__MAIN_TEXT__
feature-image

Page 1

#VISITEKSJÖ

2020

UPPLEV [ EXPERIENCE | ERLEBNISSE ] Sid. 2–20 BOENDE [ ACCOMMODATION | UNTERKUNFT ] Sid. 21 MAT & DRYCK [ FOOD & DRINK | ESSEN & TRINKEN ]

Sid. 22–23


2

www.visiteksjo.se


3 www.visiteksjo.se

Den unika trästaden Trähus som bevarats i århundraden. I Gamla stan väntar historiska miljöer runt varenda knut. Kullersten som leder in bland solvarma träväggar, knarrande portar och oregelbundna gränder. Innergårdarna, som många är öppna för allmänheten, har mycket att berätta om hur livet en gång såg ut i Eksjö. Garverier, skomakare och slaktare är i dag utbytta mot caféer, restauranger och småbutiker, men känslan av svunna tider lever än. Trästaden upplever du antingen på egen hand eller genom en guidad stadsvandring. Läs mer på sidan 11.

Eksjö’s Old Town is steeped in historical settings. Cobbled streets and alleys wend between sun-baked wooden facades, creaking gateways and charming courtyards. Experience the wooden town either on your own or on a guided town walk. Read more on page 11. Die Altstadt von Eksjö hat eindrucksvolle historische Milieus zu bieten. Auf Kopfsteinpflaster geht man entlang an sonnenwarmen Holzwänden, vorbei an knarrenden Türen durch verwinkelte Gassen. Die Holzstadt erforschen Sie entweder in eigener Regie oder Sie nehmen an einer geführten Stadtführung teil. Mehr darüber auf Seite 11.

Ladda ner appen Telling Eksjö och upplev både Albert Engström och stadsvandringar i Gamla stan.

[ HISTORIA: EKSJÖ ]

TELLINGEKSJÖ

På tidigt 1400-tal fick Eksjö sina stadsrättigheter av Erik av Pommern. Redan då var staden sedan länge en mötesplats för köpmän, hantverkare, militärer och bönder. Den medeltida staden låg cirka 500 meter sydväst om den nuvarande stadskärnan och ödelades av en brand 1568. Erik XIV beordrade då att en ny stadsplan skulle göras. Norr om Stora Torget i Gamla stan är denna stadsplan, signerad byggmästare Arendt de Roy, än i dag intakt. In the early 1400s, Eksjö was chartered as a town by King Eric of Pomerania. The medieval town, which was ravaged by fire in 1568, was located some 500 meters southwest of the present town centre. Today, the old central buildings are all listed and Eksjö counts as one of Sweden’s best-preserved wooden towns. Im frühen 15. Jahrhundert erhielt Eksjö die Stadtrechte von Erich von Pommern. Die mittelalterliche Stadt lag etwa 500 Meter südwestlich von der heutigen Stadt und wurde durch einen Brand im Jahre 1568 zerstört. Die alten Stadtteile von Eksjö gehören zu den besterhaltenen Holzstädten Schwedens und der gesamte Innenstadtkern steht unter Denkmalschutz.

Download the app Telling Eksjö for more information about Albert Engström and walks through the Old Town. The tours are available in Swedish, English, German, Arabic and Farsi. Laden Sie die App ”Telling Eksjö” herunter und erleben Sie Albert Engström sowie Stadtführung in der Altstadt.


4 Foto: Emma Jansson

www.visiteksjo.se

[ FILMBYN SMÅLAND ] Kliv in i filmens värld i en utställning som är skapad i Astrid Lindgrens anda. I Filmbyn Småland får du se klassiska studiobyggen och originalkostym från filmerna, sjunga till filmmusik, skapa egna mobilfilmer och uppleva andra interaktiva miljöer. Passa även på att besöka någon av alla de tolv inspelningsplatserna som ligger runt knuten.

lei ne Lan d

de

Im Filmdorf Småland kann man Szenen von Kinderfilmklassikern wie Michel aus Lönneberga, „Wir Kinder aus Bullebü“ und „Pippi Langstrumpf“ sehen. Treten Sie ein, in die Welt des Films, in eine magische Ausstellung in Astrid Lindgrens Geist.

ley

Step into the world of filmmaking via a magical exhibition, created in the spirit of Astrid Lindgren. At Filmbyn Småland (Film Village) you can experience scenes and original props from classical children’s films, e.g. Emil in Lönneberga, the Bullerby children and Pippi Longstocking. to: Fo

M

a


5 Fem minuters promenad från torget i Mariannelund ligger Herrgårdsparken med Tempelbron. En romantisk trädgård som anlades av en generallöjtnant till sin hustrus ära på 1700-talet.

Mariannelund Bullerbyn och Katthult runt knuten. Astrid Lindgren placerade Mariannelund på världskartan när hon lät Emil hissa upp sin syster i flaggstången för att se »ända till Mariannelund«. Här är du mitt i Astrid Lindgrens hembygd med närhet till alla de platser där Emil-filmerna spelades in. I Filmbyn Småland kan du uppleva klassiska studiobyggen och originalkostymer från just Emil i Lönneberga, men även Pippi Långstrump, Ronja Rövardotter och Saltkråkan. Här finns den småländska naturen med skogar, ängar, röda stugor och sjöar. Du kan uppleva den via vandringsleden mellan Mariannelund och Lönneberga eller i Rumskullaskogarna där inlandsisen efterlämnat extrema spår i landskapet. I Mariannelund doftar det dessutom av konfekt från karamellkokeriet där gamla tiders marknadsgodis är ett gediget hantverk. Och Astrid Lindgrens Värld ligger bara ett stenkast härifrån. This is where the Emil films were created. Mariannelund became known in the books about Emil in Lönneberga. In one of the stories, Emil hoisted up his little sister Ida in the flagpole so that she could see »all the way to Mariannelund«. It is in the home district of author Astrid Lindgren, where the Bullerbyn and Katthult villages are situated. The film locations are all nearby. In Filmbyn Småland in Mariannelund you are welcome to take a look behind the scenes and see how the Emil stories were filmed. And the Astrid Lindgren’s World theme park is only a few minutes away. Astrid Lindgren machte Mariannelund dadurch bekannt, dass Michel von Lönneberga seine kleine Schwester an der Fahnenstange hochzog, damit sie »bis nach Mariannelund« sehen konnte. Das hier ist das »Land« von Astrid Lindgrens, wo auch die Orte Bullerby und Katthult liegen. Hier wurden die Filme von Michel von Lönneberga gedreht, was man sich im Filmdorf Småland ansehen kann.

A five-minute walk from the Mariannelund town square brings you to Herrgårdsparken with its legendary temple bridge, Tempelbron. A romantic manor park established in the 18th century. Fünf Fußminuten vom Marktplatz in Mariannelund liegt der Herrgårdspark mit der Tempelbrücke. Dieser romantische Garten wurde im 18. Jahrhundert angelegt.

KARAMELLKOKERI Besök det anrika karamellkokeriet där all tillvekning sker för hand enligt gamla hemliga recept. Kika in i fabriken och köp med gotter hem från butiken. Visit the tradition-steeped sweet factory in Mariannelund where everything is made by hand. Watch the production process and buy some sweets to take home. Besuchen Sie die historische Bonbon-Kocherei in Mariannelund, wo die Süßwaren von Hand hergestellt werden. Nach dem Besuch der Fabrik kauft man hier Leckereien feinster Qualität.

www.visiteksjo.se

HERRGÅRDSPARKEN


6

www.visiteksjo.se


7

En mäktig spricka i berget. Skurugata är en cirka 800 meter lång ”skura” eller förkastningsspricka som ofta beskrivs som södra Sveriges mest egendomliga naturfenomen. En vandring genom gatan är en storslagen naturupplevelse. Här kryssar du mellan stenblock och bergväggarna är på sina ställen upp till 35 meter höga. I början av gatan finns utsiktspunkten Skuruhatt som är en av Smålands högsta punkter (337 meter över havet). ”Hatten” bjuder på en magnifik och oförglömlig utsikt över bygden. A mighty crack in the rock. Skurugata is an 800 meter long fault line in an area that offers exciting natural experiences. From the highest point at Skuruhatt, you have a magnificent view over the surrounding countryside.

Ein mächtiger Riss im Fels. Die Skurugata stellt als etwa 800 Meter lange Schlucht, bzw. Bruchlinie ein großartiges Naturerlebnis dar. An ihrem Startpunkt liegt der Aussichtspunkt „Skuruhat”, von wo sich ein prachtvoller und unvergesslicher Blick auf die Landschaft bietet.

www.visiteksjo.se

Skuruhatt & Skurugata


8

www.visiteksjo.se


9 På Aschanska gården har tiden stått stilla i mer än 150 år och ett besök här tar dig rakt in vardagen hos en svensk borgarfamilj på 1850-talet. In this old merchant’s home, time has stood still for 150 years. Step back in time and experience daily life in a small-town upper-class family of the 1850s.

Eksjö museum

Hier hat die Zeit 150 Jahre lang stillgestanden, sodass man hier unmittelbar den Alltag einer schwedischen Bürgerfamilie der 1850er Jahre erlebt.

FORNMINNESGÅRDEN

En oas mitt i stan. Eksjö museum är vackert beläget vid Eksjöån och skapar med sin inbjudande trädgård en härlig entré för besökare. Det är en utmärkt plats att starta sin eksjöupplevelse på. Muséet har tre fasta utställningar. Den stadshistoriska utställningen låter dig följa Eksjös utveckling genom seklerna och ger ett bra faktaunderlag till dina fortsatta äventyr i eksjöbygden. Sveriges största Albert Engström-samling finns också att beskåda och även Smålands militära historia från medeltid till våra dagar finns samlad i en utställning.

I en kopparslagargård från 1600-talet finns hembygdsmuséet Fornminnesgården. Här finns bland annat stora samlingar av verktyg, hantverk och inredning att beskåda.

I två konsthallar visas tillfälliga utställningar inom samtidskonst, konsthantverk, fotografi, kulturhistoria och mycket mer. I Eksjö museums entré hittar du Eksjö Tourist Center och där finns det även möjlighet att köpa vykort, souvenirer och unika presenter.

Im Hof eines Kupferschmieds des 17. Jahrhunderts ist das Heimatmuseum Fornminnesgården untergebracht, dessen Besuch sich auch unbedingt lohnt.

Eksjö Museum is beautifully situated beside the Eksjöån river, and its delightful garden in itself an invitation to visit. The museum has three permanent exhibitions. There are also two art halls exhibiting contemporary art, handicraft, photography, cultural history etc, for limited periods. Eksjö Museum liegt sehr hübsch am Fluss Eksjöån und bildet mit seinem einladenden Garten einen liebevollen Eingang für Besucher. Das Museum hat drei permanente Ausstellungen. In zwei Kunsthallen werden außerdem wechselnde Ausstellungen über Gegenwartskunst, Kunsthandwerk, Fotografie, Kulturgeschichte und andere Bereiche geboten.

The arts and crafts museum is housed in the old coppersmith’s workshop from the 1600s. The museum is well worth a visit.

www.visiteksjo.se

ASCHANSKA GÅRDEN


BESÖKSMÅL [ PLACES TO VISIT | BESUCHERZIELE ] Aschanska gården Norra Storgatan 18, Eksjö 0381-361 60 | aschanska.se Filmbyn Småland Spilhammarvägen 4, Mariannelund 0496-216 91 | filmbyn.se Bruzaholms bruksmuseum Bruksvägen, Bruzaholm 0381-202 03 | bruzabruk.se Eksjö museum Österlånggatan 31, Eksjö 0381-361 60 | eksjomuseum.se Engströmsgården i Hult (förbokning) Kyrkbyvägen, Hult 0381-302 05, 070-589 24 43 engstromsgardenhult.se FOBOs Trädgård Kvarnarps gård, Eksjö 070-276 60 67 | fobo.se Fornminnesgården/ Hembygdsmuseum 072-588 37 09 Arendt Byggmästares gata 22, Eksjö hembygd.se/eksjo

Jaktmuséet Skedhult (förbokning) Skedhult 1, Eksjö 077-183 03 00 | jagareforbundet.se Julles mekaniska verkstad (förbokning) Östra Storgatan 3, Mariannelund 0496-216 90 | korta.nu/julles Ljusboden Kållarp, Hult 0381-300 61 | ljusbodenihult.se Mariannelunds hembygdsgård 070-565 30 13 korta.nu/mlund Slöjdstugan Järnvägsparken, Eksjö 070-948 91 44 *Säsongsöppet / Open in season / Geöffnet in der Saison Med reservation för eventuella förändringar. Subject to change without notice. Änderungen vorbehalten.

[ ALBERT ENGSTRÖMSGÅRDEN ]

Få människor är så förknippade med Eksjö som författaren och konstnären Albert Engström. Han ligger sedan 1940 begravd i Hult, orten där han spenderade stor del av sin uppväxt. På Albert Engströmsgården i Hult kan du boka ett besök i Alberts föräldrahem. Besökare välkomnas även att se sig omkrig på gården och omgivningarna på egen hand. Det går utmärkt att slå sig ner för en picknick i de lugna och vackra miljöerna! The artist Albert Engström is intimately associated with Eksjö. Visit his birthplace, Engströmgården in Hult. A lovely spot for a picnic. Nur wenige Menschen sind so stark mit Eksjö verknüpft wie der Schriftsteller und Künstler Albert Engström. Im Albert Engströmsgården in Hult kann man sein Elternhaus besuchen.

BRUZAHOLMS BRUKSMUSEUM

De svenska bruksorterna bär på en alldeles speciell historia. På Bruzaholms bruksmuseum finns historien och föremålen bevarade. Allt från gjutna kaminer och spisar till grytor och vädurspumpen finns att beskåda. Besök även de gamla arbetarbostäderna. The old foundry dates back to the 1600s. Here you can see an display of products, from iron stoves to pots and pans and the famous “Väduren”– the hydraulic ram pump. Learn about the time-honoured ironworking trade and visit the old workers’ dwellings. Im Eisenhüttenmuseum in Bruzaholm sind Geschichte und alte Gegenstände gut erhalten geblieben. Hier können Besucher u.a. alte gusseiserne Öfen und Herde; Töpfe und Kolbenpumpen betrachten und außerdem die alten Arbeiterhäuser besuchen.


11

The wooden buildings in Eksjö Old Town possess a unique character and provide a quaint backdrop to the town’s newer parts. The historic towns of Eksjö, Nora and Hjo constitute the Europa Nostra prizewinning network of the “Three Wooden Towns”. Die alten Gebäude i Eksjö geben der Stadt ihren einzigartigen Charakter und sorgen gleichzeitig für einen reizvollen Kontrast zu den neueren Vierteln der Stadt. Eksjö bildet zusammen mit Nora und Hjo das Netzwerk „Drei Holzstädte“.

STADSVANDRING

Sommartid kan du ge dig ut på en guidad stadsvandring som utgår från Eksjö Tourist Center. Välkommen in så berättar vi mer! 19/6–20/8.

TOWN WALKS

During the summer months guided town walks are available from the Tourist Center in Eksjö. Welcome to visit us for more information! 19.6–20.8.

STADTFÜHRUNG

Im Sommer empfiehlt sich eine geführte Wanderung durch die Stadt, die am Tourist Center in Eksjö beginnt. Wenn Sie uns besuchen, erfahren Sie mehr. 19.6.–20.8.

www.visiteksjo.se

Den gamla bebyggelsen i Eksjö ger staden en unik prägel samtidigt som den blir en trevlig kontrast till stadens nyare stadsdelar. Gamla stan i Eksjö erhöll 1997 ett Europa Nostra-diplom. I motiveringen kan man bland annat läsa: ”För utomordentlig renovering av denna betydelsefulla samling av äldre trähusbebyggelse som har givit nytt liv till den gamla stadskärnan”. Eksjö, tillsammans med Nora och Hjo bildar nätverket ”Treträstäder”. Läs mer om städerna och samarbetet på www.tretrastader.se.


FAMILJEAKTIVITETER [ FAMILY ACTIVITIES | AKTIVITÄTEN FÜR DIE FAMILIE ]

Eksjö Camping Vildparken Ett stenkast från centrala Eksjö utmed Eksjöån ligger Vildparken. Det vackra grönområdet lämpar sig väl för picknick och lekparken är perfekt för leksugna barn. Här finns även en boulebana. Lekparken och den intilliggande toaletten är tillgänglighetsanpassade. A stone’s throw from central Eksjö overlooking the Eksjöån river lies Vildparken, an ideal place for picnics, while the play area is perfect for children with energy to spare. Nur einen Katzensprung vom zentralen Eksjö, am Ufer des Eksjöån, liegt der Wildpark, der sich für Picknick gut eignet und verspielten Kindern einen idealen Spielplatz bietet.

Skullaryd Älgpark

Foto: Henrietta Öster

Ta chansen att se älgar och hjortar på riktigt nära håll! På Skullaryds älgpark kan ni åka safarivagn, uppleva djuren i deras naturliga miljö och se på när de matas. I en gammal ladugård finns souvenirer och fika att köpa.

På Eksjö Camping finns en mängd olika aktiviteter för hela familjen. Lekplats, badplats, äventyrsgolf, café och servering, turisttåg, samt uthyrning av båtar, trampbilar med mera. Torsdag, fredag och lördag under vecka 27–31 anordnas en rolig timme för leksugna barn. At Eksjö Camping there are activities for the whole family, including a playground, a bathing spot, adventure golf, a cafeteria, a tourist train, and boats and pedal cars for hire. Eksjö Camping bietet Aktivitäten für die ganze Familie, Kinderspielplatz, Badestelle, Abenteuer-Golf, Café und Gastronomie, Touristenzug sowie Verleih von Booten und Tretautos.

At the Skullaryd Moose Park you can take a tour in a safari wagon and experience the animals in their natural environment, and also watch them being fed. The old barn in the park offers souvenirs and refreshments. Im Elchpark von Skullaryd können Sie im Safari-Wagen fahren, die Tiere in ihrer natürlichen Umgebung beobachten und bei der Fütterung zuschauen. In einer alten Scheune werden Andenken und Erfrischungen zum Kauf angeboten.


13

Frisbeegolf I närheten av Eksjö Camping finns en frisbeegolfbana med nio hål som vem som helst har möjlighet att gå och kasta med sina egna frisbeediscar. Det är gratis att nyttja banan och har man inte egna discar finns det att hyra på campingen.

Close to the Eksjö Camping site is a nine-hole frisbee golf course that visitors can use free of charge. If you don’t have frisbees of your own, they can be hired at the campsite. In der Nähe von Eksjö Camping liegt eine Frisbeegolfbahn mit neun Körben, der kostenlos genutzt werden darf. Frisbeescheiben kann man am Campingplatz mieten.

Filmbyn Småland

Upplevelseskogen

Besök upplevelsecentrumet som skapats kring Astrid Lindgrens populära barnfilmer. Filmbyn rymmer både utställning, interaktiva miljöer, köttbullerestaurang, glassbar och souvenirbutik. Utanför väntar Upplevelseskogen. Läs mer om Filmbyn på sidan 4.

A parkour course, poetry board, balance course, playhouse and film backdrops can all be found in the pine forest just outside Filmbyn Småland. Eine Parkourbahn, eine Poesietafel, eine Balancestrecke, ein Spielhaus und Filmkulissen sind Teil des Erlebniswaldes vor den Toren des Filmdorfes.

Foto: Emma Jansson

I tallskogen utanför Filmbyn Småland finns spännande miljöer skapade för lek, rörelse och filmskapande. Parkourbana, poesitavla, balansbana, lekstuga och filmkulisser är delar av Upplevelseskogen.

Storegårdsområdet Skatepark, fotbollsplan, beachvolley-/ beachhandbollsplan och en multiarena för bland annat basket och landbandy – allt på Storegårdsområdet i närheten av Eksjö Camping. The area of Storegård, nearby Eksjö Camping, offers a skate park and courts for volleyball, football and basketball. Auf dem Storgård-Areal in der Nähe des Campingplatzes gibt es einen Skatepark sowie Spielfelder für Fußball, Volleyball und Basketball.

Visit the Småland Film Village (Filmbyn), inspired by Astrid Lindgren’s popular children’s films. Experience the film locations and the outdoor playground. Read more on page 4. Das Filmdorf Filmbyn Småland ist anlässlich der beliebten Kinderfilme von Astrid Lindgren entstanden. Hier erlebt man die Drehorte der Filme hautnah. Mehr darüber auf Seite 4.

www.visiteksjo.se

Foto: Carina Engqvist


14

www.visiteksjo.se


15

Tror du på talesättet om ”mörka Småland”? De som besökt Eksjö brukar inte göra det längre. Istället är det ljuset, vattnet och vyerna som blir det bestående intrycket. Skogarna breder ut sig på Småländska höglandet men det gör också sjöarna. Är du ute på ”grönbete” kan du njuta av underbara växlingar i landskapet – mellan de vidsträckta utsikterna och det jordnära och småskaliga. De stora höjdskillnaderna gör att man kan skaffa sig en överblick över naturen.

In and around Eksjö, the light, the water, the woods and the views make a lasting impression. There are many different ways of enjoying our beautiful countryside. Cycle or hike along one of our trails, bathe and fish in splendid clearwater lakes, or take a ski trip or go jig fishing in winter. In Eksjö machen Licht, Wasser, Wälder und Aussichten einen bleibenden Eindruck. Es gibt viele Möglichkeiten, unserer reizvollen Natur zu begegnen. Auf unseren Wanderwegen kann man Rad fahren oder wandern, unsere herrlich klaren Seen laden zum Baden und Angeln und im Winter sind Skilanglauf und Eisfischen beliebt.

Det finns många olika sätt att möta den vackra naturen på. Cykla eller vandra längs någon av våra leder, bada och fiska i vackra klarvattensjöar, åka längdskidor och pimpla vintertid, ströva i naturreservat som Skrôle Hie eller leta sig upp till utsiktsplatser som Skuruhatt.

Fiskekort

Fishing licence / Angelschein Eksjö Tourist Center Österlånggatan 31, 0381-361 70 Turistbyrå, Mariannelund Spilhammarvägen 4, 0496-216 91

[ FISKELYCKA ]

Sportfiske eller avkoppling? I Eksjö kommun finns något för både den inbitne storfiskaren och hobbymetaren som är på jakt efter en stunds avkoppling. Du kan fiska (med fiskekort) i ett 40-tal sjöar i kommunen. De flesta är källsjöar vilket innebär att det är ”klarvattensjöar”. Självklart är de dominerande fiskarterna abborre, gädda och mört. Abborren i våra sjöar är ofta välväxt och även gäddfisket anses bra – men är en utmaning som kräver sin fiskare. Men här finns också braxen och sutare och i kommunens största sjö, Solgen, finns ett bra bestånd av gös och inplanterad regnbåge. God fiskelycka!

Go fishing or time to relax? Eksjö offers something for both the seasoned sports fishing enthusiast and the occasional angler. Fishing is available (with a permit) in some 40 lakes throughout the municipality of Eksjö. Most of these lakes are head water lakes which means they have clear waters. Sportangeln oder entspannen? Eksjö hat sowohl etwas für den passionierten Sportangler als auch für Freizeitangler zu bieten, die auf der Suche nach einem erholsamen Urlaub sind. Sie dürfen (mit Angelschein) in über 40 Seen in der Gemeinde angeln. Da die meisten Quellseen sind, handelt es hier um „Klarwasserseen”.

www.visiteksjo.se

Naturupplevelser runt knuten


16

www.visiteksjo.se


17 www.visiteksjo.se

[ CYKELLEDER ] Albert Engströmleden. Kuperad led på asfalt och grus genom vacker bokskog. Besök gärna Skurugata och Hult med Engströmsgården, Ljusboden och lanthandel. The Albert Engström trail takes you through beautiful beech forests on paved and gravel paths. Visit the Skurugata fault and the artist’s birthplace and museum, Engströmsgården in Hult. The Ljusboden candlemaker’s shop is not far away. Hüglige Strecke auf Asphalt und Schotter durch schönen Bucherwald, tiefen zauberhaften Wald und typisch småländische Szenerien. Beuschen Sie Skurugata und Hult mit Engströmsgården, Kerzenladen und Dorfladen. Paradisturen. Cykla i småländsk natur och varierat landskap. Besök gärna FOBOs trädgård, Höreda kyrka och Kulla Kapell. Café och lanthandel finns ett stenkast från leden. The Paradis trail. Experience the varied Småland landscape at your own pace and visit FOBOs gardens, Höreda Church and the Kulla Chapel. A café and countryshop are only a stone’s throw from the path. Man radelt durch småländische Natur und abwechslungsreiche Landschaft. Besuchen Sie FOBOs Trädgård, dire Kirche in Hörade und die Kapelle Kulla. Nur einen Katzensprung vom Weg entfernt, gibt es ein Café und einen Dorfladen.

Vandringskartor Hiking maps | Karten

Eksjö Tourist Center Österlånggatan 31

Höglandsleden Höglandsleden sträcker sig genom hela det Småländska höglandet och består av fyra olika etapper. Sammanlagt är det en 44 mil lång vandring som bjuder på bland annat stora skogar, öppna fält, ängar, sjöar och mossar. En av etapperna kallas ”Utsikternas led” och passerar fina utsikter som Paradisområdet, Klinten, Hässleåsa damm, Valbacken och Skuruhatt. Leden är markerad med orange färg och skyltad med en fyrkantig blå skylt med två vandrare i mitten.

Turistbyrå, Mariannelund Spilhammarvägen 4

The Highland Trail is a 440 km hiking trail comprising four stages and extending throughout Småland’s highland area with its forests, fields, lakes and mosslands. Der Höglandsleden ist ein 440 km langer Wanderweg, bestehend aus vier Etappen, die sich durch das gesamte småländische Hochland mit seinen Wäldern, Weiden, Seen und Moorgebieten erstreckt.

Information om fler cykel- och vandringsleder hittar du på Eksjö Tourist Center och www.visiteksjo.se. For more information about local cycle routes, please visit Eksjö Tourist Center or www.visiteksjo.se. Weitere Fahrradstrecken finden Sie im Eksjö Tourist Center und bei www.visiteksjo.se.


www.visiteksjo.se

Foto: Jenna Lindstedt

Foto: Christoffer Jonsson

18


19

AC Horse & Cattle Co. Ridning Kolshester gård, Eksjö 073-339 30 72 | achcc.se Bergets Sportfiske & Aquakultur Ädelfiske, gruppbokningar 070-318 38 75 Boaryds Golf Pay and play-golfbana Hults-Boaryd 5 076-792 96 59 | boarydgolf.se Bruzaholms Gokarthall Solhöjdsvägen 2, Bruzaholm 073-151 03 04 (förbokning) Cykelsmedjan Cykeluthyrning Norra Storgatan 25, Eksjö 0381-142 10 | cykelsmedjan.com Cykla i Filmlandskapet Småland Cykeluthyrning, cykelturer & cykelpaket Turer till Katthult, Bullerbyn m.m. cyklaifilmlandskapetsmaland.se

Eksjö padelcenter Kråkebergsvägen 2, Eksjö 073-539 15 28 | matchi.se/facilities/eksjo Eksjö simhall Storegårdsgatan 3, Eksjö 0381-361 82 | www.eksjo.se First Class Padel Prästängsvägen 5, Eksjö 070-669 68 44 matchi.se/facilities/FirstClassPadelEksjo Hammar vid Solgen Stuga, försäljning av fiskekort Hammar 4, Värne, Eksjö 070-518 47 57 hammarvidsolgen.se Harmoni Rid- och Aktivitetscenter Ridning, träffa hästar Norra Råsa, Eksjö, 072-222 24 41 harmonicenter.com Högefälle Mountainbike Park Mountainbikebana eksjock.se/hogefallemtbpark/

Eksjö Bowling Kaserngatan 30, Eksjö 0381-163 00 | eksjobowling.se

Höglandets Kanotcenter Bocksjöstugan, Eksjö 0381-400 81 , 070-857 01 14

Eksjö Camping Äventyrsgolf, kanotuthyrning m.m. Prästängsvägen 5, Eksjö 0381-395 00 | eksjocamping.se

Movänta Camping Kanotuthyrning, minigolf m.m. Badvägen 4, Hult 0381-300 28 | movantacamping.se

Eksjö Fiskeklubb Fiskekort, Åsa Fiskegård 073-275 39 63 | eksjofiskeklubb.se

Paradis Fiskecamp Kräftfiske, fiske, fiskekort, stugor Paradis Gård, Eksjö (förbokning) 070-575 11 44 | paradisfiskecamp.se

Eksjö Golfbana Skedhult, Eksjö 0381-135 25 | eksjogk.se

Skidstugan Eksjö Konstsnöspår, natursnöspår 0381-61 15 33 eksjosok.se/konstsnosparet/ Skullaryd Älgpark Älgsafari – guidade turer Skullaryd Sjöarp 1, Eksjö 073-812 28 68 skullaryd-algpark.se Skälsnäs gård Fiske, fiskekort, båt, stuga Skälsnäs Piatorp 1, Hult 0381-440 07 | www.skalsnasgard.se Spilhammars Camping Kanotuthyrning Spilhammarvägen 2, Mariannelund 0496-102 73, 070-565 03 17 spilhammarscamping.com Stall Kosel Ridning, Hult | 073-738 63 99 facebook.com/StallKoselClydesdale Valbackens alpina Valbacken Ingatorp 0381-210 77 | valbacken.se Åsa Fiskegård Båt, fiske, fiskekort Edshult, Eksjö 0381-450 30 | eksjofiskeklubb.se Åsa Gård I&D Handledda ridturer, ridning Edshults-Åsa 1, Eksjö 076-793 57 54, 0381-77 31 11 asagard.se

Further suggestions for activities can be found at Eksjö Tourist Center or www.visiteksjo.se Weitere Tipps für Aktivitäten findet man im Eksjö Tourist Center und bei www.visiteksjo.se

www.visiteksjo.se

AKTIVITETER [ EXPERIENCE | ERLEBNISSE ]


20 www.visiteksjo.se

[ MYSIG SHOPPING I ANRIK STAD ] I Eksjö finns ett bra utbud av unika butiker och mysiga caféer. Här kan du i lugn och ro njuta av den anrika trästadens atmosfär på en uteservering, eller ge dig in och botanisera bland butikernas breda utbud. Vill du handla second hand-produkter och antikviteter finns det en mängd ställen att besöka. På visiteksjo.se/loppis finns en bra lista för en lyckad antik- och loppisrunda! Cosy shopping in a traditional setting. Eksjö offers a good selection of unique shops and snug cafés. Enjoy the atmosphere of the old wooden town in an open-air café and browse through the wide range of shops. Looking for second-hand and antique goods? Go to visiteksjo.se/loppis for more information.

Gemütlich einkaufen in der alten Stadt. Eksjö hat eine prima Auswahl an einzigartigen Läden und gemütlichen Cafés. Hier können Sie in aller Ruhe die Atmosphäre der historischen Holzstadt in einem Garten- oder Straßenlokal genießen, oder das breite Angebot der vielen Geschäfte auskundschaften.


21

Hotell

Eksjö Stadshotell Stora Torget 9, Eksjö 0381-130 20 | eksjostadshotell.se Eksjö Wärdshus Abborraviken Kråkebergsvägen 1, Eksjö 0381-167 00 | abborraviken.se Hotel Ullinge Ullinge, Eksjö 0381-810 60 | ullinge.se Hotell & Pensionat Paradis Paradis 2, Eksjö 0381-810 15 | hotellparadis.nu Pensionat Solhöjden Kullagatan 2, Mariannelund 0496-108 98 | pensionatsolhojden.se

Camping

Mycklaflons camping Gummarp Eksjö, 0381-430 00 mycklaflonscamping.com

Regnbågsdalen Café & Guesthouse Storgatan 24 A, Ingatorp 0381-210 04 | regnbagsdalen.se

Spilhammars Camping Spilhammarvägen 2, Mariannelund 0496-102 73 spilhammarscamping.com

Villa Lind B&B Storgatan 21, Ingatorp | 070-547 12 81

Vandrarhem & B&B B&B Bruzaholm Eksjövägen 46, Bruzaholm 073-705 77 15 Boaryd B&B och ställplats Hults Boaryd 5, Hult 076-792 96 59 Eksjö vandrarhem Stora Torget, Eksjö 0381-133 00 | eksjovandrarhem.se

Eksjö Camping & Konferens Prästängsvägen 5, Eksjö 0381-395 00 | eksjocamping.se

Sov gott B&B Västra Storgatan 5 A, Mariannelund 072-350 75 70

Movänta Camping & Stugby Badvägen 4, Hult 0381-300 28 | movantacamping.se

Susanns B&B Kyrkogatan 27, Mariannelund 0705-38 96 54

Övrigt boende Klinten konferens och lägergård Hult | 0381- 360 00 | eksjo.se Paradis Fiskecamp Paradis Gård, Eksjö 070-575 11 44 | paradisfiskecamp.se Ställplats Gjuterigatan Gjuterigatan 4, Eksjö Ställplats Klocketorpet Hembygdsgatan, Mariannelund Ställplats Lyckarp Hult, Eksjö Rv 40 070-653 03 01, 070-585 58 07 Ställplats Slättvallen Majsgatan 4, Mariannelund 070-516 95 64

CHECK OUT WWW.VISITEKSJO.SE FOR MORE ACCOMMODATIONS WEITERE UNTERKÜNFTE FINDEN SIE UNTER WWW.VISITEKSJO.SE

www.visiteksjo.se

BOENDE [ ACCOMMODATION | UNTERKUNFT ]


På utflykt med fikakorgen [ PERFECT EXCURSIONS WITH A PICNIC BASKET ]

Kvänsås bokskog

[ TIPPS FÜR AUSFLÜGE MIT PICKNICKKORB ]

5 km* I den flera hundra år gamla bokskogen är ljuset magiskt – en perfekt plats att sitta ner en stund på och beskåda naturens kulisser och andas in den friska luften som naturreservatet erbjuder. Barnen har gott om yta att springa runt på och utforska träden och den spännande miljön.

Mycklaflon badplats 22 km* Runtom Mycklaflon finns många sevärda platser. Vid sjöns norra spets finns en naturskön badplats med mjuk sandbotten. I närheten finns även Norrsånna ekhage, ett naturreservat med stora ängsmarker och ett intressant lövskogsbestånd. En utflykt som lämpar sig för både cykel, bil och vandring!

Borgmästarängen 6 km*

Klinten 15 km* Vildmarkskänsla och sjöbad i klart vatten väntar i naturreservatet Klinten. Miljön som beskrivs i Albert Engströms böcker kan upplevas genom att följa de stigar som finns utmärkta. Bestig Klintaberget och njut av utsikten över Försjön, kanske är det platsen att packa upp fikakorgen på?

Mitt i vacker småländsk skog ligger Borgmästarängen – en del av friluftsområdet Skedhult – med vacker sjöutsikt och vindskyddad grillplats. I området finns också en motorikbana som passar både små och stora med spring i benen. Ströva runt i ekskogen eller titta på de betande djur som ofta syns till i närheten.

FOBOs trädgård 3 km* På promenadavstånd från centrala Eksjö finns FOBOs trädgård, en oas med odlingar och plats att breda ut picknickfilten på. Botanisera bland säsongens grödor och gå in i växthuset och känn på den speciella atmosfären. Sandlåda, koja och spännande skogsmiljö tillfredsställer även de yngre besökarna.

* Avstånd från Eksjö centrum. For information in english visit Eksjö Tourist Center. Informationen auf Deutsch gibt es im Eksjö Tourist Center.


23 www.visiteksjo.se

MAT & DRYCK [ FOOD & DRINK | ESSEN & TRINKEN ] Amazing Taste Steakhouse Norra Storgatan 23 C, Eksjö 0381-100 20

Nya Lennarts Konditori Stora Torget, Eksjö 0381-61 13 90 | lennartskonditori.se

Ambri's Italien delikatessbutik Södra Storgatan 5, Eksjö 072-323 51 10

Hotell Paradis Paradis 2, Eksjö 0381-810 15 | hotellparadis.nu

Café Erikshjälpen Kråkebergsvägen 2, Eksjö 0381-67 13 00

Paj, Pytt & Pilsner Västra Storgatan 5 A, Mariannelund 072-350 75 70

Eksjö Konditori Gamla stan Norra Storgatan 24, Eksjö 0381-139 39 | eksjokonditori.se

Princess Konditori Södra Storgatan 2, Eksjö 0381-155 05 | princess-konditori.se

Sofias Restaurang Trädgårdsgatan 2, Mariannelund 0496-212 78 | sofiasrestaurang.se

Eksjö Stadshotell / Albert Bistro & Bar Stora Torget, Eksjö 0381-130 21 | eksjostadshotell.se

Puben Eksjö Södra Storgatan 10 D, Eksjö 079-341 26 35

Stjernbergs Skafferi Verdandigatan 5, Mariannelund 0496-100 85 | stjernbergsskafferi.se

Eksjö Wärdshus Abborraviken Kråkebergsvägen 1, Eksjö 0381-167 00 | abborraviken.se

Putte Kock Kaserngatan 18, Eksjö 0381-152 70 | puttekock.se

Sushi Tree Norra Storgatan 22 A, Eksjö 08-20 50 05

Harrys Norra Storgatan 26 C 0381-401 00

Regnbågsdalen Café & Guesthouse Storgatan 24 A, Ingatorp 0381-210 04 | regnbagsdalen.se

Under Eken Bistro & Catering* Prästängsvägen 5, Eksjö 0381-395 00 | eksjocamping.se

Hos Jonas Norra Storgatan 21, Eksjö hos-jonas.se

Restaurang Coco Thai Breviksvägen 17 A, Eksjö 0381-171 00 | coco-thai.se

Hotel Ullinge Ullinge, Eksjö 0381-810 60 | ullinge.se

Restaurang Bron Norra Storgatan 38, Eksjö 076-014 40 60 | restaurangbron.se

Krusagården* Norra Storgatan 29, Eksjö 0381-100 87 | krusagarden.nu Norrby Ängar Gårdsbutik & Café Norrby Västergård 3, Eksjö 070-190 07 70 | norrbyangar.se

Restaurang Skogen Småland Spilhammarvägen 4, Mariannelund 0496-216 91 | filmbyn.se Restaurang Sunrise Norra Storgatan 19, Eksjö 0381-121 20 | sunrise-eksjo.se

PIZZA OR FAST FOOD? WWW.VISITEKSJO.SE PIZZA ODER FAST FOOD? WWW.VISITEKSJO.SE

*Säsongsöppet / Open in season / Geöffnet in der Saison


24 www.visiteksjo.se

Eksjö – Med hela Småland runt knuten Vad menar vi egentligen med allt precis runt knuten? Jo, att du har nära till glittrande sjöar, öppna hagmarker och skogen med röda lingon och gula kantareller. Att du har nära till solvarma vitmålade husknutar och ljudet av taktfasta toner. Att du har nära till julmarknaden och knarret av snö under kängorna. Och att du har nära till en sommarfika i den unika trästaden och smaken av nykokta karameller. What do we mean with everything just around the corner? Well, you are close to the Christmas market and the creak of snow under your boots. You are close to the woods and the smell of resin and wet moss. You are close to the sun-warmed whitewashed house corners and the smell of freshly cut grass. And you are close to a summer snack in the arbor and the taste of freshly boiled candies. Welcome to Eksjö with all of Småland around the corner. Was meinen wir eigentlich mit alles gleich um die Ecke? Gemeint ist die unmittelbare Nähe von glitzernden Seen, offenen Wiesen und Wäldern. Einen Katzensprung entfernt liegen herrliche Sommercafés in der unverwechselbaren Holzstadt und der verführerische Duft hausgemachter Süßwaren. Die reizenden Ortschaften der Kommune liegen wie eine Perlenkette an der Landstraße 40, von Eksjö über Bruzaholm, Hjältevad und Ingatorp – bis nach Mariannelund.

For information in other languages, ​​see our website at www.visiteksjo.se.

TOURIST

CE NT E R

Eksjö Tourist Center Österlånggatan 31 575 80 Eksjö 0381-361 70 turism@eksjo.se TOURIST

CE NT E R

Mariannelund Tourist Information Spilhammarvägen 4 598 97 Mariannelund 0496-216 91 info@emilkraften.se

Broschyren är utgiven och producerad av Eksjö kommun, 2020. Omslagsfoto: Johan Lindqvist Foto: Duo Fotografi, Johan Lindqvist, Linus Talltjärn, Karin Nordin, Pia Löfgren, m.fl. Text: Anette Stendahl, Minna Lindell m.fl. Översättning: Citytext Tryck: DanagårdLitho Upplaga: 5 000 exemplar. Med reservation för ändringar och eventuella fel.

Profile for Visit Eksjö

Turistbroschyr Visit Eksjö 2020  

Eksjö – Med hela Småland runt knuten. Från den unika trästaden till Filmbyn i Mariannelund. Kulturhistoriska miljöer, trolska småländska urs...

Turistbroschyr Visit Eksjö 2020  

Eksjö – Med hela Småland runt knuten. Från den unika trästaden till Filmbyn i Mariannelund. Kulturhistoriska miljöer, trolska småländska urs...

Advertisement

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded