACEH (Waspada): Sudah dua pekan lebih, 11 kontainer bantuan media dari Jerman untuk Rumah Sakit Zainal Abidin (RSUZA) Banda Aceh ditahan Bea cukai Pelabuhan Belawan, Sumatera Utara. Bantuan tersebut masih bagian dari proses rehab rekon Aceh pasca tsunami. Bantuan medis itu merupakan hibah negara donor untuk RSUZA yang baru. Rumah sakit tersebut dibangun atas bantuan Jerman. Gara-gara tertahannya bantuan itu, menyebabkan pemindahan pelayanan RSUDZA ke gedung baru tak bisa terlaksana sepenuhnya.

SINGKIL (Waspada): Dinas Pekerjaan Umum Kabupaten Aceh Singkil akan memprogramkan bebas daerah terisolir dengan membangun dan membuka jalan – jalan penghubung di daerah itu. Demikian disampaikan Mahyuddin Desky, BE saat ditemui Waspada, Kamis (16/7), di kantornya Jl. Singkil – Rimo Kecamatan Singkil Utara. “Untuk membebaskan masyarakat yang masih terisolir kita akan membangun dan membuka jalan – jalan baru sebagai penghubung ke ibukota kabupaten dan ibukota kecamatan.

Waspada/Syahrul Karim

MOS: Para siswa baru SMA Negeri 1 Langsa tahun ajaran 2009/2010 mengikuti acara Masa Orientasi Siswa (MOS) di halaman sekolah.

Sambut HBA Ke-49 Kejari Langsa Donor Darah kegiatan olehraga hiburan. Selain donor darah, pihaknya juga melakukan kunjungan ke panti-panti asuhan di Kota Langsa. Kemudian akan digelar kegiatan olahraga termasuk didalamnya jalan santai atan keluarga besar Kejari. Diharapkannya, kepada seluruh jajarannya agar dapat mengambil hikmah dari setiap agenda kegiatan bakti sosial yang dilakukan dan jangan sampai kegiatan tersebut hanya dijadikan sebatas acara seremonial.(czu)

Pelaku Bisnis Diminta Lebih Profesional TAPAKTUAN (Waspada): Bupati Aceh Selatan Tgk. Husin Yusuf, S.PdI minta organisasi profesi yang bergerak dalam bidang bisnis bekerja lebih profesional dalam meningkatkan laju pembangunan perekonomian. Upaya peningkatan kapasitas profesi mesti terus diupayakan dalam rangka meningkatkan peran usaha berbasis kepada sumber daya manusia maupun sumber daya alam, kata Husin Yusuf dalam sambutannya dibacakan Asisten II Bidang Pembangunan Setdakab H. Tanius MN, SE, MM ketika membuka pelatihan bagi kalangan organisasi profesi di Aceh Selatan di Tapaktuan, Rabu (15/7). Pelatihan organisasi profesi itu diikuti

puluhan peserta terdiri dari pengurus dan anggota Kadin, Gapensi, AKA, Gapeknas, Ardin dan usaha koperasi serta pelaku dunia usaha lainnya. Organisasi profesi merupakan agen pembangunan di satu sisi dan di sisi lain adalah pelaku ekonomi yang berorintasi pada profit oriented. “Dengan demikian, keberadaannya di tengah masyarakat benar-benar harus memberi manfaat dan kontribusi sebesar-besarnya bagi daerah,” katanya. Sebelumnya Kabag Ekonomi Setdakab Aceh Selatan Nyaklah, SE, MM melaporkan, pelatihan dengan thema “fasilitasi pemberdayaan organisasi profesi” berlangsung dua hari diikuti 75 peserta dari kalangan dunia usaha di Aceh Selatan.(b19)

KUALASIMPANG (Waspada): Kejari Kualasimpang, Kabupaten Aceh Tamiang memusnahkan 340 kg ganja dan 14,66 gram sabu-sabu (SS) di halaman kantor Kejari, Rabu (15/7). Kajari Basyar Rifai, SH dalam sambutannya pada pemusnahan narkotika dan psikotropika tersebut mengatakan, ganja dan sabu-sabu yang dimusnahkan memang sudah diatur dalam Undang-Undang. “Narkotika dan psikotropika merupakan barang yang sangat berbahaya, sudah ada UU No. 22 Tahun 1995 tentang narkotika dan UU No. 5 Tahun 1995 tentang psikotropika,” tegas Kajari Kualasimpang pada acara pemusnahan ganja dan SS dihadiri Kapolres AKBP Drs. Hariyanta, Bupati diwakili Asisten II, Syahrizal Ardha, Ketua PN Kualasimpang, Fauzul, SH, Ka. Kesbang dan Politik Drs. Rudiyanto, Kadis Syariat Islam Drs. Effendi, Ketua MPU M. Nasir, Ketua Mahkamah Syariah Kualasimpang dan undangan. Kajari Kualasimpang menyatakan pemusnahan barang bukti berupa ganja dan SS tersebut setelah adanya kekuatan hukum tetap terhadap 39 berkas kasus narkotika dan 27 berkas kasus psikotropika.(b24)

11 Kontainer Bantuan Medis Dari Jerman Tertahan Di Belawan Direktur RSUZA, dr. Taufik Mahdi, SpOG pada sosialisasi pemindahan pelayanan RSUZA lama ke gedung baru, Kamis (16/7) di Banda Aceh menyebutkan, ke-11 kontainer berisi peralatan seperti meja operasi, furniture, tentilator, maupun perlengkapan medis RSUZA lainnya,” sebut dia. Taufik menyebutkan, lebih kurang sudah dua Minggu perlengkapan tersebut ditahan di Belawan. “Untuk operasional gedung baru masih terkendala, karena ditahannya kontainer itu. Di gedung baru ini kami pelayanan poliklinik. Sementara untuk perawatan masih di gedung lama,” ujarnya. Dia menyebutkan, pihaknya sudah melakukan berbagai upaya untuk proses pelepasan kontainer yang dimaksud. Bahkan, lanjut dia, pihak

RSUZA sudah bertemu Departemen Keuangan maupun Departemen Kesehatan agar permasalahan tersebut dapat segera diselesaikan. Menurut Taufik, alasan pihak Bea Cukai Belawan menahan kontainer tersebut karena Badan Rehabilitasi dan Rekonstruksi (BRR) Aceh-Nias sudah berakhir. Padahal, tambah dia, proses rehab-rekon tersebut masih berlanjut sampai sekarang. “Ini masih dari kelanjutan proses rehab rekon. Dalam pertemuan tersebut juga ikut serta Kepala BKRA sebagai badan yang lahir melanjutkan BRR NAD-Nias,” ungkap Taufik yang didampingi Wakil Direktur Dr. Andalas Sp.OG, perwakilan Jerman selaku negara donor serta tim pemindahan pelayanan rumah sakit.

PU Akan Bebaskan Daerah Terisolir Di Aceh Singkil

LANGSA (Waspada): Untuk menyambut Hari Bakti Adhiyaksa (HBA) ke 49 pada 22 Juli 2009, pegawai dan honorer Kejari Langsa mengadakan donor darah. Selain itu diadakan bakti sosial ke Panti Asuhan di daerah tersebut. Kajari Langsa, Adonis, SH didampingi Adityo Gunawan, SH di ruang kerjanya mengatakan, untuk memperingati hari jadi HBA ke 49 pihaknya akan dan telah melaksanakan serangkain kegiatan bersifat sosial serta

25

Mantan Kepala Dinas Sosial Naker dan Transmigrasi Kabupaten Aceh Singkil yang juga mantan staf ahli bupati bidang pembangunan itu juga akan memperogramkan pembangunan berbagai sarana air bersih di desa- desa terpencil, sebagai upaya menunjang kebutuhan masyarakat untuk mudah mendapat air bersih. Sedangkan untuk mendukung masyarakat di bidang pertanian dan perkebunan, Dinas Pekerjaan Umum akan terus bersinergi dengan mambangun fasilitas -Irigasi sebagai sarana pendukung keber-

hasilan masyarakat petani di daerah itu. Semua itu akan kita lakukan dengan berbagai sumber pendapatan meliputi APBK, APBA dana Otsus dan Migas. Untuk itu Mahyuddin yang juga mantan Kepala Dinas PU Kabupaten Aceh Jaya dan Kabupaten Semelue, berharap agar program yang akan dilakukan mendapat dukungan pihak legislatif, masyarakat dan wartawan. “Semua ini akan tercapai apabila didukung semua pihak dan kerja sama yang baik,” ujar Mahyuddin.(cb02)

Bupati Tinjau Jalan Singkil – Rantau Gedang SINGKIL (Waspada): Bupati Aceh Singkil H. Makmursyah Putra didampingi Kepala Dinas Pekerjaan Umum Mahyuddin Desky, BE, Staf Ahli Bidang Ekonomi dan Keuangan, Kepala Inspektorat H. Alamsyah, SH serta Camat Singkil, Kaharuddin, SE, meninjau pembangunan jalan Singkil – Rantau Gedang, Kamis (16/7). Peninjauan dilakukan untuk melihat langsung volume bangunan dan persentase pembangunan jalan menghubungkan Kecamatan Singkil – dengan kampong Rantau Gedang dan Teluk Rumbia. Kepada PPK Faisal, Bupati Makmursyah minta agar jalan yang dibangun dengan anggaran Sisa BRR Aceh – Nias senilai Rp4.655.413.000 sepanjang 5,5 km, dapat dilintasi masyarakat dalam jangka waktu tidak terlalu lama atau paling tidak pada bulan puasa ini. Menanggapi itu, PPK Faisal mengatakan akan berupaya agar pembangunannya selesai sesuai target, yaitu Oktober tahun ini.

Menjawab Waspada sekaitan adanya penolakan warga karena jalan yang dibangun itu sebelumnya hanya 1,6 km dengan bangunan hotmix dan menggunakan talut, Faisal

mengaku itu sudah selesai dan pihaknya akan tetap membangun jalan hingga ke Kampong Rantau Gedang dan Teluk Rumbia, sesuai permohonan masyarakat di sana.(cb02)

Jaksa Nakal Akan Ditindak Tegas LANGSA (Waspada): Apabila ada oknum jaksa di Kejari Langsa merusak citra penegakan hukum dan citra kejaksaan, maka akan diambil tindakan tegas sesuai proses hukum yang berlaku. “Tidak ada perlindungan atau pilih kasih bagi oknum jaksa yang berani melakukan tindakan tercela atau merusak citra penegakan hukum. Bila ditemukan seperti itu, pertama sekali saya sendiri yang akan mengambil tindakan,” tegas Kepala Kejari Langsa, Adonis, SH, kepada Waspada, Rabu (15/7) di ruang kerjanya. Dikatakannya, perilaku oknum jaksa yang melanggar dan berbuat di luar konteks hukum tentu mencoreng pribadi jaksa tersebut, selain itu juga merusak citra lembaga kejaksaan itu sendiri di

mata masyarakat. “Kita tidak ingin garagara perbuatan tercela oknum-oknum yang tidak bertanggungjawab, yang berbuat untuk kepentingan pribadi demi keuntungannya, yang ujungnya merusak citra lembaga,” katanya seraya menambahkan, semua pihak harus menghormati proses hukum yang sedang berjalan. Ketika disinggung tentang melebarnya kasus praperadilan Fauzi Yusuf, menurut Adonis, seharusnya suatu kasus harus dilihat dalam suatu perkara pokok, jangan pula hal tersebut terkesan tergiring menjadi persoalan lain. “Saya hanya bisa menjelaskan dalam aspek yuridis, semua proses hukum yang kita lakukan sudah memenuhi kriteria hukum yang berlaku,” terang Adonis.(czu)

Taufik menyebutkan, untuk ‘membebaskan’ bahan bantuan tersebut, setidaknya mereka harus membayar pajak bea masuk senilai Rp3-4 miliar. “Kita malu dengan ne-

gara donor. Mereka sudah membantu, tapi mental bangsa kita seperti ini. Peralatan itu dihibahkan tapi masuk negara kita masih dikenakan biaya masuk,” sesalnya.(b05)

Kantor LBH Dibobol Maling TAPAKTUAN (Waspada): Kantor LBH (Lembaga Bantuan Hukum) Banda Aceh Pos Tapaktuan, Aceh Selatan berlokasi di Samadua, sekira delapan kilometer dari Tapaktuan ke jurusan Banda Aceh, Selasa (14/7) dinihari dibobol maling mengakibatkan sejumlah peralatan kantor senilai Rp20 juta raib. Kejadian sekira pukul 04.30 itu bersamaan dengan penjarahan tujuh unit rumah warga sekitar. Sedangkan modus operandinya, pelaku membuka jendela kantor dan merusak pintu rumah warga yang sedang tertidur lelap. Koordinator LBH Pos Tapaktuan, Syahminan Zakaria, SH kepada wartawan di Tapaktuan, Selasa (14/7), membenarkan kejadian itu. Peristiwa itu terjadi saat dia dan beberapa anggota lainnya sedang tidur. Mereka baru mengetahui pagi harinya, setelah melihat ruangan kantor berantakan. “Beberapa barang inventaris dan milik pribadi raib,” katanya. Sedikitnya, satu Laptop, dua HP Nokia serta satu tas baju lenyap sehingga kerugian diperkirakan mencapai Rp20 juta. Sementara kerugian yang diderita warga berupa pesawat TV, HP, kipas angin, perhiasan emas dan satu kenderaan roda dua. Kasus ini telah ditangani oleh Polsek Samadua.(b19)

Monitoring Pilpres Sukses TAPAKTUAN (Waspada): Pemkab Aceh Selatan menyampaikan apresiasi kepada Orari Lokal Aceh Selatan dan Rapi Wilayah 15, sehubungan tugas monitoring dan pemantauan Pilpres yang dilakukan kedua organisasi komunikasi, pada Rabu pekan lalu, dinilai sukses. “Kita salut dan menyampaikan apresiasi yang tinggi kepada Orari dan Rapi dalam menyukseskan Pilpres melalui komunikasi radio,” kata Bupati Aceh Selatan Tgk. Husin Yusuf melalui Ketua Tim Koordinasi Penyelenggara Pilpres (TKPP) Drs. H. Harmaini, M.Si kepada Waspada di Tapaktuan, Kamis (16/7). Tugas monitoring termasuk pelaporan hasil Pilpres di setiap TPS dan PPK dalam Kabupaten Aceh Selatan, katanya, merupakan tugas pengabdian, karena dana mobilisasi tidak tersedia di Pemkab seperti tugas monitoring sebelumnya. “Jadi kita beri apresiasi yang tinggi karena mereka bekerja atas inisiatif dan swadaya sendiri,” katanya. Sedangkan dalam tugas pemantauan dan monitoring sebelumnya, Pemkab Aceh Selatan senantiasa memobilisasi tugas lapangan sesuai kemampuan daerah terutama para personil yang bertugas di wilayah terpencil seperti Kecamatan Kluet Tengah dan Trumon. “Hasil pemantuan Orari-Rapi, hasil Pilpres bisa final masuk ke desk sore harinya,” sebut Harmaini yang juga Sekdakab Aceh Selatan.(b19)

Jauhkan Narkoba Sebelum Terlambat LANGSA (Waspada): Kepala SMA Negeri 1 Langsa Drs H.A Samad Hasan, MBA mengingatkan siswanya tidak mengkonsumsi narkoba karena barang haram tersebut akan menghancurkan masa depan. Karena itu, sebelum terlambat segera menjauhkan diri dari barang-barang narkotik apa pun jenisnya, apalagi sampai mengkonsumsi. “Mendekati saja tidak boleh apalagi sampai mencoba memakainya,” kata Samad Hasan kepada Waspada, usai melaksanakan penyuluhan tentang narkoba kepada siswanya. Nada serupa disampaikan petugas kejaksaan dan kepolisian yang tampil sebagai pembicara pada acara penyuluhan tentang bahaya narkoba bagi generasi muda. Sebab itu, para siswa hendaknya tidak bermain-main dan mencobanya karena akan terpengaruh dan terjerat sehingga merusak masa depan. Petugas kepolisian, kejaksaan maupun Kepala SMA Negeri 1 Langsa berharap semua anak didik segera mempersiapkan diri dengan masa depan yang lebih menjanjikan. Hal itu baru bisa dicapai kalau mereka tidak tersangkut dan terlibat narkoba. Tinggalkan narkoba sekarang juga dan raih masa depan yang lebih cemerlang, katanya.(b26)

Waspada/Syahrul Karim

TANYA JAWAB: Salah seorang siswa SMA 1 Langsa tampil dalam acara tanya jawab tentang masalah narkoba.


26 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

Bursa

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Carry Alexander Thn. 85, pintu belakang. Siap pakai. Masih satu nama, Hrg. 16 Jt Nego (tanpa perantara). Hub. 0813 7680 9378 - (061) 76915166

HONDA City New IDSI ‘04. Tiptronic, M/T, Airbag, ABS, Htm, BK Mdn, Tgn. I Ass. A/R. DP 30Jt. Angs. 4,9Jt. Hub. 76700976

SUZUKI Karimun Thn. 2001 Dijual AC, Tape, VR, Body mulus, Medan asli. Harga Rp. 65 Jt/Nego. Hub. 0813 6104 5908

HONDA City Th. 96 dijual. 1343cc. Hijau tua metalic. Type SX 86 M. Hub. HP. 0813 700 90140 / 7031021

CHEVROLET Trooper Thn. 88/89. Silver Met. Mls. 5 pintu 4x4 Diesel, AC, VR, BR, Tape, Cantik. 44 Jt. Nego. Hub. 0878 688 65261

ISUZU Panther ‘96 BK Medan, AC, PS, Warna merah 1 tangan Rp. 55 Jt. Hub. 061-77.100.200 - 0812 6400 800

DAIHATSU Zebra Pick Up Espass Thn. 2003. W. Hitam. BK Mdn. Harga Rp. 35Jt/Nego. Hub. 0816 3113 014 DAIHATSU Espass Thn. 1995. Minibus. AC, VR, Warna merah metalik (Kondisi mulus). Harga 31,5Jt. Hub. 0811 634 998/ (061) 76715797 DAIHATSU Pick Up 2004 Mulus, orisinal, W. Hitam, BK Medan, tangan pertama dari baru. Tidak angkat berat. Mesin, body bagus. Siap pakai. H. 37 Jt. Hub. 0812 6472 6918

ISUZU PANTHER 2005 LS DIJUAL CEPAT Plat B. Harga Nego. Warna Hitam. Hubungi 0813 10988 616 ISUZU Panther Gren Royal Plus Th. 1996 Akhir. BK Medan. Tape, AC DB. SL, PW. Ban baru. W. Hijau gelap. Mulus, siap pakai. H. 72Jt. Nego. Hub. 0813 6227 1115 ISUZU Panther Hi Grade Th. ‘94. W. Merah met. Catdan mesin mulus. Siap pakai a/n. Sendiri. Butuh Uang. Harga 62Jt Nego. Hub. 061-6626705 / 0811 652 506

MERCY Boxer 90 - 230 - E BK 8 - YV. Kondisi bagus. Hub. 061-6878 4368

DAIHATSU Espass 1.6 S. Van ‘96, Mrh Met. Sliding Door, AC, RT, VR, BR, DP 13 Jt. Angs. 1,2Jt. TYT. Kijang LSX EFI ‘01/’02. Biru Met, AC, TP, VR, BR, DP 22 Jt. Angs: 3,47Jt. Hub. 76700976 - 7876495

MERCY Boxer 200 E Dijual. ‘88. Merah, AC, Tape, VR, BR, Mesin dan body sangat mulus sekali (seperti baru). Terawat. Hub. 0813 6112 5154

D A I H AT S U T a f t G T S T h n . 8 7 Pemakaian 89. W. Hitam, BK Medan, AC, Tape, VR, BR, Mesin Gerdang Bagus. Hub. 0813 611 17292

MAZDA 323 Interplay mulus. Thn. 90. Biru muda metalik. AC, Velg Racing. Interior original. 30 Jt. Nego. Hub. 0812 650 6340

CAPELLA DAIHATSU GATSU 1

Sales Person: Agustina (0852 7003 9888 / 7630 4788) LUXIO...Angs. 3Jt-an + diskon khusus Tersedia: Xenia, Terios, Sirion, GranMax DAIHATSU Xenia 1.0 DP 16 Jt-an Angs. 3 Jt-an Xenia 1.3 DP 18 Jt-an Angs. 3 Jt-an Terios AC Double DP 24 Jt-an Angs. 5 Jt-an Pick Up 1.3 DP 8 Jt Angs. 2 Jt-an Hub. 061-77815 888 / 0811 627 635 Unit Terbatas !!!

DAIHATSU Feroza (Mega Top). M. Rocky Thn. 96. Mesin ok, body mulus. Plat BK W. B. Tua Metalik. Pajak panjang. Hg. Nego. Hub. 0811 615 411

Rp. 91.000 Rp. 104.000

FORD Everest Thn. 2005. Warna silver. Siap pakai. Harga Nego. 1 tangan AC, Tape, VR, Ban Radial. HP 0812 6477 946

CHEROKEE ‘95 4x4 M/T, AC, RT, VR, BR 31”, PW, PS, Biru tua Met, jok Klt, DP 22 Jt. Angs: 2,33. Mercy C180 ‘95/’94, ABS, A. Bag, Jok Klt, AC, RT, VS, BR, DP 31 Jt. Angs. 3,1x 23 Hub. 68790794, 061.76700976

DAIHATSU Xenia Li Thn. 2004 Warna silver, BK Medan asli, Cat Original, mulus. Hub. 0813 9610 1939

7 CM 8 CM

MITSUBISHI Eterna 92 Matic. BK Baru, Ban semua baru, kondisi mulus sekali. Hub. 061-91145520 MITSUBISHI Galant ‘84 Dijual. Silver, BK Medan, Pjk 1 thn. Tape, AC, VR, BR, mulus, Kaleng2 Dalam Interior original. Harga Rp. 19 Jt. Nego. Hub. 0813 6144 0003

NISSAN Terano Grand Road Thn. 98 Warna hijau metalik kondisi ok. Harga 75Jt/Nego. Hubungi: 0812 603 68620 - (061) 77295685 SUZUKI Katana GX ‘94 Merah Mulus. Tape, AC, PS, Jok Kulit, BK Mdn. 43 Jt (Nego). Hub. 0811 6030 86 TP

SUZUKI Sidekick ‘98 Silver. Asli Medan. Hub. 0812 6507 413

9 CM Rp. 126.000 10 CM Rp. 140.000

Bursa

HONDA Supra Fit Cakram ex Cewek Thn. 2004 Akhir. Nama Sendiri dari baru, Hrg. 6.5 Jt Nego. Hub. 061- 9135 6484

Bursa

ANDA BUTUH DANA

TOYOTA 100% BARU

Jaminan BPKB mobil min Th. 89. Truk Th. 93 keatas. Proses cepat, leasing resmi. Ansuran dapat diketahui, Hub. (061) 7731.1945 / 0813 7000 0055

TOYOTA Kijang Commando Thn. 88/ 89. Hijau met. Mls. Cantik. 6 Speed. AC, VR, BR, Tape, Mdn asli. H. 43Jt Nego. Hub. 0878 6886 5261 TOYOTA Corolla Twin Cam Thn. 88/ 89. Hitam met mls. Mdn asli. AC, VR, BR, Tape, 1.3 cantik, tidak kecewa. H. 36 Jt Nego. Hub. 0878 6886 5261

TOYOTA Kijang Super G 1995. 1800cc. Wrn. Abu2 metalik long. BK Asli Medan. BPKB 1 nama. Hrg. 65 Jt Nego. Hub. 0812 60181 483

TOYOTA Kijang LGX Diesel, 2002, Biru, BK Medan asli, STNK Full 1 thn. As. All Risk. Rp. 128Jt. Hub. 7655 9623 TOYOTA Kijang LGX 2003, Matic, Hitam, mulus seperti baru, TV, DVD, dll. BK R. Prapat. Harga 135 Jt (nego). Hub. 0813 7525 3165

TOYOTA Kijang Krista Bensin Thn. 97. Warna biru mica, BK Medan asli, cat original. Sangat mulus. Hub. 7796 3012 TOYOTA Corolla ‘82 Dijual Cepat. Warna hitam, mesin sehat, body lempang. BK baru. Harga Rp. 22 Juta (nego) Hub. 0819 866311

TOYOTA Starlet 1.300cc dijual. Thn. 1988. W. biru dongker. BK Medan. Hub. 0857 600 13126 TIMOR DOHC, Thn. 97. Warna biru, Komplit. Hrg. 42Jt Nego (TP). Hub. 0813 7680 9378

NEW !!! 120ML

1000ML

HARGA EKONOMIS

BUTUH UANG Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

TOYOTA Corolla Twincam 1.6 Thn. 89. Hitam met, orisinil, complit, Asli Medan. Hrg.43Jt. Nego. Hub.0812 64777088

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

SEPEDA MOTOR

TOYOTA Kijang Capsul LSX Diesel Dijual. Thn. 2001. BK Medan asli, warna biru, AC, Tape,VR, BR, Mirror. Mesin sehat, body kaleng2 sangat mulus. Harga Rp. 120Jt/Nego. Hub.0812 603 8561 AVANZA (READY),RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. “Avanza DP 20 Jt-an” Hub. 0813 7512 7297 - (061) 7795 1428

11 CM Rp. 165.000 12 CM Rp. 180.000

SEPEDA MOTOR

MOBIL

AND AB UTUH D AN A TUN AI ??? ANDA BUTUH DAN ANA TUNAI

MINI & EFEKTIF IKLANKAN PRODUK ANDA

WASPADA

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

Ingin Promosikan Produk Anda Harian

WASPADA

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

AVAILABLE NOW IN STORE CELANA PENDEK UNTUK TENIS, BADMINTON FITNES & CELANA BOLA

TERSEDIA BERBAGAI MODEL SEPATU SPORTS & FUTSAL

SPORTS & MUSIC

SPORTS & MUSIC

Bursa

TERCECER / HILANG

TERIMA HP SECOND EXTRA TINGGI HUB. 061 76631177 (DIJEMPUT)

1 BPKB Kijang No. 443146-G asli No. BK 1140 XH. Atas nama: WISETYO SASONGKO. Alamat Perumahan Menteng Indah Blok BII/4 Medan Denai. Tel. 061-7874044 / 0813 7637 0628

Media yang Tepat untuk Iklan Anda

BUTUH DANA CEPAT

Kontan dan Cepat, Jaminan BPKB Mobil Thn. ‘92 Up Proses Cepat, BPKB Aman, Dana Langsung Cair. Hub. Mr. Yan’s:06177631 725, 0815 3447 0666

Jum’at, 17 Juli 2009

Bursa

Bursa

SHOOTING/PHOTO

ELEKTRONIK

SHOOTING DVD & PHOTO

JUAL & BELI TV, PS 1, 2, 3. Laptop, LCD Projector. Handycam Camera, Keyboard, Kulkas, M. Cuci, Sound, dll. Hub. MARKET ELECTRONIC. Telp. 821.0097. 66900693. Jl. Setia Budi No. 424B Dkt. Ring Road.

MURAH BERKUALITAS & BERPENGALAMAN MITRA STUDIO (061) 7751.7888 - 0812.6407.8888

xpress

ZIDAN GAME PS GARANSI 13 BLN

PS 2 Baru Rp. 1.350. Rekondisi Rp. 1.200. PS 1 Rp. 350 HDD Rp. 1.950 PSP 4 GB Rp. 1.650 NB: Service PS 1, 2, 3 Telp. 77418902 Jl. Sei BT. Hari No. 2 HR. Hakim No. 104

Jl. Pelangkaraya 64/15D Telp. 061-4571043 Sun Plaza Level 2 A - 12 Telp. 061-4501503

Jl. Pelangkaraya 64/15D Telp. 061-4571043 Sun Plaza Level 2 A - 12 Telp. 061-4501503

KOMUNIKASI

Service

AC

SERVIS

AC

ELEKTRONIK LEONI SERVICE

CUCI/SERVICE AC, PERBAIKAN AC, BONGKAR PASANG AC, MESIN CUCI, KULKAS. Hubungi: 0812 6300 746

CUCI AC, ISI FREON, BONGKAR PASANG. REPARASI, AC CENTRAL. FLOOR STANDING Hub. DIFA SERVIS

0813 9735 7061

AC GARANSI

PERISAI TEKNIK

- Servis / Perbaikan - Cuci, Isi Freon, Bongkar Pasang - M. Cuci - Kulkas Hub. 455 - 2167/775 - 24156

MAJU TEKNIK

AC

TV

7030118 76750084

KULKAS, M. CUCI DISPENSER (BERGARANSI) RUSAK?

Toshiba, Sony, Digitec, Polytron, LG, dll. Hub. SURYA TV - 08136224 8455 Siap Ditempat - Garansi

Bursa

BUSANA & AKSESORIS

TERCECER

HILANG / TERCECER

Satu Berkas Surat Tanah Hilang. Tercecer atas nama: Bardan Jl. Sidorukun No. 121 Luas.825 Mtr.

HILANG

BPKB BB 2059 VC. a/n. H. Agusman Gea, SH. Jl. Diponegoro 78 G. Sitoli HP. 0813 6169 9115 TERCECER

1 (Satu) Buah BPKB Asli STNK BK 6722 UJ. a/n. Anjur Simanullang STH. MA. Alamat Jl. Sei Mencirim No. 130 / 86A Kel. Babura Medan

TERCECER BK 5723 RM. a/n. Muhammad Ali Hanafi TERCECER 1 (Satu) buah BPKB BK 1615 - GB Isuzu Minibus Nomor Rangka MRCTBRS4 F1 K231499. Nomor Mesin E231499 milik PT Dipo Star Finance. Jalan Diponegoro No. 11 Wisma RSBC 5 Th. Floor Medan. TERCECER 1 (Satu) buah BPKB BK 1458 UP Isuzu/Minibus. Nomor Rangka MHCTBR54BTOD9528 Nomor Mesin E009528 Milik Ibrahim Lubis Komplek Deppen Blk E722 RT 04/10 Cimanggis Harjamukti 16954 TERCECER BPKB Sp. Motor BK 6411 ii Honda Revo a/n. ITA MARIANI Jl. Eka Bakti No. A-4 Kel. Gedung Johor Medan. Bagi siapa yang menemukan mohon dikembalikan ke alamat diatas.

Bursa

PERCETAKAN

TELAH TERBAKAR Asli Surat Kiosk Nomor 185 Lantai - II Pasar Pusat Pasar An. H. BGD DARWIN No. SIPT 511.3/1047/ PDPKM/2005 tanggal 28 Februari 2005

TELAH HILANG / TERCECER

Asli Surat Kiosk Nomor 457 Lantai-II Pasar Pusat Pasar No. SIPT B 511.3/4983/PDPKM/ 2007 Tanggal 05 Sept 2007 dan asli surat Kios Nomor 458 Lantai - II Pasar Pusat Pasar Nomor SIPTB 511.3/4982 /PDPKM/2007 tanggal 05 Sept 2007 An. Rimaiwaty, SE

HILANG / TERCECER 2 Lembar asli surat Kiosk Nomor 70 dan 71 Lantai - II Pusat Pasar An. Mirayanti. SIPTB Nomor: 511.3/4839/PDPKM/2007, 22 Agustus 2007 dan SIPTB Nomor: 511.3/ 4838/PDPKM/2007, 22 Agustus 2007

TELAH TERCECER

1 Lembar asli Surat Pernyataan ganti rugi tanah atas nama Sugiman. yang dikeluarkan oleh Lurah Tanah 600 pada tgl. 5 Februari 1985. Letak tanah di Lingk. 3 T. 600 Medan Marelan. Luasnya 768,96 Mtr. Tercecer pada tahun 2001. Medan sampai Pulau Jawa

KIRIMKAN... DATA IKLAN ANDA

DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)

Service

KONSTRUKSI WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 7878078 NARO SERVICE Jl. Sisingamangaraja

WC

TUMPAT/ SEDOT

77442112

Jl. Gatot Subroto Medan Ada Garansi

WC 0812 642 71725 Mobil. Sedot

Jl. Brayan Medan

PAK ADI HP.

WC

WC

Tumpat Sedot

M. SAFII

ANDA TUMPAT - SEDOT

Hub. 8219951 Jl. Setia Budi No. 2 Jl. Setia Budi / Tj. Sari Telp.: Flexi:

8442271 77944642

Jl. Gatot Subroto Medan

Ingin Promosikan Produk Anda Harian

WASPADA

Media yang Tepat untuk Iklan Anda


15

WASPADA Jum’at 17 Juli 2009

FAKULTAS KEPERAWATAN USU UNIVERSITAS SUMATERA UTARA

MURAH - NYAMAN

1. UMROH REGULER 11 HR BERANGKAT 20 JULI 2. UMROH REGULER 9 HR BERANGKAT 11 AGUSTUS 3. UMROH RAMADHAN AWAL 21 AGUSTUS 4. UMROH PERTENGAHAN RAMADHAN 7 SEPTEMBER 5. UMROH AKHIR RAMADHAN 11 SEPTEMBER 6. UMROH 1 BULAN RAMADHAN 21 AGUSTUS S/D 21 SEPTEMBER

Pelaksanaan Ujian: Ekstensi: Tgl. 28 - 29 Juli 2009 Reguler Mandiri: Tgl. 29 Juli 2009

Terakreditasi BAN PT (Nilai B) SK No. 037/BAN - PT /ak-IX/S1/III/2006

MENERIMA MAHASISWA/I BARU PROGRAM S1 KEPERAWATAN EKSTENSI & REGULER MANDIRI TAHUN AKADEMIK 2009/2010 GELOMBANG II

UMROH RAMADHAN 1430H

Pendaftaran Dimulai: Tanggal 16 - 27 Juli 2009 Pada jam: 08.00 s/d 15.00 Wib

Sekretariat: Jl. Prof. Ma’as No. 3 Kampus USU Medan Telp. (061) 8213318 Fax. (061) 8213318 http: //www.psik-fkusu.ac.id/

LOWONGAN KERJA

DIBUTUHKAN

DIJUAL CEPAT

DICARI SGR lls SLTA/ sdrj Unt diddk & lsg dislrkan mjd Guru PG/TK Hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 453.3875 - 456.9269, Jl. Karyawisata No. 23 A Johor Tp. 786.1690 Medan,

DIBUTUHKAN 1 Orang Adm. Keuangan. Syarat: SMK / D1/D2/D3 Usia 20 - 35 Thn. Pria, Muslim. Hub. 0812 6500 454. Lamaran sms 2 hari saja.

AKADEMI FISIOTERAPI YRSU Dr. RUSDI MEDAN Berdiri sejak 1987 Terakreditasi

1. RSU Dr. Rusdi Medan (Kampus A) Jl. H. Adam Malik Telp. 661.4941 - 661.5991

2. AKFIS Dr. Rusdi Medan (Kampus B)

Jl. H. Sutan Oloan No. 1 Pondok Surya Telp. 846.4282 08.00-15.30 Wib Setiap hari kerja CP: 0852.9725.2579 - 0819.824.289 0812.1880.0269

Pendaftaran Mulai Sekarang (Testing Gel. I = 15 Juli 2009) Tempat Pendaftaran / Informasi Hub:

Kampus Akademi Kesehatan Dr. Rusdi Jl. Sutan Oloan No. 1 Komp. Pondok Surya Helvetia Medan Telp. 845 5304 - 847 5679 845 0654 - 847 4290 Hp. 0812 6342 1769

MINI & EFEKTIF SEKOLAH TINGGI ILMU KESEHATAN IKLANKAN PRODUK ANDA Bursa

PENDIDIKAN

AKADEMI PERAWATAN

MALAHAYATI MEDAN

Berdasarkan izin MENDIKNAS RI NO. 258/D/O/2008 MENERIMA MAHASISWA/I BARU T.A. 2009/ 2010 LULUSAN: SMU/ SMA/ SPK/ SMK/ MADRASAH ALIYAH

PENDAFTARAN: Mulai 1 Juni s/d 23 Agustus 2009 TESTING: - Gelombang I : 15 Juli 2009 - Gelombang II : 05 Agustus 2009 - Gelombang III : 24 Agustus 2009

(STIKes) FLORA MEDAN

IZIN MENDIKNAS RI No. 14/D/O/2009 Tanggal 2 Maret 2009 Rekomendasi Pengurus Pusat PPNI No. 482/PP.PPNI/S/X/2008 Tanggal 15 Oktober 2008 Rekomendasi Kepala Badan PPSDM DepKes RI No. HK. 03.05/1/4/5652/2008 Tanggal 30 Desember 2008 Menerima Mahasiswa Baru T.A. 2009/ 2010 Untuk Program Studi:

1.Sarjana Keperawatan (S1 KEPERAWATAN) Angkatan I 2.Akademi Keperawatan (Akper) Angkatan XVII 3.Akademi Kebidanan (Akbid) Angkatan VIII Pendaftaran Mulai Tanggal 16 Juli s/d 4 Agustus 2009

Testing Tanggal 5 Agustus 2009 Informasi selanjutnya hubungi:

Kampus STIKes Flora: Jl. Rajawali No. 24 Medan 20122 Telp. (061) 845.4406 - 845.4407 845.4408 - 845.4409 HP. 0812.650.6377

Kampus Akademi Perawatan Malahayati Jl. Cendrawasih No. 161 Sei Sikambing B Medan Telp. (061) 845.2445 E-mal: akper_malahayati_medan@yahoo.com

Hub: IBU FIKA,AMD/BPK.NAZRUL LUBIS, AMD HP. 0813.7588.6514/ 0852.9700.4559(TDKSMS) Atau datang lsg ke kantor: Jl. KH. Wahid Hasyim No. 118 A (+/- 100 metermasuk dari simpang Barat Gatot Subroto) NB. Pendidikan min SMU sederajat - S1/terbuka bagi mahasiswa

LOWONGAN KERJA KE MALAYSIA

Sebuah Perusahaan INCOILS ELECTRONICS SDN BHD (DIRECT COMPANY) Yang berlokasi di Butterworth, Penang, Malaysia memerlukan segera beberapa pekerja Per empuan sebagai O P E R ATO R PRODUKSI. TANPA TESTING LANGSUNG MEDICAL LEVI Fasilitas dan Gaji: SUBSIDI 1. Gaji Memuaskan 100% 2. Ada tunjangan kehadiran, makan & lembut 3. Asrama, Transport dan Rumah Sakit disediakan 4. Dilindungi oleh Asuransi selama bekerja Dengan persyaratan sebagai berikut: 1. Perempuan berumur antara 18 - 24 tahun 2. Pendidikan minimal SMU / sederajad 3. Sanggup menyelesaikan kontrak kerja 2 tahun 4. Mendapat izin dari orang tua / keluarga Jika berminat segera medical & membawa Ijazah, KTP, Kartu Keluarga (asli & foto copy 5 lembar) dan pasphoto berwarna 10 lembar diantar langsung ke alamat berikut: PT. SAHARA FAJARINDO CORP. JALAN KANGKUNG NO. 61 MEDAN 20153 (BELAKANG GEDUNG BUMI PUTERA DI JLN. ISKANDAR MUDA) TELP. 4157621, 4551305

Bursa PROPERTY LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

TAMAN JOHOR MAS Subsidi Uang Muka 20 Juta Untuk 4 Unit Saja

DP HANYA 10%

Harian

WASPADA Tempat Iklan Anda Hub.

4576602

Type 55/ 112 & 65/ 120

Fasilitas: - Taman Bermain - Lapangan Badminton & Jogging Truck - Sertifikat, IMB, Listrik, PDAM

SURYAMAS PROPERTY GROUP Hotline:

ITA : 0812.605.5709 - (061) 7702.0749 NELVI : 0813.6125.0120

Bursa

MAKANAN

“BENALU KOPI ASLI” Baik untuk kesehatan Hub. 0812.6077.5575

061-6846 2888 061- 6846 3888

Lokasi Tembung ± 400m dari jalan besar Tembung, Uk. 16x8m, Garasi 7x4m, Kmr 3, Kmr Mandi 3 + Musholla, PAM, PLN 900 Watt, Luas Tanah 5 Rante, 6 Juta Pertahun Khusus Muslim Hub. Nurdin 822.3975/ 0812.6064.7450

DIJUAL RUMAH

3 KT Ukuran 3x4, 2KM, Ruang Tamu 4x5, Ruang Keluarga 4x8m, 1 Garase 3x5, Halaman bisa 2 mobil, Tepi jalan besar, Pondasi tingkat semua, Aman, PDAM, PLN 450 Maaf Tanpa Perantara Hub. 0812.1046.7497

Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong

Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000

Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802

SPECIALIST SOFA (REPARASI & TEMPAHAN) K. Sofa, Makan, Kantor, Jepara, Spring bed, Ganti Kain/ Kulit + Busa, NB. Terima tukar tambah sofa Ayong 662.8642 - 0813.6153.6320

TANAH DAN RUMAH DIJUAL Luas Tanah 20 x 40M. Rumah 20 x 10 M. Hub. 061-7742 9883 TP. Harga Nego. Jl. Mesjid Kpt. Muslim Ujung No. 54 A

TANAH KAVLING Uk. 8x17=13,5Jt, 8,5x16=13,5Jt, 6/10x17=15Jt. Harga Termasuk Biaya Surat, Padat Penduduk. Lokasi Jl. Sekip Sei Mencirim, Sunggal. Hub. 762 65139, 77467719

Ukuran 15x30m, Tembung Psr. IX Jl. Sidomulyo G. Podang, Masuk kedalam kira2 60m Hub. 0813.6132.1130 / 414.8848

BONUS: PAGAR, TERALIS JENDELA - AC KAMI BUKA KEMBALI DENGAN JUMLAH TERBATAS, KAWASAN STRATEGIS DEKAT RINGROAD HUB: KANTOR I 061-77552137 KANTOR II 061-8221447 RAMLAN 061-77100489 JESSY 061-77117439 FAKHRUL 061-30086484

TAMAN GRAND PERMATA HIJAU TAMAN PERMATA HIJAU

DP HANYA Rp. 10.000.000 Dapat DI CICIL

Jl. Ileng Marelan Type: 45, 55 & 65

Fasilitas: - Kolam Rekreasi & Taman Bermain - Lap. Tennis & Jogging Track - Mesjid - Sertifikat, IMB, Listrik, PDAM

SURYAMAS PROPERTY GROUP Hotline:

AIDA : 0812.6068.6248 - (061) 7719.8522 TUTI : 0813.9632.0898

Surat Kabar Tercinta:

Harian

DIJUAL CEPAT

Tanah dan Bangunan Luas +/- 350 M2. Jl. Garu II A, No. 52, Dpn Kampus UMN. HP. 0813 7820 6626, 0813 6100 5308

TANAH DIJUAL

TANAH DIJUAL

Tanah: Uk. 10x25m, Sertifikat Alamat: Pasar Merah Gg. Budi Harga: 250 Jt/nego Hub. 0813.6135.8779 7711.8623

Bursa

PELUANG BISNIS

LILIN

JUAL LILIN BAHAN LILIN MESIN LILIN HUB. 0812.6487.4950 (061) 844.2134

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:

Harian

WASPADA

Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

CD

Ya Tentu...Pasang Iklan di...

TANAH Kapling Dekat K. Namo. 10x25M = 13.750.000. Hub. 0812 6500 454. - 0813 7045 3562

SEGERA DIBANGUN PENGEMBANGAN PERUMAHAN

DISC s/d 10 %

4576602 FD

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain?

TANAH

TANAH Dijual Pinggir jalan Klambir V Psr. IV, ± 1 Km dr Pjk Kp Llng, Dpn Mesjid Ubudiyah, Tnh Datar, SK Camat, Uk. 12x50m, Hrg 280 Rb/mtr, Nego/ TP Hub. (061) 7652.6516/ 0812.654.1659

JL. PASAR II SETIABUDI TANJUNG SARI

Hub.

Jl. Denai No. 205 HP. 0852.9708.6572 Cabang Tg. Morawa - L. Pakam Km. 18,5 No. 40 Telp. (061) 9123.5036 Medan

4610 7564 4890 4204

TAMAN HARAPAN INDAH

Tempat Iklan Anda

Menjual/ Menerima tempahan & reparasi ukiran Jepara, Kursi, Lemari, Alat-alat pengantin

Khusus 8x15=27Jt Muka Belakang Jalan. harga bisa Nego. Bebas biaya Surat. Siap bangun. Lokasi Jl. Sei Mencirim Kec. Sunggal Dpn. Komp. TASA. Hub. 0813 61122791 0815 3018 999- 7707 2611 315 6362 655 7635

WASPADA

FURNITURE

TANAH KAVLING

0816 0813 0812 0813

Harian

JEPARA

Uk. 8x14 : 20Jt 7x23=27Jt 7x21=25Jt 8x16=23Jt

-

Hub Jl. Sentosa Lama Gg. Keluarga No. 11 0812.645.1785 - 7704.6185

SPRING BED DIJUAL MURAH

DIJUAL CEPAT

RUMAH DISEWAKAN

PENG. ALNTERNATIF KI AGENG TAPA PUTIH

1. Ajian Prabu Sliwangi, Kekebalan, T. Dalam, Hipnotis, Silat Ghaib 2. Sesak Sekar Mayang, Penunduk, Pengeretan, Daya tarik, Iner biuti 3. Pelat, pelaris usaha, buka aura, Masalah RT, Seret rezeki, Pesugian, Khodam pendamping, Bekam Tanduk, Alat Vital, Tdk punya keturunan

TEMPAHAN MURAH -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802

RUMAH SIAP HUNI DIJUAL Mulai Type 36, 48, 54 & 70. Lokasi Komplek Griya Nusa Tiga. Jl. Flamboyan Raya Simp. Melati T. Selamat Medan. Hub. (061)-7711739 - (061) 30086484 - (061) 77552137 Rumah Komplek Bumi Asri 3 KT, 2 KM, RT, RK, RM, Dapur, Garasi, Carport, Taman, Letak Strategis dan Aman. Hub. 0819 1181 4233, 0813 6169 2103

Hub. PAK RANDI

Alamat: Perumahan CENDANA ASRI Blok AC/ 06 Kampung UNDIAN Tj. MORAWA (masuk dari simpang Timbangan Jl. Limao Manis Tj. Morawa) Telp. (061) 7778.9233/ 0812.6083.5345 (No SMS) NB. Ribuan Orang Telah Tertolong & Membuktikannya

DIJUAL BIBIT SAWIT GRADE “A” SERTIFIKAT Usia diatas 1 Tahun +/- 20.000 batang lokasi: Kec. Barumun Tengah, Kab. Padang Lawas Hub. 061-7629 6735

Bursa

DIJUAL CEPAT 1 Unit Rumah Kondisi 90% Selesai. Jl. Eka Suka Depan Gang Eka Suka 9 Gedung Johor. Ukuran tanah 15 x 24 M2. Ukuran rumah 12 x 16 M2. Kamar 4 buah, Garasi 1 buah, SHM, IMB. Hub.0819 2112101

Subsidi Uang Muka 20 Juta

Jl. Sidodadi - Eka Surya - JOHOR

Bursa

PERKEBUNAN

PERABOT

1 Unit Rumah Bangunan baru Jl. Eka Warni III No. 18. Lbr. 10,5. Pjng. 15,5. Listrik, PAM, Siap huni. Berminat Hub. 0812 602 75881

DIJUAL

1 Unit Rumah Type 75, Luas Tanah 142M2: 3 K. Tidur, 1 Dapur, 1 R. Keluarga. 1 R. Tamu, 1 K. Mandi, PAM, PLN 2200 Watt, SHM. Komp. Surya Regency Blok C/7, Jl. Persatuan Helvetia (dkt Jl. Kapt. Muslim - Simp. Zipur). Harga Nego / Tanpa Perantara. Hub. 0813 7615 6400

TERAKREDITASI NO: 012/BAN-PT/AK-X/51/VI/2007

KAMPUS

Penghasilan Rp.1.500.000 - Rp. 2.500.000/bln (tergantung posisi kerja)

Apakah Anda Telah Meminta Bantuan Kemana-mana?Tetapi Belum Merasa Puas? I. Pengobatan Medis & Non Medis: Diabetes, TBC, Typus, Lever, Kanker, Stress, gila, kena guna2, dsb (Mahar ikhlas) II. Pelarisan usaha, Kharisma, Daya Tarik, Pemikat, Karier, Jabatan, Benteng diri, Kekebalan, Pemasangan Susuk, Mandi Minyak panas, Pengisian, Khadam, Pengisian air raksa, dsb

MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Depan Gg. Sadu Medan

RUMAH DISEWAKAN

RMH MEWAH HRG MRH! Akses Tol, Kot. Mdn, ±15 mnt Mdk Walk, G. Prize: Xenia, DP 24 Jt, Angs: 1,8 Jt Hub. Griya Albania (061) 7670.0976/ 0852.9710.0575

Menerima Mahasiswa Baru/ Pindahan T.A. 2009/ 2010

Jl. Gatot Subroto No. 325 Medan Telp. 456.9548 - 457.3158 Fax. 415.4154

100% BUKAN SALES Perusahaan swasta pusatnya di Jakarta, buka cabang di Medan, butuh 35 org P/W (17 - 35 thn) utk diposisikan di kantor Persyaratan: BISA PILIH - Foto copy KTP SHIFT KERJA - Pas Photo3x4 - Guntingan Iklan utk interview, Syaratlain bisa menyulus setelah interview diterima

“DIBUTUHKAN SEGERA”

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

SEKOLAH TINGGI TEKNOLOGI IMMANUEL MEDAN (S1)

Informasi dan Pendaftaran

LOWONGAN KERJA

Informasi Pembaca Bursa Property

Informasi selanjutnya hubungi:

PROGRAM STUDI: 1.TEKNIK MESIN (S1) 2.TEKNIK ELEKTRO (S1) SARANA PRAKTEK TERLENGKAP

Guru Laki-laki untuk Pesantren, Diutamakan yang bisa Berbahasa Arab, Pendidikan S1, Lulusan Pesantren Hub. - (061) 7333.564 - 0812.6000.9765 - 0813.7675.7571 - 0813.7679.9605

ILMU DARI MADINA, YOGYAKARTA, BANTEN AKTE NOTARIS NO: 07/NA/2009

PECI MAHKOTA

RUMAH DIJUAL CEPAT Uk. 13,4 x 9 M. Permanen 3KT, PAM, Listrik, Telp. Hub. 0852 7518 6444, 7332812 Harga Nego (TP), Jl. Letda Sujono G. Habincaran No. 3 Bdr. Selamat.

YAYASAN PENDIDIKAN Dr. RUSDI

DIBUTUHKAN

#PONDOK KEBATHINAN & TASAWUF NUR ILLAHI#

Bursa

RUMAH & TANAH

DIJUAL CEPAT

Menerima Mahasiswa/I Baru T.A. 2009/ 2010 Angkatan: XXIII Pendaftaran s/d Agustus 2009

Hubungi: IBU TINI HP. 0852 7524 0184 Jl. Seser No. 65 dari Jl. Suluh depan Kantor Gubernur Pancing/ Willem Iskandar

BUSANA & AKSESORIS

Jl. Letda Sujono Gg. Suka No. 3 A Bdr. Selamat. Dari Aksara Plaza +/- 200M. Sebelum Jl. Mandala. Tanah 10 x 20 M. Bangunan 8x13 M. Fasilitas PLN, PAM, Telp. Surat Camat. Harga Rp. 130Jt. Nego. Hub. Syakban Nst. HP.0813 9623 9510.

LOWONGAN KERJA

Berdiri Sejak Tahun 1989

DISEWAKAN RUMAH Di Jl. Setia Luhur Gang Anggrek No. 32 A Medan. Lokasi strategis Dekat dengan Plaza Millenium. Hub. HP. 0813 7538 5755. TP. Harga damai.

Komplek Pemda Tk. I Tanjung Sari Jl. Cempaka 3 No. 22, Kamar 3, Kamar Mandi 3, SHM Hub. (061) 7777.0342 / 0812.633.1231

Kami sebuah lembaga yang bergerak dalam bidang pendidikan membutuhkan beberapa untuk ditempatkan pada posisi: SUPIR Dengan ketentuan: a. Memahami jalan wilayah Medan b. Rajin dan bertanggung jawab c. Minimal tamatan SMA d. Umur max 35 thn e. Lamaran lengkap, pas photo, Fc. KTP, SIM, Ijazah terakhir, Kartu Keluarga dan Daftar Riwayat Hidup Kirimkan surat lamaran anda atau datang langsung ke Jl. Malaka No. 29/59 Medan

DAN

RUMAH & TANAH Pasar 9 Tembung, Jl. Sudomulyo Gg. Setia Tanah 11 x 18 M. Bangunan 7x11M. Harga Rp. 77,5 Juta/nego. SK Camat. Hub. Syakban Nst. HP. 0813 9623 9510

RUMAH DIJUAL

YAYASAN RSU Dr. RUSDI D/H GLUGUR

* Akademi Perawatan (Akper) * Akademi Kebidangan (Akbid) * Akademi Analis Kesehatan (AAK) * Akademi Analis Farmasi (Akafarma) * Akper Jalur Khusus

Informasi/ Pendaftaran:

RUMAH DIJUAL

Jl. Karya Darma I No. 2B (depan Lapangan Bola) Medan Johor, LT. 210m, KT: 3, 2 Tingkat (Harga nego) Hub. 7787.8387/ 0852.9700.1251

Lokasi Pusat Kota Lhokseumawe. Jl. Iskandar Muda No. 2 Fas. 7 KT, 4 KM, Telp, PDAM, Listrik. Halaman sangat luas, cocok utk kantor, Mes, tempat tinggal. Hub. Telp. (061) 7686 8383 HP. 0813 6014 0084

Menerima Mahasiswa Baru TA. 2009 - 2010 untuk Akademi - Akademika Kesehatan

Uji Tulis Gel I : Tgl. 15 Juli 2009 Uji Tulis Gel II: Tgl. 05 Agustus 2009

DIBUTUHKAN SEGERA

Rumah Uk. 4x16m, SHM, PLN, PAM, Telp, 2 KT, 2 KM, 2.1/2 Tkt, Katamso Square T. Kuning, 375 Nego Hub. 736.4710 - 7791.0154

Seorang pria yang berpengalaman membuat masakan Bakso dan Mie Ayam. Gaji memuaskan. (1/3 dari Keuntungan) Hub. Rudy P. (061 8363395 / 0813 7051 7159)

PELOPOR PENDIDIKAN FISIOTERAPI DI SUMATERA Telah Meluluskan 19 Angkatan Yang tersebar ke seluruh Indonesia

DIJUAL

1 Unit Rumah 12x13m2, 1 Ruang Tamu, 4 Kamar Tidur, 2 K. Mandi, 2 Dapur, Jl. Sekata 10 Gg. Flamboyan No. 6A Hub. 0813.6138.7449

Tiga org Tk. Pangkas Pengalaman, Hub. Pangkas Necis Jl. AR. Hakim 181C Sp. Bromo, Fasilitas Full AC

USD. 2400 USD. 2500

JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. 061- 457.6116/ 7731.3385 HP. 0812.6566.807 - 0813.61372.321

SD/ Guru Kelas, TK, SMP. YASPEN DARUL HIKMAH/ TK MELATI HP. 0813.9796.0600 Jl. Karet Raya Perumnas Simalingkar Medan

DIBUTUHKAN

PENGOBATAN KUSUK TERAPI TRADISIONAL

Dapat mengobati segala macam penyakit: - Gula - Pinggang/ Ginjal - Angin duduk - Lemah syahwat/ - Belum mendapat Impoten keturunan

USD. 1600 USD. 1700

MULTAZAM

MENCARI GURU

Sales Counter HP, Syarat: Wanita, SLTA, Rajin, Jujur, Sanggup kerja full time Hub. (061) 7786.0356 (Ibu Ayu)

USD.1500

INFO DAN PENDAFTARAN HUBUNGI:

RUMAH DIJUAL Di Kompleks Taman Citra Marelan. 2 KT, 1 KM, LT 200 MLB 50 M, PLN, PDAM, SHM, HOOK, Hadap Timur, 2 Ruko di Jl. Setia Budi Gg. Kenanga (cocok u/Kost) 200 Jt. Hub. Yudha 0815 300 1814 / 76369807/ 0819 7227 790

Bursa

PENGOBATAN

BUTUH ALA TB ANTU DENGAR? ALAT BANTU TRA HEARING AID Hub. MEL MELTRA Jl. Kediri No. 36 Medan Tel. 4516161

USD.1650

(SEGERA DAFTAR SEKARANG) SEAT TERBATAS

Contact Person: Jefri Irmanda, SKM: 0812.631.6639

Bursa

Bursa

MATERI BANGUNAN

WASPADA

Untuk informasi lebih lengkap hub

Bursa

PELUANG USAHA

INFO LANGKA

Jika anda seorang guru agama, guru pesantren, guru madrasah, guru TK guru ngaji, dai/muballigh atau para medis dll. ingin sambil menjaga kesehatan keluarga, bisa mendapat penghasilan Rp. 2 juta s/d puluhan juta rupiah/ bln (terbukti) anda mau tau? Hubungi: NABIL S. Ag Hp. 0813 6171 7785 Batas akhir 18 juli 2009 PELUANG USAHA BUDIDAYA JAMUR TIRAM MODAL KECIL UNTUNG BESAR Ikuti Pelatihan Usaha Budidaya Jamur Tiram lengkap: Pembuatan bibit F0, F1, F2, F3 dan F4, Pembuatan media tanam, Teknik sterilisasi, Perawatan, Panen, Pasca panen, Info pemasaran, Produk olahan jamur. Kandungan Gizi: Asam Amino (18 Jenis), Protein, Mineral, Vitamin, Karbohidrat, Lemak tak jenuh dll. Khasiat obat: Anti Kolesterol, Anti kanker, Anti Oksidan, Peremajaan kulit (Anti Aging), Anti Virus HIV, H5N1, H1N1*, dll Pelatihan diadakan pada: Sabtu/ Minggu: 18/ 19 Juli 2009.

TEL. (061) 4576602 FAX. (061) 4561347

KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)

PENGOBATAN MAKRIFATULLAH Ingin INSYA ALLAH DLM 30 MENIT Promosikan PENYAKIT LANGSUNG MEMBAIK Produk DIHARI PERTAMA, TDK TERBUKTI ANDA BEBAS DARI BIAYA/ GRATIS Anda 1. SESAK NAPAS RINGAN DLM 30 MENIT NAPAS NORMAL KEMBALI AGAK SULIT BICARA KAKI TERASA BERAT DIBAWA JALAN 2. LUMPUH YG BARU, 5 HARI PENGOBATAN SUDAH BISA BERJALAN 3. KENA GUNA-GUNA SUDAH BEROBAT KEMANA-MANA TIDAK KUNJUNG SEMBUH DLM 30 MENIT LANGSUNG MEMBAIK 4. KENA PASUNG, 10 HARI PENGOBATAN SUDAH BISA DIBEBASKAN 5. GANGGUAN JIWA SILAKAN DATANG KPD KAMI 6. LUTUT, PINGGANG, TULI RINGAN, ASMA, SYARAF TERJEPIT, GULA, JANTUNG BENGKAK, GEMETAR, SAWAN, STROKE, SULIT BUANG AIR BESAR, SUSAH TIDUR, NAPAS BAU, TANGAN BASAH, DLL ALAMAT: DARI TERMINAL AMPLAS ±200M JALAN PENGILAR I NO. 16 B ANWAR, B ALIAS DATU HATORANGAN 0852.7058.4878

Tempat: Jalan Bakti Luhur No. 139 Medan Helvetia (Masuk dari Jl. Kapt. Muslim samping RSU. Sari Mutiara). Biaya Pelatihan Rp. 500.000 per orang, Mahasiswa dan Kel. Pra Sejahtera Disc. 50%. Pendaftaran Muchtar: 0813.8197.7962 Fajar: 0813.7030.6995 Dariah: 0812.6003.945 - (061) 845.9753 Pembayaran pada saat pelatihan atau dapat ditransfer ke rekening: BRI Capem Kranggan Cibubur A/C: 057 801 009 839 502 An. MUHTARUDIN

Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di TVRi Tgl. 15 & 25 Juli 2009 Jam 20.00 WIB

Bursa

Call Center: 0818 090 73481

AIR MINUM

PUSAT PENGOBATAN SPESIAL ALAT VITAL DITANGANI LANGSUNG

BPK. HARYONO ASLI DARI BANTEN

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008


Pentas Demokrasi

28

WASPADA Jumat 17 Juli 2009

Ormas BK Usulkan SBY Susun Kabinet Progresif JAKARTA (Antara): Ormas Benteng Kedaulatan (BK) mengusulkan kepada capres Susilo BambangYudhoyono (SBY) jika ditetapkan sebagai presiden (2009-2014) agar dalam penyusunan kabinet bisa merangkul kaum muda yang berpotensial, sehingga kabinet progresif akan terbentuk dalam pemerintahan mendatang. “Penyusunan kabinet progresif dimaksudkan untuk memberikan ruang pada generasi muda untuk ikut andil bagian dalam membangun bangsa ini,” kata Ketua Umum Benteng Kedaulatan Farhan Effendi di Jakarta, Kamis (16/7). Menurut Farhan, orang-orang yang akan duduk dalam kabinet progresif tersebut hendaknya memiliki visi, misi yang jelas untuk melakukan percepatan pembangunan Indonesia. “Kabinet progresif ini hendaknya mengakomodir dari kalangan muda 50 persen dan kaum tua 50 persen,” ujarnya. Dia mengusulkan nama-nama seperti Anis Baswedan, Anas Urbaningrum, Khatib Basri, Dino Pati Jalal, Andi Arif, Raden Pardede dan Aam Sapulete bisa mewakili kalangan muda

yang akan duduk dalam kabinet tersebut. “Meskipun penyusunan kabinet menjadi hak prerogratif presiden, namun kami mengusulkan nama-nama tersebut bisa masuk dalam jajaran kabinet. Kami tidak mempunyai kepentingan apapun atas nama-nama itu. Orangorang tersebut sudah memiliki kompetensi dan kredibilitas yang jelas di bidangnya masingmasing,” katanya. Dia mengharapkan, agar partai pendukung SBY pada pilpres lalu tidak berharap banyak dalam komposisi kabinet. Memang sudah menjadi hal yang wajar jika partai pendukung memperoleh jatah kursi menteri. Namun semua itu dikembalikan saja pada SBY untuk menyusun kabinetnya. Farhan menambahkan, yang terpenting saat ini adalah bagaimana SBY bisa menyusun menteri yang bisa melakukan percepatan pembangunan demi kesejahteraan rakyat Indonesia. Karena seorang menteri adalah pembantu presiden, artinya siapapun nanti yang akan duduk menjadi menteri harus tunduk dan patuh pada perintah presiden bukan tunduk pada partainya lagi, katanya.

Tenggat Penyerahan Laporan Dana Kampanye 18 Juli JAKARTA (Antara): Tim kampanye nasional pasangan calon presiden dan calon wakil presiden memiliki waktu hingga Sabtu, 18 Juli untuk menyerahkan laporan penerimaan dan penggunaan dana kampanye. Kepala Bagian Administrasi, Biro Hukum Komisi Pemilihan Umum (KPU) Ahmad Fayumi di Jakarta, Kamis (17/7) mengatakan, pihaknya telah mengingatkan tim kampanye capres dan cawapres mengenai batas akhir penyerahan laporan tersebut. “Kita sudah menyurati, sudah menghubungi juga agar menyerahkan laporan penerimaan dan penggunaan dana kampanye paling lambat 18 Juli,” katanya. Setelah diserahkan ke KPU, laporan penerimaan dan penggunaan dana kampanye pilpres akan diserahkan ke Kantor Akuntan Publik (KAP) yang akan mengaudit laporan tersebut. Laporan dana kampanye itu memuat laporan penerimaan dan penggunaan dana kampanye, daftar sumbangan sampai 18 Juli, daftar pengeluaran dan saldo. Laporan itu juga harus dilengkapi dengan surat pertanggungjawaban yang di tandatangani

tim kampanye nasional dan diketahui oleh capres yang bersangkutan. Sesuai ketentuan Undang-Undang No. 42 Tahun 2008 tentang pilpres 2009, tim kampanye nasional wajib menyerahkan laporan penggunaan dana kampanye untuk diaudit. Pasal 100 ayat 1 UU 42/2008 menyebutkan, pasangan calon dan tim kampanye di tingkat pusat melaporkan penggunaan dana kampanye kepada KPU, KPU provinsi dan KPU kabupaten/kota paling lama 14 hari sejak berakhirnya masa kampanye. Kampanye berakhir 4 Juli, dengan demikian batas akhir penyerahan laporan pada 18 Juli. Sebelumnya tim kampanye nasional telah melaporkan jumlah penerimaan dana kampanye sampai 5 Juli 2009. Pasangan capres dan cawapres nomor urut satu Megawati-Prabowo melaporkan jumlah penerimaan dana kampanyenya Rp257,6 miliar. Sementara jumlah penerimaan dana kampanye pasangan nomor urut dua Susilo Bambang Yudhoyono-Boediono Rp200,47 miliar. Sedangkan pasangan nomor urut tiga Jusuf KallaWiranto melaporkan jumlah penerimaan dana kampanye per 5 Juli 2009 adalah Rp83,33 miliar.

Rekapitulasi Penghitungan Suara Di Aceh Salatan Tegang TAPAKTUAN (Waspada): Perdebatan ‘sengit’ antara saksi, KIP, Panswaslu dan PPK membuat suasana rapat pleno penghitungan perolehan suara pilpres di aula kantor KIP Jl. Sudirman, Tapaktuan tegang, Kamis (16/7) Kondisi dipicu terlambatnya sidang pleno yang seharusnya pukul 08:30 menjadi pukul 10:00 dengan alasan menunggu saksi capres PDI-Perjuangan. Ketua KIP Lian Azwin mengatakan, keterlambatan itu menyebabkan saksi capres JKWiranto, T. Mudasir mengajukan protes. Selain tentang keabsahan pleno tanpa dihadiri saksi PDI-P, juga mempersoalkan perolehan suara sah, suara yang rusak dan DPT, termasuk penghitungan suara yang dikirim dan dikembalikan ke KIP. Perdebatan mereda setelah disepakati semua lembaran berita acara yang dikirim PPK diparaf saksi JK-Win. Tetapi saksi SBY-Boediono dari Partai Demokrat menolak memaraf dengan dalih percaya kepada PPK. Namun tetap menuai

protes sejumlah PPK dan Panwaslu. Sidang dilanjutkan setelah Wakil Ketua KIP Suhaimi Salihin menengahinya dengan menyebutkan segala protes bisa dilanjutkan seusai rekapitulasi. Berdasarkan rekapitulasi penghitungan suara, capres SBY-Boediono mencatat kemenangan hampir di semua kecamatan, dengan total suara 96.377 atau 96,1 persen. Sedangkan JK-Win meraih 2.875 suara atau 2,86 persen dan Mega-Prabowo 998 suara atau 0,99 persen. Suara sah 125.00, tidak sah 4.764 dari 105.014 suara yang masuk. Sementara yang tidak memilih 35.181 atau 36 persen lebih dari jumlah DPT 140.195 orang. Sejumlah anggota DPRK Aceh Selatan mengaku prihatin tingginya angka golput dalam pilpres tersebut, meski menurun dibandingkan pileg beberapa bulan lalu. “Ini terjadi selain tidak akuratnya DPT, juga kurangnya sosialisasi kepada masyarakat, sehingga tingkat partisipasi masyarakat rendah,” sebut Wakil Ketua Komisi D DPRK Aceh Selatan, Azmir.(b19)

Bawaslu Stop Pengusutan Telekonferensi SBY JAKARTA (Waspada): Badan pengawas pemilu (Bawaslu) menilai kegiatan Presiden Susilo Bambang Yudhoyono dalam telewicara jarak jauh dengan para kepala daerah sehari menjelang pemilihan presiden tidak mengandung unsur kampanye. Itu sebabnya Bawaslu menghentikan pengusutan kasus yang dilaporkan tim sukses Megawati Soekarnoputri dan Prabowo Subianto. “Kesimpulan itu didasarkan atas keterangan para pihak yang diklarifikasi, para ahli serta anggota panwas provinsi yang ikut telekonferensi,” kata Wirdyaningsih, anggota Bawaslu di Jakarta, Kamis (16/7). Klarifikasi dari SBY disampaikan Ketua Tim Hatta Rajasa didampingi Wakil Ketua Djoko Suyanto, Sekretaris Marzuki Alie, dan Ketua Tim Advokasi Amir Syamsudin.

Menurut Wirdyaningsih, keterangan yang diberikan tim kampanye itu tidak ada pengucapan visi, misi, dan program. Keterangan yang meringankan SBY juga disampaikan Menteri Dalam Negeri Mardiyanto. Bekas Gubernur Jawa Tengah itu diklarifikasi dalam kapasitasnya sebagai penanggung jawab acara telewicara jarak jauh itu. Kepada Bawaslu, Mardiyanto menjelaskan kesertaan SBY dalam telewicara sesuai kapasitasnya sebagai Kepala negara dan kepala pemerintahan. Pengawas pemilu provinsi yang dikonfirmasi antara lain dari Papua, Kalimantan Barat, Yogyakarta, dan Jawa Tengah. “Panwas menyatakan tidak ada unsur kampanye dalam telekonferensi itu,” ujar Wirdyaningsih.(vivanews)

Antara

REKAPITULASI AKHIR: Seorang anggota tim sukses melakukan interupsi saat berlagsungnya rapat rekapitulasi suara pilpres terakhir di KPUD Solo, Kamis (16/7). Dalam penghitungan terakhir tersebut pasangan SBY-Boediono berhasil unggul di Solo yang merupakan salah satu basis terbesar PDIP.

Antara

JATAH KOALISI: Dari kanan ke kiri: Ketua DPP Partai Golkar, Priyo Budi Santoso, Ketua DPP Partai Demokrat, Anas Urbaningrum, Ketua DPP PKS, Zulkieflimansyah, dan Ketua DPP PAN Totok Daryanto, menjadi pembicara pada diskusi politik, di gedung DPR/MPR, Jakarta, Kamis (16/7). Diskusi bertema “Menghitung Jatah Koalisi” itu digelar untuk membahas mengenai kemungkinan koalisi antar partai politik pada kabinet mendatang setelah unggulnya pasangan Susilo Bambang Yudhoyono - Boediono pada Pilpres 2009.

Model Memilih Boediono Diterapkan Untuk Kabinet JAKARTA (Antara): Ketua DPP Partai Demokrat Anas Urbaningrum menegaskan, cara berfikir Susilo Bambang Yudhoyono saat memilih Boediono sebagai calon pendampingnya di pilpres akan diterapkan untuk membentuk kabinet pemerintahan mendatang. Saat menjadi pembicara dalam diskusi ‘Menghitung Jatah Koalisi’ di ruang wartawan DPR Jakarta, Kamis (16/7), Anas menjelaskan bahwa pada masa kedua pemerintahannya, SBY menginginkan terbentuknya kabinet yang lebih kuat dan efektif dalam bekerja. “Karenanya cara berfikir SBY saat memilih cawapresnya akan dilanjutkan untuk membentuk kabinet,” ujar Anas.

Anas mengatakan bahwa kabinet pemerintahan mendatang akan lebih menonjolkan postur kabinet kerja dan bukan kabinet politik. Hal itu menurut dia, akan lebih menjamin adanya soliditas internal, loyalitas dan kecakapan atau keterampilan dalam melaksanakan berbagai program kerja pemerintahan. Namun kata Anas, untuk komposisi, jumlah dan siapasiapa yang akan bergabung dalam kabinet pemerintahan mendatang menjadi otoritas presiden terpilih dengan hak prerogatifnya. Dia juga mengatakan bahwa periodekeduapemerintahanSBY merupakan masa-masa baginya untuk mencatatkan tinta emas dalam sejarah bangsa ini. Selain itu, harapan masya-

Kalla Dorong Yuddy Pimpin Golkar JAKARTA (Antara): Ketua Umum Dewan Pimpinan Pusat (DPP) Partai Golkar Jusuf Kalla mendorong tokoh muda seperti Yuddy Chrisnandi maju menggantikannya sebagai Ketua Umum guna regenerasi dalam tubuh Partai Golkar. “Ya harus (ada tokoh muda), harus mix, supaya ada regenerasi dan kelanjutan, tidak boleh dimonopoli,” kata Kalla di Jakarta, Kamis (16/7). Pernyataan Jusuf Kalla disampaikan ketika ditanya soal pencalonanYuddy Chrisnandi sebagai kandidat Ketum DPP Partai Golkar. Menurut Kalla, semua kader partai yang memenuhi syarat berhak, namun supaya ada regenerasi maka tidak boleh ada monopoli kalangan tua. “Pengurus itu supaya ada kelanjutan,” kata dia. Sebelumnya dalam rapat pleno DPP Partai Golkar, Rabu (15/ 7), Yuddy mengajukan diri sebagai kandidat Ketum DPP Partai Golkat pada Munas mendatang. Dua nama lain disebut-sebut berminat adalah Surya Paloh dan Aburizal Bakrie, namun keduanya belum mengajukan diri.

SBY-Boediono Menang Telak Di Lhokseumawe LHOKSEUMAWE (Waspada): Hasil rekapitulasi penghitungan perolehan suara di Komisi Independen Pemilihan (KIP) Kota Lhokseumawe,pasanganSusiloBambangYudhoyono(SBY)-Boediono mendulang suara mencapai 94,2 persen atau 69.726 suara. Sementara peringkat pasangan HM Jusuf Kalla- Wiranto dengan perolehan 3.624 suara atau 3,624 persen, dan pasangan Megawati Soekarno Putri- Prabowo Subianto dengan 694 suara atau 0,94 persen. Jumlah suara sah di Lhokseumawe 74.044, dan suara tidak sah 3.345. Berdasarkan hasil penghitungan perolehan suara, jumlah total pemilih yang ikut berpartisipasi pada pilpres 77.389 jiwa. Sementara daftar pemilih tetap (DPT) mencapai 118.880 jiwa, di empat kecamatan yaitu Banda Sakti, Blang Mangat, Muara Satu, dan Muara Dua, kata Ridwan Hadi, Ketua KIP Kota Lhokseumawe, Kamis (16/7). Ridwan mengatakan, hasil penetapan akan dikirim langsung ke KIP Provinsi di Banda Aceh, guna melaksanakan pleno untuk tingkat kabupaten/kota, direncanakan 19 Juli nanti. Disebutkan, proses penghitungan suara berlangsung aman sebagaimana pileg lalu. Aceh Singkil Pasangan SBY–Boediono juga unggul di Kab. Aceh Singkil dengan memperoleh 37. 433 suara atau 87, 4 persen dari 42. 829 suara sah. Hasil rekapitulasi KIP Aceh Singkil, Kamis (16/7), pasangan Megawati – Prabowo memperoleh 2. 674 suara atau 6, 2 persen dan pasangan Yusuf Kalla – Wiranto 2. 722 suara atau 6, 4 persen, dengan suara rusak mencapai 2. 358 lembar. Ketua kelompk kerja rekapitulasi suara pilpres KIP Aceh Singkil, Syahrial Raff usai rapat pleno mengatakan, Berdasarkan data rekapitulasi KIP, Jumlah DPT 62. 299 orang, yang menggunakahak pilih berdasarkan DPT 44. 985 orang, tidak memilih 17. 314 orang atau 27, 8 persen. Pemilihan tambahan menggunakan kartu tanda penduduk atau pemilih pindah TPS sebanyak 202 orang. Perolehan suara pilpres di Aceh Singkil tersebar di 10 kecamatan meliputi yakni, Pulau Banyak, Singkil Utara, Kuala Baru, Gunung Meriah, Simpang Kanan, Danau Paris , Suro, Singkohor dan Kota Baharu.(cmun/b30)

rakat terhadap pemerintahan SBY kali ini juga lebih besar ketimbang pada saat dia mendapat kesempatan memimpin bangsa ini lewat pilpres 2004. “Karena ekspektasi publik jauh lebih besar kepada SBY pada saat ini, maka kabinet mendatang juga harus lebih kuat dan efektif dalam mendeliver berbagai program kerja yang menguntungkan rakyat.” Sementara fungsionaris

PKS dalam diskusi itu, Zulkieflimansyah mengatakan bahwa partainya tidak ingin terjebak wacana terkait komposisi dan jatah menjatah kursi kabinet. Presiden SBY ujarnya, sudah mengatakan bahwa persoalan pembentukan kabinet baru akan dibicarakannya bersama partai-partai pendukung koalisi setelah KPU resmi mengumumkan pemenang pilpres. “Karenanya berbagai waca-

na tentang pembentukkan kabinet pada saat ini sifatntya spekulatif dan PKS ingin menghindar dari jebakan-jebakan itu,” ujarnya. Zulkieflimansyah mengatakan bahwa PKS merasa cocok berkoalisi dengan SBY karena dia berkomitmen memperkokoh sistem presidensil yang juga akan berjalan baik jika ditopang partner oposisi yang juga kuat di DPR.

Mega-Prabowo Adukan Penciutan TPS JAKARTA (Waspada): Tim Kampanye Nasional Megawati Soekarnoputri-Prabowo Subianto kembali mendatangi Kantor Bawaslu. Mereka kembali mendesak Bawaslu agar menyatakan bahwa Komisi Pemilihan Umum (KPU) melakukan pelanggaran soal penghilangan 69.700 TPS. “Kami berharap Bawaslu bisa menyatakan KPU melakukan pelanggaran, tapi Bawaslu mau mempertimbangkan untuk membawanya ke ranah hukum,” kata anggota tim hukum dan advokasi Mega-Prabowo,

Arteria Dahlan di kantor Bawaslu Jakarta, Kamis (16/7). Menurut dia, kedatangan untuk kesekian kalinya itu dalam rangka memberikan data tambahan terkait dugaan pehilangan TPS, berdasarkan data DPT yang diterbitkan KPU. Menurutnya, penghilangan TPS itu merupakan perbuatan terstrukur dan sistemik, sehingga dapat merugikan pasangan calon lain. “TPS ketika pemilu ditetapkan berjumlah 519.047 disertai dengan jumlah pemilih per TPS, sedangkan pada pilpres 450.229 namun tidak disertai jumlah

pemilih, sehingga sulit untuk mengeceknya,” kata Arteria. Sebelumnya KPU membantah mengurangi jumlah TPS. Akan tetapi jumlah TPS pada pemilihan legislatif memang berbeda dengan pemilihan presiden. KPU merujuk UU No. 42 tahun 2008 pasal 113 tentang pemilihan presiden, jumlah maksimal pemilih tiap TPS 800 pemilih. “Kalau pileg kan maksimal 500, malah beberapa 350 tiap TPS.Wajar kalau jumlah TPS lebih banyak,” ujar Anggota KPU Andi Nurpati.

Didesak Buka Tabulasi SMS

KPU: Tak Perlu Ada Yang Ditutupi J A K A RTA ( Wa s p a d a ) : Komisi Pemilihan Umum (KPU) menyambut baik desakan Tim Kampanye Nasional MegaPrabowo untuk membuka tabulasi short messege system (SMS) pilpres 2009. Tidak perlu ada yang ditutup-tutupi soal tabulasi yang kontroversial tersebut. “Nggak masalah, nggak perlu ditutupi. Tapi kalau keputusan KPU kan harus diplenokan,” kata anggota KPU I Gusti Putu Artha di kantor KPU, Jl Imam Bonjol,

Kamis (16/7). Menurut Putu, dari 450 ribuan TPS yang ada, KPU hanya menargetkan perhitungan 20 persen atau sekitar 100 ribuan TPS karena terkendala geografis (sinyal) di beberapa daerah. Namun dari 100 ribu TPS itu hanya 40 ribu yang berhasil ditabulasi. Tabulasi pun dihentikan pada 9 Juli 2009 dengan sekitar 18 juta suara yang masuk. Putu meminta masyarakat menunggu rekapitulasi nasional oleh KPU ketimbang terpenga-

ruh rumor via SMS. “SMS itu kan bisa dari siapa nyampe ke mana. Masyarakat harus cerdas melihatnya,” kata Putu. Berikut isi SMS yang beredar mengenai perolehan real count KPU yang diduga ditutup karena hasil perolehan SBY dibawah 50 persen: Kenapa tabulasi KPU dihentikan ? Info dari YD peneliti IFES karena dilarang dipublikasikan tabulasi akhir yaitu: SBY-Budi: 47,32%, Mega-Pro: 32,15%, JK-Win: 20,53%.(dtc)

KPU Bantah Diperintah IFES JAKARTA (Waspada): KPU membantah telah diperintahkan International Foundation for Electoral System (IFES) untuk menutup tabulasi pesan singkat (SMS) pilpres. Data berhenti karena memang tempat pemungutan suara (TPS) yang melaporkan hanya sedikit. “Ya nggak bener lah. Masa KPU di perintah-perintah IFES,”

keluh anggota KPU Abdul Aziz dalam pesan singkat kepada wartawan, Kamis (16/7). Aziz pun menjelaskan duduk persoalan mengenai berhentinya perhitungan tabulasi pilpres via SMS yang terus menuai protes keras banyak kalangan. Menurut Aziz hanya disebabkan kelompok panitia pemungutan suara (KPPS) yang

tidak mengirim data. “Itu bukan penghentian, data ituberhentimengalirkarenacuma segitu data yang terkirim oleh KPPSyangtelahmeregistrasidiri,” terang Aziz. Dia menilai data hasil tabulasi SMS valid, karena diambil langsung setelah penghitungan di TPS. “Data yang dikirim itu data publik yang telah diumumkan diTPS,” tegasnya.(dtc)

LSI: 80% Masyarakat Nilai Pemilu Jurdil JAKARTA (Waspada): Dari hasil survei dilakukan oleh Lembaga Survei Indonesia (LSI), pemilu legislatif (pileg) dan pemilihan presiden (pilpres) telah dilakukan secara jujur dan adil (jurdil). Ini membantah tudingan elit politik tertentu yang selamainimengatakansebaliknya. “Di tingkat elit mengatakan jika pemilu tidak berjalan dengan jujur dan adil, tapi ini terbantahkan dari penelitian kami yang mengatakan masyarakat lebih memilih jika

pemilu itu jujur dan adil,” ujar Direktur Eksekutif LSI Kuskrido Ambardi di kantornya Jl. Lembang Terusan, Menteng, Jakarta, Kamis (16/7). Menurut dia, masyarakat sebagai pemilih menilai pemilu itu sangat jujur dan adil. Dari data LSI 80 persen masyarakat menilai jika pelaksanaan pileg dan pilpres sangat jurdil. Data lainnya, 85 persen mengatakan puas dengan pelaksanaan demokrasi di Indonesia. Metode yang digunakan

dalam penelitian itu ada dua. Pertama lewat exit poll yang dilakukan pada 9 April 2009 dan 8 Juli 2009. Untuk pileg, setiap satu TPS diambil dua responden dari 2.100 TPS di Indonesia. Dengan marjin eror kurang lebih 1,7 persen dan tingkat kepercayaan mencapai 95 persen. Untuk exit poll yang dilakukan pada pilpres, satu TPS satu orang sampel dengan jumlah TPS yang sama. Marjin eror 2,4 persen dan tingkat kepercayaan 95 persen.(dtc)


waspada