Page 1

Autoclima / Giorgio Moffa fa il punto sulle famiglie di prodotto Maurelli Group / La gamma accessori Gam Technic brand di successo Vega Editrice - Monza, Italy - Anno XXVIII - N. 268 / APRILE 2018 - Euro 5,00

IL MONDO DEI TRASPORTI

Mensile di Politica, Economia, Cultura e Tecnica del Trasporto - FONDATO

E DIRETTO DA

PAOLO ALTIERI

Un grande gruppo al servizio di Iveco e Fiat Professional

Massimo Tentori essere dealer ieri e oggi CLASSE 1960, MASSIMO TENTORI È UN IMPRENDITORE DI SUCCESSO CHE HA SEMPRE CREDUTO NELL’IMPORTANZA DEL LAVORO DI CONCESSIONARIO IN VIRTÙ DEL PRIVILEGIO DI POTER CONTARE SULLA CONOSCENZA DEL TERRITORIO E SUL RAPPORTO DI FIDUCIA CON OGNI SINGOLO CLIENTE. STORICO PUNTO DI RIFERIMENTO DEL NETWORK LOMBARDO DI IVECO E FIAT PROFESSIONAL, TENTORI VEICOLI INDUSTRIALI È OGGI UNA REALTÀ CONSOLIDATA CHE HA SAPUTO VINCERE LE SFIDE DEL MERCATO E SI PROIETTA CON DETERMINAZIONE NEL FUTURO.

Poste Italiane Spa -Spedizione in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano

Paolo Altieri e Fabio Basilico a pagina 4

DAILY PROTAGONISTA NEL NOLEGGIO IL SUD PUNTA SUL METANO LIQUIDO I A Completata la fornitura Iveco alla società Locauto

Sotto l’egida di Scania la prima stazione LNG del Gruppo Bianco Petroli

veco Daily conferma per l’ennesima volta le doti innate di autentico punto di riferimento del settore veicoli commerciali per versatilità e flessibilità d’impiego. Presso il Daily Center di Suzzara, punto vendita di Officine Brennero, dealer di proprietà Iveco, si è svolta la cerimonia

di consegna di due modelli 35C14 del nuovo Daily a Locauto, azienda italiana di servizi di noleggio con oltre 30 anni di esperienza nel mondo automotive. E ra no presenti alla cerimonia Agatino e Marco Di Maira, rispettivamente Amministratore delegato e Direttore Operativo di Locau-

to, Giuseppe Cereda, Responsabile commerciale di Officine Brennero, Lorenzo Chioetto, Responsabile di sede e Fabio Ternavasio, District Sales Manager Iveco. I due Daily fanno parte di una fornitura estremamente importante.

NETWORK FRAIKIN

PETRONAS

EVINDUSTRIAL

Service Point ad Alatri un vero ponte tra Centro e Sud Italia Campanella a pagina 23

Il futuro parte dal nuovo moderno polo di Santena Servizio a pagina 52

A pagina 22

Setti Trasporti si affida a Kögel per l’efficienza della sua attività Basilico a pagina 16

nche Scania, che ha appena presentato la sua offerta a metano liquido, è fortemente attiva nell’incrementare il network di distribuzione dell’LNG su tutto il territorio nazionale, al fine di arrivare ad assicurare ai trasportatori la piena e comoda accessibilità al gas naturale,

diventato ormai un’altertiva credibile e disponibile al tradizionale gasolio. Italscania era al fianco del Gruppo Bianco Petroli, storica a zienda del comparto petrolifero e leader nel campo dell’energia alternativa, con sede a Mesagne, per l’inaugurazione della prima stazione di ri-

MORINI RENT

LAMBERET

Un’offensiva in grande stile con la flotta e il network Servizio a pagina 30

Distributore per l’Italia dei contenitori Melform Sinari a pagina 44

fornimento LNG del Sud Italia. L’impianto, situato proprio a Mesagne, in provincia di Brindisi, rappresenta un importante passo avanti per incrementare e completare la rete di stazioni di rifornimento sul territorio nazionale. Fabio Basilico a pagina 12

All’interno inserto sul mondo dei veicoli commerciali


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 3

IN APRILE IL TRADIZIONALE VEGA DAY PER LA PRESENTAZIONE DELL’ANNUARIO TRUCKS & VANS

Con il decennale raggiunto un grande traguardo

A

PAOLO ALTIERI MONZA

l traguardo dei 10 anni di vita, l’Annuario Trucks & Vans edizione 2018 vive in aprile il suo debutto in una grande giornata organizzata da Vega Editrice in collaborazione con la Divisione Veicoli Commerciali di PSA Groupe Italia e con il tradizionale supporto di Voith Turbo e Hankook Tire Italia. Teatro dell’evento, come per le precedenti nove edizioni, il Ristorante Saint George Premier all’interno del Parco di Monza, con la partecipazione di rappresentanti della stampa, di Case costruttrici di veicoli, di aziende del settore, di società di trasporto e di logistica, Il tradizionale incontro con la stampa ha quest’anno come relatore il capo dei Veicoli Commerciali di PSA Groupe, Stephane Narberburu che si sofferma sul tema “Importanza dei veicoli commerciale nella distribuzione urbana delle merci oggi. Il ruolo di PSA Groupe”. Segue poi una riflessione sulla realtà italiana da parte di Valentino Munno, responsabile dei veicoli commerciali di PSA Groupe Italia. Nel programma della giornata anche l’assegnazione del premio de Il Mondo dei Tra sporti “Personaggio dell’Anno 2018” e il conferimento degli “Mdt Award 2018” destinati a personaggi e aziende che si sono particolarmente distinti per i risultati conseguiti lo scorso anno..

NELLA CONSUETA CORNICE DEL

RISTORANTE SAINT GEORGE PREMIER NEL PARCO DI MONZA, IN PROGRAMMA LA PRESENTAZIONE DELL’EDIZIONE

2018

DELL’ANNUARIO

TRUCKS & VANS. L’EVENTO È ORGANIZZATO CON IL SUPPORTO IMPORTANTE DI PSA

GROUPE ITALIA VEICOLI COMMERCIALI.

L’edizione 2018 dell’Annuario Trucks & Vans si conferma ancor più come unico e originale strumento di consultazione per quanti utilizzano nel lavoro veicoli industriali e commerciali oltre che van derivati da vetture. La costante e apprezzata evoluzione del l’Annuario Trucks & Vans è avvenuta negli anni più difficili anche per il settore dell’autotrasporto, il che conferma l’idea comunque vincente

di Vega Editrice quando nel 2009 decise di utilizzare competenze e professionalità del mensile Il Mondo dei Trasporti per dare vita a questo importante prodotto editoriale. Pur mantenendo il solito schema con le schede tecniche di tutti i modelli di veicoli industriali, commerciali e van, l’Annuario Trucks & Vans 2018 è ancora più ricco sotto il profilo delle notizie tecniche e storiche dei vari

modelli. Importanti novità sono gli ampi servizi, che aprono la pubblicazione, dedicati all’andamento del mercato nei vari segmenti, dai truck ai van ai semirimorchi. Ne risulta una lettura agevole e completa di tutte le informazioni sui veicoli che tanta parte hanno nella nostra vita quotidiana per soddisfare tutte le necessità collettive. Il 2018 segna il 28esimo anno di attività de Il Mondo

dei Trasporti, oggi periodico tra i più influenti nel settore, certamente tra i più ricchi per contenuti anche per quanto riguarda i veicoli commerciali settore al quale ogni mese viene dedicato un corposo inserto. Ricordiamo che il Premio “Personaggio dell’Anno“ è stato assegnato la prima volta nel 2010 a Stefano Chmielewski, allora Presidente di Renault Trucks; nel 2011 è

toccato a Lorenzo Sistino di Fiat Professional, quindi nel 2012 a Hubertus Troska di Mercedes-Benz, nel 2013 a Eva Katharina Zimmer di Voith Turbo Italia, nel 2014 a Hervé Bertrand di Renault Trucks, nel 2015 a Heinz-Jürgen Löw di MAN Truck & Bus.nel 2016 a Pierre Lahutte, Iveco Brand President, e nel 2017 a Giovanni Lo Bianco, Amministratore delegato di Volvo Group Italia..

IL MONDO DEI TRASPORTI

Mensile di Politica, Economia, Cultura e Tecnica del Trasporto Direttore responsabile Paolo Altieri - paolo.altieri@vegaeditrice.it

Mensile presente da 28 anni, anche quest’anno “Il Mondo dei Trasporti” organizza il Vega Day: appuntamento ad Aprile nella consueta cornice del Ristorante Saint Georges Premier, nel cuore del Parco di Monza.

Comitato di Redazione Fabio Basilico - f.basilico@vegaeditrice.it Max Campanella - m.campanella@ vegaeditrice.it Direzione, redazione e amministrazione Via Ramazzotti 20 - 20900 Monza Tel. +39.039.493101 - Fax +39.039.493103 info@vegaeditrice.it www.ilmondodeitrasporti.com Sede Legale Via Stresa 15 - 20125 Milano Editore Vega Editrice Presidente Luisella Crobu Vice Presidente Michele Stefano Altieri Direttore editoriale Cristina Altieri Condirettore editoriale Vincenzo Lasalvia Pubblicità Vega Editrice srl: Via Ramazzotti 20 - 20900 Monza Tel. +39.039.493101 - Fax +39.039.493103 Promozione Piero Ferrari Impaginazione e Fotocomposizione Varano, Busto Garolfo (Milano) Stampa Reggiani spa, Brezzo di Bedero (VA) Il Mondo dei Trasporti è registrato presso il Tribunale di Milano numero 327 del 4/5/1991 - Abbonamento annuo: Italia Euro 50,00, estero: Euro 150,00 - Banca d’appoggio: UniCredit Banca - Agenzia Muggiò; Codice IBAN: IT 21 V 02008 33430 000041141143 - Poste Italiane Spa - Sped. in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano - Distribuzione GE.MA Srl: Burago di Molgora (MB).


IL MONDO DEI TRASPORTI

Pagina 4

N° 268 / Aprile 2018

ESCLUSIVO / INTERVISTA A MASSIMO TENTORI, TITOLARE DI TENTORI VEICOLI INDUSTRIALI SPA

La forza del destino CLASSE 1960, ORIGINARIO DI LECCO, MASSIMO TENTORI È UN IMPRENDITORE DI SUCCESSO CHE HA SEMPRE CREDUTO NELL’IMPORTANZA DEL LAVORO DELLA CONCESSIONARIA IN VIRTÙ DEL PRIVILEGIO DI POTER CONTARE SULLA CONOSCENZA DEL TERRITORIO E SUL RAPPORTO DI FIDUCIA CON OGNI SINGOLO CLIENTE.

STORICO PUNTO DI RIFERIMENTO DEL NETWORK LOMBARDO DI IVECO E FIAT PROFESSIONAL, TENTORI VEICOLI INDUSTRIALI È OGGI UNA REALTÀ CONSOLIDATA CHE HA SAPUTO VINCERE LE SFIDE DEL MERCATO E SI PROIETTA CON DETERMINAZIONE NEL FUTURO.

P

PAOLO ALTIERI FABIO BASILICO MONZA

ercorrendo la Statale 36 che collega Milano con la Valtellina, è difficile non puntare lo sguardo sui moderni e imponenti edifici della Tentori Veicoli Industriali, la cui sede centrale di Molteno, a pochi chilometri da Lecco, spiccano come fari per tutti i professionisti del trasporto. Storica concessionaria Iveco fin dagli inizi dell’avventura del brand torinese, Tentori Veicoli Industriali è un nome molto conosciuto nel settore, punto di riferimento in Lombardia del network italiano di Iveco e Fiat Professional. E proprio al titolare Massimo Tentori - nato a Lecco il 6

luglio 1960, sposato con Claudia e padre di Federico, 31 anni, impegnato nell’a zienda di famiglia, e Arianna, 26 anni - abbiamo chiesto di rac contarci la tappe più salienti della storia della concessionaria e soprattutto di raccontarci, in un’intervista esclusiva, cosa significa oggi essere un dealer di veicoli industriali. “L’azienda è nata sul la precedente attività di meccanico avviata da mio padre Lino, poi coadiuvato dai suoi quattro fratelli e in particolare dall’intraprendente e vulcanico zio Giuseppe che è purtroppo venuto a mancare tre anni fa - esordisce Massimo Tentori - Dagli anni Cinquanta, i cinque fratelli si sono dedicati dapprima all’attività di riparatori di autocarri e auto nonché di no-

leggiatori di rimessa, con la sede di Dolzago (Lc) ricavata all’interno di un ex cinema dismesso. Successivamente, iniziano con la riparazione di autocarri diventando poi trasportatori. Il background familiare è dunque innanzitutto quello di riparatori ma anche di trasportatori, attività proseguita fino a una dozzina di anni fa con un’azienda dedicata slegata dall’attività della concessionaria”. IMPORTANTE SVOLTA NEL 1975

Con il passaggio alla riparazione autocarri, i fratelli Tentori avviano anche le prime vendite, soprattutto di veicoli usati. “L’attività commerciale ha preso piede e si è deciso di passare alla vendita

Massimo Tentori, titolare di Tentori Veicoli Industriali.

anche di veicoli nuovi - prosegue Tentori - Nel 1975 siamo diventati concessionaria Iveco, tra i primi in contemporanea con la nascita della Casa. Allora eravamo in società con il concessionario Fiat locale dal momento che a quei tempi il mandato veniva dato aggregato a coloro che erano già dealer Fiat veicoli industriali. L’azienda è nata dunque con la denominazione di Colombo e Tentori; quando poi dopo qualche anno c’è sta ta l’uscita del socio Colombo noi abbiamo assunto la completa gestione pur mantenendo ancora per un certo periodo la denominazione Colombo e Tentori. Poi negli anni Novanta nasce ufficialmente la Tentori Veicoli Industria-

li Spa”. Nel corso degli anni, Tentori ha incrementato il business mettendo a segno importanti acquisizioni. “Negli anni novanta avevamo una sola sede a Molteno - dice ancora Massimo Tentori - I passi successivi sono stati l’acquisizione di una partecipazione nella ATL di Colico, gestita dalla famiglia di Patrizio Dono. Per noi l’attività di concessionaria è prettamente familiare: la prova è che le aziende che riescono a stare su un mercato difficile come il nostro sono quelle condotte da gruppi familiari. La partnership con ATL dura da vent’anni ed è sempre stata proficua per entrambi. Abbiamo an che acquisito la storica

con cessionaria Borona di Monza, recuperando la sede situata in via Borgazzi e costruito una nuova struttura in zona viale delle industrie, nella parte est della città. Non è tutto. Nel frattempo ci siamo strutturati per dare un servizio a tutto tondo e abbiamo creato la Delcar di Oggiono (Lc), una delle carrozzerie industriali più importanti per volumi, in grado di garantire tutte le possibilità di allestimento e una completa parte ripartiva”. “Fa parte della nostra storia anche la società di leasing che abbiamo dovuto liquidare nel 2017 stante la nuova normativa sui rapporti bancari aggiunge Tentori - In pratica, la società doveva trasformarsi


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 5

in una piccola banca e non potevamo permettercelo dal momento che solo il progetto organizzativo avrebbe comportato costi enormi e una serie di incombenze burocratiche non di poco conto. Per noi il leasing era un servizio aggiunto reso in modo semplice e veloce, basato sul rapporto di fiducia instauratosi con i clienti. Negli anni più recenti siamo entrati nell’allora Milano Carri oggi Milano Industrial con la famiglia di Alfredo Capitani e coadiuvati da una persona esperta e competente come Stefano Laggetta”.

L’apporto del concessionario nel settore auto è modesto, vale il 10 per cento. Oggi con la presenza di uno strumento efficace come il configuratore il cliente si reca dal dealer auto con tutte le idee chiare e non gli resta che mettere una firma sul contratto di acquisto. Con il veicolo industriale è diverso: noi possiamo condizionare una decisione di acquisto molto di più, i nostri venditori possono spostare da una parte all’altra la decisione proprio perché ci troviamo di fronte a un prodotto complesso con caratteristiche specifiche che necessita di un’opportuna attività di consulenza per far si che al cliente venga consegnato il veicolo giusto per la mission specifica che deve svolgere”.

LE CIFRE DEL GRUPPO

Il Gruppo di cui fa parte Tentori, che conta circa 250 dipendenti, ha venduto nel 2017 circa 2.000 veicoli nuovi Iveco, a cui si aggiungono i 500 commerciali Fiat Professional. Il fatturato è pari a 180 milioni di euro. La sola Tentori Spa, che vanta 105 dipendenti, ha registrato un fatturato 2017 attorno ai 65 milioni di euro. “Abbiamo anche l’attività collaterale di distribuzione degli oli Petronas - continua Massimo Tentori un’attività che occupa una decina di dipendenti, trasversale ma collegata, gestita in prima persona da mio cugino Raffaele. Va poi inclusa la vendita di ricambi per rimorchi e semirimorchi, staccata dall’attività di dealer vero e proprio. Nel settore rimorchi siamo dealer del produttore Schmitt Cargobull, di cui vendiamo una cinquantina di pezzi l’anno”. L’assistenza è un punto di forza di Tentori che vanta un network di ben 40 officine autorizzate dirette capillarmente distribuito sul territorio di competenza, che comprende le province di Milano, Monza, Varese, Lecco, Como e Sondrio: “in una decina di queste officine siamo entrati in partecipazione con quote oscillanti tra il 20 e il 35 per cento, scegliendo di rinforzare il nostro importante legame”, precisa Tentori. Cosa è cambiato nel corso degli anni nel mestiere di dealer? “È cambiato l’approccio al business, è cambiata la clientela e abbiamo adeguato il nostro modo di operare ai nuovi tempi - risponde Massimo Tentori - In generale è anche cambiato l’atteggiamento delle Case costruttrici nei nostri confronti: oggi si pensa che si possa stare sul mercato a prescindere dal lavoro del dealer. Non sono poche le Case che fanno trattative dirette con il cliente bypassando il nostro operato. Si comportano così soprattutto le Case che non hanno potuto conservare una rete efficiente. Per quanto ci riguarda, stante il lungo e proficuo rapporto instaurato, devo dire che con Iveco questo atteggiamento è assai meno rilevante. In realtà, la presenza del dealer è ancora essenziale per tutta una serie di motivi: il poter conoscere da vicino la clientela e il territorio in cui opera è un vantaggio non da poco, così come il poter assicurare un servizio efficiente e veloce, anche in orari e giorni particolari”. Nel tempo anche il cliente ha subito una trasformazione. “Oggi il cliente ha perso le caratteristiche di fedeltà a un brand - spiega Tentori - Si guarda in giro, è curioso e più informato. Il nostro ruolo è allora quello di gestire con attenzione e abilità la specializzazione feroce che caratteriz-

MESTIERE PIÙ BELLO DEL MONDO

Il Gruppo di cui fa parte Tentori Veicoli Industriali si estende alla concessionaria ATL di Colico, gestita dalla famiglia di Patrizio Dono, e Milano Industrial guidata dalla famiglia di Alfredo Capitani coadiuvata da Stefano Laggetta.

za il mondo del trasporto e i veicoli. Succede così che in certe nicchie di prodotto siamo numero uno e in altre no, il cliente va ad analizzare a fondo le sue esigenze di trasporto e il genere di veicolo specializzato di cui ha bisogno e si ritrova a scegliere tra più brand. Noi siamo relativamente fortunati perché sia con Iveco che con Fiat Professional copriamo tutti i settori operativi e siamo in grado di dare risposta a ogni singola richiesta. Il nostro focus più importante è attualmente il settore dell’ecologia dove siamo molto forti grazie a una rete riparativa importante in tutta Italia. Così riusciamo a venire incontro ai bisogni di un cliente molto esigente e informato, molto attento ai tempi di riparazione del veicolo e ai consumi. Per noi è importante fornire il veicolo giusto per la mission specifica. Oggi la definizione del prodotto giusto è complessa, i clienti non possono permettersi di sbagliare veicolo e noi dobbiamo essere attenti a proporre il veicolo giusto. Tutti parliamo di cliente ma le belle parole non bastano perché dietro c’è un’attività, una criticità e chi come noi ha avuto un passato da trasportatore sa cosa significa in termini di costi avere un veicolo fermo con un problema non risolto. Alla volte le Case fanno fatica a comprendere questi elementi perché loro hanno logiche diverse. Ci piacerebbe che le Case recepissero e tenessero in giusta rilevanza le nostre esperienze dirette con il cliente”. Quali sono oggi i margini di guadagno di un dealer? “Le attività di assistenza devono coprire i costi generali e fissi, mentre la parte vendita deve cercare di creare quella marginalità che consente di ottenere quel 2-3 per cento sul fatturato che equivale comunque a cifre modestissime - dice ancora Tentori - La guerra dei prezzi pesa moltissimo. E pesa la scelta di non affidarsi più alla vendita del veicolo ma a pratiche come il

buyback. Io non chiamo vendita l’operazione effettuata con il patto di riacquisto. Una pratica molto diffusa in Europa e meno in Italia che ha por tato innanzitutto all’appiattimento dei valori di riferimento”. UN GRANDE VALORE AGGIUNTO

“Le case e i dealer si sono trovati a gestire una parte di valore aggiunto del trasportatore: la gestione dell’autocarro, la rivendita, ecc.. Tutte cose che prima spettavano al trasportatore e che noi abbiamo acquisito proponendo al trasportatore di pagare una rata e di affidare a noi la gestione di tutto il re sto. Ci manca l’autista e i trasportatori li facciamo noi. Dicendo questo sembro un retrogrado della vecchia guardia che vuole ancora vendere camion e riprendersi l’usato per poi rimetterlo sul mercato. Ma questo è il mio mestiere: vendere il nuovo, permutare l’usato e rivenderlo. Tut to questo mi è stato in un certo senso ‘scippato’ dalle Case

che hanno voluto non solo vendere il veicolo ma anche ritirare l’usato per poi rivenderlo. Quello però è un lavoro prettamente nostro. Le Case devono fare bene i camion e immetterli sul mercato con un prezzo concorrenziale, al resto ci pensiamo noi che abbiamo il rapporto diretto con il cliente e conosciamo il territorio”. Collegata direttamente al buyback è la problematica del lo smaltimento di grossi stock di truck usati. “È un problema che non tocca in modo incisivo l’Italia che ha una quota rientri di veicoli mo desta che è in grado di smaltire - commenta Massimo Tentori - Non è la stessa cosa per quei paesi, come la Germania, in cui il buyback è stato usato in modo più massiccio e hanno più problemi di smaltimento. Questi veicoli avevano una logica anni fa quando si pensava a potenziali mercati di smaltimento, come i mercati emergenti e me no performanti dell’Est Europa. La realtà ha smentito le previsioni perché nell’Est Europa si è verificata piuttosto la ten-

denza alla scelta di veicoli nuovi. Inoltre, in ossequio alla volontà di riprendersi anche quei mercati si è voluto applicare sul nuovo prezzi più bassi rispetto ai mercati delle economie avanzate come Germania, Francia e Italia e sono stati applicati crediti più favorevoli sul nuovo che sul l’usato con il risultato di saturare quel potenziale bacino di rivendita dei veicoli usati”. Quale potrebbe essere l’evo luzione della vendita di veicoli industriali? “Le Case ci pagano perché distribuire i veicoli tramite noi costa meno di una distribuzione diretta fatta da loro - ammette Tentori - Alle Case interessa far distribuire a noi i veicoli. Il nostro lavoro è talmente difficile e complesso da richiedere decisione pratiche, concrete, terra terra. Questo fa si che non si possa ipotizzare una distribuzione gestita da grandi gruppi con ampie organizzazioni, per loro natura incapaci di operare in modo veloce, efficiente e a diretto contatto con il cliente a cui viene data la massima disponibilità anche in termini di orari.

Se tornasse indietro nel tempo, Massimo Tentori rifarebbe le stesse scelte. “Nonostante tutte le difficoltà e le sfide quotidiane, il mestiere del dealer è stato ed è uno dei mestieri più belli in assoluto ammette con orgoglio - Posso parlare con le persone, conoscere la loro storia e la realtà delle aziende, i loro bisogni. Per chi ama rapportarsi con la gente è la professione adatta, anche se, lo devo ammettere, è diventata più difficile e complessa. Nel 2017 la vendita più soddisfacente che ho fatto riguardava un cliente che avevo perso e che sono riuscito a riconquistare”. Qual è dunque il segreto del successo della Tentori? “La basicità - risponde immediatamente Massimo Tentori Niente voli pindarici, un passo alla volta, molta modestia e la consapevolezza che il nostro è un lavoro dove non esiste una ricetta miracolosa per avere successo ma ci si deve a dattare continuamente alle situazioni che cambiano e conoscere la realtà in cui si opera, senza manie di protagonismo. La tua competenza ti vie ne riconosciuta grazie al lavoro di ciascun membro dell’organizzazione, non solo a livello organizzativo e gestionale ma anche al livello di chi opera come autista, in officina, come venditore. Tutti sono importanti, nessuno escluso. La mia ambizione conclude Tentori - è vendere un camion in più di quelli che ven do oggi ma soprattutto che l’armonia che oggi regola i rapporti all’interno della mia famiglia e all’interno dell’azienda duri a lungo per far fronte con serietà e passione alle sfide del futuro”.

Il segreto del successo delle attività del Gruppo Tentori sta essenzialmente nel service affidato a personale di grande professionalità.


IL MONDO DEI TRASPORTI

Pagina 6

STORICA CONSEGNA IVECO ALLA TEDESCA VERBIO LOGISTIK

Stralis NP va a mille S

L’ESEMPLARE NUMERO 1.000 DELL’AMMIRAGLIA IVECO A GAS NATURALE È PARTE DI UN GRUPPO DI CINQUE MEZZI CONSEGNATI ALL’AZIENDA DI SCHWEDT. GLI STRALIS NP DA 400 CV A CNG SARANNO ALIMENTATI A BIOMETANO DERIVANTE DALLA PAGLIA, COMPIENDO IN QUESTO MODO UN ENORME PASSO AVANTI VERSO IL TRASPORTO PESANTE A EMISSIONI DI CO2 MINIME.

LINO SINARI SCHWEDT

tralis NP macina successi su successi. Iveco ha infatti consegnato l’e sem plare numero 1.000 della sua ammiraglia alimentata a gas naturale alla tedesca Verbio Logistik

GmbH (controllata di Verbio Vereinigte BioEnergie AG). Il millesimo Stralis NP 400 è parte del gruppo di cinque mezzi consegnati all’azienda di Schwedt. Gli Stralis NP saranno alimentati a biometano derivante dalla paglia, compiendo in questo modo un enorme passo avanti

verso il trasporto pesante a emissioni di CO2 minime. Il contratto appena siglato rappresenta un importante traguardo anche per Iveco. I cinque Stralis NP sfrutteranno l’alimentazione a biometano, prodotto presso lo stabilimento di Verbio a Schwedt, che permetterà una

riduzione del 90 per cento della CO2 emessa e una notevole diminuzione delle emissioni di particolato e ossidi d’a zoto rispetto ai camion die sel tradizionali. Con questi veicoli, Verbio implementa la prima flotta neutrale in termini di CO2 di tutta la Germania, adibita al

N° 268 / Aprile 2018 trasporto pesante. “Verbio è un cliente molto importante per noi nel campo delle trazioni alternative a gas naturale, poiché il combustibile che utilizza proviene da una fonte rinnovabile. Siamo assolutamente convinti che il biogas sia il nuovo idrogeno! La scelta dello Stralis NP da parte di Verbio per la sua flotta indica chiaramente che oggi, con il biogas, il trasporto pesante può essere redditizio e raggiungere la neutralità dal punto di vista del carbonio”, ha affermato Pierre Lahutte, Iveco Brand President, durante il suo discorso tenuto in occasione della consegna dei veicoli nella sede di Schwedt. Per l’utilizzo che Verbio intende fare dei cinque Stralis NP, l’azienda ha optato per la versione CNG monocarburante da 400 cv. Con due serbatoi da 920 litri di metano compresso o biometano, lo Stralis NP 400 vanta un’autonomia di 570 km. Il nuovo Stralis NP è stato dotato di componenti idraulici ad elevate prestazioni, che consentono l’integrazione perfetta in una flotta esistente di rimorchi a pianale mobile. Gli Stralis NP offrono un doppio vantaggio: le ottime prestazioni ambientali si uniscono a un funzionamento estremamente silenzioso, con livelli di rumore del 50 per cento inferiori rispetto alle corrispettive versioni diesel, sia durante la guida che in modalità PTO. “Gli Stralis a CNG rappresentano l’espansione logica e moderna della nostra flotta di veicoli che, compo-

sta da circa 80 camion, include già 12 veicoli bicarburante alimentati a diesel e CNG/biometano - ha dichiarato Bernd Sauter, COO di Procurement & Logistics di Verbio - La trazione monocarburante a CNG/biometano dei cinque nuovi veicoli Iveco consente di raggiungere un’efficienza in termini di costi e CO2 ancora maggiore. Con lo Stralis NP da 400 cv, Iveco mette a disposizione una macchina potente, in grado di rispondere ai nostri requisiti per il trasporto pesante di merci, non solo in termini di protezione del clima ma anche di effettiva praticabilità e redditività”. Nel settore del trasporto pesante il nuovo Stralis NP eguaglia il diesel in termini di prestazioni e costo totale di esercizio (TCO), fornendo nel contempo il più elevato grado di sostenibilità sul mercato. Si tratta del primo camion a gas naturale appositamente progettato per le lunghe distanze, nonché dell’unico in grado di fornire la potenza nominale, il comfort, la tecnologia di trasmissione e l’autonomia necessari nelle missioni a lungo raggio, con un’autonomia fino a 1.600 km tra un rifornimento e quello successivo. Verbio produce biometano su scala industriale a partire da residui agricoli e paglia, utilizzando una tecnologia sviluppata internamente. Il prodotto finale, il cosiddetto “verbiogas”, viene utilizzato come biocombustibile per veicoli a CNG in tutta la Germania, nel settore privato, pubblico e commerciale.

SECONDA EDIZIONE DELLA COMPETIZIONE RISERVATA ALLE 250 TRUCK STATION EUROPEE

Una bella sfida per il Best Service Iveco I

IVECO SERVICE CHALLENGE È INSERITA NEL PROGRAMMA DI ACCREDITAMENTO DEL BRAND PER LE SUE 250 TRUCK STATION EUROPEE, UNA RETE DI OFFICINE E CONCESSIONARI SPECIALIZZATI, DEDICATI ALLE ESIGENZE SPECIFICHE DELLE FLOTTE DI VEICOLI PESANTI. IL PROGRAMMA DI SPECIALIZZAZIONE DELLE TRUCK STATION DI IVECO E IL SERVICE CHALLENGE MIRANO A GARANTIRE AI CLIENTI UN SERVIZIO DI QUALITÀ, RAPIDO ED EFFICIENTE, FORNITO DA TECNICI ALTAMENTE QUALIFICATI ED ESPERTI DOTATI DEGLI STRUMENTI DI DIAGNOSTICA PIÙ AVANZATI PER LE OPERAZIONI DI ASSISTENZA. IL TEAM ITALIANO DI TENTORI VEICOLI INDUSTRIALI È RISULTATO VINCITORE DEL BEST EUROPEAN TRUCK STATION AWARD NELLA PRIMA EDIZIONE.

GUIDO PRINA TORINO

l 2018 è l’anno di Iveco Service Challenge, seconda edizione della competizione che mira a identificare e premiare i migliori team di assistenza. È riservata alle 250 Truck Station europee del network del costruttore che si contendono il premio Best Service. Il match rientra nell’ambito del programma di accreditamento di Iveco per le sue Truck Station, una rete di officine e concessionari specializzati, dedicati alle esigenze specifiche delle flotte di veicoli pesanti. Il programma di specializzazione delle Truck Station e il Service Challenge mirano a garantire ai clienti un servizio di qualità, rapido ed efficiente, fornito da tecnici altamente qualificati ed esperti dotati degli strumenti di diagnostica più avanzati. Durante la prima edizione di Iveco Service Challenge i team delle allora 204 Truck Station si sono contesi il titolo, dimostrando la propria professionalità nell'assistenza alle flotte di veicoli pesanti dei clienti Iveco in tutta Europa. A ottobre 2017 i tredici team finalisti si so-

no riuniti a Torino per un evento di tre giorni, che ha incluso la visita dell’Iveco Customer Center, del magazzino ricambi e dello stabilimento di produzione motori, per poi concludersi con la cerimonia di premiazione. Otto team provenienti da

Italia, Spagna, Germania, Paesi Bassi, Francia, Regno Unito, Polonia e Repubblica Ceca si sono aggiudicati il titolo di Best Truck Station nei rispettivi mercati, mentre il team italiano di Tentori Veicoli Industriali ha ricevuto il Best European Truck

Station Award. Per la prima edizione dell’Iveco Service Challenge erano stati stabiliti criteri fondati sull'efficienza e la rapidità di intervento dei team (velocità di soccorso + tempo di riparazione), la pronta disponibilità dei com-

ponenti (misurata attraverso l'indice di disponibilità) e la competenza tecnica dimostrata durante i mesi di valutazione. La seconda edizione del Service Challenge estende i criteri di giudizio, includendo parametri come la capaci-

tà di riparazione entro 24 ore e l'efficienza nella gestione delle campagne di richiamo, oltre a misurare in modo più accurato la qualità dell'assistenza fornita dai team. Questo implica anche la verifica delle certificazioni attestanti il completamento della formazione tecnica richiesta da parte dello staff, nonché delle capacità necessarie per eseguire tutte le riparazioni sui veicoli in arrivo presso l'officina. Le Truck Station saranno valutate anche in termini di disponibilità dei componenti in magazzino. Iveco sta formando una rete di 250 Truck Station in tutta Europa mediante un programma di accreditamento, che mira a garantire ai clienti la possibilità di accedere ai servizi offerti da un'officina specializzata ed efficiente, dedicata alle esigenze specifiche delle flotte di veicoli pesanti. Le Truck Station certificate hanno dimostrato di rispondere a una serie di rigorosi standard riguardanti tutte le aree commerciali, che includono la formazione di personale esperto, l’estensione degli orari di apertura e l’incremento della disponibilità dei componenti.


RINNOVA A ARE PER RISP PA ARMIARE. BTS

IVECO EURO 6 SCR ONL LY SEMINUOVO RECUPERI FINO A 8. 8.000 000 € L L’ANNO ’ANNO DI ACCISE

Tuo a

749 €

al messe

SOLO IVECO TI GARANTISC CE PER 2 ANNI LA CAT TENA CIN NEMAT TICA E L’ESCLUSIVA A TECNOLOGIA A EURO 6 SCR ONLY Y.. 2IIIH HUWDYDOLGD¼QRDODSULOH

Ã&#x2C6; TUTTO O OK! Sostituisci il tuo vecchio veicolo con c un seminuovo IVECO Euro 6: 3XRLULVSDUPLDUH¼QRD¹O³DQQRUHFXSHUDQGROHDFFLVHVXOFDUEXUDQWH  7L DVVLFXUL LO ULPERUVR GHOOH DFFLVH DQFKH VH GRYHVVHUR FDPELDUH OH QRUPH SHU JOL (XUR  ¼GDELOLWjHI¼ ¼FLHQ]DHOXQJDGXUDWDGHOPRWRUH +DLODPLJOLRUHFRPELQD]LRQHGLDI¼ <  JUD]LHDOO³HVFOXVLYDWHFQRORJLD,9(&26&521/<

WWW.OKTRUCKS.IT 3JJIV XEZEPMHEWYKEQQETIWERXIWXVEHEPI)YVS:-GSRER^MERMXkQEWWMQEERRMIGLMPSQIXVEKKKMSQEWWMQSOQZEPMHE½RSEPETVMPI'SRXVEXXXXSHMIWXIRWMSRIHMKEVER^MEERRMSOQHIXXEKPMHIPPEGSTIV XYVEHMWTSRMFMPMTVIIWWSPIGSRGIWWMSREVMI-:)'3EHIVIRXM )WIQTMSGEPGSPEXSWYQSHIPPS%7784 :EPSVIHMJSVRMXYVEº-:%PIEWMRKEQIWMERXMGMTS ZEPSVIHMVMWGEXXS½REPI VEXXIHEºEPQIWIGSQTVIRWMZSHM4SPM^^E*YV XSI-RGIRHMS8EWWS0IEWMRK 7TIWITVEXMGE-:%XVEWTSV XSIQIWWEWYWXVEHEIWGPYWI 7EPZSETTVSZE^MSRI-:)'3'ETMXEP '2,-RHYWXVMEP'ETMXEP)YVSTI7%7  4IVPIGSRHM^MSRMGSRXVEXXXYEPMJEVIIVMJIVMQIRXSEM*SKPMMRJSVQEXXMZMHMWTSRMFMPMTVIWWSPIGSRGIWWMSREVMIEHIVIRXMEPP´MRM^MEXMZE-QQEKMRIETYVSWGSTSMPPYWXVEXMZS1IWWEKKKMSTYFFPMGMXEVMSGSR½REPMXkTVSQS^MSREPIRSRGYQYPEFMPIGSREPXVITVSQS^MSRM 'STIV XYVEHIPPEXIGRSPSKME)YVS'EXEPM^^EXSVIMRGPYWSMP½PXVSERXMTEV XMGSPEXS (4* ¯7MWXIQE%H&PYI® 6MWTEVQMSSXXIRYXSGSRPEWSWXMXY^MSRIHMYRZIMGSPS)YVSGSRYRZIMGSPS)YVSFEWEXSWYYRGLMPSQIXVEKKMSERRYSHMOQ

OK TRUCKS Piacenza 9LD&DRUVDQD®3,$&(1=$

OK TRUCKS Modugno 63NP®02'8*12 (BA)


IL MONDO DEI TRASPORTI

Pagina 8

N° 268 / Aprile 2018

VOLVO TRUCKS / CAMBIA IL NOSTRO MODO DI VIVERE E LAVORARE

Automazione responsabile LA CASA DI GÖTEBORG HA REALIZZATO UN NUOVO FILMATO IN DUE EPISODI INTITOLATI “AUTOMATION - THE BIG CHANGE” E “AUTOMATION - DRIVING INTO THE FUTURE” CHE TRATTANO ARGOMENTI DI GRANDE ATTUALITÀ INCENTRATI SULLE TECNOLOGIE FUTURE. PROTAGONISTI DUE FIGURE FONDAMENTALI DI VOLVO TRUCKS, SASKO CUKLEV, DIRECTOR AUTONOMOUS SOLUTIONS, E ANN-SOFI KARLSSON, DIRECTOR HUMAN FACTORS FOR AUTOMATION. I FILMATI ILLUSTRANO NON SOLO LA VISIONE E LO SCOPO ALLA BASE DEL CONTINUO IMPEGNO DI VOLVO TRUCKS VERSO L’AUTOMAZIONE, MA ANCHE LE SPERANZE E LE PREOCCUPAZIONI DI COLORO LA CUI VITA QUOTIDIANA POTRÀ CAMBIARE GRAZIE A TALE IMPEGNO.

L

FABIO BASILICO GÖTEBORG

a sicurezza delle persone è da sempre al centro della strategia Volvo Trucks. Anche per quanto riguarda l’automazione dei veicoli pesanti, oggi al centro delle attenzioni degli operatori del settore e dei principali costruttori, la Casa svedese utilizza il “filtro” della sicurezza per implementare i progressi delle conoscenze tecnologiche. I costanti progressi compiuti dall’automazione dei veicoli offrono straordinarie opportunità al settore dei trasporti e alla società nel suo

complesso. Per quanto riguarda l’evoluzione di queste tecnologie, Volvo Trucks è all’avanguardia da più di vent’anni. Lo dimostra un filmato in due episodi che spiega come il costruttore di Göteborg Volvo Trucks intenda de finire l’automazione così da trasformare il nostro modo di vivere e lavorare nei prossimi anni. Oggi la tecnologia si evolve a una velocità senza precedenti. Nei settori dei servizi, i robot sono sempre più diffusi. Auto e veicoli pesanti ormai si guidano da soli. Tutto questo può dare l’impressione di un futuro dal carattere imper-

Sasko Cuklev, Director Autonomous Solutions Volvo Trucks.

sonale e funzionale, nonostante l’automazione svolga ormai un ruolo fondamentale nelle nostre vite. Volvo Trucks è convinta che le persone siano sempre state e debbano rimanere al centro di qualsiasi filosofia orientata al futuro. Mentre la tecnologia viaggia verso una meta in cui concetti nuovi e all’avanguardia sembrano ormai facilmente raggiungibili, Volvo Trucks continua a sviluppare soluzioni pratiche per garantire più semplicità e sicurezza ad autisti, clienti e altri utenti della strada. Gli episodi intitolati “Automation - the Big Change” e “Automation - Driving into the Future” trattano argomenti di grande attualità incentrati sulle tecnologie future per i veicoli pesanti. I due episodi del filmato raccontano come vivono e lavorano due figure fondamentali dell’organizzazione Volvo Trucks, Sasko Cuklev e Ann-Sofi Karlsson, rispettivamente Director Autonomous Solutions e Director Human Factors for Automation. I video, che contengono anche le testimonianze del l’austriaco Lukas Strohmeier, autista di veicoli pesanti, e del pendolare Rohini Teather di Londra, illustrano non solo la visione e lo scopo alla base del continuo impegno di Volvo Trucks verso l’au tomazione, ma anche le speranze e le preoccupazioni di coloro la cui vita quotidiana potrà cambiare grazie a ta-

le impegno. Forte delle sue con vinzioni, Sasko Cuklev parla apertamente delle notevoli possibilità che intravede per il prossimo futuro. “Inizieremo senza dubbio a vedere veicoli pesanti Volvo a guida autonoma sulle nostre strade e questi diventeranno presto parte integrante della nostra società. La tempistica esatta dipende da molti fattori, tra cui normative sul traffico, infrastrutture stradali e,  naturalmente, standard di sicurezza”. Sebbene il passaggio a veicoli completamente automatizzati sia parte integrante dello sviluppo, ciò che occorre adesso è garantire

un’implementazione graduale, che consenta alla professione degli autisti di evolversi verso una maggiore sicurezza, produttività e comodità. “L’automazione non causerà una riduzione dei posti di lavoro - dichiara Ann-Sofi Karlsson - L’esigenza di autisti esperti sarà elevata anche in futuro. La popolazione mondiale e gli scambi commerciali sono in continua crescita, così come il settore dei trasporti di merci. L’automazione si limiterà a rendere tutto più efficiente”. Oltre a basarsi su un quadro globale, l’impegno di Volvo Trucks nell’automazio-

Ann-Sofi Karlsson, Director Human Factors for Automation.

ne ha come scopo principale semplificare le attività quotidiane delle persone, come nel caso dell’autista Lukas Strohmeier. Durante le sue giornate di lavoro, questo professionista che trasporta cisterne silo nell’Austria meridionale deve spesso effettuare operazioni di carico nella piccola e trafficata città di Graz. Le persone sono sempre più vulnerabili, la complessità del traffico è in continuo aumento e il problema della sicurezza è diventato un fattore ancora più essenziale per i team Volvo Trucks addetti all’automazione.  I principali progetti pilota di automazione dei veicoli pesanti nel settore dell’estrazione mineraria, della raccolta dei rifiuti e della coltivazione della canna da zucchero hanno dimostrato che le tecnologie per l’automazione non solo aumentano la sicurezza, ma incrementano significativamente la produttività, mentre il platooning di camion sulle autostrade offre la possibilità di ridurre il consumo di carburante e le emissioni di CO2. Coinvolgere i clienti in un dialogo costante e nelle attività di ricerca riguardanti tali sviluppi permette a Volvo Trucks di mantenere la concentrazione sui problemi che riguardano le persone. L’impegno nell’automazione dei veicoli continuerà a offrire notevoli vantaggi ai clienti, agli autisti e alla società nel suo complesso.

SÌ ALLA DICHIARAZIONE SUL CONSUMO DI CARBURANTE E SULLE EMISSIONI

VOLVO TRUCKS IMPEGNATA PUBBLICAMENTE NEL DIFENDERE L’AMBIENTE D al 1° gennaio 2019 i nuovi veicoli pesanti fabbricati all’interno dell’Unione Europea dovranno essere accompagnati da una dichiarazione che mostri il consumo di carburante e le emissioni di CO2. La legge verrà introdotta gradualmente per varie tipologie di veicoli pesanti. Lo scopo è rendere più facile per i clienti scegliere veicoli a basso consumo energetico con un minore impatto sul clima, riducendo così le emissioni. Volvo Trucks considera la nuova dichiarazione una gradita aggiunta agli strumenti con cui il settore sta già lavorando. “Le dichiarazioni forniranno ai nostri clienti informazioni comparabili e facili da comprendere sul consumo di carburante e sulle emissioni di CO2, utili per scelta di nuovi veicoli - afferma Lars Mårtensson, Direttore Ambiente e Innovazione di Volvo Trucks - Tuttavia, la cosa più importante è che

ora c’è una maggiore attenzione all’efficienza energetica e all’impatto sul clima. Questo è una questione chiave per l’industria automobilistica, il settore dei trasporti e la società nel suo insieme “. Secondo il gruppo intergovernativo sui cambiamenti climatici delle Nazioni Unite (IPCC), il traffico pesante su strada rappresenta circa il 6 per cento delle emissioni globali di gas serra e il settore è ancora fortemente dipendente dai combustibili fossili. “Pertanto, ci auguriamo che il nuovo sistema di dichiarazioni sarà accompagnato da incentivi economici che rendano redditizia per le aziende di trasporto la sostituzione di vecchi veicoli con nuovi camion più efficienti dal punto di vista energetico e con minori emissioni di CO2”, aggiunge Mårtensson. Al momento, non sono previste esenzioni o incentivi asso-

ciati alle nuova dichiarazione. Tuttavia, nel documento “Una strategia europea per la mobilità a basse emissioni” si presume che le emissioni di CO2, dovute al traffico di veicoli pesanti diminuiranno in media dell’1,5 per cento all’anno fino al 2030. Naturalmente, l’efficienza energetica non è affatto una novità, né per i produttori di veicoli pesanti né per le società di trasporto. Per un’impresa di trasporto europea, il carburante rappresenta circa un terzo dei suoi costi variabili. Pertanto, tutte le misure che possono ridurre il consumo di carburante sono interessanti anche da un punto di vista economico. L’efficienza energetica è un importante vantaggio competitivo. “L’efficienza energetica è sempre stata una priorità per Volvo Trucks - continua Lars Mårtensson - Confrontando un Volvo F12 del 1991 con un Volvo FH13 del 2016 si evince

che dall’inizio degli anni ‘90 siamo riusciti a diminuire di un quinto il consumo di carburante per i camion di nuova produzione e continuiamo a ridurre il consumo di carburante ogni anno. Migliorare l’efficienza energetica è anche la cosa più importante che possiamo fare per ridurre al minimo l’impatto del veicolo sul clima”. “La dichiarazione è un buon punto di partenza, ma non mostra l’intero scenario. Al fine di ottimizzare i consumi di carburante, riducendo al minimo l’impatto ambientale, è bene che ciascun veicolo abbia la configurazione più idonea per il lavoro che deve svolgere. Per una strategia orientata all’efficienza dei consumi, concentrarsi sulla formazione dei conducenti e utilizzare strumenti di pianificazione del trasporto sofisticati sono due soluzioni che possono avere effetti estremamente positivi” conclude Mårtensson.


www.hankooktire.com/it

Nuovo pneumatico autobus per tutte le posizioni Pneumatico per autobus a lunga percorrenza. Fornisce un’ottima frenata, confortevoli prestazioni di guida e un’usura migliorata.

Diventa una cosa sola con l’innovazione Hankook e Real Madrid Un’unica squadra

Tu e la strada, una cosa sola

Hankook Tire Italia S.r.l. Edison Park Center – Edificio A Viale T.Edison 110 – 20099 Sesto San Giovanni (MI) Tel: +39 02 2434161 Fax: +39 02 24341689


IL MONDO DEI TRASPORTI

Pagina 10

N° 268 / Aprile 2018

MERCEDES-BENZ TRUCKS AVVIA LA SPERIMENTAZIONE DA PARTE DI CLIENTI SELEZIONATI

eActros vuol dire la sua

C

MICHELE S. ALTIERI STOCCARDA

he il Gruppo Daimler stia rapidamente accelerando sul fronte della mobilità elettrica lo provano le ultime notizie d’attualità che vedono protagonista il colosso tedesco sia in ambito truck che bus. Per quanto riguarda i truck, nel 2018 prende il via la sperimentazione sul campo dell’innovativo Mer cedes-Benz eActros da parte di nove clienti selezionati. Già nel 2016 MercedesBenz Trucks è stato il primo costruttore a livello mondiale a presentare un veicolo industriale elettrico pesante. Nell’ottica di consolidare la propria leadership tecnologica, la Casa di Stoccarda compie ora il passo successivo con la sperimentazione dell’eActros. Dieci veicoli, suddivisi nelle due varianti a due e tre assi da 18 e 25 tonnellate di peso complessivo, verranno consegnati nel corso delle prossime settimane ad altrettante aziende clienti - 8 tedesche e 2 svizzere - che ne metteranno alla prova la funzionalità e la redditività nell’uso quotidiano, in condizioni di lavoro reali. L’obiettivo a lungo termine è viaggiare in modalità silenziosa e a zero emissioni locali nei centri urbani con veicoli industriali prodotti in serie. Le aziende selezionate so no: Dachser, Edeka, Hermes, Kraftverkehr Nagel, Ludwig Meyer, pfenning logistics, TBS Rhein-Neckar e Rigterink per quanto riguarda la Germania; Camion Transport e Migros per la Svizzera. Tutti queste aziende curano la distribuzione merci in ambito urbano, ma in settori e categorie completamente differenti tra loro. La gamma spazia dai generi alimentari fino ai materiali da costruzione e alle materie prime in genere. I veicoli presenteranno allestimenti differenti a seconda dei diversi requisiti operativi, versioni cassonate, frigo, silo o telonati. I conducenti dell’eActros seguiranno corsi di guida specifici per questa tipologia di mezzi. I clienti pilota proveranno i veicoli in condizioni di lavoro reali per

NELL’OTTICA DI CONSOLIDARE LA PROPRIA LEADERSHIP TECNOLOGICA, LA CASA DI

STOCCARDA AVVIA

LA SPERIMENTAZIONE SU STRADA DEL PROPRIO TRUCK ELETTRICO DA PARTE DEI CLIENTI.

DIECI

VEICOLI, SUDDIVISI NELLE DUE VARIANTI A

18 E 25 TONNELLATE DI PESO COMPLESSIVO,

DUE E TRE ASSI DA

VERRANNO CONSEGNATI NEL CORSO DELLE PROSSIME SETTIMANE AD ALTRETTANTE AZIENDE – E

8 TEDESCHE 2 SVIZZERE - CHE NE METTERANNO ALLA PROVA LA FUNZIONALITÀ E LA

REDDITIVITÀ NELL’USO QUOTIDIANO, IN CONDIZIONI DI LAVORO do dici mesi, dopodiché i truck saranno affidati a un secondo gruppo di clienti per altri dodici mesi. L’obiettivo di Mercedes-Benz Trucks è produrre in serie veicoli industriali elettrici, destinati al servizio di distribuzione pesante in ambito urbano, economicamente competitivi e pronti per essere commercializzati sul mercato a partire dal 2021. eActros adotta l’autotelaio dell’Actros come base di partenza. A parte questo, si tratta di un’architettura completamente impostata in funzione del la trazione elettrica, con un’e levata percentuale di componenti realizzati ad hoc. L’asse motore, per esempio, è basato sul modello ZF AVE 130, che ha dato prova delle sue potenzialità e della sua affidabilità sugli autobus ibridi e con celle a combustibile di Mercedes-Benz ed è stato profondamente rivisto in funzione dell’eActros. La trazione è affidata a due motori e-

lettrici asincroni trifase raffreddati a liquido, che funzionano con una tensione nominale di 400 V e posizionati accanto ai mozzi delle ruote dell’asse posteriore. Ciascun motore eroga 125 kW di potenza per 485 Nm di coppia

massima, che il rapporto di tra smissione converte in 1.000 Nm: le prestazioni di guida sono, pertanto, paragonabili a quelle di un truck diesel. Il carico massimo ammesso sugli assi si attesta sulle consuete 11,5 tonnellate.

Su eActros l’energia per un’autonomia fino a 200 km è fornita da batterie agli ioni di litio con una potenza di 240 kWh.

L’energia per un’autonomia fino a 200 km è fornita da batterie agli ioni di litio con una potenza di 240 kWh che, avendo già ottenuto buoni risultati presso EvoBus, non possono più essere considerate come prototipi. Le batterie sono alloggiate in un totale di undici pacchi: tre nell’area del telaio, gli altri otto al di sotto. Per motivi di sicurezza, i pacchi batteria sono protetti da alloggiamenti in acciaio. In caso di collisione, i supporti cedono e si deformano in modo da convogliare l’energia d’urto lontano dalle batterie, in modo da prevenirne il danneggiamento. Le batterie ad alta tensione non forniscono solo energia per la pro pulsione, ma al veicolo nel suo insieme. Componenti au siliari quali ad esempio compressore per l’impianto frenante, pompa del servosterzo, compressore per l’impianto di condizionamento della cabina e cassone refrigerato (ove presente), sono

DAIMLER TRUCKS / VENDITE E UTILI PREVISTI IN DECISO AUMENTO RISPETTO ALL’ANNO SCORSO

IL 2018 DELLE BUONE PROSPETTIVE I l 2018 si annuncia come un anno di successo per il colosso tedesco Daimler Trucks. Vendite e utile sono previsti in deciso aumento rispetto all’anno precedente. Il 2017 è stato un anno di grande successo per Daimler Trucks, nonostante un avvio sottotono e qualche perturbazione in mercati importanti. Nell’anno, la divisione Trucks di Daimler ha mostrato una crescita del 13 per cento delle vendite a 470.700 unità. Anche il fatturato è salito significativamente, attestandosi a 35,7 miliardi di euro. Il margine operativo si è attestato al 6,7 per cento dal 5,9 per cento precedente. “Su questa base ci aspettiamo di poter ancora nuovamente ottenere una decisa crescita - ha spiegato Martin Daum, Membro del Board of Management di Daimler AG e Responsabile Trucks & Bus - Per fare questo non contiamo solo sulla crescita dei mercati. Lavoriamo sistematicamente alla trasformazione della nostra strategia di lungo termine. In tutto ciò che facciamo il nostro focus sono i nostri clienti. Per offrire loro i migliori prodotti e soluzioni, investiamo continuamente in

innovazione. In questo modo continueremo ad avere successo anche nel 2018, anno in cui si terrà il Salone Internazionale dei veicoli Industriali (IAA)”. Nel 2018 e nel 2019 Daimler Trucks investirà mediamente circa 1,3 miliardi di euro l’anno in attività di Ricerca & Sviluppo. Visto che i temi mobilità elettrica, connettività e guida autonoma sono sempre più sentiti anche nel settore dei veicoli industriali, in questo periodo circa 500 milioni di euro saranno destinati esclusivamente a Ricerca e Sviluppo su questi fronti tecnologici. A tale riguardo Daimler Trucks si avvarrà naturalmente di sviluppi e conoscenze a livello di Gruppo, come nel caso di tecnologia delle batterie, sistemi di assistenza e sicurezza oltre che della guida autonoma. Con i suoi brand di veicoli industriali Mercedes-Benz, Freightliner e Fuso, Daimler Trucks svolge da molti anni un’attività pionieristica sul fronte della guida automatizzata e connessa. A livello mondo, Daimler Trucks ha intanto connesso circa mezzo milioni di veicoli indu-

striali con l’Internet of Things. Già nell’aprile 2016 tre truck Mercedes Actros connessi tra loro e capaci di guida autonoma hanno viaggiato da Stoccarda a Rotterdam in Olanda nell’ambito dello European Truck Platooning Challenge. Con il truck platooning, la connettività e la guida automatizzata aumentano la sicurezza dei truck che viaggiano incolonnati, diminuendo sia lo stress al volante sia i consumi di carburante grazie alla riduzione delle

REALI.

tutti alimentati elettricamente. Le batterie scariche possono essere ricaricate completamente in un arco di tempo da tre a undici ore, presupponendo una potenza realistica compresa tra 20 e 80 kW dei singoli dispositivi di ricarica mobili all’interno del parco veicoli. Lo standard per la ricarica è il Combined Charging System CCS. La rete di bordo LV, dotata di due batterie tradizionali a 12 V, viene alimentata attraverso le batterie ad alta tensione con l’au silio di un convertitore CC/CC. In tal modo, nel caso in cui la rete ad alta tensione si guasti o venga disattivata, viene garantito il corretto funzionamento di tutte le principali funzioni del veicolo come luci, indicatori di direzione, sistema di frenata, sospensioni pneumatiche e i sistemi relativi alla cabina. La rete ad alta tensione può essere attivata solo a condizione che le due batterie LV (a bassa tensione) siano cariche.

distanze tra i veicoli. Nell’autunno 2017 in un test finora unico Daimler Trucks ha presentato un’ulteriore possibilità di futuro impiego di veicoli industriali a guida autonoma. Quattro motrici Mercedes Arocs hanno infatti provveduto alla pulizia di una pista di atterraggio di un aeroporto in modo automatizzato e in formazione comandata a distanza. Daimler è anche il primo produttore di veicoli industriali negli Usa a sperimentare su strade aperte al traffico l’impiego di truck connessi digitalmente. A partire da quest’anno Daimler Trucks North America sperimenterà, in collaborazione con i grandi clienti flotte, l’accoppiamento digitale dei truck nell’attività quotidiana relativa ai trasporti. Daimler Trucks viaggia in convoglio anche sotto le insegne Fuso: un truck pesante del modello Super Great viaggia collegato elettronicamente e in modalità parzialmente automatizzata in un platoon del quale fanno parte truck di altri costruttori giapponesi di veicoli industriali. Il test di platooning è stato avviato da due ministeri giapponesi e fa parte della Future Strategy 2017 del governo nipponico. I risultati stannoa dunque per arrivare.


Più Potenza, quando è necessario. Il nuovo sistema Hydraulic Auxiliary Drive. Efficace. Potente. Leggero. Il nuovo sistema Hydraulic Auxiliary Drive coniuga i vantaggi di una potente trazione integrale con un peso inferiore. Il risultato: più carico utile e meno consumi per Actros, Arocs e Antos. Un altro dettaglio da non dimenticare: una notevole coppia nei momenti decisivi, premendo un semplice pulsante. Per maggiori informazioni rivolgetevi al vostro Concessionario Mercedes-Benz di fiducia o consultate il sito Internet all’indirizzo www.mercedes-benz.com/had


IL MONDO DEI TRASPORTI

Pagina 12

N° 268 / Aprile 2018

NEL 2017 I VOLUMI DI VENDITA DI SCANIA SONO CRESCIUTI DEL 55 PER CENTO

ITALIA TERRA DI MOTORI INDUSTRIALI E MARINI C ontinua a crescere il comparto motori di Scania in Italia. Un’evoluzione continua che nel 2017 ha fatto registrare un incremento dei volumi di vendita del 55 per cento. Un percorso positivo che Italscania prevede di proseguirà anche nel 2018 con il consolidamento del posizionamento nel mercato italiano. Il team motori di Trento, diretto da Paolo Carri, ha obiettivi chiari: “Vogliamo consolidare il nostro posizionamento nel mercato italiano e continuare a crescere. Scania è un marchio che si contraddistingue per affidabilità, produttività ed efficienza. Tutte caratteristiche che, unitamente a una rete di assistenza diffusa in maniera capillare su tutto il territorio italiano, rispecchiano le peculiarità

dei nostri motori. Siamo pronti a dimostrarlo con i fatti: chi sceglie Scania per i motori, sia industriali che marini, potrà contare su un partner di grande eccellenza. Nel 2018, inoltre, vogliamo accelerare il processo di crescita nel comparto dei motori marini grazie alla creazione di una struttura di vendita che ci consenta di diventare un player di riferimento in questo settore”. Il 2017 è stato un anno particolarmente positivo in tutti i settori di applicazione, in particolare quello dei motori industriali, motori per la produzione di energia elettrica e motori marini. Un anno che ha visto il consolidamento di collaborazioni con clienti storici quali CVS Ferrari, azienda di grande ec-

cellenza, al fianco di Scania da oltre 15 anni, che produce carrelli elevatori e reach stacker, e Tecniwell, leader internazionalmente riconosciuto nelle tecnologia Jet-Grouting. Lo scorso anno è stato importante anche per rafforzare partnership strategiche con aziende quali Cometto (gruppo Faymonville), uno dei principali produttori a livello mondiale di modulari pesanti e rimorchi semoventi, NED Generators, realtà impegnata nella progettazione, produzione e vendita di gruppi elettrogeni, e BioBrent, azienda leader nel settore degli impianti di cogenerazione e trigenerazione ad alto rendimento. “Abbiamo concluso il 2017 con grande soddisfazione, siamo ora pronti ad affrontare

il 2018 con grande entusiasmo e determinazione - ha evidenziato Riccardo Moraglia, responsabile vendite Motori di Italscania Vogliamo consolidare il nostro posizionamento nel settore dei motori marini grazie all’introduzione di nuovi motori IMO Tier III, adatti sia per la propulsione che per la generazione di bordo. Motori eccellenti dal punto di vista dei consumi e conformi alle ultime normative sulle emissioni, particolarmente restrittive. A partire dal 2018 saranno inoltre disponibili nuovi modelli di motori per il settore da diporto: già a listino il nuovo 13 litri, da 588 kW (800 CV) a 2.300 rpm, capace di una stupefacente curva di coppia che nel suo apice supera i 3.100 Nm. Altri modelli di elevata potenza verranno introdotti nel corso dell’anno”.

SCANIA / INAUGURATA STAZIONE LNG CON GRUPPO BIANCO PETROLI

Il Sud apre al metano liquido A MESAGNE, IN PROVINCIA DI BRINDISI, HA APERTO LA PRIMA STAZIONE DI MERIDIONE D’ITALIA. IL GRIFONE HA APPOGGIATO L’ARTEFICE DELL’IMPRESA, IL GRUPPO BIANCO PETROLI, STORICA AZIENDA DEL COMPARTO PETROLIFERO. L’IMPIANTO RAPPRESENTA

RIFORNIMENTO PER METANO LIQUIDO DEL

A

UN IMPORTANTE PASSO AVANTI PER INCREMENTARE E COMPLETARE IL

FABIO BASILICO MESAGNE

NETWORK NAZIONALE DI PUNTI RIFORNIMENTO LNG.

nche Scania, che ha ap pena presentato la sua offerta a metano liquido, è fortemente attiva nell’incrementare il network di distribuzione dell’LNG su tutto il territorio nazionale, al fine di arrivare ad assicurare ai trasportatori la piena e comoda accessibilità al gas naturale, diventato ormai un’altertiva credibile e disponibile al tradizionale gasolio. Ital-

scania era al fianco del Gruppo Bianco Petroli, storica azienda del comparto petrolifero e leader nel campo dell’energia alternativa, con sede a Mesagne, per l’inaugurazione della prima stazione di rifornimento LNG del Sud Italia. L’impianto, situato proprio a Mesagne, in provincia di Brindisi, rappresenta un importante passo avanti per incrementare e completare la rete di stazioni di rifornimento sul territorio nazionale. “Guidare il cambiamento

verso un sistema di trasporto sostenibile”: è questo l’impegno che accomuna Scania e Gruppo Bianco Petroli. Che ora hanno concretizzato questa vision comune con l’apertura, all’interno della stazione di servizio di via Torre Santa Susanna Km 1+1000, il primo storico impianto LNG attivo nel Meridione d’Italia. Erano presenti all’inaugurazione anche i rappresentanti di Scania e della concessionaria del Grifone Ribatti Veicoli Industriali, con sede ad Andria

Da sinistra: Alessandro Girardi, Sales Engineering Manager di Italscania; Gianluca Bianco, Amministratore delegato di Gruppo Bianco Petroli Snc; Antonio Ribatti, titolare della concessionaria Scania Ribatti Veicoli Industriali.

(Bt). “Sono molto orgoglioso di poter inaugurare oggi il primo impianto LNG del Sud Italia. Credo fortemente che sia necessario accelerare il percorso verso un sistema di trasporto sostenibile: solo incrementando la rete di distribuzione riusciremo a far sì che questo avvenga - ha evidenziato Gian luca Bianco, Amministratore delegato del

Gruppo Bianco Petroli Snc L’impianto, in grado di erogare sia metano liquido che in forma gassosa, è situato a soli tre km dalla trafficata e nevralgica strada statale 7, quindi con una collocazione strategica per le rotte dei trasporti nazionali e internazionali su gomma e per i veicoli in collegamento con la Grecia”. “Al Gruppo Bianco Petroli

L’impianto di Mesagne è collocato strategicamente sulle rotte dei trasporti nazionali e internazionali, anche per quanto riguarda il collegamento con la Grecia.

vanno i miei complimenti per l’inaugurazione di questo nuovo impianto che va a incrementare in maniera strategica la rete di stazioni di rifornimento LNG in Italia. Lo sviluppo della rete infrastrutturale è di fondamentale importanza per agevolare la diffusione di soluzioni di trasporto rispettose dell’ambiente. Anche grazie all’impegno di aziende quali Gruppo Bianco Petroli saremo in grado di dare vita a un sistema di trasporto sostenibile”, ha dichiarato Franco Fenoglio, Presidente e Amministratore delegato di Italscania. La cerimonia di inaugurazione della stazione di rifornimento è stata l’occasione per presentare alle aziende di trasporto presenti all’evento pugliese il nuovo veicolo LNG di Scania: “Il motore a metano da 13 litri, con una coppia di 2.000 Nm e 410 cv, rappresenta un’importante novità che amplia ulteriormente l’offerta di soluzioni a carburanti alternativi per la nuova generazione Scania - ha precisato Alessandro Girardi, Sales Engineering Manager di Italscania - È un veicolo pensato per le missioni a lunga distanza, grazie a un’autonomia fino a 1.100 km e a prestazioni paragonabili a un motore a diesel di pari potenza. Infatti, grazie al nuovo Opticruise di quinta generazione, offre cambi marcia rapidi e fluidi garantendo eccellenti livelli di guidabilità, erogazione di coppia e comfort. Sul fronte della sostenibilità, assicura emissioni di CO2 inferiori del 15 per cento di metano di origine fossile e con il biometano può garantire una riduzione fino al 90 per cento”.


SCANIA: GARANTIRE LA MASSIMA PROFITTABILITÀ NEL SEGNO DI UNA CONCRETA SOSTENIBILITÀ.

“LA SOSTENIBILITÀ non è un’opzione, è l’unico futuro possibile...” Sostenibilità ambientale ed economica Scania. Un prodotto tecnologicamente avanzato, compatibile con un’ampia gamma di carburanti alternativi, unito a servizi che massimizzano la produttività e l’efficienza della soluzione di trasporto.

SCANIA. PER L’UNICA IMPRESA CHE CONTA. LA TUA.

15:39


IL MONDO DEI TRASPORTI

Pagina 14

N° 268 / Aprile 2018

IVECO DEFENCE VEHICLES PER LE FORZE ARMATE TEDESCHE E ROMENE

Eurocargo entra in azione

M

MICHELE S. ALTIERI

CONTRATTI: IL PRIMO RIGUARDA UNA CONSIDEREVOLE COMMESSA DA PARTE

BWFUHRPARK SERVICE GMBH PER DI

UNA NUOVA FLOTTA DI

EUROCARGO 4X4 MULTIUSO PER L’ESERCITO TEDESCO; IL SECONDO È STATO SOTTOSCRITTO CON IL

MINISTERO DELLA DIFESA ROMENO, CHE HA COMMISSIONATO UN ORDINE DI 173 VEICOLI MILITARI

pribile, proiettori oscurati secondo specifiche Nato, versione per rimorchio, alloggiamento per ruote di scorta e sistema innovativo multiuso per la modifica del telaio (in caso di utilizzo in diversi tipi di missione al di fuori della Germania). Tutti i veicoli saranno pienamente conformi alle normative Euro 6, compresa la piena capacità di funzionamento a singolo combustibile, e of-

frono un carico utile ai vertici della categoria. Il contratto tra Iveco Defence Vehicles e BwFuhrpark Service GmbH è il risultato di due anni d’intensa valutazione del mercato e di numerose prove sul campo con un veicolo dimostrativo. Tra i recenti contratti aggiudicati con le Forze armate tedesche rientrano anche 133 blindati Trakker-8x8. Entrambi sono un’ulteriore te-

stimonianza della leadership di Iveco Defence Vehicles in termini sia tecnici che economici. Il contratto con il Ministero della Difesa romeno comprende veicoli militari logistici 6x6 appositamente progettati, appartenenti alla gamma di veicoli a elevata mobilità di Iveco Defence Vehicles. Questi veicoli, progettati come mezzi di trasporto generico e di truppe e dotati di verricello a re-

cupero automatico, offrono una mobilità eccezionale (con sistema di gonfiaggio pneumatici centralizzato incluso) e una capacità di guado per fornire supporto tattico in qualsiasi operazione militare. Inoltre, possono essere trasportati su aerei C130. La commessa è conseguente alla piena soddisfazione del Ministero della Difesa romeno riguardo alle performance e all’affidabili-

Farmaci che non scadono mai

T

BRUXELLES

hermo King, azienda leader nelle soluzioni di controllo della temperatura per varie applicazioni mobili e l’olandese VTS Transport & Logistics, specialista dei servizi di trasporto e magazzinaggio a temperatura controllata per aziende mediche e farmaceutiche, hanno portato la loro partnership a un livello superiore condividendo conoscenze e migliori pratiche in occasione della conferenza organizzata da Parenteral Drug Association (PDA) a Praga. Peter Wilms, esperto in soluzioni farmaceutiche presso Thermo King, e Joost Hafmans, direttore e titolare di VTS Transport & Logistics, sono stati invitati a intervenire alla conferenza sulla logistica della catena del freddo e sui sistemi di approvvigionamento per il sistema farmaceutico. Nel corso della loro presentazione, hanno parlato dell’importanza della visibilità delle temperature in tempo reale nella catena di fornitura dei prodotti farmaceutici. Hanno dimostrato come poter garantire un trasporto conforme dei componenti medicali agli impianti produttivi e dei prodotti finiti dagli impianti produttivi ai distributori, agli ospedali, alle farmacie e agli altri punti vendita di farmaci. “Il mantenimento della qualità e dell’integrità dei prodotti medicali e biologici durante il trasporto è di cruciale importan-

E LA PROTEZIONE DUE IMPORTANTI

L’IMPEGNO DI THERMO KING PER IL SETTORE FARMACEUTICO

GIANCARLO TOSCANO

I VEICOLI PER LA DIFESA CIVILE, HA FIRMATO

LONDRA

archio di CNH Industrial per i veicoli per la difesa e la protezione civile, Iveco Defence Vehicles ha annunciato la firma di due importanti contratti: il primo riguarda una considerevole commessa da parte di BwFuhrpark Service GmbH per una nuova flotta di automezzi militari medi 4x4 multiuso per l’Esercito tedesco. L’ordine prevede la consegna di 280 Eurocargo entro il 2018; il secondo è stato sottoscritto con il Ministero della Difesa romeno, che ha commissionato un ordine di 173 veicoli militari logistici, da consegnarsi anche in questo caso entro il 2018. Negli ultimi dieci anni, Ive co Defence Vehicles ha fornito all’Esercito tedesco circa 1.000 veicoli della sua ampia gamma di prodotti, che sono già stati ampiamente utilizzati in aree operative come l’Afghanistan e il Mali. I veicoli MLL 150 E 28 WS inclusi in quest’ultimo ordine verranno equipaggiati con cabina del conducente non protetta per lunghe tratte, con nuova disposizione di posti estremamente confortevole, magazzino flessibile per i sistemi radio e le attrezzature, pneumatici singoli offroad, tettuccio a-

IVECO DEFENCE VEHICLES, MARCHIO DI CNH INDUSTRIAL PER

STRATEGICA E IMPRONTATA ALLA COSTANTE INNOVAZIONE: È LA KING, AZIENDA LEADER NELLE SOLUZIONI DI CONTROLLO DELLA TEMPERATURA PER VARIE APPLICAZIONI MOBILI, E L’OLANDESE VTS TRANSPORT & LOGISTICS, SPECIALISTA DEI SERVIZI DI TRASPORTO E MAGAZZINAGGIO A TEMPERATURA CONTROLLATA.

COLLABORAZIONE TRA THERMO

za per i produttori farmaceutici e logistici, oltreché, naturalmente, per la salute pubblica e la sicurezza dei pazienti -

ha affermato Wilms - Lavoriamo con VTS da molti anni e siamo lieti di essere il loro partner di fiducia. La flotta

VTS opera con la nostra gamma completa di unità di refrigerazione per autocarri e semirimorchi ed è dotata di so-

luzioni aggiuntive, come i sistemi di gestione integrata delle risorse. Questo protegge le spedizioni grazie ai controlli critici in tutti i punti della catena di fornitura e offre la possibilità di tracciare, monitorare e gestire la flotta in tempo reale, in caso di eventuali incidenti”. Recentemente, VTS ha aggiornato la propria flotta con le ultime unità di refrigerazione per semirimorchi Thermo King SLXi, che sono state sviluppate prestando maggiore attenzione all’intelligenza dell’unità, alla capacità di comunicazione, ai consumi di carburante e alla gestione della temperatura. “La visibilità, il monitoraggio e la registrazione delle temperature di stoccaggio, la mappatura della temperatura dei magazzini per l’individuazione di punti caldi e freddi, nonché l’adozione di misure appropriate in caso di escursioni termiche sono fattori estremamente importanti per il trasporto e lo stoccaggio dei prodotti farmaceutici - ha dichiarato Hafmans - Thermo King ci aiuta ad affrontare le precise esigenze del settore farmaceutico fornendo sistemi, soluzioni e un’ampia gamma di servizi che ci permettono di mantenere la qualità del prodotto e ottimizzare l’integrità della catena di fornitura”. La piattaforma SLXi è un’unità di refrigerazione per semirimorchi completamente compatibile per i sistemi telematici, in grado di offrire una totale visibilità dell’unità stessa e

LOGISTICI.

tà dei veicoli ordinati precedentemente (57 mezzi nel 2015, tra cui camion ad alta mobilità, già impiegati sul territorio nazionale). Con questi contratti, si rafforzano ulteriormente i solidi e duraturi rapporti di fiducia tra Iveco Defence Vehicles e le Forze armate tedesche e romene, consolidando la posizione dell’azienda come partner chiave per i veicoli da difesa.

della condizione del carico grazie al nuovo dispositivo di comunicazione TK BlueBox di Thermo King e al Bluetooth di serie. Il TK BlueBox raccoglie e memorizza i dati dell’unità, a cui è possibile accedere con un’app gratuita da smartphone o dispositivo abilitato Bluetooth. In questo modo è possibile una comunicazione bidirezionale che consente la gestione dell’unità in tempo reale e l’accesso ai dati fondamentali. Gli u ten ti possono così gestire a distanza scongelamento, previaggio, punto di riferimento e ulteriori impostazioni della modalità operativa. La soluzione per la gestione integrata delle risorse Tracking di Thermo King sfrutta un sistema telematico basato sul web per monitorare le temperature, l’apertura degli sportelli e i livelli di carburante, per modificare il punto di riferimento e altri parametri di controllo, per modificare le modalità operative e per rispondere agli allarmi da un computer, tablet o smartphone connesso alla rete sicura esistente dell’operatore. Nella flotta VTS di unità per semirimorchi sono stati recentemente introdotti i pannelli solari ad alta capacità ThermoLitesolar di Thermo King. Questa soluzione è stata progettata per conservare il carico e aumentare la durata della batteria dell’unità frigorifera. I pannelli solari consentono ai sistemi telematici di monitorare i dispositivi per lunghi periodi di tempo, anche quando l’unità di trasporto refrigerato è spenta o al minimo, cosa par ticolarmente importante nel trasporto di prodotti farmaceutici quando si è in costante contatto con i semirimorchi attraverso sistemi telematici.


DA AILY Y BLUE POWER

CONSEGNE SENZA LIIMITI CAMPIONE N DI SOSTE ENIBILITÀ

DAILY Y ELECTRIC Il veicolo a emissioni zero, GSRYR´EYXSRSQME½RSEOQ IQSHEPMXkHMGEVMGEVETMHEMRSVI

DAILY Y HI-MAT TIC NAT TURAL POWER R Il primo veicolo con cambio automatico a 8 rapporti abbinato a un motore a gas naturale compresso HEPMXVM

DAILY Y EURO 6 RDE 2020 READY Il veicolo pronto per le normative WYPPIIQMWWMSRMHMKYMHEVIEPM 6() HIP Fino al 7% di risparmio sul carburante in missioni urbane reali

La giuria è stata par ticolarmente impresssionata dal livello di innovazione tecnica della nuova gamm ma IVECO e dal fatto che “il nuovo motore diesel RDE sia stato presentato ora - con tre anni a di anticipo rispetto all’entrata in vigore della normativva UE per i furgoni - ben prima di qualunque altro concorrente”” nonché dall’assoluto piace piacere ere di guida del Daily HI-MA ATIC TIC Natural Powerr. Nel consegnare il prestigioso premio, che riconosce l’impegno del brand nell’utilizzo di tecnologie orientate alla sostenibilità,, i giudici hanno afffermato concordi che la gamma Daily Blue Power “riunisce le principali soluzioni efffettivamente ettivam mente praticabili per ridurre l’impatto ambientale dei veicoli commerciali leggeri (LCV) nelle neelle missioni urbane e suburbane. IVECO mette a disposizione disposizzione veicoli sostenibili richiesti dal mercato” e che “le tecnologie elettriche, a gas naturale e SCR impiegate sono tutte soluzioni comprovate sviluppate da IVECO”.

“IVECO è sempre stato in pr ima linea per promuovere la sostenibilità del segmento degli LCV V.. La nuova gamma Daily Blue Power non ffaa altro c he r iconffermare tale posizione .” Jarlath Sweeney, Presidente della giuria dell’International Van of the Year

DAIL LY BLUE POWER. L’IT TALIA CHE VINCE. CORRI IN CONCESSIONARIA O CHIAMA SUBITO IL NUMERO VERDE ! lun-ven 8-20 / sabato 8-12


IL MONDO DEI TRASPORTI

Pagina 16

N° 268 / Aprile 2018

A CASA DI SETTI TRASPORTI, IMPORTANTE CLIENTE DI EVINDUSTRIAL SRL

Sulla strada dell’efficienza L’AZIENDA DI CASTELNUOVO SCRIVIA EFFETTUA TRASPORTI DI MERCI DA E PER LE PRINCIPALI DESTINAZIONI EUROPEE ED È UN CLIENTE DI PUNTA DI

EVINDUSTRIAL, SOCIETÀ CREMONESE LEADER NEL SETTORE DEI SEMIRIMORCHI, TRATTORI STRADALI E MOTRICI, RIVENDITORE AUTORIZZATO DELLA

KÖGEL. NEL 2017 LA SOCIETÀ

TEDESCA

CAPITANATA DAI

GRAZIANO E LILIANO SETTI HA ACQUISTATO 10 SEMIRIMORCHI KÖGEL FRATELLI

CON CARROZZERIA

FLEXIUSE.

L

FABIO BASILICO

CASTELNUOVO SCRIVIA

e regole del trasporto sono sempre più stringenti e le sfide per le aziende sono sempre più impegnative. Reggere il mercato oggi vuol dire avere non solo una solida organizzazione ma anche tanta competenza, passione e una chiara visione del futuro al di là delle inevitabili incertezze previsionali. Proprio come fa Graziano Setti, titolare della piemontese Setti Trasporti, azienda dalle ampie vedute, come dimostra il claim “European Services” che compare sui semirimorchi fermi sull’ampio piazzale della sede centrale di Castelnuovo Scrivia (Al). Setti Trasporti effettua trasporti di mer ci da e per le principali destinazioni europee ed è un cliente di punta di Evindustrial, società cremonese leader nel settore dei semirimor-

di veicoli con una scelta a 360 gradi imperniata alla massima qualità del servizio di vendita e post-vendita. Per conoscere da vicino Setti Trasporti ed entrare nel dettaglio dei suoi rapporti con Evindustrial siamo andati a Castelnuovo Scrivia in compagnia di Giuseppe Ziliani, consulente commerciale di Evindustrial per Liguria, Piemonte, Valle d’Aosta e provincia di Lodi, profondo conoscitore della zona e dell’attività di Setti Trasporti. Ad accoglierci c’è proprio Graziano Setti, a capo dell’azienda insieme al fratello Liliano. “L’azienda che vedete oggi ha iniziato la sua attività nel 1993 sull’onda dell’impegno di nostro padre Carlo attivo fin dagli anni Sessanta - esordisce Graziano Setti - Lui che a veva iniziato con un solo veicolo sarebbe di sicuro entusiasta di sapere che la flotta è arrivata a contare 33 truck

95 per cento del totale business, che per noi vuol dire trasporto generico, industriale, ADR, alimentare e agricolo - aggiunge Setti - Siamo cresciuti con le aziende della zona e il nostro inizio è stato l’export, che oggi costituisce ancora il 50 per cento del totale. Per l’80 per cento effettuiamo carichi parziali e per il 20 per cento carichi completi. La Francia è senza dubbio uno dei nostri mercati di riferimento”. Il rapporto con Evindustrial è iniziato tre anni fa. “Dopo venti anni di utilizzo di semirimorchi italiani - continua Setti - abbiamo nei primi anni Duemila deciso di cambiare rotta affidandoci a costruttori esteri. Questo fino al 2008 quando siamo ritornati a guardare il prodotto italiano, per poi successivamente tornare all’estero. Nel 2015 ci siamo stabilizzati grazie alle proficue trattative con EvinDa sinistra: Graziano Setti, titolare della Setti Trasporti, e Giuseppe Ziliani di Evindustrial.

chi, trattori stradali e motrici, rivenditore autorizzato della tedesca Kögel in Emilia-Romagna, Lombardia, Liguria, Piemonte e Valle d’Aosta, da sempre impegnata nell’offerta

di proprietà a cui si aggiungono 70 semirimorchi. Per il 90 per cento si tratta di trattori Sca nia Euro 6”. “Siamo un’azienda a forte vocazione internazionale, almeno per il

dustrial concretizzate poi nell’acquisto di 10 semirimorchi Kögel con carrozzeria FlexiUse nel 2017. Il rapporto con Evindustrial è ottimo. Abbiamo migliorato anche il livello

generale dell’attività di trasporto, proprio grazie all’utilizzo del prodotto Kögel, altamente affidabile. In realtà, abbiamo constatato che Kögel non vende dei semirimorchi ma vere e proprie soluzioni di trasporto in grado di sod disfare le esigenze di un’azienda a 360 gradi, non solo quindi in termini di qualità del prodotto offerto ma anche dei servizi annessi”. Va anche detto che semirimorchi in dotazione a Setti Trasporti hanno assali SAF con ampia garanzia di 6 anni: un altro prodotto di qualità per un trasporto all’insegna della massima efficienza”. Tra gli autisti dipendenti di Setti Trasporti ci sono anche stranieri con età media di 35 anni. “Qui in Italia non c’è ricambio generazionale e non

possiamo che rivolgerci agli au tisti provenienti da altri paesi, in prevalenza dall’Est Europa, Romania in testa. Pos siamo anche contare su autisti italiani che lavorano con noi da almeno 20 anni”. Il rapporto di fiducia è alla base della filosofia di Setti Trasporti. Vale per gli autisti ma anche per i clienti. “Siamo sempre stati vicini ai clienti storici e anche con quelli nuovi cerchiamo di instaurare un proficuo rapporto di lavoro qualitativamente avanzato che escluda ogni problema e ostacolo - conferma Graziano Setti - Oggi del resto conta la qualità del servizio e su questo non sono ammessi sconti”. Al futuro Graziano Setti guarda con ragionato ottimismo. “Per noi significa conti-

nuare mettendo a segno la stessa percentuale di crescita che abbiamo registrato negli ultimi anni - precisa - I mercati internazionali diventeranno sempre più importanti e Setti Trasporti si qualificherà sempre più come azienda di respiro europeo. L’aumento dei rapporti con altri paesi europei è motivato dal fatto che il mercato italiano ha bisogno di materie prime che qui non vengono prodotte. L’export dal l’Italia è invece fondato sui prodotti finiti. Per quanto riguarda Evindustrial -il rapporto non potrà che rafforzarsi in virtù della professionalità che ci lega. Sia l’azienda che Kögel ci sono sempre stati vicini e credo che questo sia un’ottima base per costruire un futuro di relazioni ottimali”.


A prova dii citttà tà e molto o altro

Brridgeston ne R-S STEER 0002 e R-DR RIVE 002: in nuovi pne eumaticii per au utocarri medi/leg m ggeri BRIDGEST T ONE EUROPE NV/SA , IT ALIAN A BRANCH Via Energyy Park, 14 20871 Vimercate Vim mercate (MB)

www.bridgestone.it


IL MONDO DEI TRASPORTI

Pagina 18

N° 268 / Aprile 2018

LA SERIE SPECIALE RENAULT TRUCKS T HIGH EDITION CONQUISTA IL GERMAN DESIGN AWARD

I

FORZA TEUTONICA PER IL TRASPORTO SU LUNGA DISTANZA l Consiglio Tedesco del Design ha conferito il German Design Award a Renault Trucks nella categoria Trasporti per merito della serie speciale T High Edition. Il riconoscimento premia l’estetica di un modello originale che valorizza in particolar modo il singolare design del Renault Trucks T, fiore all’occhiello della gamma long distance del costruttore francese. La cerimonia ufficiale di consegna del riconoscimento si è svolta Francoforte nell’ambito del Salone Internazionale Ambiente. Renault Trucks T è un camion iconico il cui design è caratterizzato principalmente da tre elementi: la cabina a trapezio, l’in-

clinazione del parabrezza a 12° e la calandra, con la forma a P greco. Un layout atipico valorizzato, nell’edizione speciale T High Edition, dalla vernice nera, i cerchi in alluminio, il rivestimento grigio scuro che ricorda il carbonio e i sottili profili rossi che richiamano le maniglie delle porte, anch’esse rosse. Hervé Bertrand, Direttore design di Renault Trucks, ha dichiarato: “Questo premio ci rende molto orgogliosi. Il Renault Trucks T è un camion dalle linee moderne che offre il massimo comfort. Ha un design innovativo che inizialmente ha lasciato qualcuno perplesso ma che oggi, con questo premio, viene finalmente riconosciuto”.

Renault Truck T High Edition, presentato la prima volta in Germania al Salone IAA di Hannover nel 2016, si era già aggiudicato il secondo posto nel “Young Professionals Truck Award 2017”, il premio attribuito dai giovani autisti. Il German Design Award ricompensa i prodotti e i progetti innovativi nel settore del design, sia in Germania che all’estero, insieme ai rispettivi costruttori e designer. I vincitori sono nominati da una giuria composta da 43 esperti internazionali. Il German Design Award è promosso dal Consiglio Tedesco del Design, fondazione creata nel 1953 dal Parlamento federale.

RENAULT TRUCKS RAFFORZA LE SUE POSIZIONI

Renault Trucks

Due anni di garanzia sulle parti di ricambio

R

enault Trucks estende a due anni la garanzia sulle parti di ricambio montate presso le proprie officine autorizzate. L’estensione di garanzia senza limiti di chilometraggio permette al costruttore di offrire agli autotrasportatori la protezione ideale che consente di lavorare in assoluta serenità. L’estensione di garanzia riguarda i ricambi originali Renault Trucks, i ricambi di rotazione eXchange (ricambi rigenerati con un rigoroso processo industriale) e gli accessori Renault Trucks. L’estensione è valida in tutti i paesi e presso tutte le officine autorizzate della Losanga. Nell’ambito della copertura di garanzia i ricambi difettosi saranno sostituiti gratuitamente e rapidamente recandosi presso un riparatore autorizzato Renault Trucks. Sono inclusi inoltre i costi di mano d’opera e di assistenza su strada e anche i costi relativi agli eventuali danni indiretti. I ricambi originali Renault Trucks e di rotazione garantiscono le performance ottimali del veicolo e il controllo dei costi di gestione. Sono disegnati e omologati in base a un protocollo tecnico e nel rispetto delle norme più rigorose in termini di affidabilità, sicurezza e ambiente.

R

LINO SINARI LIONE

enault Trucks affonda le sue radici europee e grazie ai risultati conseguiti nel 2017 può meritatamente programmare di estendere la sua offensiva anche nel 2018. Lo scorso anno la Losanga ha registrato il trend migliore nel vecchio continente. Il costruttore ha visto aumentare il fatturato con un volume complessivo di 49.930 veicoli, il 4 per cento in più. Renault Trucks ha così rafforzato le sue posizioni e ottenuto la migliore crescita in termini di quote a livello generale europeo e particolare francese. Sul solo mercato dei veicoli oltre le 6 tonnellate i volumi fatturati sono aumentati del 7 per cento. In que sto segmento Renault Trucks ha registrato i migliori indici di crescita sul mercato europeo e il trend migliore sul mercato francese. Più nel dettaglio, le unità fatturate in Europa, Francia esclusa, sono state 23.635, mentre in Francia ne sono sta te consuntivate 21.409 e nel resto del mondo 4.886. Nel segmento europeo oltre le 16 tonnellate, Renault Trucks ha registrato una crescita del 7,7 per cento ottenendo la migliore progressione in termini di quote di mercato con +0,5 punti, ossia l’8,4 per cento. Sui mercati delle gamme intermedie (6-16 tonnellate) la Losanga mantiene la sua posizione con una quota che scende solo di 0,1 punti. La leggera contrazione è dovuta essenzialmente al ritiro dell’offerta commerciale del D Cab 2m nel 2017. Questo veicolo pesava infatti per 1,1 pun ti di quota di mercato. Dopo quattro anni di crescita, il mercato europeo dei veicoli oltre le 6 tonnellate è tornato ai livelli del 2008. Renault Trucks è stata particolarmente efficiente su questo segmento, crescendo sulla maggior parte dei mercati europei e segnando un aumento complessivo dei volumi del 9,1

per cento. Il costruttore francese registra la progressione maggiore rispetto a tutti i costruttori competitor di veicoli pesanti, con +0,6 punti e una quota di mercato arrivata all’8,7 per cento. Fuori dal vecchio continente Renault Trucks è attiva essenzialmente in Africa e nel Medio Oriente. Nel 2017 i volumi si sono contratti del 4 per cento a 4.886 unità fatturate, una riduzione che deriva dall’introduzione di quote di importazione in Algeria. Renault Trucks resta comunque il leader del mercato dei costruttori europei nell’Africa francofona, raggiungendo il 40 per cento delle quote in Algeria nel segmento sopra le 16 tonnellate. Renault Trucks ha aumentato i suoi volumi del +40 per cento anche in Turchia, in un mercato che rimane comunque depresso. Nel 2017 il costruttore ha aperto nel paese quattro nuovi punti vendita e assistenza, a Izmir, Istanbul, Denizli e Ankara. In Iran, Renault Trucks ha rinnovato la cooperazione con Arya Diesel Motors per l’importazione delle gamme

L’Europa sotto il segno della Losanga NEL 2017 IL COSTRUTTORE FRANCESE HA VISTO AUMENTARE IL FATTURATO CON UN VOLUME COMPLESSIVO DI 49.930 VEICOLI, PARI A UN INCREMENTO COMPLESSIVO DEL 4 PER CENTO.

SUL SOLO MERCATO DEI VEICOLI SOPRA LE 6 TONNELLATE I VOLUMI FATTURATI SONO AUMENTATI DEL 7 PER CENTO. IN QUESTO SEGMENTO RENAULT TRUCKS HA REGISTRATO I MIGLIORI INDICI DI CRESCITA SUL MERCATO EUROPEO E IL TREND MIGLIORE SUL MERCATO FRANCESE. T, C, K e l’assemblaggio della gamma T. Infine, lo scorso anno è stato segnato anche dall’introduzione delle gamme T, C e K in Cile. Per quanto riguarda l’attività dei veicoli d’occasione, Renault Trucks ha mantenuto i volumi in un mercato difficile, con 6.846 camion fatturati, e ha implementato importanti risorse. Il costruttore ha aperto due nuovi centri di veicoli d’occasione a Dubai e Budapest e nel cuore del sito industriale di Bourg-en-Bresse (Ain) ha creato la Used Trucks Factory, un’officina per la trasformazione dei veicoli usati. Qui i camion vengono modificati dal costruttore per rispondere perfettamente alle esigenze dei clienti: le

motrici vengono trasformate in trasportatori e i camion per lunghe distanze in veicoli di servizio ai cantieri. Nel 2017 sono stati trasformati 230 veicoli d’occasione, ma l’azienda ha l’obiettivo di trasformare ogni anno 1.000 camion. Da ultimo, Renault Trucks ha aperto una piattaforma online dove è possibile trovare i suoi camion d’occasione. Il nuovo strumento digitale è attualmente dedicato alla presentazione dei veicoli in vendita, ma entro il 2020 diventerà un sito di e-commerce. Per Renault Trucks fortemete strategica è anche l’attività di post vendita, fondamentale perché strettamente legata ai risultati attesi dai clienti. Nel 2017 il costruttore

Nel 2018 Renault Trucks dovrebbe continuare a cogliere i frutti di una situazione di mercato proficua.

ha visto aumentare il suo fatturato di pezzi di ricambio del +2,6 per cento. Renault Trucks ha inoltre sviluppato un’offerta di contratti di manutenzione che registra an ch’essa un tasso di penetrazione in crescita di 4 punti. Nel 2018 Renault Trucks dovrebbe continuare a cogliere i frutti di una situazione di mercato proficua che ha favorito tra l’altro l’apertura nel 2017 di 35 nuovi punti vendita e assistenza. Quest’anno la Casa di Lione preparerà in particolare la commercializzazione di una gamma di camion 100 per cento elettrici e aprirà una linea dedicata ai veicoli zero emissioni nella fabbrica di Blainville-surOrne (Calvados).


RENAUL LT TRUCKS GAMMA A D 2.1 AD OGNUNO IL SUO

VEICOLO ROBUSTO E VERSA ATILE TILE: DA 7,5 A 18 TON Veicolo ideale per la distribuzione urbana ed extraurbana e l’approccio cantiere. Si caratterizza p per la facilità di allestimento, agevole accesso in cabina e per i ridotti consumi di carburante. Le nostre Concessionarie ti aspettano per configurare il veicolo in funzione del tuo fabbisogno.

SEGUICI SU

Renault Trucks Italia

www.renault-trucks.it


IL MONDO DEI TRASPORTI

Pagina 20

N° 268 / Aprile 2018

CON MAN CUSTOMERFIRST LA RETE AGISCE PER IL CONTINUO MIGLIORAMENTO

Il cliente ha sempre ragione “OVVIAMENTE UN’AZIONE DI CONTROLLO SULLA SODDISFAZIONE DEL CLIENTE ESISTEVA ANCHE PRIMA - SPIEGA ALESSIO SANI, DIRETTORE AFTER SALES DI MAN TRUCK & BUS ITALIA E RESPONSABILE DEL PROGRAMMA CUSTOMERFIRST IN ITALIA - MA NON CON QUESTE CARATTERISTICHE CHE LA RENDONO MOLTO PIÙ SIMILE AGLI STRUMENTI IN DOTAZIONE AI COSTRUTTORI AUTOMOBILISTICI, QUINDI ALL’AVANGUARDIA ASSOLUTA PER I VEICOLI INDUSTRIALI. IN PRATICA CON CUSTOMERFIRST FORNIAMO, ATTRAVERSO UN PORTALE DEDICATO, ALLA NOSTRA RETE DI DEALER E OFFICINE UNO STRUMENTO CHE

L

PERMETTE LORO DI VERIFICARE GIORNO DOPO GIORNO LE OPINIONI

PIETRO VINCI

DEI LORO CLIENTI E LA PERCEZIONE DEL SERVIZIO OFFERTO”.

DOSSOBUONO

a “customer satisfaction” non è uno slogan pubblicitario ma la concreta attività di supporto al cliente trasportatore in tutte le sue esigenze e problematiche. È un valore strategico e un pilastro dell’azione di tutti i costruttori. Lo dimostra MAN Truck & Bus che lancia CustomerFirst, programma che si propone di fornire in modo dettagliato e tempesti-

creati per avere dei report il più possibile veritieri e realistici in grado di fornire informazioni utili alla definizione di strategie e contromisure future nel delicato settore della soddisfazione del cliente. Tutto questo è ancora più importante in questi anni dove si stanno delineando scenari finora sconosciuti, dall’avvento dei social media alle nuove tecnologie e sistemi di trazione, che richiedono un cambiamento culturale necessario per continuare a gestire al

Alessio Sani, Direttore After Sales di MAN Truck & Bus Italia.

vo informazioni sulla soddisfazione del cliente, mettendo l’intera Rete MAN nelle condizioni di poter attuare misure di continuo miglioramento a tutto beneficio degli operatori che hanno dato fiducia al costruttore di Monaco. Nell’intero settore automotive, sono tante le iniziative messe in campo e tanti gli strumenti

meglio l’esperienza del cliente nella nuova complessità moderna. Il programma CustomerFirst va proprio in questa direzione ed è stato sviluppato da MAN Truck & Bus per migliorare in modo concreto la qualità dei propri servizi. Il sistema registra puntualmente le valutazioni dei clienti

MAN dopo ogni esperienza di vendita e assistenza, analizzando nel suo complesso l’intero processo che li vede coinvolti con un concessionario, un’officina o un Center MAN sul territorio nazionale. I risultati vengono quindi elaborati in un portale online e sono disponibili per gli operatori già il giorno successivo. Così il personale MAN che utilizza il programma riceve tempestivamente tutte le informazioni necessarie per organizzare al meglio la propria attività, relazionandosi con il cliente finale in maniera costruttiva e propositiva. Alessio Sani, Direttore After Sales di MAN Truck & Bus Italia, è il responsabile del programma CustomerFirst in Italia: “L’inizio del progetto risale al 2016 e da allora è stato continuamente implementato e sviluppato per tutto il mondo truck. Ovviamente un’azione di controllo sulla soddisfazione del cliente esisteva anche prima, ma non con queste caratteristiche che la rendono molto più simile agli strumenti in dotazione ai costruttori automobilistici, quindi all’avanguardia assoluta per i veicoli industriali. In pratica con CustomerFirst forniamo, attraverso un portale dedicato, alla nostra rete di dealer e officine uno strumento che permette loro di verificare giorno dopo giorno le opinioni dei loro clienti e la percezione del servizio offerto. Nel caso di criticità vengono avvisati direttamente con una mail in modo che possano contattare il cliente scontento e provare a porre

rimedio alle sue critiche”. “I resoconti sono il risultato di interviste telefoniche a clienti che hanno da poco usufruito di un servizio MAN: sia un servizio commerciale, quindi una vendita, sia di postvendita, quindi assistenziale, inclusa l’attività del Mobile24, il servizio MAN di pronto intervento su strada - prosegue Sani - I clienti da intervistare sono scelti a campione tra tutti quelli del periodo oggetto di valutazione e non possono essere richiamati prima di sei mesi dopo la prima intervista. Il questionario si compone di vari quesiti con un punteggio che va da 1 a 5 (da completamente insoddisfatto a completamente soddisfatto): i voti 1 e 2 sono insufficienti (quindi scatta una mail di allerta “Hot Alert” - che arriva anche sul computer del Direttore Generale di MAN Truck & Bus

Italia), mentre 3 è la soglia della sufficienza. Lo scorso anno in Europa sono state eseguite oltre 100mila interviste, di cui più di 3.000 solo in Italia. Il nostro Paese si attesta su buoni livelli di performance: la media è tra il 4 e il 5 e anche per il servizio Mobile24 si è superata la soglia del 4, nonostante sia facile immaginare che un’avaria per strada non favorisca un report soddisfatto”. “Nel caso di “Hot Alert” continua Sani - la prassi prevede che la struttura MAN interessata (avvisata al massimo dopo 24 ore) debba contattare il cliente scontento per chiarire i punti contestati e provare dove possibile a porvi rimedio. Gli indici attuali lasciano presagire ulteriori margini di miglioramento e già dai primi riscontri del 2018 il trend conferma un an-

damento positivo. Come positiva è la reazione dei clienti che, dopo un’iniziale diffidenza, oggi apprezzano molto CustomerFirst per l’opportunità che offre di avere un filo diretto con MAN”. Il progetto CustomerFirst si è recentemente aggiudicato in Germania il German Excellence Awards 2018. A proposito del premio, Stefan Hartner, responsabile centrale del programma, ha dichiarato: “Abbiamo implementato un programma molto efficace e il German Excellence Awards 2018 naturalmente non riduce il nostro impegno. Nella sua dichiarazione di eccellenza, la giuria ha sottolineato come il programma fornisca informazioni tempestive sulla soddisfazione del cliente, a tutti i livelli e in tutti i 21 mercati MAN, implementando misure dirette di customer service”.

Il management di Man Truck & Bus Italia al quartier generale di Dossobuono.

TREND DI CRESCITA SU TUTTI I FRONTI PER LA FILIALE VERONESE

MAN ITALIA PIÙ FORTE CHE MAI I dati consuntivi diffusi a marzo parlano chiaro: il 2017 è stato un anno di segno “più” per MAN Truck & Bus Italia, che conferma il solido trend di crescita su tutti i fronti. Gli obiettivi sono stati centrati, sia per le vendite sia per i servizi di assistenza, con indici di livello assoluto che confermano il generale processo di crescita della qualità della Rete MAN su tutto il territorio nazionale. Se tutto questo si traduce in un fatturato poco sotto i 300 milioni di euro con un incremento di quasi il 25 per cento rispetto al 2016, che a sua volta aveva fatto segnare un altro record con un incremento del 29,5 per cento sull’anno precedente, il giudizio non può che essere ampia-

mente positivo. La Divisione Truck, a fronte di una crescita del mercato globale sopra le 6 t del 3,1 per cento, fa registrare un incremento degli ordini del 22 per cento e dei mezzi fatturati del 17 per cento, portando la quota di mercato sopra l’8 per cento. Il tutto nell’attesa delle cabine Model Year 2018 di TGX e TGS e del nuovo motore D08 per TGL e TGM, che solo alla fine dell’anno hanno fatto la loro comparsa nelle concessionarie. Lo stesso vale per l’ultimo arrivato, il nuovo commerciale MAN TGE, le cui consegne sono iniziate negli ultimi mesi del 2017, ma che sta già riscuotendo molto successo e che può già contare su un nutrito portafoglio ordi-

ni. Nell’ambito del trasporto persone, sono quasi 300 le unità consegnate nel 2017 dalla Divisione Bus, per una quota sopra l’11 per cento e la conferma per il Gruppo MAN di essere uno dei tre principali attori del mercato. I nuovi NEOPLAN Tourliner e MAN Lion’s Coach sono stati protagonisti assoluti del segmento turistico e proiettano importanti traguardi anche per il 2018. Sono numerose pure le consegne di veicoli per il trasporto pubblico locale, in primis i 40 NEOPLAN Skyliner a due piani per Cotral, ma anche le forniture a Trieste Trasporti, Trentino Trasporti, TPER Bologna e al Gruppo Arriva, che confermano l’ottimo momento che la Casa di Monaco sta vivendo nell’ambito urbano. I Ricambi fanno segnare il record assoluto degli ultimi 9 anni con un incremento di oltre

10 punti percentuali sul 2016. Quasi 200mila i litri di olio in più venduti rispetto all’esercizio precedente, a conferma dell’apprezzamento della linea di lubrificanti originali MAN introdotti poco più di un anno fa. Boom anche dei contratti di manutenzione programmata che, superando il muro delle 1.000 unità, segnano un incremento di oltre il 20 per cento. Tutto questo si inquadra nel generale consolidamento della struttura organizzativa di MAN Truck & Bus Italia che ha fatto segnare nel 2017 una crescita del 30 per cento sul fronte occupazionale, anche grazie all’apertura dei due MAN Center di Roma e Brescia. Con una visione decisamente ottimistica, MAN Truck & Bus Italia è pronta a consolidare e rafforzare la propria posizione sul mercato anche nel corso del 2018.


NUOVO CRA AFTER 4MOTION T ALLESTITO NEW FRIGOLINE INARR RESTABILE, ANCHE A IN MO ONTAGNA! Casssa frigo g fino a -20° e trazione integrale g Per chi guida in n inverno, in montagna, a, su terreni impervi e su strade sterrate e in forte pendenza, con la neve o il fango ngo, la consegna dei prodotti può sembrare are un’impresa impo ossibile. Il nuovo telaio o-cabina Volkswagen Crafter 4Motion allestito tito con cassa frigo o Lamberet New Frigoline garantisce una tempra granitica e una u solidità struttura ale invidiabile, capace di superare anche i passaggi all’apparenza più complessi. La fu urgonatura isotermica a New Frigoline sviluppata per TELAI-CABINA NA da 2,5 2,5>7, 7,,5 t di PTA AC associa alluminio nio, acciaio THLE e Ino ox che assicurano peso eso ridotto e resistenza enza eccezionale, massimo isolamento, faccilità di manutenzione e riparazione, ergonomia studiata per il confort ottimale.

Richiedi una prova del veiccolo

LAMBERET S.p.A. Corso Europa, 5 - 20020 Lainate (MI) IT TALIA A ALIA Tel: +39 02-94324200 - +39 02-94324 02-94324250 4250 www.lamberet.it - info@lamberet.it


IL MONDO DEI TRASPORTI

Pagina 22

N° 268 / Aprile 2018

CON IL RESTO DELLA GAMMA NP DI IVECO ALLA PRIMA EDIZIONE DEL GREEN LOGISTICS EXPO DI PADOVA

A

DAILY HI-MATIC NATURAL POWER PROTAGONISTA DELLA LOGISTICA SOSTENIBILE

nche un Daily Hi-Matic Natural Power ha sostenuto le insegne Iveco durante la prima edizione del Green Logistics Expo, il Salone Internazionale della Logistica Sostenibile tenutosi a Padova in marzo, a cui il costruttore ha partecipato attraverso il suo concessionario Stefanelli. Un’occasione prezioso per tutti gli operatori del settore per analizzare gli aspetti normativi e, in particolare, gli obiettivi di sostenibilità che gravano sul mondo dei trasporti e su tutta la catena logistica. Daily Hi-Matic Natural Power unisce la tecnologia sostenibile Natural Power del gas naturale compresso con l’incredibile piacere di guida garantito dall’esclusiva trasmissione Hi-Matic a otto rapporti. Il veicolo è dotato di tutte quelle caratteristiche che ne fanno la soluzione ideale per le imprese sostenibili: ottimale fuel economy, che si traduce in un costo per chilometro estremamente competitivo, prestazioni ambientali significative, con una riduzione delle emissioni di CO2 che, con l’impiego del biogas, arrivano a sfiorare lo zero, silenziosità, ridotto costo totale di esercizio (TCO) ed elevato grado di connettività. In occasione dell’incontro di approfondimento “Veicoli alternativi per una logistica sostenibile”, nella sezione dedicata all’intermodalità, per Iveco è intervenuto Fabio Pellegrinelli, Gas Business Development Manager, per spiegare la visione dell’azienda in relazione al

trasporto sostenibile e alle opportunità fornite dall’impiego dei carburanti alternativi, nel particolare momento in cui l’organizzazione produttiva e i traffici mondiali stanno facendo registrare una ridefinizione significativa di equilibri, assetti e paradigmi fondanti. “Iveco è l’unico costruttore in grado di offrire un’intera gamma di

prodotti a trazioni alternative per rispondere, da un lato, ai sempre più rigorosi obiettivi indicati dalle istituzioni in termini di sostenibilità ambientale, e dall’altro a una domanda sempre più sofisticata di mobilità e trasporto da parte delle aree urbane in costante crescita demografica e sempre più congestionate – ha commentato Pellegrinelli - Il gas naturale è una tecnologia concreta subito applicabile e l'unica in grado di offrire da subito una riduzione delle emissioni di inquinanti a fronte di costi di esercizio ridotti. In primavera il parco circolante di Stralis NP raggiungerà circa 1.000 unità in Italia e, quando tutti questi veicoli saranno alimentati a biometano, sarà possibile ridurre di quasi 110.000 ton/anno le emissioni di CO2 - secondo il parametro well to wheel - rispetto a un diesel equivalente”. Iveco, unico costruttore ad avere un’intera gamma veicoli interamente alimentata a gas naturale, ha schierato a Padova anche uno Stralis NP 460, un Eurocargo CNG e un Crossway Low Entry Natural Power. Il dealer Stefanelli Spa, nato nel 1976 come azienda specializzata nella vendita di autobus e divenuta concessionaria Iveco per i veicoli industriali a partire dal 1990, opera sul territorio della provincia di Venezia, Padova e Rovigo per i veicoli industriali e sulle intere regioni Veneto e Friuli Venezia Giulia per gli autobus di Iveco Bus.

IVECO COMPLETA LA FORNITURA DI CENTOTRENTA VEICOLI A LOCAUTO

Anche il noleggio si affida a Daily DAILY CONSENTE ALLA SOCIETÀ FONDATA NEL 1979 DI ENTRARE DA PROTAGONISTA NEL SETTORE DEL NOLEGGIO DI VEICOLI COMMERCIALI.

NATA COME SOCIETÀ DI LEASING AUTO, LOCAUTO OPERA DAL 1984 NEL NOLEGGIO A LUNGO TERMINE. NEL 2006 HA DECISO DI DIVERSIFICARE LA SUA OFFERTA CREANDO IL MARCHIO LOCAUTO RENT A CAR, CON OLTRE 30 STAZIONI DI NOLEGGIO, 25 DELLE QUALI NEI PRINCIPALI AEROPORTI ITALIANI, PER GARANTIRE AI CLIENTI LA MASSIMA FLESSIBILITÀ E UNA MAGGIORE POSSIBILITÀ DI PERSONALIZZAZIONE DEL SERVIZIO.

I

FABIO BASILICO

Da sinistra: Giuseppe Cereda, Responsabile commerciale di Officine Brennero, Marco Di Maira, Direttore Operativo di Locauto, Agatino Di Maira, Amministratore delegato di Locauto, e Alberto Aiello, Amministratore delegato di Officine Brennero.

SUZZARA

veco Daily conferma per l’ennesima volta le doti innate di autentico punto di riferimento del settore veicoli commerciali per versatilità e flessibilità d’impiego. Presso il Daily Center di Suzzara, punto vendita di Officine Brennero, dealer di proprietà Iveco, si è svolta la cerimonia di consegna di due modelli 35C14 del nuovo Daily a Locauto, azienda italiana di servizi di noleggio con oltre 30 anni di esperienza nel mondo automotive. Erano presenti alla cerimonia Agatino e Marco Di Maira, rispettivamente Amministratore delegato e Direttore Operativo di Locauto, Giuseppe Cereda, Responsabile commerciale di Officine Brennero, Lorenzo Chioetto, Responsabile di sede e Fabio Ter navasio, District Sales Manager Iveco. Nata nel 1979 come società di leasing auto, Locauto opera dal 1984 nel noleggio a lungo termine. Nel 2006 ha deciso di diversificare la sua offerta creando il marchio Locauto Rent a Car, con oltre 30 stazioni di noleggio, 25 delle quali nei principali aeroporti italiani, per garantire ai clienti la massima flessibilità e una maggiore possibilità di personalizzazione del servizio. Per il tipo di missione che dovrà affrontare, Locauto ha orientato la sua scelta sul Daily, il mezzo che vanta non solo la robustezza, le prestazioni e l’affidabilità che l’hanno reso famoso, ma anche una grande versatilità e la più

ampia e varietà di combinazioni della categoria: furgone, furgone semivetrato, cabinato, scudato e cabina doppia. Ultimi veicoli di una fornitura di complessive 130 unità, che ha sancito l’inizio di una significativa collaborazione fra il costruttore e Locauto, i Dai ly oggetto dell’ultima consegna di completamento

dell’ordine sono equipaggiati con allestimento furgone in le ga leggera, completo di sponda caricatrice per agevolare le operazioni di carico e scarico, e vanno ad ampliare un parco macchine composto da circa 750 veicoli, divisi tra noleggio a breve e lungo termine. Dotato di motore F1A da 2.3 litri, che eroga una po-

tenza di 140 cv e sviluppa 350 Nm di coppia massima, con turbina a geometria variabile, che ne ottimizza le prestazioni e il risparmio di carburante, Daily vanta un sistema di trattamento delle emissioni EGR a bassa pressione, senza aggiunta di AdBlue, che garantisce la massima semplicità di gestione del vei-

colo. Al momento della consegna dei veicoli l’Amministratore delegato di Locauto, Agatino Di Maira, ha dichiarato: “La scelta di Iveco è stata naturale, questo perché Locauto e' un'azienda al 100 per cento italiana e voleva, per questa tipologia di mezzi cassonati box e ribaltabili a tra-

zione posteriore gemellata, entrare nel settore noleggio LCV con il ‘best in call’ sul mercato, fattore dimostrato dalla storia di Iveco a livello di affidabilità, qualità costruttiva e orgoglio italiano del mezzo”. Grazie alla favorevole vicinanza del Daily Center con lo stabilimento di Suzzara (Mn) dove il veicolo prende forma, la consegna è stata anche occasione per il cliente per approfondire la conoscenza del mondo Iveco attraverso la visita alla produzione, dove è possibile compiere un’esperienza unica e immersiva concepita come parte costitutiva del progetto Daily Center e che lo rende, per questo, molto più di uno showroom o di un semplice punto vendita. A pochi mesi dalla sua inaugurazione, il Daily Center continua a confermare la sua attitudine di punto di riferimento per il business e l’immagine del marchio Iveco, dove il cliente può scoprire nella maniera più completa e innovativa il veicolo sotto tutti i punti di vista, a partire da una carrellata storica, raccontata per immagini appese alle pareti del factory outlet, dalle specifiche tecniche e dalle offerte commerciali, illustrate da personale competente e professionale, fino alla possibilità di effettuare il ritiro dei veicoli, secondo un concept del tutto inedito, che vede il centro di Suzzara come punto comune e condiviso tra sei diversi con cessionari operanti nell’area geografica limitrofa, a testimonianza della partnership che da sempre lega Iveco e la sua rete.


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 23

SERVICE POINT ENTRA A FAR PARTE DEL NETWORK DI FRAIKIN

Sbarco in terra ciociara AUTENTICO “PONTE” TRA CENTRO E SUD ITALIA, IL NUOVO RIFERIMENTO DEL NOLEGGIATORE FRANCESE A FROSINONE È NATO TRE ANNI FA GRAZIE ALLA LUNGA ESPERIENZA MATURATA SUL CAMPO DA FRANCO CESTRA, AFFIANCATO NELLA NUOVA AZIENDA DA GIUSEPPE LUFFARELLI: DUE FIGURE INSTANCABILI CHE HANNO FATTO DELLA DISPONIBILITÀ E DELL’ORIENTAMENTO AL CLIENTE IL LORO PUNTO DI FORZA. “PROPONIAMO IL NOLEGGIO PER COMPLETARE L’OFFERTA DI SERVIZI PER L’AUTOTRASPORTO”, AFFERMANO.

L

MAX CAMPANELLA ALATRI

a straordinaria passione per il proprio lavoro, la vo glia d’investire e guardare avanti, il forte orientamento al cliente e l’estrema disponibilità nel far fronte alle eventuali problematiche. Sono gli ingredienti che - accanto alla naturale propensione per l’assistenza multimarca - hanno convinto Fraikin che Service Point può rappresentare il suo migliore avamposto in Ciociaria, nell’ambito della strategia, avviata l’anno scorso dal noleggiatore francese, di strutturare un network in grado di soddisfare la domanda di noleggio e quel la conseguente di assistenza post vendita. Service Point sorge al confine tra Alatri e Frosinone: 2.250 mq di ca pannone, 26mila mq di piazzale, uffici e due appartamenti a disposizione degli autisti per eventuali pernottamenti. Azienda giovane, oggi conta 14 dipendenti e, solo con il business dei servizi, ha chiuso il 2017 con un fatturato di un milione e mezzo di euro, in crescita rispetto al milione del 2016, con l’obiettivo di continuare a crescere quest’anno. Service Point nasce nel 2014 dall’unione dei soci Fran co Cestra e Giuseppe Luffarelli. Profondo conoscitore del settore il primo, caratterizzato da grande operatività e voglia di fare il secondo, ben presto i due dimostrano di avere le carte in regola per far diventare la loro a zien da un riferimento nell’ambito dell’assistenza ai veicoli industriali e commerciali, entrando a far parte della Rete Alltrucks (seconda officina italiana a scegliere il team capitanato da Gianluca An nunziata) e scegliendo quest’anno di proporre la formula del noleggio, per continuare un’opera di assortimen-

Da sinistra: Diego Pellicioli, Direttore Commerciale Fraikin Italia, Franco Cestra e Giuseppe Luffarelli, fondatori di Service Point.

to dell’offerta di servizi per il cliente finale. “In questi tre anni - spiega Cestra - abbiamo fortemente investito per dare al cliente un servizio di qualità: abbiamo un magazzino ricambi completo, con un assortimento che consente di soddisfare ogni tipo di richiesta. Entro fine anno contiamo di aprire la parte di back office, in modo da rendere operativa la vendita al dettaglio dei ricambi”. Sa il fatto suo Franco Cestra, negli Anni Ottanta venditore di veicoli industriali a marchio Fiat, poi di Iveco e Volvo Trucks, presso la Concessionaria del produttore svedese guidata da Mario Cap pelli. Conosce bene il mercato ma soprattutto le necessità delle aziende di auto-

SOCIETÀ MULTIMARCA E VOTATA AI SERVIZI SIN DALLE SUE ORIGINI TRE ANNI FA

trasporto che, in Ciociaria, sono numerose, diversificate per tipo di attività e composizione della flotta. Nel 1998 mette la sua esperienza a disposizione di un investimento che, con Pasqualino Testani, dà vita a FAG, officina autorizzata e concessionaria DAF. Per Cestra sono anni nei quali vive da protagonista l’acquisizione del costruttore olandese da parte dell’americana Paccar: DAF, da brand di fatto inesistente, grazie a FAG in Ciociaria ottiene una quota di mercato di tutto rispetto e inizia a farsi conoscere dai professionisti della zona. Nel 2013 i due soci separano le loro strade: Testani dà vita all’attuale azienda di autotrasporto che porta il suo nome e Cestra incrocia Luffa-

relli che, proveniente dal mondo dell’edilizia, intende sperimentare una nuova strada. “La crisi economica spiega Luffarelli - aveva non so lo ridimensionato molto margini e volumi nel settore delle costruzioni, ma soprattutto stava scomparendo la passione, la soddisfazione che provavo nel realizzare ad esempio progetti ampi nel settore pubblico. Nel mondo del trasporto sto ritrovando quello spirito, quella passione per il lavoro che mi mancava”. La sede ex FAG ben si presta al progetto Cestra-Luffarelli. “Service Point - precisa Cestra - nasce con l’obiettivo di dare un servizio di assistenza ai trasportatori che in terra di Ciociaria ne avvertivano la necessità. Oggi facciamo revisioni con una linea di ultima generazione di Classe II, adatta per autocarri e autobus, caratterizzata da elevata automazione e operativa tutti i giorni. Siamo FAI Service e diamo anche consulenza per le coperture assicurative”. Sin dall’inizio la scelta strategica è di non sposare un solo brand, ma proporre un servizio a tuttotondo. “I clienti - prosegue Franco Cestra in Service Point trovano un riferimento multimarca, per l’acquisto di veicoli nuovi e usati e per l’assistenza h 24. Oggi vengono da noi aziende un po’ da tutto il Lazio: Frosinone ma anche Roma, Viterbo, Latina nonché da Abruzzo e persino dalla Sicilia. Flotte di ogni dimensione che trasportano collettame, hanno se mirimorchi centinati ma fanno anche trasporto di liquidi, rifiuti e refrigerati”. Grazie a un costante aggiornamento di apparecchiature e personale, Service Point effettua elettronica sui semirimorchi e nel 2017 ha visto crescere la domanda di cambi, per lo più ZF. Officina autorizzata Kögel, effettua assistenza per ogni marchio di semirimorchi. “Dalle valvole al soffione passando per cinghie, motori frigo e pompe per betoniere da calcestruzzo, ogni problema in Service Point ha la sua soluzione”, afferma Luffarelli, dimostrando di aver maturato una considerevole esperienza in tre anni di operatività sul campo. “Del resto, se il cliente ha un problema, siamo io e lui in prima persona a occuparcene, direttamente e presso la sua sede: è questo il nostro punto di forza”, conclude Franco Cestra.

PRIME FORNITURE DI TRATTORI MAN E PIANI MOBILI STAS AD AZIENDE LAZIALI P er sua caratteristica naturale votata ai servizi, poco prima della fine del 2017 Service Point incontra Fraikin. “La strategia con cui siamo nati tre anni fa - spiega Franco Cestra - è offrire alle aziende di autotrasporto un’ampia gamma di servizi, andando oltre l’assistenza, che resta comunque il core business della nostra azienda. La proposta di inserire nel ventaglio di servizi il noleggio ha rappresentato il completamento dell’offerta, che già ci vede operativi, tramite SCL Consorzio Officine Laziali, con assicurazioni, logistica, depositi, servizi ai padroncini che possono tro vare un sostegno per la loro attività se manca loro qualche autorizzazione normativa”. Insomma, Service Point non vuole essere un’officina generica, ma un mondo a disposizione del trasporto. Una caratteristica che ha positivamente colpito il management Fraikin Italia. “Quel qualcosa in più di quest’azienda - precisa Diego Pellicioli, Direttore Commerciale del noleggiatore francese - nonché il suo magazzino, con uno stock a terra del valore di oltre 400mila euro, e l’instancabile disponibilità

dei titolari nei confronti della clientela hanno rappresentato gli elementi di valore principali che ci hanno convinto che si tratta del partner giusto per Fraikin”. Service Point, affiancata dall’Area Manager Fraikin Mauro Marcheggiani, ha già effettuato contratti di noleggio di sei MAN TGX a MA.SA. Trasporti di San Cesareo, alle porte di Roma, e di cinque piani mobili STAS, forniti da Realtrailer, a Rizzato Trasporti. E altri cinque di questi ultimi saranno forniti a maggio. “Un inizio promettente ma soprattutto aggiunge Pellicioli - Service Point sarà il riferimento per tutto quello che riguarda il servizio revisioni del nostro parco che ruota su Roma, Latina e Frosinone: i clienti Fraikin di quest’area per tutto quanto occorre in termini di assistenza avranno il loro riferimento in Service Point. Un partner importante anche da punto di vista strategico: il Fraikin Point in Ciociaria mette in connessione Centro e Sud Italia, rappresenta un ponte ideale. Service Point, con la sua esperienza e l’ampio piazzale potrà rappresentare un giorno un hub Fraikin per i veicoli usati”.


IL MONDO DEI TRASPORTI

Pagina 24

N° 268 / Aprile 2018

IVECO / IL GRUPPO TEDESCO VUOLE TESTARE LA TECNOLOCIA LNG NELLA LOGISTICA

Stralis NP convince anche BMW IL COSTRUTTORE TEDESCO HA COMPLETATO UN PROGETTO PILOTA IN COLLABORAZIONE CON

IVECO PER TESTARE I CAMION ALIMENTATI A GAS NATURALE LIQUEFATTO NELLE OPERAZIONI LOGISTICHE, UTILIZZANDO UNO

STRALIS NP 400 PROGETTATO PER I TRASPORTI A LUNGO RAGGIO. IL TEST CONSISTEVA NELL’EFFETTUARE IL TRASPORTO DI MOTORI NEL VIAGGIO DI ANDATA

530 KM DALLA FABBRICA BMW DI STEYR A RATISBONA. E RITORNO DI

S

GUIDO PRINA TORINO

empre più protagonista dell’offensiva metano liquido, Iveco ha concluso un progetto pilota di due settimane in collaborazione con il gruppo BMW per testare un camion a LNG nelle opera-

zioni logistiche del costruttore tedesco. Protagonista uno Stralis NP 400, il primo camion a gas naturale progettato per il trasporto a lungo raggio del settore. Iveco ha da poco presentato un nuovo modello della famiglia, lo Stralis NP 460, dotato di cambio automatizzato di

ultima generazione, concepito per le missioni su lunga distanza più impegnative e già incoronato “Low Carbon Truck of the Year” nel Regno Unito. Disponibile in versione ribassata, si tratta del veicolo ideale per le missioni di trasporto di merci pesanti su lunga distanza.

Il test condotto in collaborazione con BMW ha evidenziato che lo Stralis NP 400 alimentato a gas metano liquefatto è stato in grado di completare con facilità il trasporto di motori nel viaggio di andata e ritorno di 530 km tra Steyr, in Austria, sede di produzione BMW, e Ratisbona,

in Germania, utilizzando il metano liquefatto di un solo serbatoio. Questo carburante alternativo offre la maggiore autonomia nel trasporto di merci pesanti: con la trazione elettrica, ad esempio, il viaggio di 530 km avrebbe richiesto diverse ricariche.

Thomas Irrenhauser, che ha supervisionato la fase pilota per conto di BMW nell’ambito del progetto “Innovazione e Industria 4.0”, ha definito l’LNG “un’alternativa ragionevole e sostenibile al diesel” nel lungo termine. In un confronto tra le due soluzioni, le emissioni di ossidi di azo to sono fino al 60 per cento inferiori, mentre i livelli di rumore durante il funzionamento si riducono fino al 50 per cento. Le emissioni di particolato, poi, sono assolutamente trascurabili. “Siamo molto fieri di come BMW abbia compreso la visione di Iveco per il futuro del settore, nella quale il gas naturale rappresenta il prossimo passo verso la sostenibilità - ha dichiarato Pierre Lahutte, Iveco Brand President - Il numero di costruttori internazionali e operatori logistici che scelgono l’LNG per i propri requisiti di trasporto è in rapido aumento“. “Molti stanno scegliendo Iveco per convertire le proprie flotte all’LNG - continua Lahutte - grazie all’esperienza da noi sviluppata nel corso degli ultimi 20 anni”. L’LNG può consentire un risparmio sul carburante dal 20 al 40 per cento e una riduzione del consumo di quest’ultimo del 15 per cen to rispetto al diesel. Il test di BMW è stato realizzato con la compagnia di spedizioni Spedition Duvenbeck.

Scania implementa il “platooning” a guida semi-automatica con Ahola Transport

Palletways allarga la sua sfera d’influenza

Dalla Finlandia parte la rivoluzione della strada

Collegamento con Malta

S

cania ha annunciato un accordo di partnership con la società finlandese Ahola Transport per l’implementazione di nuove tecnologie di trasporto sulle strade del Nord. Si tratta del primo accordo con clienti in Europa per dare vita a un plotone di veicoli a guida semi-autonoma su strade pubbliche. La partnership si focalizzerà anche sullo sviluppo di nuove tecnologie di trasporto per l’assistenza alla guida. Ahola Transport utilizzerà i veicoli e la tecnologia Scania sulle autostrade finlandesi per testare un plotone a guida semi-autonoma formato da tre o più veicoli connessi. Durante questi test, i conducenti saranno a bordo di tutti i veicoli. A controllare l’intero

plotone però, sarà esclusivamente il conducente del primo veicolo mentre gli altri mezzi saranno a guida autonoma. Al fine di implementare nuove tecnologie di trasporto, è necessario che di pari passo ci sia accettazione pubblica e che vengano fatti passi avanti dal punto di vista della legislazione. Test in situazioni di traffico reali e con condizioni meteorologiche variabili sono quindi di fondamentale importanza. Questo accordo rappresenta un passo avanti determinante per far sì che il platooning a guida semi-autonoma diventi una realtà commercialmente percorribile. Hans Ahola, Ceo di Ahola Transport ha sottolineato: “Per noi è importante migliorare la si-

tuazione lavorativa dei nostri conducenti di veicoli grazie all’utilizzo di nuove tecnologie. Le soluzioni pianificate ci consentono di soddisfare le aspettative del cliente sia nel rispetto degli obiettivi ambientali che per quanto riguarda la richiesta di consegne più rapide. Abbiamo acquistato il nostro primo veicolo Scania nel 1959, da qui è iniziata una collaborazione che siamo felici di incrementare grazie all’implementazione di nuove soluzioni di trasporto”. In combinazione al platooning, le nuo ve funzioni di assistenza alla guida garantiranno consegne puntuali grazie a una pianificazione ottimizzata delle tratte e a una maggiore efficienza del trasporto. Effetti positivi dal punto di vista ambientale sono garantiti sia dall’ottimizzazione dei flussi di traffico che dalla minor resistenza aerodinamica ottenuta grazie al plotone di veicoli che garantisce minori consumi e, di conseguenza, una riduzione delle emissioni di anidride carbonica. “Ahola Transport è un’azienda all’avanguardia che ha scelto la via della digitalizzazione per ottimizzare le operazioni di trasporto e la pianificazione delle rotte - ha evidenziato Anders Dewoon, Director of New Business Solutions di Scania - Con partner come Ahola Transport, abbiamo la possibilità di testare nuove tecnologie che faranno parte di un futuro ecosistema di trasporto per verificarne l’efficacia e la sicurezza”.

P

alletways lungo le rotte del Mediterraneo. La società leader nel trasporto espresso di merce pallettizzata, ha annunciato che estenderà le proprie operazioni anche a Malta tramite MG Logistica Srl, il suo concessionario per la Sicilia Occidentale che garantirà gli alti standard mantenuti dal network. “Il nostro network è dinamico e affronta nuove sfide per garantire servizi sempre migliori - ha detto Albino Quaglia, Presidente di Palletways Italia - Il raggiungimento dell’isola di Malta da parte del nostro concessionario MG Logistica esprime la nostra strategia di espansione in Europa al fine di migliorare sempre di più l’offerta per i nostri clienti. Inoltre, ci permette di rafforzare ulteriormente la posizione di leader poiché nessun altro pallet network può vantare una copertura così ampia e capillare”. MG Logistica garantirà per Malta il servizio Premium con consegne in 5 giorni lavorativi, grazie a partenze settimanali verso l’isola. I ritiri verranno invece gestiti con due partenze settimanali. Il concessionario di Palletways offrirà, inoltre, la gestione delle Accise e delle pratiche doganali anche ai privati. La qualità dei servizi offerti da Palletways già raggiunge 20 Paesi in tutta Europa con più di 400 concessionari e 18 hub, di cui 3 in Italia.


IDLE I M ONDO T R A S P O RT I Mensile di Politica, Economia, Cultura e Tecnica del Trasporto FONDATO E DIRETTO DA PAOLO ALTIERI

VEICOLI COMMERCIALI

FIAT PROFESSIONAL / FULLBACK CROSS E DUCATO 4X4 PER IL FIM MOTOCROSS WORLD CHAMPIONSHIP MXGP

Il richiamo della terra IL BRAND È OFFICIAL SPONSOR, PER IL TERZO ANNO CONSECUTIVO, DELL’AVVINCENTE COMPETIZIONE SU DUE RUOTE CHE È SBARCATA IN

EUROPA DOPO L’ESORDIO IN ARGENTINA. IL CAMPIONE IN CARICA, TONY CAIROLI, È L’AMBASCIATORE DI FIAT PROFESSIONAL: IL NOVE VOLTE CAMPIONE DEL MONDO RAPPRESENTA AL MEGLIO L’AMBIZIONE DI UN COSTRUTTORE IN

F

FABIO BASILICO TORINO

iat Professional torna a “sporcarsi le mani” con le gare in sterrato del motocross e mette in campo nientemeno che due veicoli che all’off-road sono chiaramente votati, Fullback Cross e Ducato 4x4. Il marchio del Gruppo FCA dedicato ai veicoli commerciali è infatti Official Sponsor, per il terzo anno consecutivo, del FIM Motocross World Championship MXGP, sbarcato in Europa dopo l’esordio in Argentina. Il campione in carica, Tony Cairoli, è l’ambasciatore del brand: il nove volte campione del mondo rappresenta al meglio l’ambizione di un costruttore in evoluzione continua. Fullback Cross e Ducato 4x4 sono i “product heroes” della flotta ufficiale del FIM Motocross World Championship MXGP. I veicoli si rivelano perfetti per qualunque attività professionale o del tempo libero. Fullback Cross è robusto, affidabile e vanta grande capacità di carico, una portata di oltre una tonnellata e la massa rimorchiabile che supera le tre tonnellate. Inoltre, grazie alla trazione integrale e al selettore elettronico 4WD, può disimpegnarsi agilmente sui terreni più impervi e affrontare sforzi molto intensi, come quelli di un percorso fuoristrada a pieno carico. Ducato 4x4 è un “all terrain” a trazione integrale di tipo permanente, con due scatole di rinvio e un giunto viscoso centrale a funzionamento automatico. Il dispositivo assicura la giusta ripartizione della coppia motrice tra ruote anteriori e posteriori, ottimizzando la tra zione su fango, neve e sabbia. Ducato 4x4, inoltre, offre tutte le caratteristiche di solidità e performance necessarie per affrontare i percorsi fuoristrada con allestimenti che sfruttano al massimo la portata utile. Fullback Cross e Ducato sono esposti, insieme agli altri veicoli della gamma, sullo stand Fiat Professional allestito all’interno dell’area paddock di ciascuna gara del campiona-

N° 268 / Aprile 2018

EVOLUZIONE CONTINUA.

to MXGP. La partnership tra Fiat Pro fessional e FIM Motocross World Championship MXGP si fonda sulla condivisione di valori autentici quali passione, determinazione e impegno costante: gli stessi ideali espressi da Tony Cairoli che sta affrontando il mondiale di motocross sempre con grande tenacia e coraggio rispecchiando la “challenge attitude” di Fiat Professional. Dopo i grandi successi raggiunti nel 2017, infatti, Fiat Professional si avvia a vivere anche un 2018 denso di evoluzioni e novità che arricchiranno ulteriormente la gamma e che marceranno in parallelo al mondo del motocross e alle diverse tappe del mondiale. Inoltre, per tutti gli appassionati del campionato MXGP, Fiat Professional ha pensato a un’offerta dedicata: tutti coloro che assisteranno a una delle tappe europee del campionato avranno, a fronte dell’acquisto di un nuovo veicolo commerciale della gamma, 5 anni totali di garanzia inclusi. Fullback Cross amplia il raggio d’azione del Fullback introducendo una dimensione più sportiva al pickup di Casa Fiat, all’insegna della

versatilità e della mobilità libera e sicura. Perfetto rappresentante del moderno lifestyle, Fullback Cross si lascia vivere con assoluta nonchalance. Con il suo stile distintivo, Fullback Cross appare subito come la versione di punta del pick-up italiano che completa una gamma capace di rispondere alle attuali tendenze di un mercato cresciuto di oltre 60 punti percentuali in cinque anni e nel quale le versioni leisure rappresentano ben il 25 per cento del segmento. Al generale look sportivo e distintivo concorre l’esclusiva sport bar aerodinamica in nero testurizzato, che si combina ai rinnovati dettagli della griglia anteriore, degli specchi retrovisori, delle maniglie, degli archi passaruota e dei cerchi da 17”, tutti con finitura in nero opaco. Inoltre, spiccano le nuove pedane dal design innovativo rifinite in colore nero. Ricca la dotazione di serie: fari Bi-Xeno, luci di marcia diurna a Led, climatizzatore automatico dualzone, cruise control, sedili e volante in pelle. I sedili anteriori sono riscaldati e quello guidatore è regolabile elettricamente. Il comfort è comple-

tato dal sistema di navigazione con touchscreen da 7”, la radio DAB, il CD/MP3, il Bluetooth e l’USB. Infine, per viaggiare in totale sicurezza, sono di serie sette airbag, compreso quello per le ginocchia del conducente, il controllo elettronico della stabilità, il sistema anti-sbandamento del traino, il sistema di controllo per il mantenimento della corsia di marcia (LDW) e l’assistente di partenza in salita.

Il Fullback Cross non teme le sfide più estreme. In alto, il versatile e dinamico Ducato 4x4 insieme a Tony Cairoli.

Il sistema di trazione è il più completo della categoria e consente di raggiungere qualsiasi meta: Fullback Cross è dotato di ben quattro modalità diverse, oltre al bloccaggio del differenziale posteriore. Basta premere un semplice tasto per passare dalla modalità a due ruote motrici, ideale per limitare i consumi e particolarmente indicata per muoversi su strada pianeggianti e a percorrenza veloce, alla trazione integrale con un differenziale centrale Torsen, per l’utilizzo in off-road o nelle situazioni più impegnative. Inoltre, Fullback Cross offre a chi lo guida la possibilità di utilizzare le marce ridotte e, per i percorsi più estremi, di bloccare meccanicamente il differenziale posteriore. La configurazione a doppia cabina è un concentrato di versatilità e spazio da vivere all’insegna del comfort. È bene tener presente che nonostante le sue dimensioni generose, Fullback Cross è il leader del segmento per agilità: il diametro di sterzata di soli 5,9 metri è il migliore

della categoria. Va anche ricordato che con Fullback Cross è possibile trasportare fino a 1,1 tonnellate di carico e trainare 3.100 kg. Il potente motore turbodiesel in alluminio a fasatura variabile da 2.4 litri eroga 133 kW/180 cv e 430 Nm di coppia a 2500 giri/min. Consumi ed emissioni vengono ottimizzati, mantenendo un’ottimale erogazione di coppia e potenza lungo tutto l’arco di utilizzo. La trazione integrale del Ducato 4x4 è di tipo permanente, con due scatole di rinvio e un giunto viscoso centrale a funzionamento automatico. La catena cinematica è disassata, così da non occupare troppo spazio sotto lo chassis e da non limitare la facilità di allestimento, da sempre una caratteristica chiave di Ducato. La nuova trazione 4x4 è inoltre integrata con i sistemi di sicurezza di Ducato, nello specifico con il controllo elettronico della stabilità ESC. In questo modo, Ducato 4x4 garantisce una tenuta sicura anche in caso di sfruttamento totale del carico. La nuova gamma4x4, che include tutte le varianti del Ducato (non solo furgoni, ma anche cabinati, in tutte le numerose varianti disponibili nella normale gamma 4x2) rappresenta al meglio la capacità di Fiat Professional di intuire, anticipare e soddisfare le nuove esigenze del mercato.

Pagina 25


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

za dinamica in città, forza e potenza per viaggi all’aria aperta e nei lunghi percorsi. E per chi pensa ancora più in grande, Peugeot Rifter si propone in una versione Long (+35 cm) inedita per abitabilità e praticità. INTERNI CURATI E INNOVATIVI

PEUGEOT LANCIA IL SUO NUOVO VEICOLO MULTISPAZIO

Rifter, total control FRUTTO DELL’INEDITA PIATTAFORMA PRODUTTIVA EMP2, NASCE SULLE LINEE DEI SITI IBERICI DI VIGO E MANGUALDE, RAFFORZATI DA GROUPE PSA CON L’AGGIUNTA DI UNA NUOVA SQUADRA. COFANO ALTO, CORTO, ORIZZONTALE, NEL FRONTALE SFOGGIA IL LEONE AL CENTRO DELLA CALANDRA. ALTEZZA DAL SUOLO E GRANDI RUOTE DA SUV, A BORDO È EQUIPAGGIATO CON IL PEUGEOT I-COCKPIT, CHE APRE LE PORTE A UN’ESPERIENZA DI GUIDA INNOVATIVA PER IL SEGMENTO.

F

MAX CAMPANELLA MILANO

orma decisamente innovativa per il nuovo Multispazio Peugeot: si chia ma Rifter, nome con il quale il marchio del Leone intende rompere con il passato (rift in inglese vuol dire esattamente spaccare) ma soprattutto evocare avventura. In linea con lo spirito distintivo degli ultimi modelli, ivi compresi il medio Expert e la sua evoluzione passenger Tra veller, lanciati due anni fa, Rifter vuole proporsi come veicolo adatto alle avventure della vita quotidiana. Lo stile coniuga robustezza e eleganza, espressione di un veicolo votato all’avventura, a suo agio in qualunque ambiente, dalla “giungla urbana” alla natura più autentica. Proseguendo lungo un “fil rouge” che accomuna i modelli più recenti, Rifter è equipaggiato con il Peugeot i-Cockpit, promettendo un’esperienza di guida intensa, inedita nella categoria, in qualunque circostanza. Insomma, siamo davanti a un veicolo nuovo, poliedrico, modulare e pratico, frutto di una nuova piattaforma inedita, lanciata da Groupe PSA per confermarsi come produttore di riferimento nel segmento Multispazio in termini di efficienza, maneggevolezza, comfort e sicurezza. Silhouette dalle proporzioni equilibrate e dinamiche, cofano alto e corto, orizzontale, luce a terra alta e sbalzi ridotti, Rifter è sviluppato sulla base della piattaforma EMP2, la stessa che dà vita ai nuovi Citroën Berlingo e Opel Combo, che prevede propulsori ed equipaggiamenti di assistenza alla guida di ultima generazione e, per coprire tutti i tipi di utilizzo del segmento, la proposta in due lunghezze, ognuna in versione a cinque e sette posti. I tre modelli nascono negli stabilimenti iberici di Vigo, in Spagna, e Mangualde, in Portogallo, nei quali stanno per essere formate rispettivamente una quarta e una terza squadra per soddisfare gli obiettivi commerciali della nuo va offerta. Due

Pagina 26

fabbriche che soddisfano gli standard più elevati in termini di prestazioni, nelle quali Groupe PSA ha apportato profondi cambiamenti: stoccaggio automatico nelle linee di stampa, controllo geometrico della qualità mediante visione artificiale, robot collaborativi, distribuzione tramite veicoli autoguidati: autentiche innovazioni industriali che portano i due siti nell’era della Fabbrica 4.0.

PER CHI CERCA IL MASSIMO

Come per altri modelli, anche per Rifter Peugeot introduce una versione GT Line elegante e dinamica che, in assoluta esclusiva nel segmento, propone dettagli specifici Nero Onyx, come profilo della calandra, scocca dei retrovisori, barre del tetto e inserti nelle modanature laterali. Una versione che rende estremo l’invito del nuovo Multispazio a puntare sulla totale libertà d’azione: lo stile esclusivo è completato da cerchi in lega 17” diamantati Aoraki e da monogrammi GT Line a effetto ramato. Volante in pelle, dettagli della plancia verniciati, rivestimenti in Tessuto Casual e fondo dei contatori con motivo a scacchi caratterizzano l’interno di questa versione.

DESIGN ESTERNO FORTE E COMPATTO

Ogni veicolo si distingue per uno stile, esterno e interno, che lo colloca nell’universo del marchio corrispondente. Nel caso del Rifter, la sua appartenenza alla famiglia Peugeot viene rivelata già nel frontale, moderno e robusto, che sfoggia il Leone al centro della calandra verticale, caratteristica degli ultimi modelli della gamma. Il suo sguardo “felino” si fregia di una firma luminosa a led, al centro dei proiettori. Le barre del tetto fanno parte del design, con un’integrazione curata, e permettono di ancorare saldamente gli oggetti. Le forme arrotondate, in posizione simmetrica nella parte anteriore e posteriore, modellano porte e superfici vetrate, con un design nuovo in questo genere di veicoli. La modanatura in rilievo dei passaruota assegna al veicolo un carattere sportivo, esaltato dai cerchi diamantati da 17 pollici (disponibili su richiesta). La parte posteriore propone un ampio portellone che si apre su un bagagliaio dal volume generoso. Anche in questo caso l’appartenenza alla gamma del Leone è innegabile, con le luci a tre artigli e il paraurti a spigoli nella parte inferiore. Rifter adotta alcune caratteristiche di stile e funzionali proprie dei Suv: maggiore altezza dal suolo, grandi ruote, protezioni dei sottoporta generose, sottoscocca, protezioni passaruota e paraurti, deflettori anteriori e posteriori. Queste caratteristiche contribuiscono ad affermarne la personalità e permettono di esplorare una nuova versatilità: compattez-

Se lo stile esterno sorprende per la personalità forte e moderna, l’interno si caratterizza per un abitacolo assolutamente inaspettato. Anche in questo caso il design conferma l’appartenenza al marchio: il Peugeot iCockpit caratterizza un abitacolo pratico e elegante, armonioso e moderno, che gioca sulle linee, sulla tecnologia tangibile e la qualità delle finiture. Inedito nel segmento, il Peugeot i-Cock pit apre le porte a un’esperienza di guida apprezzata da oltre quattro milioni di professionisti che finora l’hanno scelto su altri modelli del Leone. Nella vita di tutti i giorni offre una guida appagante e immediata: volante compatto, dalle facili presa e manovrabilità; touch screen capacitivo da 8”, a portata di mano e nel campo visivo di chi guida; quadro strumenti con Head up Display, valorizzato da profili cromati e lancette rosse; display a colori che rende più leggibile la strumentazione. Il posto guida, curato nei dettagli, prevede, a portata di mano, eleganti comandi cromati per gestire la climatizzazione posizionati attorno al display, di colore bianco puro, che visualizza le temperature. Il freno di stazionamento elettrico libera spazio sulla console centrale e lascia posto a grandi vani portaoggetti. Unitamente a una posizione di guida alta e a un raggio di sterzata di 10,9 metri, il Peugeot i-Cockpit moltiplica l’agilità del veicolo e garantisce eccellente maneggevolezza, per un reale piacere di guida.

IL NUOVO VEICOLO GIÀ PIACE AI PILOTI PROFESSIONISTI DELLA DAKAR

U

MOTORIZZAZIONI PERFORMANTI ED EFFICIENTI scire dai sentieri battuti ed esplorare nuove strade. È la promessa di Peugeot Rifter che, nato per soddisfare ogni vocazione all’avventura, è equipaggiato di serie con l’Advanced Grip Control, funzione che, abbinata ai pneumatici M+S (Mud & Snow), agisce sullo slittamento delle ruote e aumenta la motricità su fondi scivolosi. È abbinata all’HADC (Hill Assist Descent Control), che mantiene automaticamente la velocità ottimale in presenza di forti pendenze, liberando chi guida da situazioni di difficoltà. In opzione, la gamma Rifter proporrà in futuro una versione quattro ruote motrici sviluppata con la francese Dangel, partner

storico di PSA, che ha già portato sulle strade Peugeot Partner e Traveller e Citroën Berlingo e SpaceTourer in versione Dangel: una trazione integrale caratterizzata da robustezza e resistenza studiate a fondo, con severi test su tutti i fondi stradali e con tutti i tipi di clima, per soddisfare gli utilizzi estremi. “L’avventura è la mia vita e la libertà di movimento il mio bene più prezioso. Il mio quotidiano - afferma Stéphane Peterhansel, pilota professionista, 13 vittorie alla Dakar - è un’esplorazione senza fine di quello che natura e città possono offrire: sci, mountain bike, escursionismo, skateboard, moto d’acqua, auto, moto... Ho avuto la fortuna di provare

Peugeot Rifter: qualità dinamiche, guida precisa e agilità mi hanno impressionato. È nato per accompagnarmi in tutte le circostanze”. Il lavoro eseguito dai progettisti Peugeot sull’architettura del veicolo e l’ottimizzazione della mas sa sono fattori determinanti per proseguire sulla strada della riduzione dei consumi e delle emissioni di CO2. Le motorizzazioni proposte su Rifter soddisfano l’ultima norma Euro 6.2 e sono già predisposte per il futuro ciclo di omologazione WLTP. Il motore 1.2 PureTech Turbo a benzina è declinato in due versioni, entrambe con filtro antiparticolato GPF (Gasoline Particulate Filter): PureTech 130

S&S con cambio automatico a otto rapporti EAT8 (disponibile nel corso del 2019) e PureTech 110 S&S con cambio manuale a cinque rapporti. Il motore 1.5L BlueHDi Diesel è disponibile in tre diversi livelli di potenza: BlueHDi 130 S&S con cambio manuale a sei rapporti o cambio au tomatico a otto rapporti EAT8; BlueHDi 100 con cambio manuale a cinque rapporti; BlueHDi 75, con cambio manuale a cinque rapporti. Le motorizzazioni diesel sono tutte dotate di FAP (filtro antiparticolato) e SCR (riduzione catalitica selettiva), tecnologia che permette di ridurre l’inquinamento già all’avvio del motore, senza necessità di additivo FAP.

N° 268 / Aprile 2018


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

MOTORE A 6 CILINDRI E TRAZIONE INTEGRALE PERMANENTE 4MATIC PER IL PICK-UP

Classe X factor

S

ANTEPRIMA MONDIALE AL RECENTE SALONE DI GINEVRA, LA NUOVA VERSIONE X 350 D 4MATIC PORTA POTENZA E FLESSIBILITÀ NEL MONDO DEI PICK-UP MIDSIZE PREMIUM. LA POTENZA MASSIMA EROGATA È PARI A 190 KW/258 CV PER 550 NM DI COPPIA MASSIMA. IL MODELLO AL VERTICE DELLA GAMMA CLASSE X PASSA DA 0 A 100 KM/H IN 7,9 SECONDI. DI SERIE È EQUIPAGGIATA CON L’AVANZATO CAMBIO AUTOMATICO A 7 RAPPORTI 7G-TRONIC PLUS.

FABIO BASILICO ROMA

i può dare di più. E MercedesBenz Classe X lo dimostra nei fatti, proponendo una novità interessante che ne aumenta l’appeal già ben rappresentato dalla sua anima di muscoloso pick-up midsize premium. Mercedes-Benz Vans ha scelto il prestigioso palcoscenico del Salone di Ginevra per presentare la première mondiale della versione Classe X con motore a sei cilindri e tra zione integrale permanente 4Matic. La X 350 d 4Matic eroga 190 kW/258 cv di potenza massima per 550 Nm di coppia massima. I consumi nel ciclo combinato sono di 9 litri per 100 km e le emissioni di CO2 arrivano a 237 g/km. È il modello al vertice della gamma del pick-up tedesco, un concentrato di potenza in grado di passare da 0 a 100 km/h in 7,9 secondi. Dal canto suo, la trazione integrale permanente assicura elevata stabilità di marcia e dinamicità nelle più differenti condizioni, anche su fondo bagnato e in condizioni invernali. Non è tutto. La X 350 d 4Matic dispone di serie di cambio automatico a 7 rapporti 7GTronic Plus con comandi al volante e funzione Eco start/stop. È parte della dotazione di serie anche l’interruttore per la selezione del programma di marcia Dynamic Select,

con cui è possibile personalizzare l’esperienza di guida. In Europa, la X 350 d 4Matic sarà disponibile a partire dalla metà del 2018 nelle linee di allestimento Progressive e Power. In Italia, verrà offerta a un prezzo d’attacco di 42.983 euro Iva esclusa. Per consentire ai clienti di configurare Classe X in modo ancor più individuale e conforme alle loro esigenze, la Stella ha ulteriormente ampliato la già ricca offerta di accessori. Ulteriori novità sono i cerchi in tre design, la Sport Bar, il Rollcover nero e il Softcover. Le performance di Classe X entusiasmano sui tratti off-road non meno che su strada. Carreggiata lar-

ga, passo lungo e sofisticato assetto comfort con asse anteriore a doppi bracci trasversali, asse posteriore a bracci multipli con elemento rigido e molle elicoidali su entrambi gli assi assicurano valore aggiunto in termini di piacere di guida e dinamica di marcia su strada e mai a discapito delle qualità fuoristradistiche. Il motore diesel sei cilindri da 3 litri, con iniezione diretta common rail e 258 cv di potenza, convince per la sua elevata forza di trazione. La coppia massima di 550 Nm viene sviluppata in un ampio intervallo di regime compreso tra 1.400 a 3.200 giri/min. Conseguentemente, è disponibile una coppia elevata già ai

bassi regimi. Che si prediliga uno stile di guida sportivo, elevato comfort di viaggio sulle lunghe percorrenze o le qualità necessarie per la marcia fuoristrada in condizioni gravose, il motore V6 garantisce sempre una propulsione poderosa ed efficiente. Tra i suoi highlight figurano la struttura leggera, il turbocompressore a gas di scarico a uno stadio con turbina a geometria variabile e l’innovativo rivestimento Nanoslide delle pareti interne dei cilindri, impiegato anche nella Formula 1. Il cambio automatico 7G-Tronic Plus esegue i cambi marcia senza interruzione della forza di trazione, con conseguente miglioramento del

comportamento del veicolo sulle pendenze, in fuoristrada e in caso di traino di un rimorchio. Ulteriori vantaggi dell’automatico a sette rapporti sono la rapidità di innesto e il basso livello di regime. Ciò si ripercuote positivamente soprattutto su efficienza e comfort acustico. I comandi al volante consentono al guidatore di inserire le marce anche manualmente. Una particolare dotazione della nuova versione Classe X è la funzione Dynamic Select che permette di scegliere la caratteristica del comportamento di marcia in base alle proprie preferenze. Prima d’ora un interruttore per la selezione del programma di marcia è stato offerto solo raramente nel segmento pick-up, mentre ora è parte integrante della do tazione standard della X 350 d 4Matic. Il sistema regala piacere di guida personalizzato mediante la selezione di uno dei cinque programmi di marcia disponibili: il range spazia dalla guida all’insegna del relax e del comfort, fino allo stile di guida più sportivo e dinamico. Le variazioni interessano caratteristica del motore, punti di innesto del cambio automatico e funzione ECO start/stop. La trazione integrale permanente 4Matic con rapporto di riduzione “low-range” e bloccaggio del differenziale posteriore, disponibile a richiesta, assicura ottimali performance e trazione ottimale su fondi stradali anche molto diversi tra loro. Dispone di un ripartitore di coppia a due stadi, collegato mediante flangia al cambio principale 7G-Tronic Plus. Presenta un differenziale centrale con struttura a planetari, che distribuisce la forza motrice fra asse anteriore e posteriore con ripartizione della coppia fissa nel rapporto 40/60. Questa configurazione a vantaggio del posteriore assicura maggiori qualità in termini di dinamica di marcia, accelerazioni trasversali più elevate su strada e migliore trazione in accelerazione. La trazione ottimale in ogni condizione fuoristrada è garantita dal bloccaggio del differenziale longitudinale a regolazione continua nel ripartitore di coppia, realizzato come frizione a lamelle elettromeccanica. Questa assicura che l’accoppiamento di forza agisca con la massima efficacia su tutte le quattro ruote anche sui percorsi più impegnativi. È possibile selezionare tre differenti modalità off-road: 4MAT per un comportamento di marcia più dinamico e 4H per maggiore trazione fuoristrada. È poi possibile impostare la modalità 4L (low-range) con una demoltiplicazione di 1:2,9. A richiesta è disponibile il bloccaggio al 100 per cento del differenziale per l’asse posteriore. La combinazione di bloccaggio del differenziale longitudinale regolato (0–100 per cento), bloccaggio del differenziale posteriore e riduttore assicura ottimali performance fuoristradistiche.

MERCEDES-BENZ VANS PARTNER DEL PREMIO VELISTA DELL’ANNO FIV

M

DA VITO A CLASSE X CON IL VENTO IN POPPA

Il possente posto guida della Classe X, dotata della funzione Dynamic Select che permette di scegliere il comportamento di marcia preferito.

Pagina 28

ercedes-Benz Vans ha confermato anche quest’anno lo stretto rapporto con il mondo della vela in occasione della consegna del premio Velista dell’Anno FIV, gli Oscar del la Vela che dal 1991 premiano i migliori ambasciatori di questa passione. Da sempre, infatti, i Vans della Stella rappresentano una scelta di riferimento per chi vive il mare. Dalle banchine delle marine più esclusive ai campi di gara delle competizioni amato-

riali e professionistiche, la famiglia Mercedes-Benz Vans è in grado di offrire una scelta di prodotti che uniscono la versatilità di un van allo stile, il comfort e la sicurezza di un’automobile della Stella. “Il mondo della vela ha sempre rappresentato un territorio particolarmente affine ai nostri van - ha dichiarato Dario Albano, Direttore Mercedes-Benz Vans Italia - Dal Vito alla Classe V, passando per il nuovo pick-up Classe X, la

capacità unica di mettere insieme funzionalità e stile ne ha fatto i compagni di viaggio ideali per la grande crew di appassionati sempre pronti a prendere il largo”. La 24esima edizione del Velista dell’Anno FIV ha incoronato a Roma, nella suggestiva cornice di Villa Miani, Ruggero Tita e Caterina Banti per la vittoria al Campionato Europeo e la medaglia di bronzo ottenuta al Campionato del Mondo nella classe Nacra

17. Claudia Rossi ha invece vinto il premio Armatore Timoniere dell’Anno mentre il TP 52 Azzurra è salito sul gradino più alto del podio nella categoria Barca dell’Anno. Nella categoria Club dell’Anno, premio istituito in collaborazione con la Lega Italiana Vela, il successo è andato al Circolo della Vela Bari. La Giuria del Velista dell’Anno FIV ha assegnato Il Premio Speciale a Patrizio Bertelli, Presidente di Luna Rossa Challenge.

N° 268 / Aprile 2018


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI PROSEGUE L’OFFENSIVA OPEL CON IL NUOVO COMBO LIFE

A chi piace la bella vita VERSIONI A PASSO LUNGO O CORTO, DA 5 O 7 POSTI, CASA

LA QUINTA GENERAZIONE DEL PASSENGER VAN DELLA

TEDESCA È UN MEZZO IDEALE PER LA MOBILITÀ DI TUTTA LA FAMIGLIA O PER GLI SPOSTAMENTI DI GRUPPO IN GITA FUORI PORTA.

L

LE VENDITE INIZIANO IN QUESTA PRIMA PARTE DEL 2018, MENTRE LE CONSEGNE PARTIRANNO DALLA SECONDA METÀ DELL’ANNO.

VALENTINA MASSA RÜSSELSHEIM

e famiglie possono stare tranquille. Ma anche i gruppi riuniti per una scampagnata o una gita avventurosa fuori porta. Alle lo ro esigenze di mobilità ci pensa il rinnovato Opel Combo Life, quinta generazione del passenger van tedesco le cui vendite iniziano in questa prima parte del 2018 mente le consegne partiranno dalla seconda metà dell’anno. Prosegue dunque l’offensiva di pro dotto di Opel, entrata a far parte della galassia del Groupe PSA. Il costruttore di Rüsselsheim lancia sul mercato un vero tuttofare, una vettura familiare spaziosa, estremamente pratica e versatile, e qui paggiata con una o due porte scorrevoli posteriori e disponibile nella versione a pas so corto (4,40 metri) o lun go (4,75 metri) e con cinque o sette posti. I tre sedili posteriori sono tutti dotati di attacchi Isofix per i seggiolini dei bambini e il tetto panoramico a richiesta aggiunge visibilità. TASSELLO FONDAMENTALE

Opel Combo Life è anche dotato di tecnologie e sistemi di assistenza alla guida avanzati come il rilevamento stanchezza Driver Drow siness Alert, l’Allerta incidente con Rilevamento pedoni e Frenata automatica d’emergenza, la telecamera anteriore Opel Eye, già presente su

N° 268 / Aprile 2018

modelli Opel Astra, Corsa e Mokka X, la telecamera posteriore con visione a 180°, l’head-up-display, l’IntelliGrip e di funzioni di com fort come i sedili riscaldabili e il volante riscaldabile in pel le. Il controllo della trazione IntelliGrip, a richiesta, già conosciuto con Opel Grandland X, è un differenziale elettronico anteriore in grado di adattare la distribuzione della coppia alle ruote anteriori, di permettere lo slittamento delle ruote quando è necessario e, in abbinamento al cambio automatico, di ottimizzare i punti di cambiata e la risposta del pedale dell’acceleratore. In questo modo la vettura ha sempre trazione e stabilità, indipendentemente dal fatto che Combo Life viaggi su fango, sabbia, bagnato o neve. “Il nuovo Opel Combo Life rappresenta un tassello fondamentale della nostra offensiva di prodotto ha dichiarato Michael Lohscheller, Ceo di Opel - La nuova vettura sarà sicuramente apprezzata dalle famiglie grazie alla sua versatilità e spaziosità abbinate a un’eccezionale offerta di modernissimi sistemi di assistenza che rendono più sicura la guida e più piacevole ogni viaggio. Si tratta di una vettura con un potenziale enorme, in grado di far crescere ulteriormente il nostro marchio, e ci offre la possibilità di attaccare con rinnovato vigore un segmento importante come quello dei van compatti”. Nel tipico stile Opel, Combo Life offre inoltre sistemi di infotainment

all’avanguardia, compatibili con Apple CarPlay e Android Auto e dotati di schermo touch capacitivo a colori di dimensioni fino a otto pollici. Il divertimento dei viaggiatori viene ulteriormente garantito dalle di verse possibilità di ricarica: le porte USB in prima e seconda fila consentono di ricaricare tablet e smartphone. La presa elettrica da 230V nel vano piedi anteriore consente a un passeggero di alimentare il proprio laptop. Inoltre, gli smartphone compatibili possono essere ricaricati anche in modalità wireless grazie al caricabatterie a induzione posizionato sotto i comandi del climatizzatore. Il bagagliaio della versione cinque posti di lunghezza standard ha un volume minimo di 597 litri. Chi ha bisogno di ancora più spazio può scegliere la versione a passo lungo, con un bagagliaio dal volume minimo di 850 litri. Senza dimenticare che Combo Life può essere anche utilizzato come furgone di piccole dimensioni. Con i sedili posteriori abbattuti, il vano di carico della versione standard raggiunge un volume più che triplo, pari a ben 2.126 litri che diventano 2.693 con la versione più lunga. Gli ingegneri Opel hanno anche pensato al modo migliore per trasportare gli oggetti più lunghi: il sedile anteriore lato passeggero si abbatte a filo con i sedili posteriori, aumentando così la lunghezza del vano di carico in modo da poter trasportare persino tavole da surf. E c’è perfino la giusta solu-

Tutti vogliono salire a bordo del nuovo Combo Life, spazioso e confortevole per viaggi piacevoli e rilassanti.

zione per riuscire a sfruttare lo spazio che talvolta resta inutilizzato tra i bagagli e il tetto grazie alla possibilità di aprire la finestra del portellone. Va anche detto che su entrambe le versioni di Combo Life è possibile adattare la configurazione della seconda fila di sedili alle preferenze personali. I clienti possono scegliere tra il divanetto di serie per la seconda fila, abbattibile asimmetricamente (60/40), o, a partire dal 2019, i tre sedili individuali che possono essere comodamente abbattuti dal bagagliaio. In entrambi i casi, ogni posto è dotato di serie di un attacco Isofix che consente di montare tre seggiolini per bambini uno accanto all’altro, una rarità sul mercato. Inoltre, ogni

Anche dal punto di vista del design, il nuovo Combo Life è assai convincente. Rispetto ai competitor del segmento, lo sbalzo anteriore risulta ridotto e il cofano è più alto. Combo Life ha un aspetto equilibrato, robusto e sicuro: anteriormente mostra la tipica identità Opel con l’alto cofano dotato di due linee nette che vanno dal parabrezza alla griglia e sottolineano la stabilità del veicolo. La par te dominante della

sedile ha un punto di ancoraggio superiore studiato per ridurre il movimento in avanti del seggiolino in caso di urto frontale, riducendo così il rischio di traumi. Quando viene ordinato con il tetto panoramico, Combo Life è dotato di un vano portaoggetti al centro del veicolo con illuminazione Led di serie. In questa configurazione, la vettura è equipaggiata anche con un grande vano portaoggetti da 36 litri montato sopra la cappelliera nel bagagliaio, che consente di sfruttare in modo intelligente una parte dello spa zio normalmente non utilizzata quando non si riempie completamente il bagagliaio, senza bloccare la visuale posteriore dello specchietto retrovisore interno. Questo vano portaoggetti è ideale per riporre vestiti, libri o piccoli giocattoli. Per chi vuole trainare una piccola roulotte (peso rimorchiabile fino a 1.500 kg) c’è a disposizione il gancio di traino fisso o amovibile a richiesta. In questi casi, per assicurare la massima sicurezza durante la guida, Combo Life è dotato di Trailer Stability Control (TSC) di serie, funzione aggiuntiva dello ESP che stabilizza l’oscillazione del rimorchio o rallenta il veicolo secondo necessità. Se questi interventi non sono sufficienti a evitare qualsiasi perico-

vettura è la calandra, dove i fari anteriori con le luci per la marcia diurna con Led e le tipiche alette Opel formano una linea precisa e definita. Gli spessi passaruota collegati dalle soglie laterali evidenziano ulteriormente la solidità di Combo Life che presenta un posteriore estremamente lineare caratterizzato da linee verticali che comunicano l’elevata praticità del veicolo e definiscono il profilo della generosa apertura del vano bagagli. Nell’abitacolo, l’ergonomia ha svolto un ruolo decisivo. Il risultato è un posto guida ben organizzato dove tutti i comandi sono semplici da trovare e a portata di mano. La console centrale è divisa chiaramente in tre aree e nella parte superiore il sistema di infotainment occupa la maggior parte dello spazio. Gli elementi cromati sul volante in pelle, sulle maniglie delle portiere e sulle bocchette di ventilazione aggiungono dettagli di stile e raffinatezza. Sotto il cofano, i clienti di Combo Life troveranno diversi motori turbo benzina e diesel a iniezione diretta. Tutte le unità uniscono piacere di guida e bassi consumi e sono abbinati a cambi manuali a cinque o sei velocità e per la prima volta nel segmento anche a un cambio automatico a otto velocità.

lo, il sistema riduce ulteriormente la coppia del motore e frena il veicolo in modo da abbandonare la velocità critica il più rapidamente possibile. VINCE E CONVINCE

Pagina 29


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI MORINI RENT / VISITA ALLA FILIALE DI MILANO SAN SIRO

Offensiva a tutto campo

D

MAX CAMPANELLA MILANO

DOPO L’INTERVISTA NELLA SEDE DI CORVETTO, SIAMO

opo Milano Corvetto, fa tappa a Milano San Siro il nostro tour alla scoperta del Network Morini Rent, azienda leader nel noleggio di veicoli commerciali. Una Rete sempre più capillare quella dell’azienda fondata a Torino nel 1949 da Emilio Morini e dalla moglie Francesca Girgenti e che oggi, guidata dalla terza generazione nelle persone degli Amministratori delegati Fabio Bigo e Alessandro Morini, sta conoscendo una fase di for te sviluppo: al consolidamento del Network di filiali a livello nazionale, l’azienda affianca una proposta sempre più ricca di veicoli commerciali anche allestiti - in particolare per il trasporto isotermico - per garantire ai professionisti un servizio veloce e con la garanzia di un prezzo senza sorprese, che include praticamente tutto. Esempio della strategia commerciale Morini Rent è la filiale di San Siro: ad accoglierci una comoda rampa che, dall’arteria che taglia in due l’area nord ovest del capoluogo meneghino, conduce direttamente al garage, un piazzale coperto di mille mq che consente il passaggio anche ai mezzi da trasporto a tetto alto. Il back-office, ampio e luminoso, consente cinque postazioni di lavoro. Al nostro arrivo nel garage troviamo un Fiat Ducato con vano refrige-

ANDATI A VISITARE UN ALTRO

“GIOIELLO” DEL FURGONOLEGGIATORE NEL CAPOLUOGO MENEGHINO: EQUIPAGGIATA CON RAMPA DIRETTA PER L’ACCESSO AL GARAGE, È UNA DELLE FILIALI CARATTERIZZATE DA UN’IMPORTANTE PRESENZA DI CLIENTI PROFESSIONALI.

“STIAMO SVILUPPANDO IL NETWORK ALL’INSEGNA DELLA CAPILLARITÀ E RAFFORZANDO LA FLOTTA SOPRATTUTTO DI VEICOLI ALLESTITI”, AFFERMA MARTA

PASSARELLA, FLEET & PURCHASE MANAGER. Morini Rent ha come obiettivo l’apertura di 10 Point all’anno, sviluppando la capillarità della Rete soprattuto al Sud Italia e consolidando e rafforzando le sedi nel Nord.

sta filiale - prosegue Marta Passarella, 36 anni, da due e mezzo in Morini Rent, alla quale porta la sua grande passione per i veicoli professionali, maturata in dieci anni di esperienza nell’area commerciale di PSA - è rappresentato dalle furgonature: andiamo dai classici van come il Ducato furgone passando per i principali allestimenti. Un focus particolare è dedicato ai veicoli refrigerati, per i quali proponiamo la nostra formula di noleggio full service: il servizio Morini include tutte le operazioni di prevenzione, manutenzione e riparazione del veicolo. In questo modo il cliente può concentrarsi sul suo lavoro, senza preoccuparsi dei requisiti di ge-

Il team della filiale Milano San Siro di Morini Rent. Da sinistra: Alessia Moscetti, Gabriele Somma, Gabriele Clary, Cristian Vecchione, Marta Passarella, Fleet & Purchase Manager.

rato - sul punto di essere ritirato da un cliente - e un paio di Peugeot Boxer, entrambi allestiti con gruppi frigo. Eppure siamo in uno dei Morini Point che conta qualcosa come 150 veicoli, un volume d’affari pari alle filiali di Roma Tiburtina e Torino: il resto del parco dov’è? “Per nostra fortuna - risponde Marta Passarella, Fleet & Purchase Manager - i veicoli

Pagina 30

sono tutti fuori a fare il loro lavoro”. Attraverso un software gestionale, sviluppato ad-hoc per Morini Rent, il monitoraggio di tutti i veicoli che sono usciti è immediato e costante: gli operatori controllano quelli che stanno per rientrare nonché eventuali ritardi o posticipi. Com’è costituito il parco di Milano San Siro? “Il core business di que-

N

stione del veicolo”. San Siro è predisposta per il posizionamento del rullo per il lavaggio interno (mancano le ultime autorizzazioni, entro fine anno potrebbe vedere la luce), che viene già effettuato per le normali operazioni di pulizia. La sede è stata aperta nel 2014 in luogo di quella precedente, ubicata presso un ex negozio e priva di garage collegato, ed è parte dello sviluppo della Rete avviato da Morini Rent nel 2017 e che proseguirà quest’anno. “L’offensiva - spiega Passarella passa dal rinnovamento del sistema di Network. Dopo aver chiuso il 2017 con 36 filiali, tra le quali quella nuovissima di Lamezia Terme, quest’an-

no abbiamo già rinnovato la sede di Monza (è stata trasferita in una nuova e più ampia location), Roma Aurelia e Sesto San Giovanni; nuove aperture sono previste in Puglia, a Lecce e Bari. Ad aprile sarà aperta una nuova filiale a Milano in Stazione Centrale. L’obiettivo è aprire 10 Point all’anno, sviluppando la capillarità della Rete soprattutto al Sud Italia e consolidando e rafforzando le sedi nel Nord. Nella seconda metà di quest’anno arriveremo a circa 10-12 nuovi Point. Tutte le nuove sedi hanno le dimensioni giuste per i clienti professionali e, quando possibile come nel caso di Monza, sono dotate di rampa per l’accesso dei furgoni”.

PRENDI IL FURGONE A ROMA E LO RICONSEGNI IN SICILIA

ARRIVA IL SERVIZIO “VIAGGI A LASCIARE”

ell’ambito della forte offensiva avviata da Morini Rent l’anno scorso, in parallelo allo sviluppo del Network un importante investimento è in atto sulla flotta: sempre più ampia, arricchita con nuovi veicoli per rispondere a esigenze sempre nuove, in particolare quelle della clientela professionale. Complessivamente Morini Rent ha iniziato il 2018 con 2.300 veicoli in maggioranza con marchi Fiat e Fiat Professional, a seguire Peugeot e Citroën - che in estate raggiungeranno il picco di 3mila unità. “In media - precisa Marta Passarella - puntiamo ad avere 2.500 veicoli. Il parco di ogni filiale cambia in funzione della tipologia di territorio, in particolare per i furgoni, che rappresentano il 60 per cento della nostra flotta: ogni zona presenta caratteristiche peculiari in termini di

attività predominante nonché per infrastrutture stradali. Ecco perché in ciascuna filiale troveremo tipologie di allestimento anche particolari per tipi di esigenze spe cifiche. La flotta è condivisa sul piano nazionale tra le filiali e quest’anno abbiamo lanciato il servizio “Viaggi a lasciare”: furgoni, anche allestiti, possono essere ritirati presso una filiale e riconsegnati altrove. Siamo solo all’inizio ma entro fine anno il servizio sarà a pieno regime sull’intero territorio nazionale, anche perché viene sempre più richiesto”. Elemento che distingue Morini Rent, la flotta non è di proprietà aziendale: Morini noleggia a lungo termine i veicoli, riuscendo in questo modo a ottenere importanti risultati. “L’acquisizione di veicoli da noleggiatori a lungo termine - spiega la Fleet & Purchase Manager -

ci permette di dedicarci al nostro business: non ci interessa acquistare e rivendere veicoli, ma dare una soluzione al cliente su misura delle sue esigenze. Riusciamo a tenere monitorata la flotta in modo costante, andando a investire e rafforzarla quando e dove occorre. Non da ultimo, offriamo al cliente finale un canone che include tutto, con un pacchetto assicurativo che garantisce assistenza e persino cambio gomme”. Morini Rent ha stretto partnership con i principali noleggiatori a lungo termine, ai quali ordina i veicoli che vengono richiesti dalla sua clientela. “Morini - aggiunge Passarella - identifica marche e tipologie di modelli, occupandosi della successiva trattativa con gli allestitori per il completamento del veicoli: dai ribaltabili trilaterali alle furgonature con o

spenza sponda fino al trasporto isotermico, presso la nostra flotta si trova tutto quello che occorre ai professionisti”. Tra i partner per l’allestimento, per il trasporto refrigerato Morini Rent studia la componente frigo con Lamberet e Carrier, per i cassonati in alluminio con Onnicar. “Presso ogni filiale - afferma in conclusione Passarella - i clienti non trovano al banco venditori, ma consulenti formati e competenti, che hanno l’esperienza per configurare il prodotto e dare a chi noleggia un veicolo il prodotto finito: sia che si tratti di un cliente esigente e che sa in anticipo il veicolo che gli occorre, sia che si tratti di un professionista che non ha dimestichezza con il mondo del trasporto, i consulenti Morini dialogano con il cliente per trovare la soluzione migliore per il suo lavoro”.

N° 268 / Aprile 2018


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

FORD TRANSIT CUSTOM DALLA A ALLA ZETA

Audace quanto basta DAL DESIGN ESTERNO ALLA CABINA, NELLA NUOVA GENERAZIONE IL VEICOLO MEDIO DEL COSTRUTTORE STATUNITENSE È STATO PROFONDAMENTE RINNOVATO IN STILE E FUNZIONALITÀ.

LANCIATO ALL’INIZIO DI QUEST’ANNO, È SBARCATO SULLE STRADE EUROPEE PROPONENDOSI CON NUOVE

R

SOLUZIONI E CARATTERISTICHE CHE LO DISTINGUONO.

FABIO BASILICO MAX CAMPANELLA MONZA

innovata nello stile e nella funzionalità, con un design più audace e nuovi interni della cabina, all’inizio di quest’anno è sbarcata sul mercato italiano la nuova generazione del Ford Transit Custom, veicolo commerciale medio della famiglia Transit. Vediamolo nei dettagli.

A COME AUDACE. Sia nel design esterno sia nella cabina, Ford Transit Custom si presenta con caratteristiche che lo distinguono, in termini di design e funzionalità: la griglia anteriore a tre barre ricorda che si tratta di un Transit, a bordo troviamo sistemi di connettività e tanto spazio inattesi per un veicolo professionale.

B COME BASSA. Bassa resistenza al rotolamento è tutt’altro che poca cosa quando si tratta di pneumatici per veicoli professionali: nel modello ECOnetic del Transit Custom passo corto essi contribuiscono in maniera decisiva a ridurre consumi e emissioni, unitamente

al motore da 105 cavalli, allo Start&Stop e al limitatore di velocità a 100 km/h.

C

COME C USTOM . Introdotto a fine 2012, dal 2015 è il veicolo da una tonnellata più venduto in Europa. Successo che riscontra anche nel nostro Paese: nel sotto segmento N1 dei veicoli medi immatricolati per trasporto merci, nel 2017 Ford è in cima alla classifica con uno share del 20,7 per cento.

D COME DOCKING STATION. Ideale per metterci smartphone (e tenerlo sotto carica), navigatore o altri dispositivi, la docking station MyFord Dock a bordo di Ford Transit Custom completa l’equipaggiamento.

E COME ECOBLUE. Nella versione 2.0, l’innovativo propulsore Ford assegna a Transit Custom nuove funzionalità, con l’obiettivo di migliorare l’efficienza nei consumi. Introdotto sull’intera gamma nel 2016, è disponibile con potenze da 105, 130 e 170 cv. F

FORD FAMILY. È stato il primo veicolo commerciale del COME

rinnovato line-up Transit a debuttare sul mercato, seguito dai “fratelli minori” Courier e Connect e infine dal furgone grande Transit.

G COME GIRI. Rispetto alla prece-

dente generazione, le potenze della famiglia di motori Ford EcoBlue si dimostrano nettamente superiori: la coppia è aumentata del 20 per cento a 1.250 giri.

H

H IGH LOAD CAPACITY. Nella nuova generazione Transit Custom conferma l’alta reputazione del modello nell’offrire massima capacità di carico: si arriva fino a 1.450 kg. COME

I COME ISA. Al debutto su un veicolo commerciale, il sistema ISA (Intelligent Speed Assist) rende Ford Transit Custom decisamente funzionale: per la prima volta nel segmento il veicolo previene il superamento dei limiti di velocità, a tutto vantaggio del portafoglio e

dei punti sulla patente.

L COME LUNGHEZZE. È possibile scegliere tra versioni a passo corto e passo lungo e due opzioni di altezza per il tetto, modulabili nel range da 2,6 a 3,4 t di massa complessiva. Tra i diversi stili di carrozzeria Van, Combi e modelli a doppia cabina.

M COME MATERIALI. Piacevoli e resistenti i materiali scelti dai progettisti Ford per la cabina, che si presenta inaspettatamente larga, ampiezza accentuata dagli elementi di design orizzontali del pannello strumenti.

N COME NOTORIETÀ. All’interno della variegata e completa famiglia Transit, Custom rappresenta un indubbio valore aggiunto. Il modello è stato fin dall’inizio un vero e proprio successo e la sua notorietà presso gli utilizzatori professionali è cresciuta negli anni.

O COME O TOSAN . Nell’estate 2017 Ford ha annunciato l’aumento della capacità produttiva per i modelli Transit, Transit Custom e Tourneo Custom, per soddisfare la crescente domanda dei clienti. La joint venture Ford Otosan ha investito 52 milioni di dollari nello stabilimento di Kocaeli, in Turchia, per ampliare la produzione a 330mila veicoli l’anno. P

COME PRE-COLLISION ASSIST. Funzionalità avanzate sono offerte al sistema di frenata d’emergenza con riconoscimento dei pedoni – Pre-Collision Assist con Pedestrian Detection – introdotto dal 2016. Dotato delle più recenti tecnologie radar e telecamere montate sulla nuova Fiesta, è in grado di rilevare i pedoni anche di notte.

N° 268 / Aprile 2018

Van medio da 1 tonnellata, Transit Custom è apprezzato membro della rinnovata e popolare famiglia Transit.

Q COME QUALITÀ. Nel proporre sul mercato il rinnovato Transit Custom, Ford ha puntato tutto su qualità del progetto e valorizzazione delle caratteristiche che fin dall’inizio hanno reso il suo veicolo

medio un modello specifico e ben delineato all’interno dell’offerta Transit.

R COME R IFORNIMENTO . Devi fare gasolio? Ci pensa SYNC 3, il sistema di connettività Ford che durante la guida utilizza comandi vocali semplici e colloquiali. Spingendo un tasto e pronunciando la giusta richiesta è possibile individuare e raggiungere la stazione di servizio più vicina.

S COME STILE. Ford Transit Custom si presenta con lo stesso design accattivante del frontale tipico delle vetture Ford di ultima generazione, con le quali condivide lo stesso Dna, come l’alta griglia trapezoidale e i fari dinamici e sottili. T COME TOUCH-SCREEN. Negli al-

lestimenti più completi, Transit Custom porta ai massimi livelli ergonomia e praticità grazie alla presenza di un nuovo touch-screen da 8 pollici, più veloce e reattivo, con funzione pinch & swipe, per un uso ancora più semplice del SYNC 3.

U C OME U S ER - C EN TR I C O . Il nuovo pannello strumenti si presenta molto intuitivo, con layout semplice e user-centrico, studiato per essere altamente funzionale, partendo dall’osservazione delle modalità di interazione dei consumatori con smartphone e tablet.

V COME V ERSIONE S PORT. La nuova gamma Transit Custom è guidata dalla dinamica versione Sport da 170 cv, disponibile in un’ampia scelta di ben otto diverse opzioni di carrozzeria esterna e posti a sedere.

Z COME ZERO EMISSIONI. Transit Custom definisce lo scenario per l’introduzione di una novità che ha l’ambizione di diventare protagonista della mobilità eco-sostenibile: la versione Plug-in Hybrid (PHEV), a zero emissioni, prevista per il 2019. Pagina 31


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

CITROËN / TERZA GENERAZIONE BERLINGO, SI RINNOVA IL CREATORE DEI MULTISPAZIO

L’arte della perseveranza PARTNER DEL TEMPO LIBERO E DELLA FAMIGLIA, IL NUOVO BERLINGO IN CONFIGURAZIONE VETTURA EREDITA LE CARATTERISTICHE DEGLI ULTIMI MODELLI DEL

DOUBLE CHEVRON. IL DESIGN E IL COMFORT LO RENDONO PIÙ MODERNO, RAFFORZANDO LA SPENSIERATEZZA E LA PRATICITÀ CHE HANNO DECRETATO IL SUCCESSO DI UN MODELLO DAVVERO ICONICO.

UTILIZZA UNA

NUOVA PIATTAFORMA E PROPONE 19 TECNOLOGIE DI AIUTO ALLA GUIDA,

4

TECNOLOGIE DI CONNETTIVITÀ, MOTORI DI ULTIMA GENERAZIONE, E IL

N

GIANCARLO TOSCANO MILANO

CAMBIO AUTOMATICO

on avrebbe bisogno di presentazioni, vista la fama che lo circonda dal 1996, l’anno in cui debuttò dando vita al segmento dei veicoli multispazio. Berlingo incarna alla perfezione l’identità Citroën nel mondo dei vei coli commerciali e la terza generazione, presentata in anteprima mondiale in configurazione vettura al Salone dell’Automobile di Ginevra e pro grammata per essere commercializzata nel secondo semestre del 2018, ha tutte le carte in regola per scrivere un’altra pagina in una storia di successo che dura da oltre venti anni. Partner del tempo libero e della famiglia, il nuovo Berlingo, prodotto nel sito spagnola di Groupe PSA a Vigo, eredita le caratteristiche degli ultimi modelli del Double Chevron. Il design e il comfort lo rendono più

moderno, rafforzando nel contempo la spensieratezza e la praticità che hanno decretato il successo di un modello davvero iconico, venduto in oltre 1,7 milioni di esemplari in versione vettura. Con la nuova versione, disponibile in due misure M e XL da 4,40 m e 4,75 m, 5 o 7 posti, Berlingo cambia ancora una volta per ribadire un concept vincente adeguato però a un mercato in continua evoluzione. Elemento di spicco nel segmento, Berlingo ha del resto saputo rinnovarsi nel tempo e differenziarsi restando il riferimento in termini di versatilità e praticità, ad esempio con l’introduzione dei 3 sedili posteriori indipendenti, del tetto multifunzione Modutop o del lunotto posteriore apribile. Non a caso dunque il 2017 è stato l’anno di maggior produzione di Berlingo autovettura e veicolo commerciale di seconda ge nerazione (lanciato nel 2008) con oltre 165.000 uni tà. Berlingo, modello

EAT8.

Disponibile in due misure, Citroën Berlingo cambia ancora una volta per ribadire un concept vincente.

FRUTTO DI UNA LUNGA TRADIZIONE INIZIATA NEL 1950 CON LA LEGGENDARIA 2 CV IN VERSIONE VAN

C

LA GRANDE EREDITÀ DEL BERLINGO CHE ORA PUNTA SUL MODELLO ELETTRICO

itroën Berlingo è frutto di una lunga tradizione nata nel 1950 con la leggendaria 2 CV in versione van, furgoncino compatto con trazione anteriore con tutti i vantaggi di un modello pratico ed economico. Passerà alla storia proprio come il primo furgoncino a trazione anteriore prodotto in serie. In realtà, già alla nascita del marchio Citroën agli inizi degli anni ’20 André Citroën intuisce l’importanza di offrire una vasta gamma di veicoli, da quelli commerciali veri e propri fino alle berline di lusso. La seconda metà del secolo gli dà ragione. Prodotto dal marzo 1951 al marzo 1978 in 1.246.335 e semplari, la 2 CV van é diven-

Pagina 32

tata un modello di culto di cui si intuiscono le potenzialità. Dalla metà degli anni ’50, infatti, sono molti i fornitori che propongono accessori per trasformare 2 CV furgoncino in quello che possiamo definire un precursore del ludospace. Nel 1978 l’Acadiane prende il posto di 2 CV Furgoncino. In sintesi, è lo stesso modello ma con il frontale di Dyane. Prodotta per nove anni, è la prima a proporre una versione GPL, poco prima della fine della produzione nel 1987. Ne verranno prodotti in tutto 235.393 esemplari. In Italia verrà proposta una versione “Oasi”, praticamente un camper. E dopo i piccoli motori bicilindrici su 2 CV e Acadiane, il

nuovo modello lanciato nel 1984, C15, prevede un motore a quattro cilindri raffreddato ad acqua. Nato da Visa del 1978, C15 sarà prodotto per molto tempo, ovvero fino al 2006, circa dieci anni dopo il lancio di Berlingo. Robustezza e solidità ne faranno un leader del segmento, come l’offerta di una motorizzazione diesel che contribuirà ad aumentare le vendite. C15 è stato prodotto in 1.181.471 esemplari in 22 anni. Su C 15 sarà anche sperimentato l’elettrico, con un primo modello presentato a luglio 1987, seguito da una versione di serie nell’ottobre 1990, poi prodotta in una sessantina di esemplari circa. Dal 1996, C15 sarà an-

che disponibile con doppia alimentazione NGV. Il GPL sarà in opzione. Il 1996 è l’anno della prima generazione Berlingo che mette in discussione ancora una vol ta i codici automobilistici proponendo innumerevoli innovazioni. La principale novità è che per la prima volta il modello non deriva da una berlina ma è assolutamente nuovo. A metà strada tra la berlina e il monovolume, è un modello decisamente sfaccettato. Berlingo “Multispace”, una versione pensata per le famiglie e il tempo libero, diventa subito un grande successo commerciale, ideale per chi vuole un veicolo più spazioso e modulabile di una berlina ma meno di una

monovolume. Nasce un nuovo segmento di mercato: il ludospace. Berlingo prima generazione viene ancora prodotto per alcuni mercati (Argentina, Brasile). Gli esemplari già fabbricati sono 1.200.000. Come C 15, Berlingo è disponibile in diverse versioni: GNV, GPL, Elettrico, 4x4. Nel 2002, Berlingo è sottoposto a un profondo restyling che interessa anche il frontale e la plancia e nel 2003 il modello XTR propone une versione fuoristrada. Al 2008 risale la presentazione del Berlingo seconda generazione che propone equipaggiamenti innovativi, tra cui tre sedili posteriori indipendenti, un lunotto posteriore apribi-

le e un nuovo Modutop. Nel 2009 esce una versione Grip Control con un sistema che garantisce migliore trazione in tutte le condizioni, seguita dal Berlingo elettrico nel 2013. Il restyling della seconda generazione viene proposto nella primavera 2015 al Salone di Ginevra mentre nel marzo 2017, dopo più di 2,9 milioni di esemplari prodotti dal lancio della prima generazione nel 1996, la gamma Berlingo cresce ancora con E-Berlingo Multispace, una versione elettrica di Berlingo Multispace che completa l’offerta Citroën composta da C-Zero, E- MEHARI ed E-Berlingo Electric in versione veicolo commerciale.

N° 268 / Aprile 2018


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

19 FUNZIONI DI AIUTO ALLA GUIDA

COLOR HEAD UP DISPLAY: informazioni utili alla guida direttamente nel campo visivo del conducente.

AVVISO DI SUPERAMENTO INVOLONTARIO DELLA LINEA DI CARREGGIATA: rileva il superamento involontario delle linee di delimitazione continue o tratteggiate grazie a una telecamera.

DRIVER ATTENTION ALERT: avviso di calo di attenzione del driver. COFFEE BREAK ALERT: avviso per il conducente della necessità di una pausa.

RICONOSCIMENTO DEI CARTELLI STRADALI E DEI LIMITI DI VELOCITÀ: il sistema rileva e legge automaticamente alcuni cartelli stradali, come l’inizio/fine dei limiti di velocità.

REGOLATORE DI VELOCITÀ ADATTATIVO CON FUNZIONE STOP (SULL’EAT8): il sistema permette 2 funzioni, mantenimento automatico della velocità del veicolo al valore programmato dal conducente e regolazione automatica della distanza con il veicolo che precede. SISTEMA DI SORVEGLIANZA DELL’ANGOLO MORTO: avviso di presenza di un veicolo nell’angolo morto. ACTIVE SAFETY BRAKE: sistema di frenata d’emergenza.

POST COLLISION SAFETY BRAKE: il sistema aziona i freni quando l’incidente è già avvenuto, per limitarne i danni. FUNZIONE FARI SMART BEAM: durante la guida di notte, il sistema commuta automaticamente gli abbaglianti in anabbaglianti.

Il Modutop di nuova generazione offre 92 litri di spazio e un allestimento che comprende un vano nel tetto e un arco translucido diviso in scomparti.

Citroën più venduto in quasi 17 Paesi nel 2017, resta oggi il modello Citroën più venduto dopo C3. In Europa, è il secondo Multispazio più venduto, sempre sul podio del segmento veicoli commerciali leggeri. Dall’esordio nel 1996 gli esemplari totali (vettura e van) del Berlingo prodotti sono stati oltre 3,3 milioni. Citroën ha scelto di apportare modifiche sostanziali al suo nuovo modello, che si distingue per la silhouette e per il look unico, il design robusto e le linee fluide. Berlingo nasce dal lavoro del team Stile Citroën, diretto da Alexandre Malval, che ha studiato una nuova generazione dal design espressivo, con quel tocco di audacia che caratterizza il marchio Citroën. Il frontale si distingue per caratteristiche di stile forti, che derivano dall’adozione per la parte anteriore della piattaforma EMP2 e dagli sbalzi accorciati. Il cofano, più alto e corto, domina la strada su un frontale identitario che integra la firma luminosa su due livelli, tipica del brand, e parabrezza spostato in avanti e più generoso in quanto a spazio e luminosità. Anche la scoc ca è più alta e le ampie superfici vetrate laterali presentano un profilo smussato. La silhouette è sormontata da barre al

N° 268 / Aprile 2018

tetto longitudinali (a seconda delle versioni) ed è completata dai celebri Airbump situati alla base delle portiere. I fanali posteriori sono posizionati in verticale e incorniciano il portellone, che propone un lunotto posteriore apribile oscurato che so-

FUNZIONE CORNERING LIGHT: sistema che agisce in fun-

vrasta il logo e gli chevron. Totalmente rinnovato, l’abitacolo segna un salto generazionale di rilievo per qualità della finitura. Berlingo si distingue per la plancia minimal e spaziosa e per la posizione di guida rialzata. La plancia dal design

La plancia dal design a sviluppo orizzontale è ergonomica. Sopra, i comodi sedili posteriori, facilmente accessibili.

zione dell’angolo di sterzata e sotto i 40 km/h. Oltre al flusso luminoso principale del proiettore, si accende anche il faro fendinebbia destro o sinistro, per illuminare fino a 75° l’angolo destro o sinistro del veicolo.

KEYLESS ACCESS&START: il sistema permette di aprire, chiudere e avviare il veicolo senza dover estrarre la chiave.

HILL ASSIST: facilita la partenza in pendenza impedendo all’auto di muoversi quando si rilascia il pedale del freno.

FLANKGUARD: il sistema informa di eventuali ostacoli situati vicino alle fiancate del veicolo durante la manovra.

TELECAMERA DI RETROMARCIA CON TOP REAR VISION: sistema che permette di vedere sul touch screen la parte circostante del veicolo con una telecamera panoramica a 180°. È completato dall’assistenza al parcheggio. CONTROLLO DELLA STABILITÀ DEL RIMORCHIO: funzione supplementare dell’ESP per i veicoli equipaggiati di un gancio traino. FRENO DI STAZIONAMENTO ELETTRICO: inserimento automatico del freno di stazionamento quando si spegne il motore, il disinserimento automatico quando il veicolo si muove o manuale tirando la levetta di comando.

GRIP CONTROL CON HILL ASSIST DESCENT: dispositivo di motricità per qualunque condizione, adatta la motricità delle ruote anteriori in funzione del terreno. La funzione Hill Assist Descent aiuta a mantenere il veicolo a velocità ridotta anche su forti pendenze. PARK ASSIST: aiuto attivo al parcheggio, a pettine o in parallelo al marciapiede.

a sviluppo orizzontale è più ergonomica, con accesso diretto ai comandi della climatizzazione, e lascia spazio a diversi vani portaoggetti. È possibile scegliere tra diversi ambienti interni per una combinazione sempre valorizzante.

Per la prima volta nella sua storia, il multispazio francese propone ai suoi clienti due silhouette: la versione M misura 2 cm in più della precedente generazione, per 4,40 m di lunghezza totali e 2,78 m di passo. La nuova versione allungata, la XL, è 35 cm in più, per 4,75 m di lunghezza totale e passo di 2,97 m. La larghezza in entrambi i casi è pari a 1,85 m e l’altezza a 1,84 m con barre al tetto. Il nuovo Berlingo è in grado di trasportare 5 o 7 passeggeri indipendentemente dalla versione. La versatilità è da sempre una dote innata del Berlingo, che ora adotta il programma Citroën Advanced Comfort anche per quanto riguarda il benessere delle sedute. L’abitabilità e la modularità sono tra le principali ragioni d’acquisto dei multispazio e Berlingo fa di tutto per confermare l’assunto. A cominciare dall’accessibilità di prim’ordine per i passeggeri, grazie alle due ampie porte laterali scorrevoli e funzionali, dotate di vetri elettrici. Nuovo Berlingo offre anche un ampio por tellone posteriore, che si apre su un

bagagliaio generoso: la capacità di carico arriva a 775 litri in versione M, 100 litri in più rispetto all’attuale generazione in configurazione 5 posti, e 1.050 litri in versione XL, sempre in configurazione 5 posti. L’accesso al bagagliaio è facilitato grazie al lunotto posteriore apribile e oscurato, dotato di un’inedita tendina copribagagli a scomparsa a 2 posizioni, molto utile nelle fasi di carico o scarico. Abitabilità e modularità sono parole chiave. I tre sedili posteriori singoli della seconda fila sono della stessa misura. A scomparsa nel bagagliaio permettono di ottenere un pianale piatto in modo molto semplice grazie ai comandi Magic Flat disponibili da primavera 2019. Nella fila 3 ci sono inoltre 2 sedili estraibili, che nella versione M non sono regolabili longitudinalmente mentre per la versione XL sono montati su binari. A bordo Berlingo propone ben 28 vani portaoggetti e il nuovo tetto vetrato panoramico multifunzione riprende il meglio delle generazioni precedenti e propone ancora più spazio. Il Modutop di nuova generazione offre 92 litri di spazio di contenimento, grazie a un allestimento intelligente che comprende: un vano nel tetto, a cui si accede dai posti posteriori (fila 2) o dal bagagliaio (lunotto posteriore apribile), un arco translucido diviso in scomparti che corre sull’intera lunghezza e permette di vedere gli oggetti che contiene e di usare uno spazio che si riteneva inutilizzabile, un contenitore sopra alla prima fila. Berlingo è moderno anche per l’offerta di quattro tecnologie di connettività e di infotainment. Lo scopo è garantire la continuità tra il mondo digitale del cliente e la sua auto, per restare sempre connesso. Infine, nuovo Citroën Berlingo adotta motorizzazioni di ultima generazione efficaci per consumi ed emissioni di CO2. Vengono proposti motori benzina e diesel e anche un prestazionale cambio automatico a 8 rapporti EAT8. La gamma benzina 1.2 PureTech è costituita dall’unità PureTech 110 S&S e PureTech 130 S&S EAT8 (disponibile dal secondo semestre 2019). La gamma diesel 1.5 BlueHDi è formata da BlueHDi 75, BlueHDi 100, BlueHDi 100 S&S e BlueHDi 130 S&S, disponibile anche con cambio automatico EAT8.

Pagina 33


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI RENAULT AMPLIA LA GAMMA GREEN CON IL NUOVO MASTER Z.E.

Anche il furgone diventa elettrico

STRUMENTO DI LAVORO IDEALE PER ASSICURARE UN ACCESSO SENZA FRENI NEI CENTRI CITTÀ, IL NUOVO MASTER Z.E. BATTERIA DI NUOVA GENERAZIONE AGLI IONI DI LITIO, MOTORE AD ALTA EFFICIENZA ENERGETICA, POTENZA MASSIMA DI 76 CV E AUTONOMIA REALE DI 120 KM: IL GRANDE FURGONE ZERO EMISSION SFRUTTA AL MEGLIO L’ESPERIENZA DEL COSTRUTTORE.

C

FABIO BASILICO LISBONA

resce la gamma Z.E. di Renault e “invade” altri settori decisivi del mercato. Protagonista della nuova offensiva il Master Z.E., grande furgone elettrico proposto anche in configurazione pianale cabinato e già commercializzato in Italia con un prezzo di listino che parte da 58.400 euro. Siamo andati a provarlo a Lisbona, dove Renault ne ha organizzato la presentazione internazionale. Strumento di lavoro ideale per assicurare un accesso senza emissioni e senza limiti nei centri città, Master Z.E. si dimostra particolarmente adatto alle consegne green dell’ultimo miglio. Il modello beneficia della competenza di Renault, leader europeo del veicolo elettrico; i suoi punti di forza sono notevoli: batteria agli ioni di litio di nuova generazione, motore ad alta efficienza energetica da 76 cv, autonomia reale di 120 km e tempi di ricarica adeguati alle esigenze degli operatori professionali delle consegne (ricarica al 100 per cento in 6 ore).

N

Senza contare che Master Z.E. propone tutte le soluzioni su misura di Renault Pro+, brand leader europeo dei furgoni e delle furgonette che assicura un servizio completo di vendita e post-vendita. Con un’importante novità: nell’ambito della proposta di servizi connessi Renault Easy Connect viene lanciata la nuova soluzione Easy Connect for Fleet, un ecosistema di servizi connessi per o peratori professionali, teso a facilitare la gestione di una flotta di veicoli e ridurne i costi di utilizzo. VINCENTE ANCHE IN SALITA

Elevata manovrabilità, bril lantezza e una guidabilità moderna e confortevole: sono queste le caratteristiche che ci hanno favorevolmente impressionato durante il test drive condotto in ambito urbano ed extraurbano a Lisbona e nei dintorni, su strade urbane e su tratti a più veloce scorrimento, lungo percorsi pianeggianti e collinari, dove Master Z.E. ha dimostrato di essere un Ma-

ster a tutti gli effetti affrontando con totale sicurezza anche le salite più impegnative. Merito di un concept riuscito che prevede una batteria di nuova generazione agli ioni di litio “Z.E. 33” da 33 kWh, dotata di una gestione elettronica ottimizzata. Frutto della competenza di Renault e LG Chem, la batteria - di proprietà ottimizza la densità energetica non con l’aggiunta di moduli supplementari ma grazie al miglioramento della chimica delle celle. Master Z.E. è anche dotato di un motore elettrico R75 a elevata efficienza energetica, ereditato dalla Zoe e comprovato su Kangoo Z.E., con una potenza di 57 kW/76 cv. La velocità massima di 100 km/h è più che adatta per un utilizzo che si spinge fino alle aree ex traurbane. Inoltre, attivando la modalità Eco, le performance del motore vengono limitate, consentendo di prolungare il funzionamento del furgone (accelerazioni ridotte e velocità massima limitata a 80 km/h). Il motore è prodotto nel sito Renault di Cléon, in Francia, fiore all’occhiello del Gruppo per la produ-

Carta d’identità

Nome: Master Z.E. Cognome: Renault Motore: sincrono con rotore a bobina. Potenza max: 57 kW/ 76 cv. Coppia max: 225 Nm. Tipo di propulsione: trazione anteriore. Velocità max: 100 km/h. Scatola del cambio: riduttore, 1 rapporto in avanti. Batteria: ioni di litio; massa: 255 kg; capacità: 33 kWh; struttura: 48 moduli /192 celle; tensione: 400 V. Ricarica: tempistica: wall box/colonnina 7,4 kW: 6 ore; wall box/colonnina 3,7 kW: 11 ore; presa domestica 2,3 kW: 17 ore. Dimensioni Furgone (mm): lunghezza: 5.048 (L1), 5.548 (L2), 6.198 (L3); altezza: 2.307 (H1), 2.500 (H2); larghezza: 2.070. Dimensioni Pianale cabinato (mm): lunghezza 5.530 (L2), 6.180 (L3); larghezza: 2.070. Autonomia: 200 km; autonomia reale: 120 km (furgone); secondo allestimento (pianale). Emissioni CO2 (g/km): 0. Carico volume: 8-13 mc (furgone); secondo allestimento (pianale). Carico utile: 975-1.128 kg (furgone); 1.377 kg senza trasformazione (pianale L2), 1.355 kg senza trasformazione (pianale L3). Pneumatici: Continental Vanco Eco 215/65 R16C; classe energetica: B; aderenza: B; rumorosità: 71 dB. Listino prezzi Furgone (Euro): 60.600 (L1H1), 61.300 (L1H2), 62.200 (L2H2), 62.700 (L3H2). Listino prezzi Pianale cabinato (Euro): 58.400 (L2), 59.100 (L3). Produzione: Batilly (Francia).

zione di motori e trasmissioni a elevato valore aggiunto. L’elettrificazione è a carico della società francese PVI, Power Vehicle Innovation, acquisita dal Gruppo Renault. Master Z.E. prende forma nel sito francese di Batilly, lo stesso dove nascono ben quattro veicoli dei brand Renault, Renault Trucks, Nissan e Opel, tra cui l’inossidabile Master, riferimento nel suo segmento e adottato da oltre 475.000 clienti in Europa dal lancio, alla fine del 2010. Master è numero 3 in Europa, con un record storico di vendite per il terzo anno consecutivo: 97.000 unità nel mondo nel 2017. TUTTA SUA LA CITTÀ

Partner ideale degli operatori professionali in ambito urbano, Master Z.E. agevola il loro lavoro con dispositivo speciale come lo specchio Wide View antiangolo morto, la retrocamera con schermo integrato nel retrovisore interno e il radar di retromarcia. In cabina, driver e passeggeri dei sedili anteriori hanno a disposizione un pratico spazio di lavoro con tavolino girevole e portadocumenti integrato nella plancia oltreché numerosi vani portaoggetti ergonomici. Viene fornito anche il centro multimediale connesso con il sistema R-LINK Evolution: Tom-Tom Traffic a comando vocale, gestione dell’autonomia, navigatore per organizzare i percorsi, localizzazione dei punti di carico con Z.E. Trip, e altro ancora. Master Z.E. propone una gamma di 6 versioni derivanti dalla combinazione di 3 lunghezze e 2 altezze. Le 4 versioni Furgone pro-

pongono un volume utile compreso tra 8 e 13 mc e un carico utile da 1 a 1,1 t. La soglia di carico si colloca tra le più basse del segmento (da 54 a 56 cm) e le porte con apertura a 270° facilitano le operazioni di carico e scarico. Le 2 versioni Pianale cabinato sono disponibili in lunghezze L2 (5.530 mm) e L3 (6.180). Il carico utile, rispettivamente di 1.370 kg e 1.350 kg, le trasforma in supporti ideali per allestimenti in carrozzeria Gran Volume, per un carico fino a 22 mc. Alla fine del 2017, la rete specializzata Renault Pro+ comprendeva 650 concessionarie in 40 Paesi (38 in Italia). E corrisponde anche a una rete di 400 carrozzieri autorizzati, in 29 Paesi, in grado di proporre allestimenti di veicoli commerciali in linea con le specifiche esigenze di ciascun cliente professionale. L’ambizione del Gruppo Renault è aumentare le vendite di veicoli commerciali oltre il 40 per cento entro la fine del nuovo piano strategico “Drive the future” (2017-2022) ma anche raddoppiare la copertura del mercato e conservare la leadership nei van elettrici, elettrificando tutta la proposta di furgonette e furgoni. L’Alleanza Renault-Nissan-Mitsubishi ha inoltre l’obiettivo di diventare leader mondiale del van, con oltre 2,5 milioni di unità vendute entro la fine del piano. Intanto, nel 2017, il Gruppo Renault ha venduto nel mondo 463mila veicoli commerciali, il 4,1 per cento in più del 2016. Renault si è confermata per la quinta volta leader del veicolo elettrico in Europa, con una quota di mercato del 30,2 per cento nel 2017 e circa un veicolo venduto su quattro.

EASY CONNECT FOR FLEET DISPONIBILE DA METÀ 2018

L’ECOSISTEMA CHE GESTISCE IN MODO OTTIMALE LE FLOTTE

ell’ambito della proposta di servizi connessi Renault Easy Connect, Renault Pro+ lancia la nuova soluzione Renault Easy Connect for Fleet, un ecosistema di servizi connessi, destinati agli operatori professionali, tesi a facilitare la gestione della loro flotta di veicoli e ridurne il costo, grazie a una connettività sicura e accessibile, nonché a partnership costituite con i principali fornitori di servizi telematici. Renault Easy Connect for Fleet propone la disponibilità sicura dei dati dei veicoli Re-

Pagina 34

nault di una flotta, grazie alla centralina Renault Communication Adapter che si connette all’elettronica del veicolo. Il gestore della flotta non ha più bisogno di procurarsi le informazioni presso il conducente o direttamente nel veicolo, poiché la centralina telematica consente di raccogliere le informazioni utili, a distanza e in tempo reale: chilometraggio, autonomia, posizione geografica, consumo, pressione dei pneumatici, alert tecnici, chilometri restanti fino alla manutenzione successiva. Easy Connect for Fleet con-

sente, di conseguenza, di: ridurre i costi di utilizzo della flotta e ottenere significativi guadagni in termini di consumo, gestione e anticipazione della manutenzione; facilitare la gestione della flotta con una buona visibilità della flotta a partire da dati affidabili, precisi e diversificati; realizzare una guida eco-responsabile che tenga in considerazione la diminuzione dei costi, la riduzione delle emissioni di CO2, il rafforzamento della sicurezza migliorando il comportamento al volante. Poiché le esigenze de gli operatori professionali

sono molto diverse da un mestiere all’altro, con una grande varietà di attività e specificità proprie a ogni Paese, Renault ha siglato partnership con fornitori di servizi telematici (Telematics Service Providers TSP) che sviluppano strumenti adeguati alle singole attività. Facendo capo ai TSP, Renault assicura la raccolta dei dati provenienti dai veicoli tramite server sicuri. I dati vengono poi elaborati dai TSP e vanno ad alimentare i loro servizi, commisurati all’attività del cliente. Il professionista che non utilizza ancora

servizi telematici per la sua attività può trovare la soluzione più indicata per il suo settore tra le proposte dei TSP partner, e gestire la sua flotta di veicoli Renault. Il professionista che invece ha già adottato il servizio telematico di un TSP partner, può implementare Renault Easy Connect for Fleet per la raccolta dei dati dei veicoli Renault. Inoltre, il Grup po Renault propone agli operatori professionali, tramite la sua filiale RCI Bank and Services, un nuovo strumento innovativo denominato “Fleet Asset and

Tracking Management”, che associa tutte le in formazioni necessarie alla gestione operativa di una flotta: servizi finanziari dettagliati, dati sui veicoli in tempo reale, geolocalizzazione ed eco-driving. Questo servizio, totalmente nuovo, accessibile su tutti i supporti digitali, è stato realizzato basandosi sulle esigenze dei clienti con flotte di autovetture e veicoli commerciali leggeri, e definito con la loro partecipazione. Viene lanciato in questo periodo in Europa e in America Latina. Easy Connect for Fleet sarà disponibile da metà 2018 su tutta la gamma di vei coli nuovi Renault in Europa e, in regime di post-vendita, sul parco Renault esistente.

N° 268 / Aprile 2018


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

VOLKSWAGEN VEICOLI COMMERCIALI CON TRANSPORTER E CRAFTER NEL SETTORE SOCCORSO

Affidabili soprattutto nelle emergenze

Q

PIETRO VINCI VERONA

uello dei veicoli per le o perazioni di soccorso ed emergenziali è un settore fondamentale dal punto di vista sociale e sanitario ed è anche, dal punto di vista commerciale, una nicchia strategica che unisce affidabilità e innovazione tecnologica. Volkswagen Veicoli Commerciali ha dimostrato l’attenzione che riserva al mondo delle emergenze organizzando, presso la sede centrale di Volkswagen Group Italia a Verona, gli Emergency Days, una quattro giorni con sessioni di formazione e test drive sui veicoli commerciali del brand rivolti a o peratori e autisti soccorritori delle varie associazioni italiane nonché rappresentanti del settore pubblico. Punto di ritrovo il nuovo proving ground VGI Mobility Lab, inaugurato lo scorso anno e destinato a ospitare eventi di testing e formazione alla gui da. Ospiti d’onore degli E mer gency Days i principali allestitori italiani di ambulanze che hanno mostrato i loro allestimenti proprio sui veicoli commerciali Volkswagen. “La guida sicura in ambulanza è un concetto estremamente importante per ridurre i rischi cui si va incontro durante un’emergenza sanitaria spiega Luca Bedin, Direttore Volkswagen Veicoli Commerciali Italia - Per questo mo tivo Volkswagen Veicoli Commerciali ha deciso di organizzare delle prove di guida in pista e su strada con l’obiettivo di far provare le innovazioni tecnologiche presenti sui veicoli della gamma, che li rendono tra i veicoli

PRESSO IL NUOVO PROVING GROUND VGI MOBILITY LAB ALL’INTERNO DEL QUARTIER GENERALE DI VOLKSWAGEN GROUP ITALIA A VERONA, SONO STATI ORGANIZZATI GLI

EMERGENCY DAYS, UNA QUATTRO GIORNI CON SESSIONI DI FORMAZIONE E TEST DRIVE SUI VEICOLI COMMERCIALI DEL BRAND RIVOLTI A OPERATORI E AUTISTI SOCCORRITORI.

OSPITI D’ONORE I PRINCIPALI ALLESTITORI ITALIANI DI AMBULANZE, CHE HANNO MOSTRATO I LORO ALLESTIMENTI PROPRIO SUI VEICOLI COMMERCIALI TEDESCHI. più affidabili e sicuri e, pertanto, par ticolarmente adatti per que sto tipo di allestimento. Nel corso di queste giornate sono stati quindi testati diversi sistemi di assistenza alla guida e, in particolare, il cambio automatico DSG a doppia frizione e la trazione integrale 4Motion”. Le giornate sono state strutturate su tre linee concettuali: teoria dell’approccio al la guida, pratica in pista e pratica in ambiente urbano.

Per quanto riguarda il primo punto, era prevista una breve sessione teorica che aveva come obiettivo principale quello di illustrare agli autisti soccorritori le principali caratteristiche tecniche dei diversi tipi di trazione e di cambio offerti da Volkswagen Veicoli Commerciali. Sono stati presentati, infatti, alcuni tra i più innovativi veicoli del marchio, quali Crafter, che fra i suoi optional ha il cambio automatico con convertitore di coppia e tre modalità di tra-

zione, e Transporter, con due modalità di trazione e cambio automatico DSG a doppia frizione; entrambi in grado garantire quindi sicurezza e comfort totale di marcia per soccorritori e paziente. Nel VGI Mobility Lab è stato poi possibile effettuare del le prove in pista, con lo scopo di testare le principali caratteristiche delle due tipologie di furgone: la trazione integrale 4Motion e i sistemi di assistenza alla guida di Crafter e il cambio au-

tomatico DSG di Transporter. E infine, per avere una panoramica completa sulle prestazioni dei mezzi Volkswagen Veicoli Commerciali, sono stati poi effettuati test drive su strada, dove alcuni istruttori qualificati hanno affiancato i partecipanti agli Emergency Days al fine di far provare i veicoli anche in classici scenari urbani ed extraurbani, in modo da poter testare tutte le incredibili caratteristiche di Crafter e Transporter.

LUCA BEDIN, DIRETTORE VOLKSWAGEN VEICOLI COMMERCIALI ITALIA

“I veicoli sono tanto importanti quanto l’allestimento” È

visibilmente soddisfatto Luca Bedin, Direttore Volkswagen Veicoli Commerciali Italia. Gli Emergency Days organizzati in marzo presso il VGI Mobility Lab di Verona hanno avuto dei feedback molto positivi da parte di operatori e driver soccorritori, che hanno giudicato positivamente le qualità di Crafter, Transporter e Caddy e li hanno qualificati come veicoli di base ideali per l’allestimento di ambulanze o auto mediche. “Il nostro obiettivo è stato fornire nozioni tecniche che confermassero o anche mettessero in discussioni le scelte nel delicato e importante settore delle emergenze e del soccorso sanitario dice Bedin - Il focus è stato messo non solo sulla sicurezza e la dotazione tecnologica ma anche sull’economia di gestione di un veicolo ambulanza o auto medica”. Crafter e Transporter hanno mostrato sul campo la qualità di dispositivi come la trazione integrale 4Motion o il cambio automatico DSG. “I soccorritori - continua Luca Bedin - hanno avuto l’occasione di testare diverse soluzioni di trazione e il cambio automatico DSG, verificando così quale sia la soluzione di trazione più idonea ai singoli scopi

N° 268 / Aprile 2018

specifici di impiego del mezzo e apprezzando le doti di comfort e sicurezza per il driver che derivano dall’utilizzo del cambio automatico rispetto al manuale”. “Occorre considerare che in Italia - aggiunge Bedin - nel settore emer-

genze la penetrazione del cambio automatico è ancora molto limitata. Invece noi crediamo che sia la giusta soluzione per agevolare il lavoro del driver soccorritore e permettergli di concentrarsi sulle manovre al volante. È dunque questione di conoscen-

za a cui abbiamo voluto contribuire con gli Emergency Days e che siamo disposti a soddisfare anche contribuendo per esempio alla formazione dei driver con corsi teorici e pratici organizzati presso la nuova struttura del VGI Mobility Lab”. Gli

operatori del soccorso sono molto esigenti e chiedono veicoli efficienti e sicuri ma anche con un costo di gestione controllabile e ottimale. Anche in questo ambito la Total Cost of Ownership è un concetto chiave. “Quello del soccorso e delle emergenze è una nicchia di mercato molto interessante - dice ancora Luca Bedin - Volkswagen è da anni protagonista del settore con soluzioni ottimali per gli operatori che combinano economia e tecnica. Transporter è già da anni protagonista tra i veicoli medi mentre grandi potenzialità è in grado di offrire il nuovo Crafter nel sottosettore dei grandi furgoni, adibiti alla trasformazione in ambulanza”. “Inoltre - conclude Bedin - Volkswagen Veicoli Commerciali collabora con i principali allestitori di ambulanze e auto mediche, che sono i nostri principali interlocutori nel momento in cui proponiamo un veicolo come base per il successivo allestimento. L’allestimento è ovviamente importante ma lo è anche il veicolo di base che deve poter garantire efficienza, sicurezza e ottimale gestione dei costi. Per questo con gli Emergency Days abbiamo creato un ponte tra utente e costruttore”.

Pagina 35


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI SU STRADA / RENAULT ALASKAN INTENS 190 CV E ALASKAN ZEN 160 CV S&S E6

Freddati da tanta potenza MUSCOLI È LA PAROLA D’ORDINE CON CUI LA LOSANGA HA PORTATO IN EUROPA IL SUO PICK-UP, DOPO AVERLO MESSO ALLA PROVA NEI TERRITORI DELL’AMERICA LATINA, A COMINCIARE DALLA COLOMBIA. DOPPIA CABINA E CINQUE POSTI DI SERIE, LO PROVIAMO IN ANDATA CON HARDTOP E PORTELLONE RICHIUDIBILE. AL RITORNO CON CASSONE, ROLL BAR CROMATO E COPERTURA IN ALLUMINIO RIGIDO. IN ENTRAMBI I CASI IL DIVERTIMENTO STA TUTTO NELL’OFF-ROAD, DAL FANGO ALLA NEVE FINO ALLA SABBIA.

L

MATTEO GALIMBERTI TRENTO

anciato inizialmente in A merica Latina, Alaskan, pick-up di casa Renault dal design imponente e grintoso, si è affacciato sul nostro mercato verso la fine del l’anno scorso. Versatile e ro busto, conserva i punti di forza del pick-up (trazione integrale inseribile con due modalità, cambio automatico, sospensioni 5-link e capacità di carico fino a una tonnellata) cui unisce il french design della Losanga. Alaskan mantiene dunque tutte le capacità di un veicolo commerciale ma per la sua linea si propone come veicolo multiuso: valido

alleato nella propria attività professionale, ideale mezzo per i weekend con la famiglia. Tant’è che in Italia lo troviamo esclusivamente in versione Doppia Cabina, a cinque posti, e a fine anno è attesa una versione King Cab (2+2), con cassone di lunghezza maggiore. MENO FAMILIARE PIÙ PROFESSIONAL

La prima versione che mettiamo la prova, in allestimento Intens, si propone addirittura con hardtop e portellone richiudibile, per aumentare il volume di stoccaggio e proteggere il carico dalle intemperie (e dal rischio di furti): sembra soddisfare proprio le esi-

genze di chi cerca un veicolo dall’ampia capacità di ca rico, spazioso, in grado di accogliere ogni tipo di utensile per i propri hobby, dalle mazze da golf alle racchette da tennis alle borse per una partita a calcetto. Il rivestimento bicolore conferisce al cassone così coperto un elegante tocco estetico che non guasta affatto. Al ritorno il secondo veicolo in uso è in allestimento Zen. Prima di salire a bordo la differenza sta nel cassone, con roll bar cromato e copertura in alluminio rigido per proteggere il carico da sole, in temperie o sguardi indiscreti. Per quanto dall’aria meno “familiare” e più propenso a prestarsi per attività professionali, anche il cassone del secondo Alaskan

resta assolutamente comodo per ogni carico, grazie a una superficie di quasi due metri e mezzo di metri quadrati (sono esattamente 2,46 mq) e all’intelligente sistema di fissaggio C-Channel, che mantiene il carico in sicurezza: con tre binari fissati su tre sponde del cassone e quattro ganci mobili, possiamo adattare e fissare qualunque tipo di carico in mo do semplice, pratico e rapido. La sponda posteriore del cassone può sostenere fino a 500 kg e questo facilita le operazioni di carico e scarico. Anche l’accesso al cassone avviene in maniera facile e senza rischi grazie a un’altezza da terra che supera di pochissimo gli 80 cm. Il nostro percorso prevede da

Monza a Trento un traffico in gran parte autostradale ma, una volta giunti a destinazione, il cambio del veicolo avverrà in un’area limitrofa alla città di Trento, consentendoci di mettere alla prova il pick-up anche su sterrato e percorsi accidentati in salite-discese, resi ulteriormente difficoltosi da fango e zone ghiacciate per le basse temperature. QUEL ORIGINE SUDAMERICANA

Diamo il consueto occhio al design senza dimenticare che Alaskan è nato in Sud A me rica: in quei territori, ben avvezzi all’utilizzo dei pick-up, è già presente dal 2016. Ha iniziato la sua av-

Carta d’identità

Cognome: Renault Nome: Alaskan Intens Carrozzeria: Autocarro per trasporto cose 5 posti (4 passeggeri + conducente), trazione integrale inseribile, doppia cabina, hardtop con portellone richiudibile in rivestimento bicolore. Motore: M9T 2,3 litri dCi quattro cilindri con twin-turbo a iniezione diretta/common rail con FAP e S&S. Cilindrata: 2.298 cc. Carburante: gasolio. Potenza max: 140 kW/190 cv. Velocità max: 180 km/h. Accelerazione 0-100 km/h: 10,8 sec. Coppia max: 450 Nm a 1.500-2500 g/min Livello ecologico: Euro 6b. Cambio: automatico a 7 marce. Dimensioni (mm): lunghezza 5.332; larghezza 1.850; altezza 1.810, passo 3.150, sbalzo posteriore 1.310. Portata: 949 kg. Massa a vuoto: 2.086 kg. Diametro di sterzata: 6,60 m (entro muri); 6,20 m (entro marciapiedi). Dotazioni: ABS+ESP+Extended Grip+Hill Start Assist; 7 airbag (frontale conducente e passeggero); alzacristalli anteriori elettrici “one touch”; specchietti retrovisori cromati elettrici; vetri posteriori oscurati; volante con finitura in pelle; navigatore satellitare con schermo 7” touch e retrocamera; sedile conducente a regolazione multipla (lombare, in altezza e in profondità); schienale reclinabile; servosterzo; climatizzatore automatico bizona; chiusura delle porte a veicolo in movimento; chiusura centralizzata con telecomando; cerchi in lega da 18”. Consumi: 6,9 l/100 km (ciclo misto). Emissioni di CO2: 183 g/km Sito produttivo: Barcellona.

Pagina 36

N° 268 / Aprile 2018

Alaskan mantiene tutte le capacità di un veicolo commerciale, ma per la sua linea si propone come veicolo multiuso.


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI una capacità di traino (3,5 t) assolutamente idonea per le attività del tempo libero e contemporanee doti da fuoristrada, ci mettiamo al volante consapevoli di guidare un veicolo adatto a ogni avventura. Una volta alla guida le capacità da fuoristrada vengono confermate dal propulsore Renault 2,3 litri dCi, che abbiamo già avuto modo di provare sul Master, furgone alto di gamma della Losanga. In andata lo troviamo con twin-turbo e una potenza di 190 cv e cambio automatico a sette rapporti, al ritorno con turbocompressore singolo, 160 cv di potenza e cambio manuale. In termini di accelerazione e rendimento Alaskan si dimostra sicuro di sé, proponendo, soprattutto all’andata, una guida tranquilla, rilassata e nel contempo pronta a far valere le doti del veicolo, ad esempio in fase di sorpasso. Il motore è efficace e le sue per formance sono decisamente apprezzabili anche quando, di ritorno da Trento con cambio manuale, decidiamo di scalare di marcia e aumentare i giri per completare rapidamente il percorso lungo una strettoia di 300 metri. AMORE PER L’AVVENTURA

ventura in Colombia e l’anno scorso è arrivato in Europa iniziando da Spagna (dove nasce, nel sito di Barcellona) e naturalmente Francia, per poi via via raggiungere il resto d’Europa. I “muscoli” sono proprio quelli in stile latino: look atletico, frontale energico, design imponente con un’ampia calandra dalle finiture cromate, logo prominente che spicca su sfondo nero brillante e firma luminosa a forma di C (CShape) che sconfina dai grup pi ottici. Insomma Alaskan si presenta robusto in ogni componente, che cattura subito lo sguardo dell’osservatore, dimostrando che Renault vuole puntare tutto sulla potenza per fare la differenza in un mercato che sta diventando particolarmente dinamico: nel 2017 la crescita è stata di circa il 20 per

cento dopo un 2016 che aveva già fatto registrare un aumento del 25 per cento. Professionisti, imprenditori, commercianti o proprietari di aziende agricole cercano in un pick-up doti di veicolo robusto e versatile, capace di trasportare carichi pesanti ma anche di accogliere comodamente il personale o la famiglia.

Renault Alaskan si presenta robusto in ogni componente, che cattura subito lo sguardo dell’osservatore.

Alaskan è un pick-up progettato per dominare ogni tipo di terreno e avventurarsi su tutte le strade, anche le più accidentate. Ragion per cui dà il meglio di sé quando ci avventuriamo in un vasto parco-giardino reso umido, fangoso e con collinette che presentano persino tratti ghiacciati. Finora in autostrada abbiamo utilizzato la modalità a due ruote motrici (2WD): con questo tipo di

trazione la potenza viene inviata alle ruote po steriori, che sono quindi responsabili della trazione in condizioni normali di guida. In questo caso il veicolo si ren de adatto per un utilizzo quotidiano, migliorando tenuta di strada e rendimento energetico. Prima di affrontare fango e pietre giriamo l’apposita manopola per inserire la modalità quattro ruote motrici (4H), che sfrutta la trazione del le quattro ruote: affrontiamo il fondo scivoloso con una velocità inferiore a 60 km/h ed eccoci pronti a un off-road non estremo. Percorso poco più di un chi lometro il fango si fa più denso e rischiamo maggiore perdita di trazione. Fermiamo il veicolo e inseriamo la modalità quattro ruote motrici ridotte (4LO), che agisce a sua volta sulle quattro ruote ma utilizzando un riduttore di coppia supplementare. Il risultato è maggiore potenza e migliore aderenza: il terreno estremo non fa più paura. Anche quando troviamo un tratto di neve e la perdita di trazione è totale Alaskan si dimostra perfetto. Prima di rientrare con il secondo Alaskan affrontiamo un percorso di sabbia, stavolta per mettere alla prova il sistema eLSD (Differenziale elettronico a slittamento limitato), che utilizza sensori di frenata per sorvegliare la velocità di rotazione di ciascuna ruota. In sostanza il sistema agisce quando uno degli assali gira più velocemente dell’altro: Alaskan frena brevemente da solo e migliora l’aderenza, rafforza la stabilità e potenzia la sensazione di sicurezza quando valichiamo una collinetta particolarmente ripida. Insomma, un mezzo che sa regalare vere soddisfazioni.

IMPONENTE IN OGNI MISSIONE

Alaskan è pensato per le esigenze dei professionisti del l’edilizia, del trasporto mer ci o del settore sanitario ma è anche veicolo spazioso, con comfort interno all’altezza di una vettura. L’allestimento che utilizziamo in andata presenta uno spazio importante nella parte posteriore: con

Carta d’identità

N° 268 / Aprile 2018

Senza limiti: Alaskan è progettato per dominare ogni tipo di terreno e avventurarsi anche nelle situazioni più extreme.

Cognome: Renault Nome: Alaskan Zen Carrozzeria: Autocarro per trasporto cose 5 posti (4 passeggeri + conducente), trazione integrale inseribile, doppia cabina, cassone scoperto con sistema di fissaggio del carico C-Channel. Motore: M9T 2,3 litri dCi quattro cilindri a iniezione diretta/common rail con turbocompressore singolo, FAP e S&S. Cilindrata: 2.298 cm3. Carburante: gasolio. Potenza max: 120 kW/160 cv. Velocità max: 172 km/h. Accelerazione 0-100 km/h: 12 sec. Coppia max: 403 Nm a 1.500-2500 g/min Livello ecologico: Euro 6b. Cambio: manuale a 6 marce . Dimensioni (mm): lunghezza 5.332; larghezza 1.850; altezza 1.810, passo 3.150, sbalzo posteriore 1.310. Portata: 945 kg. Massa a vuoto: 2.011 kg. Diametro di sterzata: 6,60 m (entro muri); 6,20 m (entro marciapiedi). Dotazioni: ABS+ESP+Extended Grip+Hill Start Assist; 7 airbag (frontale conducente e passeggero); alzacristalli anteriori elettrici “one touch”; climatizzatore manuale elettronico con ventilazione posteriore; sedile conducente a regolazione multipla (lombare, in altezza e in profondità); schienale reclinabile; servosterzo; chiusura delle porte a veicolo in movimento; chiusura centralizzata con telecomando; cerchi in lega da 16”. Consumi: 6,3 l/100 km (ciclo misto). Emissioni di CO2: 183 g/km Sito produttivo: Barcellona.

Pagina 37


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI MICHELIN ESTENDE LA GAMMA CROSSCLIMATE AI VEICOLI COMMERCIALI

Distribuzione all season con Agilis “IDEALE PER LE ATTIVITÀ DI DISTRIBUZIONE URBANA ED EXTRAURBA, AGILIS CROSSCLIMATE È UN PNEUMATICO ESTIVO CON PRESTAZIONI INVERNALI COMPLETE - SPIEGA VALERIO SONVILLA,

RESPONSABILE LINEA PRODOTTO VETTURA E TRASPORTO LEGGERO ITALIA E MALTA DI MICHELIN ITALIANA - APRE A UNA NUOVA GENERAZIONE DI PNEUMATICI AD ALTE PRESTAZIONI PER VEICOLI COMMERCIALI, SENZA COMPROMESSI IN FATTO DI MOBILITÀ IN CONDIZIONI METEOROLOGICHE AVVERSE”. MICHELIN ANCORA UNA VOLTA IN ANTICIPO SUI TEMPI.

L

PAOLO ALTIERI MILANO

e attività di distribuzione sono sempre più importanti e determinanti dal punto di vista economico e sociale. Per questo motivo, Michelin ha pensato di facilitare il lavoro degli utilizzatori di veicoli da lavoro di medie e piccole dimensioni - quelli principalmente deputati ai servizi distributivi all’interno delle aree urbane ed extraurbane estendendo la gamma CrossClimate, lanciata tre anni fa come proposta per vetture, ai veicoli commerciali per il trasporto leggero con l’ingresso della nuova proposta Agilis CrossClimate. “Si tratta di un pneumatico estivo con prestazioni invernali complete, che apre a una nuova generazione di pneumatici ad alte prestazioni per questa tipologia di veicoli, senza compromessi in fatto di mobilità in condizioni invernali, così come su fango ed erba -spiega Valerio Sonvilla, Responsabile Linea Prodotto Vettura e Trasporto Leggero Italia e Malta di Michelin Italiana, manager di provata esperienza che vanta una carriera trentennale all’interno dell’organizzazione del produttore francese - Pneumatici che vantano elevata durata chilometrica e un ridotto TCO (Total Cost of Ownership), sicurezza in ogni condizione meteo, robustezza e resistenza agli urti”. In conseguenza del boom dello shopping online e del forte incremento delle consegne nei centri urbani, unitamente alle restrizioni alla mobilità cittadina per i veicoli pesanti, le vendite di veicoli commerciali leggeri sono in crescita. “L’esplosione delle vendite online ha comportato l’estensione della capillarità delle consegne e quindi un maggiore utilizzo dei furgoni, che superano gli ostacoli derivanti dalla limitazione della circolazione per gli autocarri nelle città - continua Sonvilla - L’incremento del mercato dei furgoni va di pari passo con quello del ricambio pneumatici. In Europa, nel 2017, è stato venduto il 4 per cento in più di pneumatici per il trasporto leggero”. Insieme alle mutate abitudini di acquisto sono aumentate le aspettative dei clienti che ambiscono ad avere il prodotto ordinato su internet con sempre maggiore velocità. Pertanto, artigiani, piccoli imprenditori e fleet manager, per poter assicurare la disponibilità delle consegne e dei servizi tutto l’anno, in modo puntuale, indipendentemente dalle condizioni meteorologiche, sempre di più ricorrono all’impiego di pneu matici All Season, cioè in grado di assicurare prestazioni otti-

Pagina 38

mali in sia in estate che in inverno e quindi una gestione ottimale e profittevole per chi si occupa del doorto-door tutto l’anno. “All’interno del mercato pneumatici per veicoli commerciali c’è un comparto che è cresciuto tantissimo, quello dei pneumatici All Season con ferma Valerio Sonvilla - L’au mento del 2017 rispetto al 2016 è pari al 37 per cento. Inoltre, ci sono paesi che hanno registrato crescite incredibili, come per esempio l’Italia che ha consuntivato un incremento dell’86 per cento, analoga a quella tra 2015 e 2016. In Europa oggi il

mercato All Season vale il 12 per cento del totale. In Italia siamo al 9 per cento”. Michelin Agilis CrossClimate è stato disegnato e concepito partendo dai risultati di uno studio condotto su un campione di utilizzatori in Europa da GMV, un ente di ri cerca esterno. Le esigenze emerse attraverso questa indagine sono state principalmente due: un unico pneumatico in grado di fornire grip, trazione e affidabilità in tutte le stagioni, in ogni condizione meteo, su ogni tipologia di superficie stradale e con elevata durata chilometrica; un pneumatico robusto e resistente ai danneggiamenti, in particolare nell’ambiente urbano dove gli urti con i marciapiedi e altri oggetti possono essere frequenti. “Gli utilizzatori professionali - aggiunge Sonvilla chiedono: capacità di carico, perché spesso il trasporto leggero è soggetto

al sovraccaric; robustezza nell’utilizzo urbano e prestazioni sulle strade extraurbane; aderenza su tutti i terreni; chilometraggio”. Agilis CrossClimate è dotato del marcaggio 3PMSF ed è quindi certificato per l’utilizzo in condizioni invernali. Inoltre, nonostante le elevate performance invernali, la durata chilometrica e la frenata sono equiparabili a quelle di un pneumatico estivo su strade asciutte. “Questi risultati - dice ancora Valerio Sonvilla - sono resi possibili da due caratteristiche chiave: una mescola di ultima generazione che conferisce flessibi-

Valerio Sonvilla, Responsabile Linea Prodotto Vettura e Trasporto Leggero Italia e Malta di Michelin Italiana.

lità alla gomma e al battistrada anche a temperature rigide; un battistrada multistrato che minimizza il trasferimento di calore attraverso il pneumatico. Ispirato al più volte premiato pneumatico per auto CrossClimate+, Agilis CrossClimate ripropone la scultura a V formata da un’innovativa combinazione di tasselli ultra tecnologici. Questi contengono lamelle autobloccanti bi-direzionali che creano spigoli taglienti capaci di “aggrapparsi” a fondi ghiacciati e innevati, per un grip ottimale in caso di condizioni invernali severe. Questa combinazione tra la

nuova mescola del battistrada e la scultura a V permette di avere grip in tutte le condizioni, ma permette an che un incremento della durata chilometrica del prodotto, pari al 35 per cento in più rispetto alla media dei concorrenti premium testati. La notevole resistenza ai danneggiamenti è raggiunta attraverso l’aggiunta di blocchi di gomma trapezoidali profondi 1,5 mm posti intorno alle spalle e sulla parte alta del fianco. Questa soluzione fornisce grande protezione, senza compromettere la flessibilità della carcassa e deriva dai pneumatici per trasporto pesante a uso militare”. Agilis CrossClimate è stato sviluppato e rigorosamente testato in severe condizioni invernali dai team di collaudatori Michelin in due location europee, poste a 4.000 chilometri di distanza l’una dall’altra: Ivalo, situata nel Circolo polare artico, in Finlandia, e Barcelonnette, a 2.715 metri di altitudine sulle Alpi, una delle più alte strade europee. “Agilis CrossClimate non è solo un altro pneumatico All Season - conclude Sonvilla- offre tutti i vantaggi di un pneumatico estivo in frenata su bagnato (grading “A” nell’etichettatura europea dei pneumatici sia nella categoria estiva che in quella invernale), frenata su asciutto, durata ed efficienza energetica nonché i vantaggi di un pneumatico invernale in trazione e frenata per coloro che affrontano temperature rigide o condizioni di neve occasionale. Presentiamo un pneumatico che prima non esisteva nel settore del trasporto leggero. L’offerta dimensionale parte da maggio 2018 e si concluderà il prossimo anno arrivando a coprire il 95 per cento del mercato”.

CAMBIO AL VERTICE DI MICHELIN ITALIANA SPA

S

SIMONE MIATTON NUOVO PRESIDENTE E AD

imone Miatton è il nuovo Presidente e Amministratore delegato di Michelin Italia Spa. Subentra a Lorenzo Rosso, che lascia il comando del Gruppo in Italia per ricoprire l’incarico di Presidente della Regione geografica Michelin Europa del Sud. Sposato e padre di un figlio, Simone Miatton è nato a Este (Pd) nel 1970 e si è laureato in Ingegneria Aeronautica al Politecnico di Torino. Ha iniziato la sua carriera nel

Gruppo Michelin nel 1997, dove ha maturato un’esperienza pluriennale in diversi ambiti aziendali anche all’estero. Rientrato in Italia ha lavorato presso gli stabilimenti di Torino e Alessandria, è stato Direttore dello stabilimento di Cuneo, il più importante impianto produttivo di pneumatici in Italia e uno dei più grandi siti Michelin in Europa, poi Direttore del Personale; incarico, quest’ultimo, che conserva tutt’ora.

N° 268 / Aprile 2018


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

AVIS BUDGET ITALIA / AMICOBLU SPONSOR DEL CAMPIONATO MONDIALE DI SNOWKITE

Il van che arriva anche sulla neve ABILITÀ DEI MIGLIORI ATLETI ALLA PROVA A ROCCARASO, NEL COMPRENSORIO SCIISTICO DELL’ALTO SANGRO, NELLA BASSA PROVINCIA DELL’AQUILA. A DISPOSIZIONE DEGLI ORGANIZZATORI PER TUTTA LA DURATA DELLA MANIFESTAZIONE UN VEICOLO COMMERCIALE AMICOBLU PER IL SUPPORTO LOGISTICO. “IL NOSTRO FURGONE SI È RIVELATO ALLEATO IDEALE CON UNA VERA E PROPRIA SEGRETERIA MOBILE”, AFFERMA

MICHELE ALESSANDRELLI, VAN DIRECTOR DI AVIS BUDGET ITALIA.

S

MATTEO GALIMBERTI ROCCARASO

inonimo di furgone per la voro, per il trasporto di ogni tipo di bene e per i traslochi, AmicoBlu si dimostra compagno ideale anche per organizzare e accompagnarti a una gara di snowkite. Avete presente lo skilift che porta il rider dove vuole, in piano, salita o discesa, senza volare e senza pericolo? Nato dall’unione tra un’ala da kitesurf e gli sci o lo snowboard, lo snowkite consente di “navigare” sulla neve seguendo il vento. Le regole sono semplici: percorrere in una determinata unità di tempo più chilometri, più variazioni in altezza e più perimetro complessivo attraverso l’utilizzo di un GPS, con la massima libertà

N° 268 / Aprile 2018

quindi e la possibilità di scegliere il proprio percorso. Divenuto autentica disciplina sportiva, da cinque anni si svolge un campionato mondiale che, quest’anno, ha fatto tappa in Italia, nel corso di un evento che, nella stupenda cornice di Roccaraso, è stato sponsorizzato da AmicoBlu, brand appartenente ad Avis Budget Italia. ALLEATO PER IL TEMPO LIBERO

Leader sul mercato italiano nel noleggio di furgoni e veicoli commerciali, con una flotta che conta oltre duemila furgoni, affiancandosi al Campionato mondiale di snowkite AmicoBlu intende proporsi come utile alleato anche per il tempo libero. “Con la parteci-

pazione al Campionato mondiale di snowkite - spiega Michele Alessandrelli, Van Director di Avis Budget Italia - AmicoBlu dimostra la sua flessibilità e adattabilità anche alle esigenze di chi fa sport invernali. L’organizzazione ha potuto usufruire per tutta la durata della manifestazione sportiva di un veicolo commerciale per il supporto logistico e, grazie alla funzionalità della proposta AmicoBlu, il furgone si è rivelato alleato ideale per dare vita a una vera e propria segreteria mobile che ha consentito agli organizzatori di seguire gli atleti in tutti i campi gara”. L’evento si è svolto a Roccaraso, piccolo comune della bas sa provincia dell’Aquila, in Abruzzo. Qui, ai margini me ridionali dell’Altopiano del le Cinquemi-

glia, trenta tra i più forti atleti di questa particolare disciplina si sono dati battaglia sulle montagne del Comprensorio sciistico dell’Alto Sangro: un successo di pub blico e di partecipazione anche grazie alle potenzialità del comprensorio abruzzese. “Questo sport che permette di “navigare” sulla neve e seguire il vento commenta Alessandrelli - ha in comune con i van di AmicoBlu la possibilità di mettere alla prova intuito, spirito di libertà e sicurezza”. IN ATTESA DI NUOVE SFIDE

La tappa di Roccaraso è stata organizzata da Outdoor 360 e dalla scuola di Snowkite SnowkiteRoccaraso.com e faceva parte di

un tour mondiale promosso dalla International Kiteboarding Association, componente di World Sailing e in collaborazione con la FIS (Federazione Internazionale dello Sci). Al termine della gara i rappresentanti AmicoBlu e gli organizzatori hanno premiato nella categoria Ski men il tedesco Felix Kernsten, primo classificato seguito dall’italiano Andrea di Lisa e dallo spagnolo Javi Mezo; nella Categoria Snowboard Men l’austriaco Reinhold Gehrer è arrivato primo seguito dal pluricampione del mondo Guillaume Chastagnol e Felix Werner. Questa sponsorizzazione è il punto di partenza per AmicoBlu. “Nei prossimi mesi afferma in conclusione A les sandrelli - i nostri furgoni si vestiranno di nuove sfide. Che non passeranno inosservate”.

Ha fatto tappa a Roccaraso, nota località sciistica abruzzese, il tour mondiale di Snowkite, disciplina che consente di “navigare” sulla neve seguendo il vento. Sponsor del campionato è AmicoBlu, leader nel noleggio di furgoni.

Pagina 39


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 41

INTERVISTA AL MANAGER CHE SI OCCUPA DI FLOTTA E LOGISTICA DELLA FILIALE ITALIANA

Il migliore tecnico per Fraikin DALL’ANNO SCORSO DIRETTORE TECNICO DELLA FILIALE ITALIANA, FABIO MIGLIORE METTE A DISPOSIZIONE DEL NOLEGGIATORE FRANCESE UNA LUNGA ESPERIENZA MATURATA SUL CAMPO. ORIGINARIO DI CALTANISSETTA, CON IL SUO SORRISO “SICULO” UNITO A PASSIONE E COMPETENZA RAPPRESENTA IL RIFERIMENTO PER TUTTO QUANTO CONCERNE IL CIRCOLANTE FRAIKIN, LA DISPONIBILITÀ DEI MEZZI E L’INTERA VITA DEL VEICOLO NOLEGGIATO.

I

MAX CAMPANELLA MILANO

l successo che anche nel nostro Paese sta riscuotendo Fraikin e la sua formula del noleggio di veicoli industriali passa attraverso gli uomini, ovvero dalla squadra che l’Amministratore delegato Claudio Gariboldi ha strutturato in questi tre anni di affermazione del noleggiatore francese in Italia. Gradualmente, Fraikin Italia si è strutturata nella sua organizzazione: ha aperto l’headquarter di Milano, nel crocevia autostradale del capoluogo lombardo, e ha costituito un team di manager che, pur dopo alcuni opportuni cambiamenti, è oggi affiatato e determinato nel raggiungere gli obiettivi. Dall’anno scorso, alfiere di Gariboldi nelle vendite è Diego Pellicioli, Direttore Commerciale, che mette in campo una consolidata conoscenza del mercato e un’autentica passione per il settore del trasporto. Nella squadra dell’Ad, figura cruciale è quella del Direttore Tecnico, ovvero di colui che si occupa degli approvvigionamenti, della flotta a tutto tondo, dagli aspetti di efficienza a quelli di disponibilità per soddisfare le domande della clientela. Da un anno a ricoprire questo ruolo è stato chiamato Fabio Migliore, classe 1976 e un’esperienza vissuta sul campo ad ampio raggio, in tutti gli aspetti della logistica. Persona cordiale, dal “sorriso siculo” che mette a proprio agio l’interlocutore - anche e soprattutto quando cir-

costanze esterne possano mettere tensione - Migliore è il manager cui è demandata la sicurezza che, una volta che il cliente abbia effettuato l’ordine, tutto funzioni al meglio nella consegna dei veicoli e nella successiva fase di assistenza per l’intera durata di vita del mezzo. Fabio Migliore nasce a Caltanissetta, nel cuore della Sicilia, di cui mantiene intatte caratteristiche di solarità nella comunicazione. Dopo la formazione scientifica si laurea in Ingegneria Meccanica all’U niversità di Palermo: le sue doti innate nell’innova-

zione tecnica lo portano a Par ma, in occasione del XXXI Convegno AIAS (Associazione Italiana per l’Analisi delle Sollecitazioni), dove viene illustrata la sua tesi sperimentale sull’applicazione di fibre ottiche in materiali compositi. I primi lavori lo vedono in aziende sicule come tec nico di progettazione di impianti eolici. La conoscenza con Laura, che diventerà sua moglie, lo convince ad am pliare gli orizzonti fuori dalla regione d’origine. Nel 2004 Fabio Migliore inizia il suo percorso professionale a Milano presso una

Fabio Migliore, Direttore Tecnico Fraikin Italia.

multinazionale che produce cartongesso, in quegli anni inglobata nella galassia Saint Gobain. È in quel ruolo che incrocia il settore dei veicoli industriali. Il lavoro nelle cave e nei siti produttivi richiedeva mezzi quali pale gommate e escavatori: nel panorama dei fornitori c’è CGT, che vende e noleggia mezzi per attività edilizia a marchio Caterpillar. Nel 2008 l’ingegner Migliore entra in CGT, che in quegli anni lancia la sua offensiva nei veicoli industriali.

Presso quella che ai tempi era già Concessionaria Daf, apprende tutto quanto concerne il mondo del trasporto, vivendo da protagonista lo sviluppo dei prodotti in qualità di Product Manager, supportando vendite e acquisti. Nel 2013 timidamente si affaccia anche in Italia la formula del noleggio di veicoli industriali, che altrove in Europa - in primis in Francia - è una realtà in via di consolidamento. Migliore si occupa di una nuova “startup”: strutturare una squadra di Area Manager che si occupi

La flotta di veicoli professionali di Fraikin Italia, filiale del noleggiatore francese impegnata in una forte offensiva di mercato.

del noleggio. “Quegli anni spiega il Direttore Tecnico Fraikin Italia - hanno rappresentato per me una vera fucina formativa: proponendo sul mercato molti veicoli allestiti, mi interfacciavo personalmente con numerose aziende italiane che si occupano di scarrabili, cava-cantiere, allestimenti per ecologia e trasporto rifiuti, mezzi d’opera, refrigerati, motrici con gru ecc.” Nella struttura della nuova azienda si occupa dell’intera gestione della flotta, pianificazione e assegnazione dei veicoli a lungo e breve termine, dell’assistenza ai clienti e alla forza vendite. A Migliore manca un ultimo step per completare la sua formazione: diventare Gestore del trasporto, ovvero acquisire ulteriori competenze ed essere in possesso dell’Attestato di Ido neità Professionale. Nel 2016 ottiene il titolo e dopo qualche mese incrocia Fraikin, che gli propone la nuova sfida: occuparsi del “cuore” del noleggio. “Quando ho parlato con Gariboldi e Pellicioli - spiega Migliore - un elemento ha subito catturato la mia attenzione: Fraikin si pone sul mercato come un vero noleggiatore, proponendo tutto quanto offre il mondo dei veicoli professionali, dal Piaggio Porter al Trattore al Mezzo d’Opera a tre assi. E per giunta di ogni brand. Un lavoro certamente complesso, legato com’è alla difficoltà d’interfacciarsi con numerosi player. L’obiettivo non è standardizzare l’offerta, ma accontentare il cliente”.

NEL SUO STAFF TRE COLLABORATORI, UNO PER OGNI GRADINO DELLA “FILIERA”

“LA SFIDA È RIDURRE ALLE IMPRESE DI TRASPORTO COSTI FISSI E VARIABILI” N el suo ruolo da Direttore Tecnico Fraikin Italia, l’ingegner Fabio Migliore è affiancato da tre collaboratori: uno per la supply chainacquisti; uno per il customer care-customer service; uno per la parte operations. “Fraikin Italia - spiega Migliore - conta oggi una flotta di circa 500 veicoli. Numeri che indicano chiaramente che nel parco sono presenti veicoli con età superiore a due anni, che richiedono uno scadenziario per interventi di manutenzione ordinaria e straordinaria e gestione sinistri. Nella flotta sono presenti circa 130 veicoli refrigerati per il trasporto di derrate alimentari, che periodica-

mente devono essere controllati per il rispetto delle più severe normative vigenti. Oggi il noleggio di Fraikin è un mondo di attività: inizia con la consegna dei veicoli e da quel momento prosegue con tutta una serie di servizi”. Quali sono oggi le principali richieste dell’autotrasporto al fornitore di noleggio? “La logistica delle merci - risponde Migliore - si presenta come scenario ad alta variabilità: fino al 2008 le imprese di trasporto avevano costi fissi elevati e una bassa componente variabile. Oggi è il contrario: le stesse imprese esercitano la loro attività riducendo i costi fissi e aumentando

la variabilità. Si registra un picco di lavoro? Si rivolgono al noleggio consapevoli della sua formula estremamente flessibile, possono avere il veicolo in flotta senza imprevisti. Questa è la vera sfida del noleggio: la possibilità di ridurre il TCO senza alcun imprevisto. L’azienda ha a disposizione veicoli nuovi, il parco diventa efficiente senza aumentare i costi”. Qual è l’offerta complessiva di Fraikin nel noleggio a breve e lungo termine? “Miriamo risponde in conclusione il Direttore Tecnico - a soddisfare l’esigenza del cliente ad ampio raggio, con il nostro servizio FULL: assistenza

stradale 24/7, gestione dei pneumatici, servizi telematici, attività di reporting, feedback dati dei veicoli, veicoli tampone preconsegna, veicoli sostitutivi in caso di fermo macchina, che spesso rappresenta un pesante onere per l’impresa. Stiamo strutturando il un Network di officine Fraikin Point, con le quali operiamo con un contratto di servizio standard: in questo modo sarà raggiunto un livello di servizio omogeneo, uniformando ed ottimizzando le modalità di intervento sui veicoli della nostra flotta con delle procedure condivise e standardizzate”.


IL MONDO DEI TRASPORTI

Pagina 42

N° 268 / Aprile 2018

LA CALABRESE SPEZZANO TRASPORTI PUNTA SU KÖGEL COOL - PURFERRO QUALITY

Sempre al fresco anche al Sud

N

PIETRO VINCI

PROVINCIA DI

BURTENBACH

essun problema di temperatura anche nella calda Italia Meridionale. Spezzano Trasporti Srl, con sede a Corigliano Calabro (Cs), ha ordinato 15 semirimorchi refrigerati premium Kögel che consentiranno alla ditta specializzata, tra l’altro, nel trasporto di alimenti freschi e surgelati, di svolgere al meglio il proprio lavoro. I nuovi semirimorchi Cool - PurFerro quality si distinguono per dotazione di serie ed elevato grado di personalizzazione: due elementi che hanno conquistato il management Spezzano. I veicoli refrigerati Kögel sono dotati di serie di un fondo di alluminio a bassa rumorosità, affinché le procedure di caricamento e scaricamento siano il più possibile silenziose. Per una migliore igiene e una più facile pulizia della zona del pianale, i furgoni refrigerati premium dispongono di telai in alluminio saldati. Il telaio del pianale impedisce inoltre la penetrazione dell’umidità nelle strutture portanti, aumentando così la durata e la redditività del semirimorchio. Naturalmente, Kögel Cool - PurFerro quality soddisfa i requisiti HACCP (Hazard Analysis and Critical Control Point) a garanzia della salute del consumatore per quanto riguarda il trasporto di prodotti alimentari deperibili nel traffico internazionale di merci. Inoltre, i furgoni refrigerati soddisfano i requisiti dei mezzi omologati ATP-

CON SEDE PRINCIPALE A CORIGLIANO CALABRO, IN COSENZA, L’AZIENDA DI TRASPORTI HA ORDINATO IN TOTALE

15 SEMIRIMORCHI REFRIGERATI PREMIUM

KÖGEL. LA DITTA SPECIALIZZATA, TRA LE ALTRE COSE, NEL TRASPORTO DI ALIMENTI FRESCHI E SURGELATI, IMPIEGA NUOVI SEMIRIMORCHI

COOL – PURFERRO QUALITY. SONO STATI LA DOTAZIONE DI SERIE E L'ELEVATO GRADO DI PERSONALIZZAZIONE DEL VEICOLO REFRIGERATO

KÖGEL A

CONQUISTARE

SPEZZANO. FRC. Le carrozzerie furgonate della versione refrigerata del Kögel Cool - PurFerro quality sono costituite da una schiuma speciale perfezionata e altamente isolante, priva al 100 per cento di CFC. Lo strato di copertura in acciaio, robusto e facile da pulire, è inoltre rivestito all'interno di pellicole di PVC rigido. Le pareti dello spessore di 60 millimetri, il tetto dello spessore di 85 millimetri e il fondo dello spessore di 125 millimetri garantiscono un

coefficiente di trasmissione del calore (valore K) notevolmente migliorato. Questa elevata protezione dall’influenza della temperatura riduce il consumo di energia consentendo al tempo stesso di ridurre i costi. In più, il veicolo possiede di serie un certificato di immobilizzazione del carico a norma DIN EN 12642 Codice XL, particolarmente adatto al trasporto ad accoppiamento geometrico di collettame e merci su pallet. Il furgone refrigerato pre-

mium di Kögel è disponibile anche con numerose dotazioni personalizzate per soddisfare le più diverse esigenze negli specifici settori di impiego. A richiesta, i veicoli Cool - PurFerro quality dispongono di un’attrezzatura RoRo per il trasporto accompagnato via nave o traghetto, costituita da quattro coppie di anelli di fissaggio per carichi pesanti con carico di rottura di 12.000 chilogrammi e apposita segnaletica a norma DIN EN 29367-2. Oltre a una coppia di rulli

antiurto in acciaio, sono montati due file di battute di gomma continue nella lamiera di chiusura del telaio e un bull bar di gomma a sinistra e a destra telaio del portale. Le guide piano e le barre di ancoraggio, in via opzionale schiumate direttamente nelle pareti, rendono superfluo il loro montaggio successivo e rappresentano un valido aiuto nell'immobilizzazione rapida e affidabile del carico. Della dotazione speciale fanno inoltre parte un sollevatore completamente auto-

matico del primo asse, un sistema che indica l’usura delle pastiglie del freno, un termografo, un portapallet per 36 europallet, un paio di chiusure a barre girevoli aggiuntive sul retro, un portaluci di acciaio, diverse luci a LED e molto al tro. Infine, anche nel Kögel Cool - PurFerro quality tutto il telaio del veicolo è protetto in modo durevole dalla corrosione mediante la tecnologia nanoceramica più rivestimento cataforetico con successiva verniciatura UV.

Venti semirimorchi per il trasporto sicuro di elettrodomestici

Kögel Cargo e Mega per Fried-Sped

L

a Fried-Sped Friedrichsohn Internationale Spedition GmbH, con sede a Ummendorf, in Germania, acquista 20 nuovi semirimorchi Kögel, quindici nella variante Kögel Cargo e altri cinque del modello Kögel Mega. I veicoli vanno a integrare il parco dello spedizioniere composto al 100 per cento da semirimorchi Kögel. I nuovi modelli saranno utilizzati prevalentemente per il trasporto di frigoriferi e congelatori di alta qualità di un produttore noto a livello internazionale. Già nella dotazione di base i semirimorchi Kögel Cargo e Mega presentano noti vantaggi, come i costi di manutenzione ridotti e l’elevata qualità della lavorazione. Per l’immobilizzazione del carico, il laterale perforato esterno in acciaio VarioFix dispone di 13 coppie di anelli fermacarico con una

forza di trazione di 2.000 chilogrammi ciascuno. La resistenza della carrozzeria soddisfa i requisiti della normativa DIN EN 12642 Code XL, il che rende superflua l'ulteriore immobilizzazione del carico in caso di trasporto ad accoppiamento geometrico. Grazie al telo tetto integrale Kögel di serie, inoltre, le cinghie non pendono più nello spazio di carico quando il tetto è aperto, poiché sono integrate nel telone. In questo modo si evita che le cinghie possano agganciarsi durante il carico e lo scarico. Nei semirimorchi Mega il carico e lo scarico di tre gabbie a griglia metallica impilate è agevolato dall’altezza libera interna di tre metri e dal tetto sollevabile meccanicoidraulico che rientra nella dotazione di serie. Lo stesso aumenta l’altezza di carico laterale e posteriore a oltre tre metri.

L’estensione riguarda 17 mercati

Mercedes-Benz Uptime integra anche i rimorchi

U

n anno dopo il lancio di MercedesBenz Uptime, il complesso programma di service sta per essere esteso fino a comprendere anche le attività riguardanti i rimorchi. “Questa iniziativa ha dichiarato Stefan Buchner, Direttore di Mercedes-Benz Trucks - risponde alla promessa da noi fatta di allargare l’accessibilità al Sistema Uptime progressivamente, in modo da soddisfare i nostri clienti con una soluzione proveniente da un unico fornitore per incrementare l’affidabilità del veicolo anche in configurazione con il rimorchio”. Lo scopo di Mercedes-Benz Uptime è raggiungere nel lungo periodo un significativo increment dell’affidabilità della combinazione trattore/semirimorchio grazie alla trasmissione digitale dei dati e delle informazioni. Con Uptime, infatti, i dati provenienti dal veicolo possono essere continuamente analizzati e così favorire un’ottimale programmazione degli interventi manutentivi. Per la prima volta, i problemi che solitamente interessano il sistema di

frenatura del rimorchio sono messi in evidenza per informare i client attraverso il portale apposito. In questa prima fase, vengono posti sotto controllo tre sistemi del rimorchio: la fornitura d’aria al sistema frenante e alle sospensioni pneumatiche, l’attuazione della frenatura e la presa di corrente del rimorchio. Se una perdita viene riscontrata nel circuito freni pneumatico questa viene immediatamente segnalata. Uptime sarà in grado di ricevere le informazioni sul trailer dal trattore e quindi inviarle al portale cliente attraverso il Truck Data Center e il server del Mercedes-Benz Service. Sulla base dei dati riportati, il fleet manager può iniziare la pianificazione degli interventi riparativi. La funzionalità di base del sistema è garantita per una vasta tipologia di variant trailer. Va anche ricordato che con Uptime, il truck è costantemente in contatto anche con il MercedesBenz Customer Assistance Centre a Maastricht e con l’officina Mercedes-Benz direttamente responsabile del cliente.


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 43

GIANLUCA ANNUNZIATA, MARKET MANAGER ITALY ALLTRUCKS

“OVID È STATA TRA LE PRIME OFFICINE AD ADERIRE” O VID conta oggi 34 dipendenti, ha chiuso il 2017 con un fatturato di 5,3 milioni di euro, in crescita rispetto ai 4,95 dell’anno precedente, e si prepara a consolidare e ulteriormente crescere quest’anno. Nel marzo 2016, tra le prime cinque officine OVID è entrata a far parte del Network Alltrucks. Già da diversi anni officina KnorrBremse (una delle tre aziende che hanno fondato Alltrucks insieme a ZF e Bosch), ad avvicinare l’azienda bergamasca alla Rete di assistenza europea sono state diverse variabili che ben sposano la strategia di Alltrucks. “OVID - ha spiegato Gianluca Annunziata,

Market Manager Italy Alltrucks - lavora molto nel segmento dei semirimorchi e nell’assistenza ai cambi ZF: quando nel 2016 abbiamo avviato la presenza di Alltrucks in Italia è stato un interlocutore naturale. La conoscenza con la famiglia Ubiali mi ha poi convinto della scelta: la disponibilità che hanno nei confronti del cliente è davvero encomiabile. Quando un professionista va in OVID non gli viene mai risposto di no: prendono in carico la questione e, se proprio non riescono a soddisfare la sua esigenza direttamente, lo indirizzano in modo da trovare una soluzione”.

Per Dino Ferdinando Ubiali Alltrucks rappresenta un’opportunità in più. “Far parte del Network Alltrucks - spiega - per noi è un supporto importante: abbiamo un partner cui fare riferimento. Con Alltrucks siamo facilitati nel trovare il giusto contatto per risolvere un problema al cliente nel modo più rapido ed efficace possibile. Un obiettivo che raggiungiamo potendo accedere a una serie d’informazioni e grazie al programma di formazione avviato da Alltrucks, che ci consente di avere personale sempre preparato e adeguatamente formato per l’utilizzo delle nuove tecnologie al servizio del trasporto”.

ALLTRUCKS / VISITA ALLA STORICA OFFICINA OVID DI DALMINE

Fedeli alla linea OVID È DA SEMPRE UN RIFERIMENTO NELL’ASSISTENZA ALLE AZIENDE DI TRASPORTO CHE, DALL’AREA BERGAMASCA MA ANCHE DA MASSA CARRARA, SONO AL SERVIZIO DI DALMINE SPA. LE SUE ORIGINI RISALGONO AL 1898: UNA TARGA BRONZEA DEL 1913 RICORDA IL PREMIO ASSEGNATO DA RE UMBERTO II ALLA PREMIATA FABBRICA DI CARRI UBIALI FILIPPO E FIGLI. OGGI AL TIMONE C’È LA QUARTA GENERAZIONE, SOTTO LA GUIDA DI ERMANNO UBIALI, PERSONAGGIO D’INCREDIBILE ENERGIA.

I

MAX CAMPANELLA DALMINE

n una targa di bronzo, copia di quella originale in o ro risalente al 1913, è sintetizzata non solo la lunga, gloriosa storia della OVID. In quella benemerenza, assegnata da re Umberto II per la realizzazione del rimorchio più potente del mondo, si cela tutta la straordinaria passione che lega la famiglia Ubiali al mondo del trasporto. A fare da sfondo a questa tradizione che risale al 1898, quando nasceva la Premiata Fabbrica di Carri Ubiali Filippo e Figli, è l’area che, in provincia bergamasca, unisce i comuni di Mozzo e Dalmine. STORIA DI FAMIGLIA

OVID (Officine Veicoli Industriali Dalmine), da marzo 2016 officina della Rete Alltrucks, oggi è guidata da Dino Ferdinando Ubiali, che porta il nome del nonno che, nel 1916, proseguì l’opera avviata dal trisavolo: quella che negli anni a cavallo tra i due se coli era già una rinomata of ficina, nel periodo tra le due guerre si specializzò nella manutenzione e costruzione di veicoli da trasporto. Ai tempi erano realizzati in legno e l’officina Ubiali si occupava di sistemare le sponde, oltre che realizzare carri. In un’immagine del 1929 sono visibili le due generazioni nelle persone di Filippo e Ferdinando che, dimostrando di essere decisamente avanti, già negli Anni Trenta partecipavano alle fiere di settore, a Varese, per tenersi informati sulle nuove tecnologie. Nel 1931 nasceva la terza generazione; tra i cinque fratelli, Ermanno Ubiali sin da giovane dimostra innate doti d’intraprendenza: unico a seguire la scuola professionale, con incredibile intuito apprende le prime basi di quello che, dopo la Seconda Guerra, ha assunto la forma di sviluppo tecnologico. Ben ricorda Ermanno gli anni del conflitto, quando l’officina Ubiali era un riferimento per la ma-

nutenzione anche dei veicoli militari: era solo un ragazzo quando quell’attività salvò la vita di suo nonno. “Era stato forgiato un anello per una ragazza contesa tra tedeschi e partigiani - ci racconta - e solo quando gli autisti ricordarono ai militari tedeschi il lavoro che svolgeva l’arresto fu sospeso”. Terminata la fase bellica lo sviluppo economico dà un’autentica volata alla Dalmine Spa, azienda che - a poca distanza da Mozzo - inizia a produrre tubi in acciaio partendo dal rottame di ferro. “Un po’ tutti i giovani in quel periodo - prosegue Ermanno Ubiali - diventavano tecnici al la Dalmine, imparando a usare fucina e martello e a lavorare al tornio. Forse i modi erano un po’ brutali, ma s’imparava il mestiere per davvero. Dalmine e dintorni era una vera scuola di apprendistato: tutto doveva essere ese-

guito al la perfezione, altrimenti si ricominciava il processo daccapo. Il mio primo lavoro? Raddrizzare chiodi e sistemare viti, perché lo scarto doveva essere il minore possibile”. Negli Anni Sessanta le co-

noscenze tecnologiche di Ermanno lo convincono a staccarsi dai fratelli. La prima sede è a Mozzo, ma dopo pochi mesi, sostenuto nella nuova impresa dal padre Ferdinando, Ermanno Ubiali intuisce che spostare la sede a Dalmi-

ne può rappresentare un valore aggiunto per i clienti, considerata la vicina uscita autostradale dell’A4 e la presenza della Dalmine Spa. “L’esigenza dei trasportatori che raggiungevano la Dalmine provenendo da Bergamo e da Massa Carrara - spiega Ermanno Ubiali - era talmente in crescita che il lavoro proprio non mancava: abbiamo iniziato in due, io e un operaio, e in poco tempo siamo arrivati a una decina di dipendenti”. Il core business era sempre l’officina e la costruzione di attrezzature per trasporto specifico, in particolare per carichi indivisibili. A Ubiali si deve il sistema con punto fisso su motrice e corsoio su rimorchio che, nelle sterzate, consentiva al carico di spostarsi in modo razionale. Sin dall’inizio il punto forte di Ermanno Ubiali è l’assistenza, con estrema disponibilità nei confronti del cliente. “Se succedeva qualcosa precisa - si partiva con il camioncino e li si raggiungeva sulla Cisa per effettuare riparazioni sul posto”. Nel 1968 nasce Dino Ferdinando, quarta generazione. Quando il “piccolo erede” sta crescendo, esattamente nel 1974, nasce OVID: Ermanno Ubiali ha appena individuato una nuova area nei pressi del casello. Il 24 dicembre 1974 iniziano i lavori della nuova sede. Nel dicembre 1979 viene effettuato il trasloco, con tanto di scorta della Polizia

municipale. Il 2 gennaio 1980 è operativa la nuova OVID: 4.600 mq di officina, oltre ad altri 750 mq nel distaccamento di Lallio, e 18mila mq di piazzale. Dino Ferdinando e il fratello Federico, di quattro anni più piccolo, trascorrono l’infanzia giocando con la tuta da lavoro. È scritto nel loro destino, ma più ancora a farla da padrone è la passione: a 14 anni il primogenito ha già il libretto di lavoro. Lo spirito è quello di sempre: “Il mio primo lavoro? - ricorda Dino Ferdinando - Mio padre mi diede una scopa e mi mandò a pulire la strada intorno all’officina, perché l’azienda deve essere sempre ben pulita e organizzata”. Dino Ferdinando di giorno lavora, la sera studia Ragioneria. Nel 1991 affianca suo padre a tempo pieno. Con l’arivo della quarta generazione - Dino si occupa della clientela, Federico di oleodinamica OVID diventa officina certificata per le gru Palfinger, di cui è anche Concessionaria, nella top tre per volume di acquisto gru. All’assistenza multimarca per l’intero mondo dei veicoli industriali (autocarri, semirimorchi, assali, sponde ecc.) affianca l’attività di allestimento. Un altro ramo di OVID si occupa inoltre di manutenzione specifica per semirimorchi che trasportano bombole d’idrogeno: al professionista che si reca in OVID sono garantiti manutenzione e collaudo certificati SIAD.

Da sinistra: Gianluca Annunziata, Dino Ferdinando, Ermanno e Federico Ubiali della OVID di Dalmine, e Alice Biganzoli, Marketing Manager Italy Alltrucks.


IL MONDO DEI TRASPORTI

Pagina 44

N° 268 / Aprile 2018

MASSIMA GARANZIA NEL TRASPORTO DEL FARMACO CON LA CERTIFICAZIONE PHARMASAFE+ DI LAMBERET

PROGRESSI CONTINUI PER LA SALUTE DI TUTTI S i chiama Pharmasafe+ la certificazione di Lamberet che garantisce la perfetta coibentazione per il trasporto dei prodotti medici per la salute. Un allestimento su misura applicabile a tutta la gamma veicoli, dai veicoli industriali ai commerciali leggeri, per il trasporto sicuro del farmaco. Una filiera, quella della salute, che in Italia vale circa l’11 per cento del Pil e dà lavoro a oltre 2 milioni di persone. Lamberet lancia un’offensiva forte sul fronte del trasporto sicuro del farmaco dotando tutta la sua gamma di veicoli, dai semirimorchi agli autocarri e agli LCV, di certificazioni ad hoc come Pharmasafe+. Il primo veicolo isotermico in Italia certificato per il Pharma è in consegna al cliente Napoli Uno, società di Crispano specializzata nei trasporti a temperatura controllata: si tratta del nuovo Volkswagen Crafter telaio-cabina allestito con cassa Lamberet New Frigoline certificata "Pharmasafe+" a K termico garantito

e gruppo frigo Thermo King V 300-50 montato con termo registratore e certificazione Pharma conforme al protocollo delle buone pratiche della distribuzione (GDP), con supervisione e convalida da parte di specialisti indipendenti che operano al servizio del settore farmaceutico. Il gruppo frigo è fornito di sistema di monitoraggio a distanza e tracciamento in tempo reale TracKing e consente di rilevare eventuali scostamenti di temperatura e di intervenire subito per proteggere il carico. Dalla cella isotermica al gruppo frigo, Lamberet offre il sistema d’isolamento più innovativo ed efficiente per il mondo della salute, che prevede materiali compositi dalla complessa manodopera. Lamberet è in grado di integrare le soluzioni di sicurezza per il trasporto del farmaco anche con specifici sistemi satellitari come Frigomatics, un sistema integrato progettato con Novacom. Frigomatics offre il vantaggio di un'interfac-

cia di gestione securizzata, accessibile 24h24 e 7 giorni su 7 attraverso il web con un supporto preferito tra PC, tablet, smartphone e permette di scaricare dati in tempo reale su variazioni di temperature, tempi di tragitto e consegna, sicurezza del trasporto del farmaco.

LAMBERET / NUOVO DISTRIBUTORE PER L’ITALIA DI MELFORM

Piccoli contenitori per grandi missioni GRAZIE ALL’ACCORDO COMMERCIALE LAMBERET DISTRIBUIRÀ SU TUTTO IL TERRITORIO ITALIANO I CONTENITORI ISOTERMICI E REFRIGERATI MELFORM SPECIFICI PER LA RISTORAZIONE, LA LOGISTICA ALIMENTARE E BIOMEDICALE. LAMBERET CONOSCE MEGLIO DI CHIUNQUE ALTRO

A

LINO SINARI LAINATE

PLAYER IL MERCATO DEL TRASPORTO ISOTERMICO AGROALIMENTARE E FARMACEUTICO E LE AZIENDE CHE LO COMPONGONO E HA UNA RETE VENDITA CAPILLARE IN TUTTA ITALIA FATTA DI VENDITORI E DEALER CHE LAVORANO OGNI GIORNO CON LE AZIENDE DEL SETTORE.

ffermato costruttore leader in Europa di soluzioni per il trasporto a temperatura controllata da 1 a 100 mc Lamberet allarga la sua sfera d’influenza diventando distributore per l’Italia di Melform, azienda italiana che da oltre 50 anni è specializzata nello studio, rea lizzazione e produzione di contenitori “amovibili” isotermici e refrigerati per la ristorazione, la logistica alimentare e la logistica biomedicale. Da sempre sinonimo di sicurezza e qualità, Melform offre una vasta gamma di contenitori e accessori ad e sempio per il settore del Food service, con capacità variabile da 20 a 150 litri e range di regolazione delle temperature da -25° C a + 40° C in grado di soddisfare ogni esigenza di trasporto a temperatura controllata, dai surgelati ai piatti caldi della ristorazione. L’accordo commerciale non nasce dal caso. Lamberet conosce meglio di chiunque altro player il mercato del trasporto isotermico agroalimentare e farmaceutico e le aziende che lo compongono e ha una rete vendita capillare in tutta Italia fatta di venditori e dealer che lavorano ogni giorno con le aziende del settore. “Con la distribuzione dei contenitori isotermici di Melform - spiega Ismaele Iaconi, Commercial & Marketing Director Lamberet Italia - il trasporto a temperatura controllata in multi-temperatura non ha più limiti. Le casse frigo Lamberet possono essere allestite con tre diverse temperature per trasportare ad esempio nello stesso carico i surgelati a -20°, il fresco a +4° e il secco a +8°. Ora, con i contenitori Melform, sulle casse Lam beret si possono trasportare prodotti, anche in piccole quantità, con una pluralità in-

finita di temperature da -25°C a +40°C. Pensiamo ad esempio alle opportunità per le società di catering che trasportano dal caldo al freddo”. “Le differenti capacità dei contenitori Melform - sottolinea Monica Lazzari, Marketing & Sales Manager Melform - si adattano perfettamente alle specifiche esigenze del cliente che trasporta prodotti deperibili, sia alimentari che farmaceutici. Offrono flessibilità nella gestione trasporti e ottimizzazione dei costi di delivery. Anche un piccolo minivan può essere caricato in multi-temperatura. Inoltre, i nostri contenitori

sono eco-friendly in quanto lavabili e sanificabili do po ogni trasporto per evitare contaminazioni e completamente riciclabili al termine della loro vita operativa”. Sono quattro le principali linee di prodotto Melform: Koala, specifica per la ristorazione con contenitori isotermici attivi, frigoriferi portatili e contenitori refrigerati; Cargo, ideale per la logistica alimentare con contenitori isotermici ad alta capacità per il trasporto dei prodotti deperibili; Biomed, studiata per la logistica biomedicale con frigoriferi portatili per il trasporto di campioni di laboratorio, vac-

cini e farmaci; Thermax, linea di contenitori per il trasporto dei pasti e delle be vande a temperatura controllata. Melform, ramo di azienda di Bonetto Group, vanta un Ufficio Tecnico altamente qualificato, in grado di studiare soluzioni personalizzate per specifiche esigenze di stoccaggio e di trasporto. Da sempre, Melform è sinonimo di sicurezza e qualità: i contenitori isotermici e refrigerati Melform sono distribuiti in tutto il mondo tramite una rete capillare di vendita di distributori e rivenditori specializzati. Numero uno in Italia. Nel 2017 Lamberet ha rafforzato

la sua posizione di leadership nel settore del trasporto a temperatura controllata. “Il giro d’affari è praticamente tri plicato dalla ristrutturazione avvenuta nel 2009 e stabilisce un record storico dalla creazione del marchio”, ha di chiarato Erick Méjean, Amministratore delegato di Lamberet SAS. Il fatturato del Gruppo francese è salito a 205 milioni di euro, con un in cremento del 2,4 per cento rispetto agli ottimi risultati dell’anno precedente. In Italia, Lamberet è il numero uno del mercato, con un giro d’affari di 40 milioni di euro e un margine operativo lordo del 12,9

I contenitori della linea Biomed di Melform sono studiati per il trasporto di campioni di laboratorio, vaccini e farmaci.

per cento. “I risultati - commenta Vincenzo Aristide Di Salvo, Ceo di Lamberet Italia - premiano gli sforzi della nostra politica commerciale soprattutto per la gamma dei veicoli medio-pesanti e dei veicoli commerciali leggeri che hanno fatto registrare un +17,3 per cento delle vendite rispetto al 2016”. A livello di Gruppo,il numero dei nuovi veicoli, per tutte le gamme, è salito del 7 per cento sull’anno precedente, e si è tra dotto nella consegna di 7.300 mezzi a temperatura controllata, di cui 4.400 veicoli industriali e 2.900 veicoli commerciali. Numeri che fanno di Lamberet il leader assoluto tra i produttori di carrozzerie frigorifere in Francia, tra i primi a livello mondiale con una struttura di distribuzione in 38 paesi e oltre 350 punti di servizio. Nord America e Cina sono i recenti sviluppi sui quali si punta come aree di ulteriore forte crescita nel prossimo futuro. Intanto, il portafoglio ordini del 2018 è già aumentato del 10 per cento, grazie al successo com merciale dei nuovi prodotti presentati all’ultimo Solutrans, il Salone internazionale di Lione dedicato ai professionisti del trasporto. Il 50 per cento del fatturato è stato realizzato per l’esportazione, con posizioni significative nei principali mercati europei. Il brand Lamberet è come detto leader di mercato in Italia, numero 3 in Germania, Olanda, Portogallo, numero 4 in Belgio, numero 5 in Spagna. Lamberet Italia ha venduto nel 2017 un totale di 1.100 veicoli frigoriferi, il 49 per cento semirimorchi e il 51 per cento autocarri e LCV. Autocarri e veicoli commerciali sono aumentati del 17,3 per cento a un totale di 557 unità. La quota di mercato Lamberet Italia nel solo settore dei semirimorchi è risultata pari al 22,7 per cento.


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 45

INTERVISTA / GIORGIO MOFFA, AMMINISTRATORE DELEGATO AUTOCLIMA

Cold line sempre più evoluta

A

MAX CAMPANELLA CAMBIANO

cquisita nel settembre 2017 da Indel B, società con sede a Sant’Agata Feltria, in provincia di Rimini, quotata all’MTA di Borsa Italiana e a capo di un gruppo attivo nella produzione di sistemi di refrigerazione per il mobile e mobile living per i mercati automotive, nell’anno pieno della nuova proprietà Autoclima punta a consolidare il suo ruolo di player in primo piano nel settore dei condizionatori, rivendicando con orgoglio la produzione italiana doc, che trova il suo baricentro nel sito di Cambiano, alle porte di Torino. A Cambiano lavorano circa un centinaio di persone e lo stabilimento, che copre circa 20mila mq fino a spingersi al confine con il comune di Toffarello, è una vera e propria fucina di giovani apprendisti, che garantiscono la continuità di una produzione che da sempre, sin dalle origini quan do venne fondata l’azienda è basata sull’obiettivo di realizzare prodotti innovativi, che anticipano le esigenze dei clienti e sbarcano in Italia prima che in altri mercati. “La chiave di differenza di Autoclima - precisa Giorgio Moffa, dal 1993 Amministratore delegato - sta nel suo essere un produttore che non realizza né vende oggetti, ma tecnologia, idee e soluzioni. Su questa capacità non c’è con fronto che tenga su importazioni da Paesi extraeuropei”. NATI IN ITALIA PER L’ITALIA

Insomma niente “guerra di prezzi”, quella di Autoclima, bensì una proposta di famiglie di prodotti progettati, sviluppati e costruiti in Italia per il mercato italiano. Con Moffa facciamo il punto sulla gamma, che a partire dall’anno scorso sta conoscendo una fase di costante e graduale evoluzione in tutte le sue diverse ramificazioni. “L’avanzata delle nuove tecnologie e la sempre crescente evoluzione dei sistemi di trasporto e di mobilità - spiega l’Amministratore delegato - oggi rispetto a dieci anni fa conduce necessariamente a ripensare i prodotti dopo cinque anni: se un decennio fa si aspettavano sette o otto anni per un restyling, oggi dopo un quinquennio si va oltre”. Giorgio Moffa è stato confermato nel suo incarico, che

tan to apprezzamento ha riscosso sul mercato. Continueremo a produrlo e distribuirlo per soddisfare una domanda della clientela che ce lo chiede espressamente: la nuova generazione garantisce maggiore potenza, ma abbiamo ricevuto richieste di clienti che, essendosi trovati molto bene con il modello RT 3000, proprio non ne vogliono sapere di cambiare”. Autoclima è anche produttore di gruppi frigo, con una nicchia di prodotti che coprono portate fino ai 35 q: la gamma Frosty è costituita da cir ca quaranta modelli, sviluppati per il trasporto di derrate alimentari, che sono tutti in fase di rinnovamento.

NELL’ANNO PIENO DELLA NUOVA PROPRIETÀ DI INDEL

B,

IL PRODUTTORE DI CONDIZIONATORI DI

CAMBIANO PROSEGUE L’OPERA DI RINNOVAMENTO DELLE FAMIGLIE DI PRODOTTI AVVIATE NEL 2017.

NEL SEGMENTO DEI PARKING COOLER

FRESCO RT 5000 È SBARCATO SUL MERCATO ALL’INIZIO DI

FOCUS SU VERSATILITÀ

QUEST’ANNO, ANDANDO AD AFFIANCARE LA PRECEDENTE GENERAZIONE. IN VIA DI RINGIOVANIMENTO ANCHE LE GAMME PER MINI E MIDIBUS E I GRUPPI FRIGO.

Giorgio Moffa, Amministratore delegato Autoclima.

ricopre da un quarto di secolo con un’indole da manager caratterizzato da massima operatività, ma anche con un approccio al mondo esterno dai clienti ai fornitori - basato su estrema cordialità e simpatia. Perché l’obiettivo di Autoclima, e l’obiettivo di Giorgio Moffa, è trovare soluzioni che facilitino la vita dei professionisti. E realizzare prodotti sempre più leggeri, più

performanti ma anche più competitivi sul mercato. PIÙ LEGGEREZZA PER I MINIBUS

“L’anno scorso - illustra Moffa - abbiamo rinnovato la gamma dei condizionatori per minibus: dal più piccolo a salire nella famiglia stiamo rinnovando tutti i prodotti, al fine di renderli ancora più leg-

geri e affidabili e con uno stile più moderno, dalle linee filanti. Nella prima fase di rinnovo ci siamo concentrati sulle gamme per mini e midibus, che rappresenta una fetta importante del business di Autoclima nel settore dei veicoli trasporto persone ”. Cambiamento tuttora in divenire: trattandosi di una famiglia di prodotti molto numerosa, il ringiovanimento proseguirà per l’intero 2018.

Fresco 5000RT, gioiello della gamma parking cooler di Autoclima. In basso a sinistra, Frosty, gruppo frigo per veicoli fino ai 35 quintali, e a destra il modello RT 85.

“Le novità nella famiglia di prodotti per bus - prosegue Moffa - sono veramente tante: in tutti i casi sono state aumentate le performance di con dizionamento, ridotta la rumorosità, il peso e i consumi. Il frutto della nuova progettazione è un prodotto più moderno, che segue un po’ le tendenze di design in atto nel mondo del bus: oggi mini e midibus sono più arrotondati e il condizionatore deve seguire le sue linee”. Il 2017 è stato anche l’anno della rivisitazione del parking cooler Fresco RT, condizionatore da stazionamento dedicato all’autocarro. “Rispetto alla precedente generazione - prosegue l’Amministratore delegato - l’attuale prodotto è più potente, è stato ridotto in altezza ed è più accattivante nel design: trattandosi di un condizionatore a tetto, visibile dall’esterno, anche l’occhio vuole la sua parte. Fresco 5000RT è un prodotto completamente nuovo, frutto di una nuova piattaforma produttiva: col finire del 2017 sono state attivate le nuove linee e sul mercato abbiamo oggi entrambi i modelli, quello attuale e il precedente Fresco 3000RT, che

La fase di rinnovamento delle famiglie di prodotti Autoclima proseguirà quest’anno, innanzitutto con il completamento della gamma di condizionatori per mini e midibus. “L’obiettivo - precisa l’Amministratore delegato - è avere entro fine anno una gamma completamente nuova. Proseguiremo con il rinnovo dei gruppi frigo: stiamo lavorando a nuovi modelli per il trasporto leggero studiati e sviluppati per l’esportazione in Paesi che badano al prezzo e alle performance, piuttosto che al design”. Del resto l’export rappresenta storicamente per Autoclima poco meno della metà del suo fatturato. Una volta completata questa fase quale sarà la “chiave di differenza” di Autoclima nel segmento dei condizionatori? “Sarà la gamma, in tutta la sua versatilità. Avremo a quel punto - risponde Giorgio Moffa in conclusione - una famiglia ampia, diversificata, moderna e in linea con le attuali esigenze dei settori ai quali ci rivolgiamo: parking cooler, ambulanze, minibus. Ad essa si aggiunge un elemento che rappresenta da sem pre la nostra forza: la fles sibilità. Pur avendo una capacità produttiva in grado di rispondere rapidamente alle richieste della clientela, riusciamo ad adattarci alle sue necessità con un lavoro qua si sartoriale. La nostra strategia è partire da prodotti standard ma, consapevoli che la clientela ha esigenze diverse, lavoriamo con flessibilità, in modo da proporre al cliente il prodotto giusto per le sue esigenze, a un prezzo sempre competitivo”.


IL MONDO DEI TRASPORTI

Pagina 46

N° 268 / Aprile 2018

INTERVISTA / FILIPPO PELLEGRINO, SALES MANAGER VIBERTI RIMORCHI

Orgoglio italiano CON UNA LUNGA ESPERIENZA MATURATA NELLE VENDITE DI VEICOLI INDUSTRIALI E AUTOBUS, DAL 1° GENNAIO FILIPPO PELLEGRINO HA ASSUNTO IL TIMONE DELL’AZIENDA CHE, PARTE DEL GRUPPO WIELTON, HA SEDE NELLO STORICO STABILIMENTO ABRUZZESE DI TOCCO DA CASAURIA. “STIAMO CRESCENDO NEI VOLUMI E NELLA RETE VENDITA: ABBIAMO LE CARTE IN REGOLA PER COMPETERE ALLA PARI CON I PLAYER TEDESCHI APPROFITTANDO DEL TREND POSITIVO”, AFFERMA IL NEO SALES MANAGER.

quale sono previsti futuri progetti - punta a rafforzare i marchi Cardi e Viberti, i cui veicoli vengono prodotti e verniciati in cataforesi nei suoi siti in Polonia, che hanno una capacità produttiva di oltre 15mila unità l’anno, e assemblati nella fabbrica abruzzese, da dove partono per raggiungere la Rete di Dealer. “Oggi - illustra Filippo Pellegrino - il Network Viberti Rimorchi è costituito da otto Concessionarie ufficiali: siamo molto presenti nel Centro e Sud Italia, dal Lazio alla Sicilia passando per Campania, Calabria e Puglia. Stiamo lavorando per nuovi dealer nel Centro Nord per la completare la Rete Vendita. Al momento sono af-

fiancato da quattro Area Manager e due risorse impiegate nel back office”. Il 2018 è partito bene per Viberti Rimorchi che, dopo un 2017 chiuso con dati positivi, per l’anno in corso continua la sua affermazione con una forte offensiva prodotti e l’implementazione della Rete. “Anche grazie alla nuova centina e alla combinata Gran Volume illustra Pellegrino - l’anno scorso abbiamo consuntivato oltre 200 unità in più rispetto al 2016, con un immatricolato passato da 650 a 880 unità: in entrambi i casi siamo entrati in segmenti molto competitivi, ma con soddisfazione i clienti ci hanno scelto apprezzando il nostro prodotto. Per l’anno in corso ci aspettiamo almeno gli stessi numeri del 2017, molto dipenderà dalla politica sull’intermodale, ovvero se il nuovo governo deciderà di investire con contributi statali: il segmento potrebbe svilupparsi come merita, ma necessita d’incentivi. Nel caso di un’importante ripresa siamo pronti a rispondere alla domanda con veicoli di punta, moderni e frutto dell’alta tecnologia produttiva di Wielton, alla quale affianchiamo l’allestimento in Italia”. Viberti Rimorchi ha chiuso il 2017 con una quota di mercato di circa il 5 per cento: con quale strategia si intende crescere nel 2018? “Nel Sud Italia - risponde Pellegrino - abbiamo una quota in media del 7,5 per cento: abbiamo introdotto un nuovo Area Manager nel Nord Italia, dove vogliamo crescere di più”.

Filippo Pellegrino, Sales Manager Viberti Rimorchi.

L

MAX CAMPANELLA TOCCO DA CASAURIA

a tempesta della crisi e conomica ha certamente rivoluzionato il settore dei semirimorchi. Sulla scia di molte aziende di trasporto messe alle strette,alle prese con bilanci in rosso, anche i produttori hanno dovuto fare i conti con il crollo dei vo lumi. Oggi, stante la necessità di far fronte a un mercato in ripresa con flotte moderne e in linea con un trasporto che deve rispondere a istanze di ecologia e risparmio nei consumi, le aziende hanno a disposizione un’offerta di prodotti veramente ampia e diversificata. Nel segmento dei rimorchi, tra i protagonisti di questo mondo che avanza in tecnologia e modernizzazione, Viberti Rimorchi punta orgogliosamente sul sito italiano di Tocco da Casauria: entrato nell’orbita del Gruppo Wielton produttore polacco di semirimorchi in prima linea in molti mercati europei - lo stabilimento abruzzese, adibito agli allestimenti dei mezzi a marchio Cardi e

Viberti, continua a rappresentare il punto di forza di Viberti Rimorchi, azienda che commercializza i due brand nel nostro Paese. La strategia Viberti e Cardi dal 1° gennaio è nelle mani di Filippo Pellegrino, classe 1973, manager esperto e di grande cordialità, cresciuto nelle vendite dei veicoli industriali. Inizialmente venditore di autocarri a marchio Mercedes-Benz, per sette anni Area Manager di Volvo Bus, ha vissuto una parentesi di due anni nel Gruppo Margaritelli come Area Manager e di un an no in DAF Trucks. Dall’aprile 2016 Area Manager Italiana Rimorchi, nel team guidato prima da Andrea Bettini e poi da Roberto Mollo, quest’anno ha assunto la pie na responsabilità delle vendite nel ruolo di Sales Manager dell’azienda di Tocco. “Ho assunto il nuovo incarico - afferma Pellegrino - innanzitutto con soddisfazione: ho imparato molto lavorando accanto alle persone che mi han no preceduto e oggi metto a frutto l’esperienza maturata al loro fianco. E poi con la

consapevolezza di far parte di un Gruppo che assegna grande importanza al Mercato Italia, per il trend positivo dei volumi registrati nel nostro Paese e soprattutto per valorizzare l’impianto di Tocco: la strategia

Wielton in tutta Europa è partire e consolidare il meglio dei marchi storici presenti nei Paesi dove intende affermarsi”. Nel caso dell’Italia, Wielton - messo in sospeso il marchio Merker, sul

Un semirimorchio della famiglia Cardi e, sopra, un veicolo firmato Viberti.

ENTRO FINE ANNO IN ARRIVO UNA NUOVA VERSIONE DI PORTACONTAINER

MAN BASSA DI ORDINI PER UNA GAMMA ARTICOLATA E VERSATILE C on quale famiglia di prodotti si presenta og gi sul mercato Viberti Rimorchi? “L’anno scorso - risponde Filippo Pellegrino, Sales Manager - abbiamo distinto il ventaglio complessivo in due famiglie: con il marchio Viberti andiamo a proporre tutto il ventaglio di veicoli general cargo, con Cardi proponiamo quelli che chiamiamo tipper, ovvero ribaltabili e mezzi per utilizzi specifici. Nel primo caso la gamma, particolarmente ampia, va dal classico centinato alla francese al centinato spondato a quello con buca coil, con tutte le portate occorrenti. Anche nel caso dei portacontainer abbiamo tutto quanto occorre al

mercato: il nostro cavallo di battaglia è il modello allungabile, sul quale è possibile caricare ogni tipo di container”. Caratteristica comune di tutti i veicoli è il tipo di acciaio utilizzato per i telai, l’S700, utilizzato anche nella famiglia Cardi. “Anche in questo caso - aggiunge Pellegrino - la gamma dei ribaltabili è completa, con vasche in acciaio per chi richiede massima robustezza o in alluminio per missioni che prediligono la leggerezza, e cubature che vanno dai 23 fino a 60 mc: un ventaglio ampio di modelli che al 99 per cento sono equipaggiati con assali SAF rinforzati”.

Tra le novità introdotte nel 2017 l’unità combinata Gran Volume, allestimento disponibile su motrice e su biga. “Da Viberti Rimorchi - precisa il Sales Manager dell’azienda abruzzese - il cliente riceve il veicolo “chia vi in mano”, completamente allestito nelle sue varianti alla francese o furgonata e nelle misure classiche da 7,45 o 7,80 o 8,20 m. L’anno scorso abbiamo lanciato la centina con portale posteriore in alluminio rinforzato e sistema di apertura delle porte posteriori: mantiene tutte le caratteristiche di robustezza e resistenza alla corrosione e garantisce maggiore funzionalità”.

Quali invece le novità di quest’anno? “Nella seconda metà del 2018 - afferma in conclusione Pellegrino - lanceremo una nuova centina tutta in alluminio, compresa la testata anteriore, veicolo che fa parte della lunga e gloriosa tradizione del marchio Viberti. Arriverà inoltre, entro fine anno, una nuova versione di portacontainer specifico per containers da 40’ e 45’ high cube. L’obiettivo è offrire alle nostre Concessionarie e al cliente finale una gamma che sia la più ampia possibile: su questo Wielton ha le capacità e la forza che consentono a Viberti e Cardi di competere alla pari con i player tedeschi”.


; IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 47

MAURELLI GROUP / LA GAMMA ACCESSORI GAM TECHNIC BRAND DI SUCCESSO

Pezzi da novanta

DISTRIBUITA IN ESCLUSIVA IN TUTTE LE FILIALI DEL GRUPPO, LA FAMIGLIA GAM TECHNIC È L’EMBLEMA DELLA VOLONTÀ DELL’AZIENDA DI ADATTARSI AI REPENTINI CAMBIAMENTI DEL MERCATO DI AUTOCARRI E SEMIRIMORCHI.

Q

NATA NEL 2013, LA RICCHISSIMA OFFERTA RICAMBI, DEDICATA SIA A MOTRICI SIA A RIMORCHI, È IN COSTANTE AGGIORNAMENTO. TRA I PRODOTTI DI MAGGIORE SUCCESSO I DISCHI GAM: CIRCA 200 CODICI PER LE APPLICAZIONI PIÙ COMUNI.

MICHELE S. ALTIERI CAPUA

chisce con frequenza continua. Il segreto del successo del brand distribuito in esclusiva da Maurelli è la sua combinazione fatta di qualità certificata a un prezzo super competitivo: il marchio rispecchia l’esperienza, la passione e la voglia di fare del Gruppo. La gamma, dedicata sia a motrici sia a rimorchi, è in crescita continua e si amplia con costante frequenza. Ad oggi l’offerta GAM Technic è molto ricca: componenti elettrici, kit perni fusi, valvole pneumatiche, brake chambers, filtri abitacolo, leve freno, tamburi freno, rivetti, batterie, kit riparazione compressori, segnalatori usura, dischi freno, pastiglie freno, alzacristalli elettrici, molle aria, colonnette, dadi e rondelle, ammortizzatori, tiranteria sterzo e accessori vari. I fornitori del private label GAM

Technic sono tutti certificati, i prodotti sono tutti omologati e certificati secondo gli standard europei e hanno una garanzia di uno o due anni in base all’articolo. Prima di essere commercializzati, i prodotti GAM Technic, per garantire un prodotto sicuro ed efficiente, sono sottoposti a sofisticati test nel laboratorio del Gruppo Maurelli, presso l’officina plurimarca Interservice di Trento. Presso la warehouse di Pastorano sono sempre disponibili oltre tremila articoli del private label Maurelli. Inoltre, tutti i cataloghi GAM Technic, costantemente aggiornati, si caratterizzano per la presenza di cross reference dal codice GAM a quello originale e viceversa nonché di schede tecniche e di immagini sezionate dei prodotti complete di descrizioni. Uno dei prodotti brandiz-

zati GAM Technic di maggiore successo è rappresentato dall’ampia gamma di dischi GAM che include circa 200 codici per le applicazioni più comuni come Iveco, DAF, MAN, Mercedes-Benz, Renault, Scania e Volvo, nonché Setra, Isuzu e Nissan. L’assortimento comprende inoltre un vasto numero di codici per rimorchi come Acerbi, BPW, Meritor, Kögel, SAF e Schmitz. I dischi GAM sono omologati secondo la norma ECE R90 e rispettano il nuovo standard qualitativo per il prodotto aftermarket. Questa normativa garantisce al disco GAM un risultato equivalente al prodotto originale in termini di sicurezza, efficienza e funzionalità. Il codice di omologazione rilasciato dalle autorità di approvazione è marchiato sul bordo del disco, insieme al codice GAM.

GAM Technic, marchio registrato e distribuito in esclusiva da Maurelli Group.

uello dei truck è un settore dinamico per antonomasia: se non cresci, non progredisci, rischi di andare a fondo. Maurelli Group l’ha capito e non si è fatta trovare impreparata. Oggi è leader del settore grazie alla capacità di soddisfare tutte le richieste del mercato, offrendo un’ampia gamma di servizi che coinvolgono autocarri, rimorchi e semirimorchi a 360 gradi. Core business dell’offerta Maurelli è la vendita di ricambi originali e aftermarket disponibili h 24. Per permettere una distribuzione capillare, l’azienda – che ha il suo headquarter a Capua, in provincia di Caserta, a pochi metri dal casello autostradale – si è dotata di un struttura distributiva che si articola in tutta la nazione, con le filiali italiane, e all’estero, con le

sedi di Malta e in Polonia. Maurelli, in questo modo, assicura ai professionisti del trasporto un’ottima gestione dei tempi di preparazione della merce, e grazie all’attenta selezione dei fornitori e dei corrieri garantisce che le consegne siano precise ed effettuate in tempi brevi. Emblema della volontà del Gruppo di sapersi adattare ai cambiamenti di un mercato come questo è stata

la decisione di sviluppare un proprio brand registrato, GAM Technic, che Maurelli distribuisce in esclusiva in tutte le sue filiali. GAM Technic – acronimo di Guaranteed AfterMarket – nasce nel 2013 ma ha già le qualità e l’esperienza di un veterano, grazie alla professionalità e alla competenza dei tecnici Maurelli. L’ampia gamma di ricambi a marchio GAM Technic è in costante aumento e si arric-

#8 `Jg ``Jg N#SSWS#=8

; ;

g=WJ  #1g "1G

À¹¯ª€„ “€¼pÊ£“|‘„ ¹„¼ ÆÊÆƓ “ ӄ“|¯£“ ÔÔ ÔÔ Ô p£Æ“©pª“£“Æ |¯©

; ; ; ; ;






IL MONDO DEI TRASPORTI

Pagina 48

N° 268 / Aprile 2018

KÖGEL / IL NETWORK SI ESTENDE VERSO IL MAR NERO

Unitrailer nuovo partner in Bulgaria UNITRAILER, EX ELIA TRANS, È GIÀ RAPPRESENTANTE GENERALE DI KÖGEL IN BULGARIA DAL 2001. I COLLABORATORI CONOSCONO I SEMIRIMORCHI E I SERVIZI DEL PRODUTTORE TEDESCO E SONO A DISPOSIZIONE DELLA CLIENTELA LOCALE PER L’ANALISI DI NECESSITÀ SPECIFICHE E PER LA CONSULENZA RELATIVA ALLA GAMMA PRODOTTI RIVOLTA AI SETTORI DELLE SPEDIZIONI E DELL’EDILIZIA. IN FUTURO DUNQUE UNITRAILER NON SI OCCUPERÀ SOLO DELLA VENDITA DEI VEICOLI NUOVI KÖGEL, MA ANCHE DEL SERVIZIO RICAMBI.

Thomas Gregor, Direttore della divisione veicoli usati internazionali Kögel.

C

VALENTINA MASSA BURTENBACH

on la società Unitrailer Kögel ha acquisito un nuovo partner in Bulgaria. In realtà, Unitrailer, ex Elia Trans, è già rappresentante generale del produttore tedesco in Bulgaria dal 2001. I collaboratori conoscono i se mirimorchi e i servizi di Kögel e sono a disposizione della clientela locale per l’analisi di necessità specifiche e per la consulenza relativa alla gamma prodotti rivol-

ta ai settori delle spedizioni e dell’edilizia. In futuro dunque Unitrailer non si occuperà solo della vendita dei veicoli nuo vi Kögel, ma anche del servizio ricambi in Bulgaria. Oltre alle scorte a magazzino di tut ti i ricambi originali Kögel più comuni, i clienti possono usufruire anche dell’assistenza in officina. Per questo all’indirizzo 8010 Burgas, Prof. YakimYakimov 3, sono a disposizione un nuovo edificio amministrativo e grandi capannoni adibiti a officina.

“Unitrailer ora è il partner di Kögel in Bulgaria per i veicoli nuovi, l’After Sales e l’assistenza in officina - afferma Denko Atanassov, Amministratore di Unitrailer - Per il 2018 ci siamo posti un obiettivo di vendita di 150 semirimorchi Kögel. Inoltre, a breve inizieremo anche con il montaggio dei semirimorchi Kögel, e in questo caso prevediamo altri 100 semirimorchi circa”. Kögel Used. Thomas Gregor, 44 anni, è stato nominato Direttore della divisione vei-

coli usati internazionali. In questa posizione, Gregor è responsabile del settore veicoli usati Kögel Used e avrà il compito di ampliarne ulteriormente e gradualmente l’in ternazionalizzazione. Tra le sue mansioni si possono citare, oltre all’acquisto e alla vendita di semirimorchi usati, anche la collaborazione con i settori vendita di veicoli nuovi per quanto riguarda i valori di riscatto e la permuta. Gregor riferisce direttamente a Massimo Dodoni, Amministratore delegato di Kögel. Il

nuovo Direttore vanta una pluriennale esperienza nelle vendite e nei veicoli usati nel settore dei semirimorchi e dei veicoli commerciali e ha mosso i primi passi nelle Vendite presso una nota società di noleggio di veicoli com merciali. Successivamente, ha ricoperto le più diverse posizioni dirigenziali nei settori dell’Asset Management e delle Vendite presso società di noleggio di veicoli commerciali rinomate a livello internazionale e concessionarie di veicoli usati. “Il mio obiettivo è quello di essere, insieme al mio staff di Burtenbach, Zwolle e Verona e ai miei colleghi delle Vendite, un partner corretto e competente per i nostri clienti in Eu-

ropa per tutte le questioni inerenti i veicoli usati”, ha affermato Thomas Gregor. “La vendita di veicoli usati ha le proprie leggi che variano da paese a paese: ognuno infatti vanta le proprie preferenze in termini di equipaggiamento. Dobbiamo quindi acquistare e vendere determinati tipi di veicolo in modo molto mirato - ha commentato Massimo Dodoni, Amministratore delegato Vendite di Kögel per i veicoli industriali sia nuovi che usati e il mondo dell’Aftermarket - Con Thomas Gregor abbiamo acquisito un candidato ideale per questa mansione che contribuirà naturalmente anche all’ulteriore ampliamento di Kögel Used”.

STRATEGIA INNOVATIVA PER CNH INDUSTRIAL CAMBIO AL VERTICE DI ZF

Verso il futuro con Microsoft Wolf-Henning Scheider nuovo Ad

C

Nuovo importante progetto di trasformazione digitale volto a sostenere i clienti dei brand agricoli e di Iveco.

NH Industrial e Microsoft hanno annunciato un nuovo progetto di trasformazione digitale, volto a sostenere i clienti dei brand agricoli globali di CNH Industrial - Case IH e New Holland Agriculture - e del suo marchio di veicoli commerciali Iveco con servizi tecnologici potenziati. I dati ottenuti dai veicoli connessi saranno utilizzati sia per ottimizzare le attività commerciali sia per liberare nuovi flussi di entrate, grazie all’introduzione di servizi digitali innovativi, basati sul cloud di Microsoft Azure e le sue tecnologie intelligenti. Il risultato atteso da questo progetto prevede che le macchine agricole di nuova generazione vengano sviluppate ed equipaggiate con innovative tecnologie di connettività per garantire agli utilizzatori una serie di servizi a valore aggiunto che sfruttano l’ampio insieme di dati ottenuti durante il funzionamento del mezzo. La Service Delivery Platform diventerà cruciale nel processo di digitalizzazione dei brand agricoli globali di CNH Industrial, contribuendo allo sviluppo di servizi di connettività avanzati e consentendo un trasferimento continuo di dati agronomici provenienti dalle macchine attraverso le tecnologie di Microsoft Azure basate sul cloud. I veicoli commerciali potranno usare l’innovativa tecnologia telematica per offrire nuove funzioni e capacità in tutti i segmenti di mercato ai responsabili delle flotte e ai clienti finali. I clienti potranno monitorare tutta una serie di parametri, dalla meccanica interna alle valutazioni dello stile di guida, beneficiando di una manutenzione proattiva e migliorando così il tempo di operatività complessiva del veicolo. Tra gli ulteriori vantaggi

per i responsabili delle flotte sono inclusi il monitoraggio dei consumi di carburante, così come la condivisione di questo dato con partner e fornitori per maggiori benefici. Attraverso la collaborazione con Microsoft, CNH Industrial è in grado di offrire ai clienti un insieme di potenti strumenti per utilizzare i Big Data per migliorare le loro attività. Questo progetto fa parte della Service Delivery Platform complessiva dell’azienda, che include tra le altre cose l’Internet of Things (IoT) industriale, l’intelligenza artificiale e le tecnologie di Analytics e Business Intelligence, che fanno tutte parte dell’ecosistema Microsoft. CNH Industrial potrà inoltre appoggiarsi al dipartimento dei Microsoft Enterprise Services per l’attuazione complessiva della Service Delivery Platform, affidandosi alle competenze degli Entreprise Services nel realizzare programmi di trasformazione digitale complessa, dalla strategia alla messa in pratica.

Z

Manager di grande esperienza, continuerà a implementare in modo sistematico la strategia ZF 2025.

F ha un nuovo Amministratore delegato. Si tratta di Wolf-Henning Scheider, che succede a Konstantin Sauer in veste di Ceo e capo del Gruppo tedesco. Il 55enne laureato in business administration vanta una pluriennale esperienza in campo dirigenziale in società tecnologiche quali Bosch e Mahle. “Nella veste di Ceo di Mahle, Wolf-Henning Scheider ha dimostrato straordinarie competenze in relazione a significativi processi di trasformazione - ha affermato Franz Josef Paefgen, Presidente del Consiglio di sorveglianza di ZF - Scheider è un esperto del settore e un leader che crede nel valore della continuità, con competenze tecniche e nella gestione dei rapporti interpersonali. Continuerà a implementare in modo sistematico la strategia ZF 2025. È inoltre un visionario e crede nel cambiamento guidato. Guiderà ZF, con il suo tatto e grazie a un’interlocuzione continua con tutte le parti, attraverso i complessi processi di trasformazione che l’intera industria automobilistica ha in questo momento di fronte a sé”. Wolf-Henning Scheider, nato a Saarbrücken, Germania, il 6 maggio 1962, ha studiato business administration all’Università di Saarbrücken e alla RWTH di Aquisgrana, Germania, dove si è laureato nel 1987. Successivamente ha iniziato un tirocinio presso Robert Bosch GmbH. Tra il 1989 e il 2010, in Bosch, ha ricoperto differenti posizioni quali, ad esempio, Vice Presidente Power Tools in Francia, Amministratore delegato della divisione Car Multimedia a Hilde-

sheim, Germania, e Amministratore delegato della divisione Gasoline Systems a Schwieberdingen, Germania. Dal 2010 al 2015 è stato membro del Consiglio di amministrazione di Robert Bosch dove è diventato portavoce del settore commerciale Automotive Technology nel luglio 2013. Wolf-Henning Scheider è entrato a far parte del Consiglio di amministrazione del Gruppo Mahle nell’aprile 2015 e ha assunto il ruolo di Presidente e Ceo nel luglio 2015.


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 49

WEBASTO PRESENTA LA SOLUZIONE FRIGO TOP RT-D

L’innovazione che rispetta l’ambiente CON GLI INNOVATIVI ED ECOCOMPATIBILI FRIGO TOP RT-D, PROGETTATI E PRODOTTI IN ITALIA, WEBASTO AMPLIA ULTERIORMENTE LA SUA GAMMA DI SOLUZIONI PER LA REFRIGERAZIONE MOBILE. PROGETTATA APPOSITAMENTE PER REFRIGERARE VEICOLI COMMERCIALI CON VOLUME DI CARICO FINO A 22 MC, LA NUOVA SERIE DI MODELLI OFFRE PRESTAZIONI SUPERIORI CON UN COSTO PER WATT TRA I PIÙ BASSI SUL MERCATO.

L

GIANCARLO TOSCANO MOLINELLA

a refrigerazione che va d’accordo con l’ambiente. Innovativa ed ecocompatibile. È quanto pro pone Webasto con Frigo Top RT-D per veicoli commerciali. Una gamma diversificata di potenti sistemi per

tutte le esigenze di trasporto, dalle derrate alimentari ai farmaci sensibili alla temperatura e ad altre sostanze deperibili. una soluzione su misura per ogni tipo di veicolo e di u tilizzo. Partner strategico per l’industria automotive, Webasto ha una presenza mondiale e sviluppa soluzioni innovative per il settore automotive da

oltre 100 anni. La sede centrale si trova in Germania (a Stockdorf) mentre la consociata Webasto Thermo & Comfort Italy di Molinella (Bo) si occupa dello sviluppo e della produzione delle tecnologie del freddo del brand. Ed è proprio in Italia che, dopo un lungo processo di R&D, prototipazione, simulazioni,

testing e validazione, è nata la linea Frigo Top, così come i più recenti Frigo Top RT-D. Con gli innovativi Frigo Top RT-D Webasto amplia ulteriormente la sua gamma di soluzioni per la refrigerazione mobile. Progettata appositamente per refrigerare veicoli commerciali con volume di carico fino a 22 mc, la nuova serie di modelli offre prestazioni superiori con un costo per watt tra i più bassi sul mercato. Questa soluzione completa offre una vasta gam ma di varianti in virtù delle molteplici potenze refrigeranti, i kit di riscaldamento opzionali, la posizione di installazione a tetto o frontale, la disponibilità delle versioni 12 V e 24 V e la vasta gamma di accessori. I Frigo Top RTD a trazione diretta presentano un design moderno, una struttura leggera e sviluppano fino a 4.300 W di potenza refrigerante. Questo sistema innovativo è ecocompatibile essendo disponibile per i refrigeranti R134a e R404A, ed è stato

progettato anche per l’utilizzo del nuovo refrigerante R452A conforme alla normativa UE N. 517/2014 per la riduzione delle emissioni di CO2. Frigo Top RT-D è stato progettato per ottenere la massima efficienza di scambio termico negli stessi volumi; inoltre, l’utilizzo del Model Based Design nella progettazione consente la simulazione delle prestazioni su modelli termodinamici prima che le unità siano testate in camera climatica o presso laboratori esterni, riducendo così i tempi e i costi di progettazione. Un altro vantaggio è dato dalla semplice manutenzione, anche grazie alla facilità di accesso dei componenti. Webasto offre anche uno speciale servizio post-vendita: il Priority Service Webasto con linea di emergenza 24 ore. Il servizio è disponibile in tutta Europa nella rispettiva lingua locale. La rete di assistenza, composta da oltre 500 rivenditori qualificati Webasto, offre un’assistenza rapida e professionale. La funzio-

nalità e l’affidabilità operativa del sistema di refrigerazione sono protette e garantite mediante intervalli di manutenzione annuali. Inoltre, quando si sceglie l’opzione di servizio completo, tutti i costi sostenuti durante la manutenzione o la riparazione sono coperti. Questo permette agli imprenditori di avere il controllo completo dei costi e di fare affidamento sulla gestione veloce e semplice dei loro trasporti. Webasto ha compiuto grandi investimenti nell’ambito dello sviluppo dei sistemi a temperatura controllata per il trasporto di alimenti, medicine e sostanze deperibili, tanto che è in grado di offrire una gamma diversificata e completa di sistemi di refrigerazione fino ai 6 kW di potenza refrigerante. Tale gamma si estende dai sistemi a trazione diretta totalmente integrati ai sistemi direct drive con montaggio a tetto o frontale, ai sistemi elettrici fino a 2 kW e ai sistemi multi temperatura, consentendo così un’ampia varietà applicativa.

IVECO / STRALIS CON ALLESTIMENTO SCARRABILE B.T.E PER LA FLOTTA LAMACART

Fiducia sulla carta

S

LINO SINARI

VILLAFRANCA DI VERONA

tralis continua a soddisfare le richieste delle aziende di trasporto. Iveco ha consegnato 10 Stralis AT260S48 Y/FSD a Lamacart, gruppo veronese che offre soluzioni industriali al servizio dell’ambiente oggi leader in Europa nel recupero della carta da macero. Un’attività nata negli anni Trenta del secolo scorso grazie all’intraprendenza di Francesco Nicolis, che decide di “inizare a raccogliere ciò che gli altri gettano via: la carta da macero”. Negli anni ’60 il figlio Luciano trasforma questo spirito di iniziativa in un’azienda strutturata, oggi guidata dalla terza generazione Nicolis. La cerimonia ufficiale di consegna dei nuovi Stralis si è svolta a Villafranca di Verona, presso il Museo Nicolis, dove Luciano ha collezionato oggetti introvabili e preziosi, che l’interesse per la meccanica lo ha portato a cercare in tutto il mondo: dalle automobili alle motociclette e biciclette, dagli strumenti musicali alle macchine fotografiche e per scrivere. Oggi le attività famigliari sono portate avanti con la stessa passione ed estrema professionalità da Thomas Nicolis, Presidente Lamacart, e dalla sorella Silvia, Presidente

del Museo. Per le missioni nelle quali verranno impiegate, il cliente ha scelto le motrici Stralis nella configurazione a tre assi e con sospensione pneumatica integrale, punto di riferimento per l’elevata versatilità e la straordinaria facilità di allestimento. Le caratteristiche del mezzo esaltano le peculiarità dell’attrezzatura, combinando maneggevolezza e gestione semplificata dei carichi trasportati. L’equipaggiamento dei veicoli prevede un

motore Cursor 11, in grado di sprigionare una potenza di 480 cv che, grazie alle massime prestazioni e alla sua elevata affidabilità, conferiscono allo Stralis le giuste specifiche per affrontare ogni tipo di missione. L’esclusivo sistema di post trattamento dei gas di scarico HI-SCR garantisce un abbattimento di NOx fino al 97 per cento. Più leggero, meno ingombrante, più efficiente e più semplice da manutenere di qualsiasi altra so-

luzione Euro 6, mentre riduce le emissioni di CO2, l’HI SCR riduce anche i costi. L’al lestimento dei veicoli è stato curato dalla Busi Group, azienda all’avanguardia nel settore della produzione e commercializzazione di prodotti per la raccolta, la compattazione e il trasporto dei rifiuti, attraverso la B.T.E. Busi Tecnologie Ecologiche, società del gruppo, che vanta un team di ingegneri e progettisti specializzati nella creazione di attrezzature di alta qualità, in grado di rispondere alla richiesta specifica del cliente con il massimo livello di personalizzazione. In un’ottica di flessibilità e

funzionalità, i veicoli sono stati equipaggiati con attrezzatura scarrabile (MEC modello KT 20/65) a doppio sfilo, per il trasporto di un ampio range di casse (da 4,8 a 7,2 m), caratterizzata da un angolo di ribaltamento a 52°, che agevola lo scarico delle merci anche in strutture chiuse; presentano una dotazione che ne migliora la sicurezza operativa, come il gancio di incarramento con chiusura pneumatica. I 10 Stralis verranno impiegati per trasportare container e compattatori dalla sede del gestore del servizio al cliente finale e saranno ritirati una volta pieni, ottimizzando i viaggi.

IVECO HA CONSEGNATO 10 STRALIS AT260S48 Y/FSD A LAMACART, GRUPPO VERONESE CHE OFFRE SOLUZIONI INDUSTRIALI AL SERVIZIO DELL’AMBIENTE OGGI LEADER IN

EUROPA

NEL RECUPERO DELLA CARTA DA MACERO.

I

VEICOLI SONO STATI EQUIPAGGIATI CON ATTREZZATURA SCARRABILE E L’ALLESTIMENTO È STATO CURATO DA

BUSI

GROUP, AZIENDA ALL’AVANGUARDIA NEL SETTORE DELLA PRODUZIONE E COMMERCIALIZZAZION E DI PRODOTTI PER LA RACCOLTA, LA COMPATTAZIONE E IL TRASPORTO DEI RIFIUTI.


IL MONDO DEI TRASPORTI

Pagina 50

N° 268 / Aprile 2018

11 CAMION IVECO E RENAULT TRUCKS NELLA FLOTTA PUBBLICA DELLA VILLE LUMIÈRE

Parigi punta su veicoli a gas con trasmissioni Allison AGLI INIZI DELL’ANNO, IVECO E RENAULT TRUCKS SONO STATE SCELTE PER FORNIRE VEICOLI ALIMENTATI A GAS NATURALE CON DIVERSI ALLESTIMENTI TRA CUI GANCI SCARRABILI, GRU ARTICOLATE E PIATTAFORME AEREE.

GLI 11 NUOVI VEICOLI, TUTTI ALLESTITI CON

ALLISON, SONO DUE IVECO EUROCARGO, DUE IVECO STRALIS E SETTE RENAULT DELLA GAMMA D WIDE. AUTOMATICI

S

PIETRO VINCI PARIGI

empre più di attualità i veicoli alimentati a gas naturale, preferiti non solo per motivi ecologici a quelli dotati di propulsori Diesel. La flotta pubblica di veicoli commerciali e pesanti del Comune di Parigi si è arricchita infatti all’inizio dell’anno di 11 nuovi mezzi, tutti alimentati a gas naturale. Non solo, ma questi veicoli sono tutti allestiti con trasmissioni completamente automatiche Allison. “Ai nostri autisti piace il grande comfort di guida dei veicoli con le trasmissioni automatiche Allison,” ha detto Hervé Foucard, responsabile della flotta pubblica del municipio di Parigi. “Queste trasmissioni, in abbinamento ai motori a gas naturale, ottimizzano le prestazioni dei nostri veicoli. Inoltre, i camion richiedono una minore manutenzione, perché i motori subiscono una minore usura.”

La flotta del Comune di Parigi possiede 100 veicoli da 16 a 44 tonnellate. Trasportano carichi e prodotti diversi: dal legname alle pietre per la pavimentazione, dalle attrezzatu-

re scolastiche alla documentazione. Dal 2014, in linea con il suo impegno verso la sostenibilità, il comune di Parigi ha congelato i suoi ordini di veicoli pesanti, decidendo di ban-

dire il diesel dai suoi acquisti pubblici, nell’attesa che i costruttori lanciassero sul mercato modelli nuovi a carburanti alternativi. Così, agli inizi dell’anno, Iveco e Renault Trucks

sono state selezionate per fornire veicoli alimentati a gas naturale con diversi allestimenti tra cui ganci scarrabili, gru articolate e piat taforme aeree. Gli 11 nuo vi veicoli,

Iveco Stralis NP fa parte della fornitura per il comune di Parigi. Sopra, i veicoli della gamma Renault Trucks D Wide.

tutti allestiti con automatici Allison, sono due Iveco Eurocargo, due Iveco Stralis e sette Renault Trucks della gamma D Wide. I motori a gas naturale rispondono meglio se abbinati a una trasmissione Allison. Il convertitore di coppia Allison moltiplica la coppia motore allo spunto, migliorando in maniera significativa la capacità di avviamento. Rispetto alle trasmissioni manuali e ai semiautomatici, la Continuous Power Technology™ consente un’accelerazione più immediata, una maggiore pro duttività e più efficienza, sfruttando al meglio i benefici dei motori a gas naturale. “Grazie alle trasmissioni automatiche Allison, i veicoli sono sempre disponibili e operativi, e questo è fondamentale per noi perché riusciamo a ottimizzare il lavoro,” ha detto Foucard. “Meno rotture, migliori prestazioni: questo è essenziale per gestire il nostro carico di lavoro.”

IMPORTANTE TRAGUARDO PER ALLISON SERIE 4000

FESTEGGIATA CON TUTTI I DIPENDENTI LA TRASMISSIONE NUMERO 500.000 A llison Transmission ha annunciato la produzione della trasmissione automatica Serie 4000™ numero 500.000. Questa serie di trasmissioni, impiegata su un’ampia gamma di veicoli industriali, si utiizza in numerose applicazioni: dai camion per la raccolta rifiuti a quelli per il movimento terra, dai veicoli per le emergenze a quelli per la distribuzione, dagli autobus ai caravan. Allison ha iniziato a produrre le trasmissioni Serie 4000 nel 1993, nel suo quartier generale di Indianapolis. Per poter soddisfare le richieste al di fuori del Nord America, nel 2005 la società ha iniziato a produrre la trasmissione anche nel suo stabilimento di Szentgotthárd, in Ungheria. Le trasmissioni completamente automati-

che Allison utilizzano la Continuous Power Technology™ per moltiplicare dolcemente la coppia motore e fornire maggiore potenza alle ruote. Grazie a questa tecnologia, le flotte possono avere maggiore produttività, risparmi sui consumi, comfort di guida, sicurezza e flessibilità operativa rispetto alle trasmissioni manuali o automatizzate (AMTs). Riconosciute in tutto il mondo per la loro qualità ed affidabilità, le trasmissioni Allison sono rinomate per il miglior valore economico globale. Questo è dimostrato dal maggior valore residuo che accompagna un veicolo con trasmissioni Allison, rispetto a uno con una trasmissione manuale, automatizzata o a doppia frizione (DCT). Del resto, non si arriva a 500.000 per caso.


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 51

Enno Straten, Direttore della divisione Commercial Specialty Tires di Continental, e un’immagine sul campo delle applicazioni innovative del produttore di pneumatici tedesco.

CONTINENTAL E IL FUTURO DELLE APPLICAZIONI OFF-THE-ROAD

Tecnologia in primo piano ENNO STRATEN, DIRETTORE DELLA DIVISIONE COMMERCIAL SPECIALTY TIRES DEL PRODUTTORE TEDESCO, HA TENUTO UN DISCORSO DURANTE L’ANNUALE MANIFESTAZIONE “TIRE TECHNOLOGY EXPO” AD HANNOVER. DIGITALIZZAZIONE, AUTOMAZIONE E CONNETTIVITÀ LE PRINCIPALI LINEE-GUIDA DELLA CRESCITA NEL SETTORE: “LE SOLUZIONI DIGITALI PROPOSTE DA CONTINENTAL CONSENTONO DI MIGLIORARE DURATA D’ESERCIZIO, PRODUTTIVITÀ, SICUREZZA E RAPPORTO QUALITÀ-PREZZO”, AFFERMA STRATEN.

D

MICHELE S. ALTIERI HANNOVER

ifferente, specializzato e ambizioso: il mercato globale dei pneumatici OTR (off-the-road) sta crescendo. Secondo recenti studi, il mercato OTR registrerà un tasso di crescita annuale di circa il quattro per

cento in termini di volumi e di circa il 5 per cento in termini di fatturato, fino al 2022. Digitalizzazione, automazione e connettività saranno i driver principali di questa crescita: già oggi otto aziende su dieci si basano su soluzioni informatiche altamente specializzate per gestire, ad esempio, le operazioni

logistiche. Durante la manifestazione Tire Technology Expo di quest’anno ad Hannover, Enno Straten, direttore della divisione CST (Commercial Specialty Tires) di Continental, ha parlato di questi trend nel settore off-the-road e di come Continental stia già da tempo affrontando queste sfide.

“Continental - afferma Straten - sta diventando sempre più un fornitore di servizi e soluzioni per quanto concerne il settore off-the-road, e non solo un produttore di pneumatici. Oltre alle specifiche misure di pneumatici previste per le innumerevoli applicazioni di questo settore, i clienti chiedono sempre più

soluzioni che consentano una maggiore durata d’esercizio. È proprio qui che entra in gioco la nostra tecnologia, con applicazioni innovative come ContiConnect, ContiPressureCheck and C-Logger”. Il discorso di Straten ha fatto parte della conferenza programmatica della manifestazione: con più di 290 espositori e più di 5mila visitatori, Tire Technology Expo rappresenta la principale vetrina mondiale dell’alta tecnologia applicata ai pneumatici. I visitatori hanno avuto modo di ammirare soluzioni e materiali che coprono l’intero ciclo produttivo. Da Hannover arriva inoltre la notizia che quest'estate Continental andrà a estendere il suo portafoglio radiale per macchine agricole. Al debutto una nuova denominazione dei pneumatici: TractorMaster la punta di diamante della serie 65 che integra i pneumatici

NOKIAN TYRES FESTEGGIA 120 ANNI

Dal grande Nord a tutto il mondo PRODOTTI INNOVATIVI, UN BRAND AFFIDABILE E L’IMPEGNO NEI CONFRONTI DEI CLIENTI HANNO CONFERITO AL PRODUTTORE DI PNEUMATICI PIÙ NORD DEL MONDO UNA POSIZIONE DI FORZA SUL MERCATO. IN

120 ANNI,

L’AZIENDA FINLANDESE È DIVENTATA UN BUSINESS MONDIALE CHE GUARDA AL FUTURO, RINNOVATA E PRONTA AD AFFRONTARE LE NUOVE OPPORTUNITÀ.

C

VALENTINA MASSA NOKIA

ome altre grandi industrie del settore automotive, anche Nokian Tyres ha superato abbondantemente il secolo di vita e oggi festeggia ben 120 anni di attività e presenza nel business mondiale degli pneumatici. Nokian Tyres celebra i suoi 120 anni come pioniere del settore. Prodotti innovativi, un brand affidabile e l’impegno nei confronti dei clienti hanno conferito al produttore di pneumatici più nord del mondo una posizione di forza sul mercato. In 120 anni, l’azienda finlandese è diventata un business mondiale che guarda al futuro, rinnovata e pronta ad affrontare le oppor-

tunità offerte da un mondo in continua evoluzione. “Siamo orgogliosi delle nostre radici e del nostro forte patrimonio tecnologico, dell’elevata alta qualità e dello Spirito Hakkapeliitta. In qualità di esperti delle condizioni di guida difficili, abbiamo promosso e agevolato il trasporto sicuro per decenni. Tutto questo è una buona base per costruire una storia di successo ancora più forte insieme al nostro personale, ai nostri clienti e ai nostri partner”, ha dichiarato Hille Korhonen, Presidente e CEO di NokianTyres. Le tappe di Nokian Tyres raccontano una storia importante legata all’industria della gomma finlandese. Fondata nel 1898 come Suomen Gummitehdas Osakeyhtiö, l’azien-

da ha prodotto galosce, guarnizioni in gomma, diversi tipi di tubi e, in seguito, pneumatici per le biciclette. La produzione degli pneumatici per auto inizia nei primi anni del

’900 quando il numero di automobili inizia a crescere. La vera svolta nel settore degli pneumatici per Nokian Tyres avvenne nel 1934, quando l’a zienda sviluppò il primo

Negli Anni ’30 Nokian sviluppa il primo pneumatico invernale.

pneumatico invernale al mondo, il “Kelirengas”. Due anni più tardi inizia la produzione del primo pneumatico invernale Hakkapeliitta che ha spalancato le porte alla crescita e al mercato internazionale. Nokian Hakkapeliitta è da oltre 80 anni il principale marchio di pneumatici invernali. Oggi, Nokian Tyres è l’azienda più redditizia nel suo business; impiega 4.600 professionisti in tutto il mondo e ha un fatturato netto di circa 1,6 miliardi di euro. I prodotti della Casa scandinava sono venduti in quasi 60 paesi. I me ga trend come le nuove forme di mobilità, la digitalizzazione e il cambiamento climatico stanno mettendo alla prova il settore, ma stanno anche offrendo nuove e interessanti opportunità di cresci-

standard Tractor70 e Tractor85. Inoltre, il produttore tedesco lancerà uno pneumatico per mietitrebbie nella misura 800 / 65R32 178 A8 che sarà denominata CombineMaster. I nomi dei nuovi pneumatici sono in linea con il concetto di denominazione di tutti i pneumatici Continental OTR: proprio come i pneumatici per applicazioni portuali , i nomi connettono il tipo di veicolo utilizzato con il termine "Master". Il concetto di denominazione utilizza la logica di tutti i pneumatici Continental OTR che padroneggiano letteralmente le sfide del veicolo specifico per cui sono sviluppati. In conseguenza del lancio e della denominazione del pneumatico per trattore serie 65, il pneumatico TractorMaster per l'utilizzo su trattori terminali in applicazioni portuali verrà rinominato TerminalMaster entro la prossima estate.

ta che Nokian è pronta a cogliere e sfruttare. “Possiamo restare ai vertici del settore solo attraverso uno sviluppo e un rinnovamento costante. Que sto significa, per esempio, espandersi al di fuori del tradizionale mercato degli pneumatici invernali e investire in servizi che rendano an cora più facile prendersi cura degli pneumatici. Abbiamo intenzione di continuare il nostro lavoro sistematico e sostenibile verso lo sviluppo di soluzioni innovative e mantenere la nostra capacità di adattarci rapidamente e in modo flessibile ai cambiamenti che ci circondano”, ha aggiunto il numero uno Korhonen. Per celebrare il suo anniversario, Nokian Tyres ha deciso di ridefinire il suo brand. Il nuovo marchio riflette la lun ga storia dell’azienda, il business sostenibile e i valori nordici. Un rinnovamento che risponde alle mutevoli esigenze dei consumatori e consente a Nokian di diventare più attraente nelle aree strategiche di crescita, in particolare Nord America ed Europa centrale, dove l’azienda sta cercando uno sviluppo redditizio anche al di fuori dei tradizionali mercati degli pneumatici invernali. “Le nostre robuste radici come produttori scandinavi di pneumatici e pionieri nelle condizioni atmosferiche impegnative permettono di e spanderci con successo in altri segmenti, compresi quelli degli pneumatici estivi e allseason”, ha concluso Hille Korhonen.


IL MONDO DEI TRASPORTI

Pagina 52

N° 268 / Aprile 2018

PETRONAS HA INAUGURATO IL NUOVO CENTRO RICERCA & TECNOLOGIA

Il futuro parte da Santena

B

MAX CAMPANELLA SANTENA

en oltre l’apertura di un nuovo sito. L’evento con il quale Petronas, attraverso la sua divisione PLI (Petronas Lubricants International), ha inaugurato il nuovo Centro di Ricerca & Tecnologia di Santena, al confine con Villastellone dove, a pochi chilometri da Torino, sorge il suo quartier generale, dimostra in tutta la sua concretezza lo sguardo verso il futuro dell’unico produttore di lubrificanti che ha il baricentro globale in Italia. Una proiezione verso il futuro possibile che, oltre agli aspetti d’innovazione produttiva, è frutto delle partnership che Petronas ha costruito negli ultimi anni, con i suoi clienti - in primis le Case costruttrici - e con le istituzioni. Perché l’obiettivo non è solo fare business ma “realizzare un sogno insieme ai partner che hanno creduto in noi, hanno lavorato al nostro fianco e condividono il nostro progetto di mobilità intorno al mondo”, ha affermato Giuseppe D’Arrigo, autentico protagonista dell’evento inaugurale nel suo ruolo di CEO e Amministratore delegato del Gruppo PLI. All’avanguardia nell’innovazione della ricerca e dello svi luppo, il nuovo Centro R&T, destinato a diventare riferimento globale per tutte le formulazioni future dei prodotti Petronas, ha richiesto un investimento di circa 60 milioni di dollari, a testimonianza dell’impegno costante del gruppo nel campo dell’innovazione della tecnologia dei fluidi. L’evento ha rappresentato un’anteprima esclusiva

GIUSEPPE D’ARRIGO, CEO E AD DEL GRUPPO PETRONAS LUBRICANTS INTERNATIONAL, E SYED ZAINAL PRESIDENTE DEL

BOARD E VICE PRESIDENTE DI

PETRONAS DOWNSTREAM MARKETING, CON LA POSA DI UNA PARTICELLA MOLECOLARE HANNO APERTO LE PORTE PER UN VERO E PROPRIO TOUR NEI NUOVI LABORATORI PIEMONTESI. “È IL FRUTTO DELLA PARTNERSHIP CON I PLAYER CHE HANNO CREDUTO IN NOI”, HA AFFERMATO D’ARRIGO. per i partner storici di Petronas per lo sviluppo di fluidi e lubrificanti, ovvero i gruppi FCA e CNH. “La collaborazione - ha dichiarato D’Arrigo nel suo discorso di benvenuto - è l’essenza di ogni partnership e rappresenta la formula vincente: lavorare insieme, condividere conoscenze, capacità tecniche ed esperienza. Petronas è impegnata nel ricoprire

il ruolo di leader mondiale in veste di partner di soluzioni tecnologiche”. Al suo fianco in un originale taglio del nastro (la posa di una particella molecolare ha fatto sollevare la copertura e reso visibile gli interni) è intervenuto Dato’ Sri Syed Zai nal Abidin Syed Mohd Tahir, vice presidente di Petronas Downstream Marketing e presidente del Board di

Autorità manageriali e istituzionali presenti alla cerimonia d’inaugurazione del nuovo Centro di Ricerca & Tecnologia di Santena, polo avanzato dell’organizzazione Petronas.

PLI. “Il nostro centro tecnologico di Torino - ha dichiarato l’alto manager Petronas - è il cuore delle nostre attività di ricerca e sviluppo nel mondo. Ha un ruolo essenziale nella strategia di crescita di Petronas, ben al di là del suo obiettivo primario focalizzato principalmente sulle esigenze locali in Europa. Sfrutteremo questo centro per portare la nostra esperienza globale al servizio delle esigenze tecnologiche del business di PLI in Asia, Africa, America Latina e Nord America. Questo garantirà ai nostri clienti in tutto il mondo il miglior livello di comprensione, supporto e servizio che ci si aspetta dai leader del settore”. PLI ha un’importante tradizione d’innovazione e collaborazione che risponde ai cambiamenti del mercato condividendo i successi con i partner. “PLI - ha aggiunto Syed Zainal - è impegnata in ulteriori operazioni di ricerca e sviluppo nel campo dei fluidi e lubrificanti per ridurre le emissioni di carbonio, problematica primaria per il settore. Per la riduzione delle emissioni di CO2, PLI impegnerà il 75 per cento di tutti i futuri

Da sinistra: Pierre Lahutte, Iveco Brand President; Alessandro Orsini e Norfaila Hassan di Petronas.

progetti in Ricerca & Tecnologia attraverso il suo approccio unico nella tecnologia e co-progettazione”. Nel corso dell’evento i manager PLI hanno sottolineato la stretta collaborazione intrapresa con FCA e CNH, rispettivamente nella co-progettazione e sviluppo di prodotti dedicati a vetture e autocarri. Un esempio è l’annunciata collaborazione con Iveco in un futuro Progetto E3 per la sostenibilità: Energia, Emissioni, Efficienza. “PLI - ha precisato Alessandro Orsini, Head of Europe PLI - proget-

terà in co-engineering la nuova gamma Urania E3 che rappresenterà il miglior fluido per garantire la riduzione di emissioni senza compromettere l’affidabilità e le prestazioni del motore, garantendo però la miglior efficienza in termini di Fuel economy. Questo prodotto sarà sviluppato sulla base delle più moderne tecnologie in fatto di bas sa viscosità e testato su vei coli alimentati a CNG e LNG (gas metano compresso e liquido, ndr) per rispondere alle sfide future sulle emissioni”.

UNA GAMMA ALL’AVANGUARDIA CUCITA SU MISURA PER I VEICOLI ALIMENTATI A GAS

NUOVO PROGETTO DI COLLABORAZIONE CON IVECO: NASCE URANIA E3 A distanza di due anni dalla posa della prima pietra, se il Centro Ricerche & Tecnologia di Santena ha potuto essere inaugurato e avviato nella sua operatività, è grazie al lavoro di partnership che Petronas ha saputo costruire con i player coinvolti nel progetto. Cenno di valore per le istituzioni, che all’inaugurazione erano presenti nelle vesti di Sergio Chiamparino, Governatore della Regione Piemonte, Chiara Appendino, Sindaco di Torino, Ugo Baldi, Sindaco di Santena, e Davide Nicco, Sindaco di Villastellone. “La storia di Petronas - ha sottolineato Giuseppe D’Arrigo - è frutto della storia di collaborazione con i suoi partner. Continueremo con lo stesso approccio nei confronti dei nostri clienti ma anche delle Università: lavorare insieme è il nostro modo di concepire le sfide che ci attendono. Avere avuto al

nostro fianco le istituzioni ci conferma di essere sulla strada giusta: siamo a Torino, in Europa, qui ci sono competenze e capacità per migliorare il territorio e le nostre industrie”. Sulla stessa lunghezza d’onda D’Arrigo colloca l’alleanza con Iveco. “Non è - precisa il CEO - solo una questione di business: una serie d’iniziative ci vedranno insieme. Con il lancio di Urania E3, gamma cucita su misura per i veicoli a gas, abbiamo posto una pietra miliare di una nuova collaborazione: con Iveco abbiamo in comune la stessa visione, vogliamo essere pionieri con nuovi prodotti, iniziative e Centri come quello appena inaugurato”. Nell’area esterna, ad accogliere i visitatori oltre a vetture ad alte prestazioni erano presenti un Iveco Trakker, della carovana che ha partecipato al rally Dakar, e il concept Z-Truck per lun-

ghe distanze a impatto zero, presentato al Salone IAA 2016. “La collaborazione con Petronas - ha dichiarato Pierre Lahutte, Iveco Brand President - nella partecipazione ai rally Dakar ha dimostrato tutta la sua efficacia in condizioni stradali difficili. Z Truck garantisce Zero emissioni di CO2 grazie all’utilizzo di tecnologie a gas naturale liquefatto e all’uso del biometano: l’LNG diventerà nei prossimi anni il carburante principale per il lungo raggio e Petronas ne è il produttore numero uno al mondo. Nella nostra sfida con l’alimentazione a LNG siamo sostenuti da grandi gruppi come Carrefour e Ikea. Quando il motore brucia un carburante pulito la sfida sta nel fluido lubrificante e con Petronas stiamo lavorando in sinergia per raggiungere il miglior risultato possibile”.


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 53

DISTILLATO A FREDDO IL METANO LIQUIDO RENDE DI PIÙ E SI CARICA PIÙ RAPIDAMENTE

Federico Bonato: “Con gli incentivi possibile un vero e proprio boom del gas naturale”

N

ell’ottobre 2017 B-Petrol a Villafranca di Verona dà vita a un impianto di LNG per autotrazione, il dodicesimo in Italia in ordine cronologico, che affianca quello tradizionale di gasolio e che, entro fine anno, sarà affiancato da un altro impianto LNG a San Bonifacio. “Quando abbiamo iniziato con l’LNG - spiega Federico Bonato - in Spagna si trattava di un combustibile già molto diffuso. In Italia si era solo all’inizio, lo stesso mercato di veicoli industriali non proponeva molta scelta: oggi molti produttori hanno famiglie di veicoli che già macinano chilometri a LNG e con potenze di tutto rispetto, neanche immaginabili tre anni

fa”. Quali sono le opportunità di business per un’azienda come B-Petrol aggiungendo l’offerta di LNG? “Quando la clientela - risponde Federico Bonato, chimico ambientale - si accorge della differenza, non esita a utilizzare il metano liquefatto che, rispetto al gas compresso che proviene dal metanodotto, è puro al 96 per cento. L’LNG viene trasportato a -160 gradi, temperatura alla quale avviene una specie di distillazione a freddo che lo depura da azoto e altri gas. La purezza presenta un duplice vantaggio: il metano si carica più velocemente e ha una resa chilometrica maggiore, come dimostrato da

corrieri espresso che hanno furgoni a metano e si riforniscono da noi dopo aver registrato non pochi problemi. Vantaggi che valgono per i professionisti del trasporto ma anche per aziende e privati che utilizzano van o vetture a metano”. Qual è stato l’ammontare dell’investimento per l’impianto LNG di Villafranca? “L’impianto - precisa Bonato - è stato realizzato da una cordata d’imprenditori, tutti italiani, e ha richiesto un investimento di circa un milione di euro, ammortizzato dalla crescita dei consumi: per il momento registriamo un forte aumento di utilizzo per vetture e veicoli leggeri, ma se cresce la domanda per

i veicoli pesanti assisteremo a un vero e proprio boom del gas naturale. Molto dipende dalle istituzioni: se vogliono davvero che si compia un “salto green”, occorre considerare che con il gas naturale le emissioni di CO2 sono rasenti allo zero. Impianti come i nostri stanno contribuendo al “salto green”, ma occorre mantenere gli incentivi all’acquisto di veicoli a gas: tenendo conto che la vita di un autocarro è per sua natura ciclica, presto le aziende di trasporto vorranno rinnovare i mezzi Euro 3 e Euro 4 e, se incentivate, potranno sostituire questi mezzi con veicoli a gas naturale, le cui emissioni sono rappresentate da CO2 e vapore acqueo”.

ALLA SCOPERTA DELLE ORIGINI DEL NETWORK B-PETROL

Dal carbone al gas liquefatto

S

MATTEO GALIMBERTI VERONA

toria di sacrifici e passione, di autentica passione quella che sta dietro uno dei distributori di LNG (Gas Naturale Liquefatto) che siamo andati a scoprire. A Villafranca, alle porte di Verona, raggiungiamo la stazione di servizio B-Petrol; prima beviamo un buon caffè al piccolo bar (che a mezzogiorno serve anche da cucina), osserviamo il nuovo autolavaggio attrezzato per veicoli professionali anche pesanti; e a

seguire gli impianti diesel, gpl e gas naturale, tutti disponibili anche per autocarri. Quello di Villafranca è uno dei punti B-Petrol, oggi network di stazioni operative a Ve rona, Caprino Veronese, San Bonifacio, Cavedine in provincia di Trento e Desenzano sul Garda in provincia di Brescia. Entro fine anno il marchio aprirà a San Bonifacio, stazione al momento operativa solo con combustibili tradizionali, il suo secondo impianto di LNG per autotrazione. B-Petrol è oggi un brand che ha chiuso il 2017

con 36 milioni di euro di fatturato, in netta crescita rispetto ai 26 dell’anno precedente e con un’ulteriore previsione d’incremento per superare quest’anno il target di 40 milioni. Oggi al timone dell’azienda c’è Nicola Bonato, Amministratore Unico, affiancato dalla terza generazione rappresentata dai figli Davide, che si occupa della logistica, Katia che segue il comparto finanziario e Federico, brillante 28enne con una laurea in Chimica ambientale, conseguita a Bologna e arricchita

NELL’OTTOBRE DELL’ANNO SCORSO NASCEVA A VILLAFRANCA L’IMPIANTO DI LNG PER AUTOTRAZIONE, IL DODICESIMO IN ITALIA IN ORDINE CRONOLOGICO. ENTRO FINE ANNO SARÀ OPERATIVO ANCHE QUELLO DI SAN BONIFACIO. UN VERO E PROPRIO “SALTO GREEN” PER L’AZIENDA FONDATA DA GUIDO BONATO CHE NEGLI ANNI SESSANTA INIZIÒ L’ATTIVITÀ TRASPORTANDO CARBONE E LEGNAME COME COMBUSTIBILI INDUSTRIALI. OGGI AL TIMONE IL FIGLIO NICOLA, AFFIANCATO DAI NIPOTI FEDERICO, CHIMICO AMBIENTALE, DAVIDE, CHE SI OCCUPA DELLA LOGISTICA, E KATIA, CHE SEGUE IL COMPARTO FINANZIARIO. da un Campus a Rimini, e una straordinaria passione che ricorda un po’ quella del fondatore. Bisogna tornare agli Anni Sessanta quando Guido Bonato, qui a Verona, da va inizio a quella che sarebbe divenuta l’attuale realtà di BPetrol, avviando un’attività che avrebbe fatto diventare Bonato sinonimo di trasporto di combustibili. “A quei tempi - spiega Federico Bonato - la necessità arrivava dalle aziende di produzione che avevano bisogno di legno e carbone. Mio nonno iniziò a rispondere a questa necessità trasportan-

do carbone e legname come combustibili industriali”. L’impresa Bonato cresce e si sviluppa nei numeri, nei rami d’attività e anche nell’organico, seguendo quella che da sempre è la filosofia del fondatore. “Sin dall’inizio aggiunge Federico - il nonno ha voluto che l’azienda fosse familiare, ovvero coinvolgesse i suoi fratelli e la seconda generazione. Nel 1967 ha dato vita a B-Petrol per l’attività di trasporto dei primi combustibili liquidi: se fino a quel momento la principale necessità di combustibile arrivava

Foto di gruppo della famiglia Bonato al completo con le autorità nel giorno dell’inaugurazione dell’impianto di Villafranca, alle porte di Verona.

dalle aziende, che avevano le cisterne di stoccaggio nel proprio piazzale, con gli Anni Settanta il boom del trasporto su gomma e dei veicoli pesanti ha portato a una maggiore richiesta di carburanti, ovvero gasolio e benzine”. Proseguendo nella sua filosofia, negli Anni Ottanta Guido Bonato si fa affiancare nella conduzione dell’azienda dal figlio Nicola, al quale ben presto lascia il timone di BPetrol che, con la seconda generazione, vive una nuova fase di sviluppo e di trasformazione: crescono i volumi, cresce la qualità del servizio. Negli Anni Novanta Nicola Bonato da una parte vuole rafforzare l’offerta di carburanti per utilizzo professionale, dall’altra vuole aprire B-Petrol al business dei combustibili a uso privato. Da quelle due istanze nasce l’intuizione: viene aperto il primo distributore che fornisce gasoli, benzine ma anche lubrificanti, gpl e additivi. “In questo modo - prosegue Federico veniva soddisfatta l’esigenza del privato senza rinunciare a proseguire il nostro core business di azienda al servizio dell’autotrasporto. Questa evoluzione ha prodotto un profondo cambiamento per la nostra azienda: esercitiamo tuttora attività di trasporto consegnando extrarete alle aziende, ma il nostro business principale è oggi rappresentato dalle stazioni di servizio, che permettono il rifornimento a professionisti, aziende e privati”. Due anni fa l’ulteriore evoluzione con l’ingresso della terza generazione, che sta dando a B-Petrol una vera e propria sferzata tecnologica: stazioni di servizio sempre più robotizzate, particolare cura nel servizio e forte investimento sull’LNG. “L’obiettivo - precisa Federico Bonato in conclusione - è raggiungere nel breve termine il numero di dieci stazioni di servizio, rafforzando la presenza nel Veneto che rappresenta la nostra regione d’origine”.


LOGISTICA

Pagina 54

IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

PALLETWAYS ITALIA

Roma e Bologna al centro dell’offensiva GUIDO PRINA BOLOGNA

ontinua l’offensiva di Palletways Italia, società leader nel trasporto merce su pallet. Il concessionario di Roma Mised Srl ha inaugurato il suo nuovo capiente magazzino al km 23,500 della Via Laurentina, in località Pomezia: si tratta di una superficie di 1.200 mq due volte più estesa rispetto alla struttura precedente. Il nuovo quartier generale è situato nel cuore del principale polo industriale di Roma, punto di snodo logistico per l’intera penisola. Grazie alla nuova struttura su un unico livello la famiglia Milletti è in grado di aumentare i volumi ed è più attrezzata per gestire ritiri e consegne in tutta Italia nell’ottica di un costante aumento della produttività, nel pieno rispetto delle regole operative di Palletways. La storia di Mised Srl affonda le sue radici in un solido legame familiare: nasce nel giugno del 1955, quando quattro fratelli fondano l’allora “Corriere Milletti”, società di trasporti di Ancona e provincia che in breve tempo si espande a livello nazionale, fino ad aprire due filiali a Roma e Milano. Nel 1994, grazie alla

crescita del mercato capitolino, la filiale di Ro ma diventa autonoma dando vita alla Mised Srl. Nel 2004 entra a far parte di Palletways, scelta che si rivelerà vincente per accelerare lo sviluppo del business e sperimentare metodi di trasporto-spedizione sempre più moderni ed efficaci. “Mised Srl è un’azienda che opera nel settore da più di 60 anni, caratterizzata da dinamismo e voglia di crescere. Oggi è ancora più competitiva grazie al suo business model volto al-

l’efficienza - ha dichiarato Albino Quaglia, Presidente di Palletways Italia - Lavoriamo insieme da 13 anni collaborando sempre in modo proficuo e senza dubbio Mised contribuisce al successo della nostra Rete nella penisola”. Intanto, Palletways Italia ha introdotto il primo mezzo elettrico nella sua flotta per le consegne nella ZTL di Bologna. Il veicolo - un Nissan NT400 3.5 t con centina telone e sponda caricatrice - garantisce un’autonomia fino a 125 km ed è il primo di una serie di mezzi elettrici che verranno adottati dall’azienda di Calderara di Reno per le consegne nei centri storici delle città italiane. Per Bologna è già prevista a breve la consegna di un secondo mezzo elettrico. I veicoli sono forniti da EPM (Electric Professional Mobility), azienda pisana del Gruppo Pretto, leader nella fornitura di veicoli e servizi nel settore dell’igiene urbana. “Il servizio Palletways - ha spiegato Albino Quaglia - è nato per gestire in espresso le consegne di piccole partite di merce pallettizzata, ma sta conquistando sempre di più anche clienti che hanno bisogno di consegnare nei centri storici, come ristoranti, enoteche e, con l’espansione

dell’e-commerce, anche privati. L’utilizzo dei mezzi elettrici ci consentirà di garantire le consegne non più in fasce orarie limitate e di mantenere alto il livello del nostro servizio nel rispetto degli standard di so-

stenibilità e di qualità di vita dei cittadini. Questa scelta rappresenta un ulteriore passo verso la sostenibilità ambientale tema caro non solo a Palletways Italia ma al centro delle attenzioni di tutto il Gruppo”.

Albino Quaglia, Presidente di Palletways Italia (terzo da sinistra), nel gruppo in posa davanti alla sede Mised. A sinistra, il Nissan NT400 di Bologna.

Il tassello mancante per il tuo business. usiness. Grazie all’implementazione tazione di nuove tecnologie e alla profonda ofonda capillarità sul territorio con 18 Hub, oltre 400 Concessionari in n Europa e una copertura in 20 nazioni, zioni, Palletways, il Network di trasporto orto espresso di merce pallettizzata, ti garantisce un servizio di trasporto veloce e affidabile: In vino veritas, in delivery very Palletways!

La soluzione? Pallettways.

Vieni a trovvarci al

LL Communication

C

IL CONCESSIONARIO MISED DELLA CAPITALE SI TRASFERISCE IN VIA LAURENTINA E INAUGURA UN NUOVO CAPIENTE MAGAZZINO. LA FLOTTA BOLOGNESE È STATA AMPLIATA CON L’INTRODUZIONE DI UN NISSAN NT400 PER LE CONSEGNE GREEN NEL CENTRO STORICO DI BOLOGNA.

VINITTALLY 2018 Pad. Enolitech - F STAND G3 Verona 15-18 aprile

Il Network k espresso p per per merce pallettizza p ta

portal.palletw ways.com Palletways Plus UNI EN ISO 9001:2015

UNI EN ISO 14001:2015

SISTEMA DI GESTIONE QUALITÀ CERTIFICATO

SISTEMA DI GESTIONE AMBIENTALE CERTIFICATO

Trova il tuo Concessionario di zona su © Pallet ways Europe GmbH

www.palletways.com


N° 268 / Aprile 2018

IL MONDO DEI TRASPORTI

Pagina 55

GLS AUTOMATIZZA LA GESTIONE DELLE SPEDIZIONI

Con Prestashop per l’e-commerce G

IL PLAYER DI CORRIERE ESPRESSO E L’AZIENDA FRANCESE LANCIANO UN NUOVO MODULO GRATUITO PENSATO PER IMPRESE, STARTUP E ARTIGIANI CHE VENDONO PRODOTTI ONLINE. “LE NUOVE FRONTIERE RICHIEDONO PROCESSI SNELLI E VELOCI”, DICHIARA KLAUS SCHÄDLE DI GLS EUROPE SOUTH.

VALENTINA MASSA MILANO

LS ha siglato una partnership con la francese Prestashop, una del le piattaforme di ecommerce più popolari e uno dei progetti open-source più riusciti al mondo. Le due aziende hanno lanciato un modulo gratuito, ideato pensando in maniera particolare a piccole e medie imprese, startup e artigiani che vendono prodotti online e che desiderano una gestione delle spedizioni facile, semplice e intuitiva. Grazie a questo nuovo modulo che automatizza il processo di gestione delle spedizioni e che mira quindi anche allo sviluppo dell’ecommerce nel nostro Paese, la piattaforma Prestashop può essere collegata a quella di GLSell&Send con numerosi vantaggi tra cui: caricamento in tempo reale di tutti gli ordini da tutte le piattaforme e-commerce, grande semplicità per spedizioni e stampa dei segnacolli, aggiornamento in tempo reale di tutti gli ordini su tutte le piattaforme ecommerce collegate e monitoraggio delle consegne su un pannello di controllo dedicato. “Siamo molto fe-

Klaus Schädle, Managing Director GLS Europe South.

lici - dichiara Klaus Schädle, Managing Director GLS Europe South di aver siglato la partnership tra GLS e Prestashop. Il nostro o biettivo è favorire lo sviluppo dell’ecommerce tramite processi di spedizione snelli e veloci che possano agevolare sia le aziende che le necessità degli utenti finali. Avevamo già intrapreso questo percorso con la piattaforma GLSell & Send e ora, anche grazie a questa collaborazione, saremo in grado di raggiungere l’obiettivo prefissato”.


MOBILITÀ

Pagina 56

IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

IL COMUNE DI PISTOIA UTILIZZERÀ I NUOVI

CROSSWAY LINE PER IL TRASPORTO PUBBLICO LOCALE INTERURBANO.

LA VERSIONE OGGETTO DELLA FORNITURA È LA LINE

- NORMAL FLOOR - NELLA CONFIGURAZIONE DA 10,8 METRI DI LUNGHEZZA, CON 41 POSTI + 2 SOLLEVABILI, PER LA QUALE STATO PREVISTO UN CONTRATTO DI ASSISTENZA FULL SERVICE DI 5 ANNI; GLI AUTOBUS SONO DOTATI DI

CURSOR 9 HISCR, IN GRADO DI

MOTORE

SPRIGIONARE UNA POTENZA DI 360 CV, E DEL CAMBIO AUTOMATICO

ZF ECOLIFE. CROSSWAY È IL VEICOLO INTERURBANO PIÙ VENDUTO IN EUROPA.

IVECO BUS / LA TOSCANA COPIT SCEGLIE CROSSWAY LINE

L’interurbano per il TPL

P

FABIO BASILICO PISTOIA

iazza del Duomo a Pistoia ha ospitato la cerimonia di consegna degli otto nuovi Iveco Crossway Line che andranno ad aggiornare la gamma della Copit di Pistoia. Una cornice di tutto rispetto, nel centro storico della città toscana, per dare il benvenuto all’interurbano della famiglia Iveco Bus. Copit è una Società per azioni con capitale misto pubblico e privato, nata come consorzio tra 15 comuni e la Provincia pistoiese, che nel 1995 ha intrapreso il passaggio ad azienda per la mobilità, ponendosi l'obiettivo della gestione dei diversi aspetti della mobilità dei cittadini, includendo, oltre al trasporto pubblico di linea, servizi di scuolabus, turismo e parcheggio sul territorio dei comuni soci.

Il comune di Pistoia utilizzerà i nuovi Crossway Line per il trasporto pubblico locale interurbano. Erano presenti alla cerimonia di consegna dei veicoli, che vanno ad ampliare un parco mezzi di circa 200 autobus tra urbani e interurbani, il Presidente Copit Antonio Di Zanni, l’Assessore all’Ambiente della Regione Toscana Federica Fratoni, il Consigliere della Provincia di Pistoia delegato al TPL Alessio Torrigiani, il Sindaco di Pistoia, Alessandro Tomasi, e Tiziano Dotti, Public Sales Manager Iveco Bus, nonché i rappresentanti di numerose istituzioni provinciali e cittadine. La gara, indetta a maggio 2017, è stata vinta a luglio da Iveco Bus, che si è candidata proponendo per il tipo di missione il suo Crossway, il veicolo interurbano più venduto in Europa - più di 30mila pezzi consegnati - per la sua attitudine di lavoratore instan-

Iveco Crossway dimostra di essere la scelta ideale per il trasporto passeggeri a corto e medio raggio e ben rappresenta un brand che persegue la sostenibilità come valore chiave attraverso una grande attenzione all’innovazione.

cabile, concepito per il trasporto interurbano e scolastico, polivalente e affidabile, con un vincente rapporto qualità-prezzo. La versione dei Crossway oggetto della fornitura è la Line Normal Floor - nella configurazione da 10,8 metri di lunghezza, con 41 posti + 2 sollevabili, per la quale stato previsto un contratto di assistenza full service di 5 anni; gli autobus sono dotati di motore Cursor 9 Hi-SCR, in grado di sprigionare una potenza di 360 cv, e del cambio automatico ZF Ecolife, combinazione che permette al mezzo di distinguersi per prestazioni, basso consumo di carburante e intervalli di manutenzione più distanziati, grazie al sistema di post-trattamento HISCR con filtro antiparticolato diesel (DPF). L’equipaggiamento prevede una serie di dotazioni che assicurano sicurezza e confort, sia per l’autista, attraverso una serie di sistemi di supporto alla guida e

uno spazio concepito per soddisfare gli standard ergonomici più elevati, sia per i passeggeri, e in particolare per quelli con ridotte capacità motorie, che possono contare sull’ accesso facilitato della pedana idraulica. Crossway dimostra di essere la scelta ideale per il trasporto passeggeri a corto e medio raggio e ben rappresenta un brand - Iveco Bus - che persegue la sostenibilità come valore chiave attraverso una grande attenzione a innovazione, prestazioni e sicurezza e a un’eccellenza tecnologica che pone le persone e l’ambiente al centro del business. Per sviluppare processi e prodotti a minore impatto ambientale e mantenere inalterati i suoi alti livelli di eccellenza produttiva, Iveco Bus applica i principi del World Class Manufacturing, l’innovativo metodo basato sulla filosofia del miglioramento produttivo continuo, che mira a ridurre consumi e sprechi.


BTS

VERSAT TILE PER NAT TURA. REDDITIZIO PER SCELT TA A.

VERSAT TILITÀ STRAORDINARIA Nuova architettura polivalentee su misura :S SPYQI&EKEKPMIVE½RSEQ3: ideale per il trasporto su percorsi regionali e e nazionali, i transfer aeroportuali, tuali le escursioni e i tour organizzati

AFFIDA ABILITÀ COLLAUDA AT TA A Solide tradizioni e lunga esperienza Teestato in condizioni dizioni stradali e climatiche estreme: da -30°C a +50°C Escluusiva tecnologia HI-SCR senza rigenerazione

REDDITIVITÀ OTTIMIZZAT TA A Miglior TCO della categgoria Basso consumo di carburante e ridotta frequenza e di manutenzione Eccellente valutazione dell’usato Polivalenza ottimizzata per il servizio sia s feriale che festivo

MASSIM MO COMFORT E MASSIMA SICUREZZA C Comf ort di bordo ai vertici della categoria Sistemi avanzati di sicurezza attiva e passiva Rumorosità e vibrazioni ridotte


IL MONDO DEI TRASPORTI

Pagina 58

N° 268 / Aprile 2018

A 18 ANNI DALLA PRESENTAZIONE DEL SUO PREDECESSORE, IL

MAN LION’S CITY SEGNA L’INIZIO DI UNA NUOVA ERA. I NUOVO

PROGETTISTI DELLA

CASA TEDESCA HANNO PUNTATO LA LORO ATTENZIONE SU ECONOMICITÀ, COMFORT DI MARCIA, TECNOLOGIA E DESIGN, FISSANDO NUOVI STANDARD PER TUTTI I COMPONENTI, TRA CUI LA NUOVISSIMA CATENA CINEMATICA CON SISTEMA MAN

EFFICIENTHYBRID.

AL DEBUTTO IL NUOVO MAN LION’S CITY

Nuove regole per il trasporto urbano

H

PAOLO ALTIERI DOSSOBUONO

a ufficialmente debuttato il nuovo portabandiera MAN Bus nel settore degli urbani. A 18 anni dalla presentazione del suo predecessore, il nuovo MAN Lion’s City segna l’inizio di una nuova era. I progettisti della Casa tedesca hanno puntato la loro attenzione su economicità, comfort di marcia, tecnologia e design, fissando nuovi standard per tutti i componenti, tra cui la nuovissima catena cinematica con sistema MAN EfficientHybrid, la sospensione a ruote indipendenti sull’asse anteriore, le funzioni di illuminazione realizzate a Led e il nuovo interno del veicolo a struttura modulare. Oltre ai fari anteriori marcati con fascio Led per la luce di marcia diurna e il tipico profilato frontale MAN nero con modanatura cromata, cattura l’attenzione la linea laterale in vetro abbassata. La parte posteriore si presenta come

una cover di uno smartphone, diventando un inconfondibile segno distintivo sia del Lion’s City che del fratello Lion’s Coach. A parità di dotazione, la versione da 12 metri del nuovo Lion’s City pesa circa 1.130 kg in meno rispetto al suo predecessore dotato di motore D20; una differenza che influisce anche sul consumo. Per aumentare l’economicità complessiva, MAN ha

introdotto il nuovo propulsore D1556 LOH, più leggero e conforme allo standard sulle emissioni Euro 6d che entrerà in vigore dal 1° settembre 2019. È stata introdotta solo la tecnologia Selective Catalytic Reduction (SCR) combinata con il filtro a rigenerazione continua Continuously Regenerating Trap (CRT) di MAN, al fine di garantire il ricircolo dei gas di scarico. L’unità da 9 litri viene propo-

I nuovi sedili del Lion’s City offrono più spazio ai passeggeri.

sta in configurazione 280, 330 e 360 cv. In alternativa, il nuovo propulsore D15 può essere integrato con il modulo MAN EfficientHybrid, sistema che consente di ridurre sensibilmente il consumo di carburante e le emissioni fino al 16 per cento. Inoltre, la funzione di avvio e arresto di serie permette all’autobus urbano del Leone di frenare in prossimità di fermate o semafori senza produrre il minimo rumore. Alla base di EfficientHybrid c’è un alternatore col legato al motorino d’avviamento e all’albero motore, cioè una macchina elettrica in grado di convertire l’energia meccanica in energia elettrica durante le frenate. L’energia recuperata viene immagazzinata in un modulo Ultracap situato sopra il tetto del veicolo e viene sfruttata per alimentare il sistema elettrico di bordo indipendente dal tipo di trazione, consentendo non solo di alleggerire il motore diesel ma anche di spegnerlo quando il veicolo è fermo. Per riavviare il D15 in tempi

rapidi è sufficiente invertire il funzionamento dell’alternatore collegato al motorino d’avviamento e all’albero motore, mentre per dare l’impulso all’accelerazione è possibile ricorrere alla funzione Boost. Lion’s City è il primo autobus urbano MAN a essere dotato di una sospensione a ruote indipendenti, sistema progettato in modo tale che nel caso una ruota subisca un colpo dovuto alle asperità della strada, i movimenti di ruota e supporto vengano trasmessi al lato opposto in misura nettamente inferiore. Il risultato è un’ammortizzazione complessivamente più mor bida perché agiscono mas se non sospese minori. Per quanto riguarda gli ammortizzatori, la tecnologia utilizzata finora lascia spazio ai nuovi silenziatori PVC (Pre mium Comfort Valve) proposti di serie. Gli smorzatori di vibrazioni solo idraulici garantiscono un assetto ottimale dal punto di vista del comfort di marcia e della stabilità del veicolo.

Tra i vari componenti con cui il nuovo MAN Lion’s City si propone di fissare nuovi standard spiccano i fari sulla parte anteriore e posteriori con soluzione a Led non solo per la luce diurna. Per la prima volta i fari principali sono disponibili in full led e fanno parte della dotazione di serie insieme ai gruppi ottici posteriori sempre a Led. La moderna tecnologia luminosa viene impiegata anche all’interno del bus, dove i passeggeri ven gono accolti da un ambiente ordinato e familiare grazie al nuovo sistema Colour & Trim. I colori chiari e scuri sono selezionati appositamente per assistere in modo funzionale le aree operative. I nuovi sedili, fissati alle guide laterali e con distanze ottimizzate, non solo offrono uno spazio maggiore ma facilitano anche le operazioni di pulizia. Anche il conducente ha a disposizione una postazione di lavoro completamente rivista e ottimizzata nonché inserita nel design grazie alla porta della cabina oscillante. È stata aumentata la facilità di utilizzo grazie a una nuova disposizione degli interruttori e della strumentazione. Il sedile di guida può essere regolato anche in orizzontale, garantendo una posizione ottimale e quindi una maggiore ergonomia. Un vetro modulare, inserito sulla porta del conducente, in grado di estendersi fino al parabrezza, offre protezione dalle persone non autorizzate. La produzione del la nuova generazione di autobus urbani del Leone inizierà a partire da agosto 2018 nello stabilimento di Starachowice, in Polonia.

IL MOTORE DA 9 LITRI PER AUTOBUS URBANI PUNTA SULLA TECNOLOGIA SCR

D15, IL PROPULSORE CHE RISPETTA AL MEGLIO LA NORMATIVA EURO 6D M AN Truck & Bus punta sull’avanzamento tecnologico e propone sul mercato il nuovo propulsore D1556 LOH, unità da 9 litri per autobus urbani che rispetta la norma antinquinamento Euro 6d con l’utilizzo esclusivo della tecnologia SCR che sostituisce i ricircolo dei gas di scarico. In combinazione con il filtro a rigenerazione continua CRT le emissioni di NOx vengono quasi completamente eliminate. Il nuovo motore montato verticalmente ha una potenza che va dai 206 kW/280 cv ai 265 kW/360 cv. Tra le altre novità del D15 troviamo i nuovi pistoni e le valvole bombate che consentono una pressione d’iniezione fino a

2.500 bar. Conseguenza positiva di una pressione d’iniezione elevata è la micro polverizzazione del carburante e quindi una combustione efficace che si traduce in consumi contenuti e ridotte emissioni di gas di scarico. Nei nuovi autobus urbani MAN, il D1556 LOH sostituisce il D2066 LUH. Proprio come il D20, anche il nuovo propulsore si contraddistingue per un comportamento di marcia dinamico molto buono, condizionato dalla configurazione ottimale del turbocompressore, ma con un peso inferiore e una maggiore efficienza. La riduzione del peso contribuisce a una migliore ripartizione dei carichi sugli assi, alleggerendo quello posteriore. Si tratta

di un fattore molto importante soprattutto in caso di grande sbalzo e di un’ampia superficie destinata ai passeggeri in piedi, poiché aumenta il carico utile. La coppia massima si raggiunge già a un numero di giri più basso: 1.200 Nm a 800-1.600 giri/min in configurazione 280 cv, 1.400 Nm a 900-1.600 giri/min nella variante da 330 cv, 1.600 Nm a 9001.550 giri/min con 360 cv di potenza massima. Il D15 può essere integrato con il nuovo modulo mild hybrid MAN EfficientHybrid, che favorisce il buon funzionamento del motore diesel e la sensibile riduzione del consumo.


IL MONDO DEI TRASPORTI

Pagina 60

N° 268 / Aprile 2018

EVOBUS / INIZIA L’AVVENTURA DEL MERCEDES-BENZ CITARO ELETTRICO

C’è più gusto a essere cittadini I

IL DEBUTTO INTERNAZIONALE NELLA VARIANTE DA 12 METRI È PREVISTO PER SETTEMBRE AL SALONE INTERNAZIONALE DEI VEICOLI INDUSTRIALI (IAA) MENTRE LA PRODUZIONE IN SERIE INIZIERÀ ENTRO QUEST'ANNO. TUTTE LE VARIANTI DEL CITARO ELETTRICO SI BASANO SUL BEST-SELLER MONDIALE CITARO, CHE NEL 2012 È STATO IL PRIMO AUTOBUS URBANO AL MONDO A RISPETTARE LA CLASSE DI EMISSIONI EURO VI. IL SISTEMA DI TRAZIONE FULL ELECTRIC SI BASA SU UN ASSE A PORTALE ELETTRICO CON MOTORI ELETTRICI SUI MOZZI RUOTA.

FABIO BASILICO STOCCARDA

l Mercedes-Benz Citaro elettrico è stato l’indiscusso protagonista dell’Annual Media Talk Daimler Buses di Stoccarda, l’ultimo sotto la gui da di Hartmut Schick, pronto a fare le valige per trasferirsi alla direzione di Daimler Trucks Asia. In una serie di interessanti eWork shop organizzati al Carl Benz Center di Stoccarda, la Stella ha illustrato nei minimi dettagli la rivoluzione Citaro, urbano a trazione completamente elettrica che circola a zero emissioni locali e senza emettere praticamente alcun rumore. Il debutto internazionale nella variante da 12 metri è previsto per settembre al Salone Internazionale dei Veicoli Industriali (IAA) mentre

la produzione in serie inizierà entro quest’anno. LA BASE È UN BEST-SELLER

Tutte le varianti del Citaro elettrico si basano sul bestseller mondiale Citaro, che nel 2012 è stato il primo autobus urbano al mondo a rispettare la classe di emissioni Euro VI, quella attualmente più severa. Senza dimenticare che è completamente non inquinante la variante Citaro hybrid, con un consumo di car burante ulteriormente ridotto. Se il Citaro NGT a metano con il biogas arriva quasi a un bilancio neutrale di CO2, il Citaro a trazione completamente elettrica compie ora il passo successivo, dalle basse emissioni alle emissioni zero locali.

I moduli di batterie collocabili sul tetto del nuovo Mercedes-Benz Citaro elettrico.

Il sistema di trazione full electric si basa su un asse a por tale elettrico con motori elettrici sui mozzi ruota. La potenza di picco dei motori si attesta su 2 x 125 kW, la coppia equivale a 2 x 485 Nm ed è pienamente disponibile fin dalla partenza, com’è insito nel sistema, assicurando così una dinamica di marcia adeguata anche con l’autobus pie no di passeggeri. L’alimentazione di tensione è affidata alle batterie agli ioni di li tio con una capacità complessiva massima di circa 243 kWh, suddivise in un massimo di dieci moduli da 25 kWh ciascuno, posizionati sul tetto o nel retro del bus. Su richiesta del cliente, due o quattro moduli di batterie sono collocabili sul tetto. Anche la tecnica di ricarica è flessibile. All'avvio della produzio-

HARTMUT SCHICK È PRONTO AD ASSUMERE LA DIREZIONE DI DAIMLER TRUCKS ASIA

DAI BUS AI TRUCK SEMPRE NEL NOME DI DAIMLER H artmut Schick saluta e ringrazia colleghi e giornalisti con fare affabile e grande professionalità. Dopo un decennio trascorso alla guida di Daimler Buses, lo stimato manager tedesco parte alla volta dell’Oriente per assumere la direzione di Daimler Trucks Asia, un altro importante troncone dell’impero globale Daimler. Al suo posto arriverà Till Oberwörder, un altro uomo di punta del management Daimler. Intervistato in esclusiva da Il Mondo dei Trasporti nel settembre 2017, Hartmut Schick aveva dimostrato anche allora di essere un manager preparato e dotato di un particolare talento per la visione d’insieme e la programmazione. Dal 1° gennaio 2009 alla guida di Daimler Buses nonché Presidente del Consiglio di Amministrazione di EvoBus GmbH, Schick è stato responsabile di tutto il business del Gruppo Daimler nel settore auto-

bus, autobus da turismo, autotelai per autobus e soluzioni di mobilità per gli autobus. Elegante, determinato, cortese con i giornalisti, Hartmut Schick non è un ingegnere “tutto numeri e tabelle”. Classe 1961, una laurea in Ingegneria meccanica all’Università di Karlsruhe, Hartmut Schick entra 25enne in Daimler-Benz formandosi nel reparto Ricerca Centrale. Dopo quattro anni di esperienza che lo vedono operativo nella sede di Sindelfingen nella produzione di autovetture di classe media, nel 1990 sbarca nel Marketing nella sede di Monaco. Da quel momento ha inizio una carriera manageriale che lo vede passare anche dal Brasile, nel settore della Logistica. Nel 1999 è a capo dello staff presidenziale di DaimlerChrysler AG e dal gennaio 2002 è responsabile della comunicazione internazionale del Gruppo Daimler,

prima di assumere la guida di Daimler Buses e diventare Presidente del Consiglio di Amministrazione di EvoBus GmbH. Un’esperienza diversificata e solida che ha consentito a Hartmut Schick di affrontare un periodo di grandi cambiamenti nel settore della mobilità: un’evoluzione legata alle nuove sfide imposte al settore dalle tecnologie avanzate e dai servizi di mobilità. Alle due sfide, Daimler Buses ha risposto continuando a investire fortemente su prodotti e servizi. Tra i frutti raccolti dalla nuova strategia si collocano il nuovo Mercedes-Benz Tourismo, il nuovo autobus a due piani Setra S 531 DT e naturalmente il Mercedes-Benz Citaro elettrico. “Possiamo vantare una conoscenza attenta di tutti i mercati e dei requisiti dei clienti come nessun altro specialista di autobus - afferma orgoglioso Hartumt Schick -

Abbiamo rapporti a lungo termine con i nostri clienti e il più alto livello di competenza e consapevolezza che ci rende partner affidabili per la nostra clientela. Offriamo una gamma di prodotti molto vasta con una varietà di personalizzazioni tale che i nostri clienti possono implementare con successo il loro modello di business individuale seguendo la propria strategia aziendale”.


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 61

L’ABc deLL’eLettrico

Due tecnici Mercedes-Benz alle prese con i test di rilevazione dati condotti sul Citaro elettrico prima della produzione in serie.

ne in serie è prevista la ricarica mediante connettori Combo 2. Se si desidera effettuare una ricarica intermedia per aumentare l’autonomia, il Citaro in futuro potrà anche essere caricato tramite pantografo, a richiesta. In questo modo l’innovativo urbano della Stella copre tutte le varianti attualmente in uso. CONCEPT INTELLIGENTE

Con questo concept modulare intelligente composto da batterie e varie tecniche di ricarica, Mercedes-Benz offre alle aziende di trasporto la possibilità di adattare con precisione il Citaro alle esigenze di ogni azienda o perfino di singole linee. I tecnici di Stoccarda hanno focalizzato l’attenzione sulla gestione ottimale del veicolo. Il consumo energetico di un autobus urbano è fortemente influenzato dal raffreddamento e soprattutto dal riscaldamento dell’ampio abitacolo. Per que sto motivo, la gestione termica rientra fra le caratteristiche principali del Citaro: la sua straordinaria efficienza energetica pone infatti le basi per un’autonomia idonea all'uso pratico. Il vano passeggeri viene riscaldato a basso consumo energetico attraverso una pompa di calore. A ciò si aggiungono anche i consueti riscaldatori a soffiante sulle pareti e il riscaldatore frontale. Tutti i componenti che emettono calore sono collegati tra loro, per ridurre al minimo il consumo energetico necessario per il rispettivo raffreddamento. L’impianto di climatizzazione sul tetto, nella stagione fredda, viene utilizzato anche come pompa di calore. Anche l'utilizzo della CO2 come refrigerante offre diversi vantaggi, consentendo un impiego particolarmente efficiente della pompa di calore anche a temperature molto basse. Un altro punto a favore è dato dal fatto che già durante la ricarica delle batterie in deposito, l’abitacolo può essere portato

anticipatamente alla temperatura desiderata o perfino “sovra-condizionato”. In questo modo, ad esempio, l’autobus può entrare in servizio già riscaldato o rinfrescato. Con dotazione completa di batterie Citaro elettrico raggiunge un’autonomia di circa 150 chilometri in estate. In questo modo si possono già servire reti parziali con il carico di lavoro giornaliero di un autobus urbano senza necessità di ricariche intermedie. Per EvoBus elettromobilità significa ripensare la mobilità urbana con gli autobus. Il Citaro a trazione completamente elettrica fa parte del sistema complessivo eMobility predisposto da Daimler Buses: in pratica, prima della fase di acquisto è previsto il competente servizio di consulenza eMobility Consulting, con gli esperti che analizzano ogni linea, valutano i settori di impiego e li collegano tra

loro. Un programma di simulazione calcola quindi il fabbisogno energetico. Come risultato vengono forniti consigli e calcoli precisi sia in merito alle infrastrutture di ricarica che al consumo energetico, alla potenza di allaccio del l’alimentazione elettrica del deposito e alla gestione delle ricariche. Con l’elettromobilità cambiano anche i servizi di assistenza, manutenzione e riparazione. Per questo l’eMobility Service del marchio di servizi OMNIplus offre concept di assistenza su misura: si parte dalla classica assistenza presso l'officina del cliente, proseguendo per i servizi di officina forniti in abbinamento ai contratti di assistenza in centri di competenza della fabbrica, per poi arrivare al BusDepot Management; in quest’ultimo caso, i collaboratori di OMNIplus si occupano di eseguire determinati

interventi, fino all’assistenza completa dei veicoli direttamente presso l’officina del cliente. “Nel 2017 abbiamo registrato un incremento delle vendite del 9 per cento a un totale di 28.700 unità - ha detto Hartmut Schick nel suo intervento - Daimler Buses sta andando bene e stiamo approcciando la trasformazione tecnologica che interessa il nostro comparto industriale da una posizione di forza che ci consente di fare importanti investimenti. Tra i nostri obiettivi per il 2018 c’è sicuramente l’accrescimento della nostra presenza sui mercati strategici, asiatici e latinoamericani in particolare. Un secondo aspetto che qualifica il nostro successo è il network globale di produzione, che ci consente di avere un notevole vantaggio competitivo grazie alla flessibilità. Stiamo rinforzando in parti-

Celle delle batterie Le celle delle batterie agli ioni di litio possono avere varie forme: cilindriche, “pouch” e prismatiche. Mercedes-Benz ha scelto le batterie con celle prismatiche: caratterizzate dalla forma e dalle dimensioni di un taccuino, dispongono di un proprio alloggiamento, oltre a essere stabili e facili da maneggiare. Motore elettrico Il motore elettrico converte l’energia elettrica in potenza meccanica. Le bobine attraversate dalla corrente creano campi magnetici le cui forze di attrazione e repulsione reciproca vengono convertite in un movimento rotatorio. Mercedes-Benz utilizza nel Citaro motori asincroni raffreddati ad acqua, robusti e capaci di ruotare a regimi elevati, che presentano un alto rendimento e non hanno bisogno di spazzole soggette a usura durante il funzionamento. Guida a emissioni zero I veicoli a trazione completamente elettrica sono a emissioni zero locali, ovvero non immettono alcun gas di scarico nell’ambiente circostante. Le emissioni tuttavia vengono generate attraverso la produzione stessa di corrente, ad esempio dalle centrali a carbone e a gas. Anche un autobus urbano a trazione completamente elettrica, pertanto, non è a emissioni zero in assoluto, bensì solo a livello locale. Batteria agli ioni di litio La batteria agli ioni di litio è un accumulatore di energia ricaricabile che trasforma l’energia elettrica in energia chimica e l’accumula per cederla nuovamente, laddove necessario, come energia elettrica. Durante la carica della batteria, gli ioni di litio si spostano dal catodo all’anodo, mentre durante la fase di scaricamento passano dall’anodo al catodo. Le batterie agli ioni di litio sono caratterizzate da un’elevata densità energetica e pertanto rappresentano lo stato dell’arte della tecnica per i veicoli a trazione completamente elettrica. Motore sul mozzo ruota Diversamente dal motore a combustione interna, un motore elettrico può essere collocato a piacimento sul veicolo. Nel caso degli autobus urbani si usano diversi alloggiamenti. Mercedes-Benz ha scelto una configurazione compatta, ovvero quella con il collaudato asse motore ZF AVE 130 con motori sul mozzo ruota, già in uso su altre varianti del Citaro. In questo asse a portale elettrico, su ogni ruota è alloggiato un motore asincrono raffreddato ad acqua. I motori erogano una potenza di 125 kW ciascuno, per un totale di 250 kW. La coppia equivale pertanto a 2 x 485 Nm da fermo, mentre grazie al rapporto di trasmissione sulle ruote è disponibile una coppia di ben 2 x 11.000 Nm circa. Rigenerazione Nel processo di rigenerazione, noto anche come recupero di energia frenante o frenata rigenerativa, l’energia cinetica viene trasformata in energia elettrica. In questo caso i motori elettrici sui mozzi ruota fungono da alternatori, producendo una coppia frenante. L’energia elettrica generata viene accumulata nelle batterie, dove resta disponibile per la catena cinematica. Pompa di calore La pompa di calore sfrutta gli effetti fisici del passaggio di liquidi alla forma gassosa e viceversa. Sui veicoli completamente elettrici, le pompe di calore vengono utilizzate come fonte energetica alternativa a basso consumo per il riscaldamento o il raffreddamento del veicolo.

colare la produzione in Europa, e nei prossimi anni verranno investiti circa 140 milioni di euro nel potenziamento dei siti produttivi del vecchio continente. Il terzo a spetto che qualifica la nostra

azione è l’offensiva di prodotto. Abbiamo investito un totale di 400 milioni di euro nel nuovo Setra double decker e nel nuovo MercedesBenz Tourismo. Inoltre, nel 2018 lanceremo sul mercato una nuova generazione di Minibus basata sul nuovo Mercedes-Benz Sprinter. Senza dimenticare ovviamente il Citaro NGT a gas naturale, il CItaro hybrid e il Citaro elettrico”. SEMPRE AVANTI CON I SERVIZI

La tecnica di ricarica del Citaro elettrico è flessibile. All’avvio della produzione è prevista la modalità che impiega connettori Combo 2.

Altrettanto importante in casa Daimler Buses è l’offensiva dei servizi per la mobilità, sempre più avanzati e rispondenti alle mutate esigenze di mercato. “Stiamo investendo su quattro mega trend - ha concluso Schick - connettività, guida autonoma, mobilità condivisa e trazione elettrica. Parliamo a questo proposito in Daimler Buses parliamo di CASE (Connectivity, Automated Driving, Shared Mobility, Electric Drives). Da qui al 2020 la cifra stanziata ammonta a circa 200 milioni di euro. In più, abbiamo il privilegio di poter lavorare in sinergia con tutto il Gruppo Daimler. Il progetto CASE coinvolge i colleghi delle divisioni Trucks e Vans e approfitta anche degli investimenti che sono stati effettuati nel settore auto”.


IL MONDO DEI TRASPORTI

Pagina 62

N° 268 / Aprile 2018

SCANIA / IL PRIMO GRUPPO DI TOURING SULLE STRADE ITALIANE

DISPONIBILE GIÀ DA DIVERSI ANNI IN ALTRI

La fantastica decina

D

GUIDO PRINA TRENTO

al debutto ufficiale alla prova della strada. Lo Scania Touring è pronto a conquistare un posto di primaria importanza nel segmento italiano del Granturismo. Sono già 10 gli esemplari del coach del Grifone pronti per trasportare migliaia di passeggeri. L’esordio in gran stile all’ultimo Giro d’Italia ha creato grandi aspettative attorno al Touring. Aspettative che l’autobus, dall’inconfondibile Dna Scania, non ha affatto deluso ma ha superato ampiamente. Le parole chiave sono qualità, comfort, sicurezza e consumi ottimali. “Provare per credere”: è questa la filosofia di Roberto Caldini, Direttore Buses & Coaches di Italscania. “È difficile esprimere a parole le grandi potenzialità di questo veicolo e gli eccellenti consumi registrati sia in occasione di prove su strada con clienti del settore Granturismo che test con la stampa di settore - ha precisato Caldini - Siamo estremamente soddisfatti dei risultati ottenuti sul fronte dei consumi, una dimostrazione in più del fatto che si tratti di un veicolo di grande eccellenza, in perfetto stile Scania. In Italia il parco circolante di autobus risulta essere obsoleto: è di fondamentale importanza promuovere l’acquisto di veicoli innovativi, sicuri e soprattutto sostenibili, sia da punto di vista ambientale che economico. Lo Scania Touring è il candidato ideale per gli operatori di trasporto che vogliono offrire ai propri clienti i massimi livelli di sicurezza, qualità e comfort”. Disponibile già da diversi anni in altri Paesi d’Europa, Touring ha ora conquistato an che numerose aziende di trasporto passeggeri del settore Granturismo: dieci sono infatti le unità pronte a esordire sul mercato italiano e a trasportare migliaia di turisti dalla Penisola al resto d’Europa. “Gli operatori del Granturismo, sempre ben informati, da un po’ di tempo attendevano un prodotto interamente Scania e nello specifico au-

PAESI D’EUROPA, TOURING HA ORA CONQUISTATO ANCHE NUMEROSE AZIENDE DI TRASPORTO PASSEGGERI DEL SETTORE

GRANTURISMO: DIECI SONO INFATTI LE UNITÀ PRONTE A ESORDIRE SUL MERCATO ITALIANO E A TRASPORTARE MIGLIAIA DI TURISTI

PENISOLA AL RESTO D’EUROPA. “LO SCANIA TOURING È IL DALLA

CANDIDATO IDEALE PER GLI OPERATORI DI TRASPORTO CHE VOGLIONO OFFRIRE AI PROPRI CLIENTI I MASSIMI LIVELLI DI SICUREZZA, QUALITÀ E COMFORT”, HA DICHIARATO ROBERTO

CALDINI, DIRETTORE BUSES& COACHES DI ITALSCANIA.

spicavano la disponibilità anche in Italia dello Scania Touring, dopo averlo visto all’opera in vari Paesi europei - ha evidenziato Antonino Brancato, Responsabile vendite Scania Touring - Al primo impatto ne hanno apprezzato la linearità e la pulizia del design, la marcata riconoscibilità dello stile Scania. La funzionalità complessiva, gli spazi a disposizione oltre alle qualità della parte meccanica hanno colpito positivamente quanti hanno visto e provato i primi Touring arrivati in Italia”. “Tra i clienti che utilizzano già lo Scania Touring anche Nudo Viaggi di Cosenza che, da settembre a oggi, ha superato i 100.000 km e ci conferma la sua soddisfazione sia per quanto riguarda le prestazioni che i consumi - continua Brancato - Entro pochi giorni, dopo il primo autobus già con segnato a Gaffuri Viaggi, verranno consegnati

nuovi Scania Touring a Autoservizi Merli, Autolinee Moretti, Giot to Bus, Salvadori Bus Itermar e T.A.M.”. Il nuovo Touring è il primo coach interamente progettato da Scania. Con l’obiettivo di consolidare il proprio posizionamento nel settore Granturismo, Scania ha deciso di introdurre anche in Italia il suo turistico premium. Costruito secondo i più elevati standard di qualità, Touring viene proposto in Italia nelle versioni a due e tre assi, HD 12,1 metri e HD 13,7 metri. Gli operatori possono scegliere il motore 6 cilindri 13 litri da 410, 450 o 490 cv Euro 6 SCR e tre diverse opzioni di a limentazione, biodiesel, HVO (Hydrotreated Vegetable Oil) e il tradizionale gasolio. Il cambio Opticruise a 8 o 12 marce è un’altra delle caratteristiche vincenti del coach svedese. Touring segna l’ingresso ufficiale di Scania

nel mercato coach, dove prima era presente unicamente attraverso la proficua collaborazione di lunga data con la spagnola Irizar. Dunque oggi Scania è in grado di coprire tutti i segmenti del mercato bus, dall’urbano all’interurbano fino appunto al turistico. Il Mondo dei Trasporti ha già avuto occasione di testare il nuovo Touring, nello specifico la versione HD 12,1 metri a due assi. A bordo del turistico del Gri fone, abbiamo percorso nel circondario di Trento, dove ha sede Italscania, un totale di oltre cento chilometri di strade a veloce percorrenza ma anche itinerari collinari e montani più impegnativi. In ogni situazione, il Touring ha messo in mostra le sue indubbie qualità costruttive che lo accomunano ai truck del Grifone e che confermano l’elevato know-how ingegneristico di Scania. Lo chassis viene

prodotto in Svezia mentre l’as semblaggio finale della carrozzeria del Touring viene eseguito con gli stessi standard qualitativi svedesi in Cina dal partner Higer. A quel punto il veicolo finito torna in Europa per gli affinamenti conclusivi. Quella con Higer è una partnership consolidata e destinata a ulteriori proficui sviluppi, visto che è stata

pratico e utile tavolino reclinabile. Su strada, Scania Touring garantisce un comportamento brillante e reattivo, da vero granturismo. Il riuscito controllo della rumorosità e delle vibrazioni in tutto il corpo del veicolo, sia anteriormente che posteriormente, a ridosso dell’alloggiamento del motore, consente ai passeggeri di

Il team Buses & Coaches di Italscania diretto da Roberto Caldini: da sinistra, Francesco Antolini, Roberto Caldini, Antonino Brancato e David Pisoni

Lo Scania Touring con la livrea del Giro d’Italia. Il coach del Grifone si sta facendo strada sul mercato italiano.

inaugurata la fabbrica a Suzhou che sarà impegnata e sclusivamente nella produzione del Touring e dei modelli bus e coach della gamma dual-branded Scania-Higer. Il veicolo in prova era equi paggiato con motore da 302 kW/410 cv a 1.900 gi ri/min, coppia massima di 2.150 Nm a 1.000-1.300 giri/min e cambio a 12 marce. Largo 2,55 metri e alto 3,80 metri, la versione 12,1 metri con sente un massimo di 55 posti a sedere con l’aggiunta del sedile hostess. Le porte di ac cesso al coach sono due, una anteriore e una centrale. La zona passeggeri è elegante e offre una buona visibilità esterna. I sedili sono muniti di cinture a due o tre punti e poggiatesta e piping in ecopelle. Sono presenti inoltre un bracciolo lato corridoio e un

viaggiare in modo confortevole. Nei tratti stradali a velocità più sostenuta, il potente propulsore sei cilindri assicura livelli prestazionali elevati e il cambio flessibile e dagli innesti dolci dà il suo contributo all’elevato livello generale di comfort. Sulle strade che circondano le colline e le prime alture trentine, il Touring non ha mostrato cedimenti di sorta, dimostrandosi pronto e reattivo anche nelle salite più impegnative. Le dotazioni di sicurezza sono molteplici e qualificano il Touring: Adaptive cruise control ACC, Lane departure warning LDW, Advance emergency braking AEB, Electronic brake system EBS, ABS, Traction con trol, Retarder Scania manuale/automatico, ESP, Bus stop brake, Hill hold. .


IL MONDO DEI TRASPORTI

N° 268 / Aprile 2018

Pagina 63

TOMASSINI STYLE CREA UN VEICOLO CHE ESALTA LE DOTI DELL’UNIMOG

In tour con il pullmino fuoristrada IL VEICOLO È UN AUTOBUS FUORISTRADA PER IL TRASPORTO DI PASSEGGERI SEDUTI, CATEGORIA M3G, DERIVANTE DAL TELAIO MERCEDES-BENZ “UNIMOG U5023”. GRAZIE A PECULIARITÀ COME ASSALI A PORTALE, TELAIO CON ELEVATE CAPACITA TORSIONALI, TRAZIONE INTEGRALE E NOTEVOLE ALTEZZA LIBERA DAL SUOLO, RISULTA IL VEICOLO PERFETTO PER L’UTILIZZO OFF-ROAD. UNIMOG ALLESTITO TOMASSINI STYLE È PRONTO A RISCRIVERE GLI ITINERARI CLASSICI DELLE STRADE TOSCANE, AFFINCHÉ I PASSEGGERI POSSANO APPREZZARE AL MEGLIO L’ESCLUSIVITÀ DEI PANORAMI E LE MERAVIGLIOSE STRADE STERRATE DEL CHIANTI.

N

LINO SINARI ROMA

uove strade e originali itinerari. Con Unimog tutto è possibile e lo dimostra la nuova “creatura” nata dal fruttuoso sodalizio tra Mercedes-Benz Italia Special Vehicles e l’esperto allestitore di autobus e veicoli speciali Tomassini Style: un Unimog Autobus Fuoristrada di Classe III che verrà utilizzato per organizzare Tour enogastronomici nelle cantine del Chianti. La meccanica Mercedes-Benz incontra la passione, l’elevata competenza e la capacità innovativa dell’azienda umbra. Il risultato è un gigante su quattro ruote, dalla linea aggressiva, energica e insieme minimalista, alimentato da un potente motore Euro VI a basso impatto ambientale che garantisce un’esuberante spinta per affrontare i terreni e le condizioni più difficili.

Compatto, robusto, sicuro, Unimog Autobus è un offroad vehicle che non conosce ostacoli e garantisce la possibilità di vivere vere esperienze a contatto con la natura; un trasporto sicuro e tanta avventura arrivando dove altri mezzi possono solo immaginare di avventurarsi. Nel dettaglio, il veicolo è un Autobus Fuoristrada per il trasporto di passeggeri se-

duti, categoria M3G, derivante dal telaio MercedesBenz “Unimog U5023”. Grazie a peculiarità come assali a portale, telaio con elevate capacita torsionali, trazione integrale e notevole altezza libera dal suolo, risulta il veicolo perfetto per l’utilizzo off-road. Per questo motivo, Unimog allestito Tomassini Style è pronto a riscrivere gli itinerari classici delle strade toscane, affin-

ché i passeggeri possano apprezzare al meglio l’esclusività dei panorami e le meravigliose strade sterrate del Chianti. Da oltre cinquant’anni Tomassini Style progetta e realizza veicoli personalizzati all’avanguardia nel design e nella tecnologia. La gamma dei veicoli è ampia e articolata, spaziando dai luxury van ai veicoli turistici, dai veicoli di linea agli scuolabus, dagli OB Van ai

veicoli speciali, da quelli sanitari ai veicoli per passeggeri diversamente abili. L’azienda con sede a Passignano sul Trasimeno (Pg) è diventata nel corso degli anni un solido punto di riferimento per tutti gli operatori del trasporto, in particolare quelli del trasporto passeggeri, che cercano veicoli altamente personalizzati in grado di soddisfare specifiche esigenze e particolari mission operative.

HANKOOK / COMPLETATA LA GAMMA PER BUS A LUNGA PERCORRENZA

Più silenzio, più potenza

IL COSTRUTTORE DI PNEUMATICI PREMIUM LANCIA

SMARTTOURING DL22 PER ASSE MOTORE CHE, AFFIANCANDOSI AL

“FRATELLO” SMARTTOURING AL22, COMPLETA LA FAMIGLIA DI PNEUMATICI PER AUTOBUS A LUNGA PERCORRENZA.

L’OBIETTIVO È RISPONDERE ALLA CRESCENTE DOMANDA DI LUNGHI VIAGGI IN AUTOBUS E ALL’AUMENTO DELLA RICHIESTA DI PNEUMATICI ALTAMENTE TECNOLOGICI, A BASSA RUMOROSITÀ E CHE

C

MATTEO GALIMBERTI NEU-ISENBURG

on l’introduzione del nuovo SmartTouring DL22, il costruttore di pneumatici premium Hankook offre ora ai professionisti con flotte di autobus un assortimento completo di pneumatici per bus utilizzati per lunghe percorrenze. Con l’obiettivo di rispondere al continuo aumento dei viaggi in autobus a lunga distanza, Hankook completa la sua gamma nel segmento dei

GARANTISCONO ELEVATO COMFORT DI

bus con questi nuovi pneumatici per asse motore. SmartTouring DL22 ha un coefficiente di rumore particolarmente basso e offre elevato comfort di marcia. Lo speciale disegno del battistrada garantisce usura uniforme dello pneumatico anche nell’uso continuo e rende possibile percorrenza elevata e una lunga durata di servizio. Come la maggior parte degli pneumatici per asse motore di Hankook, il nuovo pneumatico per tutte le stagioni reca

simbolo 3PMSF e marcatura M+S. Le lamelle 3D disposte a forma di V rendono possibili eccellenti proprietà di aderenza e trazione su neve e bagnato, senza avere effetto negativo sulle prestazioni di percorrenza. La tecnologia delle lamelle del nuovo modello fornisce anche buona aderenza longitudinale e laterale, oltre a stabilità direzionale e laterale, mentre la bassa resistenza al rotolamento rende possibili consumi di carburante efficienti.

Il produttore di pneumatici, nella sua gamma per autobus utilizzati su distanze brevi e medie, propone il testato e affidabile pneumatico AU03+, modello progettato specificamente per soddisfare i requisiti del traffico cittadino - caratterizzato da soste e ripartenze - e delle strade di campagna ed è particolarmente adatto all’uso su autobus urbani con orari fissi. L’anno scorso le pareti laterali sono state rinforzate per garantire un utilizzo ancora più sicuro ed

MARCIA.

efficiente nel traffico cittadino; è stato inoltre incorporato un indicatore più grande e profondo sulla parete laterale, per proteggere lo pneumatico da danneggiamenti, dovuti ad esempio al lancio di ghiaia e al contatto con i marciapiedi. Lo pneumatico per tutte le stagioni è disponibile nella misura 275/70R22,5 ed è dotato della marcatura M+S e del simbolo 3PMSF (fiocco di neve su montagna a tre cime), a garanzia di complete prestazioni.

Allison Transmission

Automatiche per il Muson River di Dotto Trains

D

otto Trains, azienda di Castelfranco Veneto (Tv), leader mondiale nella produzione di trenini turistici, ha scelto per il proprio modello di punta, il Muson River, una trasmissione completamente automatica Allison. “La scelta degli automatici Allison per Dotto è stata dettata soprattutto dalle richieste provenienti dai mercati esteri, in cui questa tipologia di trasmissioni va per la maggiore - spiega l’ingegner Fausto Rebuffoni, Amministratore delegato di Ofira Italiana, distributore italiano di Allison, consultato nel 2012 per collaborare alla nuova versione ‘automatica’ del Muson River 2x4 - Il comfort che una trasmissione automatica è in grado di offrire ai passeggeri ha anch’esso contribuito alla decisione della Dotto. Con un Allison non ci sono i rallentamenti e i sobbalzi tipici dei cambi marcia di un cambio manuale, soprattutto nei percorsi urbani”. Dotto produce trenini turistici dal 1962, anticipando le tematiche ecologiche ora così diffuse (e necessarie) e proponendo una tipologia di trasporto alternativa e di gruppo. Sono oltre 2.500 i trenini Dotto che trasportano persone in tutto il mondo. In alcune città europee come Lugano e Binz (Germania) i trenini vengono addirittura utilizzati come metropolitane di superficie. Il modello di trenino più venduto, il Muson River 2x4, risulta maneggevole nelle vie strette dei centri storici e viene utilizzato largamente in parchi tematici, località turistiche e villaggi turistici. Il Muson River monta una trasmissione Allison Serie 2500 a 5 rapporti in abbinamento a un motore turbodiesel Euro 6 a 4 cilindri. A differenza dei cambi manuali o automatizzati, le trasmissioni Allison dispongono della Continuous Power Technology che permette di trasmettere senza interruzioni la potenza del motore alle ruote, consentendo al conducente di concentrarsi sulla guida del trenino. Inoltre, la trasmissione automatica Allison si presta meglio a un’integrazione con le altre unità di controllo di bordo (come l’EDC motore) e a implementare con una certa facilità varie funzioni volte a garantire la sicurezza operativa della macchina.


20/12/17

11:24

Il Mondo dei Trasporti - Aprile 2018  
Il Mondo dei Trasporti - Aprile 2018