Page 1

at Duke ..................................................... 2 pm

Nov. 18

at Longwood ..............................................7 pm

at Wofford*.................................................6 pm

% vs. LaSalle .............................................5 pm

% at Central Florida...............................7:30 pm

Dec. 5

Dec. 15

Dec. 19

Dec. 20

FURMAN* ...................................................3 pm

Mar. 1

% Central Florida Tournament

* Southern Conference Game

Home games in CAPS/ITALICS

(at North Charleston, SC) ............................TBA

Mar. 6-10 Southern Conference Tournament

at Elon*..................................................... 2 pm

at Appalachian State* ................................7 pm

Feb. 19

WOFFORD* .................................................5 pm

at Davidson* ..............................................7 pm

Feb. 15

Feb. 28

CHATTANOOGA*.........................................7 pm

Feb. 11

Feb. 23

at College of Charleston* ..................... 4:30 pm

at Georgia Southern* .................................3 pm

Feb. 2

WESTERN CAROLINA*................................3 pm

ELON* ........................................................3 pm

Jan. 26

Feb. 9

APPALACHIAN STATE* ..............................3 pm

Jan. 21

Feb. 4

at Chattanooga* .........................................7 pm

Jan. 12

DAVIDSON* ................................................7 pm

at Western Carolina* ................................. 4 pm

Jan. 7

Jan. 18

COLLEGE OF CHARLESTON*.......................3 pm

Jan. 5

Jan. 14

at Furman*.................................................7 pm

GEORGIA SOUTHERN* ........................... 12 Noon

Jan. 2

Dec. 28 CHOWAN ...................................................3 pm

at High Point..............................................7 pm

Dec. 3

Nov. 28 CHARLOTTE...............................................7 pm

Nov. 24 Championship game ..................................3 pm

Nov. 24 Consolation game ...................................... 1 pm

Nov. 23 North Carolina A&T vs. UNC Asheville........3 pm

Nov. 23 BOSTON UNIVERSITY................................. 1 pm

UNCG Thanksgiving Tournament

at North Carolina State.............................. 2 pm

LIBERTY ....................................................7 pm

Nov. 13

ST. PAUL’S (EXH) ......................................7 pm

Nov. 11

Nov. 2

2007-08 UNCG Women’s Basketball Media Guide


Nov. 2 Nov. 11 Nov. 13 Nov. 18

7 pm 2 pm 7 pm 2 pm

7 pm 7 pm 6 pm

Dec. 19 Dec. 20 Dec. 28

at High Point at Longwood at Wofford* Central Florida Tournament vs. LaSalle$ at Central Florida$ Chowan University

Jan. 2 Jan. 5 Jan. 7 Jan. 12 Jan. 14 Jan. 18 Jan. 21 Jan. 26

at Furman* Georgia Southern* College of Charleston* at Western Carolina* at Chattanooga* Davidson* Appalachian State* Elon*

7 pm 12 Noon 3 pm 4 pm 7 pm 7 pm 3 pm 3 pm

Feb. 2 Feb. 4 Feb. 9 Feb. 11 Feb. 15 Feb. 19 Feb. 23 Feb. 28

at Georgia Southern* at College of Charleston* Western Carolina* Chattanooga* at Davidson* at Appalachian State* at Elon* Wofford*

3 pm 4:30 pm 3 pm 7 pm 7 pm 7 pm 2 pm 5 pm

Mar. 1 Mar. 6-10

Furman* Southern Conference Tournament

3 pm TBA

Nov. 23 Nov. 23 Nov. 24 Nov. 24 Nov. 28 Dec. 3 Dec. 5 Dec. 15

* Southern Conference Game ! UNCG Thanksgiving Tournament (Greensboro, NC) $ University of Central Florida Holiday Classic (Orlando, FL)

1 pm 3 pm 1 pm 3 pm 7 pm

5 pm 7:30 pm 3 pm

SPORTS INFORMATION OFFICE Sports Info. Director.......................... Mike Hirschman Email ........................................mwhirsch@uncg.edu Cell Phone........................................ 336-202-5331 Asst. SID (WBK Contact)........................ Jessica Poole Email ...........................................jepoole@uncg.edu Cell Phone........................................ 336-207-2383 Sports Info. Intern............................... Christy Kramer Email.......................................cmkramer@uncg.edu Sports Information Phone .................. 336-334-5615 Sports Information Fax....................... 336-334-3182 6,'2IÀFH$GGUHVV ..............................UNCG Athletics ............................................................PO Box 26168 ..................................... Greensboro, NC 27402-6168 Overnight Address...........................301 HHP Buliding ....................................................... 1500 Walker Ave. ...............................................Greensboro, NC 27403 Press Row Phone ............................... 336-334-3270 Website ................................ www.uncgspartans.com UNCG WOMEN’S BASKETBALL INFORMATION Head Coach ..............................................Lynne Agee Alma Mater...................................... Longwood, 1971 Record at UNCG........................... 513-233 (26 years) Career Record..............................559-256 (29 years) Division I Record .......................................... 292-171 Best Time To Reach................................. Through SID Associate Head Coach ....Carol Peschel (UNCG, 1982) Assistant Coaches ................Jon Hines (UNCG, 2002) ............................. Ashley Hayes (Murray State, 2007) :%.2IÀFH3KRQH.............................. 336-334-3002 Last NCAA Apperance ....................................... 1998 ........................................... (Lost to Alabama, 94-46) Last WNIT Appearance .......................................2001 ............................................... (Lost to Virginia Tech, 51-46) 2006 SEASON IN REVIEW 2006 Overall Record........................................ 20-10 2006 SoCon Record .......................................... 13-5 SoCon Tournament Finish.......................4XDUWHUÀQDOV 2007 OUTLOOK Players Returning/Lost ......................................10/3 Starters Returning/Lost.......................................2/3 Newcomers..............................................................6

2007-08 UNCG Women’s Baskerball Media Guide • 1

Table of Contents

St. Paul’s (EXH) at North Carolina State Liberty at Duke UNCG Thanksgiving Tournament Boston University! North Carolina A&T vs. UNC Asheville! Consolation game! Championship game! Charlotte

UNIVERSITY FACTS Name .........The University of North Carolina at Greensboro Preferred Name...................UNC Greensboro or UNCG Location ............................................Greensboro, NC Founded ............................................................1891 Enrollment..................................................... 16,386 Nickname ....................................................Spartans Colors...........................................Gold, White & Navy Arena..............................Fleming Gymnasium (1,833) $IÀOLDWLRQ............................................NCAA Division I Conference ..................................................Southern Chancellor ............................... Dr. Patricia A. Sullivan Alma Mater.......... Notre Dame College of St. John’s, 1963 Director of Athletics ............................Nelson E. Bobb Alma Mater......................................Kent State, 1970 Athletics Dept. Phone......................... 336-334-5952 7LFNHW2IÀFH3KRQH ............................ 336-334-3250

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartan

2007 UNCG Women’s Basketball Schedule


2007-08 UNCG Women’s Basketball Media Guide CREDITS The 2007 University of North Carolina at Greensboro women’s basketball media guide was written by Jessica Poole, UNCG Assistant Sports Information Director. This guide was designed using Adobe Creative Suite CS2. Editorial assistance provided by Sports Information Director Mike Hirschman and Sports Information Intern Christy Kramer. Photography by WG Sports, John Bell, Chris English, Jerry Wolford and others.

Table of Contents

ON THE COVERS Front: Seniors Kristen Boone, Kemena Brooks, Meghan Chamberlain, Jasmine Dixon and Brittany Frazier Back: Head Coach Lynne Agee (covers designed by Mike Hirschman, SID) MEDIA NOTE Just a reminder to please refer to our institution as UNC Greensboro (no hyphen) or UNCG on second reference.

2006-07 Season Review 2006-07 Statistics ......................................................... 36-39 2006-07 Recaps............................................................. 40-49 Southern Conference Review........................................... 50-52 Southern Conference History of the Southern Conference ................................. 54-55 SoCon 2007-08 Composite Schedule ..............................56-57 Oppponents................................................................. 58-64 Historical Information UNCG Women’s Basketball History.................................. 66-68 Record Book ................................................................... 69-79 All-Time Honors ....................................................................80 All-Time Results ...............................................................81-87 All-Time Roster .....................................................................88 UNCG Information This is UNCG ................................................................... 90-93 Administration.................................................................94-97 Athletics History............................................................ 98-102 UNCG Athletics Hall of Fame ....................................... 103-106 Fleming Gymnasium............................................................ 107 UNCG Spartan Club .................................................... 108-109 Getting To UNCG ................................................................. 112

Table of Contents 2007 Team Infomation 2007-08 Rosters .................................................................... 3 Summer ‘07 Italy Trip ...........................................................4-5 Season Outlook ...................................................................6-8 Coaching Staff Head Coach Lynne Agee...................................................10-12 Associate Head Coach Carol Peschel..................................... 13 Assistant Coach Jon Hines..................................................... 14 Assistant Caoch Ashley Hayes/Managers.............................. 14 Spartan Player Bios Kristen Boone ..................................................................16-17 Kemena Brooks ...............................................................18-19 Meghan Chamberlain.......................................................20-21 Jasmine Dixon................................................................. 22-23 Brittany Frazier.................................................................24-25 Gini Grimsley ...................................................................26-27 Ashley Ling ..................................................................... 28-29 Ashley Mullins.......................................................................30 Agne Girstautaite.................................................................. 31 Lakiah Hyson ........................................................................32 Amanda Leigh.......................................................................33 Sharniece Wadelington .........................................................34 TaShama Banner...................................................................33 Monique Floyd ......................................................................34 Kendra Smith........................................................................34 Johanna Womack..................................................................33

2 • 2007-08 UNCG Women’s Basketball Media Guide

Media Information Media Services ............................................................110-111 Radio/TV Chart..............................................Inside Front Cover The University of North Carolina at Greensboro is a leading student-centered university, linking the Piedmont Triad to the world through learning, discovery and service.


No. 2 3 10 12 14 15 20 21 22 23 30 31 33 40 41 44

Name Amanda Leigh* Jasmine Dixon Sharniece Wadelington Lakiah Hyson TaShama Banner Monique Floyd Johanna Womack Kristen Boone Kemena Brooks Ashley Ling Gini Grimsley Ashley Mullins Kendra Smith Brittany Frazier Agne Girstautaite Meghan Chamberlain

Pos. G F G G G G F G G G G/F F F F C C

Ht. 5-10 5-11 5-6 5-7 5-7 5-9 5-10 5-5 5-8 5-6 6-0 5-11 6-1 6-0 6-4 6-3

Yr. So-r Sr. Fr. So. Fr. Fr. Fr. Sr. Sr. Jr. Jr. So.-r Fr. Sr.-r Fr.-r Sr.

Hometown/Previous School Charlotte, NC/ Sun Valley HS (Winthrop) Reston, VA/ South Lakes HS Greenville, SC/ J. L. Mann HS Accokeek, MD/ Gwynn Park HS Bladenboro, NC/ West Bladen HS Fairmont, NC/ Fairmont HS Jacksonville, NC/ Northside HS Upper Marlboro, MD/ Gwynn Park HS Accokeek, MD/ Gwynn Park HS Centreville, VA/ Centreville HS Fairmont, NC/ Fairmont HS Honaker, VA/ Honaker HS Columbus, GA/ Kendrick HS Powell, TN/ Walters State CC Kaunas, Lithuania/ Holy Cross HS (VA) Lake Mary, FL/ Lake Mary HS

*-Leigh will sit out the 2007-08 season due to NCAA Transfer regulations

Alphabetical Roster No. 14 21 22 44 3 15 40 41 30 12 2 23 31 33 10 20

Name TaShama Banner Kristen Boone Kemena Brooks Meghan Chamberlain Jasmine Dixon Monique Floyd Brittany Frazier Agne Girstautaite Gini Grimsley Lakiah Hyson Amanda Leigh* Ashley Ling Ashley Mullins Kendra Smith Sharniece Wadelington Johanna Womack

Pos. G G G C F G F C G/F G G G F F G F

Ht. 5-7 5-5 5-8 6-3 5-11 5-9 6-0 6-4 6-0 5-7 5-10 5-6 5-11 6-1 5-6 5-10

Yr. Fr. Sr. Sr. Sr. Sr. Fr. Sr.-r Fr.-r Jr. So. So-r Jr. So.-r Fr. Fr. Fr.

Hometown/Previous School Bladenboro, NC/ West Bladen HS Upper Marlboro, MD/ Gwynn Park HS Accokeek, MD/ Gwynn Park HS Lake Mary, FL/ Lake Mary HS Reston, VA/ South Lakes HS Fairmont, NC/ Fairmont HS Powell, TN/ Walters State CC Kaunas, Lithuania/ Holy Cross HS (VA) Fairmont, NC/ Fairmont HS Accokeek, MD/ Gwynn Park HS Charlotte, NC/ Sun Valley HS (Winthrop) Centreville, VA/ Centreville HS Honaker, VA/ Honaker HS Columbus, GA/ Kendrick HS Greenville, SC/ J. L. Mann HS Jacksonville, NC/ Northside HS

*-Leigh will sit out the 2007-08 season due to NCAA Transfer regulations Head Coach: Lynne Agee (Longwood, 1971) Associate Head Coach: Carol Peschel (UNCG, 1982) Assistant Coaches: Jon Hines (UNCG, 2002), Ashley Hayes (Murray State, 2007)

UNCG Women’s Basketball Media Guide • 3

2007-08 Rosters

Head Coach: Lynne Agee (Longwood, 1971) Associate Head Coach: Carol Peschel (UNCG, 1982) Assistant Coaches: Jon Hines (UNCG, 2002), Ashley Hayes (Murray State, 2007)

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com

Numerical Roster


n May of 2007 the UNCG men’s and women’s basketball programs went on a 10-day tour of Italy. The team’s SOD\HGVRPHLQWHUQDWLRQDOFRPSHWLWLRQZKLOHDOVRJHWWLQJDÀUVWKDQGHGXFDWLRQLQDOOWKLQJV,WDOLDQ7KHWHDPV got to see the sights of the country, including spending some time at the Vatican and the world-famous St. Peter’s Basilica. The team spent time shopping in the straw markets of Florence and visiting many of the architectual sites that Florence has to offer. Getting to Venice was an adventure in itself. Since the city is surrounded by water the team’s took a boat ride into the city and went on a gondala ride during their stay. The women’s team came home with a 3-0 record after defeating teams out of San Bonifacio, Abano Terme DQG)ORUHQFHLQFOXGLQJDYLFWRU\RYHU,WDOLDQ/HDJXHFKDPSLRQV&DVWHOODQLLQWKHLUÀQDOJDPH&KHFNRXWVRPHRI their pictures and a map of all the places they toured Italian Cities Visited:

I

2007 Italy Trip

Milan Rome Lake Como Venice Florence San Marino Remmini Vatican City

4 • 2007-08 UNCG Women’s Basketball Media Guide


UNCGSpartans • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com •

2007 Italy Trip

2007-08 UNCG Women’s Basketball Media Guide • 5


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com •UNCG

Season OUtlook

n paper the 2007-08 edition of the UNCG women’s basketball team seems one destined for a rebuilding year. The squad lost their leading scorer, leading rebounder and best defender to graduation but don’t count them out just yet. The Spartans return three-time Southern Conference All-Conference performer Kristen %RRQHDQGKDYHĂ€YHVHQLRUVZKRZLOOEHWKHKHDUW and soul of this season’s squad. Last year’s team reached the 20-win plaWHDXIRUWKHĂ€UVWWLPHVLQFHWKHVHDVRQ and although they had a disappointing end to the season in the Southern Conference Tournament TXDUWHUĂ€QDOVZLWKWKHOHDGHUVKLSRIWKHXSperclassmen, this team is looking to make a deep run in the Southern Conference Championships and earn a spot to “The Big Danceâ€?.

O

Coaching Staff UNCG head coach Lynne Ageee returns for her 27th year on the sidelines for the Spartans and her 30th year overall. Agee owns a 559-256 career record and stands tied forr 16th most victories among active Division I women’s basketball coaches. Last season Agee saw some important coaching milestones. She picked up her 500th victory at UNCG when the Spartans defeated Liberty and picked up her 550th career win during the season. Associate head coach Carol Peschel returns for herr 11th season in the role of associate head coach and her 24th overall year with the Spartans. Assistant coach Jon Hines also returns this season. Hines, who is entering his fourth year with the program, begins his second season as the second assistant after being elevated when former assistant coach Vickie Henson stepped down prior to last season. The Spartans welcome former Murray State standout Ashley Hayes to the staff this season. Hayes, replaces former Spartan assistant coach Amanda Eaton who took an assistant coaching position at Mars Hill. Guards Senior point guard Kristen Boone is no stranger to anyone in the Southern Conference. The 5-5, Upper Marlboro, MD native has been a vital part of this team since VKHÀUVWDUULYHGRQWKH scene in 2004. Boone is a threetime All-Southern Conference First Team performer and last season was no different. She was second on the team in scoring last season (10.8) and was ÀUVWRQWKHWHDPLQIUHH throws made (94), steals (91) and assists (121). 6 • 2007-08 UNCG Women’s Basketball Media Guide

The senior also reac some impressive mi last season. In the s opener against UNC ington she picked u steals, one shy of th school record off 12 a new career high in when she dropped 2 points against Furm January 3rd. In addi with her 91 steals sh became UNCG’s allsteals leader with 3 passing former Spa great Samika Foster who tallied 279 dur her career. Senior Kemen Brooks will also be ORRNHGXSRQWRÀOO the void left by the graduation of Jasmine Byrd. Brooks, who primarily played off of the bench last season, will be asked to step up and help shoulder the load in the backcourt. The Accokeek, MD native appeared in 29 gam and scored a season-high nine points on two occasions. Brooks also established herself at the free throw line and on four occasions was perfect from the charity stripe. For the Spartans to go, the coaching staff will be looking for Brooks to re-create some of the magic that she had during KHUVRSKRPRUHFDPSDLJQ6KHÀQLVKHGWKDW\HDU VWURQJDQGVFRUHGLQGRXEOHÀJXUHVLQHLJKWRIWKH lastt 13 games and earned SoCon Player of the Week honors. Junior back-up point guard Ashley Ling will also play an important role this year. Ling d i ll 30

games a year ago and had several impressive performances. She turned in a career performance in the season opener against UNC Wilmington by setting new career-highs in points  ÀHOGJRDOVPDGH  IUHHWKURZVPDGH   and steals (3). She also set a new career mark IRUDVVLVWVZLWKÀYHLQ81&*¡VZLQRYHU Georgia Southern. Sophomore Lakiah Hyson will see more action this year after playing in 20 games last season. The Spartans will also bring three new guards into the backcourt mix Sharniece Wadelington, hama Banner and Monique yd. rwards e Spartans will be loaded th plenty of upperclassmen t this position and they will l be called upon to replace he loss of leading rebouder, KaLeah Latham from a year ago. Brittany Frazier came into her own light at the end of last season and will be a key player in UNCG’s forward rotation. A transfer from Walters State Community College in 2005-


Center Lake Mary, FL native Meghan Chamberlain is back after being hampered by injury most of last season. She saw action in 25 games last season, starting 22. Despite her injuries she was third on the team in blocked shots (16) and defensive rebounds (60). The Spartans will look to her to lead at the center position after the dominating sophomore campaign she had. After being inserted into the starting lineup for the last 20 games of the season she established herself as one of the top centers in the Southern Conference. Spartan fans will get a chance to see what redshirt freshman Agne Girstautaite can do after RQO\VHHLQJĂ DVKHVODVWVHDVRQEHIRUHVKHZHQW down with a knee injury in late November. In the limited time that she did see on

the court she was impress Kaunas, Lithuania native t eight points and seven reb RQRIVKRRWLQJIURPWK against Longwood in the U Thanksgiving Tournament. Schedule UNCG has put together an strong non-conference sch ule that should ready the b club for the demanding So ern Conference. The Spart will play home-and-home series with the nine other conference schools, includ ing the conference opener Wofford on Decemberr 15. The Spartans open the regular season Nov. 11 against ACC conference member and 2007 NCAA Tournament Participant, North Carolina Sate. The last time the two teams met, the Wolfpack defeated the Spartans, 76-46 in the season opener during the 2005-06 season UNCG will host its tournament around Thanksgiving and welcomes UNC Asheville, Boston University and cross-town rival, North Carolina A&T. In other critical match-ups the Spartans will take on Duke and will face backyard rival High Point in non-conference games. The Spartans will also head to the Sunshine State for the Central Florida Holiday Classic. 81&*ZLOOWDNHRQ/D6DOOHIRUWKHĂ€UVWWLPHLQ program history and will face the host Knights before breaking for the holidays. UNCG will host Liberty in Fleming Gym and will face Longwood on the road. The Southern Conference Tournament will take place March 6 through March 10 at the North Charleston Coliseum in Charleston, SC.

Senior Forward Jasmine Dixon

2007 08 UNCG Women s Basketball Media Guide • 7

Season Outlook

VKHVDZKHUÀUVWVHDVRQZLWKWKH6SDUWDQVFXW short after a knee injury against West Virginia but last year she came back and showed that she has what it takes to pull in the big rebounds and come up with crucial stops. Starting in eight games last season, the Powell, TN native recorded a careerhigh 20 points in UNCG’s 71-67 win over Wofford. She saw three double-doubles on the season DQGVFRUHGLQGRXEOHÀJXUHVLQDFDUHHUKLJKÀYH games. Another player in the mix will be Jasmine Dixon. The Reston, VA native has a wealth of experience and can grind it out in the post but also has a valuable mid-range jumper. Dixon saw action in all 30 games last season and averaged 4.0 points, 3.1 rebounds in 14. 7 minutes. Fairmont, NC native Gini Grimsley is an explosive talent that will play a much more prominent role with the team this season. The Spartans will look to get Grimsley the ball more and use her scoring ability and if all goes according to plan the Spartans are looking for Grimsley to be a double-digit scorer this season. Ashely Mullins will also be back this season after sitting out most of last year with an injury. The Honaker, VA native will work to see more time on the court this season. UNCG also adds freshman Kendra Smith to the mix. The Columbus, GA native has a great presence on the court and is sure to see action on the hardwood this season.


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com •UNCG

Season OUtlook

2007-08 Roster Breakdown STA T RTERS RETURNING: 2 ( Kristen Boone, Meghan Chamberlain) No. 21 44

Name Kristen Boone Meghan Chamberlain

Pos. G C

Ht. 5-5 6-3

Yr. Sr. Sr.

Pts 10.9 5.3

Rebs 3.4 3.9

Asts 121 19

Stls 91 8

Blks 7 16

STA T RTERS LOST: 3 OTHER RETURNERS: 8 (Jasmine Dixon, Kemena Brooks, Ashley Ling, Gini Grimsley, Ashley Mullins, Brittany Frazier, Lakiah Hyson, Agne Girstautaite) No. 3 12 22 23 30 31 40 41

Name Jasmine Dixon Lakiah Hyson Kemena Brooks Ashley Ling Gini Grimsley Ashley Mullins Brittany Frazier Agne Girstautaite

Pos. F G G G F/G F F C

Ht. 5-11 5-8 5-8 5-6 6-0 5-11 6-0 6-4

Yr. Sr. Fr. Sr. Jr. Jr. So-r Sr-r. Fr-r

Pts 4.0 0.7 3.4 0.9 3.2 2.0 5.5 2.4

Rebs 3.1 0.4 1.5 1.2 1.7 1.8 5.1 2.2

Asts 16 7 16 42 11 1 38 0

Pos. G G G F F

Ht. 5-7 5-7 5-9 5-8 6-1

Yr. Fr. Fr. Fr. Fr. Fr.

Hometown/High School Greenville, SC/J.L. Mann Bladenboro, NC/West Bladen Fairmont, NC/Fairmont Jacksonville, NC/Northside Columbus, GA/Kendrick

NEWCOMERS: 5 No. 10 14 15 20 33

Name Sharniece Wadelington TaShama Banner Monique Floyd Johanna Womack Kendra Smith

BREAKDOWN BY CLASS SENIORS: 5 (Kristen Boone, Kemena Brooks, Meghan Chamberlain, Jasmine Dixon, Brittany Frazier) JUNIORS: 3 (Gini Grimsley, Ashley Ling, Ashley Mullins) SOPHOMORES: 2 (Agne Girstautaite, Lakiah Hyson) FRESHMEN: 5 (TaShama Banner, Monique Floyd, Kendra Smith, Sharniece Wadelington, Johanna Womack)

nior Center Meghan amberlain

Sophomore Guard Lakiah Hyson

8 • 2007-08 UNCG Women’s Basketball Media Guide

Stls 17 8 7 16 12 0 16 0

Blks 7 3 3 1 19 1 29 2


Spartan Coaching Staff


GSpartans.com • UNCGSpartans

Spartan Coaching Staff

Lynne Agee File Personal Birthplace: Roanoke, VA

Education College: Longwood, 1971 Radford, 1981

Coaching Experience UNCG head coach Lynne Agee is widely respected throughout the nation as one of the premier coaches on the women’s college basketball scene. Agee embarked on her 26th season with the Spartans in 2006-07. Agee has built quite a resume as she has not only won 69 percent of her games, but ZDVDOVRWKHÀUVWZRPHQ¡VEDVNHWEDOOFRDFKWROHDGDVFKRROWRWKH1&$$7RXUQDPHQWLQ all three divisions. For her career achievements at UNCG, she was inducted into the UNCG Athletics +DOORI)DPHLQWKHIDOORI6KHZDVWKHÀUVWDFWLYHKHDGFRDFKWREHHQVKULQHGLQ he UNCG Athletics Hall of Fame and was selected to give the acceptance speech on behalf of the class, which included the 1973 women’s golf national championship team, he 1982 men’s soccer national championship team and long-time Faculty Athletics Representative and long-time friend of Agee’s David Knight, who was inducted posthumously. Agee has amassed a 513-233 mark at UNCG and a 559-256 career record in 29 years on the collegiate sidelines. This year, she has surpassed some very impressive milestones. Agee picked up her 500th at UNCG against Liberty on Dec. 30, she earned her 550 career win against Appalachian State on Jan. 13. She also coached her 800th game at the college level a year ago. In 2004, she won her 500th career game as a head coach. In 25 seasons with the Spartans, Agee has registered nearly 82-percent of the program’s wins. In 2000, she became the 16th active coach to reach 400 wins at their current school. Agee not only ranks among the most successful active Division I coaches in North Carolina, but across the country. She stands third in the state with a .686 winning per-

10 • 2007-08 UNCG Women’s Basketball Media Guide

William Fleming HS, 1971-197 Roanoke College, 1978-1981 UNCG, 1981-Present

Postseason History Roanoke College – AIAW National Tournament UNCG – 1982 NCAA Division III Tourn. Runner-up UNCG – 1983 NCAA Division III South Regional UNCG – 1984 NCAA Division III South Regional UNCG – 1985 NCAA Division III South Regional UNCG – 1986 NCAA Division III South Regional UNCG – 1987 NCAA Division III South Regional UNCG – 1988 NCAA Division III Final Four UNCG – 1991 NCAA Division II South Atlantic Regional UNCG – 1998 NCAA Division I Midwest Regional UNCG – 2002 National Invitational Tournament First Round centage, trailing only former Duke coach Gail Goestenkors (.790) and North Carolina’s Sylvia Hatchell (.728). Agee also ranks third in the state in career wins with 538, trailing only Hatchell (717) and Kay Yow (693) of North Carolina State. Under the guidance of Agee, UNCG has reached the 20-win plateau 15 times. The Spartans have also earned berths into the Division I national tournament once, the Division II tournament once and the Division III tournament seven times. With Agee at the helm, UNCG became one of onlyy 10 teams naWLRQDOO\ DOOGLYLVLRQV WRUHDFKWKH1&$$7RXUQDPHQWHDFKRIWKHÀUVWVHYHQ years it was held (1982-1988). Agee has led her teams to 13 conference championships, including the 2002 Southern Conference regular season crown. Agee also led the Spartans to the 1999 Southern Conference regular season title, the 1998 Southern &RQIHUHQFH 7RXUQDPHQW WLWOH DQG ÀYH %LJ 6RXWK &RQIHUHQFH UHJXODU VHDVRQ championships. UNCG was Big South Tournament runners-up four times, as well as Southern Conference Tournament runners-up on four other occasions, including three consecutive seasons. Agee has coached four All-Americans in her time at UNCG. Several of her players have gone on to become high school or college coaches, including current associate head coach Carol Peschel,and former Spartan assistant coaches Vickie Henson, Amanda Eaton and Nicole Murray. Agee began her coaching career at William Fleming High School in Roanoke, VA. She compiled a 94-16 record in seven years as head basketball coach. Agee captured seven league titles, four district championships and one regional title. Agee left William Fleming HS to become women’s basketball coach at Roanoke College in 1978. In three years at the helm, Agee compiled a 46-23 UHFRUG7KHGHÀQLWHKLJKOLJKWRIKHUWLPHZLWKWKH/DG\0DURRQVZDVWKH 81 season. Roanoke went 21-6, captured the Virginia Association of IntercolOHJLDWH$WKOHWLFVIRU:RPHQ $,$: 'LYLVLRQ,,,VWDWHWLWOHDQGTXDOLÀHGIRUWKH AIAW national playoffs. $JHHDUULYHGDW81&*LQDQGOHGKHUÀUVW\HDUVTXDGWRDUHcord and a trip to the inaugural NCAA Division III Tournament. The Spartans ÀQLVKHGWKDWUHPDUNDEOHFDPSDLJQDV1&$$'LYLVLRQ,,,UXQQHUXS81&*UDQ the table in the Dixie Conference, going a perfectt 12-0, and won its lastt 10


UNCGSpartans.com • UNCGSpart

Spartan Coaching Staff

games before its matchup with Elizabethtown (PA) in the National Championship game. The Spartans rallied from nine points down at halftime to force overtime, but came up just a point shy, losing to the host, 67-66. 7KH  WHDP Ă€QLVKHG LWV UHFRUG VHWWLQJ \HDU ZLWK DQ DVWRXQGLQJ  mark. UNCG set a school record for wins in a single-season and also put together a remarkable 24-game winning streak. The Spartans stood just 3-2 early into the VHDVRQEXWUDQRIIVWUDLJKWEHIRUHLWVĂ€UVWURXQGORVVWR&HQWUH&ROOHJHLQWKH NCAA Division III South Regional. The winning streak still ranks in the Top 10 in NCAA Division III history. DWULSWRWKHLQDXJXUDO1&$$'LYLVLRQ,,,7RXUQDPHQW7KH6SDUWDQVĂ€QLVKHGWKDWUHmarkable campaign as NCAA Division III runner-up. UNCG ran the table in the Dixie Conference, going a perfect The 1987-88 squad rode that momentum from WKHSUHYLRXVVHDVRQWRDUHFRUGLQLWVĂ€QDO1&$$'LYLVLRQ,,,FDPSDLJQ81&* recorded three narrow victories over Centre, Rust and Luther to reach the Final Four, but Concordia (MN) ended any hopes of a National Championship with a 103-66 triumph over the Spartans. UNCG did come back to defeat Southern Maine, 68-66, in the consolation game to place third in the tournament. In three seasons of Division II competition, the Spartans compiled a 55-24 record and earned national rankings each year. In fact, the 1990-91 squad was runner-up in the NCAA Division II South Atlantic Regional. UNCG ended that season, its last at the NCAA Division II level, ranked No. 16 in the national poll. The Spartans completed its transition from NCAA Division III to NCAA Division ,LQWKHVHDVRQ81&*ERDVWHGDUHFRUGLQLWVĂ€UVWVHDVRQRI'LYLVLRQ I. Agee was named Big South Conference Co-Coach of the Year in 1992-93 after guiding her team to a 19-10 record and winning the league’s regular season title in WKH6SDUWDQVĂ€UVWVHDVRQRIPHPEHUVKLS The Spartans went on to dominate the Big South by posting a 70-12 conference UHFRUGGXULQJLWVĂ€YH\HDUPHPEHUVKLSLQWKHOHDJXH81&*FDSWXUHGRUVKDUHGWKH regular season title every season and advanced to the conference tournament’s title game four times. ,QLWVĂ€UVWLQWKH6RXWKHUQ&RQIHUHQFH81&*SRVWHGDUHFRUG won the conference tournament championship and earned a berth into the NCAA 7RXUQDPHQW,WZDVWKHĂ€UVWDSSHDUDQFHIRUWKH6SDUWDQVLQWKH1&$$'LYLVLRQ,7RXUnament. In 1998-99, UNCG won the conference regular season title despite the loss of Ă€YHVHQLRUVIURPWKHSUHYLRXV\HDU 7KHFOXEĂ€QLVKHGZLWKDQUHFRUGDQGDGYDQFHGWRWKH6R&RQ championship game. Among the 18 wins was an overtime win overr 1999 ACC champion Clemson, UNCG’s second-ever win against an ACC opponent. The Spartans


GSpartans.com • UNCGSpartans

Spartan Coaching Staff

500-win Club ( Division I Coaches)

made win. UNCG became just the second team in North Carolina to reach the 500-win plateau. The 2000-01 team turned in the best season ever by an Agee coached team Q'LYLVLRQ,SOD\E\QRWFKLQJZLQV7KH6SDUWDQVUHDFKHGWKH6R&RQĂ€QDOVIRU he second-straight season, falling by one point to Chattanooga. In 2001-02, Agee was named SoCon Coach of the Year after leading the Spartans to a share of the regular season title and made its third straight appearance in the SoCon Tournament title game. UNCG was invited to participate QWKH:RPHQ¡V1DWLRQDO,QYLWDWLRQDO7RXUQDPHQWIRUWKHĂ€UVWWLPHIDOOLQJ o Virginia Tech 51-46. In 2002-03, the Spartans notched their 22nd consecutive winning season under Coach Agee, goingg 14-13, despite an injury to key post player Jennifer Hart early in the year. The 2003-04 season was not a typical one for UNCG. While sending Agee QWRWKHZLQFOXEWKHWHDPĂ€QLVKHGMXVWPDUNLQJWKHĂ€UVWWLPHDWHDP coached by Agee did not win at leastt 10 games. The 2004-05 squad made a drastic improvement over the prior season, SRVWLQJDUHFRUGDQGDIRXUWKSODFHĂ€QLVKLQWKH6R&RQUHJXODUVHDVRQ standings. Kristen Boone was named conference freshman of the year, while eading the country in steals. The 2005-06 edition restored UNCG among the elite in the conference. $IWHUĂ€QLVKLQJVHFRQGLQWKHUHJXODUVHDVRQZLWKDVODWHWKHPRVWOHDJXH ZLQVLQĂ€YH\HDUVWKH6SDUWDQVPDGHDUXQDOOWKHZD\WRWKH6R&RQ7RXUQDPHQW itle game, before ultimately bowing out to long-standing rival Chattanooga, 91-79. Meanwhile, Boone garnered All-SoCon plaudits and registered overr 100 steals for the second straight year. 7KHVTXDGSRVWHGZLQVIRUWKHĂ€UVWWLPHVLQFHWKH VHDVRQĂ€QLVKLQJZLWKDUHFRUGJRRGIRUDWLHIRUWKLUGSODFHLQWKH6R&RQ ZKLFKVDZIRXUWHDPVZLWKZLQVIRUWKHĂ€UVWWLPHLQFRQIHUHQFHKLVWRU\7KH season saw Boone become UNCG’s all-time steals leader with 313 steals and senior Jasmine Byrd record herr 1,000th career point. Both Spartans also recorded All-Conference honors for the third consecutive year. Agee is an original member of the NCAA Women’s Basketball Rules Committee and served as a member of the NCAA Division I East Region Selection Committee for three years. She also served, until recently, as a member of the Committee on Basketball Issues for the Women’s Basketball Coaches Associaion. In addition, Agee was an Associate Athletic Director beginning in 1984 and ater served as Senior Women’s Administrator before returning to coaching exclusively in 1999. During her tenure at UNC Greensboro, Agee also has served a stint as the ZRPHQ¡VWHQQLVKHDGFRDFKDQGOHGWKHWHDPWRDQDWLRQDOUXQQHUXSĂ€Qsh. The Roanoke, VA, native earned a bachelor’s degree in health and physical education from Longwood College in 1971 and a master’s degree in educational administration from Radford University in 1981.

12 • 2007-08 UNCG Women’s Basketball Media Guide

Name, School 1. Pat Summitt, Tennessee 2. Jody Conradt, Texas 3. Vivian Stringer, Rutgers 4. Sylvia Rhyne Hatchell, UNC 5. Kay Yow, North Carolina State 6. Rene Portland, Penn State 7. Tara VanDerveer, Stanford 8. Andy Landers, Georgia 9. Theresa Grentz, Illinois 10. Robin Selvig, Montana 11. Debbie Ryan, Virginia 12. Jim Foster, Ohio State 13. Cindy Russo, Florida Int’l 14. Joan Bonvicini, Arizona 15. Geno Auriemma, Connecticut 16. Frank Bennett, Lipscomb 16. Lynne Agee, UNC Greensboro 18. Harry Perretta, Villanova 19. James Sweat, Norfolk State 20. Muffet McGraw, Notre Dame

Years 32 37 35 31 35 30 27 27 32 28 29 28 29 27 21 26 29 28 25 24

Won 913 882 750 717 693 681 660 657 652 645 632 606 593 591 589 539 559 528 523 517

Lost 177 293 251 268 320 249 179 208 299 188 263 253 252 253 116 302 256 292 237 208

Pct. .838 .751 .749 .728 .684 .732 .787 .760 .686 .774 .706 .705 .702 .700 .835 .641 .686 .644 .688 .713

'LDQQH1RODQ)DLUĂ€HOG



  


Birthplace: Portsmouth, VA

Education High School: Cave Spring H. College: UNCG, 1982

Roanoke College, 1978-81 UNCG, 1981-82

Coaching Experience Carol Peschel enters herr 11th season as the associate head coach and 24th year overall on the UNCG women’s basketball coaching staff. Peschel is the recruiting coordinator and organizes the UNCG summer camp program. On the court, Peschel works predominantly with the Spartan perimeter players. Under her tutelage, players like Samika Foster, ChoRhonda Gwaltney and Rebecca Viverette have all registered 1,000-point careers. Off the court, Peschel is primarily responsible for team travel and budgeting, but also has a large hand in scouting. Peschel became a part-time assistant coach in 1984, before being proPRWHGLQDVWKHSURJUDP¡VĂ€UVWIXOOWLPHDVVLVWDQW6KHZDVODWHUQDPHGWKH associate head coach in 1998 in herr 13th with the Spartans. As a player, Peschel played three seasons under head coach Lynne Agee, Ă€UVWDW5RDQRNH&ROOHJHIRUWZRVHDVRQV6KHKHOSHGWKH0DURRQVWRDSDLURI postseason appearances and the Virginia Association of Intercollegiate Athletics for Women (AIAW) title in 1981. Peschel transferred to UNCG for her senior season after Agee b the head coach in 1981. She led the 1981-82 Spartans to a 25 and a berth into the NCAA Division III Final Four. UNCG came u win shy of the National Championship when the Spartans dro title game to Elizabethtown (PA), 67-66, in overtime. 3HVFKHOZDVWKHĂ€UVWIHPDOH$OO$PHULFDQLQDQ\VSRUWDW8 was named to the 1982 NCAA Division III All-Tournament team. ly, Peschel and the 1981-82 team were inducted into the UNCG Fame for their special season. The 1981-82 season triggered a run of seven consecutive VHDVRQV GXULQJ ZKLFK WKH 6SDUWDQV FDSWXUHG Ă€YH 'L[LH &RQI Championships. In fact, UNCG has made seven NCAA Tourname pearances since Peschel’s arrival to the UNCG campus. The Spa PDGHDQRWKHUUXQDWD'LYLVLRQ,,,FURZQLQEHIRUHĂ€QL in third place at the national tournament. The 1997-98 UNCG squad captured the Southern Confer 7RXUQDPHQW&KDPSLRQVKLSLQLWVĂ€UVWVHDVRQLQWKHFRQIHUHQFH HDUQHGLWVĂ€UVWHYHUEHUWKLQWRWKH1&$$'LYLVLRQ,7RXUQDPHQW Since her arrival on the UNCG bench, the Spartans have c tured 11 regular season championships and four conference to nament titles. Following her graduation from UNCG in 1982, Pesch ZRUNHGDVDĂ€QDQFLDOSODQQHUIRUWZR\HDUVDVDPHPEHURIWK Principal Financial Group and earned her life insurance license While working as a part-time coach, Peschel spent three year att 1st Home Federal Savings and Loan in the corporate services department. She got her start in insurance as a property and casualty planner when the bank developed an internal agency. Peschel earned a bachelor’s and master’s degree in business administration from UNCG. Peschel resides in Greensboro.

UNCG, 1984-Present

Postseason Experience UNCG – 1984 NCAA Division III South Regional UNCG – 1985 NCAA Division III South Regional UNCG – 1986 NCAA Division III South Regional UNCG – 1987 NCAA Division III South Regional UNCG – 1988 NCAA Division III Final Four UNCG – 1991 NCAA Division II South Atlantic Regional UNCG – 1998 NCAA Division I Midwest Regional UNCG – 2002 Women’s National Invitation Tournament First Round

2007-08 UNCG Women’s Basketball Media Guide • 13

Spartan Coaching Staff

Playing Experience

UNCGSpartans.com • UNCGSpart

Personal


GSpartans.com • UNCGSpartans

Spartan Coaching Staff

Jon Hines begins his fourth season at his alma mater as a member of Lynne Agee’s coaching staff in 2007-08. Hines was elevated to second assistant last season after Vickie Henson stepped down after four years with UNCG. Hines will work extensively with the Spartan post players and will have a hand in all aspects of individual workouts, recruiting and scouting. “We are excited about Jon’s commitment and loyalty he has shown to our SURJUDPÂľVDLG$JHH´+LVĂ€YH\HDUVRIH[SHULHQFHLQWKLVSURJUDPKDVSUHSDUHG him well. We are very proud.â€? Hines was previously the third assistant on the Spartans’ staff. He oversaw WKHĂ€OPH[FKDQJHSURJUDPKHOSHGZLWKUHFUXLWLQJDQGLQGLYLGXDOZRUNRXWVDQG scouted upcoming opponents. He served as a student-assistant for the Spartans women’s basketball team for three years while working towards his undergraduate degree at UNCG in 2002. As a student-assistant, he helped with practice and game preparation. Hines spent two seasons at neighboring Greensboro College as an assistant FRDFK7KHUHKHDVVLVWHGLQĂ€OPH[FKDQJHDQGFRDFKHGWKH3ULGH¡VSHULPHWHU players. He was part of one of the top turnarounds in NCAA Division III in 2002-03. *UHHQVERURLPSURYHGQLQHJDPHVLQKLVĂ€UVW\HDURQWKHVWDIIĂ€QLVKLQJZLWKD record.

Former Murray State standout Ashley Hayes joins the UNCG coaching staff for the 2007-08 season. 7KH.RNRPR,1QDWLYHLV0XUUD\6WDWH¡VDOOWLPHOHDGHULQFDUHHUWKUHHSRLQWÀHOG goals and tied the single game record for most three-pointers in a game during her junior year. During her sophomore season she lead the nation in three-point VKRRWLQJIRUWKUHHFRQVHFXWLYHZHHNVDQGÀQLVKHGWKHVHDVRQUDQNHG1RLQWKH nation with 2.4 three-pointers per game. She followed up her outstanding sophomore campaign with an equally LPSUHVVLYHMXQLRU\HDU6KHÀQLVKHGWKHVHDVRQUDQNHGWKLUGLQWKHFRQIHUHQFHLQ three-point baskets per game with 2.12 and 10th in the conference in three-point shooting percentage with a .364 percentage. Prior to her collegiate career she was a standout prep athlete at Kokomo High School. In her senior season she led her team to a 26-0 record and a state championship. She was named team MVP and was a McDonalds All-American nominee. Hayes will be in charge of the tape exchange program and will assist in all other facets of the program 14 • 2007-08 UNCG Women’s Basketball Media Guide


Meet The Spartans


Meet the Spartans

At UNCG A Junior Season (2006-07) Prior to the season voted Preseason Southern Conference Player of the Year... also voted onto the 10-member SoCon coaches pre-season all-league team‌ QDPHGDĂ€UVWWHDP$OO6RXWKHUQ&RQIHUHQFHSHUIRUPHUE\WKH6RXWKHUQ&RQIHUence Sports Media Association‌ also selected to the SoCon All-Tournament team... started all 30 games... became UNCG’s all-time steals leader and ended the season with 91 steals... ranked ninth in the conference with 10.9 points per game‌ second in the conference in assists (4.03) and steals (3.03)‌ concluded WKHVHDVRQUDQNHGWKQDWLRQDOO\LQVWHDOVSHUJDPHÂŤĂ€QLVKHGUDQNHGVHYHQWK in the SoCon in free throw percentage (75.2) and fourth in assist/turnover ratio (1.20)‌ scored a team-high 17 points in UNCG’s loss to Georgia Southern in the 6R&RQ7RXUQDPHQWÂŤVFRUHGLQGRXEOHVĂ€JXUHVLQRIJDPHVSOD\HGÂŤFRQcluded the season scoring in double digits in nine consecutive games... recorded a career-high 11 steals against UNC Wilmington (11/12), one shy of the school record... had a career-high 27 points against Furman (1/6) on 10-of-14 shooting IURP WKH Ă€HOG QDPHG 6RXWKHUQ &RQIHUHQFH 3OD\HU RI WKH :HHN IRU KHU FDUHHU effort against Furman‌ herr 10.9 scoring average ranks 12th all-time... she has made 313 free throws in her three years as a Spartan, which ranks 4th all-time... KHUIUHHWKURZSHUFHQWDJHLVĂ€IWKEHVWDW81&*UHFRUGHGDVHDVRQKLJK assists against Elon (1/20)‌ became the 20th player at UNCG with 200 career assists ... led the team in free throw attempts (125), free throws made (94), steals (91) and assists (121)‌ was a perfect 5-for-5 from the free throw line against GSU (2/5)‌ also went 3-for-3 from the free throw line against Wofford (2/19)‌ scored SRLQWVRQRIVKRRWLQJLQWKHVHDVRQĂ€QDOHDJDLQVW:HVWHUQ&DUROLQD

Sophomore Season (2005-06) 81&*ZHQWZKHQ%RRQHZDVLQWKHOLQHXSÂŤPLVVHGWKHĂ€UVWIRXUJDPHVRI WKHVHDVRQZLWKDSUHVHDVRQKDQGLQMXU\QDPHGDĂ€UVWWHDP$OO6RXWKHUQ&RQference performer by the Southern Conference’s Sports Media Association and to the 10-member coaches all-league game‌ also selected to the SoCon All-Tournament team‌ named to the North Carolina Sports Information Directors All-State Ă€UVWWHDPÂŤSULRUWRWKHVHDVRQZDVQDPHGWRWKHPHPEHU6R&RQ&RDFKHV SUHVHDVRQDOOOHDJXHWHDPUDQNHGĂ€IWKLQWKHFRQIHUHQFHZLWKDWHDPOHDGLQJ 12.8 points per game... led the league in assists (4.69), steals (3.88), free throws PDGH  DQGIUHHWKURZVDWWHPSWHG  Ă€QLVKHGWKLUGLQIUHHWKURZSHUFHQWage (79.6), sixth in assist/turnover ratio (1.30) and eighth in minutes per game (30.5)... averaged 12.7 points, 5.3 rebounds and 5.0 assists in the SoCon TournaPHQWÂŤVFRUHGSRLQWVDQGKDGĂ€YHDVVLVWVLQWKHORVVWR&KDWWDQRRJDLQ WKH6R&RQ7RXUQDPHQWWLWOHJDPH  ÂŤVFRUHGLQGRXEOHĂ€JXUHVDWHDPKLJK 17 times in 26 games played... tallied a career-high 25 points and eight steals in a 74-63 loss at Georgia Southern (1/9)... went 9-for-9 from the free throw line at GSU... matched that with 25 points and hauled in a career-bestt 10 rebounds LQWKHVHDVRQĂ€QDOHZLQRYHU:HVWHUQ&DUROLQD  ZHQWRIIURP the line against the Lady Cats... had 11 points and a career-high 11 assists for her Ă€UVWHYHU´GRXEOHGRXEOHÂľLQDQORVVWR&KDWWDQRRJD  VHWDVFKRRO record in the Division I era with nine steals and had 14 points in a 72-48 win over Furman (2/4)... she made 20 straight free throws at one point during the season... had eight games with six or more steals, which included six straight games at one SRLQWVFRUHGSRLQWVKDGVL[VWHDOVDQGĂ€YHDVVLVWVLQKHUVHDVRQGHEXWD 72-70 win over West Virginia (12/3)... had 16 points, seven rebounds, four assists and four steals in the 70-64 win at Wake Forest (12/14)... had 14 points, nine assists and seven steals in a 85-71 win over Appalachian State (1/14)... had 18 points and seven assists in an 84-64 win over Wofford (1/24/06).

Freshman Season (2004-05) Named Southern Conference Freshman of the Year by both the league’s coaches and media association... also named to the SoCon All-Freshman team... selected to the North Carolina Sports Information Directors All-State second team, she was the only freshman named to the 10-player squad... led Division I women’s EDVNHWEDOOZLWKVWHDOVSHUJDPHKHUVWHDOVZDVWKHÀIWKPRVWVWHDOV ever by a freshman in a single-season and a school record...fell one steal shy of

Kristen Boone Year 2004-05 2005-06 2006-07 TOTAL

GP-GS 28-2 26-24 30-30 84-56

Min 24.0 30.5 28.1 27.5

FG-FGA Pct 3FG-3FGA Pct 89-240 .371 9-38 .237 104-262 .397 7-35 .200 108--274 .394 17-48 .354 301-776 .388 33-121 .273

16 • 2007-08 UNCG Women’s Basketball Media Guide

FT-FTA 102-134 117-147 94-125 313-406

Pct O-D-Reb. .761 38-48-86 .796 31-80-111 .752 42-60-102 .771 111-188-299

Avg 3.1 4.3 3.4 3.6

Ast 78 68 121 320

TO 101 122 101 296

Blk 12 3 7 22

Stl 121 101 91 313

Pts 289 332 327 948

Avg 10.3 12.8 10.9 11.3


High School

(DUQHGĂ€UVWWHDP$OO0HWURIURPWKH Washington Post as a senior at Gwynn Park High School in Brandywine, MD... was also named all-conference and all-county as a senior... averaged 14.0 points, 6.5 assists and 5.5 steals per game as a senior... team won the 3A state title her junior season with a 25-1 record and won it again her senior season... team had a 17-game winning streak at one point during the season with an average margin of victory of 41 points... averaged 12.8 points, 2004-05 7.0 assists, 6.0 steals and 4.0 rebounds per game as a junior... was ranked in the Opponent at West Virginia Top 250 seniors nationally by All-Star Girls Report... played in high school with Winthrop current classmate Kemena Brooks and sophomore Lakiah Hyson... honor roll stu- Pittsburgh at Arizona dent at Gwynn Park. vs Delaware

Personal Kristen Aisha Boone... daughter of Wendy McCray and William Boone... born DeFHPEHUPDMRULQJLQH[HUFLVHDQGVSRUWVVFLHQFHZLWKDĂ€WQHVVOHDGHUship concentration at UNCG.

Career High’s Points...............................................................27 vs. Furman, 1/6/07 Rebounds: ........................................................10 vs. Western Carolina, 2/26/06 FG: ...................................................................10 vs. Furman, 1/6/07 FGA: .................................................................18 vs. Western Carolina, 2/12/05 3FG: .................................................................2, six times 3FGA: ...............................................................6 at College of Charleston, 1/15/07 FT: ....................................................................9, three times FTA: ..................................................................12 at Georgia Southern, 2/5/05 Assists:.............................................................11 vs. Chattanooga, 1/2/06 Turnovers..........................................................8, twice Steals:..............................................................11 vs. UNC Wilmington, 11/12/06 Blocks: .............................................................2, four times Minutes: ...........................................................38, twice

High Point Chattanooga at Appalachian State UNC Wilmington at Wofford at Furman Elon Georgia Southern College of Charleston at Western Carolina at Davidson at East Tennessee State Appalachian State Furman at Elon at Georgia Southern at College of Charleston Western Carolina Davidson East Tennessee State at Chattanooga Wofford vs. Georgia Southern

33 32 33 29 25 33 36 27 34

6-13 4-8 5-11 6-10 2-6 3-8 4-8 8-14 6-18

FT-FTA 4-6 7-8 0-1 0-0 0-0 4-6 1-2 0-0 3-4 1-4 1-2 0-0 8-10 6-7 1-2 5-7 9-10 4-5 1-1 2-4 0-0 0-0 2-4 5-5 4-5 7-9 6-8 3-3 6-7 4-5

O-D-R 1-1-2 0-2-2 0-2-2 0-1-1 3-1-4 1-1-2 1-1-2 2-1-3 0-2-2 0-3-3 0-0-0 4-2-6 0-2-2 3-0-3 1-3-4 2-2-4 2-1-3 1-4-5 1-2-3 0-3-3 0-5-5 3-2-5 2-1-3 1-1-2 2-3-5 5-3-8 1-5-6 3-3-6 1-2-3 2-1-3

PF 4 3 4 4 2 4 3 3 1 3 3 3 1 1 4 3 4 4 1 4 2 4 2 4 1 2 3 3 4 1

A 3 4 3 5 5 1 3 1 1 5 5 6 3 5 3 2 4 6 10 4 9 4 4 4 6 2 3 8 2 0

TO 3 2 3 2 4 6 2 3 6 3 0 4 2 2 4 6 5 4 3 3 5 4 4 1 4 6 3 3 4 0

Blk 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 2 0 0 0 0 2 0 2 0 0

Stl 11 5 1 2 2 4 6 1 3 4 1 2 4 6 3 5 4 4 3 0 0 2 3 1 1 3 2 4 0 4

Pts 10 17 4 6 5 8 7 6 11 3 5 2 15 27 7 9 13 14 7 11 4 14 11 16 18 11 12 12 25 17

Min. 21 19 14 31 21 21 19 16 25 23 20 17 31 27 23 26 21 24 29 22 29 14 31 37 28 28 23 33

FG 3-10 0-3 2-7 2-7 2-5 1-7 5-11 0-4 2-5 2-9 2-6 5-9 3-12 5-8 4-6 5-12 4-10 5-9 1-9 3-8 3-10 3-8 7-18 4-10 4-8 3-7 4-11 5-11

3FG 1-2 0-1 0-1 0-2 0-0 0-0 0-1 0-2 0-1 0-1 0-1 1-1 0-2 2-3 2-3 0-2 0-0 1-2 0-2 0-1 0-2 0-0 1-3 1-1 0-2 0-2 0-0 0-0

FT-FTA 2-2 2-2 1-1 3-3 0-0 6-8 4-5 4-5 7-8 6-8 2-4 2-2 2-2 5-5 8-10 6-7 4-7 0-0 3-6 4-4 7-12 5-7 0-0 7-8 5-7 2-3 1-2 4-6

O-D-R 2-1-3 0-1-1 0-0-0 0-1-1 1-1-2 2-4-6 1-1-2 0-1-1 0-1-1 2-4-6 1-3-4 1-2-3 3-4-7 2-1-3 1-1-2 0-2-2 0-0-0 2-4-6 1-0-1 6-3-9 0-4-4 3-0-3 3-1-4 0-3-3 2-0-2 1-1-2 3-1-4 1-3-4

PF 4 4 2 2 3 1 3 3 3 2 5 1 2 2 3 1 5 3 3 2 1 4 2 3 3 3 4 4

A 0 5 1 4 3 1 1 3 7 1 4 3 0 2 2 5 0 5 3 4 1 1 4 5 2 5 3 2

TO 4 4 5 6 7 1 2 3 4 3 4 1 7 4 0 4 2 6 4 2 3 1 5 3 8 3 1 4

Blk. 0 0 0 0 0 1 1 0 1 2 0 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 1

St. 4 1 4 1 2 2 4 5 5 6 6 4 3 6 5 7 7 4 4 2 8 2 8 5 5 4 2 5

Pts. 9 2 5 7 4 8 14 4 11 10 6 13 8 17 18 16 12 11 5 10 13 11 15 16 13 8 9 14

Min. 27 23 36 27 32 28 33 29 31 29 38 32 28 25 38 34 28 26 31 37 32 18 33 31 33 34

FG 5-11 2-5 4-10 2-9 5-16 4-12 4-11 2-5 8-12 6-7 5-15 2-11 1-11 7-13 4-13 5-12 5-10 0-3 6-11 2-11 2-5 2-6 7-12 3-10 4-7 7-14

3FG 0-0 0-1 1-2 0-1 0-3 0-0 0-3 1-1 0-1 0-0 0-1 0-1 0-1 0-1 0-2 0-1 1-2 0-1 1-2 1-3 0-1 0-0 2-3 0-0 0-1 0-3

FT-FTA 6-8 1-2 7-10 6-8 8-9 3-5 3-3 4-6 9-9 2-2 8-11 2-2 6-6 4-4 2-2 4-4 3-4 7-8 4-6 3-4 3-6 3-4 9-10 2-3 5-6 3-5

O-D-R 1-1-2 0-2-2 1-6-7 0-5-5 7-1-8 3-2-5 0-3-3 2-2-4 0-1-1 0-4-4 1-3-4 0-1-1 1-2-3 1-4-5 2-3-5 2-3-5 2-1-3 0-1-1 0-5-5 0-5-5 1-5-6 1-0-1 3-7-10 2-6-8 1-6-7 0-1-1

PF 3 4 2 5 4 3 3 2 3 2 2 3 1 2 2 4 1 4 2 3 0 4 2 2 2 3

A 5 5 4 2 7 4 11 5 2 9 1 3 4 7 5 5 3 8 5 5 1 3 3 4 6 5

TO 2 2 2 3 6 6 7 4 3 4 4 5 1 3 4 2 1 2 8 1 5 5 4 4 2 4

Blk. 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0

St. 6 4 4 1 6 3 3 3 8 7 6 6 7 3 3 3 9 0 4 3 2 3 2 1 2 2

Pts. 16 5 16 10 18 11 11 9 25 14 18 6 8 18 10 14 14 7 17 8 7 7 25 8 13 17

2005-06 Opponent WEST VIRGINIA CAMPBELL at Wake Forest DAVIDSON at UNC Wilmington at Coastal Carolina CHATTANOOGA at Furman at Georgia Southern APPALACHIAN STATE COLLEGE OF CHARLESTON at Western Carolina at Elon WOFFORD at Davidson at Chattanooga FURMAN GEORGIA SOUTHERN at Appalachian State at College of Charleston ELON at Wofford WESTERN CAROLINA vs. Georgia Southern vs. Davidson vs. Chattanooga

2007-08 UNCG Women’s Basketball Media Guide • 17

Meet the Spartans

CHATTANOOGA at Furman at Georgia Southern APPST COLLEGE OF CHARLESTON at Elon WOFFORD at Western Carolina vs. Georgia Southern

3FG 0-0 0-1 0-0 0-0 1-1 0-2 0-3 0-1 0-2 0-1 0-2 0-0 1-2 1-1 0-0 0-3 0-0 2-6 0-1 1-1 0-0 2-2 1-1 1-2 2-2 0-1 0-2 1-2 3-6 1-3

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

WKH 6R&RQ UHFRUG 7UDF\ .UXHJHU RI 0DUVKDOO   ÀUVW 'LYLVLRQ , SOD\HU Career Game-by-Game (men or women) to reach 100 steals in 2004-05...tied the then school record twice with eight steals in a game... averaged 10.3 points, 4.3 steals, 3.1 rebounds 2006-07 Opponent Min FG-FGA and 2.8 assists per game... averaged 4.85 steals per game in conference play... UNC WILMINGTON 25 3-5 26 5-7 second on the team in scoring and paced the club in steals and assists... shot at Campbell at Charlotte 49ers 17 2-3 76.1 (102-for-134) percent from the free throw line... the 134 free throw attempts LONGWOOD 17 3-3 35 2-8 is the ninth most in a single-season at UNCG... had a steal in every game...had PROVIDENCE North Carolina 28 2-9 ÀYHRUPRUHVWHDOVLQJDPHVFDPHXSZLWKHLJKWVWHDOVDW*HRUJLD6RXWKHUQ at at Davidson 33 3-13  DQGDJDLQVW:HVWHUQ&DUROLQD  VFRUHGLQGRXEOHÀJXUHVWLPHV COASTAL CAROLINA 22 3-8 21 4-7 VFRUHG D VHDVRQKLJK SRLQWV DQG KDG ÀYH VWHDOV LQ D ZLQ DW :HVWHUQ HIGH POINT WESTERN CAROLINA 31 1-9 Carolina (1/15)... scored 17 points and had six steals in a 71-50 win over College at #1/1 Maryland 26 2-10 32 1-9 RI&KDUOHVWRQ  KDGSRLQWVVHYHQDVVLVWVDQGÀYHVWHDOVLQD vs Liberty Chattanooga 28 3-10 ZLQRYHU81&:LOPLQJWRQ  KDGSRLQWVVHYHQVWHDOVDQGÀYHDVVLVWV at FURMAN 32 10-14 in a 78-66 win at Davidson (1/18).. had 10 points, a season-high nine rebounds GEORGIA SOUTHERN 23 3-7 28 2-11 DQGIRXUDVVLVWVLQDORVVDW(ORQ  KDGSRLQWVÀYHDVVLVWVDQG VIRGINIA TECH at Appalachian State 28 2-5 ÀYHVWHDOVLQDGRXEOHRYHUWLPHZLQRYHU'DYLGVRQ  VHQWWKHJDPH at College of Charleston 30 4-15 ELON 21 3-6 LQWRRYHUWLPHE\GULYLQJWKHOHQJWKRIWKHà RRUZLWKÀYHVHFRQGVOHIWDQGEXULHGD at Wofford 29 4-11 3-pointer at the top of the arc against the Wildcats. DAVIDSON 30 2-8


High School (DUQHGĂ€UVWWHDP$OO0HWURIURPWKH Washington Post as a senior at Gwynn Park High School in Brandywine, MD... was also named all-conference and allcounty as a senior... averaged 15.1 points, 6.5 rebounds per game and 5.1 assists per game... team won the 3A state title her junior season with a 251 record and won it again her senior season... team had a 17-game winning streak at one point during the season with an average margin of victory of 41 points... averaged 12.1 points, 6.0 assists, 3.1 steals and 6.0 rebounds per game as a junior... earned second team all-county and fourth team All-Met as a junior... played in high school with current classmate Kristen Boone and sophomore Lakiah Hyson... honor roll student at Gwynn Park.

Personal Kemena Nichole Brooks... daughter of Philomena and Kevin Brooks... born June 4, 1986...majoring in interior architecture at UNCG.

Meet the Spartans

At UNCG A Junior Season (2006-07) Saw action in 29 games... posted a season-high nine points on two occasions... averaged 3.5 points and 1.5 rebounds in 11.7 minutes of action... played a season-high 21 minutes in UNCG’s 84-68 win over Campbell (11/17)‌ was erfect from the free-throw line a team-high four times‌ was 4-for-4 from he line against Coastal Carolina (12/16), Davidson (12/4) and Appalachian tate (1/13) and was 2-for-2 from the line against Georgia Southern (1/6)... econd on the team in free throw percentage (.750)‌ went 21-of-28 from the ee throw line for the season‌ tossed in nine points in the Spartans 67-54 LQRYHU/LEHUW\  RQDVHDVRQKLJKRIVKRRWLQJIURPWKHĂ€HOGÂŤ allied a season-high six rebounds against Chattanooga (1/0/07)‌ posted VHDVRQKLJKĂ€HOGJRDOSHUFHQWDJHDJDLQVW&KDUORWWH  DQG urman (2/3/07).

Career High’s Points:...................................................................25 at Appalachian State, 2/11/06 Rebounds: .............................................................6, four times FG: ........................................................................8 at Appalachian State, 2/11/06 FGA: ......................................................................13, three times 3FG: ......................................................................3 vs. Georgia Southern, 3/3/06 3FGA: ....................................................................6, twice; last at Wofford, 2/21/06 FT: .........................................................................8 vs. Winthrop, 11/26/04 FTA: .......................................................................11 vs. Winthrop, 11/26/04 Assists:..................................................................3, three times Turnovers...............................................................5 at Arizona, 12/4/04 Steals:...................................................................4 at Davidson, 1/28/06 Blocks: ..................................................................1, six times Minutes: ................................................................29 at Arizona, 12/4/04

ophomore Season (2005-06) rst guard off the bench that appeared in 29 games during second season ith the Spartans... posted career-best totals in every statistical category, inuding points (7.1), rebounds (2.6), assists (28), steals (23) and 3-pointers ade (22)... ranked second on the team in treys made...was named the Southrn Conference Player of the Week on Februaryy 14 after averagingg 17.5 and 5.5 ebounds in 24 minutes of action... tossed in 14 points on 5-of-8 shooting in HZLQRYHU*HRUJLD6RXWKHUQLQWKH6R&RQTXDUWHUÀQDOZLQRYHUWKH ady Eagles (3/3)‌ scored a career-high 25 points, including 21 alone in the HFRQGKDOIDQGVHYHQSRLQWVLQWKHÀQDOPLQXWHVLQDQORVVDW ppalachian State (2/11)... went 7-of-7 from the free throw line against the ountaineers... followed that up with 10 points and six rebounds in a 59-58 LQDW&ROOHJHRI&KDUOHVWRQ  VFRUHGLQGRXEOHÀJXUHVHLJKWWLPHVLQ HÀQDOJDPHVRIWKHVHDVRQOHGWKHWHDPLQVFRULQJWKUHHWLPHVVFRUHG then career-bestt 17 points in a 63-62 overtime win at Davidson (1/28)... had 5 points in a 72-62 win over Georgia Southern (2/6)... had a streak of seven traight games with a 3-pointer.

reshman Season (2004-05) ppeared in 24 games off the bench for UNCG... averaged 3.0 points and 2.0 ebounds per game... missed the last four games of the regular season with a RRWLQMXU\VFRUHGDVHDVRQKLJKSRLQWVWROHDGWKH6SDUWDQVWRWKHLUĂ€UVW in of the season, 62-52, over Winthrop in the opening round of the UNCG ournament (11/26)... also tossed in 10 points at nationally-ranked Arizona a 98-48 loss at the Fiesta Bowl Classic in Tucson, AZ (12/4)... scored eight RLQWVDQGJUDEEHGDVHDVRQKLJKĂ€YHUHERXQGVLQDORVVDW)XUPDQ 1/2).

Kemena Brooks’ Career Stats Year 2004-05 2005-06 2006-07 TOTAL

GP-GS 24-0 29-0 29-0 82-0

Min 10.5 16.0 11.6 12.8

FG-FGA 21-77 70-164 34-108 125-349

Pct .273 .427 .315 .358

18 • 2007-08 UNCG Women’s Basketball Media Guide

3FG-3FGA 2-18 22-64 9-35 33-117

Pct .111 .344 .257 .282

FT-FTA 29-42 45-58 21-28 95-128

Pct .690 .776 .750 .742

O-D-Rebs 17-30-47 22-54-76 13-30-43 52-114-166

Avg 2.0 2.6 1.5 2.0

Ast 9 28 16 53

TO 21 48 19 88

Blk 3 2 3 8

Stl 15 23 7 45

Pts 73 207 98 378

Avg 3.0 7.1 3.4 4.6


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

Career Game-by-Game 2006-07 Min FG-FGA 5 0-1 21 1-5 17 4-6 10 1-4 16 2-8 6 0-2 15 2-5 19 3-5 17 3-6 10 1-2 17 4-9 19 2-8 10 0-3 7 0-1 10 0-1 15 1-4 14 1-8 15 1-6 4 0-0 4 0-1 10 1-2 9 2-3 6 1-1 8 0-1 7 0-7 11 1-3 10 2-5 15 1-5 8 0-1

3FG 0-0 1-2 0-1 0-1 1-4 0-0 0-0 1-3 2-4 0-1 1-2 0-2 0-0 0-0 0-1 0-0 0-3 0-2 0-0 0-0 0-0 2-3 0-0 0-0 0-1 0-0 1-2 0-2 0-1

FT-FTA 0-0 1-2 1-2 0-0 1-2 0-0 4-4 0-0 0-0 0-1 0-0 0-0 0-0 2-2 0-0 0-0 0-0 3-4 0-0 4-4 0-0 1-2 0-0 4-4 0-0 0-0 0-0 0-1 0-0

O-D--R PF 0-0-0 0 0-3-3 1 0-0-0 3 0-0-0 0 1-0-1 3 1-1-2 1 2-1-3 0 3-2-5 2 0-4-4 1 0-0-0 1 0-1-1 0 2-4-6 1 0-0-0 0 0-0-0 2 0-1-1 3 1-1-2 0 0-1-1 2 0-3-3 1 0-0-0 0 0-1-1 1 0-0-0 0 0-1-1 2 1-1-2 1 0-1-1 0 0-0-0 1 1-1-2 1 0-0-0 0 1-3-4 1 0-0-0 0

A 0 0 1 0 1 1 1 1 0 0 1 1 0 0 2 0 0 2 0 0 0 1 0 0 0 1 1 1 1

TO 1 0 1 1 2 0 1 2 0 1 0 2 0 0 0 0 0 1 1 1 0 1 2 0 0 0 0 2 0

Blk St. Pts 0 0 0 0 1 4 0 1 9 0 0 2 0 1 6 0 0 0 0 1 8 0 1 7 0 0 8 0 0 2 0 0 9 0 0 4 0 0 0 0 0 2 0 0 0 0 0 2 1 0 2 0 1 5 0 0 0 1 0 4 0 0 2 0 0 7 0 0 2 0 0 4 1 0 0 0 1 2 0 0 5 0 0 2 0 0 0

Meet the Spartans

Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD at North Carolina at Davidson COASTAL CAROLINA HIGH POINT WESTERN CAROLINA at #1/1 Maryland vs Liberty at Chattanooga FURMAN GEORGIA SOUTHERN VIRGINIA TECH at Appalachian State at College of Charleston ELON at Wofford DAVIDSON CHATTANOOGA at Furman at Georgia Southern APPST COLLEGE OF CHARLESTON at Elon WOFFORD at Western Carolina vs. Georgia Southern

2005-06 Opponent at NC State LONGWOOD OHIO at High Point WEST VIRGINIA CAMPBELL at Wake Forest DAVIDSON at UNC Wilmington at Coastal Carolina at Furman at Georgia Southern APPALACHIAN STATE COLLEGE OF CHARLESTON at Western Carolina at Elon WOFFORD at Davidson at Chattanooga FURMAN GEORGIA SOUTHERN at Appalachian State at College of Charleston ELON at Wofford WESTERN CAROLINA vs. Georgia Southern vs. Davidson vs. Chattanooga

Min. 20 21 26 17 10 12 15 16 14 3 6 8 7 19 12 14 14 24 21 13 20 28 19 22 19 12 23 22 8

FG 4-8 2-5 2-6 0-3 3-4 4-7 0-3 1-3 0-3 1-1 0-3 0-2 1-2 3-7 1-6 3-5 5-6 7-8 4-10 0-5 4-13 8-13 4-8 4-8 2-8 1-5 5-8 1-3 0-1

3FG 0-0 0-1 1-1 0-1 1-2 0-1 0-1 0-0 0-1 0-0 0-3 0-2 0-0 2-2 1-3 1-3 0-1 1-2 2-4 0-2 1-6 2-4 2-3 2-4 2-6 1-4 3-4 0-2 0-1

FT-FTA 2-3 3-3 6-6 0-0 0-0 1-2 2-2 2-2 0-0 0-0 1-2 0-0 2-2 0-0 4-6 1-2 2-2 2-2 0-2 0-0 6-7 7-7 0-0 0-0 0-2 0-0 1-2 3-4 0-0

O-D-R 0-1-1 1-0-1 0-3-3 0-0-0 0-0-0 1-1-2 0-4-4 1-0-1 1-1-2 0-0-0 0-1-1 0-1-1 0-0-0 3-3-6 2-2-4 0-3-3 1-3-4 0-4-4 2-2-4 0-1-1 2-1-3 2-3-5 1-5-6 0-2-2 1-3-4 2-1-3 1-4-5 1-5-6 0-0-0

PF 1 1 3 1 0 1 1 1 0 0 0 0 0 1 2 0 2 0 0 1 1 1 0 0 1 1 0 1 0

A 0 1 1 1 0 1 2 1 0 0 0 1 1 1 3 0 3 2 1 1 0 0 1 1 0 1 3 0 2

TO 3 2 3 4 0 1 3 3 1 1 1 0 1 0 1 1 3 0 1 0 1 3 2 1 3 1 3 4 1

Blk. 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

St. 2 3 0 1 0 1 1 0 0 0 0 0 0 2 0 1 1 4 0 0 0 1 1 2 3 0 0 0 0

Pts 10 7 11 0 7 9 2 4 0 2 1 0 4 8 7 8 12 17 10 0 15 25 10 10 6 3 14 5 0

Min. 16 19 7 29 14 7 13 16 22 8 23 3 1 4 2 6 6 6 14 12 2 4 9 9

FG 1-7 4-7 0-3 3-13 0-3 0-2 1-2 0-3 2-6 0-1 4-11 0-1 0-0 0-1 0-0 1-1 0-0 1-2 0-5 1-3 1-2 0-0 2-4 0-0

3FG 0-0 1-2 0-0 0-4 0-2 0-1 0-0 0-1 1-4 0-0 0-3 0-0 0-0 0-1 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

FT-FTA 0-0 8-11 0-0 4-6 2-2 1-2 2-2 3-4 2-2 2-6 0-1 0-0 0-0 0-0 0-0 0-0 1-2 0-0 4-4 0-0 0-0 0-0 0-0 0-0

O-D-R 2-1-3 1-3-4 1-1-2 1-2-3 0-2-2 1-2-3 1-2-3 2-0-2 1-1-2 1-1-2 1-4-5 0-0-0 0-0-0 1-1-2 0-1-1 2-0-2 1-2-3 1-0-1 0-1-1 0-2-2 0-0-0 0-1-1 0-1-1 0-2-2

PF 0 2 1 0 2 0 0 1 0 0 1 0 1 0 0 0 1 0 0 0 0 0 0 1

A 1 1 2 0 0 1 1 1 0 1 0 0 0 0 0 0 0 0 1 0 0 0 0 0

TO 0 1 0 5 0 0 0 3 0 1 4 1 0 0 0 0 2 2 0 0 0 0 1 1

Blk. 0 0 0 1 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0

St. 2 0 1 0 0 1 0 0 1 2 2 0 0 0 0 0 0 2 2 0 1 0 0 1

Pts. 2 17 0 10 2 1 4 3 7 2 8 0 0 0 0 2 1 2 4 2 2 0 4 0

2004-05 Opponent at West Virginia Winthrop Pittsburgh at Arizona vs Delaware High Point Chattanooga at Appalachian State UNC Wilmington at Wofford at Furman Elon Georgia Southern College of Charleston at Western Carolina at Davidson at East Tennessee State Appalachian State Furman at Elon at Georgia Southern at Coll of Charleston Western Carolina vs. Georgia Southern

2007-08 UNCG Women’s Basketball Media Guide • 19


High School (DUQHGĂ€UVWWHDPDOOFRQIHUHQFHDQGDOOVWDWHKRQRUDEOHPHQWLRQSODXGLWVDW Lake Mary High School as a junior and senior... averaged a “double-doubleâ€? each of her last two seasons, with 12.1 ppg and 10.1 rpg as a junior and 12.2 ppg and 10.0 rpg as a senior... was an honor roll student at Lake Mary and graduated Cum Laude... received the school’s Who’s Who Award.

Personal Meghan Shaena Chamberlain... daughter of Tara and Eugene Chamberlain... born May 3, 1986... majoring in exercise and sports science.

Career High’s

Meet the Spartans

AT UNCG A Junior Season (2006-07) Hampered by a back injury most of the season... played in 25 games, starting 22... averaged 5.3 points and 3.9 rebounds in 17.5 minutes of action... third on the team in blocked shots with 16 on the season... third on the team in defensive rebounds (60)... recorded a season-high 12 points in UNCG’s 68-61 win over Appalachian State... ranks third all-time at UNCG with 72 career blocks‌ scored in double digits twice‌ had 10 points against Furman (1/6/07) and 12 points DJDLQVW$SSDODFKLDQ6WDWH  ÂŤZDVSHUIHFWIURPWKHIUHHWKURZOLQHĂ€YH times‌ tossed in nine points and went 3-of-4 from the free throw in UNCG’s win over Longwood (11/24/06)‌ posted a season-high nine rebounds in an 72-68 win over Providence (11/25/06)‌ ranked 11th in the Southern Conference in blocked shots with 0.64 per game.

Points:..................................................................16 at Appalachian State, 2/11/06 Rebounds: ............................................................ 14 vs. Coll. of Charleston, 1/16/06 FG: .......................................................................7, twice FGA: .....................................................................18 vs. Coll. of Charleston, 1/16/06 3FG: .....................................................................0 3FGA: ................................................................... 0 FT: ........................................................................6 at Appalachian State, 2/11/06 FTA: ......................................................................10 at Davidson, 1/28/06 Assists:................................................................. 3, four times Turnovers.............................................................. 5 at Arizona, 12/4/04 Steals:.................................................................. 3 vs. Wofford, 1/24/06 Blocks: ................................................................. 3, twice Minutes: ............................................................... 37 vs. Coll. of Charleston, 1/16/06

Sophomore Season (2005-06) Started 20 straight games and appeared in all 30 games for the Spartans... came on midway through the season to post career best numbers in scoring (7.4), rebounding (5.3), blocks (35), assists (28) and steals (15)... ranked among WKHOHDGHUVLQWKH6RXWKHUQ&RQIHUHQFHLQPXOWLSOHFDWHJRULHVÂŤĂ€IWKLQEORFNV  VHYHQWKLQĂ€HOGJRDOSHUFHQWDJHZLWKD IRU SHUFHQWVKRRWing clip...also was 15th in rebounding and 11th in offensive rebounds (2.33)... averaged 8.8 points and 6.2 rebounds after being inserted into the starting OLQHXSJDPHVLQWRWKHVHDVRQKDGĂ€YHSRLQWVDQGHLJKWUHERXQGVLQWKH 91-79 loss to Chattanooga in the SoCon Tournament title game‌ notched a career-high 16 points in an 85-84 loss at Appalachian State (2/11)... became Ă€UVW81&*SOD\HUWRSRVWFRQVHFXWLYH´GRXEOHGRXEOHVÂľLQWKUHH\HDUVZKHQ she had 14 points and 10 rebounds in an 85-71 win over Appalachian State (1/14)... followed that with 14 points and a career-bestt 14 rebounds in a 70-67 RYHUWLPHORVVDW&ROOHJHRI&KDUOHVWRQ  VFRUHGLQGRXEOHĂ€JXUHVVHYHQ times and had four games with 10 or more rebounds.

Freshman Season (2004-05) /HGWKHWHDPZLWKEORFNVDSSHDUHGLQJDPHVPDGHĂ€UVWDQGRQO\VWDUW of the season at Appalachian State (12/18)... scored four points and had six rebounds in the 69-41 loss to the Mountaineers... averaged 3.8 points and 3.0 rebounds for the season...scored a season-high 14 points and hauled in seven UHERXQGVLQDORVVWR3LWWVEXUJKLQWKHĂ€QDOVRIWKH81&*7RXUQDPHQW  VHWDVHDVRQKLJKZLWKQLQHUHERXQGVLQWKHUHJXODUVHDVRQĂ€QDOH against Wofford (2/26)... scored 10 points in a 98-48 loss to nationally-ranked Arizona (12/4)... scored nine points in a 79-68 win over UNC Wilmington (12/20)... had three blocks in a 71-50 win over College of Charleston (1/10).

Meghan Chamberlain’s Career Stats Year 2004-05 2005-06 2006-07 TOTAL

GP-GS 27-1 30-20 25-22 82-43

Min 13.5 21.7 17.5 17.7

FG-FGA 40-107 91-191 54-143 185-441

Pct .374 .476 .378 .420

20 • 2007-08 UNCG Women’s Basketball Media Guide

3FG-3FGA 0-0 0-0 0-0 0-0

Pct .000 .000 .000 .000

FT-FTA 23-41 40-70 25-38 88-149

Pct .561 .571 .658 .591

O-D-Rebs 32-49-81 70-90-160 37-60-97 139-199-338

Avg 3.0 5.3 3.9 4.1

Ast 33 28 19 56

TO 21 41 31 93

Blk 21 35 16 72

Stl 3 15 8 26

Pts 103 222 133 458

Avg 3.8 7.4 5.3 5.6


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

Career Game-by-Game 2006-07 Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD PROVIDENCE at North Carolina at Davidson COASTAL CAROLINA HIGH POINT WESTERN CAROLINA at #1/1 Maryland vs Liberty at Chattanooga FURMAN GEORGIA SOUTHERN VIRGINIA TECH at Appalachian State at College of Charleston ELON at Wofford DAVIDSON CHATTANOOGA at Furman at Georgia Southern APPST

Min 9 21 19 14 25 15 16 15 10 12 22 20 17 25 19 15 26 23 17 21 17 13 14 21 12

FG-FGA 0-0 3-7 2-5 3-4 3-11 2-5 0-4 3-5 0-2 0-3 2-5 3-10 1-2 3-9 2-7 2-10 5-10 3-7 3-5 2-5 3-6 1-6 4-6 2-4 2-5

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

FT-FTA 0-0 2-4 2-2 0-0 3-4 0-0 2-4 0-0 0-2 0-0 0-0 2-2 1-2 4-6 0-0 0-0 2-2 2-2 2-2 0-1 0-0 0-0 0-0 2-3 1-2

O-D-R 0-0-0 2-0-2 2-1-3 1-2-3 4-5-9 0-2-2 3-3-6 1-3-4 0-2-2 1-1-2 0-4-4 2-1-3 3-1-4 1-2-3 1-7-8 0-1-1 1-3-4 2-1-3 3-4-7 3-3-6 2-5-7 1-4-5 1-0-1 0-4-4 3-1-4

Avg 0.0 1.0 1.7 2.0 3.4 3.2 3.6 3.6 3.4 3.3 3.4 3.3 3.4 3.4 3.7 3.5 3.5 3.5 3.7 3.8 4.0 4.0 3.9 3.9 3.9

PF 4 2 1 0 2 1 1 1 0 0 1 4 2 1 0 1 2 1 0 0 3 1 1 3 1

A 1 2 0 0 1 2 0 1 0 2 0 0 2 1 1 0 1 0 0 2 1 0 1 1 0

TO 1 0 1 0 1 0 3 2 0 2 2 0 1 0 2 0 2 3 0 3 1 1 0 3 3

Blk 1 1 1 1 0 0 0 1 1 0 0 0 0 1 2 0 1 0 1 1 1 2 1 0 0

Stl 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 2 2 0 0 0 0 1 0 0

Pts 0 8 6 6 9 4 2 6 0 0 4 8 3 10 4 4 12 8 8 4 6 2 8 6 5

2005-06 Min. 18 5 9 15 15 20 18 18 25 23 26 33 30 25 37 24 17 25 27 11 27 27 29 20 24 17 20 21 23 22

FG 1-7 0-1 1-1 2-5 1-5 3-6 2-6 1-3 4-8 3-5 7-9 4-8 4-7 6-11 6-18 4-7 3-5 2-6 0-3 2-5 6-10 4-8 5-9 3-5 3-6 5-5 3-7 3-5 1-5 2-5

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

FT-FTA 0-0 0-0 0-0 2-4 0-2 2-4 2-4 2-2 0-0 2-4 1-2 1-2 3-4 2-3 2-3 1-2 0-0 0-0 5-10 0-0 0-1 1-2 6-8 2-3 1-2 0-0 1-2 1-2 2-2 1-2

O-D-R 3-2-5 0-0-0 2-0-2 4-3-7 1-1-2 1-3-4 2-3-5 3-1-4 1-2-3 2-2-4 2-3-5 5-5-10 2-3-5 4-6-10 7-7-14 5-3-8 2-3-5 2-3-5 4-3-7 1-3-4 2-5-7 4-6-10 1-4-5 2-3-5 0-3-3 0-2-2 1-2-3 2-2-4 2-2-4 3-5-8

PF 5 1 1 0 2 0 0 2 2 1 3 2 4 1 2 1 3 2 0 4 3 0 4 1 0 2 2 1 1 4

A 0 0 0 2 0 1 1 0 1 0 1 1 1 0 2 0 1 1 2 2 0 0 1 2 3 1 0 3 0 2

TO 2 0 0 0 2 0 0 2 1 2 3 2 1 1 2 1 2 1 3 2 0 1 3 1 3 1 2 1 1 1

Blk. 0 0 1 2 2 2 0 2 1 1 3 2 0 1 2 0 1 2 0 1 2 1 3 1 1 0 1 2 1 0

St. 0 0 0 0 1 0 0 0 1 2 2 0 0 0 1 0 0 3 2 0 0 0 0 0 1 0 1 1 0 0

Pts. 2 0 2 6 2 8 6 4 8 8 15 9 11 14 14 9 6 4 5 4 12 9 16 8 7 10 7 7 4 5

Min. 17 5 27 20 19 17 14 18 13 15 5 13 15 18 18 11 21 9 4 6 9 12 14 5 17 13 10

FG 0-3 0-1 7-14 4-10 1-5 3-6 0-0 2-5 4-7 1-3 0-1 1-3 2-4 1-5 1-7 1-2 4-5 2-2 0-1 0-2 2-3 1-5 1-2 0-1 1-4 0-4 1-2

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

FT-FTA 0-0 2-2 0-1 2-2 1-2 1-2 0-0 0-2 1-1 3-5 0-0 3-5 0-0 3-4 1-3 0-0 0-2 1-4 0-0 0-0 2-2 0-0 0-0 0-0 1-2 2-2 0-0

O-D-R 1-3-4 0-0-0 4-3-7 1-0-1 0-4-4 2-2-4 0-1-1 2-4-6 2-1-3 0-3-3 0-2-2 2-2-4 1-1-2 2-3-5 2-4-6 0-3-3 0-2-2 1-0-1 0-0-0 2-0-2 2-0-2 0-1-1 0-1-1 1-0-1 2-4-6 5-4-9 0-1-1

PF 0 0 1 1 2 4 0 1 4 1 0 1 1 1 1 2 2 0 1 3 1 2 1 0 1 1 1

A 0 0 0 0 1 0 3 0 0 0 0 2 0 0 0 0 1 0 0 1 0 0 0 0 0 0 1

TO 0 1 0 5 0 1 1 3 1 0 0 0 0 1 1 3 1 0 0 0 0 0 2 0 0 1 0

Blk. 1 1 1 0 0 1 1 2 0 0 0 0 2 3 0 0 2 1 0 0 0 1 1 1 1 1 1

St. 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 1 1 0

Pts. 0 2 14 10 3 7 0 4 9 5 0 5 4 5 3 2 8 5 0 0 6 2 2 0 3 2 2

Meet the Spartans

Opponent at NC State LONGWOOD OHIO at High Point WEST VIRGINIA CAMPBELL at Wake Forest DAVIDSON at UNC Wilmington at Coastal Carolina CHATTANOOGA at Furman at Georgia Southern APPALACHIAN STATE COLLEGE OF CHARLESTON at Western Carolina at Elon WOFFORD at Davidson at Chattanooga FURMAN GEORGIA SOUTHERN at Appalachian State at College of Charleston ELON at Wofford WESTERN CAROLINA vs. Georgia Southern vs. Davidson vs. Chattanooga

2004-05 Opponent at West Virginia Winthrop Pittsburgh at Arizona vs. Delaware High Point Chattanooga at Appalachian State UNC Wilmington at Wofford at Furman Elon Georgia Southern College of Charleston at Western Carolina at Davidson at East Tennessee State Appalachian State Furman at Elon at Georgia Southern at College of Charleston Western Carolina Davidson at Chattanooga Wofford vs. Georgia Southern

2007-08 UNCG Women’s Basketball Media Guide • 21


selection... played in VHSL All-Star Game, scoring seven points... honor student at South Lakes... International Baccalaureate Diploma Graduate from South Lakes... member of the National Honor Society.

Personal Jasmine Ashley Dixon... daughter of Rhonda and Oscar Dixon... born March 24, 1986... chose UNCG over American, Radford, Wagner, UNC Asheville, Mount St. Mary’s, Penn and Yale... graduated last May and is currently working on her graduate degree.

Career High’s

Meet the Spartans

AT UNCG A Junior Season (2006-07) Appeared in all 30 games... averaged 4.0 points and 3.1 rebounds in 14.7 minutes per game... scored a season-high 11 points against Georgia SouthHUQ  SRVWHGDFDUHHUKLJKHLJKWÀHOGJRDODWWHPSWVDW>@0DU\ODQG (12/29)... played a season-high 22 minutes and tallied nine points in a 73-59 ORVVDW'DYLGVRQ  JUDEEHGDVHDVRQKLJKÀYHUHERXQGVWZLFH against Elon (1/20/07) and Georgia Southern (1/8/07)... recorded six blocks and 17 steals on the season‌ scored in double digits twice on the season‌ had 11 points in a 68-60 win over Georgia Southern (2/5/07) and tallied 10 points in a 88-40 win over Elon (1/20/07)‌ scored three three-pointers on the season‌ was perfect from the free-throw line twice‌ wentt 6-for-6 against Davidson (1/27/07) and was 3-for-3 against Campbell (11/17/06).

Points:..................................................................18 vs. UNC Wilmington, 12/20/04 Rebounds: ............................................................8 vs. Georgia Southern, 3/3/06 FG: .......................................................................6 vs. UNC Wilmington, 12/20/04 FGA: .....................................................................8 at Maryland, 12/29/06 3FG: .....................................................................Ă€YHWLPHV 3FGA: ...................................................................2, twice FT: ........................................................................6, three times FTA: ......................................................................8, twice Assists:.................................................................2, four times Turnovers:.............................................................6 vs. Appalachian State, 1/14/06 Steals:..................................................................2, six times Blocks: .................................................................2 vs. Georgia Southern, 1/8/05 Minutes: ...............................................................29 at E. Tennessee State, 1/20/05

Sophomore Season (2005-06) Appeared in all 30 games and made one start... averaged 3.9 points and 3.6 rebounds in 13.0 minutes of action per game... started against Georgia Southern and scored a season-high 10 points and hauled in six rebounds in a 72-62 win over the Lady Eagles (2/6)... had seven points and grabbed a career-high eight rebounds in only nine minutes in the 68-56 win over Georgia 6RXWKHUQLQWKH6RXWKHUQ&RQIHUHQFHTXDUWHUĂ€QDOYLFWRU\ÂŤVFRUHGQLQHSRLQWV DQGKDGĂ€YHUHERXQGVLQDQZLQRYHU$SSDODFKLDQ6WDWH  SOD\HG a season-high 23 minutes and scored eight points in the 72-70 upset win over West Virginia (12/3)... grabbed seven rebounds on two occasions... came up with 12 steals and seven blocks... showed some versatility by canning two 3-pointers on the season.

Freshman Season (2004-05) Started two games and appeared in 27 games... averaged 3.3 points and 2.7 UHERXQGVSHUJDPHVKRW RI SHUFHQWIURPWKHĂ€HOGDQG (31-of-46) percent from the free throw line... scored a career-high 18 points on 6-of-6 shooting in a 79-68 win over UNC Wilmington (12/20)... hauled in a season-high seven rebounds and had two blocks in a 63-49 win over Georgia 6RXWKHUQ  VFRUHGHLJKWSRLQWVDQGKDGĂ€YHUHERXQGVLQĂ€UVWFDUHHU start, a 75-63 loss at ETSU (1/20)... scored nine points in a 69-41 loss at Appalachian State (12/18).

High School Earned Street & Smith All-America Honorable Mention plaudits each of her last two seasons at South Lakes High School in Reston, VA... scored 1,019 career points at South Lakes... averaged a “double-double� as a senior with 14.1 ppg and 10.1 rpg... All-Northern Virginia second team selection... all-district

Jasmine Dixon’s Career Stats Year 2004-05 2005-06 2006-07 TOTAL

GP-GS 27-2 30-1 30-0 87-3

Min 12.1 13.0 14.7 13.3

FG-FGA 29-71 41-94 39-96 106-261

Pct .408 .436 .375 .406

22 • 2007-08 UNCG Women’s Basketball Media Guide

3FG-3FGA 1-3 2-8 3-9 6-20

Pct .333 .250 .333 .300

FT-FTA 31-46 34-61 44-69 109-176

Pct .674 .557 .638 .619

O-D-Rebs 26-46-72 35-72-107 32-60-92 93-178-271

Avg 2.7 3.6 3.1 3.1

Ast 8 7 16 31

TO 35 45 77 157

Blk 7 7 7 21

Stl 10 12 17 39

Pts 90 118 119 327

Avg 3.3 3.9 4.0 3.8


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

Career Game-by-Game 2006-07 Min FG-FGA 20 0-2 14 1-1 14 0-2 11 0-2 15 3-5 16 2-6 22 2-5 11 0-2 15 1-5 17 2-3 19 2-8 8 1-1 13 1-4 13 0-5 18 1-4 19 1-4 16 0-5 15 2-2 17 2-3 14 0-1 10 1-1 13 1-2 13 1-2 14 3-3 16 2-4 15 3-5 10 2-4 17 0-1 15 1-2 12 1-2

3FG 0-0 0-0 0-0 0-0 1-1 0-0 0-0 0-1 0-1 0-0 1-1 0-0 0-1 0-0 0-0 0-1 0-1 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 1-2 0-0 0-0 0-0

FT-FTA 2-4 3-3 2-4 0-0 0-0 0-0 5-6 3-4 1-3 0-0 2-2 1-4 0-0 0-0 0-1 0-1 1-2 0-0 6-8 0-1 6-6 0-0 0-0 5-6 2-5 2-5 3-4 0-0 0-0 0-0

O-D--R 1-3-4 1-0-1 2-1-3 1-2-3 2-3-5 2-1-3 1-3-4 1-3-4 1-3-4 1-2-3 0-2-2 1-1-2 1-3-4 1-1-2 1-4-5 0-4-4 2-1-3 2-1-3 1-4-5 0-2-2 1-2-3 0-1-1 1-2-3 1-1-2 0-2-2 1-2-3 0-3-3 1-2-3 4-0-4 1-1-2

PF 2 2 2 2 2 3 3 0 1 2 0 3 4 3 1 3 2 2 3 4 1 3 4 0 4 2 2 2 3 4

A 0 0 0 0 2 1 0 0 0 1 1 2 0 0 2 2 0 0 0 0 0 0 1 0 0 0 1 2 0 1

TO 2 3 3 2 2 4 3 2 3 3 3 2 3 1 3 4 3 1 2 0 5 5 1 0 5 0 3 2 4 3

Blk 0 0 0 0 1 0 0 0 1 0 0 0 0 0 1 0 0 0 1 1 0 1 0 0 0 0 0 0 0 1

Stl 1 1 2 1 0 0 1 0 1 1 1 0 0 1 1 2 0 1 1 1 1 0 0 0 0 0 0 0 0 0

Pts 2 5 2 0 7 4 9 3 3 4 7 3 2 0 2 2 1 4 10 0 8 2 2 11 6 8 8 0 2 2

Meet the Spartans

Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD PROVIDENCE at North Carolina at Davidson COASTAL CAROLINA HIGH POINT WESTERN CAROLINA at #1/1 Maryland vs Liberty at Chattanooga FURMAN GEORGIA SOUTHERN VIRGINIA TECH at Appalachian State at College of Charleston ELON at Wofford DAVIDSON CHATTANOOGA at Furman at Georgia Southern APPST COLLEGE OF CHARLESTON at Elon WOFFORD at Western Carolina vs. Georgia Southern

2005-06 Opponent at NC State LONGWOOD OHIO at High Point WEST VIRGINIA CAMPBELL at Wake Forest DAVIDSON at UNC Wilmington at Coastal Carolina CHATTANOOGA at Furman at Georgia Southern APPALACHIAN STATE COLLEGE OF CHARLESTON at Western Carolina at Elon WOFFORD at Davidson at Chattanooga FURMAN GEORGIA SOUTHERN at Appalachian State at College of Charleston ELON at Wofford WESTERN CAROLINA

Min. 6 4 2 8 23 16 10 3 16 21 15 21 12 16 14 16 15 13 10 18 11 17 17 9 13 15 8

FG 1-1 0-1 1-2 1-2 3-4 3-6 0-3 0-0 0-1 2-5 0-1 1-3 0-2 4-7 2-3 1-3 1-5 1-4 1-4 2-5 3-4 3-5 2-5 1-4 1-3 2-3 1-1

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-1 0-0 0-0 0-0 0-0 1-2 0-1 0-1 0-0 0-0 0-0 1-1 0-1 0-0 0-0 0-0 0-0

FT-FTA 0-1 2-2 1-2 0-0 2-4 1-2 4-4 2-2 1-2 1-5 0-0 2-2 1-2 1-2 1-2 1-2 0-0 1-3 0-0 0-1 0-1 3-4 0-1 0-0 0-0 1-5 2-2

O-D-R 0-0-0 0-2-2 0-0-0 1-1-2 0-4-4 1-0-1 1-4-5 0-1-1 2-3-5 1-3-4 0-3-3 3-4-7 2-2-4 2-3-5 2-1-3 0-5-5 2-2-4 2-0-2 1-2-3 3-3-6 2-3-5 2-4-6 2-5-7 1-0-1 0-2-2 1-2-3 2-1-3

PF 2 2 0 0 4 0 2 3 2 2 0 3 0 3 1 2 1 4 1 3 2 3 3 2 0 3 1

A 1 1 0 0 1 0 0 0 0 1 0 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0

TO 1 1 0 1 1 1 1 2 2 2 1 1 2 6 2 1 1 3 1 1 0 4 4 1 0 1 0

Blk. 0 0 0 0 1 1 0 0 0 0 0 1 0 1 1 0 0 1 0 0 0 0 0 0 0 0 0

St. 0 0 0 2 0 1 0 0 1 0 0 0 1 0 1 0 1 1 0 1 1 2 0 0 0 0 0

Pts. 2 2 3 2 8 7 4 2 1 5 0 4 1 9 5 4 2 3 2 4 6 10 4 2 2 5 4

Min. 16 12 3 16 3 3 12 16 19 10 15 10 11 20 24 11 29 11 11 11 12 14 4 7 16 9 2

FG 0-5 0-0 0-0 1-2 0-0 0-1 1-2 2-3 6-6 3-4 1-5 1-2 1-4 2-4 3-7 1-1 2-4 0-2 2-6 1-4 1-3 1-3 0-0 0-1 0-1 0-1 0-0

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 1-1 0-0 0-0 0-0 0-0 0-0 0-1 0-0 0-0 0-1 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

FT-FTA` 1-2 2-2 2-2 3-7 0-0 0-0 0-0 4-5 6-8 1-2 0-0 0-0 0-1 4-4 0-0 0-0 4-6 0-0 2-3 1-2 0-0 0-0 0-0 0-0 0-0 1-2 0-0

O-D-R 1-1-2 0-3-3 1-2-3 2-0-2 0-0-0 1-0-1 1-0-1 1-2-3 2-4-6 2-3-5 1-2-3 0-0-0 2-5-7 0-3-3 4-2-6 0-2-2 1-4-5 0-1-1 3-2-5 1-1-2 1-1-2 0-1-1 0-0-0 0-0-0 1-5-6 1-2-3 0-0-0

PF 1 1 0 2 3 3 4 1 1 2 1 0 1 4 1 3 2 1 3 1 4 4 1 1 0 3 0

A 0 0 0 0 0 0 0 0 1 0 0 0 0 1 0 2 0 0 1 0 1 1 0 0 1 0 0

TO 1 1 2 0 1 0 1 0 3 1 2 2 1 1 1 3 1 1 1 1 2 3 2 1 2 1 0

Blk. 0 0 0 0 0 0 0 0 0 0 0 1 2 1 0 0 1 0 1 0 0 0 0 0 0 0 1

St. 0 0 0 0 0 1 0 0 1 1 2 0 0 0 0 1 2 0 1 0 0 0 0 0 1 0 0

Pts. 1 2 2 5 0 0 2 9 18 7 2 2 2 8 6 2 8 0 6 3 2 2 0 0 0 1 0

2004-05 Opponent at West Virginia Winthrop Pittsburgh at Arizona vs Delaware High Point Chattanooga at Appalachian State UNC WILMINGTON at Wofford at Furman Elon Georgia Southern College of Charleston at Western Carolina at Davidson at East Tennessee State Appalachian State Furman at Elon at Georgia Southern at College of Charleston Western Carolina Davidson at Chattanooga Wofford vs. Georgia Southern

2007-08 UNCG Women’s Basketball Media Guide • 23


er in rebounds... also played nine seasons for the Stars club team in Lebanon, TN for coach Mark Odom.

Personal Brittany Nicole Frazier... daughter of Darlene and Don Frazier... born May 4, 1984 in Knoxville, TN... majoring in sociology.

Career High’s

Meet the Spartans

At UNCG A Junior Season (2006-07) Saw action in all 30 games, starting eight... averaged 5.5 points and 5.1 rebounds in 22.1 minutes of action... tallied a career-high 20 points in UNCG’s 71-67 overtime win against Wofford (2/19)... also grabbed a season-high UHERXQGVUHFRUGHGFDUHHUKLJK¡VLQĂ€HOGJRDOVPDGH  DQGDWWHPSWHG   DJDLQVW :RIIRUG   SRVWHG D FDUHHUKLJK Ă€YH EORFNV DJDLQVW $Spalachian State (2/10)... posted back-to-back double-doubles against Appalachian State (1/13) and College of Charleston (1/15)‌ ranked 12th in the conference in rebounding (5.1), 14th in defensive rebounds (3.23 per game) DQGVL[WKLQEORFNHGVKRWV SHUJDPH ÂŤJRWKHUĂ€UVWVWDUWRIWKHVHDVRQ against Coastal Carolina, scoring eight points and grabbing six rebounds in WKHZLQÂŤVFRUHGLQGRXEOHĂ€JXUHVLQDFDUHHUKLJKĂ€YHJDPHVÂŤKDGD season-high four assists in a 83-66 loss to Chattanooga (1/29/07)‌ recorded a season-high four steals against Elon (1/27/07)‌ went 6-for-6 from the free throw line against Appalachian State (2/10/07)‌ had three consecutive games with double-digit rebounds‌ posted 11 rebounds against Appalachian State (2/10/07) and recorded 10 against College of Charleston (2/12/07) and 11 against Elon (2/17/07).

Points:.....................................................................20 vs. Wofford, 2/19/07 Rebounds: ...............................................................11, three times FG: ..........................................................................9 vs. Wofford, 2/19/07 FGA: ........................................................................13 vs. Wofford, 2/19 3FG: ........................................................................0 3FGA: ......................................................................0 FT: ...........................................................................6 vs. Appalachian State, 2/10/07 FTA: .........................................................................7, twice Assists:....................................................................4 vs. Chattanooga, 1/29/07 Turnovers:................................................................6 vs. Furman, 1/6/07 Steals:.....................................................................4 vs. Elon 1/20/07 Blocks: ....................................................................5 vs. Appalachian State 2/10/07 Minutes: ..................................................................39 vs. Wofford, 2/19/07

Medical Redshirt Season (2005-06) 6WDUWHGWKHÀUVWÀYHJDPHVRIWKHVHDVRQDWIRUZDUGIRU81&*VXIIHUHGD knee injury in the opening minutes of the 72-70 upset win over West Virginia (12/3)‌ posted a double-double in just the second game of the year with 13 points and 11 rebounds in a loss to Longwood (11/25)‌ also had 14 points and seven rebounds the next day in a win over Ohio (11/26) at the UNCG Tournament‌ was named to the all-tournament team after averagingg 13.5 points and 9.0 rebounds in the two games‌ if you take out the WVU game, Frazier averaged 9.0 points and 6.8 rebounds in the four full games she played.

At Walters State Community College A Played for two seasons at Walters State Community College in Morristown, TN XQGHUKHDGFRDFK'DYH.UDJHO:DOWHUV6WDWHĂ€QLVKHGHLJKWKLQWKH1-&$$ National Tournament in Salinas, KS with a program best 31-5 record in 200405... the Lady Senators won the TJCCAA/NJCAA Region VII championship and was ranked No. 13 in the nation heading to the National Tournament... tabbed as an honorable mention All-American and was named All-State and All-Region VII after averagingg 10.7 points and a team-leading 6.3 rebounds per game.

High School Named all-state, all-region and all-conference at Oak Ridge High School in 2DN5LGJH71SOD\HGIRUFRDFK-LOO3UXGGHQĂ€QLVKHGUXQQHUXSIRUWKH0LVV Tennessee Basketball award...MVP of the district... the Wildcats all-time lead-

Brittany Frazier’s Career Stats Year 2005-06 2006-07 TOTAL

GP-GS 5-5 30-8 35-13

Min 20.4 22.1 21.9

FG-FGA 13-32 71-180 84-212

Pct .406 .394 .396

3FG-3FGA 0-0 0-0 0-0

24 • 2007-08 UNCG Women’s Basketball Media Guide

Pct .000 .000 .000

FT-FTA 10-18 24-44 34-62

Pct .556 .545 .548

O-D-Rebs 9-18-27 55-97-152 64-115-179

Avg 5.4 5.1 5.1

Ast 4 38 42

TO 8 59 67

Blk 2 29 31

Stl 2 16 18

Pts 36 160 202

Avg 7.2 5.5 5.8


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

Career Game-by-Game 2006-07 Min 19 27 15 20 14 22 9 25 26 26 14 14 23 15 21 25 17 18 23 18 22 24 19 15 25 32 35 39 29 32

FG-FGA 1-5 2-5 0-5 2-4 2-4 2-11 1-2 4-8 4-5 1-6 0-1 0-4 5-8 2-4 5-9 1-6 1-5 1-2 4-10 1-2 4-8 4-5 2-5 0-5 2-5 5-9 2-10 9-13 2-7 2-7

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

FT-FTA 0-0 1-2 0-0 2-4 0-0 0-0 0-1 0-0 1-4 0-0 0-0 0-0 0-0 0-1 5-6 2-4 0-2 0-4 0-0 1-1 0-0 1-2 1-3 0-0 6-6 0-0 0-0 2-2 0-0 2-2

O-D-R 0-1-1 2-3-5 3-0-3 0-3-3 0-2-2 4-2-6 0-0-0 3-3-6 0-4-4 2-7-9 0-0-0 1-3-4 2-6-8 3-4-7 3-1-4 1-2-3 1-2-3 3-2-5 2-5-7 0-5-5 4-2-6 0-4-4 0-3-3 2-2-4 4-7-11 3-7-10 4-7-11 2-2-4 3-2-5 3-6-9

PF 3 2 0 0 1 0 0 0 1 2 1 4 2 4 2 3 0 0 2 3 3 0 4 0 2 2 2 0 2 1

A 0 3 0 2 1 1 1 2 2 1 0 0 0 1 1 0 0 1 1 1 1 4 2 1 3 2 2 1 3 1

TO 3 3 1 1 1 0 0 2 3 0 1 0 2 6 5 2 1 0 3 1 5 0 2 3 4 3 1 1 3 2

Blk 0 0 0 0 0 0 0 1 3 2 0 1 0 0 2 0 2 2 1 0 0 2 1 0 5 0 3 1 2 1

Stl 0 0 0 0 0 1 0 0 1 0 2 0 0 0 1 1 0 0 4 0 0 1 0 0 2 0 1 0 2 0

Pts 2 5 0 6 4 4 2 8 9 2 0 0 10 4 15 4 2 2 8 3 8 9 5 0 10 10 4 20 4 6

Min. 23 29 26 23 1

FG 1-4 4-9 5-10 3-9 0-0

3FG 0-0 0-0 0-0 0-0 0-0

FT-FTA 1-3 5-7 4-7 0-1 0-0

O-D-R 2-4-6 5-6-11 2-5-7 0-3-3 0-0-0

PF 2 1 0 1 0

A 1 0 0 3 0

TO 5 2 0 1 0

Blk. 0 0 2 0 0

St. 0 1 0 1 0

Pts. 3 13 14 6 0

Meet the Spartans

Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD PROVIDENCE at North Carolina at Davidson COASTAL CAROLINA HIGH POINT WESTERN CAROLINA at #1/1 Maryland vs Liberty at Chattanooga FURMAN GEORGIA SOUTHERN VIRGINIA TECH at Appalachian State at College of Charleston ELON at Wofford DAVIDSON CHATTANOOGA at Furman at Georgia Southern APPST COLLEGE OF CHARLESTON at Elon WOFFORD at Western Carolina vs. Georgia Southern

2005-06 Opponent at NC State LONGWOOD OHIO at High Point WEST VIRGINIA

2007-08 UNCG Women’s Basketball Media Guide • 25


IRUWZR\HDUVÂŤWKH)RUFHĂ€QLVKHGWKDWWKH$$8-U2O\PSLFVLQ.

Personal Virginia Caroline Grimsley‌ prefers Gini‌ born November 28, 1986 in Ft. Ord, CA‌ daughter of Andy and Antonette Grimsley‌ exercise and sports science major‌ uncle Mike Baker played basketball at Roanoke College.

Career High’s

Meet the Spartans

At UNCG A Sophomore (2006-07) Saw action in 29 games... averaged 3.2 points and 1.7 rebounds in 12.7 minutes... had a season-high 13 points against Longwood during the UNCG 7KDQNVJLYLQJ 7RXUQDPHQW JUDEEHG D VHDVRQKLJK Ă€YH UHERXQGV WZLFH against Wofford (1/22/07) and Georgia Southern (1/8/07)... posted a career-high four steals against Providence (11/25/06)... recorded a careerhigh 20 minutes in UNCG’s 103-48 loss to North Carolina... second on the team in blocks with 19...tallied 12 steals on the year‌ fourth on the team LQ WKUHHSRLQWHUV PDGH   DQG Ă€IWK LQ WKUHHSRLQW Ă€HOG JRDO SHUFHQWDJH (29.2)‌ had two nine point games against Georgia Southern on (1/8/07) DQGDJDLQDJDLQVWWKH(DJOHVLQWKH6R&RQTXDUWHUĂ€QDOV  ÂŤVKRW percent (6-of-8) from the foul line.

Points:................................................................... 22 vs. Wofford, 1/24/06 Rebounds: ............................................................. 5, three times FG: ........................................................................ 8 vs. Wofford, 1/24/06 FGA: ...................................................................... 11 at High Point, 11/29/05 3FG: ...................................................................... 4 vs. Wofford, 1/24/06 3FGA: .................................................................... 5, four times FT: ......................................................................... 4 vs. Longwood, 11/25/05 FTA: ....................................................................... 5 vs. Longwood, 11/25/05 Assists:.................................................................. 2, three times Turnovers:.............................................................. 4, twice Steals:................................................................... 2, three times Blocks: .................................................................. 2, twice Minutes: ................................................................ 20 at North Carolina, 11/30/06

Freshman Season (2005-06) 0DGHĂ€UVWFDUHHUVWDUWDW&RDVWDO&DUROLQDVFRULQJVHYHQSRLQWVVDZDFtion in 29 games... averaged 4.1 points and 1.2 rebounds in 8.3 minutes per game... scored 15 points in second collegiate game in a 69-66 loss to Longwood (11/25)... had a break-out game against Wofford with 22 points RQRIVKRRWLQJIURPWKHĂ€HOGLQFOXGLQJRIIURPEH\RQGWKHDUFLW was the most points scored by a Spartan freshman since Melinda Goodson had 28 points twice during the 1996-97 season... also had 10 points in an ORVVWR&KDWWDQRRJD  VFRUHGIRXUSRLQWVLQĂ€YHPLQXWHVRIJDPH DFWLRQLQWKHZLQRYHU'DYLGVRQLQWKH6RXWKHUQ&RQIHUHQFHVHPLĂ€QDOV victory over the Wildcats (3/4/06)‌ shot 83.3 (10-of-12) percent from the foul line... had nine steals and eight blocks.

High School Four year letterwinner for coach Travis Kemp at Fairmont High School in Fairmont, NC‌ Fairmont’s all-time leading scorer with overr 1,600 career points‌ averaged 19 points and 10 rebounds per game as a senior and led the Lady Golden Tornadoes to the second round of the state Class 2A playoffs‌ team won two Tri-Six Conference Tournament Championships‌ played in the EastWest All-Star Game at the Greensboro Coliseum‌ four-time All-Tri-Six Conference and All-Robeson County honoree‌ named to the Robeson County Christmas Classic All-Tournament team four times‌ honorable mention allstate during junior year after averagingg 15 points and 11 rebounds per game‌ posted 19 points and 11 rebounds per outing as a sophomore...also lettered four years in volleyball and three years in track‌ Fairmont’s all-time leader in kills‌ three-time all-conference honoree and two-time conference MVP in volleyball‌ named all-conference in high jump, shot put and 800m event‌ Fairmont’s valedictorian as a senior with the top GPA amongg 139 graduating seniors‌ member of the Beta Club‌ was honored as a freshman student of excellence‌ NCAA East-West Academic All-Star‌ also competed for the Fayetteville Phantoms AAU team for seven years and for the Carolina Force

Gini Grimsley’s Career Stats Year 2005-06 2006-07 TOTAL

GP-GS 29-1 29-0 58-1

Min 8.3 12.7 10.5

FG-FGA 47-118 37-112 84-230

Pct .398 .330 .365

26 • 2007-08 UNCG Women’s Basketball Media Guide

3FG-3FGA 15-55 14-48 29-103

Pct .273 .292 .282

FT-FTA 10-12 6-8 16-20

Pct .833 .750 .800

O-D-Rebs 14-22-36 16-32-48 30-54-84

Avg 1.2 1.7 1.4

Ast 7 11 18

TO 28 31 59

Blk 8 19 27

Stl 9 12 21

Pts 119 94 213

Avg 4.1 3.2 3.7


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

Career Game-by-Game 2006-07 Min 15 4 16 17 14 20 10 9 9 10 14 2 10 16 16 12 11 15 13 11 11 13 9 15 10 16 16 20 14

FG-FGA 1-2 1-2 1-4 5-9 0-1 1-6 2-4 1-4 0-2 0-1 3-8 0-2 0-2 4-4 1-6 1-7 2-7 2-6 0-3 1-3 0-2 1-1 1-3 1-4 0-2 2-3 1-5 1-3 4-6

3FG 1-2 0-0 0-1 3-5 0-1 0-2 1-3 1-1 0-0 0-1 1-4 0-1 0-0 1-1 0-5 1-4 1-5 1-1 0-1 0-0 0-0 1-1 0-0 0-2 0-1 0-0 1-2 0-1 1-3

FT-FTA 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-2 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 2-2 2-2 0-0 0-0 0-0 0-0 0-0 0-0 2-2 0-0 0-0 0-0

O-D--R 0-1-1 0-0-0 0-1-1 0-2-2 0-1-1 1-3-4 0-0-0 1-1-2 1-0-1 0-1-1 1-1-2 1-0-1 1-3-4 2-3-5 0-0-0 1-1-2 1-2-3 1-0-1 2-3-5 0-0-0 0-1-1 1-0-1 1-1-2 0-0-0 0-0-0 0-2-2 1-3-4 0-1-1 0-1-1

PF 1 3 0 0 1 1 2 2 2 0 2 1 0 3 0 0 1 4 1 0 3 3 2 1 2 0 1 3 1

A 0 0 0 2 0 1 0 1 0 0 0 0 0 1 0 0 0 2 0 2 1 0 0 0 0 0 0 0 1

TO 1 1 2 4 0 1 0 1 1 2 3 0 1 1 1 1 1 3 0 0 0 2 0 1 1 0 1 1 1

Blk 0 0 0 0 0 1 1 1 0 2 1 0 1 1 1 1 1 0 1 1 1 0 0 0 1 1 2 0 1

Stl 0 0 0 0 2 1 0 0 0 0 0 0 0 0 1 1 0 0 1 1 0 0 1 0 0 0 2 0 2

Pts 3 2 2 13 0 2 5 3 0 0 7 0 0 9 2 3 5 7 2 2 0 3 2 2 0 6 3 2 9

Min. 9 16 7 15 11 3 2 15 19 11 6 11 10 6 13 8 19 11 2 8 3 3 2 6 5 3 3 5 10

FG 1-2 5-10 2-4 2-11 4-9 0-0 0-1 3-9 3-9 4-5 0-2 2-7 0-1 0-2 3-6 2-3 8-9 0-3 1-2 0-3 0-1 2-2 0-1 0-3 2-3 0-2 0-1 2-3 1-4

3FG 0-0 1-4 0-0 1-4 0-2 0-0 0-1 1-5 1-4 2-2 0-2 0-3 0-0 0-0 0-3 2-3 4-5 0-3 0-0 0-2 0-1 2-2 0-1 0-1 0-1 0-1 0-0 0-1 1-4

FT-FTA 0-0 4-5 2-2 0-1 0-0 0-0 0-0 2-2 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 2-2 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

O-D-R 0-2-2 3-2-5 0-1-1 0-4-4 1-1-2 0-0-0 0-0-0 1-2-3 0-2-2 1-0-1 1-0-1 1-0-1 0-2-2 0-0-0 1-1-2 0-0-0 2-2-4 0-1-1 2-1-3 1-0-1 0-0-0 0-1-1 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0

PF 1 3 2 4 2 1 1 1 0 2 3 0 2 0 0 1 1 1 1 0 1 0 1 0 0 0 0 1 2

A 1 0 0 0 0 0 0 0 0 1 0 0 0 0 0 1 0 0 0 1 1 0 0 0 0 1 0 0 1

TO 2 2 0 2 4 0 0 1 1 1 0 1 1 0 1 2 3 1 0 2 1 1 1 0 0 0 0 1 0

Blk. 0 0 0 1 0 0 0 0 1 0 1 0 0 1 1 0 1 0 0 0 0 0 0 1 0 0 0 1 0

St. 0 0 1 0 0 0 0 1 1 2 0 0 0 1 0 0 2 0 0 0 0 0 0 1 0 0 0 0 0

Pts. 2 15 6 5 8 0 0 9 7 10 0 4 0 0 6 6 22 0 2 0 0 6 0 0 4 0 0 4 3

Meet the Spartans

Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD PROVIDENCE at North Carolina at Davidson COASTAL CAROLINA HIGH POINT WESTERN CAROLINA at #1/1 Maryland vs Liberty FURMAN GEORGIA SOUTHERN VIRGINIA TECH at Appalachian State at College of Charleston ELON at Wofford DAVIDSON CHATTANOOGA at Furman at Georgia Southern APPST COLLEGE OF CHARLESTON at Elon WOFFORD at Western Carolina vs. Georgia Southern

2005-06 Opponent at NC State LONGWOOD OHIO at High Point CAMPBELL at Wake Forest DAVIDSON at UNC Wilmington at Coastal Carolina CHATTANOOGA at Furman at Georgia Southern APPALACHIAN STATE COLLEGE OF CHARLESTON at Western Carolina at Elon WOFFORD at Davidson at Chattanooga FURMAN GEORGIA SOUTHERN at Appalachian State at College of Charleston ELON at Wofford WESTERN CAROLINA vs. Georgia Southern vs. Davidson vs. Chattanooga

2007-08 UNCG Women’s Basketball Media Guide • 27


At UNCG A Sophomore Season (2006-07) Played in all 30 games... had a career day against UNC Wilmington... had a FDUHHUKLJKHLJKWSRLQWVWRJRZLWKFDUHHUKLJK¡VLQÀHOGJRDOVPDGH  IUHH throws made (2) and steals (3)... averaged 0.9 points and 1.7 rebounds per JDPHLQPLQXWHVGLVKHGRXWDFDUHHUKLJKÀYHDVVLVWVLQ81&*¡V 60 win over Georgia Southern (2/5)‌ scored three points and had two steals in UNCG’s 73-59 loss to Davidson (12/4/06)‌ pulled down a season-high four rebounds against Liberty (12/30/06) and Longwood (11/24/07)‌ had three steals on three occasions‌ played a season-high 19 minutes in a 88-40 win over Elon (1/20/07)‌ tallied four defensive rebounds on two occasions.

Meet the Spartans

Freshman Season (2005-06) 81&*¡VEDFNXSSRLQWJXDUGWKDWVWDUWHGWKHÀUVWVL[JDPHVRIWKH\HDUDQGVDZ action in all 30 games‌ averaged 1.0 points, 1.2 rebounds and 1.0 assists LQPLQXWHVSHUJDPHVFRUHGDVHDVRQKLJKÀYHSRLQWVDQGKDGWKUHH rebounds and two assists in an 84-64 win over Wofford (1/24)... also scored four points at Coastal Carolina (12/31) and against College of Charleston (1/16)... dished out a season-high three assists on three occasions... came up with two steals in two games...played a season-high 28 minutes in a 6563 overtime loss at High Point (11/29)‌ had two assists in just six minutes of action in the 91-79 setback to Chattanooga in the Southern Conference Tournament title game.

High School Lettered four years as the point guard for Gus Taylor at Centreville High School in Clifton, VA‌ led the Wildcats in assists and steals per game during her VHQLRUVHDVRQZLWKDQGUHVSHFWLYHO\ÀQLVKHGVHFRQGLQUHERXQGLQJ ZLWKSHURXWLQJQDPHGÀUVWWHDP$OO&RQFRUGH'LVWULFWDQGÀUVWWHDP all-defensive team.

Personal Ashley Rogeria Ling‌ born June 30, 1987 in Beaufort, SC‌ daughter of Earnestine Ling‌majoring in criminology.

Career High’s Points:.................................................................... 8 vs. UNC Wilmington, 11/12/06 Rebounds: .............................................................. 5 at High Point, 11/29/05 FG: ......................................................................... 3 vs. UNC Wilmington, 11/12 FGA: ....................................................................... 3, three times 3FG: ....................................................................... 0 3FGA: ..................................................................... 1, three times FT: .......................................................................... 2, three times FTA: ........................................................................ 4 vs. Ohio, 11/26/05 Assists:................................................................... 5 vs. Georgia Southern, 1/8/07 Turnovers:............................................................... 5 vs. Wofford, 1/22/07 Steals:.................................................................... 3 vs. UNC Wilmington, 11/12/06 Blocks: ................................................................... 1, three times Minutes: ................................................................. 28 at High Point, 11/29/05

Ashley Ling’s Career Stats Year 2005-06 2006-07 TOTAL

GP-GS 30-6 30-0 60-6

Min 11.3 11.3 11.3

FG-FGA 11-30 11-24 22-54

Pct .367 .458 .407

3FG-3FGA 0-1 0-2 0-3

28 • 2007-08 UNCG Women’s Basketball Media Guide

Pct .000 .000 .000

FT-FTA 7-14 4-6 11-20

Pct .500 .667 .550

O-D-Rebs 8-28-36 4-31-35 12-59-71

Avg 1.2 1.2 1.2

Ast 18 42 72

TO 34 36 70

Blk 3 1 4

Stl 13 16 29

Pts 29 26 55

Avg 1.0 0.9 0.9


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

Career Game-by-Game 2006-07 Min 15 13 17 19 5 8 7 15 15 9 15 8 12 9 15 12 12 10 19 10 10 6 8 8 11 15 7 9 13 7

FG-FGA 3-3 0-1 0-1 0-0 0-0 0-0 1-1 0-3 1-1 1-1 0-0 0-0 0-0 0-0 0-0 0-0 0-1 0-0 1-1 0-0 0-0 1-1 0-1 0-0 1-2 0-1 0-0 2-2 0-3 0-1

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-1 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-1 0-0 0-0 0-0 0-0 0-0 0-0 0-0

FT-FTA 2-2 0-0 0-0 0-0 0-0 0-0 1-1 0-0 0-0 0-0 0-0 0-0 0-0 0-1 0-0 0-0 0-0 1-2 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

O-D-R 0-0-0 0-1-1 0-1-1 0-4-4 0-1-1 0-0-0 0-0-0 0-2-2 1-1-2 0-0-0 0-0-0 0-4-4 0-2-2 2-0-2 1-1-2 0-2-2 0-1-1 0-1-1 0-2-2 0-1-1 0-1-1 0-1-1 0-0-0 0-0-0 0-0-0 0-2-2 0-0-0 0-0-0 0-3-3 0-0-0

PF 0 2 1 1 0 0 1 0 1 0 1 0 3 0 1 1 0 1 2 0 0 0 0 2 1 0 0 0 1 0

A 2 3 1 4 0 0 0 2 1 1 2 0 0 0 5 3 1 0 4 0 2 0 2 1 0 4 0 1 2 1

TO 0 2 2 1 0 3 0 2 0 1 0 1 0 4 1 0 1 2 1 5 1 1 1 1 0 4 0 0 1 1

Blk 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0

Stl 3 1 2 1 0 0 2 0 0 1 0 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 1 2 1

Pts 8 0 0 0 0 0 3 0 2 2 0 0 0 0 0 0 0 1 2 0 0 2 0 0 2 0 0 4 0 0

Min. 19 17 23 28 13 17 4 8 9 12 7 11 9 11 7 8 12 15 7 7 12 14 9 3 8 18 10 9 7 6

FG 0-3 0-1 0-3 0-1 1-2 0-1 0-1 0-0 0-0 2-2 0-0 1-2 0-0 0-1 2-2 0-0 0-1 2-2 0-0 0-0 0-0 1-1 0-1 1-1 0-0 0-2 1-2 0-1 0-0 0-0

3FG 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-1 0-0 0-0

FT-FTA 0-0 1-2 2-4 0-0 0-0 0-0 0-0 2-2 0-0 0-0 0-0 0-0 0-0 1-2 0-0 0-0 0-0 1-2 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-2 0-0 0-0

O-D-R 0-0-0 0-1-1 1-1-2 1-4-5 0-2-2 1-1-2 0-0-0 0-0-0 1-0-1 0-2-2 0-0-0 0-0-0 0-0-0 0-1-1 0-0-0 0-0-0 0-2-2 0-3-3 1-0-1 0-0-0 0-2-2 0-3-3 1-2-3 0-0-0 0-2-2 1-1-2 1-0-1 0-0-0 0-0-0 0-1-1

PF 0 1 1 1 2 1 0 1 0 0 0 1 0 1 0 1 0 1 0 0 2 0 0 1 1 1 0 1 1 0

A 0 2 2 3 0 1 0 0 1 1 1 2 1 0 0 1 1 2 1 0 3 1 0 0 1 3 0 0 1 2

TO 1 2 0 3 2 0 0 1 2 3 1 0 0 2 0 2 2 2 1 2 0 0 0 0 1 4 1 1 1 0

Blk. 0 0 0 0 0 1 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0

St. 2 1 1 1 0 0 0 0 0 1 1 0 0 1 1 0 0 0 1 0 0 0 0 1 0 2 0 0 0 0

Pts. 0 1 2 0 2 0 0 2 0 4 0 2 0 1 4 0 0 5 0 0 0 2 0 2 0 0 2 0 0 0

Meet the Spartans

Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD PROVIDENCE at North Carolina at Davidson COASTAL CAROLINA HIGH POINT WESTERN CAROLINA at #1/1 Maryland vs Liberty at Chattanooga FURMAN GEORGIA SOUTHERN VIRGINIA TECH at Appalachian State at College of Charleston ELON at Wofford DAVIDSON CHATTANOOGA at Furman at Georgia Southern APPST COLLEGE OF CHARLESTON at Elon WOFFORD at Western Carolina vs. Georgia Southern

2005-06 Opponent at NC State LONGWOOD OHIO at High Point WEST VIRGINIA CAMPBELL at Wake Forest DAVIDSON at UNC Wilmington at Coastal Carolina CHATTANOOGA at Furman at Georgia Southern APPALACHIAN STATE COLLEGE OF CHARLESTON at Western Carolina at Elon WOFFORD at Davidson at Chattanooga FURMAN GEORGIA SOUTHERN at Appalachian State at College of Charleston ELON at Wofford WESTERN CAROLINA vs. Georgia Southern vs. Davidson vs. Chattanooga

2007-08 UNCG Women’s Basketball Media Guide • 29


Career Game-by-Game 2006-07 Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD at North Carolina at Davidson

Min FG-FGA 3FG 4 0-0 0-0 2 0-0 0-0 5 2-4 0-0 8 2-3 0-1 10 0-3 0-1 2 0-1 0-0

FT-FTA 2-2 0-0 2-2 0-0 0-4 0-0

O-D-R 0-2-2 0-0-0 2-0-2 2-2-4 1-1-2 0-1-1

PF 1 0 0 2 0 0

A 1 0 0 0 0 0

TO 0 0 0 1 2 0

Blk 1 0 0 0 0 1

Stl 0 0 0 0 0 0

Pts 2 0 6 4 0 0

Min. 3 6 3 5 5 7 7 2 2 1 2 3

FT-FTA 0-0 0-0 1-1 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

O-D-R 0-0-0 1-0-1 0-0-0 1-1-2 0-1-1 1-1-2 0-0-0 0-0-0 0-0-0 0-0-0 0-1-1 0-0-0

PF 0 0 0 0 0 0 4 0 0 0 0 1

A 0 1 0 0 0 1 0 0 0 0 0 0

TO 2 0 1 0 0 0 0 1 0 0 0 0

Blk. St. Pts. 0 0 0 0 0 5 0 0 3 0 0 0 0 1 3 0 0 5 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0

2005-06

Meet the Spartans

At UNCG A Sophomore Season (2006-07) Only saw action in six games due to a thumb injury suffered in practice in early December... averaged 2.0 points and 1.8 rebounds in 5.2 minutes‌ posted a career-high six points in loss at Charlotte (11/20)... also posted a career-high four rebounds against Longwood (11/24)‌ played a season-high 10 minutes against North Carolina (11/30/06)‌ tallied 11 rebounds, one assist and one steal on the season.

Freshman Season (2005-06) Came off the bench in 12 games for UNCG... averaged 1.3 points and 0.6 UHERXQGV LQ  PLQXWHV SHU JDPH VFRUHG ÀYH SRLQWV RQ RI VKRRWLQJ LQDZLQRYHU2KLR  DOVRVFRUHGÀYHSRLQWVLQDZLQDW )XUPDQ  PDGHWKHÀUVWWKUHHSRLQWHUVVKHDWWHPSWHGLQKHUFDUHHU VKRW RI SHUFHQWIURPWKHÀHOGFDPHXSZLWKVHYHQUHERXQGV two assists and two steals.

High School First female athlete from Honaker High School to play Division I basketball‌ three-year varsity player for coach Larry Shortridge‌ averaged 21.5 points, 9.7 rebounds and 2.5 steals as a senior‌ was a three-time All-Region D and Black Diamond District selection, and was named Player of the Year in both as DVHQLRUZDVDOVRDÀUVWWHDP$OO6RXWKZHVW9LUJLQLDVHOHFWLRQE\WKH Bristol Herald Courier and a second team member on the All-State team‌ scored 1,202 points for her career‌ earned similar accolades in volleyball, including being named All-Region on three occasions and All-Southwest Virginia DQGDOOVWDWHDOVRFRPSHWHGLQVRIWEDOODQGWUDFNQDPHGÀUVWWHDP%ODFN Diamond District shortstop and utility player‌ was a district, regional and state competitor in track‌ National Honor Society member‌twice honored with National Spanish award and Who’s Who Among American Students‌ competed on multiple AAU teams overr 10 years and was named to numerous All-Tournament teams.

Opponent at NC State OHIO at High Point CAMPBELL at UNC Wilmington at Furman at Georgia Southern APPALACHIAN STATE at Elon WOFFORD FURMAN at Appalachian State

FG 0-0 2-3 1-2 0-0 1-1 2-3 0-1 0-0 0-1 0-1 0-0 0-0

3FG 0-0 1-1 0-0 0-0 1-1 1-2 0-1 0-0 0-0 0-0 0-0 0-0

Career High’s Points:...................................................................6 at Charlotte, 11/20/06 Rebounds: .............................................................4 vs. Longwood, 11/24/06 FG: ........................................................................2, four times FGA: ......................................................................4 at Charlotte, 11/20/06 3FG: ......................................................................1, three times 3FGA: ....................................................................2 at Furman, 1/7/06 FT: .........................................................................1 at High Point, 11/29/05 FTA: .......................................................................4 at North Carolina, 11/30/06 Assists:..................................................................1, three times Turnovers:..............................................................2, twice Steals:...................................................................1, twice Blocks: ..................................................................1 vs. UNC Wilmington, 11/12/06 Minutes: ................................................................10 at North Carolina, 11/30/06

Personal Ashley Dawn Mullins‌ born November 30, 1986 in Bristol, VA‌daughter of Louie and Rhonda Mullins‌ majoring in public health‌ her aunt Annie Chapman played soccer at UNCG.

Ashley Mullins’ Career Stats Year 2005-06 2006-07 TOTAL

GP-GS 12-0 6-0 18-0

Min 3.8 5.2 4.3

FG-FGA 6-12 4-11 10-23

Pct .500 .364 .435

30 • 2007-08 UNCG Women’s Basketball Media Guide

3FG-3FGA 3-5 0-2 3-7

Pct .600 .000 .429

FT-FTA 1-1 4-8 5-9

Pct 1.000 .500 .556

O-D-Rebs 4-4-8 5-6-11 9-10-19

Avg 0.7 1.8 1.1

Ast 2 1 3

TO 4 4 8

Blk 0 1 1

Stl 2 0 2

Pts 16 12 28

Avg 1.3 2.0 1.6


2006-07 Opponent UNC WILMINGTON at Campbell at Charlotte 49ers LONGWOOD at North Carolina

Min FG-FGA 3FG 5 1-2 0-0 1 0-0 0-0 12 0-2 0-0 17 3-8 0-0 10 0-1 0-0

FT-FTA 1-4 0-0 1-2 2-3 0-0

O-D-R 0-0-0 0-0-0 1-1-2 4-3-7 1-1-2

PF 0 1 2 3 2

A 0 0 0 0 0

TO 0 0 1 1 1

Blk 1 0 0 1 0

Stl 0 0 0 0 0

Pts 3 0 1 8 0

Career High’s

Freshman Season (2006-07) 2QO\VDZDFWLRQLQĂ€YHJDPHVDIWHUVXIIHULQJDNQHHLQMXU\DJDLQVW1RUWK&DURlina... had her best game of the season against Longwood during the UNCG Thanksgiving Tournament.. tallied eight points and seven rebounds on 3-of-8 VKRRWLQJIURPWKHĂ€HOGÂŤSOD\HGDVHDVRQKLJKPLQXWHVLQWKH81&*¡V 50 win over Longwood (11/24/06)‌ also went 2-of-3 from the foul line.

Points:..........................................................................8 vs. Longwood, 11/24 Rebounds: ....................................................................7 vs. Longwood, 11/24 FG: ...............................................................................3 vs. Longwood, 11/24 FGA: .............................................................................8 vs. Longwood, 11/24 3FG: .............................................................................0 3FGA: ...........................................................................0 FT: ................................................................................2 vs. Longwood, 11/24 FTA: ..............................................................................4 vs. UNC Wilmington, 11/12 Assists:.........................................................................0 Turnovers......................................................................1, three times Steals:..........................................................................0 Blocks: .........................................................................1, twice Minutes: .......................................................................17 vs. Longwood, 11/24

Played one year at Holy Cross Regional Catholic School in Lynchburg, VA for head coach Charles Sprouse‌ led team to a 31-3 record and to a state title... averaged nearlyy 15 points and 15 rebounds for the Gaels in 2005-06‌ named to the Virginia Independent Schools Division III all-state team‌ also named to the all-tournament teams at the Holy Cross and Blue Ridge in-season tournaments‌ played for the Lithuania Under 20 national team and led WKHPWRDWKLUGSODFHÀQLVKDWWKH(XURSHDQ&KDPSLRQVKLSVOHGWHDP WRDVL[WKSODFHÀQLVKLQ

Personal Agne Girstautaite‌ born August 6, 1986 in Kaunas, Lithuania‌ daughter of Rimantas Girstautas and Rima Girstautiene‌ has an older sister Greta‌ also considered George Washington, Towson, Delaware and Appalachian State‌ majoring in international business at UNCG.

Agne Girstautaite’s Career Stats Year GP-GS 2006-07 5-0 TOTAL 5-0

Avg 9.0 9.0

FG-FGA 4-13 4-13

Pct 3FG-3FGA .308 0-0 .308 0-0

Pct .000 .000

FT-FTA 4-9 4-9

Pct .444 .444

O-F-Rebs 6-5-11 6-5-11

Avg 2.2 2.2

Ast 0 0

TO 3 3

Blk 2 2

Stl 0 0

Pts 12 12

Avg 2.4 2.4

2007-08 UNCG Women’s Basketball Media Guide • 31

Meet the Spartans

High School

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG

Career Game-by-Game


Career Game-by-Game 2006-07

Meet the Spartans

Freshman Season (2006-07) Saw action in 20 games... averaged 0.7 points and 0.4 rebounds in 5.3 minutes off the bench… tallied a season-high four points twice against Elon (1/20/07) and Longwood (11/24/06)... pulled down two rebounds against College of Charleston (1/15)... went 3-of-4 from the free throw line against Virginia Tech (1/10)... played a season-high 16 minutes in UNCG’s 88-40 win over Elon (1/20)… tallied two assists, two steals and one block in UNCG’s win over Longwood in the UNCG Thanksgiving Tournament… tallied seven rebounds, seven assists and three blocks on the season.

High School Played four years at Gwynn Park High School in Brandywine, MD for head coach Marvin Vann… named honorable mention All-Met by the Washington Post during her senior season... named to the Prince George’s 3A/2A $OO/HDJXHWHDP«ÀQLVKHGKHUVHQLRUVHDVRQZLWKDUHFRUG«DYHUDJHG 16.8 points per game which ranked 10th in Prince George’s County… scored DJDPHKLJKSRLQWVLQWKH<HOORZ-DFNHWV$VWDWHVHPLÀQDOORVVWR%DOtimore City’s Western HS… scored a career-high 32 points and had 10 assists in a 70-28 win over Potomac… scored 20 or more points eight times, LQFOXGLQJWKHÀQDOWKUHHJDPHVRIWKHVHDVRQ«VFRUHGLQGRXEOHÀJXUHVLQ all but three games… scored overr 1,000 career points… won two state championships as a freshman and sophomore when she played alongside current UNCG seniors Kristen Boone and Kemena Brooks… member of four regional championship teams.

Opponent UNC WILMINGTON at Charlotte 49ers LONGWOOD PROVIDENCE at North Carolina COASTAL CAROLINA HIGH POINT at #1/1 Maryland vs Liberty FURMAN GEORGIA SOUTHERN VIRGINIA TECH at College of Charleston ELON at Wofford DAVIDSON at Furman APPST COLLEGE OF CHARLESTON WOFFORD

Min FG-FGA 3FG 2 1-1 0-0 11 0-1 0-0 15 2-3 0-1 3 0-0 0-0 4 0-0 0-0 3 0-1 0-0 10 0-1 0-1 10 0-1 0-0 0 0-0 0-0 3 0-1 0-0 2 0-0 0-0 4 0-0 0-0 9 0-0 0-0 16 2-3 0-0 1 0-1 0-0 5 0-0 0-0 5 0-0 0-0 3 0-0 0\-0 0 0-0 0-0 0 0-0 0-0

FT-FTA 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 3-4 0-0 0-1 0-0 0-0 0-0 0-0 0-0 0-0

O-D-R 0-0-0 0-1-1 0-1-1 0-0-0 0-1-1 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-2-2 0-1-1 0-0-0 0-1-1 0-0-0 0-0-0 0-0-0 0-0-0

PF 0 0 1 1 0 0 0 0 0 1 0 0 1 2 0 0 1 1 0 0

A 0 0 2 0 1 0 0 1 0 0 0 0 1 1 0 0 1 0 0 0

TO 0 0 2 0 0 0 1 0 1 1 1 0 1 1 1 0 0 0 1 0

Blk 0 0 1 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 0 0

Stl 1 1 2 0 2 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0

Pts 2 0 4 0 0 0 0 0 0 0 0 3 0 4 0 0 0 0 0 0

Career High’s Points:....................................................................4, twice Rebounds: ..............................................................2 at College of Charleston, 1/15 FG: .........................................................................2, twice FGA: .......................................................................3, twice 3FG: .......................................................................0 3FGA: .....................................................................1 vs. Longwood, 11/24 FT: ..........................................................................3 vs. Virginia Tech, 1/10 FTA: ........................................................................4 vs. Virginia Tech, 1/10 Assists:...................................................................2 vs. Longwood, 11/24 Turnovers................................................................2 vs. Longwood, 11/24 Steals:....................................................................2, twice Blocks: ...................................................................2 vs. Elon, 1/20 Minutes: .................................................................16 vs.Elon, 1/20

Personal Lakiah Allise Hyson… born April 3, 1988… daughter of Lawrence and Beverly Hyson… has two brothers, Lawrence and Lamar, and one sister, Latoya… Lamar plays football at Cheyney University… also considered Coppin State, North Carolina A&T and Loyola (MD)… business major at UNCG.

akiah Hyson’s Career Stats ear 006-07 OTAL

GP-GS 20-0 20-0

Min 5.3 5.3

FG-FGA 5-13 5-13

Pct .385 .385

3FG-3FGA 0-2 0-2

32 • 2007-08 UNCG Women’s Basketball Media Guide

Pct .000 .000

FT-FTA 3-5 3-5

Pct .600 .600

O-D-Rebs 0-7-7 0-7-7

Avg 0.4 0.4

Ast 7 7

TO 10 10

Blk 3 3

Stl 8 8

Pts 13 13

Avg 0.7 0.7


Played four years at West Bladen High School in Bladenboro, NC for head coach Teresa Colemanâ&#x20AC;Ś was named Tri-County Player of the Year after avHUDJLQJSRLQWVVHYHQUHERXQGVĂ&#x20AC;YHVWHDOVDQGIRXUDVVLVWVGXULQJKHU senior seasonâ&#x20AC;Ś earned All-Southeastern Conference honors during her junior and senior yearsâ&#x20AC;Ś scored a school record 1, 490 points at West Bladen High Schoolâ&#x20AC;Ś was named MVP, Best Defensive Player and Female Player of the Year for her efforts her senior seasonâ&#x20AC;Ś was nominated for the North Carolina East-West All-Star gameâ&#x20AC;Ś played one season for coach Marlon Hardy and the Carolina Force and went to the AAU Jr. Olympics in New Orleans, LAâ&#x20AC;Ś also a member of the track teamâ&#x20AC;Śgarnered All-State and All-Conference honorsâ&#x20AC;Ś also garnered the State Championship award in the 4x100 relay.

High School Earned four varsity letters at guard for head coach Ryan Cook at Sun Valley HSâ&#x20AC;Ś Sun Valleyâ&#x20AC;&#x2122;s all-time leading scorer with overr 1, 000 career points VFRUHGDQGLVWKHDOOWLPHOHDGHUIRUWKUHHSRLQWĂ&#x20AC;HOGJRDOVPDGHÂŤDOVRKROGV the record for most points scored in a seasonâ&#x20AC;Ś two-time all-conference selectionâ&#x20AC;Śearned conference Player of the Year honors in 2005 and 2006â&#x20AC;Ś high school team was conference champions during the 2005-06 seasonâ&#x20AC;Ś two-time Union County Player of the Yearâ&#x20AC;Ś second team All-State selection... played in the East-West All-Star game

Personal TaShama Tyniquia Bannerâ&#x20AC;Ś born September 2, 1988... daughter of Wallace and Phyllis Robinsonâ&#x20AC;Ś has one sister Shayla, and one brother Dietrichâ&#x20AC;Ś brother Dietrich played basketball at UNC Pembrokeâ&#x20AC;Ś undecided on a majo at UNCG.

Personal Amanda Rae Leighâ&#x20AC;Śdaughter of Derek Leigh and Angela Carverâ&#x20AC;Śhas six siblings, Ashleigh Harris (19), Justin Carver (16), Zachary Carver (10), Jessey Leigh (10), Cory Carver (8) and Kody Leigh (8)â&#x20AC;Ś majoring in sports medicine at UNCG.

High School Earned three varsity letters in cross country, basketball and track at Northside HS in Jacksonville, NCâ&#x20AC;Ś a four-year member of the basketball team who earned all-conference and all-area honorsâ&#x20AC;Ś was a all-conference and all-area cross country and track performerâ&#x20AC;Ś holds state relay records in the 4x400 and the 4x200â&#x20AC;Ś also played four years of AAU basketball for the East Carolina Storm.

Personal Earned a spot on the team as a walk-on during preseason workouts... Johanna Nicole Womackâ&#x20AC;Ś daughter of Joseph and Felicia Womackâ&#x20AC;Ś majoring in exercise and sport science at UNCG.

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 33

Meet the Spartans

High School

Saw action in 26 games and started twoâ&#x20AC;Ś averaged 2.2 points and 1.0 rebounds in 9.4 minutesâ&#x20AC;Ś had her best game of the season against BirmingKDP6RXWKHUQZKHUHVKHZDVRIIURPWKHĂ RRUDQGZDVRIIURPEHKLQG the arcâ&#x20AC;Ś tallied a career-high eight points against Birmingham-Southern and WDOOLHGDVHDVRQKLJKĂ&#x20AC;YHUHERXQGVDJDLQVW&KDUORWWHÂŤZDVDSHUIHFWIRU from the free throw line for the season

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Freshman Season (2006-07) at Winthrop University


Meet the Spartans

High School

High School

Played four years at Kendrick High School in Columbus, GA for head coach Sterling Hicks… tallied 238 points, 195 rebounds, 45 assists, 73 steals and 36 blocks during her senior campaign… a member of the All-Bi-City All-Star team …led her team to a 113-12 record during her four-year tenure… high VFKRROWHDPDGYDQFHGWRIRXUFRQVHFXWLYHVWDWHÀQDOIRXUDSSHDUDQFHVDQG earned state runner-up honors during her sophomore year… team was fourtime regional champions and took home the Christmas tournament title three times… was named to the All-Bi-City and All-Region teams… was the team’s leading rebounder and shot blocker and held the team’s best free-throw percentage… played two seasons of AAU Basketball for the Dream Team.

Played four years at J.L Mann High School in Greenville, SC for head coach 'DUDK+XIIPDQ«VKHEHFRPHVWKHÀUVWSOD\HUIURPWKHVWDWHRI6RXWK&DURlina to ever play for Coach Agee… was named the Greenville County Basketball Coaches Association Player of the Year after averagingg 16.7 points, four steals and three assists per game during senior season… also was selected to the SCBCA All-State team… scored 33 points in a 76-63 victory over North Charleston to win the Class 3A state championship… she emerged as the Patriots’ leader of a young squad that featured only two seniors among 0DQQ·VÀUVWVHYHQSOD\HUVIRXULQWKHURWDWLRQZHUHVRSKRPRUHV«FRPSHWHG in the Carolinas All-Star Basketball Classic, which features the South Carolina women all-stars versus the North Carolina all-stars… scored a seasonhigh 42 points in a regular season loss to Greenville, but came back to score SRLQWVLQWKH3DWULRWV·ZLQLQWKH8SSHU6WDWHÀQDORYHU*UHHQYLOOH«ZDV named second team all-county and All-Peach Blossom Conference as a junior… selected the most improved player on the team as a sophomore… also garnered third team all-county plaudits that year.

Personal Kendra Bresha Smith… daughter of the late Kelvin Smith and Alice Smith… has two siblings, Anthony Hoskin (25) and Myranteiya Smith (23)… plans to major in early childhood education at UNCG.

Personal Sharniece Wadelington…born August 9, 1988 in Greensboro, NC…daughter of James and Angela Wadelington…also considered USC Upstate, Francis Marion and Anderson…majoring in parks and recreation managament at UNCG.

High School Played four years at Fairmont HS, in Fairmont, NC for head coach Travis Kemp… four-time Southeastern Conference Player of the Year… four-time all-county and all-region selection… earned Robesonian County Player of the Year during her junior and senior years… team was sectional champions and advanced WRWKHUHJLRQDOVHPLÀQDOVGXULQJKHUVHQLRU\HDU«DOVRFODLPHGWKH&KULVWPDV7RXUQDPHQWWLWOH«HDUQHG)LUVW7HDP$OO6WDWHKRQRUVDVVHQLRUDQG was named to the Second-Team during her junior year… during her senior year was named to the All-Cape Fear team and earned MVP honors at the Holiday 7RXUQDPHQW«SDUWLFLSDWHGLQWKH(DVW:HVW$OO6WDUJDPHDQGWKH1RUWK6RXWK$OO6WDUJDPHEHFRPLQJWKHÀUVWSOD\HUDW)DLUPRQWWRSDUWLFLSDWHLQERWK$OO Star games… set the record for most points scored in the holiday tournament with 42 points… graduated as the all-time leading scorer in Fairmount history with overr 1,652 points in 101 games played…was a McDonald’s All-American nominee.. also played volleyball for four years… two-time all-conference selecWLRQ«HDUQHG&RQIHUHQFH3OD\HURIWKH<HDUSODXGLWVGXULQJKHUVHQLRU\HDU«WHDPZHQWXQGHIHDWHGEHIRUHIDOOLQJLQWKHÀUVWURXQGRIWKHVWDWHSOD\RIIV« member of the NCHSAA Academic All-Star team.

Personal Shaquail Monique Floyd… prefers Monique… daughter of Vincent Floyd and Sheila Page… has two siblings, Ramail Leonard (9) and Kadeem Leonard (4)… planning to major in sports medicine at UNCG.

34 • 2007-08 UNCG Women’s Basketball Media Guide


2006-07 In Review


NCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG-

2006-07 Statistics

RESULTS DATE N 12 N 17 N 20 N 24 N 25 N 30 D4

OPPONENT UNC WILMINGTON at Campbell at Charlotte LONGWOOD PROVIDENCE at North Carolina *at Davidson

SCORE W 74-46 W 84-68 L 40-86 W 81-50 W 72-68 L 48-103 L 59-73

RECORD 1-0 2-0 2-1 3-1 4-1 4-2 4-3, 0-1 SoCon

ATTEND 315 757 646 263 244 2842 241

D 16 D 18 D 20 D 29

COASTAL CAROLINA HIGH POINT *WESTERN CAROLINA at Maryland

W 64-54 W 63-53 L 52-53 L 57-92

5-3 6-3 6-4, 0-2 SoCon 6-5

157 98 219 7633

HIGH POINTS (27)Byrd, Jasmine (24)Byrd, Jasmine (9)Brooks, Kemena (22)Byrd, Jasmine (23)Byrd, Jasmine (16)Byrd, Jasmine (11)Byrd, Jasmine (11)Otamiri, Irene (17)Latham, Kaleah (16)Latham, Kaleah (16)Byrd, Jasmine (15)Byrd, Jasmine

D 30 J2 J6

vs. Liberty *at Chattanooga *FURMAN

W 67-59 W 71-68 W 67-53

7-5 8-5, 1-2 SoCon 9-5, 2-2 SoCon

1254 1285 238

(21)Byrd, Jasmine (17)Latham, Kaleah (27)Boone, Kristen

J8 J 10 J 13 J 15 J 20

*GEORGIA SOUTHERN VIRGINIA TECH *at Appalachian State *at College of Charleston *ELON

W 80-55 L 45-56 W68-61 L 61-73 W 88-40

10-5, 3-2 SoCon 10-6 11-6, 4-2 SoCon 11-7, 4-3 SoCon 12-7, 5-3 SoCon

180 479 388 287

(25)Byrd, Jasmine (10)Byrd, Jasmine (18)Byrd, Jasmine (14)Boone, Kristen (16)Byrd, Jasmine

J 22 J 27 J 29

*at Wofford *DAVIDSON *CHATTANOOGA

W 62-54 W 78-55 L 66-83

13-7, 6-3 SoCon 14-7, 7-3 SoCon 14-8, 7-4 SoCon

181 643 408

F3 F5 F 10 F 12 F 17 F 19 F 24 M1

*at Furman *at Georgia Southern *APPALACHIAN STATE *COLLEGE OF CHARLESTON *at Elon *WOFFORD *at Western Carolina vs. Georgia Southern

W 65-58 W 68-60 W 81-62 W 70-61 W 57-48 W OT71-66 L 67-73 L 64-81

15-8, 8-4 SoCon 16-8, 9-4 SoCon 17-8, 10-4 SoCon 18-8, 11-4 SoCon 19-8, 12-4 SoCon 20-8, 13-4 SoCon 20-9, 13-5 SoCon 20-10

586 591 556 215 287 932

(26)Byrd, Jasmine (24)Byrd, Jasmine (14)Boone, Kristen (14)Otamiri, Irene (15)Latham, Kaleah (19)Latham, Kaleah (18)Boone, Kristen (23)Byrd, Jasmine (18)Latham, Kaleah (20)Frazier, Brittany (25)Boone, Kristen (17)Boone, Kristen

HIGH REBOUNDS (6)Otamiri, Irene (8)Otamiri, Irene (4)Byrd, Jasmine (7)Girstautaite, Agne (10)Latham, Kaleah (6)Frazier, Brittany (10)Latham, Kaleah (7)Latham, Kaleah (9)Latham, Kaleah (9)Frazier, Brittany (4)Chamberlain, Meghan (4)Latham, Kaleah (14)Latham, Kaleah (12)Otamiri, Irene (7)Frazier, Brittany (7)Otamiri, Irene (8)Chamberlain, Meghan (5)Latham, Kaleah (5)Otamiri, Irene (11)Latham, Kaleah (7)Chamberlain, Meghan (7)Frazier, Brittany (10)Latham, Kaleah (11)Latham, Kaleah (8)Latham, Kaleah (15)Latham, Kaleah (13)Latham, Kaleah (11)Frazier, Brittany (11)Latham, Kaleah (11)Frazier, Brittany (7)Latham, Kaleah (7)Latham, Kaleah (9)Frazier, Brittany (9)Latham, Kaleah

POINTS-REBOUNDS-ASSISTS Opponent UNC Wilmington at Campbell at Charlotte LONGWOOD PROVIDENCE at North Carolina at Davidson COASTAL CAROLINA HIGH POINT WESTERN CAROLINA at Maryland vs Liberty at Chattanooga FURMAN GEORGIA SOUTHERN VIRGINIA TECH at Appalachian State at College of Charleston ELON at Wofford DAVIDSON at Furman at Georgia Southern APPALACHIAN STATE COLLEGE OF CHARLESTON at Elon WOFFORD at Western Carolina vs Georgia Southern

03 DIXON 2-4-0 5-1-0 2-3-0 0-3-0 7-5-2 4-3-1 9-4-0 3-4-0 3-4-0 4-3-1 7-2-1 3-2-2 2-4-0 0-2-0 2-5-2 2-4-2 1-3-0 4-3-0 10-5-0 0-2-0 2-1-0 2-3-1 11-2-0 6-2-0 8-3-0 8-3-1 0-3-2 2-4-0 2-2-1

04 OTAMIRI 8-6-0 14-8-6 0-3-1 5-3-4 9-3-4 4-2-0 11-6-3 2-6-2 4-6-2 8-3-0 8-1-1 10-7-2 5-12-4 14-7-3 9-7-6 7-4-1 11-5-3 8-7-3 10-3-2 6-6-4 14-6-5 4-1-2 7-6-2 16-5-1 10-1-2 2-2-0 10-4-2 6-3-3 13-5-3

12 HYSON 2-0-0 DNP 0-1-0 4-1-2 0-0-0 0-1-1 DNP 0-0-0 0-0-0 DNP 0-0-1 0-0-0 DNP 0-0-0 0-0-0 3-0-0 DNP 0-2-1 4-1-1 0-0-0 DNP 0-0-1 DNP 0-0-0 0-0-0 DNP 0-0-0 DNP DNP

36 • 2007-08 UNCG Women’s Basketball Media Guide

21 BOONE, 10-2-3 17-2-4 4-2-3 6-1-5 5-4-5 8-2-1 7-2-3 6-3-1 11-2-1 3-3-5 5-0-5 2-6-6 15-2-3 27-3-5 7-4-3 9-4-2 13-3-4 14-5-6 7-3-10 11-3-4 14-5-4 11-3-4 16-2-4 18-5-6 11-8-2 12-6-3 12-6-8 25-3-2 17-3-0

22 BROOKS 0-0-0 4-3-0 9-0-1 2-0-0 DNP 6-1-1 0-2-1 8-3-1 7-5-1 8-4-0 2-0-0 9-1-1 4-6-1 0-0-0 2-0-0 0-1-2 2-2-0 2-1-0 5-3-2 0-0-0 2-0-0 7-1-1 2-2-0 4-1-0 0-0-0 2-2-1 5-0-1 2-4-1 0-0-1

23 LING 8-0-2 0-1-3 0-1-1 0-4-4 0-1-0 0-0-0 3-0-0 0-2-2 2-2-1 2-0-1 0-0-2 0-4-0 0-2-0 0-2-0 0-2-5 0-2-3 0-1-1 1-1-0 2-2-4 0-1-0 2-1-0 0-0-2 0-0-1 2-0-0 0-2-4 0-0-0 4-0-1 0-3-2 0-0-1

24 BYRD 27-2-3 24-7-2 6-4-0 22-3-2 23-6-0 16-3-1 11-2-2 11-3-2 11-0-3 16-2-3 15-1-2 21-3-1 15-1-2 7-2-4 25-4-1 10-1-1 18-4-3 6-2-0 16-3-2 26-2-0 13-1-2 10-0-1 5-2-2 12-3-4 23-3-1 5-8-3 13-2-0 19-2-1 9-1-1

30 GRIMSLEY 3-1-0 2-0-0 2-1-0 13-2-2 0-1-0 2-4-1 5-0-0 3-2-1 0-1-0 0-1-0 7-2-0 0-1-0 DNP 0-4-0 9-5-1 2-0-0 3-2-0 5-3-0 7-1-2 2-5-0 0-1-1 3-1-0 2-2-0 2-0-0 0-0-0 6-2-0 3-4-0 2-1-0 9-1-1

31 MULLINS 2-2-1 0-0-0 6-2-0 4-4-0 DNP 0-2-0 0-1-0 DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP

33 LATHAM 7-4-5 5-3-0 4-1-0 5-5-1 15-10-1 0-2-1 9-10-1 17-7-0 16-9-1 9-5-0 9-4-0 14-14-0 17-9-1 5-5-0 7-5-2 4-5-0 6-4-1 11-11-0 11-5-0 10-10-1 8-8-3 15-15-3 19-13-1 6-7-2 8-11-3 18-8-1 4-7-2 7-7-0 8-9-1

40 FRAZIER 2-1-0 5-5-3 0-3-0 6-3-2 4-2-1 4-6-1 2-0-1 8-6-2 9-4-2 2-9-1 0-0-0 0-4-0 10-8-0 4-7-1 15-4-1 4-3-0 2-3-0 2-5-1 8-7-1 3-5-1 9-4-4 5-3-2 0-4-1 10-11-3 10-10-2 4-11-2 20-4-1 4-5-3 6-9-1

41 GIRST 3-0-0 0-0-0 1-2-0 8-7-0 DNP 0-2-0 DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP DNP

44 CHAMB 0-0-1 8-2-2 6-3-0 6-3-0 9-9-1 4-2-2 2-6-0 6-4-1 0-2-0 0-2-2 4-4-0 8-3-0 3-4-2 10-3-1 4-8-1 4-1-0 12-4-1 8-3-0 8-7-0 4-6-2 2-5-0 8-1-1 6-4-1 5-4-0 DNP DNP DNP DNP DNP


Player Byrd, Jasmine Boone, Kristen Latham, Kaleah Otamiri, Irene Frazier, Brittany Chamberlain, Meghan Dixon, Jasmine Brooks, Kemena Grimsley, Gini Girstautaite, Agne Mullins, Ashley Ling, Ashley 30-0 Hyson, Lakiah TEAM Total Opponents

GP-GS 30-30 30-30 30-30 30-30 30-8 25-22 30-0 29-0 29-0 5-0 6-0 11-24 20-0

TOTAL

3-PTS

FG-FGA Pct 164-409 .401 108-274 .394 114-248 .460 98-224 .438 71-180 .394 54-143 .378 36-96 .375 34-108 .315 37-112 .330 4-13 .308 4-11 .364 .458 0-2 . 5-13 .385

3FG-FGA 77-213 17-48 8-28 21-71 0-0 0-0 3-9 9-35 14-48 0-0 0-2 000 0-2

740-1855 .399 149-458 .325 673-1685 .399 149-466 .320

REBOUNDS

Pct .362 .354 .286 .296 .000 .000 .333 .257 .292 .000 .000 4-6 .000

FT-FTA 54-63 94-125 56-85 22-28 24-44 25-38 44-69 21-28 6-8 4-9 4-8 .667 3-5

361-516 .700 417-584 .714

Pct .857 .752 .659 .786 .545 .658 .638 .750 .750 .444 .500 .600

O-D-T 18-62-80 42-60-102 82-142-224 50-93-143 55-97-152 37-60-97 32-60-92 13-30-43 16-32-48 6-5-11 5-6-11 4-31-35 0-7-7 62-57-119

422-742-116438.8 365-788-115338.4

Avg 2.7 3.4 7.5 4.8 5.1 3.9 3.1 1.5 1.7 2.2 1.8 1.2 0.4 4.0

A 51 121 33 72 38 19 16 16 11 0 1 42 7 0

TO 50 101 60 55 59 31 77 19 31 3 4 36 10

Blk 0 7 11 5 29 16 7 3 19 2 1 1 3

552 535

4 -

427 544 396 624

Stl 45 91 48 81 16 8 17 7 12 0 0 16 8 8

Pts 459 327 292 239 166 133 119 98 94 12 12 26 13

Avg 15.3 10.9 9.7 8.0 5.5 5.3 4.0 3.4 3.2 2.4 2.0 0.9 0.7

104 349 112 273

1990 1912

66.3 63.7

Playerr Byrd, Jasmine Boone, Kristen Latham, Kaleah Otamiri, Irene Frazier, Brittany Chamberlain, Meghan Dixon, Jasmine Grimsley, Gini1 Brooks, Kemena Ling, Ashley Hyson, Lakiah Mullins, Ashley TEAM Total Opponents

GP-GS 18-18 18-18 18-18 18-18 18-5 14-13 18-0 7-0 18-0 18-0 10-0 1-0

TOTAL FG-FGA A 95-245 73-176 79-163 65-136 51-115 31-79 24-56 19-60 16-61 7-14 2-5 0-1

Pct .388 .415 .485 .478 .443 .392 .429 .317 .262 .500 .400 .000

3-PTS 3FG-FGA 46-133 15-33 3-15 13-49 0-0 0-0 1-4 7-23 5-19 0-1 0-0 0-0

462-1111 .416 90-277 378-1007 .375 86-289

Pct .346 .455 .200 .265 .000 .000 .250 .304 .263 .000 .000 .000

FT-FTA 28-32 66-86 27-46 12-15 16-28 16-24 30-44 6-6 14-17 2-4 0-1 0-0

.325 .298

217-303 254-362

Pct .875 .767 .587 .800 .571 .667 .682 1.000 .824 .500 .000 .000 36-30-66 .716 .702

REBOUNDS O-D-TT 8-38-46 27-44-71 49-102-151 33-56-89 38-68-106 25-39-64 19-36-55 11-21-32 7-22-29 3-15-18 0-4-4 0-1-1 3.7 0 256-476-732 219-444-663

Avg 2.6 3.9 8.4 4.9 5.9 4.6 3.1 1.9 1.6 1.0 0.4 1.0

A 33 85 23 46 26 12 7 6 8 23 3 0

40.7 36.8

272 212

TO 32 62 36 34 40 24 44 15 10 24 6 1 5 333 367

Blk 0 7 6 5 23 10 4 14 3 1 2 0

Stl 22 50 25 54 11 6 8 6 2 8 1 0

Pts 264 227 188 155 118 78 79 51 51 16 4 0

75 70

193 172

1231 68.4 1096 60.9

2007-08 UNCG Women’s Basketball Media Guide • 37

Avg 14.7 12.6 10.4 8.6 6.6 5.6 4.4 3.0 2.8 0.9 0.4 0.0

2006-07 Statistics

SOCON REGULAR SEASON STA TATISTICS

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGS

OVERALL STA TATISTICS


NCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCG-

2006-07 Statistics

UNC GREENSBORO-INDIVIDUAL GAME HIGHS

POINTS

27 27 26 25 25

Boone, Kristen vs Furman (1/6/2007) Byrd, Jasmine vs UNC Wilmington (11/12/06) Byrd, Jasmine at Wofford (01/22/07) Boone, Kristen at Western Carolina (02/24/07) Byrd, Jasmine vs Georgia Southern (1/8/07)

FIELD GOALS MADE

11 10

Byrd, Jasmine vs UNC Wilmington (11/12/06) Boone, Kristen vs Furman (1/6/2007)

FIELD GOAL ATT

19 19

Byrd, Jasmine vs Wofford (2/19/07) Byrd, Jasmine at Maryland (11/29/06)

FG PCT (min 5 made)

1.000 ( 5-5 ) .833 ( 5-6 )

Otamiri, Irene vs Elon (1/20/07) Otamiri, Irene at Davidson (12/04/06)

3 PT FG MADE

6 6

Byrd, Jasmine vs Georgia Southern (1/8/07) Byrd, Jasmine vs Providence (11/25/06)

3 PT FG ATTEMPTS

14 12

Byrd, Jasmine vs Wofford (2/19/07) Byrd, Jasmine vs Providence (11/25/06)

3-PT FG PCT (min 2 made)

1.000 ( 2-2 ) 1.000 ( 2-2 )

Boone, Kristen vs Appalachian State (2/10/07) Boone, Kristen vs Chattanooga (1/29/07)

FREE THROWS MADE

9 8 8

Boone, Kristen at Appalachian State (01/13/07) Boone, Kristen at Chattanooga (01/02/07) Latham, Kaleah vs High Point (12/18/06)

FREE THROW ATT

10 10 10

Boone, Kristen at Appalachian State (01/13/07) Boone, Kristen at Chattanooga (01/02/07) Latham, Kaleah vs High Point (12/18/06)

FT PCT (min 3 made)

1.000 ( 7-7 ) 1.000 ( 7-7 ) 1.000 ( 6-6 )

Byrd, Jasmine at Appalachian State (01/13/07) Latham, Kaleah vs Coastal Carolina (12/16/06) Frazier, Brittany vs Appalachian State (2/10/07)

REBOUNDS

15 14

Latham, Kaleah at Furman (02/03/07) Latham, Kaleah vs Liberty (12/30/06)

ASSISTS.

10 9

Boone, Kristen vs Elon (1/20/07) Boone, Kristen vs Davidson (1/27/07)

STEALS

11 6

Boone, Kristen vs UNC Wilmington (11/12/06) Otamiri, Irene vs Appalachian State (2/10/07)

BLOCKED SHOTS

5 3

Frazier, Brittany vs Appalachian State (2/10/07) Frazier, Brittany at Elon (02/17/07

TURNOVERS.

6 6 6

Latham, Kaleah at Elon (02/17/07) Boone, Kristen vs College of Charleston (2/12/07 Boone, Kristen vs Virginia Tech (1/10/07)

FOULS

5 5 5

Byrd, Jasmine at Western Carolina (02/24/07) Latham, Kaleah vs Wofford (2/19/07) Otamiri, Irene at College of Charleston (01/15/07

Ashley Ling

38 • 2007-08 UNCG Women’s Basketball Media Guide

Kristen Boone


OPPONENT-GAME HIGHS

88 84

vs Elon (1/20/07) at Campbell (11/17/06)

POINTS

103 92

at North Carolina (11/30/06) at Maryland (11/29/06)

FIELD GOALS MADE

35 32

vs Elon (1/20/07) vs Longwood (11/24/06)

FIELD GOALS MADE

39 34

at North Carolina (11/30/06) at Charlotte (11/20/06)

FIELD GOAL ATTEMPTS

72 71

vs Wofford (2/19/07) at College of Charleston (01/15/07)

FIELD GOAL ATTEMPTS

77 74

at North Carolina (11/30/06) vs High Point (12/18/06)

FIELD GOAL PERCENTAGE

.538 (35-65) .525 (32-61)

vs Elon (1/20/07) vs Longwood (11/24/06)

FIELD GOAL PERCENTAGE

.596 (34-57) .571 (28-49)

at Charlotte (11/20/06) at Maryland (11/29/06)

3 PT FIELD GOALS MADE

9 9

vs Georgia Southern (1/8/07) vs Longwood (11/24/06)

3 PT FIELD GOALS MADE

12 11

at Maryland (11/29/06) vs Chattanooga (1/29/07)

3 PT FG ATTEMPTS

25 25

at Western Carolina (02/24/07) vs Wofford (2/19/07)

3 PT FG ATTEMPTS

28 26

at Georgia Southern (02/05/07) vs Chattanooga (1/29/07)

3 PT FG PERCENTAGE.

.643 ( 9-14) .636 ( 7-11)

vs Georgia Southern (1/8/07) vs UNC Wilmington (11/12/06)

3 PT FG PERCENTAGE

.571 (12-21) .571 ( 4-7 )

at Maryland (11/29/06) vs Providence (11/25/06)

FREE THROWS MADE

24 21

at Appalachian State (01/13/07) vs Appalachian State (2/10/07)

FREE THROWS MADE

24 24

at Western Carolina (02/24/07) at Maryland (11/29/06)

FREE THROW ATTEMPTS

31 27

at Appalachian State (01/13/07) at Campbell (11/17/06)

FREE THROW ATTEMPTS

32 28

at Western Carolina (02/24/07) at Campbell (11/17/06)

FREE THROW PERCENTAGE

1.000 ( 9-9 ) .938 (15-16)

vs Wofford (2/19/07) vs Georgia Southern (3/1/07)

FREE THROW PERCENTAGE

.960 (24-25) .905 (19-21)

at Maryland (11/29/06) vs College of Charleston (2/12/07)

REBOUNDS

52 49

vs Liberty (12/30/06) at Chattanooga (01/02/07)

REBOUNDS

57 52

at North Carolina (11/30/06) vs Virginia Tech (1/10/07)

ASSISTS

24 22

vs Elon (1/20/07) vs Georgia Southern (1/8/07)

ASSISTS

27 23

at North Carolina (11/30/06) at Maryland (11/29/06)

STEALS

27 18

vs UNC Wilmington (11/12/06) at Campbell (11/17/06)

STEALS

22 16

at North Carolina (11/30/06) vs College of Charleston (2/12/07)

BLOCKED SHOTS

8 7

vs Georgia Southern (1/8/07) vs Appalachian State (2/10/07)

BLOCKED SHOTS

8 8

vs Wofford (2/19/07) at North Carolina (11/30/06)

TURNOVERS

31 25

at North Carolina (11/30/06) at Wofford (01/22/07)

TURNOVERS

35 31

vs UNC Wilmington (11/12/06) vs Elon (1/20/07)

FOULS

26

at Western Carolina (02/24/07)

FOULS

25

vs UNC Wilmington (11/12/06)

OPPONENT-GAME LOWS

UNC GREENSBORO-GAME LOWS POINTS

40 45

at Charlotte (11-20-06) vs Virginia Tech (1/10/07)

POINTS

40 46

vs Elon (1/20/07) vs UNC Wilmington (11/12/06)

FIELD GOALS MADE

15 16

at Charlotte (11-20-06) vs Virginia Tech (1/10/07)

FIELD GOALS MADE

11 17

vs Elon (1/20/07) vs UNC Wilmington (11/12/06)

FIELD GOAL ATTEMPTS

51 52

vs UNC Wilmington (11/12/06) vs High Point (12/18/06)

FIELD GOAL ATTEMPTS

39 48

vs UNC Wilmington (11/12/06) at Davidson (12/04/06)

FIELD GOAL PERCENTAGE FIELD GOAL PERCENTAGE

.242 (16-66) .246 (17-69)

vs Virginia Tech (1/10/07) at North Carolina (11/30/06)

.212 (11-52) .288 (19-66)

vs Elon (1/20/07) vs College of Charleston (2/12/07)

3 PT FIELD GOALS MADE 3 PT FIELD GOALS MADE

0 1

at Charlotte (11-20-06) at Georgia Southern (02/05/07)

0 1

vs Virginia Tech (1/10/07) vs Western Carolina (12/20/06)

3 PT FG ATTEMPTS 3 PT FG ATTEMPTS.

8 10

at Georgia Southern (02/05/07) vs Coastal Carolina (12/16/06)

5 7

vs Virginia Tech (1/10/07) vs Providence (11/25/06)

3 PT FG PERCENTAGE. 3 PT FG PERCENTAGE

.000 ( 0-12) .125 ( 1-8 )

at Charlotte (11-20-06) at Georgia Southern (02/05/07)

.000 ( 0-5 ) .067 ( 1-15)

vs Virginia Tech (1/10/07) vs Western Carolina (12/20/06)

FREE THROWS MADE FREE THROWS MADE

3

at Maryland (11/29/06)

5 6

vs High Point (12/18/06) vs Wofford (2/19/07)

FREE THROW ATTEMPTS

4 5

vs Chattanooga (1/29/07) at Maryland (11/29/06)

FREE THROW ATTEMPTS

8 10

vs High Point (12/18/06) vs Wofford (2/19/07)

FREE THROW PERCENTAGE

.455 ( 5-11) .529 ( 9-17)

at Furman (02/03/07) at North Carolina (11/30/06)

FREE THROW PERCENTAGE

.474 ( 9-19) .571 ( 8-14)

at Elon (02/17/07) vs Coastal Carolina (12/16/06)

REBOUNDS

19 24

at Maryland (11/29/06) vs UNC Wilmington (11/12/06)

REBOUNDS

24 28

at Furman (02/03/07) vs Longwood (11/24/06)

ASSISTS

6 10

at Charlotte (11-20-06) at North Carolina (11/30/06)

ASSISTS

3 6

vs Elon (1/20/07) vs Furman (1/6/2007)

STEALS

5 7

vs Coastal Carolina (12/16/06) vs Liberty (12/30/06)

STEALS.

5

vs Wofford (2/19/07)

BLOCKED SHOTS BLOCKED SHOTS

0 1

at Chattanooga (01/02/07) at Campbell (11/17/06)

0 1

at Georgia Southern (02/05/07) at Campbell (11/17/06)

TURNOVERS

12

vs Coastal Carolina (12/16/06)

TURNOVERS

13

vs Wofford (2/19/07) FOULS

FOULS

12 13

vs Coastal Carolina (12/16/06) vs Longwood (11/24/06)

7 14

vs Chattanooga (1/29/07) vs Western Carolina (12/20/06)

2007-08 UNCG Women’s Basketball Media Guide • 39

2006-07 Statistics

POINTS

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGS

UNC GREENSBORO-GAME HIGHS


Spartans.com â&#x20AC;˘ UNCGSpartanss.

2006-07 Season Review

G1: UNCG 74, UNC Wilmington 46

G2: UNCG 84, Campbell 68

G3: Charlotte 86, UNCG 40

November 12, 2006-Greensboro, NC (Fleming Gym)

November 17, 2006-Buies Creek, NC (Carter Gym)

November 20, 2006-Charlotte, NC (Halton Arena)

GREENSBORO, NC â&#x20AC;&#x201C; Jasmine Byrd scored a career-high 27 points to lead UNC Greensboro to a 74-46 season opening victory over UNC Wilmington at Fleming Gymnasium. %\UGDVHQLRUJXDUGIURP'XPIULHV9$Ă&#x20AC;QLVKHGIRUIURPWKH Ă&#x20AC;HOGLQFOXGLQJIRUIURPEH\RQGWKHWKUHHSRLQWDUF6KHDOVRDGGHGWZR steals and three assists. Junior guard Kristen Boone tallied a double-double, recording a career-high 11 steals and 10 points for the Spartans. The Upper Marlboro, MD native also collected three assists in the victory. Boone, who KDVUHFRUGHGWKHWRSWZRVLQJOHVHDVRQVWHDOWRWDOVLQVFKRROKLVWRU\LQKHUĂ&#x20AC;UVW two seasons, narrowly missed the single-game record. Her 11 steals were one shy of a school record set back in the programâ&#x20AC;&#x2122;s NCAA Division III era by Ruby Smith against Greensboro College on December 9, 1986. It was the most by a Spartan in the schoolâ&#x20AC;&#x2122;s 16 seasons as a Division I member. Freshman Ashley Ling and senior Irene Otamiri contributed eight points each for the Spartans. /RUL 'UDNH ZDV WKH RQO\ 6HDKDZN LQ GRXEOH Ă&#x20AC;JXUHV Ă&#x20AC;QLVKLQJ ZLWK 11 points and seven rebounds. Alex Stewart and Sahsha Taylor each contributed nine points. Steward and Becca Papach pulled down six rebounds for UNCW. The Spartans, the pre-season favorites in the Southern Conference, ZHUHRSHQLQJWKHVHDVRQDWKRPHIRUWKHĂ&#x20AC;UVWWLPHVLQFH81&*KDV opened the season on the road each of the last 12 seasons. The Seahawksâ&#x20AC;&#x2122; only lead came in the opening minutes of play when they led 5-4 at the 16:31 mark. However, UNCG went on a 16-7 run to PDNHLWDWWKHPLQXWHPDUN7KH6SDUWDQVFORVHGRXWWKHĂ&#x20AC;UVW KDOIVKRRWLQJSHUFHQW  IURPWKHĂ&#x20AC;HOGDQGOHGJRLQJLQWR the intermission. $IWHU81&:VFRUHGWKHĂ&#x20AC;UVWWZRSRLQWVRIWKHVHFRQGKDOIWKH6SDUWDQV rattled off the next six points to make it 44-26. UNCW never got any closer WKDQWKHUHVWRIWKHZD\DV81&*VKRWSHUFHQWIURPWKHĂ&#x20AC;HOGLQWKH second half, including 60 percent from three-point range. The Spartansâ&#x20AC;&#x2122; ODUJHVWOHDGRIWKHJDPHZDVSRLQWVZKLFKKDSSHQHGLQWKHĂ&#x20AC;QDO of the game. The Seahawks turned the ball over 35 times, which resulted in 27 steals and 42 points for the Spartans.

%8,(6&5((.1&81&*VFRUHGWKHĂ&#x20AC;UVWHLJKWSRLQWVRIWKHVHFRQGKDOI to complete a 12-0 run, breaking open a tight game and spoiling Campbellâ&#x20AC;&#x2122;s home opener, 84-68, at Carter Gym. Senior guard Jasmine Byrd, a native of Dumfries, VA, recorded her second consecutive 20-point game and the 10th of her career with 24 points to lead UNCG. She had 27 points in the season-opening win over UNC Wilmington last Sunday and now sits at 829 points for her career in her quest to become the 21st player in school history to record 1,000 points. Kristen Boone and Irene Otamiri chipped in 17 and 14 points, respectively. Otamiri, a senior from Lund, Sweden, also had eight rebounds, six DVVLVWVDQGĂ&#x20AC;YHVWHDOVRQWKHQLJKW Campbell was led by Letitia Dicksonâ&#x20AC;&#x2122;s 19 points on 7-of-11 shooting IURP WKH Ă&#x20AC;HOG 0DUOHQD 0XUSK\ FKLSSHG LQ D FDUHHUKLJK  SRLQWV DQG eight rebounds. UNCG, which won for the 11th time in 12 meetings and remained perfect all-time in Campbellâ&#x20AC;&#x2122;s Carter Gym at 5-0, raised its record to 2-0 IRUWKHĂ&#x20AC;UVWWLPHVLQFHWKHVWDUWRIWKHFDPSDLJQ7KH6SDUWDQV ZHQWRQWRĂ&#x20AC;QLVKWKDW\HDUZLWKDUHFRUGRQWKHLUZD\WRWKH6RXWKHUQ Conference title game. 7KH6SDUWDQVVKRWSHUFHQWIURPWKHĂ RRULQFOXGLQJSHUFHQW LQWKHĂ&#x20AC;UVWKDOIDQGKDGDVL]HDEOHDGYDQWDJHLQSRLQWVRIIWXUQRYHUVIRUWKH second straight game. UNCG held a 26-14 advantage in that statistical category, taking advantage of 22 Lady Camel miscues. It was just the sixth loss for Campbell (0-2) in a home-opener in the history of Carter Gym. The Lady Camels are 30-6 all-time in home openers at Carter, but have lost each of the last four seasons. â&#x20AC;&#x153;We came into Campbell expecting a tough game and despite the score we got that,â&#x20AC;? said UNCG coach Lynne Agee, who picked up her 495th win as head coach of the Spartans and the 541st of her career. â&#x20AC;&#x153;They were aggressive and played physically with us. We battled through some foul trouble. Overall, though, I thought we played well on the road. 7KHĂ&#x20AC;UVWKDOIZDVDVHULHVRIUXQVE\ERWKWHDPV81&*ORRNHGOLNH ZDVUHDG\WRUXQDZD\ZLWKLWPLGZD\WKURXJKWKHĂ&#x20AC;UVWKDOI7KH6SDUWDQV UDQRIIQLQHVWUDLJKWSRLQWVPLGZD\WKURXJKWKHĂ&#x20AC;UVWKDOIWRRSHQXSD lead with 9:04 to play. Boone, a junior from Upper Marlboro, MD, got the run started when she hit a pair of free throws, then stole the ball for an easy lay-up in UNCGâ&#x20AC;&#x2122;s half-court pressure. But following a Lady Camel time out, Campbell reeled off seven straight, capped off by Kelly Hufstedlerâ&#x20AC;&#x2122;s jumper, to close back to within two. &DPSEHOO¡VRQO\OHDGRIWKHĂ&#x20AC;UVWKDOIFDPHMXVWLQWRWKHJDPH but the Spartans couldnâ&#x20AC;&#x2122;t quite seem to shake the Lady Camels at the outset. UNCG started to get some separation, however, just before the intermission. A 9-2 run, capped by Jasmine Dixonâ&#x20AC;&#x2122;s conventional three-point play, gave UNCG a 41-33 lead with a little over a minute to go in the half. &DPSEHOOVFRUHGVL[LQDURZEXW81&*DJDLQUHVSRQGHGZLWKWKHĂ&#x20AC;QDO four points of the half, the last two coming on a steal and lay-up by Jasmine Byrd just before time expired to give the Spartans a 45-37 halftime lead. %XW81&*UDQRIIWKHĂ&#x20AC;UVWHLJKWSRLQWVRIWKHVHFRQGKDOIDQGVWUHWFKHG the lead out to as much as 18 in the early minutes of the half. Campbell cut the margin a couple of times after that, but never got it back to single-digits.

CHARLOTTE, NC â&#x20AC;&#x201C; Charlotte got 22 points apiece from Sabrina Gregory and Whitney Hoey and UNCG had an ice cold shooting night as the 49ers raced to an 86-40 win at Halton Arena on Monday night. Charlotte, which has advanced to the NCAA or NIT tournaments in each of the last four years, has now won 13 consecutive home games. Dating back to November 2001, Charlotte is 58-10 at Halton Arena. 81&*VKRWMXVWSHUFHQWIURPWKHĂ RRUIRUWKHJDPHLQFOXGLQJ 0-for-12 from three-point range. Kemena Brooks led UNCG (2-1) with nine points off the bench. Meghan Chamberlain, Ashley Mullins and Jasmine Byrd each had six points. Byrd, a senior from Dumfries, VA, averaged 25.5 points LQWKHĂ&#x20AC;UVWWZRJDPHVWKLVVHDVRQ UNCG junior guard Kristen Boone had four points, which is her lowest point total in the last 49 games going back to her freshman year. Boone did not return to the game after picking up her fourth foul with more than 16 minutes to play. 81&*  VWDUWHGRIIPLVVLQJLWVĂ&#x20AC;UVWVL[VKRWVIURPWKHĂ&#x20AC;HOG7KH 6SDUWDQVUHFRUGHGWKHLUĂ&#x20AC;UVWĂ&#x20AC;HOGJRDODWWKHPDUNZKHQ%RRQHGLVKHG DSDVVWR&KDPEHUODLQZKRSXWLWLQIRUWKH6SDUWDQV¡Ă&#x20AC;UVWEXFNHWRIWKHJDPH UNCG rattled off two more buckets in the next 40 seconds to take an 8-6 lead and looked like it was ready to settle in. However, that is the last time the Spartans would be on top. The 49ers went on a 26-6 run to take a 34-14 lead. Sabrina Gregory scored 14 of her Ă&#x20AC;UVWKDOISRLQWVLQWKHUXQ $IWHUVKRRWLQJSHUFHQWLQWKHĂ&#x20AC;UVWKDOIRQ)ULGD\QLJKWLQWKHLUZLQ over Campbell, the Spartans shot a mere 24.1 percent and 7-29 from the Ă&#x20AC;HOGLQWKHĂ&#x20AC;UVWPLQXWHVRQ0RQGD\81&*¡VĂ&#x20AC;UVWKDOIHIIRUWVZHUHDOVR KDPSHUHGE\IRXOWURXEOH%RRQHSLFNHGXSWKUHHIRXOVLQWKHĂ&#x20AC;UVWVWDQ]DZKLOH Irene Otamiri, KaLeah Latham and Kemena Brooks each picked up two. The 49ers then opened up the second half on a 15-0 run, in the process of which Boone picked up her fourth foul, and UNCG never threatened after that. â&#x20AC;&#x153;It is obvious that our team didnâ&#x20AC;&#x2122;t show up to play,â&#x20AC;? stated head coach Lynne Agee. â&#x20AC;&#x153;We werenâ&#x20AC;&#x2122;t prepared for the intensity of the game and Iâ&#x20AC;&#x2122;m very disappointed with how we turned out.â&#x20AC;? UNCG has now lost seven straight on Charlotteâ&#x20AC;&#x2122;s home court. The last time the Spartans beat the 49ers in Charlotte was way back on January 28, 1978. Charlotte leads the all-time series, 11-2.

VISITORS: UNC Wilmington 0-1 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta 05 Stewart, Alex f 3-5 0-0 3-4 34 Taylor, Sahsha f 4-6 0-0 1-3 01 Smith, Shade g 0-3 0-1 0-0 03 Lawrence, Denise g 0-0 0-0 0-0 21 Drake, Lori g 4-7 1-3 2-2 10 Papach, Becca 3-5 0-1 1-3 15 Luksyte, Greta 2-8 1-3 0-0 22 Fernald, Stephanie 0-3 0-0 0-0 33 Sawhook, Casey 1-1 1-1 0-0 35 Sawhook, Casey 0-1 0-0 2-2 TEAM Totals 17-39 3-9 9-14 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 8-16 50.0% 1st Half: 2-4 50.0% 1st Half: 6-8 75.0%

rebounds o-d-t pf 1-5-6 5 2-3-5 4 0-0-0 5 0-3-3 2 1-6-7 4 1-5-6 2 0-0-0 2 0-1-1 1 1-0-1 0 0-0-0 0 2-2-4 8-25-3325

tp 9 9 0 0 11 7 5 0 3 2

a 0 1 2 2 0 1 2 2 2 0

to bl 0 0 6 2 7 0 4 0 3 0 2 0 2 0 5 0 6 0 0 0

s 1 0 0 0 1 0 2 2 1 0

m 26 27 15 20 31 25 28 12 11 5

46123 5 27200

2nd Half: 9-23 39.1% 2nd Half: 1-5 20.0% 2nd Half: 3-6 50.0%

Game: 43.6% Game: 33.3% Game: 64.3%

HOME TEAM: UNCG 1-0 tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t pf 04 Otamiri, Irene f 2-8 1-3 3-4 0-6-6 1 33 Latham, Kaleah f 2-8 1-1 2-3 3-1-4 1 44 Chamberlain, Meghanc 0-0 0-0 0-0 0-0-0 4 21 Boone, Kristen g 3-5 0-0 4-6 1-1-2 4 24 Byrd, Jasmine g 11-14 4-5 1-1 1-1-2 1 03 Dixon, Jasmine 0-2 0-0 2-4 1-3-4 2 12 Hyson, Lakiah 1-1 0-0 0-0 0-0-0 0 22 Brooks, Kemena 0-1 0-0 0-0 0-0-0 0 23 Ling, Ashley 3-3 0-0 2-2 0-0-0 0 30 Grimsley, Gini 1-2 1-2 0-0 0-1-1 1 31 Mullins, Ashley 0-0 0-0 2-2 0-2-2 1 40 Frazier, Brittany 1-5 0-0 0-0 0-1-1 3 41 Girstautaite, Agne 1-2 0-0 1-4 0-0-0 0 TEAM 1-1-2 Totals 25-51 7-1117-26 7-17-2418 74 TOTAL FG% 3-Pt. FG% F Throw %

tp 8 7 0 10 27 2 2 0 8 3 2 2 3

a 0 5 1 3 3 0 0 0 2 0 1 0 0

to bl s m 0 0 4 23 3 2 5 27 11 0 9 3 0 11 25 1 0 2 31 2 0 1 20 00 1 2 10 0 5 0 0 3 15 1 0 0 15 01 0 4 3 0 0 19 01 0 5

15 15 5 27

1st Half: 12-23 52.2% 2nd Half: 13-28 46.4% 1st Half: 4-6 66.7% 2nd Half: 3-5 60.0% 1st Half: 10-13 76.9% 2nd Half: 7-13 53.8%

VISITORS: UNC Greensboro 2-0 tot-fg ## Player fg-fga min 04 Otamiri, Irene f 7-12 33 Latham, Kaleah f 2-3 44 Chamberlain, Meghanc 3-7 21 Boone, Kristen g 5-7 24 Byrd, Jasmine g 8-16 03 Dixon, Jasmine 1-1 22 Brooks, Kemena 1-5 23 Ling, Ashley 0-1 30 Grimsley, Gini 1-2 31 Mullins, Ashley 0-0 40 Frazier, Brittany 2-5 41 Girstautaite, Agne 0-0 TEAM Totals 30-59 2017118200

3-pt rebounds fg-fga ft-fta o-d-t pf tp a to bl s 0-1 1-2 0-0 0-1 2-7 0-0 1-2 0-0 0-0 0-0 0-0 0-0

0-1 0-1 2-4 7-8 6-6 3-3 1-2 0-0 0-0 0-0 1-2 0-0

4-4-8 3 14 0-3-3 4 5 2-0-2 2 8 0-2-2 3 17 3-4-7 3 24 1-0-1 2 5 0-3-3 1 4 0-1-1 2 0 0-0-0 3 2 0-0-0 0 0 2-3-5 2 5 0-0-0 1 0 3-2-5 4-13 20-27 15-22-3726

610 040 201 420 210 030 000 320 010 000 330 000

5 2 0 5 3 1 1 1 0 0 0 0

84

200

Game: 49.0% Game: 63.6% Game: 65.4%

2IĂ&#x20AC;FLDOV'DQ2XWODZ7LPRWK\%U\DQW.DUHQ*UXFD Technical fouls: UNC Wilmington-None. UNCG-None. Attendance: 315 Score by Periods 1st 2nd Total UNC Wilmington 24 22 46 UNCG 38 36 74

TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 17-28 60.7% 1st Half: 3-9 33.3% 1st Half: 8-9 88.9%

2nd Half: 13-31 41.9% Game: 50.8% 2nd Half: 1-4 25.0% Game: 30.8% 2nd Half: 12-18 66.7% Game: 74.1%

HOME TEAM: Campbell 0-2 tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t 30 Rich, Maggie f 0-4 0-3 0-0 0-1-1 50 Murphy, Marlena f 4-7 0-0 6-8 4-4-8 41 Rieley, Adrienne c 4-8 0-0 4-5 5-2-7 10 Dickson, Letitia g 7-11 3-4 2-2 0-2-2 14 Blackwell, Octavia g 2-7 0-0 3-4 0-2-2 04 Graham, Kristin 1-1 0-0 0-0 0-1-1 11 Oliver, Taylor 1-6 0-3 6-8 0-1-1 20 Hufstedler, Kelly 1-2 0-0 0-0 1-1-2 21 Smithberger, Lindsay 0-1 0-0 0-0 2-0-2 40 Bell, Gara 2-3 0-0 0-1 0-4-4 TEAM 1-1-2 Totals 22-50 3-10 21-28 12-19-31 23 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 13-27 48.1% 1st Half: 3-7 42.9% 1st Half: 8-10 80.0%

pf 0 3 3 5 4 0 4 1 1 2

a 1 1 0 2 6 1 1 0 3 1

to 1 1 1 7 3 2 3 0 2 2

bl s 00 02 03 00 00 00 00 0 0 00 12

m 16 26 34 28 30 4 27 7 14 14

68 16 2217200

2nd Half: 9-23 39.1% Game: 44.0% 2nd Half: 0-3 0.0% Game: 30.0% 2nd Half: 13-18 72.2% Game: 75.0%

2IĂ&#x20AC;FLDOV*DUULVRQ&RRNH0DUJR5LGGOH5LFKDUG)UDQNRII Technical fouls: UNC Greensboro-None. Campbell-None. Attendance: 757 Score by Periods 1st 2nd Total UNC Greensboro 45 39 84 Campbell 37 31 68

40 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

tp 0 14 12 19 7 2 8 2 0 4

31 17 21 26 23 14 21 13 4 2 27 1

VISITORS: UNC Greensboro 2-1 tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t pf tp a to bl s min 04 Otamiri, Irene f 0-8 0-3 0-0 2-1-3 3 0 1 0 0 1 15 33 Latham, Kaleah f 2-5 0-1 0-2 0-1-1 3 4 0 2 0 3 19 44 Chamberlain, Meghanc 2-5 0-0 2-2 2-1-3 1 6 0 1 1 0 19 21 Boone, Kristen g 2-3 0-0 0-1 0-2-2 4 4 3 3 0 1 17 24 Byrd, Jasmine g 2-13 0-6 2-2 1-3-4 1 6 0 3 0 0 23 03 Dixon, Jasmine 0-2 0-0 2-4 2-1-3 2 2 0 3 0 2 14 12 Hyson, Lakiah 0-1 0-0 0-0 0-1-1 0 0 0 0 0 1 11 22 Brooks, Kemena 4-6 0-1 1-2 0-0-0 3 9 1 1 0 1 17 23 Ling, Ashley 0-1 0-0 0-0 0-1-1 1 0 1 2 0 2 17 30 Grimsley, Gini 1-4 0-1 0-0 0-1-1 0 2 0 2 0 0 16 31 Mullins, Ashley 2-4 0-0 2-2 2-0-2 0 6 0 0 0 0 5 40 Frazier, Brittany 0-5 0-0 0-0 3-0-3 0 0 0 1 0 0 15 41 Girstautaite, Agne 0-2 0-0 1-2 1-1-2 2 1 0 1 0 0 12 TEAM 2-1-3 2 Totals 15-59 0-12 10-17 15-14-29 20 40 6 21 1 11 200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 7-29 24.1% 1st Half: 0-7 0.0% 1st Half: 6-9 66.7%

2nd Half: 8-30 26.7% 2nd Half: 0-5 0.0% 2nd Half: 4-8 50.0%

HOME TEAM: Charlotte 3-1 tot-fg 3-pt fg-fga fg-fga ft-fta

## Player min 03 Smith,Tameka f 44 Gregory,Sabrina f 55 Burgin,Danielle c 11 Ray,Traci g 22 Jones,Aysha g 10 Floyd,Erin 15 Hoey,Whitney 20 Spriggs,Ashley 33 Williams,Courtney 45 Cade,Bj TEAM Totals 200 TOTAL FG% 3-Pt. FG% F Throw %

1-2 9-12 5-6 2-5 3 -8 0 -1 8-12 3 -4 2-5 1-2

0-0 1-3 0-0 2-4 1-3 0-1 2-5 0-0 1-1 0-0

rebounds o- d-t pf tp

1-1-2 1 2 3-1-4 3 22 0-8-8 1 10 0-0-0 3 6 0-4-4 0 9 2-3-5 3 0 0-3-3 1 22 0-5-5 2 6 0-0-0 1 5 1-3-4 3 4 4-6-10 34-57 7-17 11-15 11-34-451886

1st Half: 16-29 55.2% 1st Half: 2-6 33.3% 1st Half: 9-11 81.8%

0-0 3-4 0-0 0-0 2-4 0-0 4-4 0-0 0-0 2-3

Game: 25.4% Game: 0.0% Game: 58.8%

a to bl s 0 3 1 2 4 0 7 0 1 2

2 0 2 1 7 2 5 2 1 1

0 2 1 0 0 1 0 0 0 0

20 23 4

1 3 1 0 1 0 2 1 1 0 10

2nd Half: 18-28 64.3% Game: 59.6% 2nd Half: 5-11 45.5% Game: 41.2% 2nd Half: 2-4 50.0% Game: 73.3%

2IĂ&#x20AC;FLDOV$QJHOLFD6XIIUHQ%RQQLH3HWWXV.DUHQ3UHDWR Technical fouls: UNC Greensboro-Boone, Kristen. Charlotte-None. Attendance: 646

4 27 23 19 31 17 29 14 17 19


G6: North Carolina 103, UNCG 55 November 28, 2006-Durham, NC (Carmichael Aud.)

GREENSBORO, NC â&#x20AC;&#x201C; UNC Greensboro downed Longwood, 81-50, in the opening game of the UNCG Thanksgiving Tournament at Fleming Gym. 6HQLRU -DVPLQH %\UG RQFH DJDLQ OHG WKH 6SDUWDQV   Ă&#x20AC;QLVKLQJ ZLWKSRLQWV7KH'XPIULHV9$QDWLYHZHQWIURPWKHĂ&#x20AC;HOGLQFOXGLQJ 4-6 from beyond the arc. Sophomore Gini Grimsley tallied 13 points, while freshman Agne Girstautaite had eight points and grabbed a team-high seven rebounds. UNCG had 11 players hit the scoring column, while all 13 Spartans saw playing time. Of the Spartans 81 points, 37 came from the bench. â&#x20AC;&#x153;We went to the bench and really played our depth and it showed. All around, it was a great team effort for us,â&#x20AC;? said head coach Lynne Agee. /RQJZRRG  ZDVOHGE\$ELJDLO)UHHVHDQG.HLYD6PDOOZKRĂ&#x20AC;QLVKHG ZLWKDQGSRLQWVUHVSHFWLYHO\6PDOODOVRĂ&#x20AC;QLVKHGZLWKDJDPHKLJK eight rebounds for the Lancers. 7KH6SDUWDQVVHWWKHWRQHHDUO\E\RSHQLQJXSWKHĂ&#x20AC;UVWKDOIRQD run, led by Byrd, who had nine points in the run. UNCG continued to dominate WKHĂ&#x20AC;UVWKDOIRQO\DOORZLQJWKH/DQFHUVWRVKRRWSHUFHQWIURPWKHĂ&#x20AC;HOG and score 18 total points. The Spartans closed out the half shooting 54.5 SHUFHQWIURPWKHĂ&#x20AC;HOGDQGOHGJRLQJLQWRWKHEUHDN 81&*VFRUHGWKHĂ&#x20AC;UVWVL[SRLQWVRIWKHVHFRQGKDOIWRPDNHLW after a pair of Byrd free throws. The Spartans largest lead of the game was  SRLQWV ZKLFK KDSSHQHG LQ WKH Ă&#x20AC;QDO VL[ PLQXWHV DIWHU D *LUVWDXWDLWH free throw. After only shooting 24 percent in their 86-40 loss to Charlotte on 0RQGD\WKH6SDUWDQVFDPHRXWLQIXOOIRUFHDQGĂ&#x20AC;QLVKHGWKHDIWHUQRRQE\ shooting 52 percent. â&#x20AC;&#x153;We came out ready to play and opened the game in a hurry early,â&#x20AC;? said Agee. â&#x20AC;&#x153;We maintained the intensity right away and played great defense.â&#x20AC;? The 22 Lancer turnovers resulted in 15 steals and 24 points for the Spartans.

GREENSBORO, NC â&#x20AC;&#x201C; Kristen Booneâ&#x20AC;&#x2122;s 22-footer from the left wing as the shot clock expired sealed the win as UNC Greensboro handed Providence LWVĂ&#x20AC;UVWORVVRIWKHVHDVRQLQWKHFKDPSLRQVKLSJDPHRIWKH81&* Thanksgiving Tournament. Boone, a junior from Upper Marlboro, MD, hit the slightly off-balance shot with just 18 seconds to play to give the Spartans a four-point lead. It was MXVWKHUVHFRQGĂ&#x20AC;HOGJRDORIWKHDIWHUQRRQERWKRIZKLFKLQWKHĂ&#x20AC;QDO Jasmine Byrd led the Spartans (4-1) with 23 points, the fourth time she KDVWRSSHGWKHSRLQWPDUNLQĂ&#x20AC;YHJDPHVWKLVVHDVRQ6KHNQRFNHGGRZQ 6-of-12 from three-point range. The six three-pointers were one shy of a school record. Byrd was also named tournament Most Valuable Player. â&#x20AC;&#x153;I feel good,â&#x20AC;? said Byrd after the game. â&#x20AC;&#x153;I have a different mindset this year and Iâ&#x20AC;&#x2122;ve learned to keep my head and stay positive. My teammates have really helped me keep my composure and put up big shots.â&#x20AC;? .D/HDK/DWKDPĂ&#x20AC;QLVKHGZLWKSRLQWVIRUWKH6SDUWDQVDQGSXOOHG down a team-high 10 boards. Senior Irene Otamiri and junior Meghan Chamberlain had nine points each. The win marked the second straight season UNCG has beaten a Big East opponent. Last year, UNCG topped West Virginia at home for the SURJUDP¡VĂ&#x20AC;UVWHYHUZLQRYHUD%LJ(DVWVFKRRO,WZDVDOVR81&*¡VHLJKWK straight home win. The last time the Spartans won their own tournament was in the 200203 season after defeating Loyola and East Carolina. â&#x20AC;&#x153;It feels great to win our own tournament,â&#x20AC;? stated head coach Lynne Agee, who has 497 career wins at UNCG. â&#x20AC;&#x153;We played extremely well and I am very pleased to keep the trophy here at home.â&#x20AC;? Chelsea Marandola had a double-double for Providence (6-1) with a game-high 28 points to go with 10 rebounds. 7KH6SDUWDQVMXPSHGRXWWRDQHDUO\OHDGLQWKHĂ&#x20AC;UVWĂ&#x20AC;YHPLQXWHV However, the Friars made a run of their own and brought the margin as close DVWZRZLWKĂ&#x20AC;YHPLQXWHVOHIW7KH6SDUWDQVWKHQVFRUHGQLQHXQDQswered points, including Byrdâ&#x20AC;&#x2122;s third three-pointer in the half, and went into intermission with a 36-26 lead. 3URYLGHQFHJRWLWVĂ&#x20AC;UVWOHDGRIWKHJDPHZLWKOHIWWRSOD\$JD /RUHQFFRQYHUWHGDFRQYHQWLRQDOWKUHHSRLQWSOD\IRUKHUĂ&#x20AC;UVWSRLQWVRIWKHGD\ and gave the Friars a 49-47 lead. At 5:20, Otamiri tied the game up at 61 after FRQYHUWLQJDWKUHHSRLQWSOD\7KH6SDUWDQVJUDEEHGĂ&#x20AC;QDOOHDGZLWKWR play when Otamiri put up another big shot for the 69-68 advantage. 81&*Ă&#x20AC;QLVKHGZLWKWRWDOUHERXQGVLQFOXGLQJRIIHQVLYHERDUGV The Spartans also shot 71.4 percent (10-14) from the free-throw line and are now 21-3 when scoring more than 70 points over the last three seasons. ´:HWRRNEDFNWKHPRPHQWLQWKHODVWĂ&#x20AC;YHPLQXWHVDIWHUORVLQJWKHOHDG in the beginning of the second half,â&#x20AC;? said Agee. â&#x20AC;&#x153;The focus was put back on defense and we picked it up. Our rebounding was outstanding and we hit the free-throws when we needed to.

&+$3(/+,//1&²7KHVHFRQGUDQNHG1RUWK&DUROLQD7DU+HHOVKDGĂ&#x20AC;YH SOD\HUVĂ&#x20AC;QLVKLQGRXEOHĂ&#x20AC;JXUHVLQWKHZLQRYHU81&*DWWKHKLVWRULF Carmichael Auditorium. North Carolina is ranked No. 2 in both national polls, matching the highest-ranked opponent that the Spartans have ever faced. Entering the game, the Tar Heels had the second best defense in the nation, allowing RQO\SRLQWV7KHLUPDUJLQRIYLFWRU\LVSRLQWVWKURXJKWKHĂ&#x20AC;UVW seven games of the season. The matchup pitted two of the most successful womenâ&#x20AC;&#x2122;s basketball coaches against each other. UNCG head coach Lynne Agee is 16th all-time with 542 wins, while North Carolina head coach Sylvia Hatchell is fourth with 724 victories -DVPLQH%\UGWKH6RXWKHUQ&RQIHUHQFH¡VOHDGLQJVFRUHUĂ&#x20AC;QLVKHGZLWK SRLQWVIRU81&*7KH6R&RQ3OD\HURIWKH:HHNKDGDOOIRXUĂ&#x20AC;HOGJRDOV come from three-point range. Junior Kristen Boone had eight points and four steals for the Spartans. Camille Little led the Tar Heels with 16 points, while LaToya Pringle Ă&#x20AC;QLVKHGZLWKSRLQWVDQGDJDPHKLJKQLQHUHERXQGV-HVVLFD%UHODQG KDGSRLQWVDQG+HDWKHU&OD\WRUDQG&KULVWLQD'HZLWWĂ&#x20AC;QLVKHGZLWK and 10 points, respectively. The Tar Heels (7-0) opened up the game on 21-5 run, led by Little, who had nine points in the run. North Carolina continued to expand its lead and ZHQWLQWRWKHEUHDNXS7KH6SDUWDQVVKRWSHUFHQWIURPWKHĂ&#x20AC;HOG ZKLOHWKH7DU+HHOVĂ&#x20AC;QLVKHGWKHKDOIVKRRWLQJSHUFHQW The Spartans (4-2) outscored the Tar Heels 15-12 in the opening 10 minutes of the second half to make it 69-29 but were unable to get any closer. North Carolina outrebounded UNCG 57-34 and shot 50.6 percent from WKHĂ&#x20AC;HOG'HVSLWHDOOWKDWWKH6SDUWDQVDUHWKHĂ&#x20AC;UVWWHDPWRVFRUHPRUHWKDQ 40 points in Chapel Hill this season. â&#x20AC;&#x153;We missed a handful of easy layups in the beginning and had we made those early shots, we could have been ok,â&#x20AC;? stated Agee. â&#x20AC;&#x153;We came out more relaxed in the second half and stuck together and played more as a team.â&#x20AC;? ,WZDVWKHĂ&#x20AC;UVWWLPHVLQFH'HFHPEHUWKDW81&*KDGVXUrendered 100 points, a span of 346 games. The 55-point margin was also the largest margin of defeat in school history.

VISITORS: Longwood 3-2 tot-fg 3-pt ## Player fg-fga fg-fga 04 SIMS,AMBER f 2-3 0-0 03 SMALL,KEIVA g 4-9 2-2 12 FERNANDES,BECKYg 1-5 0-0 21 HOLLMAN,ASHLEIGHg 1-9 0-3 23 FREESE,ABIGAIL g 5-13 3-9 00 WILLIAMS,ODESSA 0-1 0-0 15 SMITH,CASSANDRA 0-0 0-0 20 BLEVINS,CLAIRE 2-2 0-0 24 DYER,COURTNEY 1-5 0-3 30 STEG,ANNA 2-6 0-0 31 MASCHERIN,LEIGH 0-0 0-0 TEAM Totals 18-53 5 -17 110200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 6-23 26.1% 1st Half: 2-7 28.6% 1st Half: 4-7 57.1%

rebounds ft-fta o-d-t 0-0 0-3-3 0-1 5-3-8 4-4 0-4-4 1-2 1-1-2 1-2 0-1-1 0-0 0-1-1 0-0 0-0-0 0-0 0-1-1 0-0 0-1-1 3-4 2-3-5 0-0 0-2-2

pf 3 4 4 0 0 0 0 2 1 2 0

tp 4 10 6 3 14 0 0 4 2 7 0

a 0 2 5 2 2 0 0 0 0 1 0

to bl 30 30 60 40 30 00 01 10 00 10 10

s min 2 19 2 24 3 25 0 34 1 37 0 3 0 3 1 12 1 13 0 23 0 7

9-13 8-20-2816 50 12 22

2nd Half: 12-30 40.0% Game: 34.0% 2nd Half: 3-10 30.0% Game: 29.4% 2nd Half: 5-6 83.3% Game: 69.2%

HOME TEAM: UNCG 3-1 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta 04 Otamiri, Irene f 1-3 1-1 2-2 33 Latham, Kaleah f 2-7 1-1 0-0 44 Chamberlain, Meghanc 3-4 0-0 0-0 21 Boone, Kristen g 3-3 0-0 0-0 24 Byrd, Jasmine g 8-11 4-6 2-2 03 Dixon, Jasmine 0-2 0-0 0-0 12 Hyson, Lakiah 2-3 0-1 0-0 22 Brooks, Kemena 1-4 0-1 0-0 23 Ling, Ashley 0-0 0-0 0-0 30 Grimsley, Gini 5-9 3-5 0-0 31 Mullins, Ashley 2-3 0-1 0-0 40 Frazier, Brittany 2-4 0-0 2-4 41 Girstautaite, Agne 3-8 0-0 2-3 TEAM 1-1-2 Totals 32-619-16 8-11 200 TOTAL FG% 3-Pt. FG% F Throw %

rebounds o-d-t pf 0-3-3 0 2-3-5 0 1-2-3 0 0-1-1 4 0-3-3 0 1-2-3 2 0-1-1 1 0-0-0 0 0-4-4 1 0-2-2 0 2-2-4 2 0-3-3 0 4-3-7 3

tp 5 5 6 6 22 0 4 2 0 13 4 6 8

a 4 1 0 5 2 0 2 0 4 2 0 2 0

to 2 1 0 2 0 2 2 1 1 4 1 1 1

bl 0 0 1 0 0 0 1 0 0 0 0 0 1

11-30-411381 22 18 3

s 3 3 0 2 3 1 2 0 1 0 0 0 0

15

1st Half: 18-33 54.5% 2nd Half: 14-28 50.0% Game: 52.5% 1st Half: 8-9 88.9% 2nd Half: 1-7 14.3% Game: 56.3% 1st Half: 2-2 100% 2nd Half: 6-9 66.7% Game: 72.7%

2IĂ&#x20AC;FLDOV%LOO.HDWRQ0DUN+DUGFDVWOH7RP%DOGLQHOOL Technical fouls: Longwood-None. UNCG-None. Attendance: 263

min 14 18 14 17 20 11 15 10 19 17 8 20 17

VISITORS: Providence 6-1 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta 11 LORENC, Aga f 2-3 0-0 1-1 24 SNYDER, Shauna f 3-12 0-0 0-0 10 MARANDOLA, Chelsea g 10-13 2-2 6-6 20 HOLMES, Kendria g 1-4 0-0 0-0 21 BOVE, Catherine g 7-13 1-3 3-3 02 BAUGH, Kristina 1-1 1-1 0-0 12 DORSEY, Brittany 0-1 0-1 0-0 33 COURNOYER, Emily 2-5 0-0 1-2 50 HOWARD, Danielle 0-3 0-0 1-4 TEAM Totals.............. 26-55 4-7 12-16 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 10-25 40.0% 1st Half: 3-5 60.0% 1st Half: 3-4 75.0%

HOME TEAM: UNCG 4-1 tot-fg ## Player fg-fga 04 Otamiri, Irene f 4-7 33 Latham, Kaleah f 6-12 44 Chamberlain, Meghanc 3-11 21 Boone, Kristen g 2-8 24 Byrd, Jasmine g 7-17 03 Dixon, Jasmine 3-5 12 Hyson, Lakiah 0-0 23 Ling, Ashley 0-0 30 Grimsley, Gini 0-1 40 Frazier, Brittany 2-4 TEAM Totals 27-65 TOTAL FG% 3-Pt. FG% F Throw %

tp a 5 0 6 0 28 3 2 2 18 2 3 4 0 0 5 0 1 0

to 0 0 3 3 3 1 1 2 1

bl 0 0 2 0 0 0 0 2 3

s min 0 10 0 40 1 37 1 31 3 38 1 12 0 2 0 17 0 12

68 11 14 7

6200

2nd Half: 16-30 53.3% Game: 47.3% 2nd Half: 1-2 50.0% Game: 57.1% 2nd Half: 9-12 75.0% Game: 75.0%

3-pt fg-fga 0-0 0-1 0-0 1-1 6-12 1-1 0-0 0-0 0-1 0-0 8-16

1st Half: 14-33 42.4% 1st Half: 4-8 50.0% 1st Half: 4-6 66.7%

rebounds o-d-t pf 2-0-2 3 2-2-4 3 2-8-10 4 0-1-1 1 1-3-4 1 0 -1-1 0 0-0-0 0 0 -1-1 2 1-3-4 4 1-1-2 9-20-29 18

rebounds o-d-t pf tp a to bl s min 2-1-3 2 9 4 4 0 3 28 5-5-10 4 15 1 2 0 1 26 4-5-9 2 9 1 1 0 0 25 3-1-4 2 5 5 4 0 2 35 2-4-6 2 23 0 1 0 1 35 2-3-5 2 7 2 2 1 0 15 0-0-0 1 0 000 0 3 0-1-1 0 0 000 0 5 0-1-1 1 0 0 0 0 2 14 0-2-2 1 4 1 1 0 0 14 0-2-2 10-14 20-23-43 17 72 14 1519200

ft-fta 1-1 3-5 3-4 0-0 3-4 0-0 0-0 0-0 0-0 0-0

2nd Half: 13-32 40.6% Game: 41.5% 2nd Half: 4-8 50.0% Game: 50.0% 2nd Half: 6-8 75.0% Game: 71.4%

VISITORS: UNC Greensboro 4-2 tot-fg ## Player fg-fga 04 Otamiri, Irene f 2-7 33 Latham, Kaleah f 0-2 44 Chamberlain, Meghanc 2-5 21 Boone, Kristen g 2-9 24 Byrd, Jasmine g 4-11 03 Dixon, Jasmine 2-6 12 Hyson, Lakiah 0-0 22 Brooks, Kemena 2-8 23 Ling, Ashley 0-0 30 Grimsley, Gini 1-6 31 Mullins, Ashley 0-3 40 Frazier, Brittany 2-11 41 Girstautaite, Agne 0-1 TEAM Totals 17-69 TOTAL FG% 3-Pt. FG% F Throw %

3-pt fg-fga 0-1 0-0 0-0 0-2 4-9 0-0 0-0 1-4 0-0 0-2 0-1 0-0 0-0

rebounds ft-fta o-d-t pf 0-0 1-1-2 1 0-0 2-0-2 4 0-0 0-2-2 1 4-6 1-1-2 4 4-5 1-2-3 3 0-0 2-1-3 3 0-0 0-1-1 0 1-2 1-0-1 3 0-0 0-0-0 0 0-0 1-3-4 1 0-4 1-1-2 0 0-0 4-2-6 0 0-0 1-1-2 2 2-2-4 5-19 9-17 17-17-34 22

1st Half: 6-30 20.0% 1st Half: 0-6 0.0% 1st Half: 3-5 60.0%

TOTAL FG% 3-Pt. FG% F Throw %

39-77 6-18

1st Half: 22-42 52.4% 1st Half: 3-11 27.3% 1st Half: 10-13 76.9%

a 0 1 2 1 1 1 1 1 0 1 0 1 0

to bl s min 3 0 3 15 4 0 2 12 0 0 0 15 6 0 4 28 4 0 0 24 4 0 0 16 0 0 2 4 2 0 1 16 3 0 0 8 1 1 1 20 2 0 0 10 0 0 1 22 1 0 0 10 1 48 10 31 114200

2nd Half: 11-39 28.2% Game: 24.6% 2nd Half: 5-13 38.5% Game: 26.3% 2nd Half: 6-12 50.0% Game: 52.9%

HOME TEAM: North Carolina 7-0 tot-fg 3-pt fg-fga fg-fga f 1-3 0-0 f 6-11 2-3 f 6-7 0-0 g 2-7 1-3 g 2-6 0-3 3-6 0-0 2-7 0-1 4-8 3-6 4-5 0-1 3-6 0-0 0-1 0-0 6-10 0-1

## Player 02 Larkins, Erlana 20 Little, Camille 30 Pringle, LaToya 12 Latta, Ivory 32 McCants, Rashanda 03 Bursey, Trinity 11 Miller, Alex 14 Claytor, Heather 15 Dewitt, Christina 21 McFarland, Iman 24 Austin, Meghan 51 Breland, Jessica TEAM Totals

tp 4 0 4 8 16 4 0 6 0 2 0 4 0

rebounds ft-fta o-d-t pf tp 1-2 4-4-8 0 3 2-2 1-4-5 2 16 3-3 3-6-9 2 15 4-4 0-3-3 2 9 2-2 2-3-5 0 6 2-2 0-1-1 2 8 3-3 0-2-2 3 7 0-0 1-1-2 1 11 2-4 2-2-4 0 10 0-0 2-6-8 3 6 0-0 0-1-1 1 0 0-0 2-3-5 3 12 1-3-4 19-2218-39-5719103

a to bl 210 630 033 620 010 210 350 000 500 102 220 053

s min 4 13 2 22 1 15 2 20 3 15 0 12 1 23 2 19 1 16 2 16 2 11 2 18

2723822200

2nd Half: 17-35 48.6% Game: 50.6% 2nd Half: 3-7 42.9% Game: 33.3% 2nd Half: 9-9 100% Game: 86.4%

2IĂ&#x20AC;FLDOV(ULF%UHZWRQ.LP:DWW.DUHQ3UHDWR Technical fouls: UNC Greensboro-None. North Carolina-None. Attendance: 2842 Score by Periods 1st 2nd Total UNC Greensboro 15 33 48 North Carolina 57 46 103

2IĂ&#x20AC;FLDOV%UDG0F0LOOLRQ7RP%DOGLQHOOL7LP%U\DQW Technical fouls: Providence-None. UNCG-None. Attendance: 244 Score by Periods 1st 2nd Total Providence 26 42 68 UNCG 36 36 72

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 41

2006-07 Season Review

G5: UNCG 72, Providence 68 November 24, 2006-Greensboro, NC (Fleming Gym)

UNCGSpartans.com â&#x20AC;˘ UNCGSpa

G4: UNCG 81, Longwood 50 November 23, 2006-Greensboro, NC (Fleming Gym)


Spartans.com â&#x20AC;˘ UNCGSpartanss.

2006-07 Season Review

G7: Davidson 73, UNCG 59

G8: UNCG 64, Coastal Carolina 54

G9: UNCG 63, High Point 53

December 4, 2006-Davidson, NC (Belk Arena)

December 16, 2006-Greensboro, NC (Fleming Gym)

December 18, 2006-Greensboro, NC (Fleming Gym)

'$9,'6211&²'DYLGVRQĂ&#x20AC;QLVKHGZLWKIRXUSOD\HUVLQGRXEOHGLJLWV to top UNC Greensboro, 73-59, in Southern Conference womenâ&#x20AC;&#x2122;s basketball action at Belk Arena. UNCG (4-3, 0-1 SoCon) was led by seniors Jasmine Byrd and Irene 2WDPLULZKRHDFKWDOOLHGSRLQWV6HQLRU.D/HDK/DWKDPĂ&#x20AC;QLVKHGZLWK nine points and a game-high 10 rebounds, while junior Jasmine Dixon also scored nine points for the Spartans. Tia Washington and Brynn Kelly led Davidson (7-2, 1-0 SoCon) with 12 SRLQWVDSLHFH0HUFHGHV5RELQVRQĂ&#x20AC;QLVKHGZLWKSRLQWVDQG$OH[7KRPSVRQ chipped in 10 for the Wildcats. 7KHJDPHPDUNHGWKHĂ&#x20AC;UVWWLPHWKH6SDUWDQVRSHQHGXSFRQIHUHQFH SOD\RQWKHURDGVLQFHWKHVHDVRQDQGWKHĂ&#x20AC;IWKVWUDLJKW\HDU81&* dropped its SoCon opener. Last year, UNCG began conference play at home against Davidson. The Wildcats came away with a 69-57 victory. UNCG opened up the second stanza on a 7-2 run for the 42-34 advantage. The Wildcats made a run of their own, however, scoring nine unanswered points and grabbing the lead, 43-42. Davidson expanded its lead to 12 at the 4:09 minute mark and the Spartans never got any closer than six points the rest of the way. ,QWKHĂ&#x20AC;UVWKDOIWKH6SDUWDQVIRXQGWKHPVHOYHVGRZQHDUO\WUDLOLQJ However, Otamiriâ&#x20AC;&#x2122;s jumper at the 16:08 minute mark sparked a Spartan 12-2 run that gave UNCG a 16-11 advantage. The Wildcats took a brief 27-26 lead on a Robinson layup with 3:18 left, before Byrd gave the Spartans a 29-27 lead on a three-pointer just 15 VHFRQGVODWHU%\UGVFRUHGĂ&#x20AC;YHSRLQWVLQWKHĂ&#x20AC;QDOWKUHHPLQXWHVRIWKHĂ&#x20AC;UVW half and UNCG went into the intermission with a 35-32 lead. However that lead would not hold up in the second half as UNCG lost for just the fourth time in the last 25 games that it led at the intermission. Davidson used 31 bench points in the second half to fuel its late surge. â&#x20AC;&#x153;We just fell a part and did not come to play,â&#x20AC;? stated head coach Lynne Agee. â&#x20AC;&#x153;Davidson is an intense and aggressive team and we did not have the intensity to match them. I am very disappointed in the lack of effort and focus.â&#x20AC;?

GREENSBORO, NC â&#x20AC;&#x201C; KaLeah Latham scored a season-high 17 points and added seven rebounds and UNC Greensboro closed the game on a 101 run to defeat Coastal Carolina, 64-54, Saturday afternoon in womenâ&#x20AC;&#x2122;s basketball action at Fleming Gymnasium. Senior Jasmine Byrd added 11 points, while Irene Otamiri and Brittany Frazier each added six rebounds. With the win head coach Lynne Agee picked up her 498th win of her UNCG tenure. 7KH6SDUWDQV  ZHUHFRPLQJRIIRIDGD\OD\RIIIRUĂ&#x20AC;QDOH[DPV but picked up their ninth consecutive victory at Fleming and snapped a twogame losing skid in the process. Coastal senior guard Alisha Dills, who entered the game second in the nation in scoring at better than 24 points per game, had 27 points to lead Coastal Carolina. Junior guard Vanessa Laug was Coastalâ&#x20AC;&#x2122;s next leading scorer with just six points. â&#x20AC;&#x153;Coming off of a long break it was nice to get back out on the court,â&#x20AC;? Agee said.â&#x20AC;? KaLeah played great for us today. She really stepped up for us in a big way. Kemena Brooks also had a big play that really changed the game for us. It was good to get the win.â&#x20AC;? Brooksâ&#x20AC;&#x2122; â&#x20AC;&#x153;big playâ&#x20AC;? came with 1:25 left when she scored on a rebound RIIRIDPLVVHGWKUHHSRLQWHUE\.ULVWHQ%RRQH%RRRQHĂ&#x20AC;UHGXSDIRRWHU as the shot clock was about to expire. The horn went off while the ball was in Ă LJKWZLWKWKHEDOOKLWWLQJWKHEDFNRIWKHULP&RDVWDO&DUROLQDSOD\HUVIUR]H ZKHQWKHKRUQZHQWRII+RZHYHU%URRNVQRWKHDULQJDQRIĂ&#x20AC;FLDOV¡ZKLVWOH grabbed the ball for the putback to give UNCG a six-point lead. 7KH6SDUWDQVVKRWIRUIURPWKHĂ RRUJRRGIRUSHUFHQWDQG shot 76.2 percent from the charity stripe. Latham and Brooks were both perfect from the stripe with Latham going 7-of-7 and Brooks shooting 4-for-4. Coastal (5-3), which has never won in six trips to Fleming Gym, stormed out to a 6-0 lead to open the game behind quick buckets by Laug and Dill, but the Spartans stormed back on a pair of buckets by senior guard Jasmine %\UGWRFXWWKHOHDGWRWZR7KHWHDPVWUDGHGEXFNHWVWKURXJKRXWWKHĂ&#x20AC;UVW half with the Spartans taking a 30-28 lead into the break. The Spartans extended their lead to four early in the second half with two consecutive jumpers by Boone but Coastal hit three free throws in their next two possessions to cut the lead to one at the 16:51 mark. %RWKWHDPVZHQWZLWKRXWDĂ&#x20AC;HOGJRDOIRUWKHQH[WWKUHHPLQXWHVEXW 'LOOKLWDWUH\WRJLYH&RDVWDODOHDGLWVĂ&#x20AC;UVWOHDGVLQFHWKH PDUNRIWKHĂ&#x20AC;UVWKDOI+RZHYHUWKH&KDQWLFOHHUVFRXOGQRWJDLQDOHDGRI more than three. The teams again went back and forth with neither team gaining more than a four-point advantage until late in the game when UNCG pulled away after Brooksâ&#x20AC;&#x2122; heads-up play, which was part of a 10-1 run to close out the contest.UNCG has now won 14 straight when holding opponents under 60 points.

GREENSBORO, NC â&#x20AC;&#x201C; UNC Greensboro had three players in doubles Ă&#x20AC;JXUHVZLWKVHQLRUIRUZDUG.D/HDK/DWKDPOHDGLQJWKHZD\ZLWKSRLQWV as UNCG defeated backyard rival High Point, 63-53 in womenâ&#x20AC;&#x2122;s basketball action at Fleming Gymnasium on Monday night. Junior Kristen Boone and Jasmine Byrd had 11 points apiece while Latham added nine rebounds. The Spartans extended their homecourt win streak to 10 and head coach Lynne Agee picked up her 499th win as Spartan head coach. High Point (5-4), who snapped a three-game win streak, was led by Candyce Sellars who had a game-high 18 points on 8-of-6 shooting from WKHĂ RRU$PEHU0DQXHOZDVWKHQH[WOHDGLQJVFRUHUZLWKQLQHSRLQWV.DWLH Ralls had seven rebounds to lead the Panthers. â&#x20AC;&#x153;This was one of our best performances as a team,â&#x20AC;? head coach Lynne $JHHVDLG´:H¡YHKDGWRVKXIĂ HVRPHSHRSOHDURXQGDQGZHUHDOO\KDGVRPH players step up and do what was necessary to get through tonightâ&#x20AC;&#x2122;s game.â&#x20AC;? UNCG opened the second half with a 10-2 run to take a 40-30 point advantage at the 14:56 mark but High Point battled back with a run in the JDPHVĂ&#x20AC;QDOWZRPLQXWHVRXWVFRULQJ81&*WRFXWWKH6SDUWDQVOHDGWR four with just under a minute remaining in the half. Kristen Boone had a bucket in the paint with just under 30 seconds left to go and Latham sealed the game at the line with two free throws. 7KH6SDUWDQVVKRWSHUFHQWIURPWKHĂ RRURQRIVKRRWLQJDQG grabbed 40 rebounds, including 10 defensive boards. Junior forward Brittany )UD]LHUOHG81&*LQVKRRWLQJJRLQJRIIURPWKHĂ RRU The Spartans started the game on an 11-4 run sparked by senior guard -DVPLQH%\UG¡VWKUHHSRLQWHURQ81&*¡VĂ&#x20AC;UVWSRVVHVVLRQ81&*OHGE\DV PDQ\DVSRLQWVLQWKHĂ&#x20AC;UVWKDOIEXW+LJK3RLQWDQVZHUHGZLWKDUXQRI WKHLURZQODWHLQWKHKDOIRXWVFRULQJWKH6SDUWDQVLQWKHĂ&#x20AC;QDOPLQXWHV of the half to cut the Spartans lead to three points, as they took a 31-28 lead into the locker room. 81&*KDGĂ&#x20AC;YHWXUQRYHUVLQWKHODVWIRXUPLQXWHVRIWKHKDOIWRVSDUN High Points run late in the half. â&#x20AC;&#x153;We didnâ&#x20AC;&#x2122;t do a great job of closing out the halves tonight,â&#x20AC;&#x153; Agee said. â&#x20AC;&#x153;At the end of both halves we lost our focus a bit and let High Point get back in the game, luckily we weâ&#x20AC;&#x2122;re able to regain our focus to close out the game.â&#x20AC;? The Spartan defense was solid forcing 18 High Point turnovers and coming up with 11 steals. UNCG held High Pointâ&#x20AC;&#x2122;s leading scorer Leslie Cook, who came into the contest averaging better than 12 points per game, to only eight points. UNCG, has now won 15 straight when holding opponents to under 60 points.

VISITORS: UNC Greensboro 4-3, 0-1 SoCon tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t pf tp a to bl s min 04 Otamiri, Irene f 5-6 1-1 0-0 3-3-6 0 11 3 6 0 2 30 33 Latham, Kaleah f 4-10 0-2 1-2 3-7-10 3 9 1 2 0 1 33 44 Chamberlain, Meghanc 0-4 0-0 2-4 3-3-6 1 2 0 3 0 0 16 21 Boone, Kristen g 3-13 0-3 1-2 1-1-2 3 7 3 2 0 6 33 24 Byrd, Jasmine g 5-15 1-8 0-0 1-1-2 4 11 2 2 0 2 32 03 Dixon, Jasmine 2-5 0-0 5-6 1-3-4 3 9 0 3 0 1 22 22 Brooks, Kemena 0-2 0-0 0-0 1-1-2 1 0 1 0 0 0 6 23 Ling, Ashley 1-1 0-0 1-1 0-0-0 1 3 0 0 0 2 7 30 Grimsley, Gini 2-4 1-3 0-0 0-0-0 2 5 0 0 1 0 10 31 Mullins, Ashley 0-1 0-0 0-0 0-1-1 0 0 0 1 0 0 2 40 Frazier, Brittany 1-2 0-0 0-1 0-0-0 0 2 1 0 0 0 9 TEAM 1-1-2 Totals 23-63 3-171 0-16 14-21-3518 5911 19 114200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 14-30 46.7% 1st Half: 1-3 33.3% 1st Half: 6-8 75.0%

2nd Half: 9-33 27.3% 2nd Half: 2-14 14.3% 2nd Half: 4-8 50.0%

HOME TEAM: Davidson 7-2, 1-0 SoCon tot-fg 3-pt ## Player fg-fga fg-fga min 33 KELLY, Brynn f 5-6 0-1 44 HEMERKA, Danielle f 1-2 0-1 12 HAMILTON, Katie g 3-5 3-3 20 WASHINGTON, Tia g 4-8 0-1 25 MITCHELL, Jessica g 0-6 0-3 02 LAUNE, Monica 3-5 1-2 10 THOMPSON, Alex 1-2 1-1 14 HALBERSLEBEN, Mandy 0-0 0-0 21 ROBINSON, Mercedes 5-9 0-0 32 GASSIE, Kelly 0-0 0-0 35 PAQUETTE, Julia 3-5 0-0 TEAM Totals. 25-48 5 -12 TOTAL FG% 3-Pt. FG% FThrow %

1st Half: 13-26 50.0% 1st Half: 3-6 50.0% 1st Half: 3-6 50.0%

ft-fta o-d-t

Game: 36.5% Game: 17.6% Game: 62.5%

rebounds pf tp a to bl s

2-2 0-0 0-0 4-6 0-0 2-2 7-8 0-0 1-2 2-4 0-0

0-1-1 0 12 1 2 0 0 23 0-2-2 0 2 3 1 0 1 13 0-3-3 1 9 1 2 0 0 19 1-2-3 3 12 5 4 1 3 29 0-3-3 2 0 2 3 0 1 22 0-0-0 1 9 3 4 0 0 19 0-4-4 0 10 3 0 0 2 16 0-0-0 1 0 0 0 0 0 2 2-7-9 2 11 2 1 2 3 29 0-0-0 4 2 1 2 0 2 10 0-7-7 2 6 1 0 0 0 18 2-2-4 18-24 5-31-36 1673 22 19 312200

2nd Half: 12-22 54.5% Game: 52.1% 2nd Half: 2-6 33.3% Game: 41.7% 2nd Half: 15-18 83.3% Game: 75.0%

2IĂ&#x20AC;FLDOV&DUOD)RXQWDLQ'DZQ0DUVK%ULDQ0LOOHU Technical fouls: UNC Greensboro-None. Davidson-None. Attendance: 241 Score by Periods 1st 2nd Total UNC Greensboro 35 24 59 Davidson 32 41 73

VISITORS: Coastal Carolina 5-3 tot-fg 3-pt ## Player fg-fga fg-fga min 22 YATES, Calisha f 1 -3 1-2 50 LAUG, Vanessa c 2 -7 0-0 15 WARE, C.J. g 3-7 0-0 33 BLANCHARD, Victoriag 2-6 0-0 45 DILL, Alisha g 9-22 5-11 12 STULL, Amanda 2-5 0-0 13 LYONS, Lacey 0-4 0-3 23 PEKONEN, Joanna 0-0 0-0 32 RIVERS, Devin 1-4 0-0 40 YURICHAK, Kristy 0-0 0-0 TEAM Totals 20-58 6 200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 12-28 42.9% 1st Half: 3-8 37.5% 1st Half: 1-4 25.0%

HOME TEAM: UNCG 5-3 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 1-6 0-1 33 Latham, Kaleah f 5-7 0-0 40 Frazier, Brittany f 4-8 0-0 21 Boone, Kristen g 3-8 0-1 24 Byrd, Jasmine g 4-10 1-5 03 Dixon, Jasmine 0-2 0-1 12 Hyson, Lakiah 0-1 0-0 22 Brooks, Kemena 2-5 0-0 23 Ling, Ashley 0-3 0-1 30 Grimsley, Gini 1-4 1-1 44 Chamberlain, Meghan 3 -5 0-0 TEAM

ft-fta o-d-t

pf

1-2 1-2 0-0 0-0 4-6 1-2 0-0 0-0 1-2 0-0

3 2 3 2 1 2 0 2 3 0

0-1-1 3-1-4 2-6-8 1-3-4 1-3-4 1-4-5 0-1-1 0-0-0 1-1-2 0-2-2

6-16 8-14

4 2 5 0 6 4 4 0 27 0 5 3 0 1 0 0 3 0 0 0

0 0 0 0 3 0 0 0 1 0 1 10-22-32-18-5410

2nd Half: 8-30 26.7% 2nd Half: 3-8 37.5% 2nd Half: 7-10 70.0%

1 0 4 2 3 1 0 1 0 0

1 25 0 25 1 34 0 19 0 36 3 22 0 9 1 5 0 20 0 5 1 12 4

Game: 34.5% Game: 37.5% Game: 57.1%

rebounds ft-fta o- d-t pf

tp

a to bl s

0-0 7-7 0-0 0-0 2-4 3-4 0-0 4-4 0-0 0-2 0-0

2 17 8 6 11 3 0 8 0 3 6

2 0 2 1 2 0 0 1 2 1 1 7

3-3-6 3-4-7 3-3-6 2-1-3 1-2-3 1-3-4 0-0-0 2-1-3 0-2-2 1-1-2 1-3-4

1 3 0 3 2 0 0 0 0 2 1

00 01 21 30 10 20 00 10 20 11 21 7

64 12 14 4 5

0 2 0 1 1 0 0 1 0 0 0

Totals

23-59 2-10 16-21

17-30-47 12

TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 12-28 42.9% 1st Half: 1-4 25.0% 1st Half: 5-6 83.3%

2nd Half: 11-31 35.5% Game: 39.0% 2nd Half: 1-6 16.7% Game: 20.0% 2nd Half: 11-15 73.3% Game: 76.2%

2IĂ&#x20AC;FLDOV/DZVRQ1HZWRQ7LP%U\DQW-RQDWKDQ7KRPDV Technical fouls: Coastal Carolina-None. UNCG-None. Attendance: 157 Score by Periods 1st 2nd Total Coastal Carolina 28 26 54 UNCG 30 34 64

42 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

rebounds tp a to bl s

25 28 25 22 32 11 3 15 15 9 15

200

VISITORS: High Point 5-4 tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t pf tp a to 33 MANUEL, Amber f 4-7 0-0 1-2 3-3-6 3 9 0 5 35 BROCKMYER, Erica f 0-3 0-1 4-4 5-0-5 0 4 0 1 11 RALLS, Katie g 2-5 0-2 0-0 0-3-3 5 4 4 1 12 COOK, Leslie g 3-9 2-6 0-0 2-5-7 2 8 0 3 14 SELLARS, Candyce g 8-16 2-8 0-0 3-3-6 4 18 4 03 THOMPSON, Ayonna 1-12 0-6 0-0 1-2-3 0 2 2 2 21 TUCKER, Andrea 1-4 0-0 0-2 2-3-5 1 2 0 1 22 THYS, Caitlin 2-10 0-0 0-0 2-4-6 3 4 0 2 23 BENSON, April 0-0 0-0 0-0 0-0-0 1 0 0 0 25 LONG, Jennifer 0-2 0-0 0-0 0-0-0 0 0 1 0 44 SAMUELS, Ashlee 1-6 0-0 0-0 4-2-6 2 2 0 0 TEAM 1-1-2 Totals 22-74 4-23 5-8 23-26-4921 53 11 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 12-38 31.6% 1st Half: 3-14 21.4% 1st Half: 1-2 50.0%

HOME TEAM: UNCG 6-3 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 2-7 0-1 33 Latham, Kaleah f 4-7 0-1 40 Frazier, Brittany f 4-5 0-0 21 Boone, Kristen g 4-7 0-2 24 Byrd, Jasmine g 4-10 2-4 03 Dixon, Jasmine 1-5 0-1 12 Hyson, Lakiah 0-1 0-1 22 Brooks, Kemena 3-5 1-3 23 Ling, Ashley 1-1 0-0 30 Grimsley, Gini 0-2 0-0 44 Chamberlain, Meghan0-2 0-0 TEAM Totals 23-52 3-13 200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 12-27 44.4% 1st Half: 2-11 18.2% 1st Half: 5-9 55.6%

bl s min 0 0 17 0 0 13 2 2 34 0 0 30 3 0 3 33 0 0 16 0 0 13 1 3 26 002 006 0 0 10 18 3 8 200

2nd Half: 10-36 27.8% 2nd Half: 1-9 11.1% 2nd Half: 4-6 66.7%

Game: 29.7% Game: 17.4% Game: 62.5%

rebounds ft-fta of-d-t pf tp

a to bl s

0-0 8-10 1-4 3-4 1-2 1-3 0-0 0-0 0-0 0-0 0-2

0-6-6 2 4 2 3-6-9 2 16 1 0-4-4 1 9 2 0-2-2 1 11 1 0-0-0 1 11 3 1-3-4 1 3 0 0-0-0 0 0 0 3-2-5 2 7 1 1-1-2 1 2 1 1-0-1 2 0 0 0-2-2 0 0 0 1-4-5 14-25 10-30-40 136311

1 2 3 6 2 3 1 2 0 1 0

0 1 3 0 0 1 0 0 0 0 1

21 6

1 2 1 3 2 1 0 1 0 0 0 11

2nd Half: 11-25 44.0% Game: 44.2% 2nd Half: 1-2 50.0% Game: 23.1% 2nd Half: 9-16 56.3% Game: 56.0%

2IĂ&#x20AC;FLDOV.LP:DWW$QJHO6WDQWRQ&DURO\Q-RQHV Technical fouls: High Point-None. UNCG-None. Attendance: 198 Score by Periods 1st 2nd Total High Point 28 25 53 UNCG 31 32 63

21 27 26 21 27 15 10 19 15 9 10


G12: UNCG 67, Liberty 59 December 29, 2006-College Park, MD (Comcast Center)

GREENSBORO, NC â&#x20AC;&#x201C; UNC Greensboro had a one-point lead with 1:58 left in the game but several quick turnovers, coupled by free throws by Western Carolinaâ&#x20AC;&#x2122;s Brooke Johnson gave Western Carolina a 53-52, win over UNC Greensboro on Wednesday afternoon at Fleming Gymnasium. Senior guard Jasmine Byrd led the Spartans (6-4, 0-2 SoCon) with 16 points on 6-of-14 shooting and was a perfect 2-of-2 from the charity stripe. Brittany Frazier pulled down nine rebounds. With the loss, the Spartans 10game homecourt win streak, dating back to last season, was snapped. Western Carolina (7-5, 2-0 SoCon) was led by Lauren Powell who had 10 points on 3-of-12 shooting and was 4-of-5 from the free throw line. Chevon Keith had a game-high 10 rebounds and was the next leading scorer for the Catamounts with nine points. ´7KLVZDVDWDOHRIWZRKDOYHVÂľKHDGFRDFK/\QQH$JHHVDLG´,QWKHĂ&#x20AC;UVW KDOIZHZH¡UHJOXHGWRWKHĂ RRUDQGZHZHUHQ¡WVKRZLQJDQ\HIIRUW,ZDVUHDOO\ GLVDSSRLQWHGWKDWZHFRXOGQ¡WJHWPRUHHIIRUWLQWKHĂ&#x20AC;UVWKDOIÂľ Western Carolinaâ&#x20AC;&#x2122;s 35-20 lead at the 16:27 mark capped the Catamountsâ&#x20AC;&#x2122; largest lead of the game at 15 points. The Spartans scored nine unanswered points sparked by back-to-back three pointers by Byrd to cut the lead to six. The teams traded buckets but the Spartans couldnâ&#x20AC;&#x2122;t get the score under six points until the 3:10 mark of the second half when Irene Otamiri hit a runner in the lane and got fouled. KaLeah Latham came up with a big steal after Otamiriâ&#x20AC;&#x2122;s free throws to cut the lead to one with 2:56 left in the game. Western Carolina pushed the lead back to three with a layup by Keith but a steal by Latham gave the 6SDUWDQVDRQHSRLQWOHDGZLWKOHIWLQWKHJDPHWKH6SDUWDQVĂ&#x20AC;UVWOHDG of the afternoon. The Spartans had one last chance, but a desperation pass was intercepted and time expired. 81&*VKRWSHUFHQWIURPWKHĂ RRURQRIVKRRWLQJDQGVKRW 29.4 percent from behind the arc. The Spartans also had 33 rebounds. :HVWHUQ&DUROLQDVWDUWHGWKHJDPHRQDUXQLQWKHĂ&#x20AC;UVWPLQXWHVRIWKHKDOIEXWWKH6SDUWDQVEDWWOHGEDFNWRFXWWKHOHDGWRĂ&#x20AC;YHSRLQWV at the 8:07 mark with a jumper by Brittany Frazier and a three-pointer by Kemena Brooks. Western countered with another run pushing the lead to 11 at the 3:34 mark but UNCG scored four unanswered points to get the lead down to single GLJLWVEXWIRXOVE\)UD]LHUDQG%RRQHLQWKHĂ&#x20AC;QDOVHFRQGVRIWKHKDOIJDYH Western the 28-16 halftime lead. 7KH6SDUWDQVVKRWSHUFHQWRQRIVKRRWLQJIURPWKHĂ RRULQ WKHĂ&#x20AC;UVWKDOIWKHLUORZHVWĂ&#x20AC;UVWKDOIVKRRWLQJSHUFHQWDJHVLQFHVKRRWLQJ percent in a 103-48 loss at No. 2 North Carolina on Nov. 30.

COLLEGE PARK, MD â&#x20AC;&#x201C;The defending national champion, Maryland 7HUUDSLQVKDGVL[SOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVDVWRSUDQNHG0DU\ODQG defeated UNC Greensboro 92-57 Friday night at the Comcast Center. UNCG (6-5) was led by senior guard Jasmine Byrd who had 15 points on 6-off 19 shooting. The Spartans next leading scorer was senior forward KaLeah Latham who had nine points. Latham and Meghan Chamberlain had four rebounds each. Byrd also added four steals. Kristi Tolivar led Maryland (14-0) with a game-high 16 points on 4of-6 shooting, all from behind the arc. She was also 4-of-4 from the charity stripe. â&#x20AC;&#x153;I was very proud of the effort tonight,â&#x20AC;? head coach Lynn Agee said. â&#x20AC;&#x153;This game for us was about composure and ball control. We didnâ&#x20AC;&#x2122;t do a JUHDWMRELQWKHĂ&#x20AC;UVWKDOIEXWZHZH¡UHDEOHWRFRQWUROWKHEDOOEHWWHULQWKH second half and were able to make some big shots. Playing the No. 1 team in the country youâ&#x20AC;&#x2122;re kind of stuck between a rock and a hard place but I was proud of the way that everyone stepped up and contributed tonight. â&#x20AC;? 81&*FRQWLQXHGWKHUXQWKH\XVHGWRFORVHWKHĂ&#x20AC;UVWKDOIWRRSHQ the second half behind a quick steal and layup by Jasmine Bryd, cutting the Maryland lead to 16. Spartan seniors Jasmine Byrd and KaLeah Latham kept the Spartans in the game early in the second stanza, scoring 81&*¡VĂ&#x20AC;UVWSRLQWVRIWKHKDOIWRFXWWKHOHDGWRDWWKH mark. The teams continued to trade buckets throughout the half and UNCG was able to cut the Maryland lead to 16 points, but couldnâ&#x20AC;&#x2122;t stop Marylandâ&#x20AC;&#x2122;s offense as the Terrapins picked up theirr 14th consecutive victory. 7KH6SDUWDQVVKRWRIIURPWKHĂ RRUJRRGIRUSHUFHQW and shot 23.1 percent from behind the arc. UNCG started the game strong, winning the tip and taking an early WKUHHSRLQWOHDGZLWKDEXFNHWE\,UHQH2WDPLULRQWKHĂ&#x20AC;UVWSRVVHVVLRQ Maryland got on the board behind free thows by Shay Doran to cut the Spartan lead to one in the games early goings. The Spartans capitalized on several Maryland miscues and took a 13-12 lead at the 13:11 mark but three unanswered buckets gave the Terps a six point lead with just overr 10 minutes left in the half. UNCG was able to gain some momentum when Kristen Brooks took a charge at midcourt and Otamiri was able to cut the Maryland lead to four with a jumper in the lane midway through the half. Maryland went on a 14-8 run to close the half, while UNCG closed with three unanswered buckets as Maryland took the 48-25 halftime lead. 81&*VKRWRILQWKHĂ&#x20AC;UVWKDOIJRRGIRUSHUFHQWDQG forced 12 turnovers, while Maryland out-rebounded the Spartans 21-10, WKURXJKWKHĂ&#x20AC;UVWVWDQ]D

VISITORS: Western Carolina 7-5, 2-0 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta 35 JOHNSON, Jessika f 0-2 0-0 2-2 55 LAMITIE, Lynsie f 3-7 0-1 0-0 10 DAWSON, Monique g 2-6 0-3 0-0 21 KEITH, Chevon g 4-9 0-0 1-2 23 POWELL, Lauren g 3-12 0-6 4-5 03 SWAYNE, Heather 1-2 1-1 0-0 05 PELLOM, Ashley 2-8 0-1 0-0 30 JOHNSON, Brooke 1-4 0-2 6-6 32 MAY, Erin 0-3 0-1 0-0 33 FEEMSTER, Kristen 0-0 0-0 0-0 44 EATON, Kendra 3-8 0-0 1-2 TEAM Totals 19-61 1-15 14-17 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 11-29 37.9% 1st Half: 0-6 0.0% 1st Half: 6-6 100%

HOME TEAM: UNCG 6-5, 0-2 tot-fg 3-pt ## Player fg-fga fg-fga 04 Otamiri, Irene f 3-8 1-4 33 Latham, Kaleah f 4-8 0-0 40 Frazier, Brittany f 1-6 0-0 21 Boone, Kristen g 1-9 0-1 24 Byrd, Jasmine g 6-14 2-7 03 Dixon, Jasmine 2-3 0-0 22 Brooks, Kemena 3-6 2-4 23 Ling, Ashley 1-1 0-0 30 Grimsley, Gini 0-1 0-1 44 Chamberlain, Meghan0-3 0-0 TEAM Totals 21-595-17 5-9 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 6-27 22.2% 1st Half: 1-10 10.0% 1st Half: 3-6 50.0%

rebounds o- d--t pf 3-5-8 3 4-1-5 2 1-0-1 3 5-5-10 3 0-1-1 1 1-0-1 0 0-8-8 2 1-5-6 0 0-1-1 0 0-1-1 0 3-3-6 0

tp 2 6 4 9 10 3 4 8 0 0 7 2 18-32-50 14 53

2nd Half: 8-32 25.0% 2nd Half: 1-9 11.1% 2nd Half: 8-11 72.7%

rebounds ft-fta o-d-t pf 1-1 0-3-3 3 1-2 1-4-5 2 0-0 2-7-9 2 1-4 0-3-3 3 2-2 0-2-2 1 0-0 1-2-3 2 0-0 0-4-4 1 0-0 0-0-0 0 0-0 0-1-1 0 0-0 1-1-2 0 6-27-33

tp 8 9 2 3 16 4 8 2 0 0

a to bl s min 0 0 0 0 18 0 2 1 0 22 2 4 0 2 17 0 4 0 2 31 0 3 0 121 1 1 0 0 10 4 3 0 128 1 2 2 0 22 0 0 0 0 15 0 0 0 03 0 0 0 0 13 2 8 19 3 6 200

Game: 31.1% Game: 6.7% Game: 82.4%

a 0 0 1 5 3 1 0 1 0 2

to bl s 0 0 1 1 0 2 0 2 0 3 0 4 2 0 2 3 0 1 0 0 0 1 0 1 2 2 0 200 1 11 14 5213 14411200

min 23 25 26 31 30 17 17 9 10 2

2nd Half: 15-32 46.9% Game: 35.6% 2nd Half: 4-7 57.1% Game: 29.4% 2nd Half: 2-3 66.7% Game: 55.6%

2IĂ&#x20AC;FLDOV7RQ\/LSSD.ULVWL9HUD.DUHQ*UXFD Technical fouls: Western Carolina-None. UNCG-None. Attendance: 219 Score by Periods 1st 2nd Total Western Carolina 28 25 53 UNCG 16 36 52

VISITORS: Liberty (6-7)

VISITORS: UNC Greensboro (6-5) tot-fg 3-pt ## Player fg-fga fg-fga 04 Otamiri, Irene f 3-4 2-3 33 Latham, Kaleah f 4-6 1-2 44 Chamberlain, Meghanc 2-5 0-0 21 Boone, Kristen g 2-10 0-2 24 Byrd, Jasmine g 6-19 3-11 03 Dixon, Jasmine 2-8 1-1 12 Hyson, Lakiah 0-1 0-0 22 Brooks, Kemena 1-2 0-1 23 Ling, Ashley 0-0 0-0 30 Grimsley, Gini 3-8 1-4 40 Frazier, Brittany 0-1 0-0 TEAM Totals 23-648-243-5

rebounds ft-fta o- d-t pf tp a to bl s min 0-0 1-0-1 4 8 1 3 0 0 23 0-0 2-2-4 4 9 01 0 1 18 0-0 0-4-4 1 4 0 2 0 1 22 1-2 0-0-0 3 5 5 0 0 1 26 0-0 0-1-1 2 15 2 2 0 4 29 2-2 0-2-2 0 7 1 3 0 1 19 0-0 0-0-0 0 0 1 0 0 1 10 0-1 0-0-0 1 2 01 0 0 10 0-0 0-0-0 1 0 2 0 0 0 15 0-0 1-1-2 2 7 0 3 1 0 14 0-0 0-0-0 1 0 01 0 2 14 2-3-5 6-13-19 19 5712 16 1 11 200

TOTAL FG% 3-Pt. FG% F Throw %

2nd Half: 12-33 36.4% Game: 35.9% 2nd Half: 5-11 45.5% Game: 33.3% 2nd Half: 3-5 60.0% Game: 60.0%

1st Half: 11-31 35.5% 1st Half: 3-13 23.1% 1st Half: 0-0 0.0%

HOME TEAM: Maryland (14-0) tot-fg 3-pt ## Player fg-fga fg-fga 15 Harper, Laura f 1-4 0-0 25 Coleman, Marissa f 6-8 1-3 01 Langhorne, Crystal c 3-7 0-0 20 Toliver, Kristi g 4-6 4-6 22 Doron, Shay g 3-6 0-1 02 Wiley-Gatewood,Saâ&#x20AC;&#x2122;de 3-5 3-5 11 Marrone, Christie 1-2 1-2 21 Newman, Ashleigh 4-6 3-4 44 Noirez, Aurelie 1-2 0-0 55 Perry, Jade 2-3 0-0 TEAM Totals 28-49 12-21

ft-fta 2-2 0-0 5-6 4-4 4-4 6-6 0-0 0-0 0-0 3-3 1-2-3 24-25

TOTAL FG% 3-Pt. FG% F Throw %

2nd Half: 13-23 56.5% Game: 57.1% 2nd Half: 5-9 55.6% Game: 57.1% 2nd Half: 13-13 100% Game: 96.0%

1st Half: 15-26 57.7% 1st Half: 7-12 58.3% 1st Half: 11-12 91.7%

COLLEGE PARK, MD â&#x20AC;&#x201C; UNC Greensboro head coach Lynne Agee picked up her 500th win as Spartan head coach as UNCG defeated Liberty, 67-59 in the consolation game of the Terrapin Classic on Saturday afternoon. UNCG (7-5) was led by senior guard Jasmine Byrd who had 21 points RQRIVKRRWLQJIURPWKHĂ RRUDQG.D/HDK/DWKDPZKRKDGDFDUHHU high 14 rebounds. Kristen Boone also tied a season high dishing out six assists while Kemena Brooks tied a season-high, with nine points. Liberty (6-7) was led by Moriah and Megan Frazee, who had 17 and 15 points, respectively. â&#x20AC;&#x153;We played much better in the second half todayâ&#x20AC;?, head coach /\QQH$JHHVDLG´:HKDGORWVRIIRXOVLQWKHĂ&#x20AC;UVWKDOIEXWZHZHUHDEOHWR regroup in the second half. The job that we did on the boards in the second half was great, which was key considering that they had a size advantage on us.â&#x20AC;? UNCG opened the second half with a 6-0 sparked by two jumpers and free throws by Meghan Chamberlain to take a 39-36 lead. Liberty VFRUHGWKHLUĂ&#x20AC;UVWEDVNHWRIWKHJDPHQHDUO\VL[PLQXWHVLQWRWKHKDOIWRFXW UNCGâ&#x20AC;&#x2122;s lead to 42-38 but the Spartans defense responded with a steal by Boone and 11-2 run to extend their lead to 52-40 at the 12:38 mark, the largest lead of the game. Liberty was able to get as close as two points by converting at the free throw line but UNCG clamped down on the defensive end and was able to pull out the win snapping their two-game losing streak. UNCG started the game quickly, with Byrd hitting a three on the opening possession for the second consecutive game. The Spartans opened with a 15-4 run behind three-pointers from Byrd and KaLeah Latham, but Liberty was able to get themselves a little momentum by hitting a three coming out of a media timeout and adding a bucket in the paint to cut the Spartan lead to four with just overr 11 minutes remaining in the half. Liberty hit three unanswered buckets to cut the lead to two before 2WDPLULKLWDWKUHHSRLQWHUWKURXJKWKHOHIWVLGHWRH[WHQGWKHOHDGWRĂ&#x20AC;YH DWWKHPDUN%RWKWHDPVZHQWFROGIURPWKHĂ RRURYHUWKHQH[WWZR minutes but Kemena Brooks got the Spartans over the hump with a layup. Liberty responded with a 13-4 run over the next three minutes to take a one point lead. Byrd hit three consecutive jumpers to push the UNCG lead to 31-26 at the 3:40 mark but Liberty was able to capitalize on UNCG turnovers and fouls, going on an 8-2 run in the last two minutes to take a 36-33 led into the lockeroom. 81&*VKRWSHUFHQWIURPWKHĂ RRUDQGRXWUHERXQGHG/LEHUW\ LQWKHĂ&#x20AC;UVWKDOI

rebounds o- d-t pf 0-6-6 2 2-7-9 2 3-0-3 2 0-0-0 0 1-7-8 1 0-4-4 3 0-1-1 0 0-5-5 3 0-1-1 0 1-4-5 2

tp a to 4 23 13 5 3 11 1 3 16 71 10 11 15 4 5 3 00 11 2 3 2 02 7 12

bl 2 0 0 0 0 0 0 0 0 1

s 0 3 0 2 1 0 0 0 0 0

8-37-45 15 92 23 23 3

2IĂ&#x20AC;FLDOV'LDQD'H3DXO0LFKHOOH6W3LHUUH7RQ\/LSSD Technical fouls: UNC Greensboro-None. Maryland-None. Attendance: 7633 Score by Periods 1st 2nd Total UNC Greensboro 25 32 57 Maryland 48 44 92

min 23 26 21 18 18 24 8 25 15 22 6200

tot-fg 3-pt ## Player fg-fga fg-fga min 40 Frazee, Megan f 5-10 2-4 41 Frazee, Molly f 1-6 1-4 42 Frazee, Moriah f 5-9 0-0 12 Parker, Michelle g 0-7 0-2 25 Lightfoot, Rebecca g 1-4 0-2 03 Nikagbatse, Roli-Ann 2-3 0-0 04 Watkins, Courtney 0-2 0-1 10 Fasnacht, Allyson 2-4 1-1 21 Feagin, Jamie 3-5 0-0 22 Hammond, Rachel 1-6 0-2 TEAM Totals 20- 56 4-16 200

rebounds ft-fta o- d-t pf tp

a to bl s

1-3 2-2 7-13 2-2 1-2 0-0 0-0 0-0 2-4 0-0

1 1 1 2 0 1 2 0 0 1

TOTAL FG% 3-Pt. FG% F Throw %

2nd Half: 6-25 24.0% 2nd Half: 2-9 22.2% 2nd Half: 9-15 60.0%

1st Half: 14-31 45.2% 1st Half: 2-7 28.6% 1st Half: 6-11 54.5%

HOME TEAM: UNC Greensboro (7-5) tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 4-10 2-6 33 Latham, Kaleah f 4-10 1-2 44 Chamberlain, Meghanc 3-10 0-0 21 Boone, Kristen g 1-9 0-0 24 Byrd, Jasmine g 7-15 3-6 03 Dixon, Jasmine 1-1 0-0 12 Hyson, Lakiah 0-0 0-0 22 Brooks, Kemena 4-9 1-2 23 Ling, Ashley 0-0 0-0 30 Grimsley, Gini 0-2 0-1 40 Frazier, Brittany 0-4 0-0 TEAM Totals 24-70 7-17 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 14-42 33.3% 1st Half: 5-11 45.5% 1st Half: 0-2 0.0%

3-6-9 4 13 0-4-4 1 5 3-0-3 1 17 1-3-4 2 2 1-2-3 2 3 1-1-2 4 4 0-1-1 1 0 0-1-1 1 5 2-7-9 3 8 0-0-0 1 2 2-2-4 15-26 13-27-40 20

3 2 0 4 0 2 0 1 0 3

2 0 0 0 0 0 0 0 0 0

0 0 0 0 2 0 0 0 3 1

59 9 15 2 6

Game: 35.7% Game: 25.0% Game: 57.7%

rebounds ft-fta o- d-t pf tp

a to bl s

0-1 5-7 2-2 0-0 4-4 1-4 0-0 0-0 0-0 0-0 0-0

2 0 0 6 1 2 0 1 0 0 0

2-5-7 3 7-7-14 4 2-1-3 4 4-2-6 3 0-3-3 3 1-1-2 3 0-0-0 0 0-1-1 0 0-4-4 0 1-0-1 1 1-3-4 4 5-2-7 12-18 23-29-52 25

31 24 26 26 13 12 11 21 24 12

10 14 8 2 21 3 0 9 0 0 0

2 2 0 4 2 2 1 0 1 0 0

0 1 0 0 0 0 0 0 0 0 1

1 0 1 2 3 0 0 0 0 0 0

29 36 20 32 34 8 0 17 8 2 14

67 12 14 2 7200

2nd Half: 10-28 35.7% Game: 34.3% 2nd Half: 2-6 33.3% Game: 41.2% 2nd Half: 12-16 75.0% Game: 66.7%

2IĂ&#x20AC;FLDOV'RXJ&ORXG'DXQH0DFN0DUN%HKUHQW] Technical fouls: Liberty-None. UNC Greensboro-None. Attendance: Score by Periods 1st 2nd Total Liberty 36 23 59

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 43

2006-07 Season Review

G11: Maryland 92, UNCG 57 December 28, 2006-College Park, MD (Comcast Center)

UNCGSpartans.com â&#x20AC;˘ UNCGSpa

G10: Western Carolina 53, UNCG 52 December 20, 2006-Greensboro, NC (Fleming Gym)


Spartans.com â&#x20AC;˘ UNCGSpartanss.

2006-07 Season Review

G13: UNCG 71, Chattanooga 68

G14: UNCG 67, Furman 53

G15: UNCG 80, Georgia Southern 55

January 2, 2007-Chattanooga, TN (McKenzie Gym)

January 5, 2007-Greensboro, NC (Fleming Gym)

January 7, 2007-Greensboro, NC (Fleming Gym)

GREENSBORO, NC â&#x20AC;&#x201C; The University of North Carolina at Greensboro KDGWKUHHSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVDQGRSHQHGWKHVHFRQGKDOIZLWKDQ 11-0 run as the Spartans defeated Furman 67-53 in Fleming Gymnasium on Saturday afternoon. UNCG was led by junior guard Kristen Boone, who scored a career-high 27 points on 10-of-14 shooting in the win. Irene Otamiri added a season-high 14 points and seven rebounds, while Meghan Chamberlain added 10 points. Senior guard Jasmine Byrd, who was playing in herr 100th career game, chipped in seven points and four assists. â&#x20AC;&#x153;We played well this afternoon,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We really had several players step and contribute this afternoon, especially 0HJKDQ>&KDPEHUODLQ@ZKRKDVEHHQKXUW6KHUHDOO\GLGDJUHDWMRERQ the inside for us; she had a soft touch on the glass and played every aspect of the game well today.â&#x20AC;? Furman was led by Maggie McKemie, who had 10 points. Katie Johnson was the next leading scorer with nine points and Chrissy Phelps and Kali Holtfreter had eight points each. Adrienne Gilmore and Katie Johnson had three rebounds each. The Spartans opened the second half with an 11-point run sparked by a layup by Chamberlain. Otamiri then hit a three-pointer to extend the lead to 38-26 but three unanswered buckets pushed the lead to 43-26 at the 16:55 mark. Both teams went cold for the next two minutes combining for seven missed shots but it was the Spartans who were able to regroup, going on a 14-11 run to push the lead to 57-41 at the 8:18 mark, the largest lead of the night. Furman would get as close as nine points but it was the Spartans defense that sealed the win, forcing Furman into 25 turnovers, en route to UNCGâ&#x20AC;&#x2122;s second consecutive conference victory. 7KH6SDUWDQVVKRWSHUFHQWIURPWKHĂ&#x20AC;HOGRQRIVKRRWLQJ and out-rebounded Furman 42-16. UNCG also had a season-high 14 assists. The Spartans started the game quickly, opening up a quick 6-0 lead in the games opening minutes. Furman quickly got their offense going, hitting several buckets in the paint to cut the UNCG lead to 13-12 at the 11:01 mark. The Paladins capitalized on several Spartan fouls and were able to take a one-point lead. Byrd gave UNCG a little momentum and hit a three from the right side to push the lead back to 23-18 with just under seven minutes to play. Furman answered with a bucket in the paint and was able to cut the lead to 28-26 with just over three minutes left but a quick three by Otamiri and a steal and layup by Boone gave UNCG the 33-26 lead at halftime.

GREENSBORO, NC â&#x20AC;&#x201C; The University of North Carolina at Greensboro KDGWZRSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVZLWKVHQLRU-DVPLQH%\UGOHDGLQJWKH ZD\ZLWKSRLQWVRQRIVKRRWLQJIURPWKHĂ RRUDVWKH6SDUWDQV defeated Georgia Southern 80-55 in Fleming Gymnasium on Monday night. KaLeah Latham had a game-high eight rebounds, while Brittany Frazier and Ashley Ling both had career nights. Frazier posted a careerKLJKSRLQWVRQRIVKRRWLQJDQG/LQJGLVKHGRXWDFDUHHUKLJKĂ&#x20AC;YH assists. â&#x20AC;&#x153;This was an important game for us,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We knew it was going to be a tough physical game going in and it was IURPVWDUWWRĂ&#x20AC;QLVK,¡PSURXGRIWKHZD\WKDWZHKDQGOHGWKHLUSUHVVXUH Jasmine Byrd had another big night for us and Brittany Frazier provided a WHUULĂ&#x20AC;FVSDUNRIIRIWKHEHQFKÂľ Georgia Southern was led by Tiffany Brown, who scored 15 points. Chequilla Jessie and Ashley Melson added seven rebounds each. Georgia Southern (7-9, 2-3) opened the second half on a tear scorLQJWKHKDOI¡VĂ&#x20AC;UVWIRXUSRLQWVWREULQJWKH81&*OHDGWRLQWKHHDUO\ goings but Byrd was able to get the Spartans back into their rhythm hitting a three-pointer through the right side, extending the lead to 44-32. 7KH6SDUWDQ¡VVWLĂ LQJGHIHQVHZDVDEOHWRIRUFHEDFNWREDFN Georgia Southern turnovers but couldnâ&#x20AC;&#x2122;t convert on the other end, instead giving the ball right back to the Eagles who were able to hit several big shots cutting the lead to 49-39 with just underr 15 minutes to play in the half. UNCG (10-5, 3-2) got right back in the game going on a 6-2 run and KROGLQJWKH(DJOHVWRRQHĂ&#x20AC;HOGJRDORYHUWKHQH[WWKUHHPLQXWHV*HRUJLD Southern tried to pull the game close with several quick baskets but a UXQLQWKHJDPHVĂ&#x20AC;QDOĂ&#x20AC;YHPLQXWHVVHDOHGWKHYLFWRU\DVWKH6SDUWDQV picked up their fourth consecutive victory. 7KH6SDUWDQVVKRWSHUFHQWIURPWKHĂ RRURQRIVKRRWLQJ IURPWKHĂ RRUDQGSLFNHGXSUHERXQGV UNCG started the game fast, opening up with a 13-2 run in the JDPHVĂ&#x20AC;UVWIRXUPLQXWHV%\UGOHGWKHFKDUJHFRQQHFWLQJRQWZRWKUHH pointers early in the game. The Spartan defense continued to trouble *HRUJLD6RXWKHUQIRUFLQJWKH(DJOHVLQWRĂ&#x20AC;YHWXUQRYHUVWKURXJKWKHĂ&#x20AC;UVW eight minutes. 7KH(DJOHVFRQWLQXHGWRJRFROGIURPWKHĂ RRUEXWĂ&#x20AC;QDOO\JRWWKHLU Ă&#x20AC;UVWĂ&#x20AC;HOGJRDODWWKHPDUN81&*UHVSRQGHGE\JRLQJRQDQUXQ over the next four minutes to extend their lead to 28-11 at the 7:45 mark. Georgia Southern was able to cut the UNCG lead to 10-points with just under three minutes remaining but and got as close as 36-28 in the second half but the Spartans went on a 5-0 run to close the half and took a 41-28 lead into the lockeroom. 81&*VKRWSHUFHQWIURPWKHĂ RRULQWKHĂ&#x20AC;UVWKDOIRQRI VKRRWLQJWKHLUEHVWĂ&#x20AC;UVWKDOIVKRRWLQJSHUFHQWDJHVLQFHSOD\LQJ/RQJZRRG at the UNCG Thanksgiving Classic.

CHATTANOOGA, TN â&#x20AC;&#x201C; The University of North Carolina at Greensboro pulled out a nail-biter and defeated, league leading Chattanooga, 71-68 in McKenzie Arena on Tuesday night. The Spartans snapped a 15-game losing streak to Chattanooga, dating back to the 1999-00 season,and SLFNHGXSWKHLUĂ&#x20AC;UVWFRQIHUHQFHZLQRIWKHVHDVRQ KaLeah Latham, Athens, TN native, scored a team-high 17 points on 6-of-14 shooting, and Kristen Boone and Jasmine Byrd scored 15 apiece, Irene Otamiri pulled down a career-high 12 rebounds. â&#x20AC;&#x153;I am so proud of the way this team played team basketball tonight,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We havenâ&#x20AC;&#x2122;t beat Chattanooga in awhile and it was really great to see us battle with them tonight and play JUHDWWHDPEDVNHWEDOO:HZH¡UHORRNLQJIRURXUĂ&#x20AC;UVWFRQIHUHQFHZLQDQG WKLVZDVDJUHDWSODFHIRUXVWRSLFNXSRXUĂ&#x20AC;UVWZLQÂľ Chattanooga was led by Alex Anderson, who scored a game-high 28 points and pulled down 14 rebounds. Chattanooga (9-5, 2-1) opened the second half with a quick bucket to cut the lead to 36-30, but UNCG (8-5, 1-2) responded with several three-pointers by Jasmine Byrd to give the Spartans a 43-36 lead at the 17:58 mark. Chattanooga managed to cut the lead 49-43 with just overr 11 minutes left in the game behind baskets and free throws by Anderson. The teams traded buckets but it was the Lady Mocs who were able to capitalize at the charity stripe to cut the UNCG lead to 53-48 with just under eight minutes remaining in the game. Chattanoogaâ&#x20AC;&#x2122;s Tagan Hatchett hit a huge three to cut UNCGâ&#x20AC;&#x2122;s lead to 3 three at the 6:48 mark. The teams again traded baskets but Chattanooga was able to take a late lead at the 4:07 mark on another three-point but a bucket in the paint by Brittany Frazier gave the Spartans a 58-57 lead with just under three minutes left LQWKHJDPHDQGWKH6SDUWDQVGHIHQVHKHOGWRJLYHWKHPWKHLUĂ&#x20AC;UVWFRQIHUence win. UNCG out-rebounded Chattanooga 49-31 and shot 39.4 percent IURPWKHĂ RRURQRIVKRRWLQJ The Spartans started the game slow, letting the Mocs take an early UXQWKURXJKWKHJDPHVĂ&#x20AC;UVWIRXUPLQXWHV.ULVWHQ%RRQHJRW81&*RQ the board at the 15:36 mark with a long jumper to cut the Chattanooga lead to 5-2 in the early goings. Irene Otamiri tied the game up with a long three-pointer but Chattanooga went on a 8-2 run to take a 14-8 lead with just overr 11 minutes remaining. UNCG was able to cut the Chattanooga lead to two behind a long two-pointer by Jasmine Byrd. The Spartans went on a 12-7 run over the last four minutes to take a 30-21 lead with just over three minutes to play in the half. The Spartans ended the half on a 14-8 run to take a 36-28 lead into the lockeroom. VISITORS: UNC Greensboro 8-5, 1-2 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 2-5 1-2 33 Latham, Kaleah f 6-14 1-1 44 Chamberlain, Meghanc1-2 0-0 21 Boone, Kristen g 3-10 1-2 24 Byrd, Jasmine g 6-15 2-4 03 Dixon, Jasmine 1-4 0-1 22 Brooks, Kemena 2-8 0-2 23 Ling, Ashley 0-0 0-0 40 Frazier, Brittany 5-8 0-0 TEAM Totals 26-66 5-12 200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 14-37 37.8% 1st Half: 3-9 33.3% 1st Half: 5-6 83.3%

HOME TEAM: Chattanooga 9-5, 2-1 tot-fg 3-pt ## Player fg-fga fg-fga min 32 SPANN, Kristen f 3-4 2-2 40 ANDERSON, Alex f 11-190-0 04 HATCHETT, Tagan g 2-5 2-5 10 HALL, Laura g 3-13 0-4 12 HAND, Brooke g 2-9 2-9 14 MOHR, Amy 0-2 0-1 15 WADE-FRAY, Jenaya 0-1 0-1 21 HUFF, Ashley 1-2 0-0 44 OGAN, Erin 1-2 0-1 TEAM Totals 23-57 6-23 6200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 8-26 30.8% 1st Half: 2-11 18.2% 1st Half: 10-14 71.4%

ft-fta

rebounds o- d-t pf tp a to bl s

0-0 4-6 1-2 8-10 1-1 0-0 0-0 0-0 0-0

4-8-12 7-2-9 3-1-4 0-2-2 0-1-1 1-3-4 2-4-6 0-2-2 2-6-8

14-19 20-29

3 3 2 1 4 4 1 3 2

5 17 3 15 15 2 4 0 10

4923

4 1 2 3 2 0 1 0 0 1 71

3 1 1 2 2 3 2 0 2

0 1 0 2 0 0 0 4 0 0 0 0 0 0 0 0 0 0 1 13 16 0

28 27 17 28 33 13 19 12 23 7

2nd Half: 12-29 41.4% Game: 39.4% 2nd Half: 2-3 66.7% Game: 41.7% 2nd Half: 9-13 69.2% Game: 73.7%

VISITORS: FURMAN (5-10, 0-4) tot-fg 3-pt ## Player fg-fga fg-fga min 41 MCKEMIE, Maggie f 4-11 0-0 50 LANGE, Jessica c 1-2 0-0 03 PHELPS, Chrissy g 3-5 0-1 11 STEPHENS, Lee g 0-4 0-2 12 LIEBSCHWAGER,Melissag1-5 0-1 20 BAKER, Sarah 3-5 0-2 21 HOLTFRETER, Kali 3-6 2-4 31 GILMORE, Adrienne 0-2 0-1 33 OPIE, Courtney 3-5 0-0 44 JOHNSON, Katie 3-7 0-0 54 AGIN, Katie 0-0 0-0 TEAM Totals 21-52 2-11 200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 12-27 44.4% 1st Half: 0-7 0.0% 1st Half: 2-2 100%

ft-fta o-d-t

rebounds pf tp a to bl s

2-2 0-0 2-2 2-2 0-0 0-0 0-0 0-0 0-3 3-5 0-0

4-5-9 2 10 1 3 0 0-1-1 1 2 0 2 2 0-3-3 0 8 0 2 0 0-0-0 2 2 0 5 0 0-0-0 0 2 0 1 0 2-1-3 0 6 1 0 0 2-0-2 2 8 0 3 0 0-4-4 3 0 4 1 0 0-1-1 1 6 0 1 0 3-4-7 3 9 0 3 3 0-0-0 0 0 0 2 0 2-4-6 2 9-14 13-23-36 14 53 6 25 5

2nd Half: 9-25 36.0% 2nd Half: 2-4 50.0% 2nd Half: 7-12 58.3%

2 0 2 1 0 1 1 2 1 0 0

27 18 27 17 21 17 15 23 13 20 2

10

Game: 40.4% Game: 18.2% Game: 64.3%

VISITORS: Georgia Southern 7-9, 2-3 tot-fg 3-pt ## Player fg-fga fg-fga min 13 WATERMAN, Christa f 2-4 0-0 52 JESSIE, Chequilla f 5-14 0-1 03 BROWN, Tiffany g 6-13 1-3 04 WHITNEY, Carolyn g 2-12 0-6 24 RIVENS, Ashley g 0-6 0-6 01 WHITNEY, Elise 0-0 0-0 15 OGBURN, Jâ&#x20AC;&#x2122;Lisia 1-2 0-0 22 HENRY, Concella 1-2 0-0 33 MELSON, Ashley 2-7 1-3 34 GEIGER, Jessica 1-1 1-1 TEAM Totals 200

ft-fta 3-4 6-9 0-0 0-0 2-2 1-2 0-0 2-4 2-3

rebounds o- d-t pf tp

0-4-4 7-7-14 1-2-3 0-3-3 0-3-3 0-2-2 0-0-0 0-0-0 0-0-0 1-1-2 16-24 9-22-31

0 3 1 2 3 4 2 2 3 20

11 28 6 6 8 1 0 4 4

a to bl s 3 2 1 5 4 1 0 0 0

1 1 2 5 2 0 1 1 0

0 3 0 1 0 0 0 0 0

1 1 0 3 0 0 1 0 0

33 38 23 37 37 14 9 3 6

68 16 13 4

2nd Half: 15-31 48.4% Game: 40.4% 2nd Half: 4-12 33.3% Game: 26.1% 2nd Half: 6-10 60.0% Game: 66.7%

2IĂ&#x20AC;FLDOV7HUUL0DGGRFN0DULVVD:KDOH\'DZQ0DUVK Technical fouls: UNC Greensboro-None. Chattanooga-None. Attendance: 1285 Score by Periods 1st 2nd Total UNC Greensboro 36 35 71 Chattanooga 28 40 68

HOME TEAM: UNCG (9-5, 2-2) tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 5-9 4-7 33 Latham, Kaleah f 2-6 0-0 44 Chamberlain, Meghanc 3-9 0-0 21 Boone, Kristen g 10-14 1-1 24 Byrd, Jasmine g 3-11 1-7 03 Dixon, Jasmine 0-5 0-0 12 Hyson, Lakiah 0-1 0-0 22 Brooks, Kemena 0-3 0-0 23 Ling, Ashley 0-0 0-0 30 Grimsley, Gini 0-2 0-0 40 Frazier, Brittany 2-4 0-0 TEAM Totals 25- 64 6-15 314200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 13-33 39.4% 1st Half: 4-10 40.0% 1st Half: 3-4 75.0%

ft-fta

rebounds o- d-t pf tp

0-0 1-2 4-6 6-7 0-0 0-0 0-0 0-0 0-1 0-0 0-1

3-4-7 3 14 3 2 2-3-5 3 5 0 1 1-2-3 1 10 1 0 3-0-3 1 27 5 2 0-2-2 0 7 4 0 1-1-2 3 0 0 1 0-0-0 1 0 0 1 0-0-0 0 0 0 0 2-0-2 0 0 0 4 1-3-4 0 0 0 1 3-4-7 4 4 1 6 5-2-7 2 11-17 21-21-42 16 67 14

0 1 1 0 0 0 0 0 0 1 0

4 2 0 6 1 1 0 0 0 0 0

20

2nd Half: 12-31 38.7% Game: 39.1% 2nd Half: 2-5 40.0% Game: 40.0% 2nd Half: 8-13 61.5% Game: 64.7%

2IĂ&#x20AC;FLDOV/DZVRQ1HZWRQ-RH6DOHUQR.DUHQ3UHDWR Technical fouls: FURMAN-None. UNCG-None.

TOTAL FG% 3-Pt. FG% F Throw %

a to bl s 27 26 25 32 30 13 3 10 9 10 15

TOTAL FG% 3-Pt. FG% F Throw %

2-2 4-5 2-2 2-2 0-3 0-0 0-0 0-0 2-2 0-0

0-2-2 2-5-7 1-2-3 0-2-2 1-2-3 0-0-0 0-1-1 1-3-4 4-3-7 0-0-0

3 4 3 1 2 2 0 2 0 1

6 14 15 6 0 0 2 2 7 3

0 3 3 4 4 2 1 0 2 0 2

0 2 0 0 0 1 0 0 0 1

1 0 3 1 1 1 1 0 1 0

9

12-16 9-22-31 18 55

9 19 4

1st Half: 9-26 34.6% 1st Half: 1-5 20.0% 1st Half: 9-13 69.2%

2nd Half: 11-35 31.4% 2nd Half: 2-15 13.3% 2nd Half: 3-3 100%

Game: 32.8% Game: 15.0% Game: 75.0%

rebounds ft-fta o-d-t pf tp

a to bl s

29-61 9-14

1st Half: 15-32 46.9% 1st Half: 6-9 66.7% 1st Half: 5-7 71.4%

0-0 2-5 0-0 1-2 3-4 0-1 0-0 2-2 0-0 0-0 5-6

1-6-7 1-4-5 1-7-8 1-3-4 2-2-4 1-4-5 0-0-0 0-0-0 1-1-2 2-3-5 3-1-4

2 2 0 4 0 1 0 2 1 3 2

13-20 13-34-47

9 7 4 7 25 2 0 2 0 9 15

17

6 2 1 3 1 2 0 0 5 1 1 3

1 3 2 4 1 3 1 0 1 1 5 3

1 0 2 1 0 1 0 0 0 1 2

3 2 1 3 2 1 0 0 0 0 1

80 22 22

2nd Half: 14-29 48.3% Game: 47.5% 2nd Half: 3-5 60.0% Game: 64.3% 2nd Half: 8-13 61.5% Game: 65.0%

2IĂ&#x20AC;FLDOV0HOLVVD/HZLV'DQ2XWODZ%RQQLH3HWWXV Technical fouls: Georgia Southern-Tiffany Brown. UNCG-None Attendance: 180 Score by Periods 1st 2nd Total Georgia Southern 28 27 55 UNCG 41 39 80

44 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

a to bl s 0 0 2 5 0 1 0 0 1 0 2

20-61 3-20

HOME TEAM: UNCG 10-5, 3-2 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 4-9 1-3 33 Latham, Kaleah f 2-4 1-1 44 Chamberlain, Meghanc 2-7 0-0 21 Boone, Kristen g 3-7 0-0 24 Byrd, Jasmine g 8-16 6-9 03 Dixon, Jasmine 1-4 0-0 12 Hyson, Lakiah 0-0 0-0 22 Brooks, Kemena 0-1 0-0 23 Ling, Ashley 0-0 0-0 30 Grimsley, Gini 4-4 1-1 40 Frazier, Brittany 5-9 0-0 TEAM Totals. 813200

rebounds ft-fta o-d-t pf tp

18 27 29 34 19 17 8 15 24 9

30 22 19 23 27 18 2 7 15 16 21


G18: College of Charleston 73, UNCG 61 January 15, 2007-Charleston, SC (John Kresse Arena)

GREENSBORO, NC-UNC Greensboro played a close game with VirJLQLD7HFKDQGKDGWKHOHDGGRZQWRĂ&#x20AC;YHSRLQWVDWRQHSRLQWEXWFRXOGQ¡W SXOORXWWKHLUĂ&#x20AC;IWKFRQVHFXWLYHYLFWRU\IDOOLQJLQZRPHQ¡VEDVNHWEDOO action at the Greensboro Coliseum Wednesday night. Senior Jasmine guard Jasmine Byrd led UNCG (10-6) with 10 points, while junior guard Kristen Boone chipped in nine. KaLeah Latham had DWHDPKLJKĂ&#x20AC;YHUHERXQGV%RRQHZKRKDGĂ&#x20AC;YHVWHDOVEHFDPH81&*¡V all-time steals leader with 282 career steals. She passes former Spartan great, Samika Foster, who had 279 career steals. â&#x20AC;&#x153;We had a tall order coming into today,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We were a tired basketball team, both physically and mentally and we just couldnâ&#x20AC;?t pull it out. The effort was there and we went out and competed the best that we could today. We had our chances but it got away from us.â&#x20AC;? Virginia Tech (11-7), who picked up their 500th program win, was led by Nare Diawara who had a double-double with 18 points and 12 rebounds. 9LUJLQLD7HFKVFRUHGWKHĂ&#x20AC;UVWEXFNHWRIWKHVHFRQGKDOISXVKLQJ the lead to 35-24 in the games early goings but UNCG responded with a bucket in the paint by KaLeah Latham to cut the lead to single digits 35-26 at the 17:35 mark of the half. The Hokies scored the games next six points, but Irene Otamiri got the Spartans back on the board with a jumper, to cut the lead to 41-30 at the 13:48 mark. Jasmine Dixon came off the bench and hit a long jumper to jumpstart the Spartans. Boone kept it going converting a three point play to cut the lead to 41-35 with a little overr 12 minutes remaining. The Spartans defense continued to fuel the offense forcing Tech into several hurried shots and a turnover but it was Tech who got on the board converting a three-point play to push the lead to 35-44. Gini Grimsley converted from just inside the arc to cut the lead to 37-44 and a layup E\%ULWWDQ\)UD]LHUFXWWKHOHDGWRĂ&#x20AC;YHEXW81&*FRXOGQ¡WVWRSWKH+RNLHV IDOOLQJIRUWKHĂ&#x20AC;UVWWLPHLQIRXUJDPHV UNCG shot 24.2 percent on 16-of-66 shooting and shot 62.5 percent from the free throw line. ,QWKHĂ&#x20AC;UVWKDOI81&*JRWRQWKHERDUGĂ&#x20AC;UVWZLWKDTXLFNEXFNHWE\ picking off a Virginia Tech pass to give the Spartans the early 2-0 lead, EXWLWZDV9LUJLQLD7HFKWKDWZHQWRQWKHJDPHVĂ&#x20AC;UVWUXQVFRULQJIRXU unanswered buckets to jump out to the early 8-2 lead at the 15:17 mark. Boone was able to get the Spartans on the board early but senior guard Jasmine Byrd sparked the Spartans offense late, scoringg 12 of 81&*¡VĂ&#x20AC;UVWSRLQWVLQFOXGLQJDWKUHHSRLQWHUODWHLQWKHKDOIZKLFKFXW Virginia Techâ&#x20AC;&#x2122;s lead to 33-24 heading into the lockeroom.

BOONE, NC â&#x20AC;&#x201C; UNC Greensboro held off a late Appalachian State run to defeat the Mountaineers, 61-68 Saturday afternoon in the Holmes Center. 81&*  KDGIRXUSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVOHGE\ Jasmine Byrd who had 18 points on 4-of12 shooting, including 3-of-6 from WKHOLQH,UHQH2WDPLULKDGĂ&#x20AC;YHUHERXQGVLQWKHYLFWRU\ â&#x20AC;&#x153;This was an important conference win for us,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We played well, but had some breakdowns late in the game but I was glad that we weâ&#x20AC;&#x2122;re able to pull it out in the end. Weâ&#x20AC;&#x2122;ve got another important game on Monday that weâ&#x20AC;&#x2122;ve got to get ready for.â&#x20AC;? 81&*VWDUWHGWKHVHFRQGKDOIPXFKOLNHWKH\HQGHGWKHĂ&#x20AC;UVWRSHQLQJZLWKDUXQLQWKHĂ&#x20AC;UVWIRXUPLQXWHVH[WHQGLQJWKHOHDGWRDW the 15:44 mark, the largest lead of the game. The defense continued to be stingy forcing ASU (8-9, 2-4) into three VKRWFORFNYLRODWLRQVLQWKHJDPHVĂ&#x20AC;UVWHLJKWPLQXWHVDQGRQO\DOORZLQJWZR Ă&#x20AC;HOGJRDOVSXVKLQJWKHOHDGWRDWWKHPDUN The Mountaineers were able to pick up a little momentum with quick buckets by S. Williams and Ketner but UNCG responded with several defensive stops and pulled the lead to 56-42 with 8:10 left in the game. Appalachian State found their offense with a little over three minutes left in the game, scoring eight unanswered points to cut the UNCG OHDGWRSRLQWVDQGJRWWKHOHDGGRZQWRĂ&#x20AC;YHEXW81&*VHDOHGWKHJDPH at the line for their fourth consecutive conference win. 7KH6SDUWDQVVFRUHGRQWKHJDPHVĂ&#x20AC;UVWSRVVHVVLRQWRWDNHDQHDUO\ lead in the games early goings, but Appalachian State responded with two buckets to keep the game close but went on a 6-0 run to take a 13-7 lead at the 15:50 mark. The teams traded buckets for the next few possessions and Appalachian built a 10-point, 23-13, lead but UNCG was able to cut into the lead with their defensive pressure. Irene Otamiri forced three consecutive steals leading to six unanswered Spartans points, cutting the lead to 23-20 at the 6:21 mark. 81&*WRRNDOHDGZLWKMXVWXQGHUĂ&#x20AC;YHPLQXWHVUHPDLQLQJDQG stretched it to six points behind a Jasmine Byrd three-pointer and layups by Kristen Boone and KaLeah Latham. UNCGâ&#x20AC;&#x2122;s defense continued to fuel their offense, as the Spartans ZHQWRQDUXQLQWKHĂ&#x20AC;QDOIRXUPLQXWHVRIWKHKDOIWDNLQJD KDOIWLPHOHDGDQGKROGLQJWKH0RXQWDLQHHUVWRWZRĂ&#x20AC;HOGJRDOVLQWKHĂ&#x20AC;QDO four minutes of the half. 7KH6SDUWDQVVKRWSHUFHQWLQWKHĂ&#x20AC;UVWKDOIDQGIRUFHG$SSDODchian State into 10 turnovers.

CHARLESTON, SC â&#x20AC;&#x201C; UNC Greensboro couldnâ&#x20AC;&#x2122;t overcome a 13 point Ă&#x20AC;UVWKDOIGHĂ&#x20AC;FLWIDOOLQJWR6RXWKHUQ&RQIHUHQFHULYDO&ROOHJHRI&KDUOHVWRQ 73-61 in womenâ&#x20AC;&#x2122;s basketball action at John Kresse Arena Monday afternoon. UNCG was led by Kristen Boone who had 14 points and KaLeah Latham who pulled down 11 rebounds â&#x20AC;&#x153;This was a win that we really needed to have,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We didnâ&#x20AC;&#x2122;t do a very good job of maintaining our focus from beginning to end today and dug ourselves too big of a hole. We have another game on Saturday and weâ&#x20AC;&#x2122;ve got to become a better basketball team before then.â&#x20AC;? 7KH6SDUWDQVVKRWRIIURPWKHĂ RRUDQGKDGUHERXQGVLQ the loss. College of Charleston was led by Nikki Williams who had 23 points, including six three-pointers. 81&*FDPHRXWLQWKHVHFRQGKDOIFROGIURPWKHĂ RRUKLWWLQJMXVW WZRĂ&#x20AC;HOGJRDOVLQWKHKDOYH¡VĂ&#x20AC;UVWQLQHPLQXWHV Charleston was able extend their lead to 45-29 behind back-to-back EXFNHWVIURP(ULND6PLWKDWWKHPDUN7KH6SDUWDQVEHJDQWRĂ&#x20AC;QG their offense midway through the half behind a layup from Kemena Brooks and a three-pointer by Kristen Boone, cutting the lead to 57-39, with eight minutes remaining. UNCG went on a 6-3 run to get score down to 63-50 with 3:34 remaining and pulled it down to nine points with just over a minute remainLQJEXWFRXOGQ¡WRYHUFRPHWKHLUODUJHĂ&#x20AC;UVWKDOIGHĂ&#x20AC;FLWGURSSLQJWKHLUĂ&#x20AC;UVW conference game this month. The Spartans came out of the gate slowly, allowing Charleston to UDWWOHRIIWKHJDPHVĂ&#x20AC;UVWIRXUEXFNHWVEXW-DVPLQH%\UGJRW81&*EDFN,Q the game with a three-pointer through the right side. Charleston responded by hitting back-to-back buckets to take an early 5-4 lead, but the Spartans got themselves back in the game with buckets by KaLeah Latham, Kristen Boone and Meghan Chamberlain to take a seven point lead with just under UNCG picked up their defensive pressure and jumpstarted their offense going on an 8-4 run to take an 18-12 lead with just underr 12 minutes left in the half. Charleston wouldnâ&#x20AC;&#x2122;t be discouraged and hit a three-pointer out of a media timeout to cut the lead to 18-15 and got it down to one point at the midway point of the half. 7KH&RXJDUVUDWWOHGRIIĂ&#x20AC;YHXQDQVZHUHGEXFNHWVWRVWRUPWRD lead with just over eight minutes remaining in the half, including back-toback three-pointers, another three-pointer by Natalie Williams pushed the lead to 10 points, 28-18 at the 7:20 mark. 81&*ZHQWVWRQHFRXOGIURPWKHĂ RRULQWKHĂ&#x20AC;QDOPLQXWHVRIWKHKDOI JRLQJDOPRVWQLQHPLQXWHVZLWKRXWDĂ&#x20AC;HOGJRDODQGDOORZLQJ&KDUOHVWRQ to jump out to a 32-18 lead before a free throw by KaLeah Latham put the Spartans on the board. UNCG was able to score eight more points but couldnâ&#x20AC;&#x2122;t stop the Cougars who led 40-27 at halftime.

VISITORS: Virginia Tech 11-7 tot-fg ## Player fg-fga min 11 Nare Diawara c 6-12 05 Kirby Copeland g 2-6 21 Brittany Cook g 6-10 22 Laura Haskins g 0-2 25 Britney Anderson g 3-6 12 Vionca Murray 1-2 13 Eleanor Brentnall 0-1 15 Utahya Drye 2-2 20 Lindsay Biggs 0-5 31 Amber Hall 2-4 TEAM Totals 22-50 200 TOTAL FG% 3-Pt. FG% F Throw %

3-pt rebounds fg-fga ft-fta o- d-t pf tp

a to bl s

0-0 0-1 0-1 0-0 0-0 0-0 0-0 0-0 0-3 0-0

2 4 4 2 1 0 0 2 1 1

6-8 0-0 0-1 0-0 0-2 2-2 0-0 2-4 0-0 2-2 1-1-2 0-5 12-19

1st Half: 12-29 41.4% 1st Half: 0-3 0.0% 1st Half: 9-12 75.0%

HOME TEAM: UNCG 10-6 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 3-6 1-1 33 Latham, Kaleah f 2-11 0-2 44 Chamberlain, Meghanc 2-10 0-0 21 Boone, Kristen g 2-11 0-3 24 Byrd, Jasmine g 4-11 2-4 03 Dixon, Jasmine 1-4 0-1 12 Hyson, Lakiah 0-0 0-0 22 Brooks, Kemena 0-1 0-1 23 Ling, Ashley 0-0 0-0 30 Grimsley, Gini 1-6 0-5 40 Frazier, Brittany 1-6 0-0 TEAM Totals 16-66 3-17 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 9-32 28.1% 1st Half: 3-10 30.0% 1st Half: 3-4 75.0%

2-10-12 2-3-5 1-6-7 1-5-6 1-6-7 1-1-2 0-0-0 0-5-5 0-3-3 0-3-3

1 3 0 1 3 2 0 2 2 1

18 4 12 0 6 4 0 6 0 6

4 9 1 5 4 2 0 3 1 1

2 0 0 0 1 0 0 0 1 0

0 1 2 1 3 0 0 1 0 0

30 25 34 26 25 9 2 20 14 15

9-43-52 15 56 17 30 4 8

2nd Half: 10-21 47.6% 2nd Half: 0-2 0.0% 2nd Half: 3-7 42.9%

a to bl s

0-0 0-0 0-0 5-7 0-0 0-1 3-4 0-0 0-0 0-0 2-4

1 0 0 2 1 2 0 2 3 0 0

0-4-4 4 7 1-4-5 0 4 0-1-1 1 4 2-2-4 3 9 1-0-1 0 10 0-4-4 3 2 0-0-0 0 3 0-1-1 3 0 0-2-2 1 0 0-0-0 0 2 1-2-3 3 4 5-3-8 10-16 10-23-3318 45 2nd Half: 7-34 20.6% 2nd Half: 0-7 0.0% 2nd Half: 7-12 58.3%

2IĂ&#x20AC;FLDOV/DZVRQ1HZWRQ%LOO.HDWRQ-RKQ$OPDURGH Technical fouls: Virginia Tech-None. UNCG-None. Attendance: Score by Periods 1st 2nd Total Virginia Tech 33 23 56 UNCG 24 21 45

TOTAL FG% 3-Pt. FG% F Throw %

Game: 44.0% Game: 0.0% Game: 63.2%

rebounds ft-fta o- d-t pf tp

2 0 0 6 1 4 0 0 0 1 2

0 0 0 0 0 0 0 0 0 1 0

3 0 0 5 3 2 0 0 0 1 1

26 21 15 28 24 19 4 10 12 16 25

11 16 115200 Game: 24.2% Game: 17.6% Game: 62.5%

VISITORS: UNC Greensboro 11-6, 4-2 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 04 Otamiri, Irene f 4-7 0-1 3-4 33 Latham, Kaleah f 2-8 0-1 2-4 44 Chamberlain, Meghanc 5-10 0-0 2-2 21 Boone, Kristen g 2-5 0-0 9-10 24 Byrd, Jasmine g 4-12 3-6 7-7 03 Dixon, Jasmine 0-5 0-1 1-2 22 Brooks, Kemena 1-4 0-0 0-0 23 Ling, Ashley 0-1 0-0 0-0 30 Grimsley, Gini 1-7 1-4 0-0 40 Frazier, Brittany 1-5 0-0 0-2 TEAM Totals 20-64 4-13 24-31 200 1st Half: 12-31 38.7% 1st Half: 2-5 40.0% 1st Half: 12-15 80.0%

1st Half: 11-25 44.0% 1st Half: 1-2 50.0% 1st Half: 7-10 70.0%

2-3-5 5 2-2-4 4 1-3-4 2 2-1-3 4 2-2-4 2 2-1-3 2 1-1-2 0 0-1-1 0 1-1-2 0 1-2-3 0 3-5-8 17-22-391968

tp a to bl s 11 6 12 13 18 1 2 0 3 2

310 100 121 450 310 030 000 110 011 012 1 13 16 4

5 0 2 4 0 0 0 1 1 0

25 21 26 28 28 16 15 12 12 17

13

2nd Half: 8-33 24.2% Game: 31.3% 2nd Half: 2-8 25.0% Game: 30.8% 2nd Half: 12-16 75.0% Game: 77.4%

HOME TEAM: Appalachian State 8-9, 2-4 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 13 BENNETT, Jaime f 3-9 0-1 2-2 34 MIXON, Brittany f 0-1 0-0 0-0 04 THOMAS, GiGi g 4-11 0-1 0-0 10 COSTNER, Carleena g 3-6 2-5 0-0 25 TOSSIE, Whitney g 6-9 1-2 5-6 03 WILLIAMS, Shante 0-0 0-0 0-0 12 GRIMES, Maria 0-4 0-0 2-4 20 KETNER, Whitney 4-9 0-1 4-5 30 RANDOLPH, Whitney 2-4 1-1 0-0 TEAM Totals 22-53 4-11 13-17 200 TOTAL FG% 3-Pt. FG% F Throw %

rebounds o- d-t pf

rebounds o-d-t pf tp a to 4-5-9 3 8 0-0-0 0 0 0-2-2 4 8 0-1-1 2 8 0-2-2 5 18 1-1-2 1 0 0-3-3 4 2 1-10-11 3 12 1-1-2 0 5 4-4-8 11-29-402261

1 3 1 2 1 3 4 5 4 0 0 2 4 5 1 4 1 1 2 17 27

Totals bl s 0 0 1 0 0 0 0 4 0

2 0 1 2 2 1 0 1 0

5

9

2nd Half: 11-28 39.3% Game: 41.5% 2nd Half: 3-9 33.3% Game: 36.4% 2nd Half: 6-7 85.7% Game: 76.5%

2IĂ&#x20AC;FLDOV&DURO\Q-RQHV0DUN,MDPHV*DUU\5REHUWV Technical fouls: UNC Greensboro-None. Appalachian State-None. Attendance: Score by Periods 1st 2nd Total UNC Greensboro 38 30 68 Appalachian State 30 31 61

VISITORS: UNC Greensboro 11-8, 4-3 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 2-8 1-3 33 Latham, Kaleah f 5-10 0-2 44 Chamberlain, Meghanc 3-7 0-0 21 Boone, Kristen g 4-15 2-6 24 Byrd, Jasmine g 2-12 2-4 03 Dixon, Jasmine 2-2 0-0 12 Hyson, Lakiah 0-0 0-0 22 Brooks, Kemena 1-8 0-3 23 Ling, Ashley 0-0 0-0 30 Grimsley, Gini 2-7 1-5 40 Frazier, Brittany 1-2 0-0 TEAM

28 12 33 19 31 10 22 33 12

TOTAL FG% 3-Pt. FG% F Throw %

22-71 6-23 1st Half: 8-32 25.0% 1st Half: 3-7 42.9% 1st Half: 8-14 57.1%

ft-fta o-d-t

rebounds pf tp a to bl s

3-4 1-2 2-2 4-5 0-0 0-0 0-0 0-0 1-2 0-0 0-4

5 4 1 4 2 2 1 2 1 1 0

1st Half: 14-31 45.2% 1st Half: 6-10 60.0% 1st Half: 6-10 60.0%

8 11 8 14 6 4 0 2 1 5 2

3 0 0 6 0 0 1 0 0 0 1

2 1 3 4 2 1 1 0 2 1 0 4

0 2 0 0 0 0 0 1 0 1 2 4

1 0 2 4 1 1 1 0 0 0 0 1

24 26 23 30 20 15 9 14 10 11 18

11-19 23-24-47 23 61 11 18 610200 2nd Half: 14-39 35.9% Game: 31.0% 2nd Half: 3-16 18.8% Game: 26.1% 2nd Half: 3-5 60.0% Game: 57.9%

HOME TEAM: College of Charleston 9-8, 5-2 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 20 MOYE, Sarah f 0-1 0-0 0-0 42 SMITH, Erika f 4-12 0-0 3-5 04 HUGHES, Jade g 5-8 1-3 5-7 12 FURSTENBURG, Jill g 4-12 1-4 1-4 21 WILLIAMS, Christina g 1-1 0-0 0-0 03 WILLIAMS, Erica 0-0 0-0 0-0 10 WILLIAMS, Nikki 8-12 6-9 1-2 22 SCOTT, Ashley 0-5 0-0 4-5 32 CHAMBERS, Melissa 1-1 0-0 2-2 41 JONES, Deidra 1-2 0-0 1-2 TEAM 3-1-4 Totals 24-54 8-16 17-27 6200 TOTAL FG% 3-Pt. FG% F Throw %

5-2-7 4-7-11 2-1-3 1-4-5 1-1-2 2-1-3 0-2-2 0-1-1 0-1-1 1-2-3 3-2-5

rebounds o- d-t pf tp

a to bl s

0-4-4 3-4-7 0-2-2 3-1-4 1-0-1 0-0-0 0-5-5 0-7-7 0-5-5 1-0-1

3 2 3 1 0 1 1 1 3 2

0 11 16 10 2 0 23 4 4 3

0 0 4 2 0 0 3 2 4 0

1 3 6 3 2 0 1 3 0 1

0 1 1 2 0 0 1 2 0 0

0 0 0 1 0 0 1 1 1 2

11-29-40

17

73 15 20 7

14 34 26 34 6 1 30 22 24 9

2nd Half: 10-23 43.5% Game: 44.4% 2nd Half: 2-6 33.3% Game: 50.0% 2nd Half: 11-17 64.7% Game: 63.0%

2IĂ&#x20AC;FLDOV'RFN6LVN'DYLG3LWRFN'HUULFN7D\ORU Technical fouls: UNC Greensboro-None. College of Charleston-None. Attendance: 388 Score by Periods 1st 2nd Total UNC Greensboro 27 34 61 College of Charleston 40 33 73

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 45

2006-07 Season Review

G17: UNCG 68, Appalachian State 61 January 13, 2007-Boone, NC (Holmes Center)

UNCGSpartans.com â&#x20AC;˘ UNCGSpa

G16: Virginia Tech 56, UNCG 45 January 9, 2007-Greensboro, NC (Greensboro Coliseum)


Spartans.com â&#x20AC;˘ UNCGSpartanss.

2006-07 Season Review

G19: UNCG 88, Elon 40

G20: UNCG 62, Wofford 54

G21: UNCG 78, Davidson 55

January 20, 2007-Greensboro, NC (Fleming Gym)

January 22, 2007-Spartanburg, SC (Johnson Arena)

January 27, 2007-Greensboro, NC (Fleming Gym)

GREENSBORO, NC â&#x20AC;&#x201C; UNC Greensboro had four players in doubles Ă&#x20AC;JXUHVDVWKH\GHIHDWHG6RXWKHUQFRQIHUHQFHIRHDQGEDFN\DUGULYDO(ORQ 88-40 in womenâ&#x20AC;&#x2122;s basketball action in Fleming Gymnasium. The 48 points was the Spartans largest margin of victory this season. UNCG (12-7, 5-3) was led by senior guard Jasmine Byrd who had 16 SRLQWVRQRIVKRRWLQJIURPWKHĂ RRULQFOXGLQJRIIURPEHKLQGWKH DUF,UHQH2WDPLULZDVRIIURPWKHĂ RRUIRUSRLQWVZKLOH0HJKDQ Chamberlain and Brittany Frazier pulled down seven rebounds each. â&#x20AC;&#x153;This was our picture perfect game,â&#x20AC;? head coach Lynne Agee said. Âľ7KLVLVWKHZD\WKDWZHVKRXOGSOD\HDFKWLPHZHVWHSRQWKHĂ RRUÂľ,ZDV very pleased with the effort that our team game. We tried to change up our defense a lot to keep on their toes and to play that way we needed to have a lot of effort, which is what we had today.â&#x20AC;? Elon (7-11, 2-6) was led by Rachel Hester who had 10 points and Shamica Spears who had 10 rebounds. (ORQVFRUHGWKHĂ&#x20AC;UVWEXFNHWRIWKHVHFRQGKDOIEXWWKH6SDUWDQVUHsponded with a bucket in the paint by KaLeah Latham extending the UNCG lead to 53-23 with just underr 18 minutes left in the half. The Spartans ZHUHXQVWRSSDEOHWKURXJKWKHJDPHVĂ&#x20AC;UVWIRXUPLQXWHVH[WHQGLQJWKHOHDG to 64-23 but Elon was able to score a few buckets to cut the lead to 66-28 at the 11:44 mark. UNCG continued to take it to the Phoneix outscoring WKHPWKURXJKWKHKDOIHQURXWHWRWKHLUĂ&#x20AC;IWKFRQIHUHQFHYLFWRU\ The Spartans opened the game well with a jumper by Byrd through WKHULJKWVLGHRQ81&*¡VĂ&#x20AC;UVWSRVVHVVLRQ(ORQFRXQWHUHGZLWKDEXFNHWWR even the score at 2-2 after a minute of play but it was all UNCG from that point. Back-to-back buckets by Kristen Boone gave UNCG an early lead, but it was steals on three consecutive possessions that gave UNCG a 15-6 lead at the 14:50 mark of the half. Elon came out and hit a bucket in the paint after a media timeout, cutting the lead to 35-18. The Phoneix were able to get the ball back by forcing a Spartan turnover, but Booneâ&#x20AC;&#x2122;s quick hands forced Elon into a turnover which the Spartans were able to convert on the other end, that coupled with a three-pointer through the right side by Byrd, pushed the lead to 22-8. The Spartans continued to apply the defensive pressure on Elon KROGLQJWKHPWRWKUHHĂ&#x20AC;HOGJRDOVLQWKHĂ&#x20AC;QDOHLJKWPLQXWHVRIWKHKDOIDQG forcing them into 17 turnovers. Buckets by Byrd and Otamiri and free throws by Jasmine Dixon pushed the UNCG lead to 34-16 with just under four minutes left to play in the half. UNCG went on a 12-4 run to close the half and take a 40-26 lead into the lockeroom. 81&*VKRWRIIURPWKHĂ RRUDQGZDVRIIURPEHKLQGWKH DUF2WDPLULZDVRIIURPWKHĂ RRUDQG%\UGZDVRIIURPWKHĂ RRU UNCG out-rebounded Elon 23-16 and picked up seven assists. VISITORS: ELON 7-11, 2-6 tot-fg 3-pt ## Player fg-fga fg-fga min 13 KING, Nikko f 1-4 0-0 52 WHIDDEN, Katie c 0-3 0-0 03 BUMBREY, Tierra g 3-4 1-2 05 MOORE, Shashonna g 1-3 0-0 34 ALLISON, Nicole g 2-8 0-3 10 HESTER, Rachel 1-11 1-7 21 DAVIS, Tiffany 1-8 0-0 23 WALL, Amber 0-4 0-0 24 WILLIAMS, Maxine 0-0 0-0 30 SPEARS, Shamica 2-4 0-0 45 COTTON, Urysla 0-3 0-0 TEAM Totals 11-52 2-12 7200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 8-29 27.6% 1st Half: 0-8 0.0% 1st Half: 4-5 80.0%

HOME TEAM: UNCG 12-7, 5-3 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 5-5 0-0 33 Latham, Kaleah f 5-10 1-2 44 Chamberlain, Meghanc 3-5 0-0 21 Boone, Kristen g 3-6 0-1 24 Byrd, Jasmine g 7-10 2-4 03 Dixon, Jasmine 2-3 0-0 12 Hyson, Lakiah 2-3 0-0 22 Brooks, Kemena 1-6 0-2 23 Ling, Ashley 1-1 0-0 30 Grimsley, Gini 2-6 1-1 40 Frazier, Brittany 4-10 0-0 TEAM Totals 35-65 4-10 514200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 17-33 51.5% 1st Half: 2-4 50.0% 1st Half: 10-12 83.3%

rebounds ft-fta o- d--t pf tp a to bl s 0-0 0-0 0-0 0-0 0-0 7-8 4-4 3-6 0-0 2-5 0-0

5-2-7 3 2 0-0-0 3 0 0-1-1 0 7 1-0-1 1 2 1-0-1 0 4 0-0-0 2 10 2-1-3 1 6 2-2-4 3 3 0-2-2 1 0 6-4-10 2 6 0-4-4 2 0 1-2-3 16-23 18-18-36 18

1 5 1 1 0 3 0 0 0 2 0 6 1 4 0 3 0 1 0 3 0 2 1 40 3

0 0 0 0 0 0 0 0 0 1 2

0 0 0 0 1 1 3 0 0 1 1

17 7 18 14 20 29 23 17 16 17 22

31 3

2nd Half: 3-23 13.0% Game: 21.2% 2nd Half: 2-4 50.0% Game: 16.7% 2nd Half: 12-18 66.7% Game: 69.6%

rebounds ft-fta o- d-t pf tp

a to bl s

0-0 0-1 2-2 1-1 0-0 6-8 0-1 3-4 0-0 2-2 0-0

2 0 0 10 2 0 1 2 4 2 1

2-1-3 0 4-1-5 3 3-4-7 0 1-2-3 1 0-3-3 2 1-4-5 3 0-1-1 2 0-3-3 1 0-2-2 2 1-0-1 4 2-5-7 2 1-2-3 14-19 15-28-43

10 11 8 7 16 10 4 5 2 7 8 20

0 1 0 3 2 2 1 1 1 3 3

0 0 1 0 0 1 2 0 0 0 1

2 0 0 3 2 1 0 1 1 0 4

SPARTANBURG, SC â&#x20AC;&#x201C; UNC Greensboro had three players in doubles Ă&#x20AC;JXUHVDVWKH\H[WHQGHGWKHLUZLQVWUHDNWRWZRZLWKDZLQRYHU Wofford in womenâ&#x20AC;&#x2122;s basketball action at Johnson Arena on Monday night. UNCG (13-7, 6-3) was led by senior guard Jasmine Byrd who had26 points on 8-of-14 shooting, while KaLeah Latham had a double-doubles with a team-high 10 rebounds and 10 points. â&#x20AC;&#x153;This was a crucial road win for usâ&#x20AC;?, head coach Lynne Agee said. â&#x20AC;&#x153;This was a win that we had to grind out from beginning to end and Iâ&#x20AC;&#x2122;m pleased with the defensive effort that our team gave down the stretch. We knew we had to keep our focus at the end and we did a nice job of maintaining it until the end.â&#x20AC;? Wofford (9-10, 3-6) was led by Liz Miller who had 16 points and Kelsi Koening who had eight rebounds. The Spartans started the second half with a bucket, taking their second lead of the game at 29-28 in the early goings of the second half. Wofford responded by forcing a turnover but stingy defense by UNCG forced a Wofford turnover on the next possession. The teams began to trade buckets again before UNCG jumped out to a 36-30 lead at the 16:17 mark. 7KH6SDUWDQVEHJDQWRĂ&#x20AC;QGWKHLURIIHQVHH[WHQGLQJWKHLUOHDG behind baskets from Meghan Chamberlain and Byrd, but Wofford was able to get a bucket on the inside cutting the UNCG lead to six-points with just underr 14 minutes to play. Wofford was able to capitalize on several UNCG turnovers prompting a 6-0 Wofford run to cut the lead to two-points with just underr 11 minutes UHPDLQLQJLQWKHJDPH%RRQHZDVDEOHWRH[WHQGWKHOHDGWRĂ&#x20AC;YHZLWKD three ball at the 7:37 mark. Woffordâ&#x20AC;&#x2122;s Kelly Dwywer cut the lead to two with a long two-pointer but a bucket by Brittany Frazier and a foul pushed WKH81&*OHDGEDFNWRĂ&#x20AC;YHEXWWKH7HUULHUVUHVSRQGHGZLWKDQRWKHUEXFNHW to bring it back to a three point game with four minutes remaining. Wofford ZDVDEOHWRFXWLWWRĂ&#x20AC;YHZLWKVHFRQGVOHIWEXW81&*IUHHWKURZVOHG the Spartans to their eighth consecutive win over the Terriers. UNCG started the game slowly, winning the tip and then promptly WXUQLQJWKHEDOORYHUWZLFHLQWKHĂ&#x20AC;UVWPLQXWHRISOD\:RIIRUGKLWDWKUHHWR take an early 4-7 lead at the 16:54 mark. The Terriers extended their lead WRĂ&#x20AC;YHZLWKDTXLFNEXFNHWLQWKHSDLQWEXW-DVPLQH%\UGJRWWKH6SDUWDQV back in with a long three to cut the lead to two points and a bucket by Boone tied the game at nine all with just underr 14 minutes remaining in the half. The teams traded buckets for the next several minutes before Wofford took a 22-17 lead behind a bucket in the paint and free throws at the 7:30 mark. Kristen Boone tried to give UNCG some momentum hitting a jumper and then forcing a turnover on the other end to cut the lead to 22-19, but it was the Terriers that went on the run jumping out to a 26-19 lead. UNCG was able to cut the lead to one at halftime but Wofford had a 28-27 advantage at the break. VISITORS: UNC Greensboro 13-7, 6-3 SoCon tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 04 Otamiri, Irene f 3-9 0-2 0-0 33 Latham, Kaleah f 4-7 0-0 2-4 44 Chamberlain, Meghanc 2-5 0-0 0-1 21 Boone, Kristen g 4-11 1-1 2-4 24 Byrd, Jasmine g 8-14 4-8 6-6 03 Dixon, Jasmine 0-1 0-0 0-1 12 Hyson, Lakiah 0-1 0-0 0-0 22 Brooks, Kemena 0-0 0-0 0-0 23 Ling, Ashley 0-0 0-0 0-0 30 Grimsley, Gini 0-3 0-1 2-2 40 Frazier, Brittany 1-2 0-0 1-1 TEAM Totals 22-53 5-12 13-19 200 TOTAL FG% 3-Pt. FG% F Throw %

16 19 17 21 22 17 16 15 19 15 23

88 24 17

2nd Half: 18-32 56.3% Game: 53.8% 2nd Half: 2-6 33.3% Game: 40.0% 2nd Half: 4-7 57.1% Game: 73.7%

2IĂ&#x20AC;FLDOV.ULVWL9HUD7RPP\6DOHUQR.DUHQ3UHDWR Technical fouls: ELON-None. UNCG-None. Attendance: 287 Score by Periods 1st 2nd Total ELON 20 20 40 UNCG 46 42 88

46 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

1st Half: 12-30 40.0% 1st Half: 3-8 37.5% 1st Half: 0-2 0.0%

HOME TEAM: Wofford 9-10, 3-6 SoCon tot-fg 3-pt ## Player fg-fga fg-fga min 15 KOENIG, Kelsi f 5-10 0-2 42 VARNO, Kathlyn f 0-1 0-0 10 MILLER, Liz g 4-12 3-7 20 NICHOLS, Summer g 2-7 0-0 23 CORRELL, K.C. g 0-2 0-2 11 YEE, Mary Jo 1-4 1-4 13 DWYER, Kelly 1-2 0-1 21 GRAMBLIN, Natalie 1-1 0-0 22 WEURDING, Jennifer 2-8 0-1 24 DEPKO, Laura 2-3 0-0 40 DEMPSEY, Kate 0-4 0-0 45 PAUL, Susanna 0-0 0-0 Team Totals 616200 TOTAL FG% 3-Pt. FG% F Throw %

18-54 4-17

1st Half: 10-28 35.7% 1st Half: 2-9 22.2% 1st Half: 6-12 50.0%

rebounds of-d-t pf tp a to 1-5-6 3 3-7-10 4 3-3-6 0 0-3-3 4 1-1-2 3 0-2-2 4 0-0-0 0 0-0-0 0 0-1-1 0 2-3-5 1 0-5-5 3 2-1-3 12-31-4322

6 10 4 11 26 0 0 0 0 2 3

4 1 2 4 0 0 0 0 0 0 1

4 5 3 3 2 0 1 1 5 0 1

bl s 1 0 1 0 0 1 0 0 0 1 0

62 12 25 4

5 1 0 0 2 1 0 0 0 1 0

34 22 21 29 34 14 1 4 10 13 18

10

2nd Half: 10-23 43.5% Game: 41.5% 2nd Half: 2-4 50.0% Game: 41.7% 2nd Half: 13-17 76.5% Game: 68.4%

rebounds ft-fta o-d-t pf tp 1-5 0-0 5-7 2-2 0-0 1-2 0-0 1-2 0-0 3-4 1-2 0-0

3-5-8 0-0-0 0-5-5 1-2-3 3-2-5 0-1-1 1-0-1 0-0-0 0-2-2 0-0-0 3-1-4 0-0-0

2 3 2 3 4 1 0 2 1 0 2 1

14-24 11-23-34

11 0 16 6 0 4 2 3 4 7 1 0

21

2nd Half: 8-26 30.8% 2nd Half: 2-8 25.0% 2nd Half: 8-12 66.7%

2IĂ&#x20AC;FLDOV'RXJODV&ORXG0DUFXV6PLWK/RUL-RQHV Technical fouls: UNC Greensboro-None. Wofford-None. Attendance: 181 Score by Periods 1st 2nd Total UNC Greensboro 27 35 62 Wofford 28 26 54

GREENSBORO, NC â&#x20AC;&#x201C; The UNC Greensboro Spartans used their best defensive outing of the season to route, league leader Davidson, 78-55 in womenâ&#x20AC;&#x2122;s basketball action at Fleming Gymnasium. UNCG held Davidson to 30.3 shooting, their lowest shooting percentage of the season. UNCG (14-7, 7-3) was led by Jasmine Byrd who was 9-of-15 from WKHĂ RRUIRUSRLQWV.D/HDK/DWKDPKDGKHUVHFRQGFRQVHFXWLYH double-double with 18 points and 11 rebounds, tying her career-high with herr 18 points. Kristen Boone also dished out a game-high nine assists. ´7KLVZDVRXUEHVWJDPHRQERWKHQGVRIWKHĂ RRUÂľKHDGFRDFK Lynne Agee said. â&#x20AC;&#x153;We were just solid from end line to end line and our WUDQVLWLRQZDVRXWVWDQGLQJGXHWRRXUWHUULĂ&#x20AC;FUHERXQGLQJHIIRUWVRQERWK ends. I was very pleased with the way this group responded and the effort that we put forth tonight. Davidson was led by Tia Washington who had a team-high eight points and Katie Hamiliton who had eight rebounds. Davidson (17-4, 8-2) began the second half with a sense of urgency NQRFNLQJGRZQWKHĂ&#x20AC;UVWIRXUEXFNHWVRIWKHKDOIEHIRUH%\UGDQG&KDPberlain got UNCG on the board to extend the lead to 43-24. Davidson used several quick fouls by UNCG to get to the line, converting on all four attempts at the charity stripe to cut the lead to 43-26. The Spartans continued to be balanced on the offensive side of the ball getting everyone involved, to push the lead to 52-30 at the 12:22 mark. Davidson didnâ&#x20AC;&#x2122;t give up but couldnâ&#x20AC;&#x2122;t cut the UNCG lead to less than 17 points in the second half as the Spartans went on to their third consecutive conference win. UNCG shot 50.8 percent for the game on RIVKRRWLQJIURPWKHĂ RRUDQGKDGDVVLVWVRQWKHDIWHUQRRQ Both teams started the game in defensive mode by coming up HPSW\RQWKHLUĂ&#x20AC;UVWSRVVHVVLRQV,WZDV/DWKDPWKDWJRWWKH6SDUWDQVRQ WKHERDUGĂ&#x20AC;UVWZLWKDTXLFNEXFNHWLQWKHSDLQW%\UGSXWWKH6SDUWDQVXS 4-0 with a layup but Davidson was able to cut the lead to two-points with a short jumper. The Wildcats found their rhythm and scored two unanswered buckets to take a 6-4 lead but UNCG wouldnâ&#x20AC;&#x2122;t be discouraged and found Irene Otamiri on the inside to keep the game tied at six all at the 15:29 mark of the half. UNCG used their defense to collect four rebounds which led to two buckets on the other end, giving UNCG an 11-6 lead with just underr 14 minutes remaining in the half. The Spartans continued to roll on the defensive end, stopping Davidsonâ&#x20AC;&#x2122;s inside players and pulling down the defensive boards. Sparked by Byrd UNCG went on a 14-0 run to take a 20-6 lead midway through the half. Davidson couldnâ&#x20AC;&#x2122;t get anything to fall, missing nine consecutive shots before a bucket by Washington stopped the four minute Wildcat drought. A bucket by Washington on the inside got Davidson into double digits with 10 points but a jumper by Byrd and a layup by Brittany Frazier extended the Spartan lead to 24-10. The Spartans used a 14-9 run over the last seven minutes of the game to take a 39-19 lead into the break. UNCG out-rebounded Davidson 25-20 and held a 24-9 points in the SDLQWDGYDQWDJHZKLOHVKRRWLQJSHUFHQWIURPWKHĂ RRURQRI VKRRWLQJLQWKHĂ&#x20AC;UVWKDOI VISITORS: DAVIDSON 17-4, 8-2 tot-fg 3-pt ## Player fg-ga fg-fga ft-fta o-d-t pf min 21 ROBINSON, Mercedesf1-3 0-0 3-6 2-2-4 1 44 HEMERKA, Danielle f 3-9 0-1 0-0 5-2-7 1 12 HAMILTON, Katie g 2-12 0-2 0-0 3-5-8 3 20 WASHINGTON, Tia g 4-9 0-1 0-1 1-4-5 1 25 MITCHELL, Jessica g 0-11 0-2 3-4 2-2-4 0 02 LAUNE, Monica 1-3 0-0 2-2 0-0 0 0 10 THOMPSON, Alex 1-5 0-2 2-2 0-2-2 1 14 HALBERSLEBEN, Mandy2-3 0-0 0-1 2-1-3 3 22 HOUSLEY, Honna 3-5 3-5 0-0 0-1-1 3 32 GASSIE, Kelly 1-3 0-1 0-0 0-0-0 1 35 PAQUETTE, Julia 2-3 0-0 2-4 0-0-0 2 TEAM 2-1-3 Totals 20- 66 3-14 12-2017-20-3716 TOTAL FG% 3-Pt. FG% F Throw %

a to bl s 1 0 4 1 2 0 0 0 1 0 1 0 5

2 2 5 1 3 0 0 1 0 3 3 0 5

0 0 0 0 0 0 2 0 4 0 0 0

4 0 5 1 1 0 3 0 0 1 1 0

54 10 20

Game: 33.3% Game: 23.5% Game: 58.3%

31 8 36 20 27 14 11 4 20 13 12 4

1st Half: 9-36 25.0% 1st Half: 1-5 20.0% 1st Half: 0-3 0.0%

rebounds tp a to 5 6 4 8 3 4 4 4 9 2 6

1st Half: 18-33 54.5% 1st Half: 3-7 42.9% 1st Half: 0-1 0.0%

1 6 2 1 2 2 1 1 2 2 0

bl s 0 1 0 0 0 0 0 0 0 0 0

1 0 2 4 0 0 4 1 1 0 2

21 26 30 30 23 6 14 16 16 5 13

55 11 20 115200

2nd Half: 11-30 36.7% Game: 30.3% 2nd Half: 2-9 22.2% Game: 21.4% 2nd Half: 12-17 70.6% Game: 60.0%

HOME TEAM: UNCG 14-7, 7-3 tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t pf min 04 Otamiri, Irene f 2-5 0-2 0-0 2-3-5 1 33 Latham, Kaleah f 9-14 0-1 0-1 0-11-11 1 44 Chamberlain, Meghanc 3-6 0-0 0-0 2-5-7 3 21 Boone, Kristen g 2-8 0-0 0-0 0-5-5 2 24 Byrd, Jasmine g 9-15 4-7 2-2 1-2-3 1 03 Dixon, Jasmine 1-1 0-0 6-6 1-2-3 1 12 Hyson, Lakiah 0-0 0-0 0-0 0-1-1 0 22 Brooks, Kemena 0-1 0-0 4-4 0-1-1 1 23 Ling, Ashley 0-0 0-0 0-0 0-1-1 0 30 Grimsley, Gini 1-3 0-0 0-0 0-0-0 0 40 Frazier, Brittany 4-8 0-0 0-0 4-2-6 3 TEAM Totals 31-614-1012-13 11-33-44 13 TOTAL FG% 3-Pt. FG% F Throw %

1 3 0 3 2 0 2 0 0 0 0

tp

a to bl s

4 18 6 4 24 8 0 4 0 2 8

5 1 0 0 1 1 0 0 0 1 0

1 3 0 2 1 2 1 1 1 9 5 2 2 1 0 0 5 0 0 0 0 0 1 1 2 1 0 2 0 1 1 5 0 1 1 78 20 23 7

9200

2nd Half: 13-28 46.4% Game: 50.8% 2nd Half: 1-3 33.3% Game: 40.0% 2nd Half: 12-12 100% Game: 92.3%

2IĂ&#x20AC;FLDOV%LOO.HDWRQ7RPP\6DOHUQR6FRWW:KLWW Technical fouls: DAVIDSON-None. UNCG-None. Attendance: 643 Score by Periods 1st 2nd Total DAVIDSON 19 36 55 UNCG 39 39 78

30 31 17 30 30 10 5 4 10 11 22


G24: UNCG 68, Georgia Southern 60 February 5, 2007-Statesboro, GA (Hanner Fieldhouse)

GREENSBORO, NC- UNC Greensboro had three players in doubles Ă&#x20AC;JXUHVEXWFRXOGQ¡WVROYH&KDWWDQRRJD¡VRXWVLGHJDPHIDOOLQJWR Southern Conference rival Chattanooga in Fleming Gymnasium Monday night in womenâ&#x20AC;&#x2122;s basketball action. Senior guard Irene Otamiri and junior Kristen Boone led the way for UNCG (14-8, 7-4) with 14 points each, while KaLeah Latham had eight rebounds. Jasmine Byrd was UNCGâ&#x20AC;&#x2122;s next leading scorer with 13 points. 2WDPLULDOVRWDOOLHGDJDPHKLJKĂ&#x20AC;YHVWHDOV â&#x20AC;&#x153;There are no excuses,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;This was probably the hardest weekend weâ&#x20AC;&#x2122;ve had, coming off a big game on Saturday against Davidson and then turning around and playing Chattanooga is challenging for anyone and we didnâ&#x20AC;&#x2122;t respond well. We didnâ&#x20AC;&#x2122;t play well WRGD\ZHZHUHPLVVLQJDVVLJQPHQWVQRWGHIHQGLQJDQGZHFRXOGQ¡WĂ&#x20AC;QG our focus and that just killed us tonight.â&#x20AC;? Chattanooga (16-6, 9-2) was led by Jenaya Wade-Fray who scored a career-high 24 points and went 6-for-6 from behind the arc. Alex Anderson and was Chattanoogaâ&#x20AC;&#x2122;s next leading scorer with 23 points and also pulled down a game-high nine rebounds. The teams started the second half slowly but two UNCG free throws cut the lead to 39-36 in the early goings of the half but free throws by Chattanooga pushed the lead up to six points. Ashley Ling dropped in a long jumper to cut the lead again but UNCG couldnâ&#x20AC;&#x2122;t stop the Mocs who pushed their lead to eight points at the 14:35 mark. Brittany Frazier wouldnâ&#x20AC;&#x2122;t let UNCG fade way scoring on the inside and a long jumper from Otamiri cut the lead to four points, but UTC again found the basket pushing their lead to seven points. Otamiri again rallied the troops by hitting back-to-back buckets to cut the lead to 49-47 with just underr 11 minutes left in the half. Chattanooga went on a 9-2 run to jump back out to a 47-55 lead at the 9:25 mark and was able to get their outside game going and pushed their lead to 69-51, the largest lead of the game, at the 5:47 mark. UNCG was able to rattle off three unanswered buckets to cut the lead to 61-71, EXWFRXOGQ¡WĂ&#x20AC;QGDQDQVZHUIRU&KDWWDQRRJD¡VWKUHHSRLQWVKRWVGURSSLQJ WKHLUĂ&#x20AC;UVWJDPHLQWKHLUODVWĂ&#x20AC;YHRXWLQJV Both teams started the games slowly but it was Chattanooga that JRWRQWKHERDUGĂ&#x20AC;UVWZLWKDEXFNHWE\/DXUD+DOO7KH6SDUWDQVFDPHXS HPSW\WKHLUĂ&#x20AC;UVWIHZSRVVHVVLRQVEXW%\UGKLWDMXPSHUWKURXJKWKHULJKW side to tie the game at two all the 18:06 mark. &KDWWDQRRJD¡V$QGHUVRQKLWWKHJDPHVĂ&#x20AC;UVWWKUHHDWWKHPDUN to give Chattanooga a one-point lead with just underr 16 minutes in the half but a bucket from Otamiri and a quick steal kept the lead at one, but several quick buckets by UTC extended their lead to 11-6, but an Otamiri trey to cut the lead to two points. The teams traded buckets for the next several minutes and UNCG was able to take a three-point lead at the 9:53 mark. Frazier hit a bucket in the paint to give UNCG a 5-0 run and a 22-17 lead, but a bucket by Chattanoogaâ&#x20AC;&#x2122;s Shanara Hollinquest cut the lead to 19-22 with just under eight minutes in the half. UNCG continued to press, coming up with a steal and a bucket on the other end, pushing the lead to 24-19 and Byrd hit a jumper but back-to-back points by Chattanooga tied the game at 26 apiece with four minutes remaining.

GREENVILLE, SC â&#x20AC;&#x201C; UNC Greensboro extended their win streak to Ă&#x20AC;YHDJDLQVW)XUPDQZLWKDZLQLQZRPHQ¡VEDVNHWEDOODFWLRQDW 7LPPRQV$UHQD81&*KDGWKUHHSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVDQGZDVOHGE\ KaLeah Latham who posted her third double in the last four outings with 15 points and 15 rebounds. .LUVWHQ%RRQHDQG-DVPLQH%\UGZHUHDOVRLQGRXEOHVĂ&#x20AC;JXUHVZLWK 11 and 10 points, respectively. Jasmine Dixon, Brittany Frazier and Boone were UNCGâ&#x20AC;&#x2122;s next leading rebounderâ&#x20AC;&#x2122;s with three rebounds each. â&#x20AC;&#x153;This was a tough game,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We knew that they would play us tough at home and they did. Our post players did an excellent job of providing us points in the paint and KaLeah Latham did a great job of leading us this afternoon. Iâ&#x20AC;&#x2122;m proud of the way that the team played together today.â&#x20AC;? 7KH6SDUWDQVVKRWSHUFHQWIURPWKHĂ RRUIRUWKHJDPHRQ of-52 shooting. UNCG also pulled down 38 rebounds and had 18 assists. Furman was led by Kali Holtfreter and Melissa Leibschwager who had 12 and 10 points, respectively. Maggie McKemie led Furman with seven rebounds. 81&*VWDUWHGWKHVHFRQGKDOIULJKWZKHUHLWĂ&#x20AC;QLVKHGWKHĂ&#x20AC;UVWKDOI going on an early 4-0 run to extend their lead to 32-20. Furman got their Ă&#x20AC;UVWSRLQWVRIWKHKDOIEHKLQGWZR.DWLH-RKQVRQIUHHWKURZVEXWLWZDVWKH Spartans that kept rattling off the points. Latham and Chamberlain were a IRUFHRQWKHLQVLGHFRPELQLQJIRUDOORIWKH6SDUWDQVSRLQWVLQWKHĂ&#x20AC;UVW Ă&#x20AC;YHPLQXWHVRIWKHKDOI UNCG found a spark off of the bench in Kemena Brooks, who came in and scored two three-pointers, and Gini Grimsley and Brittany Frazier who also tallied buckets as the Spartans extended their lead to 48-30 at the 11:17 mark. Furman found their offense and were able to score four buckets to take cut the UNCG lead to 36-50 points with eight minutes remaining. )XUPDQPDGHLWDJDPHLQWKHJDPHVĂ&#x20AC;QDOĂ&#x20AC;YHPLQXWHVJRLQJRQD 8-0 run to cut the lead to 44-50 with just under six minutes remaining but two back-to-back UNCG buckets pushed the lead back to 10 points. Sara Baker made things interesting draining a three from 15 feet to cut the lead to nine points with just under four minutes remaining. UNCGâ&#x20AC;&#x2122;s pressure defense proved to be too much for Furman who FRPPLWWHGWKUHHFUXFLDOWXUQRYHUVLQWKHJDPHVĂ&#x20AC;QDOWKUHHPLQXWHVRI action as UNCG held on for a 65-58 win. The Spartans started the second half slowly but were able to force Furman into several early miscues. Meghan Chamberlain got it going for UNCG on the inside with a bucket in the paint at the 18:19 mark giving UNCG the early lead. 81&*ZDVDEOHWRKROG)XUPDQZLWKRXWDĂ&#x20AC;HOGJRDOIRUWKHJDPHV Ă&#x20AC;UVWVHYHQPLQXWHVEXWWKUHHXQDQVZHUHG)XUPDQEXFNHWVJDYHWKH3DODdins a 7-5 lead at the 11:54 mark. The Spartans werenâ&#x20AC;&#x2122;t discouraged and used their defense to get back in the game, forcing Furman into several miscues resulting in baskets on the other end. UNCG regained the lead at the 7:12 mark then rattled off three buckets to take a 21-17 lead with just under four minutes remaining in the Ă&#x20AC;UVWVWDQ]D

STATESBORO, GA â&#x20AC;&#x201C; UNC Greensboro picked up its second sweep in as many days, defeating Georgia Southern 68-60 in womenâ&#x20AC;&#x2122;s basketball action Monday night. 81&*  KDGWKUHHSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVOHGE\ KaLeah Latham with a team-high 19 points and 13 rebounds. She shot 8RIIURPWKHĂ RRUDQGUHFRUGHGKHUVHFRQGFRQVHFXWLYHGRXEOHGRXEOH â&#x20AC;&#x153;This was a physical game, as expected,â&#x20AC;? said head coach Lynne Agee. â&#x20AC;&#x153;I was very proud of our effort on the defensive end of the court. We did a very good job of asserting ourselves down there, which turned into offense on the other end. We did a good job tonight.â&#x20AC;? GSU (9-15, 4-9) was led by Carolyn Whitney who had 15 points on 5-of-13 shooting. Whitney also had seven rebounds. 7KH6SDUWDQVVKRWSHUFHQWIURPWKHĂ RRUIRUWKHQLJKW81&* also pulled down 40 rebounds and had 12 assists. Meghan Chamberlain got things started in the second half, extendLQJWKH6SDUWDQV¡OHDGWRLQWKHĂ&#x20AC;UVWWKLUW\VHFRQGVE\FRQYHUWLQJ a conventional three-point play. UNCG played stellar defense forcing two GSU turnovers in the early going to extend the lead to 35-29 with 17:17 remaining. Georgia Southern was able to force several UNCG miscues and cut the Spartan lead to 41-33 with 12 minutes remaining, but it was all UNCG after that. The Spartans went on an 11-6 run over the next three minutes to jump out to a 52-39 lead with 8:38 remaining. Georgia Southern got as close as eight points but UNCG held on en route to its second consecutive win and a sweep of the Eagles. Junior forward Jasmine Dixon provided an offensive lift for UNCG off of the bench, coming in to score a season-high 11 points, including 5-of-6 from the charity stripe. 7KH6SDUWDQVMXPSHGRXWWRDOHDGLQWKHJDPHVĂ&#x20AC;UVWWKUHHPLQutes but two quick unanswered baskets by Georgia Southern tied the game at 5-5 at the 16:47 mark. Irene Otamiri put UNCG up again with a short jumper but a bucket in the paint by GSUâ&#x20AC;&#x2122;s Shawnda Atwood again tied the game, 9-9, with just underr 14 minutes remaining before intermission. The teams traded buckets on the next few possessions but UNCG ZDVDEOHWRMXPSRXWWRDĂ&#x20AC;YHSRLQWOHDGEHKLQGEXFNHWVIURP/DWKDP Kristen Boone and Jasmine Dixon. Georgia Southern was able to cut into the lead behind a three-pointer from Jessica Geiger at the 8:27 mark of the half. *68ZDVDEOHWRWDNHLWVĂ&#x20AC;UVWOHDGRIWKHHYHQLQJZLWKOHIWLQ the half, but UNCG responded with a quick 4-0 spurt, sparked by Latham to take a 24-21 lead with 3:55 left in the half. The teams traded buckets LQWKHĂ&#x20AC;QDOPLQXWHVRIWKHKDOIDQG81&*WRRNDDGYDQWDJHLQWRWKH break. Latham led the Spartans with a game-high 12 points at the break, ZHOODERYHKHUĂ&#x20AC;UVWKDOIDYHUDJHWKLVVHDVRQ81&*DOVRSXOOHGGRZQ UHERXQGVLQWKHĂ&#x20AC;UVWPLQXWHV

VISITORS: Chattanooga 16-6, 9-2 tot-fg 3-pt ## Player fg-fga fg-fga min 32 SPANN, Kristen f 0-4 0-1 40 ANDERSON, Alex f 8-13 1-1 04 HATCHETT, Tagan g 1-4 0-2 10 HALL, Laura g 3-12 0-6 12 HAND, Brooke g 1-7 1-7 14 MOHR, Amy 2-3 0-0 15 WADE-FRAY, Jenaya 8-9 6-6 44 OGAN, Erin 3-3 3-3 50 HOLLINQUEST, Shanara2-5 0-0 TEAM Totals 28-60 11-26 200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 16-37 43.2% 1st Half: 5-15 33.3% 1st Half: 2-3 66.7%

HOME TEAM: UNCG 14-8, 7-4 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 6-10 2-5 33 Latham, Kaleah f 4-8 0-0 44 Chamberlain, Meghanc1-6 0-0 21 Boone, Kristen g 6-13 2-2 24 Byrd, Jasmine g 5-13 1-7 03 Dixon, Jasmine 1-2 0-0 22 Brooks, Kemena 1-2 0-0 23 Ling, Ashley 1-1 0-0 30 Grimsley, Gini 0-2 0-0 40 Frazier, Brittany 4-5 0-0 TEAM Totals 29-62 5-14 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 16-31 51.6% 1st Half: 2-4 50.0% 1st Half: 0-0 0.0%

rebounds ft-fta o- d-t pf tp

a to bl s

2-2 6-11 2-2 0-0 0-0 3-3 2-2 1-2 0-0

0 5 0 1 1 4 0 2 1

0-0-0 1 2 1-8-9 1 23 0-1-1 3 4 0-1-1 0 6 4-3-7 1 3 0-2-2 0 7 1-0-1 0 24 0-3-3 0 10 4-0-4 1 4 2-5-7 16-22 12-23-357 83

0 7 0 2 1 1 1 0 1

0 1 0 0 0 0 0 0 0

0 1 0 2 3 1 1 0 0

12 35 16 22 34 18 30 22 11

14 13 1 8

TOTAL FG% 3-Pt. FG% F Throw %

2nd Half: 12-23 52.2% Game: 46.7% 2nd Half: 6-11 54.5% Game: 42.3% 2nd Half: 14-19 73.7% Game: 72.7%

rebounds ft-fta o- d--t pf tp 0-0 0-0 0-0 0-0 2-2 0-0 0-0 0-0 0-0 1-2

2-4-6 2-6-8 1-4-5 3-2-5 0-1-1 0-1-1 0-0-0 0-1-1 0-1-1 0-4-4

3 4 1 4 1 3 0 0 3 0

14 8 2 14 13 2 2 2 0 9

3-4

10-24-3419 66

2nd Half: 13-31 41.9% 2nd Half: 3-10 30.0% 2nd Half: 3-4 75.0%

2IĂ&#x20AC;FLDOV-RKQ$OPDURGH0DUN-DPHV.DUHQ3UHDWR Technical fouls: Chattanooga-None. UNCG-None. Attendance: 408 Score by Periods 1st 2nd Total Chattanooga 39 44 83 UNCG 34 32 66

a to bl s 5 3 0 4 2 0 0 0 1 4 2 19

2 2 1 4 2 5 0 1 0 0

0 0 2 0 0 1 0 0 1 2 2 17 6

5 1 0 2 0 0 0 0 0 1

31 28 13 33 31 13 10 6 11 24

9200

Game: 46.8% Game: 35.7% Game: 75.0%

VISITORS: UNCG 15-8, 8-4 SoCon tot-fg 3-pt ## Player fg-fga fg-fga min 33 Latham, Kaleah f 7-9 0-0 44 Chamberlain, Meghan c4-6 0-0 04 Otamiri, Irene g 2-4 0-2 21 Boone, Kristen g 4-8 1-1 24 Byrd, Jasmine g 4-13 2-11 03 Dixon, Jasmine 1-2 0-0 12 Hyson, Lakiah 0-0 0-0 22 Brooks, Kemena 2-3 2-3 23 Ling, Ashley 0-1 0-1 30 Grimsley, Gini 1-1 1-1 40 Frazier, Brittany 2-5 0-0 TEAM Totals 27-52 6-19 7200 1st Half: 12-28 42.9% 1st Half: 2-9 22.2% 1st Half: 2-5 40.0%

rebounds ft-fta o- d-t pf tp

a to bl s

1-2 0-0 0-0 2-4 0-0 0-0 0-0 1-2 0-0 0-0 1-3

3 1 2 4 1 1 1 1 2 0 2

5-11

4-11-15 2 1-0-1 1 1-0-1 1 2-1-3 2 0-0-0 1 1-2-3 4 0-0-0 1 0-1-1 2 0-0-0 0 1-0-1 3 0-3-3 4 3-7-10 13-25-3821

15 8 4 11 10 2 0 7 0 3 5

1st Half: 8-22 36.4% 1st Half: 2-5 40.0% 1st Half: 2-4 50.0%

0 1 0 0 0 0 0 0 0 0 1

1 1 1 3 1 0 0 0 0 0 0

34 14 22 32 31 13 5 9 8 13 19

TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 12-26 46.2% 1st Half: 1-6 16.7% 1st Half: 2-3 66.7%

rebounds o- d-t pf tp

a to bl s

1-5-6 1 7 5-8-13 1 19 0-4-4 3 6 1-1-2 4 16 0-2-2 1 5 1-1-2 0 11 1-1-2 1 2 0-0-0 2 0 1-1-2 2 2 2-2-4 0 0 1-2-3 13-27-4015 68

2 1 1 4 2 0 0 1 0 1

1 4 3 1 2 0 2 1 0 3

1 0 0 0 0 0 0 0 0 0

12 17 1

1 1 0 1 3 0 0 0 1 0

29 30 21 33 35 14 6 8 9 15

7200

2nd Half: 12-31 38.7% Game: 42.1% 2nd Half: 0-2 0.0% Game: 12.5% 2nd Half: 17-20 85.0% Game: 82.6%

65 18 20 2

2nd Half: 15-24 62.5% Game: 51.9% 2nd Half: 4-10 40.0% Game: 31.6% 2nd Half: 3-6 50.0% Game: 45.5%

HOME TEAM: Furman 7-16, 2-10 SoCon tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t pf tp min 41 MCKEMIE, Maggie f 1-6 0-1 4-6 4-3-7 2 6 44 JOHNSON, Katie c 1-1 0-0 2-2 0-0-0 3 4 03 PHELPS, Chrissy g 3-11 0-0 3-4 0-2-2 1 9 20 BAKER, Sarah g 3-8 2-5 1-1 0-2-2 0 9 21 HOLTFRETER, Kali g 4-7 2-3 2-4 1-0-1 0 12 11 STEPHENS, Lee 0-3 0-1 0-0 1-1-2 1 0 12 LIEBSCHWAGER,Melissa3-5 1-2 3-5 1-0-1 1 10 31 GILMORE, Adrienne 0-0 0-0 0-0 0-0-0 1 0 33 OPIE, Courtney 2-3 0-0 0-0 0-2-2 3 4 50 LANGE, Jessica 0-3 0-0 0-0 1-3-4 1 0 54 AGIN, Katie 1-1 0-0 2-2 0-1-1 2 4 TEAM Totals 18-485-1217-24 8-16-24 15 200 TOTAL FG% 3-Pt. FG% F Throw %

3 0 5 4 1 1 0 1 1 2 2

VISITORS: UNC Greensboro 16-8 (9-4 SoCon) tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 04 Otamiri, Irene f 3-7 0-3 1-1 33 Latham, Kaleah f 8-12 0-0 3-4 44 Chamberlain, Meghanc 2-4 0-0 2-3 21 Boone, Kristen g 5-11 1-2 5-5 24 Byrd, Jasmine g 1-11 0-3 3-4 03 Dixon, Jasmine 3-3 0-0 5-6 22 Brooks, Kemena 1-1 0-0 0-0 23 Ling, Ashley 0-0 0-0 0-0 30 Grimsley, Gini 1-3 0-0 0-0 40 Frazier, Brittany 0-5 0-0 0-0 TEAM Totals 24-57 1-8 19-23

a to bl s 3 0 1 1 2 2 0 1 0 1 0

4 1 4 0 3 2 0 0 0 0 0 2 58 11

0 0 0 1 0 0 0 0 0 1 0 2 14

4 2 5 0 1 0 0 0 1 0 0

27 11 34 27 31 14 13 2 13 20 8

2 13

2nd Half: 10-26 38.5% Game: 37.5% 2nd Half: 3-7 42.9% Game: 41.7% 2nd Half: 15-20 75.0% Game: 70.8%

HOME TEAM: Georgia Southern 9-15 (4-9 SoCon) tot-fg 3-pt rebounds ## Player fg-fga fg-fga ft-fta o-d-t pf tp 23 ATWOOD, Shawnda f 4-5 0-1 0-0 2-4-6 2 8 52 JESSIE, Chequilla f 0-6 0-0 3-4 2-2-4 2 3 03 BROWN, Tiffany g 4-12 0-4 1-2 1-3-4 3 9 04 WHITNEY, Carolyn g 5-13 2-7 3-3 2-5-7 4 15 24 RIVENS, Ashley g 4-9 3-7 0-0 0-0-0 4 11 10 YOUNGBLOOD, Taylor 0-0 0-0 0-0 0-0-0 0 0 13 WATERMAN, Christa 0-1 0-0 0-0 0-0-0 0 0 15 OGBURN, Jâ&#x20AC;&#x2122;Lisia 0-1 0-0 0-0 1-2-3 3 0 22 HENRY, Concella 0-0 0-0 0-0 0-0-0 2 0 33 MELSON, Ashley 3-9 2-7 0-0 2-4-6 2 8 34 GEIGER, Jessica 1-2 1-2 3-4 0-1-1 1 6 TEAM 2-2-4 Totals 21-58 8-28 10-13 12-23-3523 60 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 8-26 30.8% 1st Half: 3-13 23.1% 1st Half: 5-6 83.3%

a 1 1 1 4 3 0 0 0 0 0 1

to 3 1 5 3 0 0 0 3 0 3 1

bl 0 0 0 0 0 0 0 0 0 0 0

s 1 1 0 2 1 0 0 0 0 0 1

min 27 20 36 34 27 0+ 4 8 4 24 16

11 19 0 6200

2nd Half: 13-32 40.6% Game: 36.2% 2nd Half: 5-15 33.3% Game: 28.6% 2nd Half: 5-7 71.4% Game: 76.9%

2IĂ&#x20AC;FLDOV'RFN6LVN7HUUL0DGGRFN'DZQ0DUVK Technical fouls: UNC Greensboro-None. Georgia Southern-None. Attendance: 591 Score by Periods 1st 2nd Total UNC Greensboro 27 41 68 Georgia Southern 24 36 60

2IĂ&#x20AC;FLDOV0HOLVVD/HZLV6XVDQ%DUJR/RUL-RQHV Technical fouls: UNCG-None. Furman-None. Attendance: 586 Score by Periods 1st 2nd Total UNCG 28 37 65 Furman 20 38 58

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 47

2006-07 Season Review

G23: UNCG 65, Furman 58 February 3, 2007-Greenville, SC (Timmons Arena)

UNCGSpartans.com â&#x20AC;˘ UNCGSpa

G22: Chattanooga 83, UNCG 66 January 29, 2007-Greensboro, NC (Fleming Gym)


Spartans.com â&#x20AC;˘ UNCGSpartanss.

2006-07 Season Review

G25: UNCG 81, Appalachian State 66

G26: UNCG 70, College of Charleston 61

G27: UNCG 57, Elon 48

February 10, 2007-Greensboro, NC (Fleming Gym)

Februaryy 12, 2007-Greensboro, NC (Fleming Gym)

February 17, 2007-Elon, NC (Alumni Gym)

GREENSBORO, NC â&#x20AC;&#x201C; The UNC Greensboro womenâ&#x20AC;&#x2122;s basketball team KDGIRXUSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVDVWKH6SDUWDQVGHIHDWHG$SSDODFKLDQ State, 81-62 in womenâ&#x20AC;&#x2122;s basketball action at Fleming Gymnasium Saturday afternoon. The win gives UNCG theirr 10th win in Southern Conference action and extends their current win streak to three games. -XQLRU.ULVWHQ%RRQHOHDG81&*  Ă&#x20AC;QLVKLQJZLWKDJDPH KLJKSRLQWVRQRIVKRRWLQJIURPWKHĂ RRU6KHDOVRGLVKHGRXWVL[ assists and was 4-of-5 from the charity stripe. Irene Otamiri was UNCGâ&#x20AC;&#x2122;s next leading scorer, tallying a season-high 16 points. Otamiri also had a FDUHHUKLJKVL[VWHDOVRQWKHDIWHUQRRQ%ULWWDQ\)UD]LHUZKRKDGKHUĂ&#x20AC;UVW double-double of the season, pulled down a team-high 11 rebounds. The Spartans also had three players perfect from the free throw line. Frazier was 6-of-6 from the line, while KaLeah Latham and Kemena Brooks were 4-of-4 from the stripe. â&#x20AC;&#x153;We were a little sluggish in the beginning of the game,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We did a good job of settling down and picking up the pressure in the second half. I was very pleased with the way Brittany Frazier played this afternoon. She played a physical game and really turned in a great performance for us.â&#x20AC;? Appalachian State (11-14, 5-9) was led by Whitney Tossie who had SRLQWVRQRIVKRRWLQJIURPWKHĂ&#x20AC;HOGDQG-DPLH%HQQHWWZKRSXOOHG down 12 rebounds. Appalachian State got out to the early lead out of the gates, starting WKHJDPHRQDUXQLQWKHJDPHVĂ&#x20AC;UVWWZRPLQXWHV Boone got the Spartans offense going and was able to cut the Appalachian State lead to 8-6 with a bucket in the paint at the 16:03 mark, but the Mountaineers got a bucket from Thomas on the next possession and pushed the lead back to four points before UNCG tied the game up at 10-10 with two unanswered buckets from Boone and Otamiri. 7KH6SDUWDQVWRRNWKHLUĂ&#x20AC;UVWOHDGRIWKHJDPHRQWKHQH[WSRVVHVsion and went on a quick 6-0 run to push the lead to 16-10 at the 13:22 mark but Appalachian State went on a small run of their own and was able to tie the game att 16-16 with just overr 12 minutes remaining in the half. The teams traded buckets over the next several minutes but the Spartans were able to jump out to a 42-29 lead with just under three minutes remaining in the half but Appalachian State went on an 11-2 run to close the half sending the Spartans into the lockeroom with a 44-39 lead. 81&*VFRUHGWKHĂ&#x20AC;UVWĂ&#x20AC;YHSRLQWVRIWKHVHFRQGKDOIWRPDNHLW with 18:23 remaining and then used their defense to create offense the rest of the afternoon and were able to go on several runs to put the game out of reach. UNCGâ&#x20AC;&#x2122;s largest lead of the game was 20 points, which came in the JDPHVĂ&#x20AC;QDOPLQXWH$SSDODFKLDQ6WDWHWULHGWRGLJWKHPVHOYHVRXWRIWKH KROHEXWFRXOGQ¡WĂ&#x20AC;QGHQRXJKRIIHQVHDVWKH6SDUWDQVFUXLVHGWRWKHLU third consecutive victory. 7KH6SDUWDQVĂ&#x20AC;QLVKHGWKHJDPHVKRRWLQJSHUFHQWRQRI VKRRWLQJIURPWKHĂ RRUDQGSXOOHGGRZQUHERXQGV81&*KDGDGHcided advantage in the paint, scoring 30 points in the paint to Appalachian Stateâ&#x20AC;&#x2122;s 18. The Spartans also got help from their bench who contributed 24 points.

GREENSBORO, NC â&#x20AC;&#x201C; UNC Greensboro withstood a late 11 point Cougar rally sparked by back-to-back three pointers by Jade Hughes to defeat College of Charleston, 70-61 in womenâ&#x20AC;&#x2122;s basketball action at Fleming Gymnasium on Monday evening. The win gives UNCG its fourth consecutive win and extends its current home win streak to two games. 7KH6SDUWDQVKDGIRXUSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVDQGZDVOHGE\ senior Jasmine Byrd who tallied 23 points on 8-of-16 shooting from the Ă&#x20AC;HOG,UHQH2WDPLUL.ULVWHQ%RRQHDQG%ULWWDQ\)UD]LHUZHUHDOOLQGRXEOHV Ă&#x20AC;JXUHVIRUWKHVHFRQGFRQVHFXWLYHJDPHDQG)UD]LHUSRVWHGKHUVHFRQG consecutive double-double with 10 points and 10 rebounds. Senior KaLeah Latham tallied a team-high 11 rebounds while Otamiri also tallied four steals. Sophomore Gini Grimsley dished out a career-high four assists in the victory. ´7KLVZDVDSUHWW\JDPHLQWKHĂ&#x20AC;UVWKDOI´KHDGFRDFK/\QQH$JHH VDLG´:HFDPHRXWDQGSOD\HGYHU\ZHOOLQWKHĂ&#x20AC;UVWKDOIZHZHUHDEOHWR Ă&#x20AC;QGHDFKRWKHUDQGGRWKHWKLQJVWKDWZHQHHGHGWRGRWRSXWRXUVHOYHV ahead. I think we hit a bit of a wall in the second half but we did manage to regroup and buckle down when we needed to in order to pull out the win.â&#x20AC;? College of Charleston (10-16, 5-10) was led by Jade Hughes who VFRUHGSRLQWVRQRIVKRRWLQJIURPWKHĂ RRU+XJKHVZDVDOVR 3-of-6 from behind the arc and Sarah Moye pulled down a game-high 14 rebounds. Charleston opened the second half by forcing three consecutive UNCG turnovers which led to six Charleston points cutting the UNCG lead to 35-24 at the 18:45 mark of the half. Otamiri provided the spark that UNCG needed to regain some momentum and on the next possession, she forced a College of Charleston turnover and hit a bucket in the paint to push the lead back to 13 points. UNCG then went on a 12-2 run over the next three minutes to extend its lead to 47-26 at the 15:58 mark and a layup by Jasmine Dixon gave the Spartans their largest lead of the afternoon at 23 points. Charleston was DEOHWRĂ&#x20AC;QGWKHLURIIHQVHPLGZD\WKURXJKWKHKDOIDQGWKH&RXJDUVZHQWRQ a 22-10 run over the next seven minutes to cut the lead to 11 points with less than six minutes to go. The teams traded buckets on the next few possessions but the Spartans saw Charleston mount another run, this time sparked by back-toback three-pointers by Hughes, which cut the lead to 62-57 with 1:26 left LQWKHJDPH81&*ZKRKDGPLVVHGĂ&#x20AC;YHFRQVHFXWLYHIUHHWKURZVODWHLQ the game, sealed the win from the line by hitting their last eight free throws en route to its fourth consecutive victory. 81&*VKRWSHUFHQWIURPWKHĂ&#x20AC;HOGRQRIVKRRWLQJDQG grabbed 43 rebounds, including 29 defensive boards. The Spartans started the game quickly by jumping out to a 10-3 OHDGLQWKHJDPHVĂ&#x20AC;UVWĂ&#x20AC;YHPLQXWHVRISOD\)UD]LHUJRWWKLQJVVWDUWHGZLWKD EXFNHWLQWKHSDLQWRQWKHĂ&#x20AC;UVWSRVVHVVLRQDQGKHUWHDPPDWHVUHVSRQGHG with four unanswered buckets. &ROOHJHRI&KDUOHVWRQJRWWKHLUĂ&#x20AC;UVWĂ&#x20AC;HOGJRDORIWKHKDOIDWWKH mark with a three-pointer by Nikki Williams but it was all UNCG the rest of the way as the Spartans went on a 13-5 run to push their lead to 27-5 at the 7:16 mark.

ELON, NC â&#x20AC;&#x201C; Despite a slow start, the UNC Greensboro womenâ&#x20AC;&#x2122;s basketball team topped Southern Conference rival Elon, 57-48 to extend WKHLUZLQVWUHDNWRĂ&#x20AC;YHRQ6DWXUGD\DIWHUQRRQDW$OXPQL*\P 81&*  ZDVOHGE\VHQLRU.D/HDK/DWKDPZKRĂ&#x20AC;QLVKHG ZLWKDJDPHKLJKSRLQWVRQIRUVKRRWLQJIURPWKHĂ&#x20AC;HOG7KH$WKens, TN native also tallied eight rebounds. Junior Kristen Boone followed with 12 points and three assists, while junior Brittany Frazier grabbed a game-high 11 rebounds. â&#x20AC;&#x153;I am very pleased with the way we played the inside game,â&#x20AC;? stated head coach Lynne Agee. â&#x20AC;&#x153;Although we are now a lot smaller in the paint without Meghan (Chamberlain), our post game did an excellent job and played great for us. Our transition game was also strength for us today and gave us some good spurts.â&#x20AC;? 7LIIDQ\'DYLVZDVWKHRQO\(ORQSOD\HULQGRXEOHĂ&#x20AC;JXUHVZLWK points. Nikko King added eight points along with 10 rebounds. The Phoenix (10-17, 4-12) opened the game by going on a 6-0 run DQGIRUFHGWKH6SDUWDQVWRJRIRUIURPWKHĂ&#x20AC;HOG/DWKDP¡VEXFNHWDW WKHĂ&#x20AC;UVWRIWKHJDPHIRUWKH6SDUWDQVVSDUNHGDQUXQIRU81&* that tied the score up at eight a piece. The two squads exchanged a handful of buckets before Frazier put 81&*XSIRULWVĂ&#x20AC;UVWOHDGRIWKHJDPH7KH6SDUWDQVFRQWLQXHG to build their lead by going on a 10-0 run that included four points from junior Jasmine Dixon. Buckets by Gini Grimsley, Boone and Jasmine Byrd pushed the Spartansâ&#x20AC;&#x2122; lead to 35-22, their largest lead of the half. UNCG RQO\DOORZHGVL[SRLQWVLQWKHĂ&#x20AC;QDOWZRPLQXWHVRIWKHKDOIDQGZHQWLQWRWKH locker room with the 25-23 advantage. (ORQFDPHRXWDQGVFRUHGWKHĂ&#x20AC;UVWSRLQWVRIWKHVHFRQGKDOIEXW UNCG answered back with two buckets from Latham and one from Frasier to extend their lead 41-25 with less than 16 minutes left in the game. However, Elon used a pair of buckets and Spartan turnovers to close the gap to nine with 10:12 left on the clock. The Spartans responded with a 9-2 run, fueled by eight points from Latham, to give UNCG a 15-point advantage. Elon cut the gap to eight but were unable get any closer as 81&*ZHQWRQWRZLQLWVĂ&#x20AC;IWKFRQVHFXWLYHJDPH 7KH6SDUWDQVĂ&#x20AC;QLVKHGWKHJDPHVKRRWLQJSHUFHQWRQIRU VKRRWLQJIURPWKHĂ RRU7KH3KRHQL[ZHQWSHUFHQWIURPWKHĂ&#x20AC;HOGRQ IRUIURPWKHĂ&#x20AC;HOG81&*RXWUHERXQGHG(ORQE\DVOLPDQG tallied 28 points in the paint to Elonâ&#x20AC;&#x2122;s 20

VISITORS: APPALACHIAN STATE 11-14, 5-9 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 13 BENNETT, Jaime f 5-10 1-1 2-2 20 KETNER, Whitney f 2-6 0-0 4-4 25 TOSSIE, Whitney f 6-11 0-0 2-2 04 THOMAS, GiGi g 3-15 0-2 3-5 12 GRIMES, Maria g 4-8 4-8 0-0 03 WILLIAMS, Shante 0-0 0-0 1-2 10 COSTNER, Carleena 2-5 1-3 0-0 24 CUNNINGHAM, Courtney0-0 0-0 0-0 34 MIXON, Brittany 0-2 0-0 0-0 42 SMITH, April 0-0 0-0 0-0 TEAM Totals 22-57 6-14 12-15 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 16-28 57.1% 1st Half: 4-6 66.7% 1st Half: 3-4 75.0%

rebounds o-d-t pf tp a to 2-10-12 4 2-2-4 5 1-2-3 3 0-0-0 1 0-1-1 3 2-1-3 2 0-2-2 2 0-0-0 1 2-2-4 1 0-0-0 0 3-1-4 12-21-3322

13 8 14 9 12 1 5 0 0 0

4 0 3 0 1 2 0 0 1 0

8 5 3 2 5 1 0 1 0 0

bl s 3 2 1 0 0 0 0 0 1 0

62 11 25 7

2nd Half: 6-29 20.7% 2nd Half: 2-8 25.0% 2nd Half: 9-11 81.8%

1 3 1 0 3 0 0 0 0 0

34 25 34 32 26 12 23 2 11 1

8200

Game: 38.6% Game: 42.9% Game: 80.0%

VISITORS: College of Charleston 10-16, 5-10 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 10 WILLIAMS, Nikki f 1-9 1-6 0-0 20 MOYE, Sarah f 3-10 0-0 0-0 42 SMITH, Erika f 1-6 0-0 4-4 04 HUGHES, Jade g 7-12 3-6 4-4 12 FURSTENBURG, Jill g 0-4 0-2 2-2 02 KOTCELLA, Brooke 0-3 0-1 2-2 03 WILLIAMS, Erica 0-3 0-0 0-0 21 WILLIAMS, Christina 0-2 0-0 2-2 22 SCOTT, Ashley 2-5 0-0 2-3 32 CHAMBERS, Melissa 5-12 0-1 0-0 41 JONES, Deidra 0-0 0-0 3-4 TEAM 1-1-2 Totals 19-66 4-16 19-21 200 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 8-32 25.0% 1st Half: 1-8 12.5% 1st Half: 1-2 50.0%

rebounds o- d-t pf tp a to bl s 1-3-4 6-8-14 2-0-2 1-1-2 1-3-4 0-0-0 0-2-2 1-1-2 2-0-2 2-1-3 3-2-5

3 2 1 3 5 0 0 0 2 0 3

3 6 6 21 2 2 0 2 6 10 3

3 0 0 4 3 0 0 0 1 0 0

1 1 2 3 3 0 0 2 3 2 0

1 0 2 0 1 0 0 0 1 0 1

4 1 0 2 4 0 0 1 3 0 1

19 26 16 30 28 11 3 10 19 24 14

20-22-4219 61 11 17 61 6

2nd Half: 11-34 32.4% Game: 28.8% 2nd Half: 3-8 37.5% Game: 25.0% 2nd Half: 18-19 94.7% Game: 90.5%

VISITORS: UNC Greensboro 19-8, 12-4 SoCon tot-fg 3-pt rebounds fg-fga fg-fga ft-fta o- d-t pf tp a to bl s

## Player min 04 Otamiri, Irene 33 Latham, Kaleah 40 Frazier, Brittany 21 Boone, Kristen 24 Byrd, Jasmine 03 Dixon, Jasmine 22 Brooks, Kemena 23 Ling, Ashley 30 Grimsley, Gini TEAM Totals 8200 TOTAL FG% 3-Pt. FG% F Throw %

TOTAL FG% 3-Pt. FG% F Throw %

3-pt rebounds fg-fga ft-fta o- d-t pf tp 2-3 0-2 0-0 2-2 2-8 0-0 0-0 0-0 0-0 0-2 0-0

2-3-5 2 16 3-4-7 1 6 3-1-4 1 5 2-3-5 1 18 0-3-3 3 12 0-2-2 4 6 0-0-0 1 0 0-1-1 0 4 0-0-0 1 2 0-0-0 1 2 4-7-11 2 10 4-1-5 6-17 21-26 18-25-4317 81

1st Half: 17-32 53.1% 1st Half: 4-11 36.4% 1st Half: 6-7 85.7%

0-0 4-4 1-2 4-5 0-0 2-5 0-0 4-4 0-0 0-0 6-6

a to bl s 1 2 0 6 4 0 0 0 0 0 3 1 16

1 0 3 4 2 5 0 0 0 1 4

1 0 0 0 0 0 0 0 1 0 5

6 3 0 1 0 0 0 0 0 0 2

27 26 12 29 28 16 3 8 11 15 25

21 712200

2nd Half: 10-30 33.3% Game: 43.5% 2nd Half: 2-6 33.3% Game: 35.3% 2nd Half: 15-19 78.9% Game: 80.8%

2IĂ&#x20AC;FLDOV(ULF%UHZWRQ&DURO\Q-RQHV/HUR\7KRPSVRQ Technical fouls: APPST-None. UNCG-None. Attendance: Score by Periods 1st 2nd Total APPALACHIAN STATE 39 23 62 UNCG 44 37 81

48 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

HOME TEAM: UNCG 18-8, 11-4 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 4-7 0-1 33 Latham, Kaleah f 4-9 0-1 40 Frazier, Brittany f 5-9 0-0 21 Boone, Kristen g 2-6 0-1 24 Byrd, Jasmine g 8-16 5-11 03 Dixon, Jasmine 3-5 0-0 12 Hyson, Lakiah 0-0 0-0 22 Brooks, Kemena 0-2 0-1 23 Ling, Ashley 0-1 0-0 30 Grimsley, Gini 0-2 0-1 TEAM Totals 26-57 5-16 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 15-31 48.4% 1st Half: 4-13 30.8% 1st Half: 1-2 50.0%

ft-fta 2-3 0-0 0-0 7-9 2-4 2-5 0-0 0-0 0-0 0-0

rebounds o- d-t pf tp

0-1-1 3 2-9-11 3 3-7-10 2 5-3-8 2 0-3-3 2 1-2-3 2 0-0-0 0 0-0-0 1 0-2-2 0 0-0-0 2 3-2-5 13-21 14-29-4317

10 8 10 11 23 8 0 0 0 0

TOTAL FG% 3-Pt. FG% F Throw %

a to bl s 2 3 2 2 1 0 0 0 4 0

1 1 3 6 2 0 1 0 4 1

1 1 0 2 0 0 0 1 0 1

4 1 0 3 2 0 0 0 0 0

31 33 32 25 32 15 0+ 7 15 10

70 14 19 610200

2nd Half: 11-26 42.3% Game: 45.6% 2nd Half: 1-3 33.3% Game: 31.3% 2nd Half: 12-19 63.2% Game: 61.9%

2IĂ&#x20AC;FLDOV%UDG0F0LOOLRQ/DZRQ1HZWRQ%U\DQ%UXQHWWH Technical fouls: College of Charleston-None. UNCG-Byrd, Jasmine. Attendance: 556 Score by Periods 1st 2nd Total College of Charleston 18 43 61 UNCG 35 35 70

1-3 8-12 2-10 3-8 2-10 2-4 1-3 0-0 2-3

0-1 0-0 0-0 0-2 1-5 1-2 0-0 0-0 0-0

21-53 2-10

1st Half: 13-27 48.1% 1st Half: 2-7 28.6% 1st Half: 7-8 87.5%

HOME TEAM: Elon 10-17,4-12 SoCon tot-fg 3-pt ## Player fg-fga fg-fga 13 KING, Nikko f 4-9 0-0 52 WHIDDEN, Katie c 2-5 0-0 03 BUMBREY, Tierra g 1-10 0-4 05 MOORE, Shashonna g 1-4 0-0 21 DAVIS, Tiffany g 4-10 2-3 10 HESTER, Rachel 1-3 1-3 12 SITZ, Carole 0-0 0-0 23 WALL, Amber 0-1 0-0 30 SPEARS, Shamica 0-1 0-0 34 ALLISON, Nicole 3-13 0-4 45 COTTON, Urysla 2-2 0-0 TEAM Totals

HOME TEAM: UNCG 17-8, 10-4 tot-fg ## Player fg-fga min 04 Otamiri, Irene f 7-10 33 Latham, Kaleah f 1-8 44 Chamberlain, Meghanc 2-5 21 Boone, Kristen g 6-10 24 Byrd, Jasmine g 5-13 03 Dixon, Jasmine 2-4 12 Hyson, Lakiah 0-0 22 Brooks, Kemena 0-1 23 Ling, Ashley 1-2 30 Grimsley, Gini 1-4 40 Frazier, Brittany 2-5 TEAM Totals 27-62

f f f g g

18-58 3-14 1st Half: 9-30 30.0% 1st Half: 1-5 20.0% 1st Half: 4-9 44.4%

0-0 2-3 0-0 6-8 0-0 3-4 0-0 0-0 2-2

1-1-2 4 2 2-6-8 2 18 4-7-11 2 4 1-5-6 3 12 0-8-8 2 5 0-3-3 2 8 1-1-2 1 2 0-0-0 0 0 0-2-2 0 6 1-2-3 13-17 10-35-45 16

0 1 2 3 3 1 1 0 0

0 6 1 3 1 3 0 0 0

0 0 3 0 0 0 0 0 1

4 0 1 2 0 0 1 0 0

2nd Half: 8-26 30.8% 2nd Half: 0-3 0.0% 2nd Half: 6-9 66.7%

Game: 39.6% Game: 20.0% Game: 76.5%

25 34 35 33 29 10 11 7 16

57 11 14 4

ft-fta 0-1 2-4 4-7 0-0 0-1 0-0 0-0 0-0 0-2 0-0 3-4

rebounds o-d-t pf 4-6-10 4 1-6-7 1 1-5-6 1 0-2-2 0 0-3-3 5 0-0-0 2 0-1-1 0 0-0-0 2 0-1-1 1 1-1-2 0 1-1-2 0

s 0 0 2 0 4 0 0 0 2 1 0

min 32 30 30 22 24 10 3 3 10 31

9-19

14-26-4016 48 9 12 1 9

200

tp 8 6 6 2 10 3 0 0 0 6 7

2nd Half: 9-28 32.1% 2nd Half: 2-9 22.2% 2nd Half: 5-10 50.0%

2IĂ&#x20AC;FLDOV-RH&XQQLQJKDP/RUL-RQHV%UXFH$GDPV Technical fouls: UNC Greensboro-None. Elon-None. Attendance: 215 Score by Periods 1st 2nd Total UNC Greensboro 35 22 57 Elon 23 25 48

a 0 1 4 1 1 1 0 0 0 1 0 6

to 1 3 2 0 2 2 0 0 0 2 0

bl 0 0 1 0 0 0 0 0 0 0 0 6

Game: 31.0% Game: 21.4% Game: 47.4%


G30: Georgia Southern 81, UNCG 64 March 1, 2007- Charleston, SC (N. Charleston Coliseum)

GREENSBORO, NC â&#x20AC;&#x201C; Wofford tried to spoil UNC Greensboroâ&#x20AC;&#x2122;s senior night but UNCG had other ideas and went a perfect 4-of-4 from the free throw line and connected on two three-pointers in overtime to defeat Wofford, 71-66 in womenâ&#x20AC;&#x2122;s basketball action at Fleming Gymnasium Monday night. The Spartans ran their unbeaten streak to six games and closed out the home schedule with three consecutive wins. 81&*KDGIRXUSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVDQGZDVOHGE\MXQLRU Brittany Frazier, who had a career-high 20 points on 9-of-13 shooting from WKHĂ&#x20AC;HOG.D/HDK/DWKDPDGGHGVHYHQUHERXQGVDQG.ULVWHQ%RRQHKDGD game-high four steals. â&#x20AC;&#x153;This was a hard fought game,â&#x20AC;&#x153; head coach Lynne Agee said. â&#x20AC;&#x153;We know that Wofford is a good shooting team and having just beaten Davidson in overtime on Saturday we knew that they had some momentum. I thought that we were sluggish at points but we were able to play scrappy enough get our hands on enough balls and come away with the win.â&#x20AC;? Wofford was led by Jennifer Weurding who had 14 points on 6-of-13 VKRRWLQJ.HOO\'Z\HUDQG.HOVL.RHQLQJZHUHDOVRLQGRXEOHVĂ&#x20AC;JXUHVIRU the Terriers with 11 and 12 points, respectively. 81&*  ZDVGRZQZLWKWKLUW\Ă&#x20AC;YHVHFRQGVOHIWLQ regulation but a jumper by Boone from the left side tied the game and a missed Wofford three-pointer sent the game into overtime. In overtime, Wofford (13-14, 7-10) took a one-point lead on a freethrow but a foul on the next possession sent Irene Otamiri to the free throw line where she converted the pair. Sophomore Gini Grimsley put UNCG up three points with a three-pointer but Wofford was able to cut it to two with free throws. The Spartans got a three-pointer from Jasmine Byrd to push their lead to 69-64 with 1:13 left to play and a steal by Grimsley coupled with free throws from Frazier sealed the win. UNCG started the game sluggish and allowed Wofford to take an early lead. Senior Jasmine Byrd was able to get UNCG back on track with a long two through the right side, although the teams traded buckets on the next several possessions. The Spartans were able to get out to an 8-4 lead behind buckets from Byrd and Frazier and were able to extend their lead to 15-7 behind several key buckets from Frazier. â&#x20AC;&#x153;I was extremely pleased with the way that Brittany Frazier played tonight,â&#x20AC;? Agee said. â&#x20AC;&#x153;She really stepped up and hit some big shots for us. 6KHZDVSOD\LQJZLWKFRQĂ&#x20AC;GHQFHDQGLWUHDOO\VKRZHGWRQLJKWÂľ Wofford was able to get back in the game when UNCG went cold PLGZD\WKURXJKWKHKDOIJRLQJQHDUO\IRXUPLQXWHVZLWKRXWDĂ&#x20AC;HOGJRDO Latham ended UNCGâ&#x20AC;&#x2122;s scoring drought with a bucket in the paint, but Wofford closed the half on a 10-7 run and went into the lockeroom with a 27-26 advantage. The Spartans started the second half on a 9-4 run to take a 35-31 lead at the 17:21 mark but Wofford wouldnâ&#x20AC;&#x2122;t go away and tied the game at 35 with back-to-back buckets in the paint. The Terriers were able to hit one more bucket to extend their lead to WZRSRLQWVZLWKWKLUW\Ă&#x20AC;YHVHFRQGVOHIWEHIRUH%RRQHKLWDMXPSHUWRIRUFH overtime.

&8//2:+((1&²'HVSLWHDSRLQWUDOO\LQWKHJDPHVĂ&#x20AC;QDOWZR minutes and a game-high 25 points from Kristen Boone, UNCG couldnâ&#x20AC;&#x2122;t JHWSDVW:HVWHUQ&DUROLQDIDOOLQJLQWKHUHJXODUVHDVRQĂ&#x20AC;QDOH7KH Spartans were led by Boone who had 25 points on 8-of-14 shooting from WKHĂ&#x20AC;HOGZKLOH.D/HDK/DWKDPSXOOHGGRZQVHYHQUHERXQGV â&#x20AC;&#x153;This was a tough loss,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We let them get too much of a lead and we just couldnâ&#x20AC;&#x2122;t overcome it. We had lots of effort down the stretch but just couldnâ&#x20AC;&#x2122;t get it done in the end.â&#x20AC;? :HVWHUQ&DUROLQDKDGĂ&#x20AC;YHSOD\HUVLQGRXEOHVĂ&#x20AC;JXUHVDQGZDVOHG E\&KHYRQ.HLWKZKRKDGSRLQWVRQRIVKRRWLQJIURPWKHĂ&#x20AC;HOG Monique Dawson was WCUâ&#x20AC;&#x2122;s next leading scorer with 14 points. UNCG came out of the locker room sluggish in the second half and DOORZHG:HVWHUQWRH[WHQGWKHLUOHDGWRLQWKHĂ&#x20AC;UVWPLQXWHRIWKH half. Boone again proved to be the spark for the Spartans hitting UNCGâ&#x20AC;&#x2122;s Ă&#x20AC;UVWVL[SRLQWVRIWKHKDOIWRFXWWKHOHDGWRZLWKMXVWXQGHU minutes remaining. Otamiri was able to cut into the lead a little more with DVKRUWMXPSHUWKURXJKWKHULJKWVLGHWREULQJWKHVFRUHWRDWWKHĂ&#x20AC;UVW media timeout. The Spartans tied the game with a bucket on the inside by Latham but Western regained the lead on the next possession with a bucket by Chevon Keith. UNCG took a 49-48 lead on a three-pointer by Byrd but FRXOGQ¡WĂ&#x20AC;QGDGHIHQVLYHVWRSDV:HVWHUQVFRUHGRQWKHLUQH[WSRVVHVVLRQ UNCG was able to get the lead down to two for the second time in the half but again couldnâ&#x20AC;&#x2122;t stop Western who went on a 5-0 run to take a 59-51 lead with just over seven minutes remaining. Despite a 15 point 81&*UDOO\LQWKHJDPHVĂ&#x20AC;QDOWZRPLQXWHVRISOD\:HVWHUQ&DUROLQD claimed their 21st victory of the season and at least a share of the Southern Conference regular season title. Western Carolina had the early 2-0 advantage after hitting a runner RQWKHLUĂ&#x20AC;UVWSRVVHVVLRQEXW.ULVWHQ%RRQHZDVDEOHWRWLHWKHJDPHXS with a jumper. Boone continued to make her mark and hit a three-pointer through the left side to give the Spartans a 5-2 lead in the early goings. Irene Otamiri pushed the lead to 7-2 with a jumper but Western responded with a three-pointer to cut the UNCG lead to two. KaLeah Latham was able to steal the inbounds pass and got fouled and after converting on bucket gave UNCG a 10-5 lead. The Spartans allowed Western Carolina to get a little momentum by forcing back-to-back fouls. Western Carolina was able to convert all four shots and coupled with a three-pointer by Brooke Johnson at the 13:50 PDUNJDYHWKH&DWDPRXQWVDWKUHHSRLQWOHDGWKHLUĂ&#x20AC;UVWVLQFHWKHJDPHV early minutes. The teams traded buckets for the later part of the half but Western Carolina had the momentum and took an 18-12 lead coming out of a media timeout, capping a 9-2 run. A bucket by Brittany Frazier in the paint cut the three minute scoring drought and cut the lead to 20-14. UNCG was able to cut the lead to six but back-to-back unanswered buckets by the Catamounts pushed the WCU lead to 20-30 with just under Ă&#x20AC;YHPLQXWHVUHPDLQLQJ%RRQHZDVDEOHWRMXPSVWDUWWKHRIIHQVHDQG VFRUHGWZRXQDQVZHUHGEXFNHWVWRFXWWKHOHDGWRĂ&#x20AC;YHDQGDWKUHHSRLQWHU by Jasmine Byrd tied the game but the Catamounts went into the locker room with a 38-33 lead at the break.

VISITORS: Wofford 13-14,7-10 SoCon tot-fg 3-pt ## Player fg-fga fg-fga min 42 VARNO, Kathlyn f 2-2 0-0 45 PAUL, Susanna f 0-3 0-0 10 MILLER, Liz g 3-9 1-4 13 DWYER, Kelly g 5-6 1-2 23 CORRELL, K.C. g 2-4 0-0 11 YEE, Mary Jo 2-3 1-2 15 KOENIG, Kelsi 5-8 1-1 21 GRAMBLIN, Natalie 0-1 0-0 22 WEURDING, Jennifer 6-13 2-6 24 DEPKO, Laura 0-0 0-0 40 DEMPSEY, Kate 2-4 0-0 Team Totals 27-53 6-15

TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 12-22 54.5% 1st Half: 3-6 50.0% 1st Half: 0-0 0.0%

HOME TEAM: UNCG 20-8, 13-4 SoCon tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 4-12 0-4 33 Latham, Kaleah f 1-7 0-1 40 Frazier, Brittany f 9-13 0-0 21 Boone, Kristen g 4-8 1-2 24 Byrd, Jasmine g 5-19 3-14 03 Dixon, Jasmine 0-1 0-0 12 Hyson, Lakiah 0-0 0-0 22 Brooks, Kemena 2-5 1-2 23 Ling, Ashley 2-2 0-0 30 Grimsley, Gini 1-5 1-2 TEAM Totals 28-72 6-25

TOTAL FG% 3-Pt. FG% F Throw %

rebounds ft-fta o- d-t pf tp 0-0 0-0 2-3 0-0 3-4 0-0 1-3 0-0 0-0 0-0 0-0 6-10

2-0-2 2 1-2-3 0 0-0-0 1 0-4-4 4 2-5-7 1 0-2-2 0 1-4-5 2 0-1-1 0 0-7-7 1 0-0-0 2 1-2-3 2 1 3-4 8-30-38 15

4 0 9 11 7 5 12 0 14 0 4 66

a to bl s 0 0 5 0 4 3 2 1 0 0 0

0 2 6 1 4 2 4 3 2 1 1

0 1 1 0 0 0 0 0 4 0 2

15 26 8

0 0 3 1 0 1 0 0 0 0 0

6 9 38 28 30 15 34 9 31 15 10

5225

TOTAL FG% 3-Pt. FG% F Throw %

2nd Half: 15-28 53.6% Game: 50.9% 2nd Half: 3-7 42.9% Game: 40.0% 2nd Half: 1-2 50.0% Game: 60.0%

rebounds ft-fta o- d-t pf tp

a to bl s

2-2 2-2 2-2 3-3 0-0 0-0 0-0 0-0 0-0 0-0

2 2 1 8 0 2 0 1 1 0

9-9

3-1-4 0 10 2-5-7 5 4 2-2-4 0 20 3-3-6 3 12 0-2-2 3 13 1-2-3 2 0 0-0-0 0 0 0-0-0 0 5 0-0-0 0 4 1-3-4 1 3 2-2-4 14-20-3414 71

1 1 1 3 4 2 0 0 0 1

0 0 1 2 0 0 0 0 0 2

2 3 0 4 3 0 0 0 1 2

2IĂ&#x20AC;FLDOV7RP%DOGLQHOOL/DZVRQ1HZWRQ.LP:DWW Technical fouls: Wofford-None. UNCG-None. Attendance: 287 Score by Periods 1st 2nd OT Total Wofford 27 34 5 66 UNCG 26 35 10 71

38 28 39 36 32 17 0+ 10 9 16

17 13 515225

1st Half: 12-33 36.4% 2nd Half: 14-34 41.2% Game: 38.9% 1st Half: 2-10 20.0% 2nd Half: 2-13 15.4% Game: 24.0% 1st Half: 0-0 0.0% 2nd Half: 5-5 100% Game: 100%

VISITORS: UNC Greensboro 20-9, 13-5 tot-fg 3-pt rebounds fg-fga fg-fga ft-fta o- d--t pf tp

## Player min 04 Otamiri, Irene 33 Latham, Kaleah 40 Frazier, Brittany 21 Boone, Kristen 24 Byrd, Jasmine 03 Dixon, Jasmine 22 Brooks, Kemena 23 Ling, Ashley 30 Grimsley, Gini TEAM Totals

f f f g g

3-12 3-7 2-7 8-14 7-16 1-2 1-5 0-3 1-3

0-5 0-1 0-0 3-6 5-10 0-0 0-2 0-0 0-1

26-69 8-25

1st Half: 14-32 43.8% 1st Half: 3-11 27.3% 1st Half: 2-3 66.7%

0-0 1-2 0-0 6-7 0-0 0-0 0-1 0-0 0-0 7-10

TOTAL FG% 3-Pt. FG% F Throw %

22-49 5-13 1st Half: 13-25 52.0% 1st Half: 4-8 50.0% 1st Half: 8-12 66.7%

3 4 2 4 5 3 1 1 3

a to bl s

6 7 4 25 19 2 2 0 2

3 0 3 2 1 0 1 2 0 1 12-21-3326 67 12

1 3 3 4 3 4 2 1 1

0 2 29 0 4 26 2 2 29 0 0 27 0 0 26 0 0 15 0 0 15 0 2 13 0 0 20 1 22 210200

2nd Half: 12-37 32.4% Game: 37.7% 2nd Half: 5-14 35.7% Game: 32.0% 2nd Half: 5-7 71.4% Game: 70.0%

HOME TEAM: Western Carolina 21-8, 15-3 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 32 MAY, Erin f 0-1 0-0 0-0 55 LAMITIE, Lynsie f 1-3 1-2 0-0 10 DAWSON, Monique g 3-6 0-1 8-12 21 KEITH, Chevon g 7-10 1-1 0-1 23 POWELL, Lauren g 1-10 1-6 3-4 03 SWAYNE, Heather 1-1 1-1 0-0 05 PELLOM, Ashley 3-6 0-0 4-5 30 JOHNSON, Brooke 2-5 1-2 5-6 33 FEEMSTER, Kristen 0-0 0-0 0-0 35 JOHNSON, Jessika 3-5 0-0 4-4 44 EATON, Kendra 1-2 0-0 0-0 TEAM Totals

0-3-3 2-5-7 3-2-5 1-2-3 0-2-2 4-0-4 1-3-4 0-3-3 0-1-1

rebounds o- d-t pf tp 1-0-1 0-2-2 0-5-5 3-7-10 1-5-6 0-2-2 1-4-5 2-6-8 0-0-0 3-1-4 0-0-0

0 1 3 4 0 1 2 2 1 0 2

0 3 14 15 6 3 10 10 0 10 2

24-32 11-34-4516 73

a to bl s 0 0 6 0 2 0 1 3 0 1 0 2

2 2 5 3 1 1 6 5 0 2 1 2

0 0 1 0 1 0 0 2 0 0 0

0 0 2 3 0 0 5 0 0 1 0

5 16 30 32 25 10 22 26 2 18 14

13 28 411200

2nd Half: 9-24 37.5% Game: 44.9% 2nd Half: 1-5 20.0% Game: 38.5% 2nd Half: 16-20 80.0% Game: 75.0%

CHARLESTON, SC â&#x20AC;&#x201C; UNC Greensboro had two players in doubles Ă&#x20AC;JXUHVDQGZDVOHGMXQLRUJXDUG.ULVWHQ%RRQHZKRKDGSRLQWVEXWWKH\ couldnâ&#x20AC;&#x2122;t overcome the Georgia Southern offense falling by a score of 84LQWKHTXDUWHUĂ&#x20AC;QDOVRIWKH6RXWKHUQ&RQIHUHQFH:RPHQ¡V%DVNHWEDOO Tournament at the North Charleston Coliseum. Brittany Frazier and KaLeah Latham each had nine rebounds in the loss. â&#x20AC;&#x153;Georgia Southern was the better team this morning,â&#x20AC;? head coach Lynne Agee said. â&#x20AC;&#x153;We were really hurting without our center Meghan Chamberlain and we just couldnâ&#x20AC;&#x2122;t keep up with them on the inside. We went up strong for rebounds but we just couldnâ&#x20AC;&#x2122;t pull anything down.â&#x20AC;? UNCG (20-10) shot 33.3 percent on 23-of-69 shooting and pulled down 33 rebounds. The Spartans wentt 15-of-16 from the charity stripe and picked up 13 steals and had three blocks. Georgia Southern (13-17) was led by Tiffany Brown who scored a game high 20 points. Chequilla Jessie, Carolyn Whitney and Ashley Rivens DOVRVFRUHGLQGRXEOHVĂ&#x20AC;JXUHVIRUWKH(DJOHV The Eagles opened the second half by going 4-for-4 from beyond the three-point line and the Spartans couldnâ&#x20AC;&#x2122;t take advantage of their full-court pressure. With Georgia Southern leading byy 12, UNCG used a 7-0 run, sparked by buckets from Boone and Otamiri, and several Georgia Southern miscues to pull within eight at 51-43 with just underr 12 minutes WRJR7KH(DJOHVFRXQWHUHGZLWKĂ&#x20AC;YHVWUDLJKWRIWKHLURZQWRWDNHD point, 56-43 lead, with 10 minutes to play. Led by Jessie, Georgia Southern extended its lead to as many as 18 DWZLWKWRJRLQWKHJDPH81&*WULHGWRĂ&#x20AC;QGWKHLURIIHQVHEXW couldnâ&#x20AC;&#x2122;t convert anything down the stretch as Georgia Southern held on for the win. The Spartans started the game slowly which allowed Georgia 6RXWKHUQWRJRRQDUXQWKURXJKWKHJDPHVĂ&#x20AC;UVWIRXUPLQXWHV7LIIDQ\ Brown connected on two three-pointers while Chequilla Jessie hit two free throw shots to give the Eagles the early advantage. UNCG slowly climbed out of the hole with a bucket in the paint by Kristen Boone followed by a triple from Irene Otamiri to cut the Georgia Southern lead to 13-11. Buckets by Jasmine Byrd and Georgia Southern tied the game but an 11-5 run put UNCG ahead 26-17 at the 7:30 mark. Just as quickly as UNCG jumped out to a nine point lead the Eagles responded with six unanswered buckets to take a 28-26 lead at the 3:43 mark of the half. The Eagles continued to have the offensive hot hand and closed the half on a 9-4 run to take a 37-30 led into the lockeroom. This meeting marked the third consecutive time the Spartans and (DJOHVKDYHWDQJOHGLQWKHTXDUWHUĂ&#x20AC;QDOV81&*GHIHDWHG*HRUJLD6RXWKHUQ 68-56 last year but the Eagles eliminated UNCG in 2005 by a score of 55-48. VISITORS: Georgia Southern 13-17 tot-fg 3-pt ## Player fg-fga fg-fga ft-fta min 52 JESSIE, Chequilla f 5-9 0-0 2-3 03 BROWN, Tiffany g 5-11 4-6 6-6 04 WHITNEY, Carolyn g 2-8 2-4 4-5 23 ATWOOD, Shawnda g 3-8 1-4 1-2 24 RIVENS, Ashley g 2-6 2-3 4-4 10 YOUNGBLOOD, Taylor 0-1 0-0 0-0 13 WATERMAN, Christa 3-4 0-0 0-0 15 OGBURN, Jâ&#x20AC;&#x2122;Lisia 2-3 0-0 0-0 22 HENRY, Concella 0-1 0-0 1-2 32 HILBERT,Sina 0-0 0-0 0-0 33 MELSON, Ashley 3-6 0-1 0-0 34 GEIGER, Jessica 2-3 0-0 0-0 TEAM Totals 27-609-18 18-22 TOTAL FG% 3-Pt. FG% F Throw %

1st Half: 15-32 46.9% 1st Half: 4-10 40.0% 1st Half: 3-6 50.0%

HOME TEAM: UNC Greensboro 20-10 tot-fg 3-pt ## Player fg-fga fg-fga min 04 Otamiri, Irene f 4-10 1-1 33 Latham, Kaleah f 2-7 0-0 40 Frazier, Brittany f 2-7 0-0 21 Boone, Kristen g 6-18 1-3 24 Byrd, Jasmine g 4-17 0-5 03 Dixon, Jasmine 1-2 0-0 22 Brooks, Kemena 0-1 0-1 23 Ling, Ashley 0-1 0-0 30 Grimsley, Gini 4-6 1-3 TEAM Totals 23-69 3-13 200 TOTAL FG% 3-Pt. FG% F Throw %

rebounds o- d-t pf tp 3-7-10 4 0-3-3 2 3-3-6 2 2-4-6 4 1-3-4 3 0-0-0 0 2-2-4 0 2-1-3 0 1-1-2 0 0-0-0 0 0-3-3 2 0-2-2 1 3-3-6 17-32-4918

12 20 10 8 10 0 6 4 1 0 6 4

a to bl s 1 4 7 1 2 0 0 0 0 0 0 1

1 2 5 3 4 0 2 0 0 0 3 0

1 0 0 0 1 0 0 0 0 0 0 1

81 16 20 3

1 0 1 0 1 0 0 0 0 0 2 0

19 22 37 21 32 1 13 8 4 0+ 17 26

5200

2nd Half: 12-28 42.9% Game: 45.0% 2nd Half: 5-8 62.5% Game: 50.0% 2nd Half: 15-16 93.8% Game: 81.8%

ft-fta 4-4 4-4 2-2 4-5 1-1 0-0 0-0 0-0 0-0

rebounds o-d-t pf tp a to bl s

2-3-5 4 5-4-9 4 3-6-9 1 2-1-3 1 0-1-1 4 1-1-2 4 0-0-0 0 0-0-0 0 0-1-1 1 2-1-3 15-16 15-18-3319

13 8 6 17 9 2 0 0 9

3 1 1 0 1 1 1 1 1

3 3 2 0 0 3 0 1 1

0 0 1 0 0 1 0 0 1

64 10 13 3

3 2 0 4 1 0 0 1 2 13

1st Half: 12-31 38.7% 2nd Half: 11-38 28.9% Game: 33.3% 1st Half: 2-5 40.0% 2nd Half: 1-8 12.5% Game: 23.1% 1st Half: 4-4 100% 2nd Half: 11-12 91.7% Game: 93.8%

2IĂ&#x20AC;FLDOV'RFN6LVN$QJHO6WDQWRQ%LOO.HDWRQ Technical fouls: Georgia Southern-None. UNC Greensboro-None. Attendance: Score by Periods 1st 2nd Total Georgia Southern 37 44 81 UNC Greensboro 30 34 64

2IĂ&#x20AC;FLDOV$QJHOLFD6XIIUHQ%LOO\6PLWK6XVDQ%DUJR Technical fouls: UNC Greensboro-None. Western Carolina-None. Attendance: 932 Score by Periods 1st 2nd Total UNC Greensboro 33 34 67 Western Carolina 38 35 73

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 49

31 34 32 34 28 12 8 7 14

2006-07 Season Review

G29: Western Carolina 73, UNCG 67 February 25, 2007-Cullowhee, NC (Ramsey Center)

UNCGSpartans.com â&#x20AC;˘ UNCGSpa

G28: UNCG 71, Wofford 66 February 19, 2007-Greensboro, NC (Fleming Gym)


2006-07 Southern Conference Standings

2006 SoCon Review

Team Chattanooga*# Western Carolina* Davidson UNCG Wofford Georgia Southern Appalachian State Furman College of Charleston Elon

SoCon Games W L 15 3 15 3 13 5 13 5 7 11 7 11 6 12 5 13 5 13 4 14

Pct. .833 .833 .722 .722 .389 .389 .333 .278 .278 .222

Overall Games W L 25 8 24 10 23 9 20 10 13 16 13 18 13 18 11 20 10 20 10 20

Pct. .758 .706 .719 .677 .448 .419 .419 .355 .333 .333

*SoCon Regular Season Co-Champions #SoCon Tournament Champions 2006-07 A Awards and Honors 2007 Coaches All-Conference Team Whitney Tossie, Appalachian State Alex Anderson, Chattanooga Laura Hall, Chattanooga Katie Hamilton, Davidson Tiffany Brown, Georgia Southern Kristen Boone, UNC Greensboro Jasmine Byrd, UNC Greensboro Monique Dawson, Western Carolina Chevon Keith, Western Carolina Lauren Powell, Western Carolina Player of the Year Alex Anderson, Chattanooga Freshman of the Year Carolyn Whitney, Georgia Southern Coach of the Year Kellie Harper, Western Carolina 2007 All-Freshman Team GiGi Thomas, Appalachian State Jenaya Wade-Fray, Chattanooga Tiffany Davis, Elon Carolyn Whitney, Georgia Southern Heather Swayne, Western Carolina 2007 SoCon Sports Media Association First Team Whitney Tossie, Appalachian State Alex Anderson, Chattanooga Kristen Boone, UNC Greensboro Monique Dawson, Western Carolina Chevon Keith, Western Carolina 2007 SoCon Sports Media Association Second Team Katie Hamilton, Davidson Tia Washington, Davidson Tiffany Brown, Georgia Southern Jasmine Byrd, UNC Greensboro Lauren Powell, Western Carolina 50 • 2007-08 UNCG Women’s Basketball Media Guide

Player of the Year Alex Anderson, Chattanooga Freshman of the Year Carolyn Whitney, Georgia Southern

Athletes of the Month December: Alex Anderson, Chattanooga January: Alex Anderson, Chattanooga February: Alex Anderson, Chattanooga March: Brooke Hand, Chattanooga

Coach of the Year Kellie Harper, Western Carolina

2007 Southern Conference Championship Results

2007 All-Tournament Team First Team Alex Anderson, Chattanooga Brooke Hand, Chattanooga Tiffany Brown, Georga Southern Chevon Keith, Western Carolina Brooke Johnson, Western Carolina

First Round No. 7 Appalachian State 64, No. 10 Elon 50 No. 9 Furman 64, No. 8 College of Charleston 59

Second Team Whitney Tossie, Appalachian State Laura Hall, Chattanooga Shanara Hollenquest, Chattanooga Kristen Boone, UNC Greensboro Ashley Pellom, Western Carolina Most Valuable Player Alex Anderson, Chattanooga Players of the Week Nov. 21: Alex Anderson, Chattanooga Nov. 28 Jasmine Byrd, UNC Greensboro Dec. 5: Whitney Tossie, Appalachian State Dec. 12: Jessica Mitchell, Davidson Dec. 19: Alex Anderson, Chattanooga Jan. 2: Alex Anderson, Chattanooga Jan 9: Alex Anderson, Chattanooga Kristen Boone, UNC Greensboro Jan. 16: Monique Dawson, Western Carolina Jan. 23: Maria Grimes, Appalachian State Jan. 30: Alex Andeson, Chattanooga Feb. 6; Alex Anderson, Chattanooga Feb. 13: Chevon Keith, Western Carolina Feb. 20: Jennifer Weurding, Wofford

4XDUWHUÀQDOV No. 2 Chattanooga 84, No. 7 Appalachian State 60 No. 1 Western Carolina 79, No. 9 Furman 56 No. 5 Georgia Southern 81, No. 4 UNCG 64 No. 3 Davidson 71, No. 6 Wofford 62 6HPLÀQDOV No. 1 Western Carolina 73, No. 5 Georgia Southern 59 No. 2 Chattanooga 80, No. 3 Davidson 68 Championship No. 1 Chattanooga, 84, No. 2 Western Carolina 66


SCORING Player, Team 1. ANDERSON, Alex-UTC

ASSISTS Cl G 33 31 30 30 31 34 34 29 30 33 32 29 31 31 34 29 31 33 30 31

Pts

Avg

27 189 164 168 124 147 104 109 108 117 117 100 121 92 139 84 116 103 114 87

677 490 459 454 402 405 402 321 327 356 342 300 318 317 346 295 304 322 292 294

20.5 15.8 15.3 15.1 13.0 11.9 11.8 11.1 10.9 10.8 10.7 10.3 10.3 10.2 10.2 10.2 9.8 9.8 9.7 9.5

281 21 77 54 69 55 36 50 17 90 49 7 13 16 8 42 17 46 8 38

25 91 54 64 85 56 158 53 94 32 59 93 63 117 60 85 55 70 56 82

REBOUNDING Player-Team Cl 1. ANDERSON, Alex-UTC JR 2. KEITH, Chevon-WCU JR 3. BENNETT, Jaime-ASU SR 4. KING, Nikko-ELON SR 5. LATHAM,Kaleah-UNCG SR 6. WALL, Amber-ELON FR 7. SMITH, Erika-COFC JR 8. KOENIG, Kelsi-WOF JR 9. HOLLINQUEST, Shanara-UTC FR 10. HEMERKA, Danielle-DAV JR 11. JESSIE, Chequilla-GSU JR 12. FRAZIER,Brittany-UNCG JR 13. MOYE, Sarah-COFC SO 14. ATWOOD, Shawnda-GSU JR 15. ROBINSON, Mercedes-DAV SO 16. CHAMBERS, Melissa-COFC SR 17. HAMILTON, Katie-DAV JR 18. OTAMIRI,Irene-UNCG SR 19. BROWN, Tiffany-GSU JR 20. WEURDING, Jennifer-WOF SR

G 33 34 31 28 30 26 27 29 25 31 31 30 30 26 32 30 32 30 30 28

OFF 93 118 89 90 82 72 69 70 58 63 66 55 64 45 61 56 49 50 36 25

DEF 240 164 159 121 142 95 89 96 85 108 98 97 86 84 97 91 107 93 103 103

TOT 333 282 248 211 224 167 158 166 143 171 164 152 150 129 158 147 156 143 139 128

FIELD GOAL PCT (Min. 3.0 made per game) Player-Team Cl 1. HOLLINQUEST, Shanara-UTC FR 2. ANDERSON, Alex-UTC JR 3. WASHINGTON, Tia-DAV SR 4. HEMERKA, Danielle-DAV JR 5. TOSSIE, Whitney-ASU JR 6. LATHAM,Kaleah-UNCG SR 7. KEITH, Chevon-WCU JR 8. PELLOM, Ashley-WCU JR 9. OTAMIRI,Irene-UNCG SR 10. KOENIG, Kelsi-WOF JR 11. BROWN, Tiffany-GSU JR 12. POWELL, Lauren-WCU SO 13. SMITH, Erika-COFC JR 14. MITCHELL, Jessica-DAV SR 15. BYRD,Jasmine-UNCG SR

G 25 33 32 31 31 30 34 34 30 29 30 34 27 31 30

FG 75 272 109 116 189 114 139 112 98 100 168 147 90 101 164

FGA 137 529 220 238 396 248 304 255 224 239 406 356 220 248 409

Pct .547 .514 .495 .487 .477 .460 .457 .439 .438 .418 .414 .413 .409 .407 .401

Avg 10.1 8.3 8.0 7.5 7.5 6.4 5.9 5.7 5.7 5.5 5.3 5.1 5.0 5.0 4.9 4.9 4.9 4.8 4.6 4.6

Player-Team 1. HUGHES, Jade-COFC 2. BOONE,Kristen-UNCG 3. HALL, Laura-UTC 4. BUMBREY, Tierra-ELON 5. WASHINGTON, Tia-DAV 6. TOSSIE, Whitney-ASU 7. WHITNEY, Carolyn-GSU 8. DAWSON, Monique-WCU 9. MITCHELL, Jessica-DAV 10. PELLOM, Ashley-WCU

BLOCKED SHOTS Cl SO JR JR JR SR JR FR JR SR JR

G 29 30 33 30 32 31 31 34 31 34

Assists 119 121 124 112 115 111 104 111 101 108

Avg/G 4.10 4.03 3.76 3.73 3.59 3.58 3.35 3.26 3.26 3.18

FREE THROW PCT (Min. 2.0 made per game) Player-Team 1. WHITNEY, Carolyn-GSU 2. WASHINGTON, Tia-DAV 3. PHELPS, Chrissy-FUR 4. PELLOM, Ashley-WCU 5. DAWSON, Monique-WCU 6. GRIMES, Maria-ASU 7. BOONE,Kristen-UNCG 8. HALL, Laura-UTC 9. BROWN, Tiffany-GSU 10. KOENIG, Kelsi-WOF

Cl FR SR JR JR JR JR JR JR JR JR

G 31 32 31 34 34 31 30 33 30 29

FTM 82 69 117 78 158 85 94 70 64 93

FTA 97 86 149 100 208 113 125 94 87 127

Cl JR JR SO SR FR JR JR JR SR SO

G 31 30 29 30 30 34 30 31 32 29

Steals 113 91 82 81 71 78 64 65 62 56

G 28 33 27 31 31 30 28 30 29 28

Blocks 81 62 47 47 40 29 26 27 19 18

Avg/G 2.89 1.88 1.74 1.52 1.29 0.97 0.93 0.90 0.66 0.64

Player-Team Cl 1. WASHINGTON, Tia-DAV SR 2. MITCHELL, Jessica-DAV SR 3. HUGHES, Jade-COFC SO 4. BOONE,Kristen-UNCG JR 5. HALL, Laura-UTC JR 6. PELLOM, Ashley-WCU JR 7. TOSSIE, Whitney-ASU JR 8. BUMBREY, Tierra-ELON JR 9. WHITNEY, Carolyn-GSU FR 10. DAWSON, Monique-WCU JR

G 32 31 29 30 33 34 31 30 31 34

Asst 115 101 119 121 124 108 111 112 104 111

Avg 3.6 3.3 4.1 4.0 3.8 3.2 3.6 3.7 3.4 3.3

Turn 69 76 96 101 110 101 108 109 103 120

Avg 2.2 2.5 3.3 3.4 3.3 3.0 3.5 3.6 3.3 3.5

Cl JR SR SR JR FR SR JR JR SO FR

G 34 28 31 33 26 30 27 29 34 25

No. 118 90 89 93 72 82 69 70 79 58

Avg/G 3.47 3.21 2.87 2.82 2.77 2.73 2.56 2.41 2.32 2.32

Cl JR SR JR SR SR SR FR JR JR FR

G 33 31 34 30 28 28 26 31 30 25

No. 240 159 164 142 121 103 95 108 103 85

Avg/G 7.27 5.13 4.82 4.73 4.32 3.68 3.65 3.48 3.43 3.40

Cl JR FR SO JR JR SR JR JR JR JR

G 31 31 29 33 33 31 34 33 30 30

Minutes 1034 999 933 1037 1036 961 1034 999 905 900

Avg/G 33.35 32.23 32.17 31.42 31.39 31.00 30.41 30.27 30.17 30.00

Ratio 1.67 1.33 1.24 1.20 1.13 1.07 1.03 1.03 1.01 0.93

OFFENSIVE REBOUNDS Avg/G 3.65 3.03 2.83 2.70 2.37 2.29 2.13 2.10 1.94 1.93

3-POINT FG PCT (Min. 1.0 made per game) Player-Team 1. HAMILTON, Katie-DAV 2. HAND, Brooke-UTC 3. BYRD,Jasmine-UNCG 4. GRIMES, Maria-ASU 5. WADE-FRAY, Jenaya-UTC 6. MITCHELL, Jessica-DAV 7. MILLER, Liz-WOF 8. WILLIAMS, Nikki-COFC 9. POWELL, Lauren-WCU 10. BROWN, Tiffany-GSU

Cl SR JR JR JR SO JR FR SR SO SR

ASSIST/TURNOVER RATIO A (Min. 3.0 assists/game) Pct .845 .802 .785 .780 .760 .752 .752 .745 .736 .732

STEALS Player-Team 1. TOSSIE, Whitney-ASU 2. BOONE,Kristen-UNCG 3. MILLER, Liz-WOF 4. OTAMIRI,Irene-UNCG 5. DAVIS, Tiffany-ELON 6. DAWSON, Monique-WCU 7. BUMBREY, Tierra-ELON 8. PHELPS, Chrissy-FUR 9. WASHINGTON, Tia-DAV 10. HUGHES, Jade-COFC

Player-Team 1. WEURDING, Jennifer-WOF 2. ANDERSON, Alex-UTC 3. SMITH, Erika-COFC 4. LANGE, Jessica-FUR 5. JOHNSON, Katie-FUR 6. FRAZIER,Brittany-UNCG 7. DWYER, Kelly-WOF 8. CHAMBERS, Melissa-COFC 9. GRIMSLEY,Gini-UNCG 10. KING, Nikko-ELON

Cl JR JR SR JR FR SR SO SO SO JR

G 32 33 30 31 33 31 29 30 34 30

3FG 49 90 77 69 44 35 42 35 55 54

Cl JR SR JR JR FR SO SO JR SO JR

G 33 30 31 30 30 29 34 32 29 33

3FG 90 77 69 54 52 50 55 49 42 46

FGA 126 235 213 191 123 98 118 99 165 165

Player-Team 1. KEITH, Chevon-WCU 2. KING, Nikko-ELON 3. BENNETT, Jaime-ASU 4. ANDERSON, Alex-UTC 5. WALL, Amber-ELON 6. LATHAM,Kaleah-UNCG 7. SMITH, Erika-COFC 8. KOENIG, Kelsi-WOF 9. EATON, Kendra-WCU 10. HOLLINQUEST, Shanara-UTC

DEFENSIVE REBOUNDS Pct .389 .383 .362 .361 .358 .357 .356 .354 .333 .327

## 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Player-Team ANDERSON, Alex-UTC BENNETT, Jaime-ASU KEITH, Chevon-WCU LATHAM,Kaleah-UNCG KING, Nikko-ELON WEURDING, Jennifer-WOF WALL, Amber-ELON HEMERKA, Danielle-DAV BROWN, Tiffany-GSU HOLLINQUEST, Shanara-UTC

Avg/G 2.73 2.57 2.23 1.80 1.73 1.72 1.62 1.53 1.45 1.39

MINUTES PLAYED A

3-POINT FG MADE Player-Team 1. HAND, Brooke-UTC 2. BYRD,Jasmine-UNCG 3. GRIMES, Maria-ASU 4. BROWN, Tiffany-GSU 5. HESTER, Rachel-ELON 6. HUGHES, Jade-COFC 7. POWELL, Lauren-WCU 8. HAMILTON, Katie-DAV 9. MILLER, Liz-WOF 10. HALL, Laura-UTC

Player-Team 1. TOSSIE, Whitney-ASU 2. WHITNEY, Carolyn-GSU 3. HUGHES, Jade-COFC 4. HAND, Brooke-UTC 5. ANDERSON, Alex-UTC 6. BENNETT, Jaime-ASU 7. KEITH, Chevon-WCU 8. HALL, Laura-UTC 9. BROWN, Tiffany-GSU 10. BUMBREY, Tierra-ELON

2007-08 UNCG Women’s Basketball Media Guide • 51

2006 SoCon Review

JR 2. TOSSIE, Whitney-ASU JR 3. BYRD,Jasmine-UNCG SR 4. BROWN, Tiffany-GSU JR 5. GRIMES, Maria-ASU JR 6. POWELL, Lauren-WCU SO 7. DAWSON, Monique-WCU JR 8. HUGHES, Jade-COFC SO 9. BOONE,Kristen-UNCG JR 10. HAND, Brooke-UTC JR 11. HAMILTON, Katie-DAV JR 12. KOENIG, Kelsi-WOF JR 13. THOMAS, GiGi-ASU FR 14. PHELPS, Chrissy-FUR JR 15. KEITH, Chevon-WCU JR 16. MILLER, Liz-WOF SO 17. HEMERKA, Danielle-DAV JR 18. HALL, Laura-UTC JR 19. LATHAM,Kaleah-UNCG SR 20. WHITNEY, Carolyn-GSU FR

FG 3FG FT

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com

2006-07 Southern Conference Individual Statistics


2006-07 Southern Conference Team Statistics SCORING OFFENSE Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Chattanooga Davidson Western Carolina Appalachian State UNC Greensboro Georgia Southern Wofford Col. of Charleston Furman Elon

3-POINT FIELD GOAL PCT DEFENSE G 33 32 34 31 30 31 29 30 31 30

W-L 25-8 23-9 24-10 13-18 20-10 13-18 13-16 10-20 11-20 10-20

Pts 2379 2260 2358 2093 1990 1953 1748 1723 1748 1565

Avg/G 72.1 70.6 69.4 67.5 66.3 63.0 60.3 57.4 56.4 52.2

G 30 30 31 32 30 33 29 34 31 31

Pts 1795 1810 1899 1964 1912 2109 1878 2239 2073 2111

Avg/G 59.8 60.3 61.3 61.4 63.7 63.9 64.8 65.9 66.9 68.1

G 32 33 34 30 31 30 31 29 31 30

OFF 70.6 72.1 69.4 66.3 67.5 57.4 63.0 60.3 56.4 52.2

DEF 61.4 63.9 65.9 63.7 68.1 59.8 66.9 64.8 61.3 60.3

Margin +9.2 +8.2 +3.5 +2.6 -0.6 -2.4 -3.9 -4.5 -4.9 -8.2

G 32 34 31 33 30 31 31 30 29 30

FTM 438 567 449 438 361 400 445 311 395 264

FTA 589 786 635 625 516 585 671 480 619 442

Pct .744 .721 .707 .701 .700 .684 .663 .648 .638 .597

G 33 32 31 30 34 29 31 30 31 30

FG 842 836 752 740 822 611 589 643 694 592

FGA 1921 1917 1841 1855 2081 1591 1570 1739 1974 1707

Pct .438 .436 .408 .399 .395 .384 .375 .370 .352 .347

G 30 31 29 34 31 31 33 30 32 30

FG 628 682 676 819 721 703 806 673 706 679

FGA 1641 1780 1748 2117 1823 1772 2027 1685 1764 1641

Pct .383 .383 .387 .387 .396 .397 .398 .399 .400 .414

FGA 746 451 458 457 418 476 398 425 574 442

Pct .345 .333 .325 .315 .313 .309 .304 .296 .287 .265

SCORING DEFENSE

2006 SoCon Review

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Col. of Charleston Elon Furman Davidson UNC Greensboro Chattanooga Wofford Western Carolina Georgia Southern Appalachian State

Davidson Chattanooga Western Carolina UNC Greensboro Appalachian State Col. of Charleston Georgia Southern Wofford Furman Elon

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Davidson Western Carolina Furman Chattanooga UNC Greensboro Georgia Southern Appalachian State Col. of Charleston Wofford Elon

1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Team Col. of Charleston Appalachian State Wofford Western Carolina Furman Georgia Southern Chattanooga UNC Greensboro Davidson Elon

1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Western Carolina Georgia Southern Chattanooga Col. of Charleston Appalachian State UNC Greensboro Wofford Davidson Elon Furman

G 34 31 33 30 31 30 29 32 30 31

Reb 1488 1280 1306 1179 1204 1164 1098 1187 1096 1101

Avg/G 43.8 41.3 39.6 39.3 38.8 38.8 37.9 37.1 36.5 35.5

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Chattanooga Davidson Col. of Charleston UNC Greensboro Western Carolina Furman Appalachian State Elon Wofford Georgia Southern

G 33 32 30 30 34 31 31 30 29 31

Reb 1177 1142 1138 1153 1307 1195 1231 1204 1173 1294

Avg/G 35.7 35.7 37.9 38.4 38.4 38.5 39.7 40.1 40.4 41.7

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Western Carolina Chattanooga Davidson Col. of Charleston UNC Greensboro Georgia Southern Appalachian State Wofford Furman Elon

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Wofford Col. of Charleston Furman UNC Greensboro Western Carolina Chattanooga Appalachian State Elon Georgia Southern Davidson

G 33 32 30 31 29 34 31 30 31 30

FG 257 150 149 144 131 147 121 126 165 117

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Davidson Chattanooga UNC Greensboro Appalachian State Wofford Western Carolina Col. of Charleston Georgia Southern Furman Elon

52 • 2007-08 UNCG Women’s Basketball Media Guide

Davidson UNC Greensboro Wofford Appalachian State Elon Col. of Charleston Furman Georgia Southern Western Carolina Chattanooga

Davidson UNC Greensboro Georgia Southern Elon Appalachian State Col. of Charleston Western Carolina Chattanooga Wofford Furman

G 32 30 31 30 31 30 34 33 29 31

TEAM 17.6 18.1 18.5 20.6 22.9 19.5 18.9 16.2 21.7 20.2

OPP 22.0 20.8 19.6 20.9 22.5 18.9 18.1 15.3 20.6 18.1

Margin +4.44 +2.67 +1.10 +0.27 -0.35 -0.60 -0.76 -0.88 -1.10 -2.16

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Chattanooga Davidson UNC Greensboro Western Carolina Georgia Southern Col. of Charleston Wofford Appalachian State Furman Elon

G 33 32 30 34 31 30 29 31 31 30

Asst 14.5 15.7 14.2 12.6 12.0 12.4 12.7 13.1 10.8 10.0

Turn 16.2 17.6 18.1 18.9 18.5 19.5 21.7 22.9 20.2 20.6

G 34 31 30 30 30 31 32 29 33 31

No. 544 489 473 423 422 433 407 367 404 354

Avg/G 16.00 15.77 15.77 14.10 14.07 13.97 12.72 12.66 12.24 11.42

G 34 33 31 29 31 30 32 31 30 30

No. 944 902 791 731 771 742 780 747 706 673

Avg/G 27.76 27.33 25.52 25.21 24.87 24.73 24.38 24.10 23.53 22.43

Avg/G 257 165 149 150 144 131 147 126 121 117

7.79 5.32 4.97 4.69 4.65 4.52 4.32 4.20 3.90 3.90

OFFENSIVE REBOUNDS Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Western Carolina Georgia Southern Col. of Charleston Elon UNC Greensboro Appalachian State Davidson Wofford Chattanooga Furman

DEFENSIVE REBOUNDS G 34 33 32 30 30 31 31 29 31 30

TEAM 43.8 39.6 37.1 39.3 38.8 41.3 38.8 37.9 35.5 36.5

OPP 38.4 35.7 35.7 37.9 38.4 41.7 39.7 40.4 38.5 40.1

Margin +5.3 +3.9 +1.4 +1.4 +0.4 -0.5 -0.9 -2.6 -3.0 -3.6

G 29 30 31 30 34 33 31 30 31 32

Blocks 149 128 120 104 112 98 86 62 59 60

Avg/G 5.14 4.27 3.87 3.47 3.29 2.97 2.77 2.07 1.90 1.88

G 32 33 30 31 29 34 30 31 31 30

Assists 501 479 427 406 367 430 371 373 335 301

Avg/G 15.66 14.52 14.23 13.10 12.66 12.65 12.37 12.03 10.81 10.03

G 32 30 29 31 30 30 31 31 34 33

Steals 382 349 325 336 314 303 283 272 290 217

Avg/G 11.94 11.63 11.21 10.84 10.47 10.10 9.13 8.77 8.53 6.58

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Western Carolina Chattanooga Georgia Southern Wofford Appalachian State UNC Greensboro Davidson Furman Col. of Charleston Elon

3-POINT FIELD GOALS MADE

STEALS Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

ASSIST/TURNOVER RATIO A

ASSISTS

3-POINT FIELD GOAL PERCENTA T GES Team Chattanooga Davidson UNC Greensboro Appalachian State Wofford Western Carolina Furman Col. of Charleston Georgia Southern Elon

Pct .291 .296 .303 .306 .320 .321 .324 .331 .335 .338

BLOCKED SHOTS

FIELD GOAL PCT DEFENSE 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

FGA 398 500 567 578 466 477 414 528 489 456

REBOUNDING MARGIN

FIELD GOAL PERCENTA T GES Team Chattanooga Davidson Appalachian State UNC Greensboro Western Carolina Wofford Furman Col. of Charleston Georgia Southern Elon

FG 116 148 172 177 149 153 134 175 164 154

REBOUNDING DEFENSE

FREE THROW PERCENTA T GES Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Elon Furman Chattanooga Western Carolina UNC Greensboro Georgia Southern Col. of Charleston Davidson Appalachian State Wofford

TURNOVER MARGIN

G 30 31 33 34 30 31 30 32 31 29

REBOUNDING OFFENSE

SCORING MARGIN Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Team 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

G Chattanooga Georgia Southern UNC Greensboro Davidson Appalachian State Wofford Western Carolina Col. of Charleston Furman Elon

3FG 33 31 30 32 31 29 34 30 31 30

Ratio 0.90 0.89 0.78 0.67 0.65 0.63 0.58 0.57 0.53 0.49


The Southern Conference 2007-08 Opponents


CGSpartans.com â&#x20AC;˘

The Southern Conference

The Southern Conference The Southern Conference, which began its 87th season of intercollegiate competition in 2007, is a national leader in emphasizing the development of the VWXGHQWDWKOHWHDQGGHĂ&#x20AC;QLQJWKHOHDJXH¡VUROHLQKHOSing to build lifelong leaders and role models. 7KH 6RXWKHUQ &RQIHUHQFH LV WKH QDWLRQ¡V Ă&#x20AC;IWK oldest NCAA Division I collegiate athletic association. Only the Big Ten (1896), the Missouri Valley (1907), the 3DFLĂ&#x20AC;F  DQGWKH6RXWKZHVWHUQ$WKOHWLF 

conferences are older in terms of origination. The Southern Conference has also excelled as the premier Football Championship Subdivision conference. Southern Conference member Appalachian State has won the last two Football Championship Subdivision titles. The Conference currently consists off 11 members in four states throughout the Southeast and sponsors 19 varsity sports and championships that produce participants for NCAA Division I Championships. Academic excellence has been a major part of the Southern Conferenceâ&#x20AC;&#x2122;s tradition. League athletes have been recognized countless times on Verizon/CoSIDA Academic All-America and district teams. A total off 19 Rhodes Scholarship winners have been selected from conference institutions. 25th Anniversary of Womenâ&#x20AC;&#x2122;s Championships The Southern Conference will celebrate 25 years of womenâ&#x20AC;&#x2122;s championships in 2007-08. A year-long celebration of womenâ&#x20AC;&#x2122;s sports will highlight studentathletes, coaches and teams. Commissioner Ken Germann spearheaded the Southern Conferenceâ&#x20AC;&#x2122;s expansion to include womenâ&#x20AC;&#x2122;s athletics. The Germann Cup, named in honor of the former commissioner, annually recognizes the top womenâ&#x20AC;&#x2122;s athletics programs in the conference. From its humble beginnings, womenâ&#x20AC;&#x2122;s athletics have become an integral part of the Southern Conference and its success. The league crowns champions in nine womenâ&#x20AC;&#x2122;s sports including cross country, VRFFHUYROOH\EDOOLQGRRUWUDFN Ă&#x20AC;HOGEDVNHWEDOOWHQQLVJROIRXWGRRUWUDFN Ă&#x20AC;HOGDQGVRIWEDOO Membership History The Southern Conference was formed on February 25, 1921 at a meeting in Atlanta, Ga. as 14 institutions from the 30-member Southern Intercollegiate Athletic Association (SIAA) reorganized as the Southern Conference. Those charter members included Alabama, Auburn, Clemson, Georgia, Georgia Tech, Kentucky, Maryland, Mississippi State, North Carolina, North Carolina State, Tennessee, Virginia, Virginia Tech and Washington & Lee. Athletic competition began in the fall off 1921. In 1922, six more schools - Florida, LSU, Mississippi, South Carolina, Tulane and Vanderbilt - joined the fold. A year later, the University of the South joined the ranks. VMI became a member in 1925 and Duke was added 1929. Since then, conference membership has experienced a series of membership changes with LQVWLWXWLRQVKDYLQJEHHQDIĂ&#x20AC;OLDWHGZLWKWKHOHDJXH The league has undergone two major transitions during its history. 7KH Ă&#x20AC;UVW RFFXUUHG LQ 'HFHPEHU  ZKHQ WKH Southeastern Conference was formed from the 23school Southern Conference. The leagueâ&#x20AC;&#x2122;s 13 members west and south of the Appalachian Mountains reorganized to help reduce the extensive travel demands that were present in the league at the time. In 1936, the Southern Conference invited The Citadel, William & Mary, Davidson, Furman, Richmond and Wake Forest to join the membership. 54 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

The second major shift came about in 1953 when Clemson, Duke, Maryland, North Carolina, North Carolina State, South Carolina and Wake Forest withdrew from the league to form the Atlantic Coast Conference. This change was brought about due to the desire of many of those schools to schedule a greater number of regular season basketball games against local rivals. Today, the league continues to thrive with a membership that spans four Tennessee, North Carolina, South Carolina and Georgia. Current league members are Appalachian State, College of Charleston, The Citadel, Davidson, Elon, Furman, Georgia Southern, UNC Greensboro, Chattanooga, Western Carolina and WofIRUG 2Q -XO\   6DPIRUG ZLOO RIĂ&#x20AC;FLDOO\ MRLQ WKH league, brining membership of the conference to 12. Leadership -RKQ,DPDULQRZDVRIĂ&#x20AC;FLDOO\QDPHGFRPPLVVLRQer of the conference on January 2, 2006. Previously, Iamarino served as commissioner of the Northeast Conference. In nine years with the New Jersey-based league, Iamarino promoted the conference through an ambitious agenda which improved competition, upgraded compliance-related matters and increased the marketing and brand awareness of the conference and its member institutions. 7KH6RXWKHUQ&RQIHUHQFHQDPHGLWVĂ&#x20AC;UVWFRPPLVsioner in Decemberr 1950. Duke head football coach Wallace Wade made the transition from Blue Devil IRRWEDOO FRDFK WR DWKOHWLFV DGPLQLVWUDWLRQ DV WKH Ă&#x20AC;UVW person at the helm of the conference. Lloyd Jordan replaced Wade as the commissioner in 1960 and served a 14-year term until Ken Germann became the league head in 1974. Germann was the commissioner forr 13 years and orchestrated the leagueâ&#x20AC;&#x2122;s expansion to include womenâ&#x20AC;&#x2122;s athletics. In 1987, he was succeeded by Dave Hart who spearKHDGHGWKHWUDQVIHURIWKHOHDJXHRIĂ&#x20AC;FHIURP&KDUORWWH N.C. to Asheville, N.C. Wright Waters succeeded Hart upon his retirement in 1991. Under Watersâ&#x20AC;&#x2122; leadership, the Southern Conference expanded to 12 members, added three womenâ&#x20AC;&#x2122;s sports and posted record revenue from the basketball Tournament. Waters, who is currently the commissioner of the Sun Belt Conference, was followed by Alfred B. White in 1998. White, a veteran member RIWKH1&$$RIĂ&#x20AC;FHLQWURGXFHGWKHFXUUHQW6R&RQORJR and elevated the conferenceâ&#x20AC;&#x2122;s commitment to marketing and development of corporate partners. He became the president of the Asheville franchise of the National Basketball Development League in 2001. Danny Morrison headed the conference from 2001-2005 and orchestrated the leagueâ&#x20AC;&#x2122;s move from Asheville, N.C. to historic Beaumont Mill in Spartanburg, S.C. Under Morrisonâ&#x20AC;&#x2122;s leadership, the conference increased its marketing and promotional efforts. Championship History 7KH Ă&#x20AC;UVW 6RXWKHUQ &RQIHUHQFH &KDPSLRQVKLS was the league basketball tournament held in Atlanta in 1922. The North Carolina Tar Heels won the tournaPHQWWREHFRPHWKHĂ&#x20AC;UVWUHFRJQL]HGOHDJXHFKDPSLRQ in any sport. The Southern Conference Tournament remains the oldest of its kind in college basketball. The Southern Conference began sponsoring womenâ&#x20AC;&#x2122;s sports during the 1983-84 season. That year, league championships were held in volleyball, basketball and tennis. Cross country joined the mix in 1985 and the league began holding indoor and outdoor track championships in 1988. Most recently, the conference instituted golf and softball championships in the spring off 1994 and added soccer in the fall off 1994.

The Southern Conference currently declares champions in 10 menâ&#x20AC;&#x2122;s sports - football, soccer, cross FRXQWU\ EDVNHWEDOO LQGRRU WUDFN DQG Ă&#x20AC;HOG RXWGRRU WUDFN DQG Ă&#x20AC;HOG ZUHVWOLQJ EDVHEDOO WHQQLV DQG JROI - and nine womenâ&#x20AC;&#x2122;s sports - soccer, volleyball, cross FRXQWU\ EDVNHWEDOO LQGRRU WUDFN DQG Ă&#x20AC;HOG RXWGRRU WUDFN Ă&#x20AC;HOGWHQQLVJROIDQGVRIWEDOO Basketball 0HQ¡VEDVNHWEDOOZDVWKHĂ&#x20AC;UVWVSRUWLQZKLFKWKH conference produced a championship. The league tournament is the nationâ&#x20AC;&#x2122;s oldest, with the inaugural championship held in Atlanta in 1922. Not only was the Southern Conference TournaPHQWWKHĂ&#x20AC;UVWRILWVNLQGWKHOHDJXHDOVRKHOSHGFKDQJH the face of college basketball. In 1980, the league began a season-long experiment with a 22-foot threeSRLQW Ă&#x20AC;HOG JRDO ZLWK WKH DSSURYDO RI WKH 1&$$ 5XOHV Committee. Ronnie Carr of Western Carolina made the Ă&#x20AC;UVWWKUHHSRLQWĂ&#x20AC;HOGJRDOLQFROOHJHEDVNHWEDOOKLVWRU\ in a game against Middle Tennessee State on Nov. 29, 1980. Another college basketball tradition that originated in the SoCon is the traditional cutting of the nets by the winning team. According to USA Today, the practice of net cutting originated in 1947 with North CaroOLQD6WDWHKHDGFRDFK(YHUHWW&DVH$VDĂ&#x20AC;UVW\HDUKHDG coach, Case led the Wolfpack to the SoCon Tournament title. To commemorate the event, Case celebrated by claiming the nets as a souvenir of the win. Basketball coaching legend Red Auerbach gives credit to former George Washington coach Bill Reinhart, who coached in the SoCon for nearly 30 years, as one of the originators of the modern fast-break. West Virginiaâ&#x20AC;&#x2122;s 10 tournament championships are still the most in league history. The Mountaineers were led by the incomparable Jerry West from 1958 through â&#x20AC;&#x2122;60. West, a two-time All-America selection, spurred West Virginia to the Final Four in 1959. The Mountaineers lost in the championship game that season to California, 71-70, but West earned Final Four Most Valuable Player honors. West was a three-time Southern Conference tournament MVP, a two-time league regular season MVP, and was twice named the conferenceâ&#x20AC;&#x2122;s Athlete of the Year. He went on to a spectacular career with the Los Angeles Lakers of the National Basketball Association and was inducted into the Naismith Memorial Basketball Hall of Fame in 1979. He was a 14-time NBA All-Star while with the Lakers. It is Westâ&#x20AC;&#x2122;s silhouette that comprises the NBAâ&#x20AC;&#x2122;s globally recognized logo. Frank Selvy set the NCAA record for points in a game while at Furman. As a Paladin senior on Feb. 13, 1954, Selvy scored 100 points in a game against Newberry, a record that still stands. Selvy was the Southern Conference Most Valuable Player in 1953 and 1954 and the leagueâ&#x20AC;&#x2122;s Athlete of the Year in 1954. He went on to a 10-year career in the NBA. Rod Hundley was another West Virginia star during the 1950s. â&#x20AC;&#x153;Hot Rodâ&#x20AC;? made a name for himself as one of the most spectacular players to tour the league during his era. Hundley averaged 24.5 points per game in his three seasons as a Mountaineer and was an allconference and all-tournament performer in each of those three years. He was the Southern Conference Most Valuable Player and Athlete-of-the-Year as a VHQLRULQ+HZDVWKHĂ&#x20AC;UVWSOD\HUVHOHFWHGLQWKH 1957 NBA draft and enjoyed a six-year career in that league. East Tennessee Stateâ&#x20AC;&#x2122;s Keith â&#x20AC;&#x153;Misterâ&#x20AC;? Jennings made his mark on the college basketball world in the earlyy 1990s. Despite standing less than six feet tall,


Coaches and Administrators The Southern Conference has also been a breeding ground for some of college athletics’ most recognized coaches and administrators. Legendary basketball coaches Adolph Rupp of Kentucky and Everett Case of North Carolina State both worked the sidelines in the Southern Conference. Rupp guided the Wildcats to a 30-5 mark during the 1931 and 1932 seasons. Yet, for all his coaching accomplishments, Rupp never led Kentucky to a Southern Conference tournament championship. Case mentored the Wolfpack to six consecutive Southern Conference Tournament championships from 1947 through 1952. Lefty Driesell coached Davidson to three Southern Conference Tournament championships in 1966, 1968 and 1969. Driesell also won the league’s Coach of the Year award four straight times from 1963 through 1966. Former Georgia Tech coach Bobby Cremins earned league Coach of the Year honors three times in the late ’70s and early ’80s while at Appalachian State DQGLVLQKLVÀUVWVHDVRQDVKHDGFRDFKDWWKH&ROOHJH of Charleston. Terry Holland saw his basketball coaching career take off at Davidson when he returned to his alma mater in 1970. Holland was honored as the Southern Conference Coach of the Year for three consecutive seasons from 1970-72 and led the Wildcats to the conference tournament title and an appearance in the NCAA Tournament in 1970. J. Dallas Shirley, a member of the Basketball Hall of Fame, spent 21 years as the assistant WRWKHFRPPLVVLRQHUDQGVXSHUYLVRURIRIÀFLDOVLQWKH Southern Conference. He also served as president of WKH ,QWHUQDWLRQDO $VVRFLDWLRQ %DVNHWEDOO 2IÀFLDOV DQG the United States Olympic Basketball Committee. Even the legendary Paul “Bear” Bryant got his coaching start in the Southern Conference as he guided the Maryland Terrapins in 1945. A legendary Southern Conference football coach is the late Frank Howard of Clemson, who guided the Tigers as a league member from 1940-52. The incomparable Howard won 69 Southern Conference games which still ranks tied for fourth on the league’s all-time coaching victories list. The Southern Conference has been represented RQ WKH VLGHOLQHV DW ÀYH 6XSHU %RZOV LQ UHFHQW \HDUV Bobby Ross, who piloted the San Diego Chargers to the 1996 Super Bowl, was the head coach at The Citadel from 1973-77. Former Buffalo Bills head coach Marv Levy directed William & Mary from 1964-68. He was succeeded at William & Mary by Lou Holtz. William & Mary competed in the Southern Conference from 1936-77.

Southern Conference Members Alabama (1921-1932) Appalachian State (1971-present) Auburn (1921-1932) College of Charleston (1998-present) Chattanooga (1976-present) The Citadel (1936-present) Clemson (1921-1953) Davidson (1936-1988, 1991-present) Duke (1928-1953) East Carolina (1964-1976) East Tennessee State (1978-2005) Elon (2003-present) Florida (1922-1932) Furman (1936-present) George Washington (1936-1970) Georgia (1921-1932) Georgia Southern (1991-present) Georgia Tech (1921-1932) Kentucky (1921-1932) Louisiana State (1922-1932) Marshall (1976-1997) Maryland (1921-1953) Mississippi (1922-1932) Mississippi State (1921-1932) North Carolina (1921-1953) North Carolina at Greensboro (1997-present) North Carolina State (1921-1953) Richmond (1936-1976) South Carolina (1922-1953) Tennessee (1921-1932) Tulane (1922-1932) University of the South (1922-1932) Vanderbilt (1922-1932) Virginia (1921-1937) VMI (1924-2003) Virginia Tech (1921-1965) Wake Forest (1936-1953) Washington & Lee (1921-1958) West Virginia (1950-1968) Western Carolina (1976-present) William & Mary (1936-1977) Wofford (1997-present) *Bold indicates current conference member

John Iamarino Commissioner The Southern Conference www.soconsports.com 2007-08 UNCG Women’s Basketball Media Guide • 55

The Southern Conference

Olympic Sports In baseball, Wake Forest advanced to the championship game of the NCAA College World Series in 1949. Demon Deacon second baseman Charles Teague was named the CWS Most Valuable Player. The Citadel PDGH KLVWRU\ LQ  E\ EHFRPLQJ WKH ÀUVW PLOLWDU\ school to make an appearance at the College World Series. The Bulldogs were joined that season at the CWS by current conference member Georgia Southern. One of the Southern Conference’s more famous baseball alums is Duke’s Dick Groat. The Blue Devil shortstop, who was also a basketball standout, was the conference’s Athlete of the Year in 1951 and 1952. He went on to a 14-year career in the major leagues. In 1960, he was named the National League MVP after he led the league in batting with a .325 average for the World Champion Pittsburgh Pirates. Among Southern Conference alums to grace MaMRU/HDJXH%DVHEDOOÀHOGVKDYHEHHQ$WOHH+DPPDNHU (East Tennessee State), Jeff Montgomery (Marshall) and Mike Ramsey (Appalachian State). Other SoCon players to go on to a career in the major leagues include Angels third baseman Dallas McPherson (The Citadel), pitchers Britt Reames (The Citadel) and Ryan Glynn (VMI) who both pitched with Oakland in 2005 and Furman’s Tom Mastny, a pitcher with the Cleveland Indians (2007). Arnold Palmer, perhaps the most famous golfer to have ever lived, competed under the Southern Conference banner as a collegian at Wake Forest. He took medalist honors at the Southern Conference Tournament in 1948 and 1949 and was the tournament’s runner-up in 1950. Palmer was the medalist at the NCAA Golf Championships in 1949 and 1950. He went on to become one of the most accomplished golfers to play

on the professional tour. Palmer won 60 tournaments while competing on the PGA Tour and has added 10 more victories as a member of the Senior PGA Tour. He has also won eight major championships - four Masters, two British Opens, one U.S. Open and one U.S. Amateur. Women’s sports are relatively young in the league’s history. In 2007-08, the Southern Conference will be celebrating its 25th Anniversary of women’s championship. Furman golfer Dottie Pepper was named the Southern Conference Women’s Athlete of the Decade in conjunction with that event. Appalachian State’s Mary Jayne Harrelson won the NCAA Outdoor title att 1500 meters in 1999 and 2001. Furman’s Brandi Jackson won the NCAA Women’s Golf East Regional in the spring of 2003.

UNCGSpartans.com

Jennings was a two-time all-conference choice and the league’s Player of the Year and Athlete of the Year in 1991. Jennings played with the Golden State Warriors of the NBA. More recently, Western Carolina’s Kevin Martin ZDVDÀUVWURXQGSLFNRIWKH6DFUDPHQWR.LQJVLQ Martin was second in the nation in scoring as a junior at 24.9 points per game before leaving a year early for the NBA. Besides West Virginia’s team in 1959, the Southern Conference has been represented in the Final Four on two other occasions. North Carolina advanced to the NCAA championship game in 1943 before falling 43 WR 2NODKRPD 6WDWH 1RUWK &DUROLQD 6WDWH ÀQLVKHG third in the tournament in 1950. Women’s basketball competition began in the Southern Conference in 1983-84 with seven teams. In the sport’s history, seven schools have won the league’s tournament at least once with Chattanooga winningg 10 and Appalachian State owning six titles. UNC Greensboro won the 1998 tournament as head coach Lynne $JHHEHFDPHWKHÀUVWFRDFKWRWDNHDWHDPWRWKH1&$$ Tournament in all three Divisions - I, II and III. In 2001, &KDWWDQRRJDKHDGFRDFK:HV0RRUHEHFDPHWKHÀUVW coach in NCAA history to take three different teams to the NCAA Tournament in all three Divisions. Since 1984, seven different teams have claimed at least a share of the regular season crown. Chattanooga has the most overall titles with 12, six of them shared. Chattanooga owns the most outright championships with seven. Only three players have won the conference Player of the Year award twice: East Tennessee State’s DeShawne Blocker in 1992-93 and 199495; Furman’s Jackie Smith, 1997-98 and 1998-99; and Chattanooga’s Damita Bullock, who won the award in 2000 and 2001.


CGSpartans.com •

2007-08 SoCon Schedule

Thursday, Nov. 1 Carson-Newman at Western Carolina (Exh.) Lee University at Chattanooga (Exh.) Friday, Nov. 2 St. Paul at UNC Greensboro (Exh.) North Greenville at Furman (Exh.) Tuesday, Nov. 6 St. Andrews at Davidson (Exh.) Friday, Nov. 9 Detroit at Western Carolina Georgia Southern at Jacksonville Penn at Elon (ISES Cancer Awareness Tipoff) Chattanooga at Austin Peay Davidson at Georgia Tech Saturday, Nov. 10 Campbell at Elon (ISES Cancer Awareness Tipoff) Sunday, Nov. 11 UNC Greensboro at North Carolina State Western Carolina at Clemson Wofford at Coastal Carolina Chattanooga at Tennessee Furman at Vanderbilt Georgia Southern at Stetson Monday, Nov. 12 North Carolina Central at Elon (ISES Cancer Awareness Tipoff)

7 pm 7 pm

7 pm 8 pm

7 pm

2 pm 2 pm 2 pm 3 pm 3 pm 3 pm

2 pm 2 pm

7 pm 8 pm

Sunday, Dec. 16 Appalachian State at Georgia Southern*

Wednesday, Nov. 28 Middle Tennessee State at Chattanooga Charlotte at UNC Greensboro East Carolina at Appalachian State Lynchburg at Elon UNC Asheville at Western Carolina

6 pm 7 pm 7 pm 7 pm 7 pm

Tuesday, Dec. 18 Wofford vs. Savannah State (UNF Holiday Classic, Jacksonville, Fla.)

Thursday, Nov. 29 Charleston Southern at Coll. of Charleston Georgia Southern at Davidson* Friday, Nov. 30 Rice at Furman Saturday, Dec. 1 USC Upstate at Georgia Southern Presbyterian at Coll. of Charleston Chattanooga at Alabama A&M Elon at Wofford* Sunday, Dec. 2 Winthrop at Davidson Western Carolina at Middle Tennessee State

Sunday, Nov. 18 UNC Greensboro at Duke 2 pm Western Carolina vs. Louisville 3 pm (Minnesota Subway Classic, Minneapolis, Minn.)

Wednesday, Dec. 5 Clemson at Furman UNC Greensboro at Longwood

56 • 2007-08 UNCG Women’s Basketball Media Guide

Saturday, Dec. 15 Alabama at Chattanooga Elon at Furman* Western Carolina vs. Oregon State (Paradise Classic, Honolulu, Hi.) UNC Greensboro at Wofford* High Point at Davidson

7 pm 7 pm

Monday, Dec. 3 Radford at Appalachian State UNC Greensboro at High Point USC Upstate at Coll. of Charleston

6:30 pm 7 pm 7 pm 7 pm 7 pm

Friday, Dec. 14 Appalachian State at Coll. of Charleston* Western Carolina at Hawai’i (Paradise Classic, Honolulu, Hi.)

Monday, Dec. 17 Coll. of Charleston at South Carolina State Elon at High Point Furman at Chattanooga* Western Carolina vs. Tennessee Tech (Paradise Classic, Honolulu, Hi.)

Saturday, Nov. 17 Clemson at Chattanooga 7 pm Western Carolina at Minnesota 7 pm (Minnesota Subway Classic, Minneapolis, Minn.) Furman at Jacksonville State 8:30 pm Davidson vs. Gardner-Webb or Georgia State TBA (Carolina First Classic, Asheville, N.C.)

7 pm 7 pm

Thursday, Dec. 13 Elon at Winston-Salem State

Tuesday, Nov. 27 Coll. of Charleston at North Carolina Wofford at Virginia Tech

7 pm

5 pm 7 pm 7 pm

Wednesday, Dec. 12 Kennesaw State at Coll. of Charleston

Tuesday, Dec. 4 Wofford at Gardner-Webb

7 pm 7 pm

7 pm

12 Noon 2 pm 4 pm 7 pm

2:30 pm 3 pm

7 pm 7 pm 7 pm

7 pm

Wednesday, Dec. 19 Coll. of Charleston at Wake Forest UNC Greensboro vs. LaSalle (UCF Holiday Classic, Orlando, Fla.) Wofford at North Florida (UNF Holiday Classic, Jacksonville, Fla.) Appalachian State at Central Florida (UCF Holiday Classic, Orlando, Fla.) Thursday, Dec. 20 Presbyterian at Georgia Southern Appalachian State vs. LaSalle (UCF Holiday Classic, Orlando, Fla.) Elon vs. UT-Arlington (Charlotte Xmas Classic, Charlotte, N.C.) Chattanooga at Western Carolina* Davidson at Viriginia Furman at Stetson UNC Greensboro at Central Florida (UCF Holiday Classic, Orlando, Fla.)

7 pm 12:00 am

2 pm 3 pm 4 pm 6 pm 7 pm

3pm

5:30 pm 7 pm 7 pm 10 pm

5 pm

11 am 5 pm 7 pm 7:30 pm

3 pm 5 pm 5 pm 7 pm 7 pm 7 pm 7:30 pm

Friday, Dec. 21 Elon vs. Charleston Southern (Charlotte Xmas Classic, Charlotte, N.C.)

5 pm

Thursday, Dec. 27 Georgia Southern vs. TBA (VCU Tournament, Richmond, Va.)

TBA

7 pm

7 pm 7 pm

Thursday, Dec. 6 East Tennessee State at Davidson

7 pm

Saturday, Dec. 8 Wake Forest at Western Carolina

4 pm

Sunday, Dec. 9 Georgia Southern at Georgia Tech Davidson at Georgia Wofford at North Carolina

4:30 pm

1 pm

Sunday, Nov. 25 Appalachian State at Virginia Commonwealth Furman at North Carolina

7 pm 7 pm

Wednesday, Nov. 14 Southern Virginia at Wofford Coll. of Charleston at Coastal Carolina Tusculum at Furman

Tuesday, Nov. 20 Wofford at Southeastern Lousiana Appalachian State at Gardner-Webb Chattanooga at East Tennessee State Furman at UNC Asheville Jacksonville State at Georgia Southern

7 pm

7 pm 8 pm 8 pm

7 pm

7 pm 7 pm 7 pm 7 pm

Monday, Nov. 19 North Carolina A&T at Elon UNC Wilmington at Coll. of Charleston

5 pm

Saturday, Nov. 24 UNC Greensboro vs. UNC Asheville/North Carolina A&T 1/3 pm (UNCG Thanksgiving Tournament) Davidson at Charlotte 2 pm Georgia Southern at UT San Antonio 4 pm (UT San Antonio Classic, San Antonio, Texas) Chattanooga vs. Delaware or Louisville TBA (Panera Bread Challenge) Elon at UNC Wilmington TBA

Tuesday, Nov. 13 Appalachian State at North Carolina State Elon at North Carolina Georgia Southern at Georgia Liberty at UNC Greensboro

Friday, Nov. 16 North Carolina Central at Appalachian State Davidson at UNC Asheville (Carolina First Classic)

Friday, Nov. 23 Georgia Southern vs. Arkansas (UT San Antonio Classic, San Antonio, Texas) Murray State at Chattanooga (Panera Bread Challenge) Boston University at UNC Greensboro (UNCG Thanksgiving Tournament)

1 pm 2:30 pm 7 pm

Friday, Dec. 28 Chowan at UNC Greensboro Davidson vs. Auburn (St. Joe’s Hawk Classic, Philadelphia, Pa.) Appalachian State at San Diego (San Diego Surf N’ Slam; San Diego, Calif.) Georgia Southern vs. TBA (VCU Tournament, Richmond, Va.)

3 pm 4 pm 9 pm TBA


3:30 pm

TBA

TBA

3 pm

Wednesday, Jan. 2 Bethune-Cookman at Wofford Davidson at Coll. of Charleston* UNC Greensboro at Furman*

3 pm 6 pm 7 pm 7 pm

Saturday, Feb. 23 Georgia Southern at Western Carolina* (TV - SportSouth) Chattanooga at Coll. of Charleston* Davidson at Wofford* UNC Greensboro at Elon*

Saturday, Jan. 26 Furman at Appalachian State* Wofford at Davidson* Elon at UNC Greensboro* Coll. of Charleston at Chattanooga* Western Carolina at Georgia Southern*

2 pm 2 pm 3 pm 5 pm 5 pm

Monday, Feb. 25 Appalachian State at Wofford* Chattanooga at Georgia Southern* Davidson at Furman* Western Carolina at Coll. of Charleston*

6 pm 7 pm 7 pm 7 pm

Monday, Jan. 28 Coll. of Charleston at Western Carolina* Wofford at Appalachian State* Georgia Southern at Chattanooga*

5 pm 5 pm 7 pm

Tuesday, Jan. 29 Furman at Davidson*

Thursday, Feb. 28 Wofford at UNC Greensboro* Coll. of Charleston at Appalachian State* Furman at Elon* Davidson at Georgia Southern* Western Carolina at Chattanooga*

5 pm 7 pm 7 pm 7 pm 7 pm

7 pm Saturday, March 1 Georgia Southern at Appalachian State* Coll. of Charleston at Davidson* Wofford at Elon* Furman at UNC Greensboro*

1 pm 2 pm 2 pm 3 pm

9/11 pm

2 pm 2 pm 3 pm

Monday, Dec. 31 Coll. of Charleston at Charleston Southern

Monday, Jan. 21 Appalachian State at UNC Greensboro* Chattanooga at Wofford* Davidson at Elon* Western Carolina at Furman*

2 pm 7 pm 7 pm

Wednesday, Jan. 30 Presbyterian at Elon Saturday, Feb. 2 Elon at Coll. of Charleston* UNC Greensboro at Georgia Southern* Wofford at Furman* Davidson at Western Carolina* Appalachian State at Chattanooga*

12 Noon

2 pm 3 pm 3 pm 4 pm 5 pm

Thursday, Jan. 3 Western Carolina at UNC Wilmington

7 pm

Saturday, Jan. 5 Coll. of Charleston at Elon* Chattanooga at Appalachian State* Western Carolina at Davidson* Georgia Southern at UNC Greensboro* Furman at Wofford*

2 pm 2 pm 2 pm 3 pm 6 pm

Monday, Jan. 7 Coll. of Charleston at UNC Greensboro* Chattanooga at Davidson* Georgia Southern at Elon* Western Carolina at Appalachian State* Wofford at Kentucky

3 pm 7 pm 7 pm 7 pm 7 pm

Saturday, Feb. 9 Davidson at Appalachian State* Chattanooga at Elon* Coll. of Charleston at Furman* Western Carolina at UNC Greensboro* Georgia Southern at Wofford*

1 pm 2 pm 3 pm 3 pm 4 pm

Tuesday, Jan. 8 Charleston Southern at Furman

7 pm

Monday, Feb. 11 Western Carolina at Elon* Coll. of Charleston at Wofford* Chattanooga at UNC Greensboro* Georgia Southern at Furman*

5 pm 6 pm 7 pm 7 pm

Wednesday, February 13 Appalachian State at Furman*

7 pm

Friday, Feb. 15 UNC Greensboro at Davidson*

7 pm

Saturday, Feb. 16 Elon at Appalachian State* Georgia Southern at Coll. of Charleston* Wofford at Western Carolina*

2 pm 2 pm TBA

Saturday, Jan. 12 Elon at Chattanooga* (TV - SportSouth) Appalachian State at Davidson* Furman at Coll. of Charleston* Wofford at Georgia Southern* UNC Greensboro at Western Carolina* Monday, Jan. 14 Elon at Western Carolina* Furman at Georgia Southern* UNC Greensboro at Chattanooga* Wofford at Coll. of Charleston*

12:30 pm 2 pm 2 pm 3 pm 4 pm

12:00 Noon 7 pm 7 pm 7 pm

Wednesday, Jan. 16 East Tennessee State at Appalachian State Friday, Jan. 18 Davidson at UNC Greensboro* Saturday, Jan. 19 Appalachian State at Elon* Western Carolina at Wofford* Coll. of Charleston at Georgia Southern* Chattanooga at Furman*

7 pm

Monday, Feb. 4 Appalachian State at Western Carolina* Elon at Georgia Southern* Davidson at Chattanooga* UNC Greensboro at Coll. of Charleston*

Monday, Feb. 18 Wofford at Chattanooga* Furman at Western Carolina*

12:30 pm 2 pm 2 pm 2 pm

Thursday-Monday, March 6-10 Southern Conference Women’s Basketball Championship (North Charleston, S.C.)

5 pm 5:15 pm 7 pm 7 pm

5:15 pm 7 pm

7 pm

2 pm 2 pm 3 pm 3 pm

Tuesday, Feb. 19 Elon at Davidson* UNC Greensboro at Appalachian State*

7 pm 7 pm

2007-08 UNCG Women’s Basketball Media Guide • 57

2007-08 SoCon Schedule

Sunday, Dec. 30 North Florida at Wofford Western Carolina at North Carolina State Chattanooga vs. Miami University (UTSA Tournament, San Antonio, Texas) Furman vs. Georgetown or East Carolina (Lady Luck Classic, Blacksburg, Va.)

3 pm

UNCGSpartans.com •

Saturday, Dec. 29 Chattanooga vs. Weber State (UTSA Tournament, San Antonio, Texas) Furman at Virginia Tech (Lady Luck Classic, Blacksburg, Va.) Appalachian State vs. Texas/DePaul (San Diego Surf N’ Slam; San Diego, Calif.) Davidson vs. TBA (St. Joe’s Hawk Classic, Philadelphia, Pa.)


CGSpartans.com • UNCGSpartans.com • UNCGSpartans.com •

2007-08 Opponents

NORTH CAROLINA STATE Novemberr 11, 2007 Reynolds Colisieum, Raleigh, NC

LIBERTY Novemberr 13, 2007 Fleming Gym, Greensboro, NC

DUKE Novemberr 18, 2007 Cameron Indoor Stadium, Durham, NC

Universityy Information Location: Raleigh, North Carolina Nickname: Wolfpack Enrollment: 29, 416 Colors: Red and White Chancellor: Dr. James L. Oblinger Director of Athletics: Lee Fowler Conference: Atlantic Coast Conference Arena (Capacity): Reynolds Coliseum (9, 500)

Universityy Information Location: Lynchburg, Virginia Nickname: Flames Enrollment: 26, 600 Colors: Red , White and Blue Chancellor: Dr. Jerry Falwell, Jr. Director of Athletics: Jeff BArber Conference: Big South Arena (Capacity): Vines Center (8, 500)

Universityy Information Location: Durham, North Carolina Nickname: Blue Devils Enrollment: 6, 558 Colors: Royal Blue and White President: Dr. Richard H. Brohead Director of Athletics: Joe Alleva Conference: Atlantic Coast Conference Arena (Capacity): Cameron Indoor Stadium (9, 314)

Coaching g Staff Head Coach: Kay Yow Alma Mater: East Carolina, 1964 Overall Record/Yrs: 708-324/36 Record at NC State/Yrs: 651-306/32 Associate Head Coach: Stephanie Glance Alma Mater: Rollins, 1985 Assistant Coaches: Jenny Palmateer, Trena TriceHill

Coaching g Staff Head Coach: Carey Green Alma Mater: Coastal Carolina, 1979 Overall Record/Yrs: 185-64/8 Record at Liberty/Yrs: Same Assistant Coaches: Alexis Sherard, Andrea “Andy” Bloodworth, Heather Stephens

Coaching g Staff Head Coach: Joanne P. McCallie Alma Mater: Northwestern, 1987 Overall Record/Yrs: 316-148/15 Record at Duke/Yrs: First Season Assistant Coaches: Al Brown, Shannon Perry, Samantha Williams

Team Information 2006-07 Overall Record: 19-12 2006-06 Conference Record: 10-4 Starters Returning/Lost: 3/2 Letterwinners Returning/Lost: 9/5

Team Information 2006-07 Overall Record: 32-2 2006-06 Conference Record: 14-0 Starters Returning/Lost: 2/2 Letterwinners Returning/Lost: 9/2

Sports p Information Women’s Basketball SID: Paul Carmany 2IÀFH3KRQH 434-582-2292 2IÀFH)D[ 434-582-2076 Email: pjcarmany@liberty.edu Press Row Phone: 434-582-7451 Web Address:ZZZOLEHUW\ÁDPHVFRP

Sports p Information Women’s Basketball SID: Lindy Brown 2IÀFH3KRQH 919-684-2664 2IÀFH)D[ 919-684-2489 Email: lbrown@duaa.duke.edu Press Row Phone: 919-684-6186 Web Address: www.goduke.com

All-Time Series UNCG leads series, 14-4 Last meeting: December 29, 2006; UNCG 67, Liberty, 59 (at College Park, MD)

All-Time Series Duke leads series, 8-4 Last meeting: Novemberr 11, 2001; Duke 90, UNCG, 58 (at Durham, NC)

Team Information 2006-07 Overall Record: 25-10 2006-06 Conference Record: 10-4 Starters Returning/Lost: 2/3 Letterwinners Returning/Lost: 8/6 Sports p Information Women’s Basketball SID: Mark Kimmel 2IÀFH3KRQH 919-515-2102 2IÀFH)D[ 919-515-2898 Email: mark_kimmel@ncsu.edu Press Row Phone: 919-513-1220 Web Address: www.gopack.com All-Time Series North Carolina State leads series, 11-1 Last meeting: Novemberr 11, 2005; NC State 76, UNCG, 46 (at Raleigh, NC) 2007-08 Schedule N7 Premier Players (EXH) N11 UNC Greensboro N13 Appalachian State N17 vs. St. Johns! N18 Vermont/Brown! N20 Arizona N23 Washington State# N24 Alabama/Eastern Michigan# N29 Illinois& D1 at Temple D4 Xavier D9 at East Carolina D16 North Carolina A&T D21 at Mississippi D28 Alabama State D30 Western Carolina J6 at Boston College J13 North Carolina J17 Georgia Tech J20 at Duke J25 Virginia Tech J27 Wake Forest F1 at Virginia F7 at Florida State F10 Boston College% F14 Miami F17 at Wake Forest F25 at North Carolina F28 at Clemson M2 Maryland M6-9 ACC Tournament

7 pm 2 pm 7 pm 2:30 pm 12:30/ 2:30 pm 7 pm 3:30 pm 1/3:30 pm 7 pm 2 pm 7 pm 2 pm 2 pm 2 pm 2 pm 2 pm 1 pm 1 pm 7 pm 1 pm 7 pm 12:30 pm 7 pm 7 pm 4:30 pm 7 pm 1:30 pm 7 pm 7 pm 1pm TBA

!-TD Banknorth Classic (Burlington, VA) #-Junkaroo Jam (Freeport, Grand Bahama Island) &-Big Ten/ACC Challenge %-Hoops for Hope

58 • 2007-08 UNCG Women’s Basketball Media Guide

2007-08 Schedule N8 Athletes in Action (EXH) N13 at UNC Greensboro N16 at North Carolina A&T N19 at Virginia Tech N23 vs.McNese State! N24 vs. Houston! N25 Xavier! N30 Virginia Union D4 James Madison D8 Binghamton D15 Glenville State D20 vs. Ball State# D21 vs. Austin Peay/UNLV# D30 at North Carolina J5 Richmond J8 at East Tennessee State J15 George Mason J19 at Charleston Southern J21 at Coastal Carolina J26 Presbyterian J29 High Point F2 Winthrop F6 at Radford F9 UNC Asheville F16 Coastal Carolina F18 Charleston Southern F23 at High Point F27 at Winthrop M1 at UNC Asheville M7 Radford M14-16Big South Tournament !-National City Xavier Invitational (Cincinnati, OH) #-Lady Rebel Christmas Classic (Las Vegas, NV)

7 pm 7 pm 7 pm 7 pm 6 pm 6 pm 2 pm 7 pm 6 pm 1 pm 2 pm 8 pm 8/10 pm 2 pm 7 pm 7 pm 7 pm 5:30 pm 7 pm 2 pm 7 pm 7 pm 7 pm 4 pm 4 pm 7 pm 7 pm 7 pm 2 pm 7 pm TBA

2007-08 Schedule N11 at Denver N15 at South Florida! N18 UNC Greensboro N22 vs. Purdue# N23 vs. Temple# N25 Stanford/UConn/Old Dominion# N28 at Vanderbilt D2 at Penn State D6 Rutgers D8 Pittsburgh$ D18 Utah Valley University D21 Bucknell D28 at Houston J3 North Carolina Central J11 Florida State J14 at Maryland J20 North Carolina State J24 at Georgia Tech J28 Tennessee F1 Virginia Tech F4 North Carolina F7 at Boston College F10 Wake Forest F13 at Clemson F17 Maryland F22 at Virginia Tech F24 Virginia M2 at North Carolina M6-9 ACC Tournament

6 pm 7 pm 2 pm 6 pm 6 pm 2 pm 8 pm 5 pm 7 pm 12 pm 7 pm 7 pm 8 pm 7 pm 7 pm 7 pm 1 pm 7 pm 7 pm 7 pm 7 pm 7 pm 2 pm 7 pm 5:30 pm 7 pm 12:30 pm 5:30 pm TBA

!-ESPNU Women’s Basketball Invitational (Tampa, FL) #-US Virgin Islands Paradise Jam (St. Thomas, Virgin Islands) $-Maggie Dixon Classic (New York, NY)


Universityy Information Location: Boston, Massachussetts Nickname: Terriers Enrollment: 16, 572 Colors: Scarlet and White President: Robert A. Brown Director of Athletics: Jack Parker Conference: America East Arena (Capacity): Nickerson Field (10, 412) Coaching g Staff Head Coach: Kelly Greenberg Alma Mater: LaSalle, 1989 Overall Record/Yrs: 132-97/8 Record at Boston University/Yrs: 48-43/4 Assistant Coaches: 0LFKDHO/HĂ DU0DU\+HOHQ Walker, Charmaine Steele

Sports p Information Womenâ&#x20AC;&#x2122;s Basketball SID: Stefanie Howlett 2IĂ&#x20AC;FH3KRQH 617-353-7787 2IĂ&#x20AC;FH)D[ 617-358-4762 Email: howlett@bu.edu Press Row Phone: 617-437-0102 Web Address: www.goterriers.com All-Time Series

Possible opponent UNCG Thanksgiving Tournament

Possible opponent UNCG Thanksgiving Tournament

Universityy Information Location: Asheville, North Carolina Nickname: Bulldogs Enrollment: 3,500 Colors: Royal Blue and White Chancellor: Dr. Anne Ponder Director of Athletics: Janet Cone Conference: Big South Arena (Capacity): Justice Center (1, 100)

Universityy Information Location: Greensboro, North Carolina Nickname: Aggies Enrollment: 11, 436 Colors: Blue and Gold Chancellor: Dr. Stanley F. Battle Director of Athletics: DeLores â&#x20AC;&#x153;Deeâ&#x20AC;? Todd Conference: Mid-Eastern Athletic Conference Arena (Capacity): Corbett Sports Center (5, 700)

Coaching g Staff Head Coach: Betsy Blose Alma Mater: James Madison, 1984 Overall Record/Yrs: 190-149/12 Record at Liberty/Yrs: 76-71/5 Assistant Coaches: Adell Harris, Summer Erb, Brooke Johnson

Coaching g Staff Head Coach: Patricia Cage-Bibbs Alma Mater: Grambling, 1972 Overall Record/Yrs: 397-238/23 Record at NC A&T/Yrs: 26-32/3 Assistant Coaches: Tarrell Robinson, Freddie Murray, Erica Handy, Cousar

Team Information 2006-07 Overall Record; 21-12 2006-06 Conference Record: 9-5 Starters Returning/Lost: 2/3 Letterwinners Returning/Lost: 6/6

Team Information 2006-07 Overall Record: 17-13 2006-06 Conference Record: 12-6 Starters Returning/Lost: 5/0 Letterwinners Returning/Lost: 9/0

Sports p Information Womenâ&#x20AC;&#x2122;s Basketball SID: Everett Hutto 2IĂ&#x20AC;FH3KRQH 82-251-6931 2IĂ&#x20AC;FH)D[ 828-251-6386 Email: ehutto@unca.edu Press Row Phone: N/A Web Address: www.uncabulldogs.com

Sports p Information Womenâ&#x20AC;&#x2122;s Basketball SID: Brian Holloway 2IĂ&#x20AC;FH3KRQH 336-334-7141 2IĂ&#x20AC;FH)D[ 336-334-7181 Email: bmhollow@ncat.edu Press Row Phone: 336-334-7405 Web Address: www.ncataggies.com

All-Time Series UNCG leads series, 14-1 Last meeting: 1998-99 season UNCG 69, UNCA, 52 (at Greensboro, NC)

First Meeting

2007-08 Schedule N10 at Siena N13 Rhode Island N17 Ohio State N19 Northeastern N23 UNC Greensboro! N24 UNC Asheville/NC A&T! N28 Massachusetts D1 at St. Johnâ&#x20AC;&#x2122;s D5 at Brown D11 at Harvard D27 vs. Georgia Southern# D28 Morgan State/VCU# D30 at Kansas J5 Hartford J12 at Binghamton J19 Stony Brook J23 at Maine J26 at New Hampshire J30 UMBC F2 Vermont F6 at Albany F9 at Hartford F13 Binghamton F19 Maine F23 at Vermont F27 New Hampshire M1 at Stony Brook M5 at UMBC M8 Albany M13-16America East Tournament

NORTH CAROLINA A&T November 24, 2007 Fleming Gym, Greensboro, NC

2 pm 7 pm 4 pm 5:30 pm 1 pm 1/3 pm 7 pm 2 pm 7 pm 7 pm 5 pm 5/7:30 pm 3 pm 1 pm 2 pm 1 pm 7 pm Noon Noon 1 pm Noon 2 pm 7 pm 7 pm 2 pm 7 pm 2 pm 7 pm 1 pm TBA

!-UNCG Thanksgiving Tournament (Greensboro, NC) #-VCU Tournament (Richmond, VA)

2007-08 Schedule N1 Mars Hills (EXH) N5 Brevard (EXH) N12 Montreat N16 Davidson N17 Gardner-Webb/Georgia State N20 Furman N23 North Carolina A&T! N24 UNC Greensboro/Boston University! N28 at Western Carolina D1 at East Tennessee State D8 Presbyterian D12 Campbell D17 at Gardenr-Webb D21 Mercer D28 Florida Tournament D29 Florida Tournament J3 at South Carolina J5 at Presbyterian J8 USC Upstate J19 High Point J26 Coastal Carolina J29 at Charleston Southern F2 at Radford F6 Winthrop F9 at Liberty F13 at Coastal Carolina F20 at High Point F23 Charleston Southern F26 Radford M1 Liberty M5 at Winthrop M 13-15 Big South Tournament !-UNCG Thanksgiving Tournament (Greensboro, NC)

All-Time Series UNCG leads series, 13-5 Last meeting: Novemberr 11, 2001; UNCG 88, NC A&T, 45 (at Greensboro, NC) 7 pm 7 pm 7 pm 8 pm 2/4 pm 7 pm 3 pm 1/3 pm TBD TBD 2 pm 7 pm 7 pm 7 pm TBA TBA 7 pm 2 pm 7 pm 7 pm 2 pm 7 pm TBD 7 pm TBD 7 pm 7 pm 2 pm 7 pm 2 pm TBA TBA

2007-08 Schedule N5 EXH N9 st Stertson N16 Liberty N19 at Elon N23 UNC Asheville N24 UNC Greesboro/Boston University N27 USC Upstate D1 at Norfolk State D5 at Virginia Tech D16 at North Carolina State D19 Campbell D30 at Texas A&M J2 at Baylor J12 Morgan State J14 Coppin State J19 Maryland-Eastern Shores J21 at Deleware State J26 Winston-Salem State J28 South Carolina State F2 Howard F4 Hampton F9 at Florida A&M F11 at Bethune-Cookman F16 Maryland-Eastern Shores F18 Deleware State F23 at Winston-Salem State F25 at South Carolina State M1 at Howard M3 at Hampton 0 1RUĂ RN 6WDWH M10-15MEAC Tournament

7 pm 6pm 7 pm 7 pm 3 pm 1/3 pm 7 pm 4 pm 7 pm 2 pm 7 pm 7 pm 7 pm 2 pm 5:30 pm 2 pm 5:30 pm 2 pm 5:30 pm 2 pm 5:30 pm 2 pm 5:30 pm 2 pm 5:30 pm 4 pm 5:30 pm 2 pm 6 pm  SP TBA

!-UNCG Thanksgiving Tournament (Greensboro, NC)

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 59

2007-08 Opponents

Team Information 2006-07 Overall Record; 15-15 2006-06 Conference Record: 7-9 Starters Returning/Lost: 3/2 Letterwinners Returning/Lost: 9/2

UNC ASHEVILLE November 24, 2007 Fleming Gym, Greensboro, NC

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com

BOSTON UNIVERSITY November 23, 2007 Fleming Gym, Greensboro, NC


CGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘

2007-08 Opponents

CHARLOTTE November 28, 2007 Fleming Gym, Greensboro, NC

HIGH POINT December 3, 2007 Millis Center, High Point, NC

LONGWOOD December 5, 2007 Willett Hall, Farmville, VA

Universityy Information Location: Charlotte, North Carolina Nickname: 49ers Enrollment: 22, 254 Colors: Green and White Chancellor: Dr. Phillip L. Dubois Director of Athletics: Judy Rose Conference: Atlantic 10 Arena (Capacity): Halston Arena (9, 105)

Universityy Information Location: High Point, North Carolina Nickname: Panthers Enrollment: 3, 100 Colors: Purple and White President: Dr. Nido Quebein Director of Athletics: Dr. Woody Gibson Conference: Big South Arena (Capacity): Millis Center (2, 565)

Universityy Information Location: Farmville, Virginia Nickname: Lancers Enrollment: 4, 350 Colors: Blue and White President: Dr. Patricia P. Cormier Interim Director of Athletics: Troy Austin Conference: Independent Arena (Capacity): Willett Hall (1, 726)

Coaching g Staff Head Coach: Karen Aston Alma Mater: Arkansas-Little Rock, 1987 Overall Record/Yrs: First Season Record at Charlotte/Yrs: First Season Assistant Coaches: .HQ*ULIĂ&#x20AC;Q.U\VWLRQ2ELH Angela Ortega

Coaching g Staff Head Coach: Tooey Loy Alma Mater: High Point, 1994 Overall Record/Yrs: 100-75/6 Record at High Point/Yrs: Same Assistant Coaches: Karen Curtis, Katie Oâ&#x20AC;&#x2122;Dell, David Kim

Coaching g Staff Head Coach: Kristin Caruso Alma Mater: Connecticut, 1990 Overall Record/Yrs: 32-79/Four Record at Longwood/Yrs: First Season Assistant Coaches: Anthony Crocitto, Elizabeth Stich, Gayle Coats

Team Information 2006-07 Overall Record:19-13 2006-06 Conference Record: 9-5 Starters Returning/Lost: 4/1 Letterwinners Returning/Lost: 9/3

Team Information 2006-07 Overall Record; 18-12 2006-06 Conference Record: 11-3 Starters Returning/Lost: 2/3 Letterwinners Returning/Lost: 10/5

Team Information 2006-07 Overall Record: 8-21 2006-06 Conference Record: N/A Starters Returning/Lost: 3/2 Letterwinners Returning/Lost: 8/5

Sports p Information Womenâ&#x20AC;&#x2122;s Basketball SID: Brent Statsny 2IĂ&#x20AC;FH3KRQH 704-687-6313 2IĂ&#x20AC;FH)D[ 704-687-4918 Email: bmstatn@uncc.edu Press Row Phone: 704-687-4999 Web Address: www.charlotte49ers.com

Sports p Information Womenâ&#x20AC;&#x2122;s Basketball SID: April Goode 2IĂ&#x20AC;FH3KRQH 336-841-4638 2IĂ&#x20AC;FH)D[ 336-841-9182 Email: agoode@highpoint.edu Press Row Phone: 336-841-4638 Web Address: www.highpointpanthers.com

Sports p Information Womenâ&#x20AC;&#x2122;s Basketball SID: Christina Oâ&#x20AC;&#x2122;Brien 2IĂ&#x20AC;FH3KRQH 434-395-2718 2IĂ&#x20AC;FH)D[ 434-395-2568 Email: obriencm@longwood.edu Press Row Phone: 434-395-2871 Web Address: www.longwoodlancers.com

All-Time Series Charlotte leads series, 11-2 Last meeting: November 20, 2006; Charlotte 86, UNCG, 40 (at Charlotte, NC)

All-Time Series UNCG leads series, 9-8 Last meeting: Decemberr 18, 2006; UNCG 63, High Point, 53 (at Greensboro, NC)

All-Time Series UNCG leads series, 15-10 Last meeting: November 24, 2006; UNCG 81, Longwood, 50 (at Greensboro, NC)

2007-08 Schedule N9 vs. Pittsburgh! N10 at Penn State! N11 vs. Arizona! N15 at Wake Forest N17 at Old Dominion N21 Hampton N24 Davidson N28 at UNC Greensboro D2 Minnesota D5 at UAB D16 Virginia Tech D20 Charleston Southern# D21 Texas-Arlington# D30 at Arkansas State J2 Clemson J5 Winthrop J12 at Duquesne J15 Massachusetts J19 St. Louis J22 at Dayton J26 at George Washington J30 LaSalle F2 at St. Louis F6 at Temple F9 St. Bonaventure F12 St. Josephâ&#x20AC;&#x2122;s F17 at Xavier F24 Rhode Island F27 at Fordham M1 Richmond M7-10 Atlantic 10 Tournament

5 pm 6:30 pm 2 pm 7 pm 4 pm 7 pm 2 pm 7 pm 2 pm 8 pm 2 pm 7:30 pm 7:30 pm 2 pm 7 pm 7 pm 7 pm 12 Noon 7 pm 7 pm 2 pm 7 pm 8 pm 7 pm 7 pm 7 pm 12 Noon 2 pm 6 pm 7 pm TBA

!- WBCA Classic (University Park, PA) #-Springhill Suites Holiday Classic (Charlotte, NC)

60 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

2007-08 Schedule N4 Emory and Henry (EXH) N7 Belmont Abbey N10 King College N11 at Virginia Tech N14 at Oklahoma State N19 at East Carolina N24 Livingstone College N27 at UNC Wlmington N29 Campbell D3 UNC Greensboro D15 at Davidson D17 Elon D29 vs.Eastern Kentucky! D30 St. Peterâ&#x20AC;&#x2122;s/Penn! J2 at Gardner-Webb J5 North Carolina Central J12 Presbyterian J19 at UNC Asheville Winthrop J23 J26 at Radford J29 at Liberty F2 Charleston Southern F6 at Longwood Coastal Carolina F9 F12 Radford F16 at Winthrop F20 UNC Asheville F23 Liberty F26 at Charleston Southern M1 at Coastal Carolina M13-15Big South Tournament !-St. Peterâ&#x20AC;&#x2122;s Tournament (Jersey City, NJ)

7pm 7 pm 7 pm 7 pm 7 pm 7pm 7 pm 7 pm 7 pm 7 pm 7 pm 7 pm 1 pm 1/3 pm 7 pm 7 pm 3 pm 2 pm 7 pm 3 pm 7 pm 3 pm 7 pm 5 pm 7 pm TBA 7 pm 7 pm 7 pm 2 pm TBD

2007-08 Schedule N4 MI Express (EXH) N9 American N10 at Virginia N13 at St. Francis N16 Howard! N17 Morgan State N23 at George Mason N29 at Richmond D1 at Maryland Easstern Shore D3 at Mount St. Maryâ&#x20AC;&#x2122;s D5 UNC Greensboro D7 William and Maryy D15 Gardner-Webb D21 VCU D30 at Wake Forest J2 at Central Conn. State J3 at Massachusetts J5 at Fordham J9 Winthrop J17 Radford J19 at NJIT J21 at Columbia J27 at Savannah State F1 at Texas-Pan American F3 vs. Chicago State F6 High Point F13 at Winston-Salem State F17 Savannah State F24 Presbyterian M2 NJIT

2 pm 5 pm 7 pm 7 pm 6 pm 3 pm 7 pm TBA 5:30 pm 7 pm 7 pm 7 pm 2 pm 3 pm 3 pm 2 pm 7 pm 1 pm 7 pm 7 pm 2 pm 7 pm 4 pm TBA TBA 7 pm 7 pm 2 pm 2 pm 2 pm


Universityy Information Location: Spartanburg, South Carolina Nickname: Terriers Enrollment: 1,250 Colors: Old Gold and Black Chancellor: Dr. Benjamin B. Dunlap Director of Athletics: Richard A. Johnson Conference: Southern Arena (Capacity): Benjamin Arena (9, 500)

Team Information 2006-07 Overall Record: 13-16 2006-07 Conference Record: 7-11 Starters Returning/Lost: 4/1 Letterwinners Returning/Lost: 9/4

UCF Holiday Classic

Universityy Information Location: Philadelphia, Pennsylvania Nickname: Explorers Enrollment: 6, 138 Colors: Blue and Gold President: Brother Michael J. McGinniss, F.S.C. Director of Athletics: Dr. Thomas Brennan Conference: Atlantic 10 Arena (Capacity): Tom Gola Arena (4, 000)

Universityy Information Location: Orlando, Florida Nickname: Knights Enrollment: 47,000 Colors: Black and Gold President: Dr. John C. Hitt Director of Athletics: Keith R. Tribble Conference: Conference USA Arena (Capacity): UCF Arena (10, 000)

Coaching g Staff Head Coach: Tom Lochner Alma Mater: Temple, 1999 Overall Record/Yrs: 42-44/4 Record at LaSalle/Yrs: Same Associate Head Coach: Chrissie Doogan Alma Mater: LaSalle, 1997 Assistant Coaches: Mimi Riley, Stacy Smalls

Coaching g Staff Head Coach: Joi Williams Alma Mater: South Florida, 1988 Overall Record/Yrs: 54-61/4 Record at Central Florida/Yrs: First Season Assistant Coaches: Brandy Manning, Alyshia Bond, Greg Brown Team Information 2006-07 Overall Record; 8-22 2006-06 Conference Record: 3-13 Starters Returning/Lost: 1/4 Letterwinners Returning/Lost: 2/8 Sports p Information Women’s Basketball SID: Cheryl Flesch 2IÀFH3KRQH 407-823-2464 2IÀFH)D[ 407-823-5266 Email: FÁHVFK#DWKOHWLFVXFIHGX Press Row Phone: N/A Web Address: www.UCFAthletics.com

Sports p Information Women’s Basketball SID: Marc Mullen 2IÀFH3KRQH 215-951-1513 2IÀFH)D[ 215-951-1694 Email: mmullen@lasalle.edu Press Row Phone: 215-438-5858 Web Address: www.GoExplorers.com

All-Time Series UNCG leads series, 23-1 Last meeting: Februaryy 19, 2007; UNCG 71, Wofford, 66 (at Greensboro, NC)

!-North Florida Tournament (Jacksonville, FL)

UCF Holiday Classic

Team Information 2006-07 Overall Record; 19-11 2006-07 Conference Record: 7-7 Starters Returning/Lost: 3/2 Letterwinners Returning/Lost: 8/2

Sports p Information Women’s Basketball SID: Travis Woods 2IÀFH3KRQH 864-597-4092 2IÀFH)D[ 864-597-4129 Email: woodstj@wofford.edu Press Row Phone: 864-597-4487 Web Address: www.wofford.edu/athletics

2007-08 Schedule N11 at Costal Carolina N14 Southern Virginia N20 at Southeast Louisiana N27 at Virginia Tech D1 Elon D4 at Gardner-Webb D9 at North Carolina D15 UNC Greensboro D18 vs. Savannah State! D19 at North Florida! D29 North Florida J2 Bethune-Cookman J5 Furman J7 at Kentucky J12 at Georgia Southern J14 at College of Charleston J19 Western Carolina J21 Chattanooga J26 at Davidson J28 at Appalachian State F2 at Furman F9 Georgia Southern F11 College of Charleston F16 at Western Carolina F18 at Chattanooga F23 Davidson F25 Appalachian State F28 at UNC Greensboro M1 at Elon M6-10 Southern Conference Tournament

CENTRAL FLORIDA December 20, 2007 UCF Arena, Orlando, FL

All-Time Series First Meeting

All-Time Series First Meeting

2 pm 5 pm 6:30 pm 7 pm TBA 7 pm 2 pm 6 pm 5 pm 7 pm 3 pm 2 pm 6 pm 7 pm 3 pm 7 pm 2 pm 6 pm 2 pm 5 pm 3 pm 4 pm 6 pm 4 pm 5:15 pm 2 pm 6 pm 5 pm 2 pm TBA

2007-08 Schedule O31 MI Express (EXH) N9 Villanova N14 Loyola (MD) N17 at Drexel N19 Albanyy N25 Central Florida N28 at Deleware D1 at Binghamton D8 Quinnipiac D16 at Boston College D19 UNC Greensboro! D20 Appalachian State! D28 Sacred Heart D31 UW-Milwaukee J4 at Lafayette J7 Penn J12 at Richmond J16 Dayton J19 at Fordham J23 at George Washington J26 St. Bonaventure J30 at Charlotte F2 Temple F6 Massachusetts F10 at St. Louis F16 Fordham F20 at Rhode Island F23 Xavierr F27 St. Joseph’s M1 at Duquesne M7-10 A-10 Championships !-UCF Holiday Classic (Orlando, FL)

7:30 pm 4 pm 7 pm 1 pm 7 pm 1 pm 7 pm 2 pm 1 pm 2 pm 5 pm 5 pm 1 pm 2 pm 7 pm 7 pm 2 pm 7 pm 3 pm 7 pm 5 pm 7 pm 1 pm 7 pm 3 pm 1 pm 7 pm 1 pm 7 pm 7 pm TBA

2007-08 Schedule N4 Rollins College (EXH) N9 Texas Tech! N11 Coppin State! N15 at North Florida N19 Jacksonville N23 at Rider N25 at LaSalle N28 Bethune Cookman D2 at Miami D9 Florida Gulf Coast D15 Southeastern Louisiana D19 Appalachian State# D20 UNC Greensboro# D31 at Stetson J5 Southern Mississippi J11 at SMU J13 at Tulsa J17 Houston J20 at Rice J25 at Southern Mississippi J31 Marshall F2 East Carolina F7 UAB F9 Memphis F15 at Marshall F17 at East Carolina F22 Tulane F24 UTEP F28 at UAB M1 at Memphis M6-9 Conference USA Tournament

2 pm 7:30 pm 4:30 pm 7 pm 7 pm 7 pm 1 pm 5 pm 12 Noon 1 pm 7 pm 7:30 pm 7:30 pm 12 Noon 7 pm TBA 3 pm 7 pm 3 pm 8 pm 7 pm 5 pm 7 pm 5 pm 7 pm 2 pm 7 pm 2 pm 8 pm 3 pm TBA

!-UCF Knights Classic (Orlando, FL) #-UCF Holiday Classic (Orlando, FL)

2007-08 UNCG Women’s Basketball Media Guide • 61

2007-08 Opponents

Coaching g Staff Head Coach: Edgar Farmar, Jr. Alma Mater: North Carolina, 1994 Overall Record/Yrs: 24-61/36 Record at Wofford/Yrs: Same Assistant Coaches: Ed Geth, Brooke Wilhoit

LLASALLE Decemberr 19, 2007 UCF Arena, Orlando, FL

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com

WOFFORD Decemberr 15, 2007 Benjamin Arena, Spartanburg, SC February 28, 2008 Fleming Gym, Greensboro, NC


CGSpartans.com • UNCGSpartans.com • UNCGSpartans.com •

2007-08 Opponents

CHOWAN December 28, 2007 Fleming Gym, Greensboro, NC

FURMAN January 2, 2008 Timmons Arena, Greenville, SC March 1, 2008 Fleming Gym, Greensboro, NC

Universityy Information Location: Murfreesboro, North Carolina Nickname: Hawks Enrollment: 850 Colors: Blue and White President: Dr. M. Christopher White Director of Athletics: Dennis Helsel Conference: Independent Arena (Capacity): Helms Center (3, 500) Coaching g Staff Head Coach: Patrick Mashuda Alma Mater: Robert Morris Overall Record/Yrs: 47-35/3 Record at Chowan/Yrs: Same Assistant Coach: Alex Street Team Information 2006-07 Overall Record:14-15 2006-06 Conference Record: 14-15 Starters Returning/Lost: 2/3 Sports p Information Women’s Basketball SID: Meredith Long 2IÀFH3KRQH 252-398-6468 2IÀFH)D[ 252-398-1390 Email: longm@chowan.edu Web Address: www.gocuhawks.com All-Time Series First Meeting

2007-08 Schedule N12 Barton College N16 vs. St. Vincent College! N17 TBA! N20 Virginia State N25 at NC Wesleyan N27 Morris College N30 WVU Tech Classic# D1 WVU Tech Classic# D5 St. Andrews Presbyterian D14 at Coker$ D15 vs. Converse$ D17 at UNC Pembroke D28 at UNC Greensboro J3 Virginia State J10 Virginia Union J12 North Greenville J13 NC Wesleyan J16 at Newport News Apprentice J19 Unoveresity of D.C. J21 WVU Tech J25 at Allen Unoversityy J26 at Morris College F2 at North Greenville F4 St. Augustine’s College F7 at Columbia Union F9 at University of D.C. F12 Newport News Apprentice F14 Allen University F18 NCAA South Region F24 Independent Classic

7 pm 5:30 pm TBA 5:30 pm 3 pm 5:30 pm TBA TBA 6 pm 4 pm 2 pm 5:30 pm 3 pm 5 pm 5 pm 2 pm 3 pm 6 pm 2 pm 6 pm 6 pm 2 pm 2 pm 7 pm 7 pm 2 pm 6 pm 6 pm TBA TBA

!-Seton Hill University Classic (Greensburg, PA) #-WVU Tech Classic (Montgomery, WV) $-Coker Classic (Hartsville, SC)

Universityy Information Location: Greenville, South Carolina Nickname: Lady Paladins Enrollment: 2, 600 Colors: Purple and White President: Dr. David Shi Director of Athletics: Dr. Gary Clark Conference: Southern Arena (Capacity): Timmons Arena (5, 000)

Universityy Information Location: Statesboro, Georgia Nickname: Eagles Enrollment: 16, 435 Colors: Blue and White President: Dr. Bruce F. Grube Director of Athletics: Sam Baker Conference: Southern Arena (Capacity): Hanner Fieldhouse (4, 358)

Coaching g Staff Head Coach: Sam Dixon Alma Mater: Wooster, 1979 Overall Record/Yrs: 73-74/6 Record at Furman/Yrs: 73-73/6 Assistant Coaches: Brooke Carrigan-Jackson, Jonathan Barbaree, Lauren Allen

Coaching g Staff Head Coach: Rusty Cram Alma Mater: Louisiana Tech, 1985 Overall Record/Yrs: 167-151/11 Record at Georgia Southern/Yrs: Same Assistant Coaches: Regina Days-Bryan, Mary Perry, Lee Dubose

Team Information 2006-07 Overall Record; 11-20 2006-06 Conference Record: 5-13 Starters Returning/Lost: 4/2 Letterwinners Returning/Lost: 11/3

Team Information 2006-07 Overall Record; 13-8 2006-06 Conference Record: 7-11 Starters Returning/Lost: 5/0 Letterwinners Returning/Lost: 10/3

Sports p Information Women’s Basketball SID: Kim Tonkin 2IÀFH3KRQH 864-294-3062 2IÀFH)D[ 864-294-3061 Email: kim.tonkin@furman.edu Press Row Phone: N/A Web Address: www.furmanpaladins.com

Sports p Information Women’s Basketball SID: Dave Headrick 2IÀFH3KRQH 912-681-5448 2IÀFH)D[ 912-681-5289 Email: dheadrick@georgiasouthern.edu Press Row Phone: 912-681-5289 Web Address: www.georgiasoutherneagles.com

All-Time Series UNCG leads series, 16-8 Last meeting: February 3, 2007; UNCG 65, Furman, 58 (at Greenville, SC)

All-Time Series UNCG leads series, 16-10 Last meeting: March 1, 2007; Georgia Southern 81, UNCG, 64 (at N. Charleston, SC)

2007-08 Schedule N2 North Greenville College (EXH) N11 at Vanderbilt N14 Tusculum N17 at Jacksonville State N20 at UNC Asheville N25 at North Carolina N30 Rice D5 Clemson D15 Elon D17 at Chattanooga D20 at Stetson D29 at Virginia Tech! D30 East Carolina/Georgetown! J2 UNC Greensboro J5 at Wofford J8 Charleston Southern J12 at College of Charleston J14 at Georgia Southern J19 Chattanooga J21 Western Carolina J26 at Appalachian State J29 at Davidson F2 Wofford F9 College of Charleston F11 Gerorgia Southern F13 Appalachian State F18 at Western Carolina F25 Davidson F28 at Elon M1 at UNC Greensboro M6-10 Southern Conference Tournament !-Lady Luck Classic (Blacksburg, VA)

62 • 2007-08 UNCG Women’s Basketball Media Guide

GEORGIA SOUTHERN January 5, 2008 Fleming Gym, Greesboro, NC February 2, 2008 Hanner Fieldhouse, Statesboro, GA

8 pm TBA 7 pm 8:30 pm 7 pm 2 pm 7 pm 7 pm 3 pm 7 pm 7 pm 3:30 pm 1 pm 7 pm 6pm 7 pm 2 pm 7 pm TBA 7 pm 2 pm 7 pm 3 pm 3 pm 7 pm 7 pm 7 pm 7 pm TBA 3 pm TBA

2007-08 Schedule N9 at Jacksonville N11 at Stetson N13 at Georgia N20 Jacksonville State N23 vs. Arkansas! N24 UT San Antonio! N29 Davidson D1 USC Upstate D9 at Georgia Tech D16 Appalachian State D20 Presbyterian D27 VCU Tournament# D28 VCU Tournament# J5 at UNC Greensboro J7 at Elon J12 Wofford J14 Furman J19 College of Charleston J26 at Western Carolina J28 at Chattanooga F2 UNC Greensboro F4 Elon F9 at Wofford F11 at Furman f16 at College of Charleston F23 Western Carolina F25 Chattanooga F28 at Davidson M1 Appalachian State M6-10 Southern Conference Tournament !-UT San Antonio Tournament (San Antonio, TX) #-VCU Tournament (Richmond, VA)

7 pm 3 pm 7 pm 7 pm 5 pm 4 pm 7 pm 1 pm 2 pm 3 pm 3 pm TBA TBA 3 pm 7 pm 3 pm 7 pm 3 pm 4 pm 7 pm 3 pm 5:15 pm 4 pm 7 pm 2 pm 3 pm 7 pm 7 pm 1 pm TBA


WESTERN CAROLINA Januaryy 12, 2008 Ramsey Center, Cullowhee, NC February 9, 2008 Fleming Gym, Greensboro, NC

CHATTANOOGA Januaryy 14, 2008 McKenzie Gym, Chattanooga, TN Februaryy 11, 2008 Fleming Gym, Greensboro, NC

Universityy Information Location: Cullowhee, North Carolina Nickname: Catamounts Enrollment: 9, 000 Colors: Purple and Gold Chancellor: Dr. John W. Barbo Director of Athletics: Chip Smith Conference: Southern Arena (Capacity): Ramesy Regional Center (7, 826)

Universityy Information Location: Chattanooga, Tennessee Nickname: Lady Mocs Enrollment: 9, 558 Colors: Navy,Old Gold and Silver Chancellor: Dr. Roger Brown Director of Athletics: Rick Hart Conference: Southern Conference Arena (Capacity): McKenzie Arena (11, 218)

Coaching g Staff Head Coach: Nancy Wilson Alma Mater: Coker, 1973 Overall Record/Yrs: 467-286/25 Record at Charleston/Yrs: 236-137/12 Associate Head Coach: Temple Elmore Alma Mater: College of Charleston, 1985 Assistant Coaches: Val Linley, Josh Keys

Coaching g Staff Head Coach: Kellie Harper Alma Mater: Tennessee, 1999 Overall Record/Yrs: 51-44/3 Record at Western Carolina/Yrs: Same Assistant Coaches: Stephanie McCormick, Jon Harper, L’tona Lamonte

Coaching g Staff Head Coach: Wes Moore Alma Mater: Tennessee, 1986 Overall Record/Yrs: 415-118/18 Record at Chattanooga/Yrs: 215-62/9 Assistant Coaches: Nikki Blassingame, Ashley McElhiney, Mike Murray

Team Information 2006-07 Overall Record; 24-10 2006-06 Conference Record: 15-3 Starters Returning/Lost: 4/1 Letterwinners Returning/Lost: 9/2

Team Information 2006-07 Overall Record; 25-8 2006-06 Conference Record: 15-3 Starters Returning/Lost: 5/0 Letterwinners Returning/Lost: 9/3

Sports p Information Women’s Basketball SID: Denise Gideon 2IÀFH3KRQH 828-227-2336 2IÀFH)D[ 828-227-7688 Email: dgideon@email.wcu.edu Press Row Phone: 828-227-2129 Web Address: www.catamountsports.com

Sports p Information Women’s Basketball SID: Anne Wehunt 2IÀFH3KRQH 423-425-4618 2IÀFH)D[ 423-425-4610 Email: anne-wehunt@utc.edu Press Row Phone: 423-756-5476 Web Address: www.gomocs.com

All-Time Series Series Tied, 21-21 Last meeting: February 24, 2007; Western 73, UNCG, 67 (at Cullowhee, NC)

All-Time Series Chattanooga leads series, 6-18 Last meeting: January 29, 2007; Chattanooga 83, UNCG, 66 (at Greensboro, NC)

Team Information 2006-07 Overall Record: 10-20 2006-06 Conference Record: 5-13 Starters Returning/Lost: 4/1 Letterwinners Returning/Lost: 9/3 Sports p Information Women’s Basketball SID: Simon Whitaker 2IÀFH3KRQH 843-953-5465 2IÀFH)D[ 843-953-6534 Email: whitakers@cofc.edu Press Row Phone: 843-953-6554 Web Address: www.cofcsports.com All-Time Series UNCG leads series, 18-6 Last meeting: Februaryy 12, 2007; UNCG 70, Charleston, 61 (at Greensboro, NC) 2007-08 Schedule N14 at Coastal Cacrolina N19 UNC Wilmington N27 at North Carolina N29 Charleston Southern D1 Presbyterian D3 USC Upstate D12 Kennesaw State D14 Appalachian State D17 at South Carolina State D19 at Wake Forest D31 at Charleston Southern J2 Davidson J5 at Elon J7 at UNC Greensboro J12 Furman J14 Wofford J19 at Georgia Southern J26 at Chattanooga J28 at Western Carolina F2 Elon F4 UNC Greensboro F9 at Furman F11 at Wofford F16 Georgia Southern F23 Chattanooga F25 Western Carolina F28 at Appalachian State M1 at Davidson

7 pm 7 pm 7 pm 7 pm 2 pm 7 pm 4:30 pm 7 pm 5:30 pm 11 am 3 pm 7 pm 2 pm 3 pm 2 pm 7 pm 3 pm 5 pm 5 pm 2 pm 7 pm 3 pm 6:15 pm 2 pm 2 pm 7 pm 7 pm 2 pm

2007-08 Schedule N1 Carson-Newman (EXH) N9 Detroit N11 at Clemson N17 at Minnesota! N18 vs. Louiseville! N28 UNC Asheville D2 at Middle Tennessee D8 Wake Forest D14 at Hawaii# D15 vs. Oregon State# D17 Vs. Tennessee Tech# D20 Chattanooga D30 at North Carolina State J3 at UNC Wilmington J5 at Davidson J7 at Appalachian State J12 UNC Greensboro J14 Elon J19 at Wofford J21 at Furman J26 at Georgia Southern J28 College of Charleston F2 Davidson F4 Appalachian State F9 at UNC Greensboro F11 at Elon F16 Wofford F18 Furman F23 Georgia Southern F25 at College of Charleston F28 at Chattanooga M6-10 Soutehrn Conference Tournament !-Minnesota Subway Classic (Minneapolis, MN) #-Paradise Classic (Honolulu, HI)

7 pm 7 pm 2 pm 7 pm 3 pm 7 pm 3 pm 4 pm 12 am 4 pm 10 pm 7 pm 2 pm 7 pm TBA 7 pm 4 pm 12 Noon TBA 7 pm 5 pm 5 pm 4 pm 5 pm 3 pm 5 pm 4 pm 7 pm 12:30 pm 7 pm 7 pm TBA

2007-08 Schedule N1 Lee University N9 at Austin Peay N11 at Tennessee N17 Clemson N20 at East Tennessee State N23 Murray State! N24 Consolation/Championship! N28 Middle Tennessee D1 at Alabama A&M D15 Alabama D17 Furman D20 at Western Carolina D29 UTSA New Year’s Classic# D30 UTSA New Year’s Classic# J5 at Appalachian State J7 at Davidson J12 Elon J14 UNC Greensboro J19 at Furman J21 at Wofford J26 College of Charleston J28 Georgia Southern F2 Appalachian State F4 Davidson F9 at Elon F11 at UNC Greensboro F18 Wofford F23 at College of Charleston F25 Georgia Southern F28 Western Carolina M6-10 Southern Conference Tournament TBA

7 pm 8 pm 3 pm 7 pm 7 pm 7 pm 5/7 pm 6 pm 5 pm 7 pm 7 pm 7 pm TBA TBA 2 pm 7 pm 12:30 pm 7 pm 3 pm 6 pm 5 pm 7 pm 5 pm 7 pm 2 pm 7 pm 5:15 pm 2 pm 7 pm 7 pm

!-Pnera Bread Challenge (Chatanooga, TN) #-UTSA Tournament (San Antonio, TX)

2007-08 UNCG Women’s Basketball Media Guide • 63

2007-08 Opponents

Universityy Information Location: Charleston, South Carolina Nickname: Cougars Enrollment: 11, 617 Colors: Maroon and White President: Conrad Festa Interim Director of Athletics: Fred Daniels Conference: Southern Arena (Capacity): John Kresse Arena (3, 500)

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com

COLLEGE OF CHARLESTON January 7, 2008 Fleming Gym, Greensboro, NC February 4, 2008 John Kresse Arena, Charleston, SC


CGSpartans.com • UNCGSpartans.com • UNCGSpartans.com •

2007-08 Opponents

DAVIDSON Januaryy 18, 2008 Fleming Gym, Greensboro, NC Februaryy 15, 2008 Belk Arena, Davidson, NC

APPALACHIAN STATE January 21, 2008 Fleming Gym, Greensboro, NC Februaryy 19, 2008 Holmes Center, Boone, NC

ELON January 26, 2008 Fleming Gym, Greensboro, NC February 23, 2008 Alumni Gym, Elon, NC

Universityy Information Location: Davidson, North Carolina Nickname: Wildcats Enrollment: 1, 700 Colors: Red and Black President: Bobby Vagt Director of Athletics: Jim Murphy Conference: Southern Arena (Capacity): Belk Arena(5, 700)

Universityy Information Location: Boone, North Carolina Nickname: Mountanineers Enrollment: 15,000 Colors: Black and Gold Chancellor: Dr. Kenneth E. Peacock Director of Athletics: Charlie Cobb Conference: Southern Arena (Capacity): Holmes Center (8, 325)

Universityy Information Location: Elon, North Carolina Nickname: Phoenix Enrollment: 5,230 Colors: Maroon and Gold President: Dr. Leo M. Lambert Director of Athletics: Dave Blank Conference: Southern Arena (Capacity): Alumni Gym (1,558)

Coaching g Staff Head Coach: Annette Watts Alma Mater: East Tennessee State, 1981 Overall Record/Yrs: 99-77/6 Record at Davidson/Yrs: Same Assistant Coaches: Stephanie Roe, Usha Gilmore, Abby Pyzik

Coaching g Staff Head Coach: Adrienne Schuler Alma Mater: Georgia, 1992 Overall Record/Yrs: 55-82/5 Record at Appalachian State/Yrs: Same Assistant Coaches: Britt King, Lindsay Smith, Allison Gregory

Coaching g Staff Head Coach: Brenda Paul Alma Mater: North Georgia, 1977 Overall Record/Yrs: 429-408/29 Record at Elon/Yrs:160-405/13 Assistant Coaches: Shelley Katkowski, Audrey Ramsey, Loretta Wilson

Team Information 2006-07 Overall Record; 23-9 2006-06 Conference Record: 13-5 Starters Returning/Lost: 2/3 Letterwinners Returning/Lost: 9/3

Team Information 2006-07 Overall Record; 13-18 2006-06 Conference Record: 6-12 Starters Returning/Lost: 2/3 Letterwinners Returning/Lost: 6/6

Team Information 2006-07 Overall Record: 10-20 2006-06 Conference Record: 4-14 Starters Returning/Lost: 4/1 Letterwinners Returning/Lost: 9/2

Sports p Information Women’s Basketball SID: Gavin McFarlin 2IÀFH3KRQH 704-894-2635 2IÀFH)D[ 704-894-2636 Email: gamcfarlin@davidson.edu Press Row Phone: 704-892-3324 Web Address: www.davidsonwildcats.com

Sports p Information Women’s Basketball SID: Charles Cochrum 2IÀFH3KRQH 828-262-7602 2IÀFH)D[ 8282-262-6106 Email: cochrumca@appstate.edu Press Row Phone: 828-262-7060 Web Address: www.GoASU.com

Sports p Information Women’s Basketball SID: Elizabeth Ballard 2IÀFH3KRQH 336-278-6634 2IÀFH)D[ 336-278-6768 Email: eballard@elon.edu Press Row Phone: N/A Web Address: www.elonphoenix.com

All-Time Series UNCG leads series, 26-8 Last meeting: January 27, 2007; UNCG 78, Davidson, 55 (at Greensboro, NC)

All-Time Series UNCG leads series, 25-21 Last meeting: Februaryy 10, 2007; UNCG 81, Appalachian, 62 (at Greensboro, NC)

All-Time Series UNCG leads series, 18-12 Last meeting: Februaryy 17, 2007; UNCG 57, Elon, 48 (at Elon, NC)

2007-08 Schedule N6 St Andrews College N9 at Georgia Tech N16 UNC Asheville! N17 TBA! N24 at Charlotte N29 Georgia Southern D2 Winthrop D6 East Tennessee State D9 at Georgia D15 High Point D20 at Virginia D28 vs. Auburn# D29 NJIT/St. Joes# J2 at College of Charleston J5 Western Carolina J7 Chattanooga J12 Appalachian State J18 at UNC Greensboro J21 at Elon J26 Wofford J29 Furman F2 at Western Carolina F4 at Chattanooga F9 at Appalachian State F15 UNC Greensboro F18 Elon F23 at Wofford F25 at Furman F28 at Georgia Southern M1 College of Charleston M6-10 Southern Conference Tournament

7 pm 8 pm 8 pm TBA 2 pm 7 pm 2:30 pm 7 pm 2:30 pm 7 pm 7 pm 4 pm TBA 7 pm 2 pm 7 pm 2 pm 7 pm 7 pm 2 pm 7 pm 4 pm 7 pm 1 pm 7 pm 7 pm 2 pm 7 pm 7 pm 2 pm TBA

!-Carolina First Classic (Asheville, NC) #-St. Joe’s Red Hawk Classic (Phildelphia, PA)

64 • 2007-08 UNCG Women’s Basketball Media Guide

2007-08 Schedule N13 at North Carolina State N16 North Carollina Central N20 at Gardner-Webb N25 at Viginia Commonwealth N28 East Carolina D3 Radford D14 at College of Charleston D16 at Georgia Southern D19 at Central Florida! D20 vs. LaSalle! D28 at San Diego# D29 vs. Texas/DePaul# J5 Chattanooga J7 Western Carolina J12 at Davidson J16 East Tennessee State J19 at Elon J21 at UNC Greensboro J26 Furman J28 Wofford F2 at Chattanooga F4 at Western Carolina F9 Davidson F13 at Furman F16 Elon F19 UNC Greensboro F25 at Wofford F28 College of Charleston M1 Georgia Southern M6-10 Southern Conference Tournament !-Central Florida Holiday Classic (Orlando, FL) #-Maggie Dixon Surf N’ Slam (San Diego, CA)

7 pm 7 pm 7 pm 2 pm 7 pm 7 pm 7 pm 2 pm 7:30 pm 5 pm 9 pm 9/11 pm 2 pm 7 pm 2 pm 7 pm 2 pm 3 pm 2 pm 5 pm 5 pm 5 pm 1 pm 7 pm 2 pm 7 pm 6 pm 7 pm 1 pm TBA

2007-08 Schedule N9 Penn! N10 Campbell! N12 North Carolina Central! N13 at North Carolina N19 North Carolina A&TT N24 at UNC Wilmington N28 Lynchburg D1 at Wofford D13 at Winston-Salem State D15 at Furman D17 at High Point D20 vs. Texas-Arlington# D21 TBA# J5 College of Charleston J7 Georgia Southern J12 at Chattanooga J14 at Western Carolina J19 Appalachian State J21 Davidson J26 at UNC Greensboro J30 Presbyterian F2 at College of Charleston F4 at Georgia Southern F9 Chattanooga F11 Western CArolina F16 at Appalachian State F19 at Davidson F23 UNC Greensboro F28 Furman M1 Wofford M6-10 Southern Conference Tournamnet !-ISES Cancer Awareness Tip-Off (Elon, NC) # Charlotte Christmas Classic (Charlotte, NC)

7 pm 7 pm 7 pm 7 pm 7 pm TBA 7 pm 2 pm 7 pm TBA TBA TBA TBA 2 pm 7 pm TBA TBA 2 pm 7 pm 2 pm 12 Noon 2 pm TBA 2 pm 5 pm TBA TBA 2 pm 7 pm 2 pm TBA


UNCG Recordbook


CGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Spartan Record Book

UNCG Womenâ&#x20AC;&#x2122;s Basketball Through Years NCGâ&#x20AC;&#x2122;swomenâ&#x20AC;&#x2122;sbasketball haswitnessedtremendous growth and success over LWVVHDVRQVRIPRGHUQĂ&#x20AC;YHSOD\HU rule competition. The team originated in 1963 XQGHUFRDFK(OOHQ*ULIĂ&#x20AC;QXVLQJVL[ player rules. Dr. June Galloway took over the squad in 1965 and directed it LQWRWKHĂ&#x20AC;YHSOD\HUUXOHHUDEHJLQQLQJ in 1969-70. The team enjoyed a 9-2 record, including five wins in Coleman Gymnasium, in the first five-player-rule season. Galloway led the Spartans to a fourth-place finish at the National Invitational Womenâ&#x20AC;&#x2122;s Intercollegiate Tournament in Cullowhee, NC, in 1970-71. A year later, UNCG won 17 games and captured the North Carolina Association of Intercollegiate Athletics for Women (AIAW) title in the programâ&#x20AC;&#x2122;s initial

U

VHDVRQRI$,$:DIĂ&#x20AC;OLDWLRQ Marilyn Gibbs took over for Dr. Galloway in 1972 and coached the team through the 1975-76 campaign. The Spartans hosted the NCAIAW Tournament in 1973-74 and placed third. The program endured tough times from 1975-79, winning 13 games under three head coaches as UNCG remained non-scholarship while other institutions developed scholarship programs. Ditty Speeler, who endured an 0-19 campaign in 1978-79, helped turn things around the following year before resigning midway through the season after seeing the Spartans off to a 6-2 start. Jim Swiggett, a former UNCG menâ&#x20AC;&#x2122;s basketball coach, took over and guided the program to its Ă&#x20AC;UVWZLQVHDVRQDVLWZRQRIWKH last 17 games of the year, including a 12-1 mark against NCAIAW Division III opponents.

Lynne Agee took over in 1981-82 af ter Robin Josephâ&#x20AC;&#x2122;s one-year stint as head coach and promptly led the Spartans to a record of 25-3, which ended with a runner-up Ă&#x20AC;QLVKLQWKH inaugural N C A A Division III Championship at Elizabethtown (PA). Carol Peschel, a former player under Agee at Roanoke College, followed her coach to

Greensbor o and became the XQLYHUVLW\¡VĂ&#x20AC;UVWIHPDOH$OO$PHULFD performer in 1981-82. The 1981-82 season triggered a run of seven consecutive 20-win campaigns, during which UNCG compiled an 85-7 record against Dixie Conference competition and ZRQĂ&#x20AC;YHFRQIHUHQFHWLWOHV The Spartans posted the lone unbeaten home record (11-0) in the teamâ&#x20AC;&#x2122;s history during the 1987-88 season and advanced to the NCAAâ&#x20AC;&#x2122;s for the seventh straight VHDVRQĂ&#x20AC;QLVKLQJWKLUGQDWLRQDOO\ UNCG was one of only 10 NCAA womenâ&#x20AC;&#x2122;s basketball teams (all GLYLVLRQV WRFRPSHWHLQWKHĂ&#x20AC;UVW seven NCAA Championships, from 1982-88. In keeping with its tradition as a pacesetter, the University decided to make the unprecedented competitive shift in its athletic status, from

66 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

7KHWHDPZDVWKHĂ&#x20AC;UVWWRUHFRUGZLQVLQDVHDVRQ i l di g i g i t N th C li

NCAA Division III to Division I. The move was accomplished over DĂ&#x20AC;YH\HDUSHULRGEHJLQQLQJZLWKWKH decision in February of 1987. UNCGâ&#x20AC;&#x2122;s move to Division I included a three-year stint in Division II. In 1990-91, Agee guided the Spar tans to the NCAA Division II Regional final and their eighth national tournament appearance since 1982. The Spartans arrived on the Division I scene in 1991-92 and posted a 21-6 record. The following year, the team joined the Big South Conference DQGEHJDQDVWULQJRIZLQQLQJĂ&#x20AC;YH straight regular-season titles. During that time, UNCG advanced to the conference tournament

finals four times. 7KH6SDUWDQVĂ&#x20AC;QLVKHGWKHLUUXQ in the Big South with a 75-17 record in conference play. Eight players were named All-Big South, including Vickie Henson, the 1992-93 Player of the Year. In 1997-98, UNCG began play in the Southern Conference and captured the tournament championship. The Spartans made WKHLUĂ&#x20AC;UVW1&$$'LYLVLRQ,7RXUQDPHQW appearance and ninth trip overall to the NCAAâ&#x20AC;&#x2122;s. Ageeâ&#x20AC;&#x2122;s team went 21-9 and earned her 400th career victory that same season. The Spartans took the 1998-99 Southern Conference regular season WLWOHĂ&#x20AC;QLVKLQJRYHUDOODQG 4 in league play. Melinda

over Christopher Newport in 1985-86.


recorded her 1,000th point as a Spartan. Both Boone and Byrd earned AllConference honors for the second consecutive year. Lynne Agee also picked up her 500th win on the UNCG sidelines and earned her 550th career win during the season. The Spartans also honored one of the most decorated players in the history of the womenâ&#x20AC;&#x2122; s program. On February 10, 2007, former Spartan Melinda Goodson had her jersey retired, becoming just the second female and the fourth player in school history to have their jersey retired. In closing, Angie Polk, Wendy Engelmann, Renee Coltrane and Carol Peschel are the only players to have been named AllAmerica during their UNCG careers.

UNCG picked up a win over ACC opponent Wake Forest.

During the 2006-07 season Lynne Agee picked up her 500th win at UNCG and tallied her 550th career victory.

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 67

Spartan Record Book

play, especially at home where they posted a 7-3 showing. The 2003-04 season was highlighted by a 63-30 win over Furman on January 3, 2004, giving Lynne Agee her 500th career victory. Agee is one of 21 active coaches to produce 500 wins. Jacinda Lamber t led the Spar tans in scoring for three consecutive years and finished her career in 2003-04 with 1,227 points, the eighth best total in program history. The2004-05seasonsawKristen Boone lead the country in steals and EHFRPHWKHĂ&#x20AC;UVWSOD\HULQSURJUDP history to be named conference Freshman of the Year. The 2005-06 season was a lackluster beginning for UNCG after starting the year without Boone, who sat out the first four games of the season with a pre-season injury. She made a triumphant return against West Virginia and orchestrated a win for the ages, 72-70, over the 0RXQWDLQHHUVIRUWKH6SDUWDQVĂ&#x20AC;UVW ever win over a team from the BIG EAST Conference. Only 11 days later, UNCG made the short trip down I-40 to play Wake Forest and once again the Spartans were up to the task. They pulled off an impressive 70-64 victory at Lawrence -RHO&ROLVHXPIRUWKHLUĂ&#x20AC;UVWZLQRYHU the Demon Deacons since 1977. UNCG earned the second seed in the SoCon Tournament and cruised LQWRWKHĂ&#x20AC;QDOVZLWKZLQVRYHU*HRUJLD Southern and Davidson, which set up a meeting with top-seeded Chattanooga for the fourth time in WKHFRQIHUHQFHĂ&#x20AC;QDOH7KH6SDUWDQV ultimately fell 91-79, but order was restored as the Spartans once again found themselves among the elite teams in their conference. A place this proud program has became all too familiar with over the years. %RRQH ZDV QDPHG D Ă&#x20AC;UVW WHDP All-SoCon performer in leading the Spartans to an 18-12 overall record and a 12-6 slate in the conference. For their efforts in the SoCon tourament, Boone, Irene Otamiri and KaLeah Latham were selected to the AllTournament team. Last seasonâ&#x20AC;&#x2122;s squad posted a 20ZLQVHDVRQIRUWKHĂ&#x20AC;UVWWLPHVLQFHWKH 2001-02 seaosn and saw standout Kristen Boone become UNCGâ&#x20AC;&#x2122;s alltime steals leader with 313 steals while senior guard Jasmine Byrd

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Goodson scored her 1,000th career point, becoming the fastest UNCG player to accomplish that feat. In the 1999-00 season, UNCG became just the second program in North Carolina to reach the 500win plateau with a 77-71 victory at Appalachian State on February 5. 81&*Ă&#x20AC;QLVKHGWKHVHDVRQZLWKDQ 11 mark, 11-7 in the conference, and UHDFKHGWKH6R&RQ7RXUQDPHQWĂ&#x20AC;QDOV as the fourth seed in the tournament. ChoRhonda Gwaltney was named AllSoCon, and was also named to the AllTournament team, along with Samika Foster and Brianne Dodgen, who took home Tournament MVP honors. The Spartans set a new Division I record for wins in 2000-01 with its 22-8 record. UNCG advanced to the SoCon Championship game for the second straight season, falling by one point to Chattanooga. The Spartans had the tournament MVP for the second straight year in Gwaltney, while Dodgen, Foster and Sandi Reid were second team All-SoCon Tournament selections. Dodgen and Gwaltney also earned all-conference honors. In 2001-02, the Spartans went 21-10 (14-4 SoCon) and claimed a share of the SoCon regular season championship and advanced to WKH:1,7IRUWKHĂ&#x20AC;UVWWLPHLQVFKRRO history. The Spartans defeated College of Charleston, 77-51, and Furman, 71-62, en route to a third straight championship game appearance. The Spar tans fell just shor t of the tournament title, losing to Chattanooga for the second straight season. UNCG took on a strong Virginia Tech squad in the WNIT. The Spartans lost to the Hokies, 51-46, in a very close opening round match. Despite missing the 20-win plateau in 2002-03 for the first time in three season, the Spartans managed to put together a 14-13 overall mark, which included a 10-8 showing in Southern Conference play. Their season mark extended UNCGâ&#x20AC;&#x2122;s streak to 22 consecutive winning seasons, which began in Lynne Ageeâ&#x20AC;&#x2122;s Ă&#x20AC;UVW\HDUDW81&* The winning season streak came to a halt in 2003-04, as the Spartans battled through injuries and a rigorous schedule to produce a 9-19 record. Despite the record, the Spartans remained tough in SoCon


CGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Spartan Record Book

UNCG In the NCAA A Tournament 21-9, 12-4 Southern Conference Southern Conference Tournament Champions NCAA A Tournament First Round

uring the 1997-98 season UNCG, which was picked four th in the Southern Conference pre-season poll, wasted no time in proving to the rest of the league that the Spartans were a force WREHUHFNRQHGZLWK,QLWVĂ&#x20AC;UVW\HDU as a member of the SoCon, UNCG carried an eight-game winning streak into the 1998 SoCon Tournament. The Spartans then blasted Western Carolina, 86-54, before slipping past Davidson, 78-75 to reach the title game. UNCG faced top-seed Georgia Southern. The Eagles and Spartans had split two meetings that season. UNCG shot just 24-percent from the

D

floor in the first-half and trailed, 32-24. However, Rebecca Viverette poured in 18 second-half points and the Spartans shot 61-percent from the Ă&#x20AC;HOG WR JHW SDVW *HRUJLD 6RXWKHUQ 75-69. The victory ensured UNCGâ&#x20AC;&#x2122;s Ă&#x20AC;UVWHYHUDSSHDUDQFHLQWRWKH NCAA Division I tournament. The Spartans were led by a pair of All-SoCon first team selections, senior post players Biz Brediger and Viverette. Both players reached the 1,000 point club during the season, with Brediger scoring 15.7 ppg and Viverette adding 15.4 ppg.

becca Viverette led 1&*WRLWVĂ&#x20AC;UVWHYHU1&$$ urnament berth during the 97-98 season

1997-98 UNC Greensboro Roster No. 00 3 10 11 14 15 21 25 30 42 43 44 50 55

Name Annika Jordan ChoRhonda Gwaltney Sadie Ochs Rebecca Viverette Sam Ferguson Katrina Smith Jennifer Lewis Nicky Armstrong Natalie Kreter Melinda Goodson Belinda Goodson Biz Brediger Amber West Katie DelCampo

Head Coach: Assistant Coaches:

Yr. Fr. Fr. Sr. Sr. Jr. So. Sr. Fr. So. So. So. Sr. Sr. Fr.

Pos. G G G F G G G G F G G C C F

Ht. 5-6 5-6 5-8 6-0 5-6 5-9 5-10 5-6 6-1 5-8 5-7 6-2 6-2 6-0

Lynne Agee Carol Peschel, Barry Street, Serena King

Hometown Lynchburg, VA Dudley, NC Garden City, KS Wilson, NC Collinsville, VA Morehead City, NC Newport, NC Lincoln, PA Jenkintown, PA Roxboro, NC Roxboro, NC Massillon, OH Galesburg, IL Rehoboth Beach, DE

1998 NCAA A Tournament First Round Midwest Region Alabama 94, UNCG 46 March 13, 1998 Tuscaloosa, AL

UNC Greensboro (46) Name Rebecca Viverette Jennifer Lewis Biz Brediger Sadie Ochs Katrina Smith ChoRhonda Gwaltney Sam Ferguson Melinda Goodson Katrina DelCampo Amber West Totals:

FG-A 3-19 1-1 6-18 2-4 1-5 1-8 1-7 4-8 0-2 0-1 19-73

FT-A 2-2 0-0 1-2 0-0 0-0 0-0 0-0 2-4 0-0 0-0 5-8

RB 5 1 14 2 5 5 3 5 3 1 46

PF 2 2 2 1 2 3 0 3 0 0 15

TP 9 2 13 6 2 2 2 10 2 0 46

A 0 1 0 0 3 3 1 2 1 0 10

TO 2 1 2 4 3 1 0 3 0 0 16

BK 0 0 1 0 0 0 0 0 0 0 1

S 0 0 0 1 2 1 1 1 1 0 7

Min. 30 10 37 21 36 21 11 28 3 3 200

Alabama (94) Name LaToya Caudle Tausha Mills Dominique Canty Brittney Ezell Leah Goss Nicole Carruth Becky Blesch Reagan Croyle Kari Belcher Pam Duncan Joni Crenshaw Kidada Holtzclaw Totals:

FG-A 2-7 4-13 10-14 1-5 5-8 5-8 0-0 1-2 0-0 5-7 0-3 1-4 34-71

FT-A 0-0 0-0 5-6 0-0 0-1 2-3 0-0 0-0 1-2 4-4 0-0 2-4 14-16

RB 7 7 5 3 7 3 0 0 0 6 2 2 42

PF 1 3 2 0 0 2 0 0 0 1 2 0 11

TP 4 8 25 2 13 16 0 2 1 15 0 4 94

A 0 0 3 10 4 0 0 1 0 1 0 1 20

TO 2 0 2 1 0 0 1 0 0 0 2 0 8

BK 0 3 0 0 2 0 0 0 0 1 2 0 8

S 1 0 4 3 1 0 1 0 0 0 0 1 11

Min. 13 16 27 34 27 14 4 4 3 17 13 14 200

Halftime: Alabama 44, UNCG 23 Three-pointers: UNCG 3-24 (Viverette 1-7, Ochs 2-3, Gwaltney 0-4, Ferguson 0-5, Brediger 0-1, DelCampo 0-2, M. Goodson 0-1, Smith 0-1) Alabama 8-18 *Canty 0-1, Ezell 0-3, Goss 3-4, Carruth 4-6, Duncan 1-3, Holtzclaw 0-1) Attendance: 3,050 Records: UNCG 21-9, Alabama 23-9.

68 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide


All school records on pg. 58 are from UNCG’s Division I era which began during the 1991-92 season.

Most Assists Game: 30, vs. C of C (12/29/99) & vs. Winthrop (2/17/93) Season: 559 (1995) Most Opponent Assists Game: 29, vs. Wake Forest (12/6/95) Season: 517 (1995) Fewest Assists Game: 5, seven times; last vs. Coll. of Charleston (1/16/06) Season: 296 (2005) Fewest Opponent Assists Game: 1, vs. High Point (12/11/04) Season: 328 (2005) Most Steals Game: 27, vs. UNC Wilmington (11/12/06) Season: 353 (2001) NOTE: 352 (2005) Most Opponent Steals Game: 24, at Kent State (12/29/93) Season: 332 (1993) Fewest Steals Game: 1, vs. Arizona (12/4/04) Season: 262 (1996) Fewest Opponent Steals Game: 1, vs. Delaware (12/5/04) Season: 238 (1999) Most Blocks Game: 9, vs. Wofford (2/16/98) & vs. Wofford (1/24/06) Note: 8, vs. Georgia Southern (1/8/07) Season: 101 (2007) Most Opponent Blocks Game: 13, at Clemson (12/30/98) Season: 116 (2005) Fewest Blocks Season: 35 (1999) Fewest Opponent Blocks Season: 46 (1993) Most Points Half: 58, vs. Providence (12/21/94) & vs. Radford (1/13/97) Game: 104 vs. Coastal Carolina (1/11/97) Season: 2,236 (1995) Most Opponent Points Half: 72, at Kent State (12/29/93) Game: 119 at Kent State (12/29/93) Season: 2,090 (1995) Fewest Points Half: 11, at West Virginia (11/19/04) Game: 39, at West Virginia (11/19/04) Season: 1,654 (2004) Fewest Opponent Points Half: 11, vs. ETSU (3/2/01) NOTE: 12, at Elon (1/21/06) Game: 35, at Elon (1/21/06) Season: 1,727 (2003) Highest Scoring Average Season: 77.8 (2,100 points, 27 games, 1992) Highest Opponent Scoring Average Season: 71.7 (1,937 points, 27 games, 1992) Lowest Scoring Average Season: 59.1 (1,654 points, 28 games, 2004) Lowest Opponent Scoring Average Season: 59.7 (1,791 points, 30 games, 2001) Largest Margin of Victory 57 points (99-42 vs. South Carolina State, 1/4/97) Largest Margin in Defeat 55 points (103-48 at North Carolina, 11/30/06)

2007-08 UNCG Women’s Basketball Media Guide • 69

Spartan Record Book

Most Games Played: 31 (1995, 2002) Most Wins: 22 (2001) Most Conference Wins: 14 (1993, 1995, 1999, 2001, 2002) Most Losses: 19 (2004) Fewest Losses: 6 (1992) Highest Winning Percentage: .777 (21-6, 1992) Best Home Record: 12-1 (2002) Most Home Wins: 12 (2002) Longest Win Streak: 12 (1/22/97-2/28/97) Longest Losing Streak: 5 (12/20/93-1/3/94, 12/6/0312/20/03) Longest Home Win Streak: 13 (2/2/97-1/22/99) Most Field Goals Made Game: 39, vs. Coastal Carolina (12/7/91) & vs. ETSU (2/16/02) Season: 844 (1992) Most Opponent Field Goals Made Game: 42, vs. Wake Forest (12/69/95) Season: 792 (1998) Fewest Field Goals Made Game: 11, at Appalachian State (12/18/04) Season: 684 (2000) Fewest Opponent Field Goals Made Game: 11, vs Elon (1/20/07) Season: 610 (2003) Most Field Goals Attempted Game: 82, vs. ETSU (1/20/01) Season: 1,857 (2002) Most Opponent Field Goals Attempted Game: 82, vs. Radford (2/7/96) Season: 1,925 (1995) Fewest Field Goals Attempted Game: 29, UNC Asheville (3/10/94) Season: 1,560 (2003) Fewest Opponent Field Goals Attempted Game: 38, at Radford (3/21/93) Season: 1,594 (1996) Highest Field Goal Percentage Half: .786 (22-28) at Campbell (2/13/93) Game: .719 (41-57) vs. UNC Asheville (2/11/94) Season: .503 (844-1679, 1992) Highest Opponent Field Goal Percentage Half: .704 (19-27), UNC Asheville (3/10/94) Game: .627 (32-51), UNC Asheville (3/10/94) Season: .438 (740-1689, 1992) Lowest Field Goal Percentage Half: .146 (6-41), at Wofford (2/10/01) Game: .214 (12-56) at West Virginia (11/19/04) Season: .371 (578-1558, 2004) Lowest Opponent Field Goal Percentage Half: .120 (3-25) vs. UMES (11/25/95) Game: .212 (11-52) vs.Elon (1/20/07) Season: .371 (676-1823, 2001) Most Three-Point Field Goals Made Game: 12, vs. Radford (1/13/97) & vs. Illinois (11/24/95) Season: 167 (2000) Most Opponent Three-Point Field Goals Made Game: 13, at Kent State (12/29/93) Season: 165 (2006) Fewest Three-Point Field Goals Made Season: 38 (1994) Fewest Opponent Three-Point Field Goals Made Season: 70 (1993) Most Three-Point Field Goals Attempted Game: 31, vs. Radford (1/13/97) Season: 535 (2000) Most Opponent Three-Point Field Goals Attempted Game: 29, vs. Longwood (11/25/05) Season: 493 (2006)

Fewest Three-Point Field Goals Attempted Season: 104 (1994) Fewest Opponent Three-Point Field Goals Attempted Season: 244 (1993) Highest Three-Point Field Goal Percentage Game: .778 (7-9), vs. Winthrop (1/16/95) Season: .377 (55-146, 1993) Highest Opponent Three-Point Field Goal Percentage Game: .833 (5-6), vs Winthrop (1/16/95) NOTE: .588 (10-17) vs. Wake Forest (12/6/95) Season: .368 (95-258, 1992) Lowest Three-Point Field Goal Percentage Season: .245 (97-396, 2005) Lowest Opponent Three-Point Field Goal Percentage Season: .270 (126-467, 2001) Most Free Throws Made Game: 37, at Elon (12/2/98) Season: 531 (1995) Most Opponents Free Throws Made Game: 37, vs. Providence (12/21/94) Season: 430 (1993) Fewest Free Throws Made Game: 0, at Duke (11/19/97) Season: 346 (1993, 2007) Fewest Opponent Free Throws Made Game: 1, four times; last at Furman (2/9/98) Season: 313 (2001) Most Free Throws Attempted Game: 55, vs. Hartford (12/30/95) Season: 798 (1995) Most Opponent Free Throws Attempted Game: 47, vs. UNC Asheville (1/23/93) Season: 652 (1993) Fewest Free Throws Attempted Game: 0, twice NOTE: 1, at Duke (11/19/97) Season: 512 (1992) Fewest Opponent Free Throws Attempted Game: 2, twice; at Appalachian State (2/5/00) Season: 469 (2000) Highest Free Throw Percentage Game: 1.000 (13-13), vs. Liberty (1/23/92); (1111), vs. Campbell (1/29/92), vs. (9-9) vs. Wofford (2/19/07) Season: .723 (370-512, 1992) Highest Opponent Free Throw Percentage Game: 1.000 (9-9), vs. Michigan State (12/17/91) NOTE: .962 (24-25), at Maryland (12/29/06) Season: .711 (349-491, 1999) Lowest Free Throw Percentage Game: .182, (2-11) at Chattanooga, 2/10/03 Season: .638 (487-763, 1997) Lowest Opponent Free Throw Percentage Season: .635 (329-518, 1998) Most Total Rebounds Game: 62, vs. Towson (1/22/95) Season: 1,318 (1995) Most Opponent Total Rebounds Game: 58, at Furman (1/8/97) Season: 1,175 (1998) Fewest Total Rebounds Game: 19, at. Maryland (12/29/07) Season: 1,056 (1992) Fewest Opponent Total Rebounds Game: 19, vs. Charleston Southern (3/5/94) Season: 959 (1992) Highest Rebound Average Season: 42.7 (1,239 rebounds, 29 games, 1997) Highest Opponent Rebound Average Season: 39.9 (1,157 rebounds, 29 games, 1997) Lowest Rebound Average Season: 36.6 (1,062 rebounds, 29 games, 2000) Lowest Opponent Rebound Average Season: 33.3 (965 rebounds, 29 games, 1994)

UNCGSpartans.com • UNCGSpartans.com • UNCG

School Records - Team


CGSpartans.com • UNCGSpartans.com • UNCG

Spartan Record Book

School Records - Individual UNCG has competed at the Division I level since the 199192 season. Records from that time are designated in italics.

Games Played Season: 33, six players (1988) 31, seven players (2002) 31, eight players (1995) Career:

122, Natalie Connor, 1982-87 118, Brianna Dodgen, 1998-02 118, Samika Foster, 1998-02

Field Goals Made Game: 18, Anna Parker vs. Wake Forest, 2/12/79 14, Biz Brediger at Furman, 2/10/98 Season:

230, Angie Polk, 1988 199, Vickie Henson, 1993

Career:

667, Angie Polk, 1985-89 536, Melinda Goodson, 1996-00

Three-Point Field Goal Percentage Game: 1.000 (5-5), Sadie Ochs vs. Liberty, 1/28/97 1.000 (5-5), Amanda Eaton at Wofford, 12/30/04 1.000 (2-2), Kristen Boone vs. Appalachian State, (2/10/07) 1.00 (2-2), Kristen Boone vs. Chattanooga, (1/29/07) Season:

Career:

.549 (28-51), Gail White, 1991 .448 (26-58), Brianna Dodgen, 2000 .387 (41-106), Jacinda Lambert, 2000-04

Free Throws Made Game: 15, Melinda Goodson vs Davidson, 2/27/99 Season:

138, Melinda Goodson, 1999

Career:

385, Melinda Goodson, 1996-00

Rebounding Average Season: 13.5 rpg, Renee Coltrane, 1985 8.9 rpg, Julie Moore, 1996 Career:

Assists Game:

10.72, Renee Coltrane, 1981-85 7.38, Melinda Goodson, 1997-00

13, Brenda Tolbert vs. St. Andrews, 2/14/84 12, Jo Zerger vs. Winthrop, 2/17/93

Season:

170, Wendy Engelmann, 1984 148, Jai Cole, 1995

Career:

574, Wendy Engelmann, 1981-85 444, Samika Foster, 1998-02

Steals Game:

12, Ruby Smith at Greensboro, 12/9/86 11, Kristen Boone vs. UNC Wilimgton 11/12/06

Field Goals Attempted Game: 30, Jody Mangus vs. Bennett, 2/14/81 30, Wendy Engelmann vs. Buff. St., 11/17/84 24, Jacinda Lambert at Elon, 1/5/04

Free Throws Attempted Game: 19, Melinda Goodson vs. Campbell, 12/30/97

Season:

121, Kristen Boone, 2005

Season:

194, Melinda Goodson, 1997

Career:

313, Kristen Boone, 2004-Presnt

Season:

Career:

568, Melinda Goodson, 1996-00

Blocks Game:

Career:

472, Wendy Englemann, 1985 392, Jasmine Byrd, 2007 368, Rebecca Viverette, 1998 1,313, Wendy Engelmann, 1981-85 1, 309, Jasmine Byrd, 2003-07 1,122, Brianne Dodgen, 1998-02

Field Goal Percentage Game: 1.000 (11-11), Melinda Goodson vs. Wofford, 2/26/99 Season:

.649 (122-188), Jana Henderson,1992

Career:

.596 (295-495), Jana Henderson, 1988-92 .588 (386-656), Vickie Henson, 1992-93

Three-Point Field Goals Made Game: 7, Mickey Haywood at Campbell, 2/13/93 6, Jasmine Byrd vs. Georgia Southern (1/8/07) 6, Jasmine Byrd vs. Providence (11/25/06) Season:

77, Jasmine Byrd, 2007 65, Sam Ferguson, 1996

Career:

193, Jasmine Byrd, 2007 169, Amanda Eaton, 2001-05

Season:

49, Rebecca Viverette, 1998

Season:

.877 (100-114),Rebecca Viverette, 1998

Career:

121, Rebecca Viverette, 1994-98

Career:

.810 (102-126), Serena King, 1993-96

Points Scored Game: 38, Anna Parker vs. Wake Forest, 2/12/79 36, Vickie Henson vs. Towson, 3/12/93 Season:

554, Angie Polk, 1988 497, Melinda Goodson, 1999

Career:

1,585, Angie Polk, 1985-89 1,464, Melinda Goodson, 1996-00

Double-Doubles Season: 9, Melinda Goodson, 1997 7, KaLeah Latham, 2007 Career:

24, Melinda Goodson, 1996-00

Scoring Average Season: 21.84 ppg, Rita Wiggs, 1975 17.75 ppg, Melinda Goodson, 1999 Career:

18.45 ppg, Rita Wiggs, 1971-75 16.67 ppg, Vickie Henson, 1993-94

Three-Point Field Goals Attempted Game: 15, Sam Ferguson at Charleston Southern, 1/27/96 14, Jasmine Byrd vs. Wofford, (2/19/07 7)

Rebounds Game: 25, Renee Coltrane vs. Christopher Newport, 2/8/85 19, Julie Moore vs. Western Carolina, 12/31/94

Season:

208, Jasmine Byrd, 2007 169, Belinda Goodson, 2000

Season:

379, Renee Coltrane, 1985 256, Julie Moore, 1995

Career:

677, Jasmine Byrd, 2003-07 517, Amanda Eaton, 2001-05

Career:

1,211, Renee Coltrane, 1981-85 799, Julie Moore, 1992-96

70 • 2007-08 UNCG Women’s Basketball Media Guide

7, Rebecca Viverette vs. Wofford, 2/16/98

Free Throw Percentage Game: 1.000 (14-14), Amanda Eaton vs. College of Charleston, 2/9/04

Angie Polk


TOP 20 ALL-TIME LEADING SCORERS 1. Angie Polk (1985-89)..........................................1585 2. Melinda Goodson (1996-00)...............................1464 3. Brianne Dodgen (1998-02)................................. 1417 4. Renee Coltrane (1981-85) ..................................1378 5. Wendy Engelmann (1981-85)..............................1368 6. Rita Wiggs (1971-75)..........................................1347 7. ChoRhonda Gwaltney (1997-01) .........................1252 8. Jasmine Byrd (2003-07) .....................................1228 9. Jacinda Lambert (2000-04) ................................1227 10. Alisa Moore (1992-96) .......................................1222 11. Natalie Connor (1982-87)................................... 1217 12. Samika Foster (1998-02)....................................1212 13. Jody Mangus (1979-83) ......................................1192 14. Michelle Blazevich (1981-84) .............................1127 15. Rebecca Viverette (1994-98) ..............................1124 Cathy Strange (1974-78).....................................1124 16. Ruby Smith (1983-87) ........................................ 1115 17. Julie Moore (1992-96) ........................................1099 18. Biz Brediger (1994-98) .......................................1097 19. Julie Bright (1988-92).........................................1036 20. Marie Cawley (1979-83) .....................................1021 TOP 10 ALL-TIME LEADING SCORERS (DIVISION I ERA) 1. Melinda Goodson (1996-00)...............................1464 2. Brianne Dodgen (1998-02)................................. 1417 3. ChoRhonda Gwaltney (1997-01) .........................1252 4. Jasmine Byrd (2003-07) .....................................1228 5. Jacinda Lambert (2000-04) ................................1227 6. Alisa Moore (1992-96) .......................................1222 7. Samika Foster (1998-02)....................................1212 8. Rebecca Viverette (1994-98) ..............................1124 9. Julie Moore (1992-96) ........................................1099 10. Biz Brediger (1994-98) .......................................1097 SCORING AVERAGE 1. Rita Wiggs (1971-75).........................................18.45 2. Vickie Henson (1992-94) ...................................16.67 3. Melinda Goodson (1996-00)..............................15.57 4. Jody Mangus (1979-83) .....................................14.36 5. Angie Polk (1985-89).........................................13.78 6. Michelle Blazevich (1981-84) ............................13.26 7. Gail White (1990-92).........................................12.79 8. Renee Coltrane (1981-85) .................................12.19 9. Wendy Engelmann (1981-85).............................12.11 10. Brianne Dodgen (1998-02)................................12.01 18 Samika Foster (1998-02)...................................10.27 19. Kymm Elliott (1990-92)......................................10.26 SCORING AVERAGE (DIVISION I ERA) 1. Vickie Henson (1992-94) ...................................16.67 2. Melinda Goodson (1996-00)..............................15.57 3. Gail White (1990-92).........................................12.79 4. Brianne Dodgen (1998-02)................................12.01

Kristen Boone (2005- ) ......................................11.50 Alisa Moore (1992-96) ......................................10.81 ChoRhonda Gwaltney (1997-01) ........................10.79 Jasmine Byrd (2003-07) ....................................10.60 Jacinda Lambert (2000-04) ...............................10.58 Samika Foster (1998-02)...................................10.27

FIELD GOALS MADE 1. Angie Polk (1985-89)............................................667 2. Wendy Engelmann (1981-85)................................601 3. Renee Coltrane (1981-85) ....................................536 4. Melinda Goodson (1996-00).................................536 5. Natalie Connor (1982-87).....................................527 6. Jody Mangus (1979-83) ........................................509 7. Brianne Dodgen (1998-02)...................................500 8. Michelle Blazevich (1981-84) ...............................494 9. Ruby Smith (1983-87) ..........................................494 10. Jacinda Lambert (2000-04) ..................................478 FIELD GOALS MADE (DIVISION I ERA) 1. Melinda Goodson (1996-00).................................536 2. Brianne Dodgen (1998-02)...................................500 3. Jacinda Lambert (2000-04) ..................................478 4. Alisa Moore (1992-96) .........................................475 5. Biz Brediger (1994-98) .........................................442 6. Samika Foster (1998-02)......................................433 7. Julie Moore (1992-96) ..........................................431 8. Jasmine Byrd (2003-07) ....................................... 416 9. Rebecca Viverette (1994-98) ................................ 414 10. ChoRhonda Gwaltney (1997-01) ...........................397 FIELD GOALS ATTEMPTED 1. Wendy Engelmann (1981-85)..............................1313 2. Jasmine Byrd (2003-07) .....................................1309 3. Angie Polk (1985-89)..........................................1269 4. Natalie Connor (1982-87)...................................1148 5. Jody Mangus (1979-83) ......................................1123 6. Brianne Dodgen (1998-02).................................1122 7. Jacinda Lambert (2000-04) ................................1088 8. Marie Cawley (1979-83) .....................................1070 9. Melinda Goodson (1996-00)...............................1026 10. Samika Foster (1998-02)....................................1022 FIELD GOALS ATTEMPTED (DIVISION I ERA) 1. Jasmine Byrd (2003-07) .....................................1309 2. Brianne Dodgen (1998-02).................................1122 3. Jacinda Lambert (2000-04) ................................1088 4. Melinda Goodson (1996-00)...............................1026 5. Samika Foster (1998-02)....................................1022 6. ChoRhonda Gwaltney (1997-01) ...........................980 7. Rebecca Viverette (1994-98) ................................958 8. Jasmine Byrd (2004- )........................................... 917 9 Amanda Eaton (2001-05) .....................................872 10. Biz Brediger (1994-98) .........................................844 FIELD GOAL PERCENTAGE (min. 100 FGM) 1. Jana Henderson (1988-92) ..................596 (295-495) 2. Vickie Henson (1992-94) .....................588 (386-656) 3. Shawne Frazier (1983-84) .................. .587 (118-201) 4. Alisa Moore (1992-96) ....................... .584 (475-814) 5. Chris Holec (1986-90) ........................ .568 (350-616) 6. Michelle Blazevich (1981-84) ..............542 (494-912) 7. Karen Jordan (1986-90).......................542 (295-544) 8. Julie Bright (1991-93)..........................541 (438-809) 9. Kymm Elliott (1990-92)........................535 (239-447) 10. Renee Coltrane (1981-85) .................534 (536-1003) FG PERCENTAGE (min. 100 FGM) - DIVISION I ERA 1. Vickie Henson (1992-94) .....................588 (386-656) 2. Alisa Moore (1992-96) ....................... .584 (475-814) 3. Julie Bright (1991-93)..........................541 (438-809) 4. Kymm Elliott (1990-92)........................535 (239-447) 5. Biz Brediger (1994-98) ........................524 (442-844) 6. Melinda Goodson (1996-00)..............522 (536-1026) 7. Stefanie Walter (1992-96) ....................513 (211-411) 8. Julie Moore (1992-96) ........................ .512 (431-841) 9. Gail White (1990-92).......................... .497 (251-505) 10. Jo Zerger (1990-94)............................ .491 (357-727)

3-POINT FIELD GOALS MADE 1. Jasmine Byrd (2003-07) .......................................193 2. Amanda Eaton (2001-05) .....................................169 3. Sam Ferguson (1995-98)......................................135 4. ChoRhonda Gwaltney (1997-01) ...........................123 5. Samika Foster (1998-02)........................................96 6. Sadie Ochs (1994-98) ............................................87 7. Belinda Goodson (1996-00) ...................................83 8. Beth Durrill (1987-91).............................................81 9. Jai Cole (1993-97)..................................................78 10. Brianne Dodgen (1998-02).....................................76 3-POINT FIELD GOALS MADE (DIVISION I ERA) 1. Jasmine Byrd (2003-07) .......................................193 2. Amanda Eaton (2001-05 ......................................169 3. Sam Ferguson (1995-98)......................................135 4. ChoRhonda Gwaltney (1997-01) ...........................123 5. Jasmine Byrd (2003- )........................................... 116 6. Samika Foster (1998-02)........................................96 7. Sadie Ochs (1994-98) ............................................87 8. Belinda Goodson (1996-00) ...................................83 9. Jai Cole (1993-97)..................................................78 10. Brianne Dodgen (1998-02).....................................76 3-POINT FIELD GOALS ATTEMPTED 1. Jasmine Byrd (2003-07 ).......................................677 2. Amanda Eaton (2001-05) ..................................... 517 3. Sam Ferguson (1995-98)......................................446 4. ChoRhonda Gwaltney (1997-01) ...........................357 5. Samika Foster (1998-02)......................................308 6. Belinda Goodson (1996-00) .................................260 7. Sadie Ochs (1994-98) ..........................................251 8. Beth Durrill (1987-91)...........................................246 9. Jai Cole (1993-97)................................................238 10. Katie DelCampo (1997-01) ...................................222 3-POINT FIELD GOALS ATTEMPTED (DIVISION I ERA) 1. Jasmine Byrd (2003-07 ).......................................677 2. Amanda Eaton (2001-05) ..................................... 517 3. Sam Ferguson (1995-98)......................................446 4. ChoRhonda Gwaltney (1997-01) ...........................357 5. Samika Foster (1998-02)......................................308 6. Belinda Goodson (1996-00) .................................260 7. Sadie Ochs (1994-98) ..........................................251 8. Jai Cole (1993-97)................................................238 9. Katie DelCampo (1997-01) ...................................222 10. Brianne Dodgen (1998-02)...................................212 3-POINT FIELD GOAL PCT. (min. 100 3FGA) 1. Jacinda Lambert (2000-04) .................. .387 (41-106) 3. Micky Haywood (1989-93) .................... .367 (65-177) 4. Rebecca Viverette (1994-98) ................ .361 (70-194) 5. Brianne Dodgen (1998-02)................... .358 (76-212) 6. Sadie Ochs (1994-98) .......................... .347 (87-251) 7. ChoRhonda Gwaltney (1997-01) ..........345 (123-357) 8. Amanda Eaton (2001-05) .....................327 (169-517) 9. Beth Durrill (1987-91)........................... .329 (81-246) 10. Stephanie Johnson (1987-90)............... .329 (72-219) 3-POINT FIELD GOAL PCT. (min. 100 3FGA) - DI ERA 1. Jacinda Lambert (2000-04) .................. .387 (41-106) 2. Micky Haywood (1989-93) .................... .367 (65-177) 3. Rebecca Viverette (1994-98) ................ .361 (70-194) 4. Brianne Dodgen (1998-02)................... .358 (76-212) 5. Sadie Ochs (1994-98) .......................... .347 (87-251) 6. ChoRhonda Gwaltney (1997-01) ..........345 (123-357) 7. Amanda Eaton (2001-05) .....................327 (169-517) 8. Jai Cole (1993-97).................................328 (78-238) 9. Belinda Goodson (1996-00) .................. .319 (83-260 10. Serena King (1993-96) ......................... .318 (42-132) FREE THROWS MADE 1. Melinda Goodson (1996-00).................................385 2. Brianne Dodgen (1998-02)...................................341 3. ChoRhonda Gwaltney (1997-01) ...........................335 4. Kristen Boone (2004- ) .........................................309 5. Renee Coltrane (1981-85) ....................................302 6. Alisa Moore (1992-96) .........................................272 7. Angie Polk (1985-89)............................................250 Samika Foster (1998-02)......................................250 8. Julie Moore (1992-96) ..........................................237 9. Sadie Ochs (1994-98) ..........................................230 Jacinda Lambert (2000-04) ..................................230

2007-08 UNCG Women’s Basketball Media Guide • 71

Spartan Record Book

GAMES PLAYED (DIVISION I ERA) Brianne Dodgen (1998-02) ...........................................118 Samika Foster (1998-02)..............................................118 Biz Brediger (1994-98) ................................................. 117 ChoRhonda Gwaltney (1997-01) ................................... 116 Jacinda Lambert (2000-04) .......................................... 116 Jasmine Byrd (2003-07) ............................................... 116 Sadie Ochs (1994-98) ..................................................115 Rebecca Viverette (1994-98) ........................................115 Jai Cole (1993-97) ........................................................ 114 Jennifer Lewis (1994-98) .............................................. 114 Alisa Moore (1992-96)..................................................113

5. 6. 7. 8. 9. 10.

UNCGSpartans.com • UNCGSpartans.com • UNCG

Top 10 Career Performances-Individual GAMES PLAYED Natalie Connor (1982-87).............................................122 Julia Weaver (1984-88).................................................119 Brianne Dodgen (1998-02) ...........................................118 Samika Foster (1998-02)..............................................118 Cheryl Carter (1984-88)................................................ 117 Biz Brediger (1994-98) ................................................. 117 ChoRhonda Gwaltney (1997-01) ................................... 116 Jacinda Lambert (2000-04) .......................................... 116 Jasmine Byrd (2003-070 .............................................. 116 Angie Polk (1985-89)....................................................115 Kathleen Tompkins (1985-89).......................................115 Sadie Ochs (1994-98) ..................................................115 Rebecca Viverette (1994-98) ........................................115 Ruby Smith (1983-87) .................................................. 114


CGSpartans.com • UNCGSpartans.com • UNCG

Spartan Record Book

Top 10 Career Performances-Individual FREE THROWS MADE (DIVISION I ERA) 1. Melinda Goodson (1996-00).................................385 2. Brianne Dodgen (1998-02)...................................341 3. ChoRhonda Gwaltney (1997-01) ...........................335 4. Kristen Boone (2004- ) .........................................309 5. Alisa Moore (1992-96) .........................................272 6. Samika Foster (1998-02)......................................250 7. Julie Moore (1992-96) ..........................................237 8. Sadie Ochs (1994-98) ..........................................230 Jacinda Lambert (2000-04) ..................................230 9. Rebecca Viverette (1994-98) ................................226 10. Kristen Boone (2004- ) .........................................219 FREE THROWS ATTEMPTED 1. Melinda Goodson (1996-00).................................568 2. Renee Coltrane (1981-85) ....................................536 3. Brianne Dodgen (1998-02)...................................468 4. ChoRhonda Gwaltney (1997-01) ...........................460 5. Alisa Moore (1992-96) .........................................454 6. Kristen Boone (2004- ) .........................................401 7. Angie Polk (1985-89)............................................398 8. Julie Moore (1992-96) ..........................................386 9. Samika Foster (1998-02)......................................349 10. Biz Brediger (1994-98) .........................................335 FREE THROWS ATTEMPTED (DIVISION I ERA) 1. Melinda Goodson (1996-00).................................568 2. Brianne Dodgen (1998-02)...................................468 3. ChoRhonda Gwaltney (1997-01) ...........................460 4. Alisa Moore (1992-96) .........................................454 5. Kristen Boone (2004- ) .........................................401 6. Julie Moore (1992-96) ..........................................386 7. Samika Foster (1998-02)......................................349 8. Biz Brediger (1994-98) .........................................335 9. Sadie Ochs (1994-98) ..........................................331 10. KaLeah Latham (2003-07 ) ...................................323 FREE THROW PERCENTAGE (min. 100 FTA) 1. Serena King (1993-96) ....................... .810 (102-126) 2. Amanda Eaton (2001-05) .....................806 (175-217) 3. Gail White (1990-92)......................... .801 (181-226) 4. Rebecca Viverette (1994-98) ...............790 (226-286) 5. Mickey Haywood (1989-93) ................ .787 (140-178) 6. Denise Mannon (1985-88)...................772 (122-158) 7. Kristen Boone (2004- ) ....................... .771 (309-401) 8. Jasmine Byrd (2003-07 )......................733 (201-264) 9. Wendy Engelmann (1981-85).............. .758 (166-219) Natalie Connor (1982-87)................... .758 (163-215) 10. Jo Zerger (1990-94)............................ .743 (124-167) FREE THROW PCT. (min. 100 FTA) - DIVISION I ERA 1. Serena King (1993-96) ....................... .810 (102-126) 2. Amanda Eaton (2001-05) .....................806 (175-217) 3. Rebecca Viverette (1994-98) ...............790 (226-286) 4. Mickey Haywood (1989-93) ................ .787 (140-178) 5. Kristen Boone (2004- ) ....................... .771 (309-401) 7. Jasmine Byrd (2003-07 )..................... .761 (201-264) 6. Jo Zerger (1990-94)............................ .743 (124-167) Kemena Brooks (2004-_....................... .742 (95-128) 8. Brianne Dodgen (1998-02)..................729 (341-468) Nicole Murray (2000-03) .................... .729 (132-181) 10. ChoRhonda Gwaltney (1997-01) ..........728 (335-460) Jacinda Lambert (2000-04) ................ .728 (230-316) TOTAL REBOUNDS 1. Renee Coltrane (1981-85) ..................................1211 2. Angie Polk (1985-89)..........................................1002 3. Julie Moore (1992-96) ..........................................799 4. Alisa Moore (1992-96) .........................................740 5. Melinda Goodson (1997-00).................................694 6. Brianne Dodgen (1998-02)...................................687 7. Chris Holec (1986-90) ..........................................662 8. Michelle Blazevich (1981-84) ...............................657 9. Sandi Reid (1998-02)...........................................592 10. Biz Brediger (1994-98) .........................................572 TOTAL REBOUNDS (DIVISION I ERA) 1. Julie Moore (1992-96) ..........................................799 2. Alisa Moore (1992-96) .........................................740 3. Melinda Goodson (1997-00).................................694 4. Brianne Dodgen (1998-02)...................................687 5. Sandi Reid (1998-02)...........................................592

72 • 2007-08 UNCG Women’s Basketball Media Guide

6. 7. 8. 9. 10.

Biz Brediger (1994-98) .........................................572 KaLeah Latham (2003-07)....................................565 Jacinda Lambert (2000-04) ..................................486 Rebecca Viverette (1994-98) ................................472 Sadie Ochs (1994-98) ..........................................428

STEALS 1. Kristen Boone (2004- ) .........................................313 2. Samika Foster (1998-02)......................................279 3. ChoRhonda Gwaltney (1997-01) ...........................242 4. Jasmine Byrd (2003-07 )....................................... 211 5. Angie Polk (1985-89)..........................................202* 6. Stephanie Johnson (1987-90)...............................194 7. Brianne Dodgen (1998-02)................................... 177 8. Melinda Goodson (1996-00).................................168 9. Jo Zerger (1990-94)..............................................164 10. Tina Wilson (1990-93) ..........................................162

8. Biz Brediger (1994-98) ........................................... 31 9. Julie Moore (1992-96) ............................................ 31 10. Brttany Frazier (2005-)............................................30 DOUBLE-DOUBLES 1. Melinda Goodson ...................................................24 2. Alisa Moore ............................................................18 3. Julie Moore.............................................................16 4. Brianne Dodgen......................................................13 5. KaLeah Latham.......................................................11 6. Vickie Henson...........................................................8 7. Biz Brediger ..............................................................6 Sandi Reid................................................................6 9. Rebecca Viverette .....................................................4 Jennifer Hart .............................................................4

*Total does not include 1985-86 season STEALS (DIVISION I ERA) 1. Kristen Boone (2004- ) .........................................313 2. Samika Foster (1998-02)......................................279 3. ChoRhonda Gwaltney (1997-01) ...........................242 4. Jasmine Byrd (2003- )........................................... 211 5. Brianne Dodgen (1998-02)................................... 177 6. Melinda Goodson (1996-00).................................168 7. Irene Otamiri (2003-07)........................................167 8. Jo Zerger (1990-94)..............................................164 9. Tina Wilson (1990-93) ..........................................162 10. Julie Moore (1992-96) ..........................................154 ASSISTS 1. Wendy Engelmann (1981-85)................................ 574 2. Ruby Smith (1983-87) ..........................................480 3. Samika Foster (1998-02)......................................444 4. Jo Zerger (1990-94)..............................................431 5. ChoRhonda Gwaltney (1997-01) ...........................420 6. Brenda Tolbert (1981-85) .....................................409 7. Jai Cole (1993-97)................................................367 8. Stephanie Johnson (1987-90)...............................363 9. Kristen Boone (2004-) ..........................................320 10. Julie Moore (1992-96) ..........................................281

Brianne Dodgen

#Total does not include 1979-80 season *Total does not include 1985-86 season ASSISTS (DIVISION I ERA) 1. Samika Foster (1998-02)......................................444 2. Jo Zerger (1990-94)..............................................431 3. ChoRhonda Gwaltney (1997-01) ...........................420 4. Jai Cole (1993-97)................................................367 5. Kristen Boone (2004-) ..........................................320 6. Julie Moore (1992-96) ..........................................281 7. Micky Haywood (1991-93) .................................... 274 8. Cescili Drake (1991-95)........................................268 9. Katrina Smith (1996-00).......................................251 10. Jennifer Lewis (1994-98) ...................................... 241 BLOCKS 1. Rebecca Viverette (1994-98) ................................121 2. Sandi Reid (1998-02).............................................73 3. Meghan Chamberlain (2004- ) ................................72 4. Alisa Moore (1992-96) ...........................................57 5. Lindsey Reed (2000-04) .........................................50 6. Angie Polk (1985-89)............................................44* 7. Kellan Law (2000-04) .............................................43 8. Jacinda Lambert (2000-04) ....................................42 9. Jana Henderson (1988-92) .....................................33 10. Julie Bright (1988-92)............................................. 31 Biz Brediger (1994-98) ........................................... 31 Julie Moore (1992-96) ............................................ 31 *Total does not include 1985-86 season BLOCKS (DIVISION I ERA) 1. Rebecca Viverette (1994-98) ................................121 2. Sandi Reid (1998-02).............................................73 3. Meghan Chamberlain (2004- ) ................................72 4.. Alisa Moore (1992-96) ...........................................57 5. Lindsey Reed (2000-04) .........................................50 6. Kellan Law (2000-04) .............................................43 7. Jacinda Lambert (2000-04) ....................................42

Amanda Eaton


FREE THROWS MADE (DIVISION I ERA) 1. Melinda Goodson (1998-99).....................................138 2. Melinda Goodson (1996-97).....................................120 3. ChoRhonda Gwaltney (1998-99) ...............................119 4. Kristen Boone (2005-06) .......................................... 117 5. Alisa Moore (1994-95)..............................................112 6. Vickie Henson (1993-94) ..........................................105 7. Melinda Goodson (1997-98) .....................................102 8. Brianne Dodgen (1999-00) .......................................102 9. Kristen Boone (2004-05) ..........................................102 10. Rebecca Viverette (1997-98)...................................100

POINTS (DIVISION I ERA) 1. Melinda Goodson (1998-99).....................................497 2. Vickie Henson (1992-93) ..........................................488 3. Alisa Moore (1994-95)..............................................480 4. Vickie Henson (1993-94) ..........................................479 5. Biz Brediger (1997-98) .............................................470 6. Rebecca Viverette (1997-98).....................................463 7. Melinda Goodson (1996-97) .....................................456 8. Jasmine Byrd (2006-07)............................................450 9. Brianne Dodgen (1999-00) .......................................422 10. Jacinda Lambert (2001-02) ....................................391

FIELD GOAL PERCENTAGE (min. 100 attempts) 1. Jana Henderson (1991-92).......................649 (122-188) 2. Chris Holec (1987-88)..............................629 (163-259) 3. Alisa Moore (1994-95).............................609 (184-302) 4. Karen Jordan (1987-88)............................ .607 (91-150) 5. Michele Blazevich (1981-82) .................. .598 (147-246) 6. Jennifer Hart (2001-02) ............................ .596 (81-136) 7. Vickie Henson (1993-94)......................... .590 (187-317) 8. Julie Bright (1988-89)............................... .588 (67-114) 9. Vickie Henson (1992-93) .........................587 (199-339) 10. Shawne Frazier (1983-84)..................... .587 (118-201)

FREE THROWS ATTEMPTED 1. Melinda Goodson (1996-97).....................................194 2. Melinda Goodson (1998-99).....................................190 3. Renee Coltrane (1984-85) ........................................183 4. Alisa Moore (1994-95)..............................................179 5. ChoRhonda Gwaltney (1998-99) ...............................166 6. Angie Polk (1987-88)................................................152 7. Renee Coltrane (1983-84).........................................151 8. Melinda Goodson (1997-98).....................................149 9. Vickie Henson (1992-93) .......................................... 147 Kristen Boone (2005-06) .......................................... 147

SCORING AVERAGE (min.15 games played) 1. Rita Wiggs (1974-75) .............................................21.84 2. Anna Parker (1978-79) ..........................................21.79 3. Cathy Strange (1976-77)........................................19.42 4. Jody Mangus (1979-80) .........................................18.86 5. Rita Wiggs (1973-74).............................................18.25 6. Melinda Goodson (1998-99).................................. 17.75 7. Sandra Lemon (1979-80) ....................................... 17.41 8. Mary Lida Alexander (1970-71) .............................. 17.30 9. Rita Wiggs (1971-72)............................................. 17.24 10. Carol Peschel (1981-82)...................................... 17.07

FIELD GOAL PERCENTAGE (min. 100 attempts) - DIV. I ERA 1. Jana Henderson (1991-92).......................649 (122-188) 2. Alisa Moore (1994-95).............................609 (184-302) 3. Jennifer Hart (2001-02) ............................ .596 (81-136) 4. Vickie Henson (1993-94) ........................ .590 (187-317) 5. Vickie Henson (1992-93) .........................587 (199-339) 6. Alisa Moore (1993-94)............................ .586 (102-174) 7. Stefanie Walter (1994-95)......................... .573 (94-164) 8. Julie Bright (1991-92)............................. .571 (128-224) 9. Biz Brediger (1997-98) ............................570 (196-344) 10. Melinda Goodson (1996-97)..................564 (168-298)

FREE THROWS ATTEMPTED (DIVISON I ERA) 1. Melinda Goodson (1996-97).....................................194 2. Melinda Goodson (1998-99).....................................190 3. Alisa Moore (1994-95)..............................................179 4. ChoRhonda Gwaltney (1998-99) ...............................166 5. Melinda Goodson (1997-98).....................................149 6. Vickie Henson (1992-93) .......................................... 147 Kristen Boone (2005-06) ......................................... 147 8. Alisa Moore (1995-96)..............................................142 9. Vickie Henson (1993-94) ..........................................139 10. Brianne Dodgen (1999-00) .....................................135

SCORING AVERAGE (min.15 games played) - DIVISION I ERA 1. Melinda Goodson (1998-99).................................. 17.75 2. Vickie Henson (1992-93) .......................................16.83 3. Vickie Henson (1993-94) .......................................16.52 4. Melinda Goodson (1996-97)..................................15.72 5. Biz Brediger (1997-98) ..........................................15.67 6. Alisa Moore (1994-95)...........................................15.48 7. Rebecca Viverette (1997-98)..................................15.43 8. Jasmine Byrd (2006-07).........................................15.00 9. Brianne Dodgen (1999-00) ....................................14.55 10. Alisa Moore (1995-98).........................................14.35

3-POINT FIELD GOALS MADE 1. Jasmine Byrd (2006-07)..............................................77 2. Sam Ferguson (1995-96)............................................65 3. Belinda Goodson (1999-00) .......................................57 4. Amanda Eaton (2003-04) ........................................... 51 5. Jasmine Byrd (2005-06) .............................................49 6. Amanda Eaton (2002-03) ...........................................48 7. ChoRhonda Gwaltney (2000-01) .................................42 8. Amanda Eaton (2004-05) ........................................... 41 9. Micky Haywood (1992-93) ..........................................39 10. Sam Ferguson (1997-98) ..........................................37

FREE THROW PERCENTAGE (min. 50 attempts) 1. Rebecca Viverette (1997-98)................... .877 (100-114) 2. Amanda Eaton (2003-04) ........................... .859 (61-71) 3. Jasmine Byrd (2006-07)...............................855 (53-62) 4. Tracey Young (1989-90) ...............................848 (50-59) 5. Serena King (1994-95) ............................... .847 (50-59) 6. Denise Mannon (1987-88)...........................828 (53-64) 7. Jasmine Byrd (2004-05).............................. .818 (81-99) 8. Gail White (1991-92) ...................................809 (72-89) 9. Jacinda Lambert (2003-04) ...................... .806 (87-108) 10.Natalie Connor (1986-87).......................... .797 (47-59)

FIELD GOALS MADE 1. Angie Polk (1987-88)................................................230 2. Carol Peschel (1981-82)...........................................220 3. Wendy Engelmann (1984-85).................................... 216 4. Vickie Henson (1992-93) ..........................................199 5. Biz Brediger (1997-98) .............................................196 6. Angie Polk (1986-87)................................................191 7. Vickie Henson (1993-94)...........................................187 8. Wendy Engelmann (1983-84)....................................184 9. Alisa Moore (1994-95)..............................................184 10. Natalie Conner (1985-86).......................................183

3-POINT FIELD GOALS ATTEMPTED 1. Jasmine Byrd (2006-07)............................................208 2. Belinda Goodson (1999-00) .....................................169 3. Jasmine Byrd (2005-06) ...........................................165 4. Jasmine Byrd (2004-05) ...........................................164 5. Sam Ferguson (1995-96)..........................................163 6. Amanda Eaton (2003-04) .........................................161 7. Jasmine Byrd (2003-04)............................................140 8. Amanda Eaton (2004-05) .........................................137 9. Amanda Eaton (2002-03) .........................................135 10. Sam Ferguson (1997-98) ........................................ 117

FREE THROW PERCENTAGE (min. 50 attempts) - DIV. I ERA 1. Rebecca Viverette (1997-98)................... .877 (100-114) 2. Amanda Eaton (2003-04) ........................... .859 (61-71) 3. Jasmine Byrd (2006-07)...............................855 (53-62) 4. Serena King (1994-95) ............................... .847 (50-59) 5. Jasmine Byrd (2004-05) ............................. .818 (81-99) 6. Gail White (1991-92) ...................................809 (72-89) 7. Jacinda Lambert (2003-04)....................... .806 (87-108) 8. Kristen Boone (2005-06) ..........................796 (117-147) 9. Micky Haywood (1992-93) .......................... .790 (64-81) 10. Lindsey Reed (2003-04) ........................... .789 (56-71)

FIELD GOALS MADE (DIVISION I ERA) 1. Vickie Henson (1992-93) ..........................................199 2. Biz Brediger (1997-98) .............................................196 3. Vickie Henson (1993-94) ..........................................187 4. Alisa Moore (1994-95)..............................................184 5. Melinda Goodson (1998-99).....................................178 6. Melinda Goodson (1996-97).....................................168 7. Rebecca Viverette (1997-98).....................................165 8. Jacinda Lambert (2001-02) ......................................162 9. Jasmine Byrd (2006-07)............................................160 10.Kymm Elliott (1991-92)............................................153

3-POINT FIELD GOAL PERCENTAGE (min. 50 attempts) 1. Gail White (1990-91) .................................. .549 (28-51) 2. Brianne Dodgen (1999-00) ..........................448 (26-58) 3. Sadie Ochs (1996-97)..................................420 (29-69) 4. Micky Haywood (1992-93) .......................... .415 (39-94) 5. Stephanie Johnson (1989-90)..................... .407 (22-54) 6. Katie DelCampo (1998-99)......................... .404 (23-57) 7. Sam Ferguson (1995-96) .......................... .399 (65-163) 8. Rebecca Viverette (1997-98)........................398 (33-83) 9. Jasmine Byrd (2006-07).............................398 (77-208) 10. Sadie Ochs (1994-95) .............................. .378 (28-74)

REBOUNDS 1. Renee Coltrane (1983-84) ........................................379 2. Renee Coltrane (1982-83) ........................................367 3. Sandra Lemon (1979-80)..........................................293 4. Angie Polk (1986-87)................................................289 5. Angie Polk (1987-88)................................................285 6. Renee Coltrane (1981-82) ........................................280 7. Shannon Young (1990-91).........................................265 8. Julie Moore (1994-95) ..............................................256 9. Michele Blazevich (1982-83) ....................................252 10.Chris Holec (1987-88) .............................................244

FIELD GOALS ATTEMPTED 1.Wendy Engelmann (1984-85) ....................................472 2. Carol Peschel (1981-82)...........................................460 3. Angie Polk (1987-88)................................................413 4. Wendy Engelmann (1983-84)....................................394 5. Jasmine Byrd (2006-07)............................................392 6. Natalie Connor (1985-86).........................................378 7. Jody Mangus (1979-80) ............................................372 8. Rebecca Viverette (1997-98).....................................368 9. Marie Cawley (19892-83) .........................................359 10.Jody Mangus (1980-81)...........................................353

FREE THROWS MADE 1. Melinda Goodson (1998-99).....................................138 2. Melinda Goodson (1996-97).....................................120 3. ChoRhonda Gwaltney (1998-99) ...............................119 4. Kristen Boone (2005-06) .......................................... 117 5. Renee Coltrane (1984-85) ........................................113 6. Alisa Moore (1994-95)..............................................112 7. Gail White (1990-91).................................................109 8. Vickie Henson (1993-94) ..........................................105 9. Melinda Goodson (1997-98).....................................102 Brianne Dodgen (1999-00) .......................................102

REBOUNDS (DIVISION I ERA) 1. Julie Moore (1994-95) ..............................................256 2. Melinda Goodson (1996-97).....................................235 3. Alisa Moore (1994-95)..............................................231 4. Alisa Moore (1995-96)..............................................227 5. KaLeah Latham (2006-07)........................................215 6. Vickie Henson (1993-94) ..........................................213 7. Vickie Henson (1992-93)........................................... 211 8. Julie Moore (1995-96) ..............................................204 9. Melinda Goodson (1997-98).....................................202 10. Biz Brediger (1997-98) ...........................................201

2007-08 UNCG Women’s Basketball Media Guide • 73

Spartan Record Book

FIELD GOALS ATTEMPTED (DIVISION I ERA) 1. Jasmine Byrd (2006-07)............................................392 2. Rebecca Viverette (1997-98).....................................368 3. Melinda Goodson (1998-99).....................................351 4. Biz Brediger (1997-98) .............................................344 5. Vickie Henson (1992-93) ..........................................339 6. Jacinda Lambert (2001-02) ......................................335 7. Brianne Dodgen (2000-01) .......................................334 8. Jasmine Byrd (2004-05) ...........................................334 9. Jacinda Lambert (2003-04) ......................................324 10. Vickie Henson (1993-94) ........................................ 317

UNCGSpartans.com • UNCGSpartans.com • UNCG

Top 10 Single Season Performances - Individual POINTS 1. Angie Polk (1987-88)................................................554 2. Melinda Goodson (1998-99).....................................497 3. Vickie Henson (1992-93) ..........................................488 4. Alisa Moore (1994-95)..............................................480 5. Vickie Henson (1993-94) ..........................................479 6. Carol Peschel (1981-82)...........................................478 7. Wendy Engelmann (1984-85)....................................472 8. Biz Brediger (1997-98) .............................................470 9. Rebecca Viverette (1997-98).....................................463 10. Renee Coltrane (1984-85) ......................................461


CGSpartans.com • UNCGSpartans.com • UNCG

Spartan Record Book

Top 10 Single Season Performances - Individual OFFENSIVE REBOUNDS 1. Shannon Young (1990-91) ........................................108 2. Melinda Goodson (1996-97).....................................105 3. Alisa Moore (1995-96)................................................97 4. Julie Moore (1994-95) ................................................91 5. Biz Brediger (1997-98) ...............................................88 6. Julie Moore (1993-94) ................................................87 7. Melinda Goodson (1997-98) .......................................87 8. Julie Moore (1995-96) ................................................83 9. Biz Brediger (1996-97) ...............................................82 10.Melinda Goodson (1998-99)......................................79

5. Angie Polk (1986-87)..................................................29 6. Brittany Frazier (2006-07)...........................................28 7. Kellan Law (2002-03)..................................................24 8. Lindsey Reed (2002-03) .............................................24 9. Alisa Moore (1994-95)................................................22 10. Meghan Chamberlain (2004-05)............................... 21 NOTE: Block totals forr 1979-80 & 1981-86 Not Available

NOTE: Offensive rebound totals forr 1981-88 Not Available DEFENSIVE REBOUNDS 1. Julie Moore (1994-95) ..............................................165 2. Alisa Moore (1994-95)..............................................159 3. Shannon Young (1990-91) ........................................157 4. Brianne Dodgen (2000-01) .......................................153 5. Vickie Henson (1993-94) .......................................... 141 6. KaLeah Latham (2006-07)........................................138 7. Vickie Henson (1992-93)...........................................133 8. Alisa Moore (1995-96)..............................................130 9. Melinda Goodson (1996-97).....................................130 10.Sandi Reid (2001-02)..............................................127 ASSISTS 1. Wendy Engelmann (1983-84)....................................170 2. Ruby Smith (1986-87) ..............................................153 3. Jai Cole (1994-95)....................................................148 4. Stephanie Johnson (1987-88)...................................146 5. Ruby Smith (1985-86) ..............................................144 6. Wendy Engelmann (1981-82)....................................140 7. Brenda Tolbert (1982-83)..........................................139 8. Wendy Engelmann (1984-85)....................................134 9. Wendy Engelmann (1982-83)....................................130 10. Brenda Tolbert (1983-84) .......................................130

ChoRhonda Gwaltney

NOTE: Assists totals forr 1979-80 & 1985-86 Not Available ASSISTS (DIVISION I ERA) 1. Jai Cole (1994-95) ....................................................148 2. Jo Zerger (1991-92) ..................................................122 3. Julie Moore (1994-95) ..............................................122 4. Kristen Boone (2005-06) ..........................................122 5. Katrina Smith (1997-98)...........................................121 6. Kristen Boone (2006-07) ..........................................121 7. Samika Foster (1999-00) ..........................................120 8. Cescili Drake (1993-94)............................................120 9. Micky Haywood (1992-93) ........................................ 114 10. Jo Zerger (1992-93) ................................................ 114

Melinda Goodson

STEALS 1. Kristin Boone (2004-05) ...........................................121 2. Kristin Boone (2005-06) ...........................................101 3. Ruby Smith (1986-87) ................................................95 4. Angie Polk (1986-87)..................................................91 5. Kristen Boone (2006-07) ............................................87 6. Stephanie Johnson (1987-88).....................................83 7. Tina Wilson(1992-93) .................................................79 8. Samika Foster (1999-00)............................................78 9. Irene Otamiri (2006-07)..............................................78 10. Angie Polk (1987-88)................................................ 74 NOTE: Steals totals forr 1981-86 Not Available STEALS DIVISION I ERA) 1. Kristin Boone (2004-05) ...........................................121 2. Kristin Boone (2005-06) ...........................................101 3. Kristen Boone (2006-07) ............................................87 4. Tina Wilson (1992-93) ................................................79 5. Samika Foster (1999-00)............................................78 6. Irene Otamiri (2006-07)..............................................78 7. Samika Foster (2000-01) ............................................ 74 8. Samika Foster (1998-99)............................................72 9. ChoRhonda Gwaltney (1999-00) .................................68 10.Nicole Murray (2002-03) ...........................................68 BLOCKS 1. Rebecca Viverette (1997-98).......................................49 2. Rebecca Viverette (1996-97).......................................43 3. Meghan Chamberlain (2005-06).................................35 4. Sandi Reid (2000-0 (2000 01 1) ................................................. .................................................30 30

74 • 2007-08 UNCG Women’s Basketball Media Guide

Gail White (ball) and Julie Bright


POINTS 1. 38, Anna Parker at Wake Forest........................... 2/12/1979 2. 36, Rita Wiggs vs. Western Carolina .......................2/1/1974 36, Vickie Henson vs. Towson .............................. 3/12/1993 3. 35, Anna Parker vs. UNC Pembroke ........................2/2/1979 35, Angie Polk vs. Christopher Newport ............... 2/28/1987 35, Angie Polk vs. NC Wesleyan........................... 1/30/1988 6. 34, Cathy Strange vs. East Carolina......................1/18/1977 7. 33, Mary Lida Alexander vs. North Carolina...........2/11/1971 33, Anna Parker vs. Western Carolina .................. 1/20/1979 33, Anna Parker vs. Mercer.................................. 1/25/1979 38, Mickey Haywood at Campbell........................ 2/13/1993

FIELD GOALS 1. 18, Anna Parker vs. Wake Forest.......................... 2/12/1979 2. 15, Angie Polk at NC Wesleyan ............................ 1/30/1988 3. 14, Biz Brediger at Furman ................................. 2/10/1998 4. 13, Eight times FIELD GOALS (DIVISION I ERA) 1. 14, Biz Brediger at Furman ................................. 2/10/1998 2. 13, Biz Brediger at Wofford ..................................1/17/1998 13, Melinda Goodson vs. Chattanooga ............... 1/16/1999 13, Micky Haywood at Campbell ......................... 2/13/1993 5. 12, Brianne Dodgen vs. Chattanooga .................... 3/4/2000 12, Julie Bright vs. Appalachian State ................. 12/4/1991 7. Nine players with 11 FIELD GOALS ATTEMPTED 1. 30, Jody Mangus vs. Bennett College....................2/14/1981 30, Wendy Engelmann vs. Buffalo State .............11/17/1984 3. 24, Jacinda Lambert at Elon ................................. 1/5/2004 4. 23, Michele Blazevich vs. Virginia Wesleyan ........ 1/20/1984 23, Wendy Engelmann vs. Elon ............................ 12/4/1984 23, Angie Polk at Christopher Newport ................ 2/28/1987 23, Angie Polk at NC Wesleyan ............................... 1/-/1988 8. 22, Brianne Dodgen at Chattanooga ................... 2/19/2000 22, Jai Cole at Wake Forest ................................. 12/7/1994 10.21, Marie Cawley vs. UNC Wilmington ................ 2/20/1983 FIELD GOALS ATTEMPTED (DIVISION I ERA) 1. 24, Jacinda Lambert at Elon ................................. 1/5/2004 2. 22, Brianne Dodgen at Chattanooga ................... 2/19/2000 22, Jai Cole at Wake Forest ................................. 12/7/1994 4. 21, Melinda Goodson vs. UNC Asheville ............ 11/18/1998 5. 20, Vickie Henson at Radford ............................. 2/29/1994 20, Brianne Dodgen vs. Chattanooga ................... 3/4/2000 20, Nicole Murray at Furman ................................ 1/2/2003 8. 19, Jasmine Byrd vs. Wofford .............................. 2/19/2007 19, Jasmine Byrd at Maryland ........................... 12/29/2006 FIELD GOAL PERCENTAGE (min. 10 made) 1. 1.000 (11-11), Melinda Goodson vs. Wofford ..... 2/26/1999 2. .909 (10-11), Angie Polk vs. Virginia Wesleyan .....2/14/1987 .909 (10-11), Jana Henderson at UNC Asheville.. 1/16/1992 3. .846 (11-13), Julie Moore vs. Towson ................. 1/22/1994 4. .833 (10-12), Chris Holec at Methodist .................. 2/-/1988 .833 (10-12), Gail White at Pitt.-Johnstown......... 12/1/1990 .833 (10-12), Melinda Goodson vs. C. Southern . 1/25/1997 .833 (10-12), Ashley Current vs. Davidson .......... 2/15/2005 8. .813 (13-16), Angie Polk at NC Wesleyan..............2/21/1987 .813 (13-16), Julie Bright at UNC Wilmington..........2/271989 FIELD GOAL PERCENTAGE (min. 10 made) - DI ERA 1. 1.000 (11-11), Melinda Goodson vs. Wofford ..... 2/26/1999 2. .909 (10-11), Jana Henderson at UNC Asheville.. 1/16/1992 3. .846 (11-13), Julie Moore vs. Towson ................. 1/22/1994 4. .833 (10-12), Melinda Goodson vs. C. Southern . 1/25/1997 . 833 (10-12), Ashley Current vs. Davidson .......... 2/15/2005 6. .786 (11-14), Brianne Dodgen vs. Ga. Southern .. 2/21/2000 7. .769 (10-13), Kymm Elliott at Liberty .................. 2/27/1992 .769 (10-13), Vickie Henson vs. Winthrop ............2/17/1993 .769 (10-13), Vickie Henson vs. Coastal Carolina .. 3/4/1994 .769 (10-13), Julie Moore at Alaska-Anchorage . 12/19/1994

REBOUNDS 1. 25, Renee Coltrane vs. Christopher Newport.......... 2/8/1985 2. 24, Renee Coltrane vs. Christopher Newport.......... 1/8/1985 3. 22, Sandra Lemon vs. Wingate ...........................11/27/1979 22, Renee Coltrane vs. Rust .................................. 3/4/1983 5. 20, Renee Coltrane vs. Christopher Newport........ 1/21/1984 20, Angie Polk vs. Liberty .................................... 2/18/1987 7. 19, Renee Coltrane vs. Virginia Wesleyan............. 1/20/1984 19, Renee Coltrane vs. NC Wesleyan .................... 1/28/1984 19, Julie Moore vs. Western Carolina ................. 12/31/1994 19, Alisa Moore vs. UNC Asheville .........................1/17/1996

3-PT. FIELD GOAL ATTEMPTS 1. 15, Sam Ferguson at Charleston Southern .......... 1/27/1996 2. 14, Jasmine Byrd vs. Wofford............................... 2/19/2007 3. 13, Beth Durrill at Virginia State...........................1/31/1991 4. 12, Sam Ferguson at Coastal Carolina ................ 1/13/1996 12, Jasmine Byrd vs. Providence....................... 11/25/2006 6. 11, Sam Ferguson vs. Radford ........................... 1/13/1997 11, Sam Ferguson at Appalachian State .............. 2/7/1998 11, Belinda Goodson vs. Wofford ....................... 1/11/1999 11, Belinda Goodson at St. Mary’s (CA) ............ 11/26/1999 11, Jasmine Byrd vs. Delaware............................ 12/5/2004

REBOUNDS (DIVISION I ERA) 1. 19, Julie Moore vs. Western Carolina ................ 12/31/1994 19, Alisa Moore vs. UNC Asheville ........................1/17/1996 3. 17, Kymm Elliott vs. Austin Peay ........................ 12/29/1991 17, Alisa Moore vs. Liberty .................................. 2/23/1993 17, Alisa Moore vs. Radford ................................ 3/12/1994 17, Julie Moore at Winthrop .................................. 2/8/1995 17, Alisa Moore at Radford ................................. 3/11/1995 17, Julie Moore at Radford .................................. 2/29/1996 9. 16, Julie Moore vs. Towson ................................. 1/22/1995 10. 15, Julie Moore vs. UMES ............................... 11/25/1995

3-PT FIELD GOAL PERCENTAGE (min. 5 made) 1. 1.000 (5-5), Sadie Ochs vs. Liberty ..................... 1/28/1997 2. 1.000 (5-5), Amanda Eaton at Wofford.............. 12/30/2004 3. .875 (7-8), Micky Haywood at Campbell ............. 2/13/1993 4. .714 (5-7), Stephanie Johnson at UC Riverside ...... 1/3/1990 .714 (5-7), Belinda Goodson vs. Appalachian State 1/5/2000 .714 (5-7), Jasmine Byrd vs. Davidson ................. 2/15/2005 7. .625 (5-8), Sam Ferguson vs. Georgia Southern 11/29/1997 .625 (5-8), Amanda Eaton at Appalachian State ... 3/1/2003 .625 (5-8), Amanda Eaton at ETSU .................... 12/13/2003 .625 (5-8), Jasmine Byrd vs. Appalachian State... 1/14/2006

ASSISTS 1. 13, Brenda Tolbert vs. St. Andrews ...................... 2/14/1984 2. 12, Ruby Smith at NC Wesleyan........................... 2/15/1986 12, Jo Zerger vs. Winthrop ...................................2/17/1993 4. 11, Ruby Smith at Methodist ................................. 2/3/1986 11, Stephanie Johnson vs. Longwood................... 1/14/1989 11, Stephanie Johnson at UC Riverside.................. 1/3/1990 11, Kristen Boone vs. Chattanooga........................ 1/2/2006 8. 10, Brenda Tolbert vs. Greensboro College .......... 1/26/1984 10, Brenda Tolbert vs. NC Wesleyan..................... 1/28/1984 10, Wendy Engelmann vs. St. Andrews................. 2/24/1984 10, Ruby Smith vs. Centre ......................................3/6/1987

FREE THROWS MADE 1. 15, Melinda Goodson vs. Davidson ..................... 2/27/1999 2. 14, Renee Coltrane vs. Christopher Newport.......... 2/8/1985 14, Amanda Eaton vs. Charleston ......................... 2/9/2004 3. 13, ChoRhonda Gwaltney vs. Davidson ................. 1/9/1999 4. 12, Sadie Ochs vs. UNC Asheville ........................ 2/28/1995 12, Melinda Goodson vs. Campbell .................. 12/30/1997 6. 11, Stephanie Johnson at NC Central..................... 2/1/1990 11, Donna Snead vs. St. Augustine’s..................... 2/6/1990 11, Kymm Elliott vs. Austin Peay ....................... 12/29/1991 11, Samika Foster vs. Charlotte ....................... 11/20/2000 FREE THROWS (DIVISION I ERA) 1. 15, Melinda Goodson vs. Davidson ..................... 2/27/1999 2. 14, Amanda Eaton vs. Charleston ......................... 2/9/2004 3. 13, ChoRhonda Gwaltney vs. Davidson ................. 1/9/1999 4. 12, Sadie Ochs vs. UNC Asheville ........................ 2/28/1995 12, Melinda Goodson vs. Campbell .................. 12/30/1997 6. 11, Kymm Elliott vs. Austin Peay ........................ 12/29/1991 11, Samika Foster vs. Charlotte ........................ 11/20/2000 8. 10, 12 players FREE THROWS ATTEMPTED A 1. 19, Melinda Goodson vs. Campbell .................. 12/30/1997 2. 18, Renee Coltrane vs. Buffalo State ..................11/17/1984 18, Kymm Elliott vs. Austin Peay ....................... 12/29/1991 3. 17, Donna Snead vs. St. Augustine’s...................... 2/6/1990 4. 16, Renee Coltrane vs. Christopher Newport.......... 2/8/1985 16, Melinda Goodson vs. Davidson ..................... 2/27/1999 6. 15, Renee Coltrane vs. Virginia Commonwealth ....2/17/1984 15, Shannon Young vs. Norfolk State................. 12/31/1990 15, ChoRhonda Gwaltney vs. Davidson ................. 1/9/1999 14, Sadie Ochs vs. UNC Asheville ........................ 2/28/1995 FREE THROWS ATTEMPTED A (DIVISION I ERA) 1. 19, Melinda Goodson vs. Campbell .................. 12/30/1997 2. 18, Kymm Elliott vs. Austin Peay ....................... 12/29/1991 3. 16, Melinda Goodson vs. Davidson ..................... 2/27/1999 4. 15, ChoRhonda Gwaltney vs. Davidson ................. 1/9/1999 5. 14, Sadie Ochs vs. UNC Asheville ........................ 2/28/1995 14, Melinda Goodson vs. Liberty ......................... 1/28/1997 14, Jennifer Hart at Appalachian State ................ 1/26/2002 14, Amanda Eaton vs. Charleston ......................... 2/9/2004 9. 13, Julie Moore vs. Hartford .............................. 12/30/1995 13, Melinda Goodson vs. Appalachian State ..........1/2/1997

ASSISTS (DIVISION I ERA) 1. 12, Jo Zerger vs. Winthrop ....................................2/17/1993 2. 11, Kristen Boone vs. Chattanooga........................ 1/2/2006 3. 10, Julie Moore vs. Western Carolina ................ 12/31/1994 10, Jai Cole at UNC Asheville .............................. 1/14/1995 10, ChoRhonda Gwaltney vs. Charleston ........... 12/29/1999 10, Kristen Boone vs. Elon................................... 1/20/2006 7. 9, Mickey Haywood vs. Liberty............................. 1/23/1992 9, Mickey Haywood at Winthrop........................... 2/24/1992 9, Jo Zerger vs. North Carolina A&T...................... 1/28/1993 9, Jo Zerger vs. Charleston Southern.................... 2/26/1993 STEALS 1. 12, Ruby Smith at Greensboro College ................ 12/9/1986 2. 11, Kristen Boone vs. UNC Wilmington............... 11/12/2006 3. 9, Stephanie Johnson vs. UNC Pembroke............... 2/2/1989 9, Kristen Boone vs. Furman.................................. 2/4/2006 4. 8, Seven players STEALS (DIVISION I ERA) 1. 11, Kristen Boone vs. UNC Wilmington............... 11/12/2006 2. 9, Kristen Boone vs. Furman.................................. 2/4/2006 3. 8, Melinda Goodson at Elon ................................ 12/2/1998 8, Samika Foster at Wofford ............................... 2/12/1999 8, Kristen Boone at Georgia Southern.................... 2/5/2005 8, Kristen Boone vs. Western Carolina ................. 2/12/2005 8, Kristen Boone at Georgia Southern.................... 1/9/2006 8. 7, 10 Players BLOCKS 1. 7, Rebecca Viverette vs. Wofford ......................... 2/16/1998 2. 6, Angie Polk at Christopher Newport .................. 1/25/1987 3. 5, Sue Reep vs. Davidson .................................... 1/12/1981 5, Rebecca Viverette vs. Radford .......................... 2/7/1996 5, Rebecca Viverette at Liberty ........................... 2/20/1997 5, Rebecca Viverette vs. Chattanooga ................. 2/21/1998 5, Rebecca Viverette at Charleston Southern ...... 2/22/1997 8. 4, Seven players

FREE THROW W PERCENTAGE (min. eight made) - DIV. I ERA 1. 1.000 (14-14), Amanda Eaton vs. Charleston ....... 2/9/2004 2. 1.000 (11-11), Samika Foster vs. Charlotte ...... 11/20/2000 3. 1.000 (9-9), Melinda Goodson at Coastal Carolina 2/8/1997 4. 1.000 (9-9), Kristen Boone at Georgia Southern .... 1/9/2006 5. 1.000 (8-8), Jai Cole vs. Holy Cross ....................... 1/1/1995

2007-08 UNCG Women’s Basketball Media Guide • 75

Spartan Record Book

POINTS (DIVISION I ERA) 1. 36, Vickie Henson vs. Towson .............................. 3/12/1993 2. 33, Mickey Haywood at Campbell........................ 2/13/1993 33, Biz Brediger at Wofford ..................................1/17/1998 33, Melinda Goodson vs. Davidson...................... 2/27/1999 33, Brianne Dodgen vs. Appalachian State............ 3/3/2000 6. 32, Brianne Dodgen vs. Chattanooga .................... 3/4/2000 7. 30, Julie Moore at Winthrop................................. 2/16/1996 30, Biz Brediger at Furman.................................. 2/10/1998 9. 27, Kristen Boone vs. Furman.....................................1/6/07 27, Jasmine Byrd vs. UNC Wilmington.....................11/12/07

3-POINT FIELD GOALS MADE 1. 7, Micky Haywood at Campbell ........................... 2/13/1993 2. 6, Sam Ferguson at Coastal Carolina ................. 1/13/1996 6, Sam Ferguson at Charleston Southern ........... 1/27/1996 6.Jasmine Byrd vs. Georgia Southern.................... 1/8/2007 6, Jasmine Byrd vs Providence .......................... 11/25/2007 6. 5, Stephanie Johnson at UC Riverside.................... 1/3/1990 5, Sam Ferguson vs. Illinois .............................. 11/24/1995 5, Sam Ferguson vs. Georgia Southern .............. 11/29/1997 5, Sam Ferguson vs. Radford .............................. 1/13/1997 5, Sadie Ochs vs. Liberty .................................... 1/28/1997

UNCGSpartans.com • UNCGSpartans.com • UNCG

Top 10 Single Game Performances - Individual


CGSpartans.com • UNCGSpartans.com • UNCG

Spartan Record Book

Top Single Season Performances - Team WINS 27 (27-3) ..............................................................................1986-87 26 (26-7)..............................................................................1987-88 25 (25-3)..............................................................................1981-82 24 (24-4)............................................................................. 1985-86 22 (22-7)............................................................................. 1983-84 22 (22-8)............................................................................. 2000-01 LOSSES 19 (0-19)..............................................................................1978-79 19 (9-19)............................................................................. 2003-04 16 (3-16) ..............................................................................1976-77 16 (6-16) ..............................................................................1977-78 15 (4-15)..............................................................................1975-76 WINNING PERCENTAGE .900 (27-3)...........................................................................1986-87 .893 (25-3)...........................................................................1981-82 .857 (24-4).......................................................................... 1985-86 .818 (9-2)............................................................................ 1969-70 .809 (17-4)...........................................................................1971-72 HOME WINS 12 (12-3)............................................................................. 2006-07 12 (12-4)..............................................................................1979-80 12 (12-2)..............................................................................1981-82 12 (12-1)............................................................................. 1985-86 12 (12-1)..............................................................................1986-87 12 (12-1)............................................................................. 2001-02 11, Seven times (NOTE: First season in Fleming Gym was 1989-90) ROAD WINS 11 (11-1) ............................................................................. 1985-86 11 (11-1) ..............................................................................1986-87 10 (10-1) ..............................................................................1981-82 9 (9-6) ..................................................................................1987-88 9 (9-3) ................................................................................. 2000-01 HOME LOSSES 9 (0-9) ..................................................................................1978-79 7 (3-7) ..................................................................................1977-78 6 (1-6) ..................................................................................1975-76 5 (2-5) ..................................................................................1976-77 5 (8-5) ................................................................................. 2002-03 ROAD LOSSES 11 (2-11) ............................................................................. 2003-04 9 (0-9) ..................................................................................1978-79 9 (3-9) ..................................................................................1980-81 8 (1-8 ) .................................................................................1976-77 8 (4-8) ................................................................................. 2004-05 WINNING STREAK 24 ........................................................................................1986-87 20 ....................................................................................... 1985-86 12 ........................................................................................1981-82 12 ........................................................................................1996-97 11 ........................................................................................1981-82 WINNING STREAK (DIVISION I ERA) 12 ........................................................................................1996-97 9 ......................................................................................... 1992-93 9 ......................................................................................... 2000-01 9 ......................................................................................... 2001-02 8 ..........................................................................................1997-98 LOSING STREAK 27 ........................................................................................1977-79 9 ..........................................................................................1975-77 8 ..........................................................................................1976-77 7 ..........................................................................................1974-75 5 ..........................................................................................1975-76 LOSING STREAK (DIVISION I ERA) 5 ......................................................................................... 1993-94 5 ......................................................................................... 2003-04 4 ......................................................................................... 2002-03 4 ......................................................................................... 2003-04 4 ......................................................................................... 2005-06 HOME WINNING STREAK 32 ...............................................................12/6/1986-2/14/1989 14 .................................................................2/9/1982-2/18/1983 13 .................................................................1/21/1984-2/2/1985 13 .................................................................2/2/1997-1/22/1999 12 .............................................................. 12/3/1985-2/18/1986

HOME WINNING STREAK (DIVISION I ERA) 13 .................................................................2/2/1997-1/22/1999 12 .................................................................2/2/1998-1/22/1999 10 ...............................................................11/20/2001-2/2/2002 10 .....................................................................2/24/06-12/20/06 9 ................................................................ 1/6/1993-12/18/1993

76 • 2007-08 UNCG Women’s Basketball Media Guide

POINTS 2,827 ...................................................................................1987-88 2,516 ...................................................................................1986-87 2,364.................................................................................. 1983-84 2,353 ...................................................................................1990-91 2,275 .................................................................................. 1984-85

FREE THROWS MADE (DIVISION I ERA) 531 ..................................................................................... 1994-95 527 ..................................................................................... 1998-99 487 ......................................................................................1996-97 468 ..................................................................................... 2004-05 465 ..................................................................................... 1995-96

POINTS (DIVISION I ERA) 2,236 .................................................................................. 1994-95 2,194 ...................................................................................1996-97 2,190 ...................................................................................1997-98 2,162 .................................................................................. 2001-02 2,100 ...................................................................................1991-92

FREE THROWS ATTEMPTED 798 ..................................................................................... 1994-95 770 ..................................................................................... 1998-99 763 ......................................................................................1996-97 760 ......................................................................................1987-88 700 ..................................................................................... 1995-96

POINTS PER GAME 85.7 .....................................................................................1987-88 83.9 .....................................................................................1986-87 81.5 .................................................................................... 1983-84 81.3 .................................................................................... 1984-85 80.5 .................................................................................... 1989-90

FREE THROWS ATTEMPTED (DIVISION I ERA) 798 ..................................................................................... 1994-95 770 ..................................................................................... 1998-99 763 ......................................................................................1996-97 700 ..................................................................................... 1995-96 677 ..................................................................................... 2004-05

POINTS PER GAME (DIVISION I ERA) 77.8......................................................................................1991-92 75.7 .....................................................................................1996-97 74.0 .................................................................................... 1998-99 73.8 .................................................................................... 1995-96 73.0 .....................................................................................1997-98

FREE THROW PERCENTAGE .729 (399-547) ................................................................... 1989-90 .723 (370-512).....................................................................1991-92 .713 (440-617).................................................................... 1999-00 .705 (420-596) ................................................................... 2000-01 .703 (460-654) ....................................................................1990-91

FIELD GOALS 1,140 ...................................................................................1987-88 1,044 ...................................................................................1986-87 993 ..................................................................................... 1983-84 964 ......................................................................................1981-82 960 ..................................................................................... 1984-85

FREE THROW PERCENTAGE (DIVISION I ERA) .723 (370-512).....................................................................1991-92 .713 (440-617).................................................................... 1999-00 .705 (420-596) ................................................................... 2000-01 .700 (419-599).................................................................... 2005-06 .692 (346-500) ................................................................... 2006-07

FIELD GOALS (DIVISION I ERA) 844 ......................................................................................1991-92 813 ..................................................................................... 1993-94 806 ..................................................................................... 2001-02 804 ..................................................................................... 1992-93 801 ..................................................................................... 1994-95

REBOUNDS 1,522 ...................................................................................1987-88 1,425 .................................................................................. 1983-84 1,422 ...................................................................................1986-87 1,356 ...................................................................................1981-82 1,342 .................................................................................. 1984-85

FIELD GOAL ATTEMPTS 2,283 ...................................................................................1987-88 2,148 ...................................................................................1986-87 2,083 .................................................................................. 1983-84 2,063 .................................................................................. 1984-85 2,040 .................................................................................. 1982-83

REBOUNDS (DIVISION I ERA) 1,318 .................................................................................. 1994-95 1,274 .................................................................................. 2001-02 1,264 .................................................................................. 2000-01 1,239 ...................................................................................1996-97 1,197 .................................................................................. 2005-06

FIELD GOAL ATTEMPTS (DIVISION I ERA) 1,857 .................................................................................. 2001-02 1,851 .................................................................................. 2000-01 1,806 ...................................................................................1997-98 1,804 .................................................................................. 1994-95 1,799 .................................................................................. 2005-06

ASSISTS 570 ..................................................................................... 1983-84 569 ......................................................................................1986-87 560 ......................................................................................1987-88 559 ..................................................................................... 1994-95 NOTE: 1985-86 season not available

FIELD GOAL PERCENTAGE .503 (844-1679) ..................................................................1991-92 .499 (1140-2283) ................................................................1987-88 .496 (813-1640) ................................................................. 1993-94 .486 (1044-2148) ................................................................1986-87 .485 (964-1989) ..................................................................1981-82 FIELD GOAL PERCENTAGE (DIVISION I ERA) .503 (844-1679) ..................................................................1991-92 .496 (813-1640) ................................................................. 1993-94 .473 (804-1698) ................................................................. 1992-93 .444 (801-1804) ................................................................. 1994-95 .443 (715-1614).................................................................. 1998-99 3-POINT FIELD GOALS MADE 167 ..................................................................................... 1999-00 146 ..................................................................................... 2006-07 139 ......................................................................................1996-97 133 ......................................................................................1997-98 128 ..................................................................................... 2000-01 3-POINT FIELD GOALS ATTEMPTED 535 ..................................................................................... 1999-00 445 ..................................................................................... 2006-07 425 ..................................................................................... 2000-01 399 ..................................................................................... 2005-06 396 ......................................................................................1996-97 3-POINT FIELD GOAL PERCENTAGE .406 (56-138) ..................................................................... 1989-90 .377 (55-146)...................................................................... 1992-93 .365 (38-104) ..................................................................... 1993-94 .358 (54-151)...................................................................... 1988-89 .354 (81-229) ......................................................................1990-91 FREE THROWS MADE 531 ..................................................................................... 1994-95 527 ..................................................................................... 1998-99 512 ......................................................................................1987-88 487 ......................................................................................1996-97 468 ..................................................................................... 2004-05

ASSISTS (DIVISION I ERA) 559 ..................................................................................... 1994-95 536 ......................................................................................1997-98 528 ......................................................................................1991-92 527 ..................................................................................... 1993-94 525 ..................................................................................... 1992-93 STEALS (SINCE 1986-87) 435 ......................................................................................1986-87 435 ......................................................................................1987-88 360 ......................................................................................1990-91 353 ..................................................................................... 2000-01 352 ..................................................................................... 2004-05 STEALS (DIVISION I ERA) 353 ..................................................................................... 2000-01 352 ..................................................................................... 2004-05 350 ..................................................................................... 2001-02 342 ..................................................................................... 1999-00 336 ..................................................................................... 2006-07 BLOCKS (SINCE 1986-87) 101 ..................................................................................... 2006-07 96 ....................................................................................... 2005-06 85 ....................................................................................... 2000-01 84 ........................................................................................1996-97 81 ....................................................................................... 2004-05 BLOCKS (DIVISION I ERA) 101 ..................................................................................... 2006-07 96 ....................................................................................... 2005-06 85 ....................................................................................... 2000-01 84 ........................................................................................1996-97


MOST POINTS SCORED 1. 139 vs. Averett College................................. 2/23/1988 2. 125 vs. Averett College .................................. 2/8/1988 3. 122 at Averett College.................................. 1/10/1985 4. 121 vs. North Carolina Wesleyan .................. 2/20/1988 5. 120 at Averett College.................................. 1/16/1988 6. 116 vs. Methodist College............................ 12/3/1983 116 vs. Averett College................................. 12/1/1984 8. 112 vs. Averett College................................. 2/24/1987 9. 110 vs. Methodist College............................ 12/2/1981 10. 106 vs. North Carolina Wesleyan................ 2/16/1985

FEWEST POINTS SCORED 1. 32 at High Point ..............................................2/2/1971 2. 34 at Wake Forest (W 34-26)...........................2/3/1970 34 at North Carolina State ..............................2/5/1979 4. 37 vs. East Tennessee State ..........................2/21/1970 5. 39 vs. Western Carolina ..............................................NA 39 vs. North Carolina State ........................ 11/28/1978 39 vs. Virginia .............................................11/24/1981 39 at West Virginia..................................... 11/19/2004 9. 40 vs. Winthrop (W 40-35) ..............................2/4/1971 40 vs. Duke (W 40-36) ....................................3/7/1972 FEWEST POINTS SCORED (DIVISION I ERA) 1. 39 at West Virginia..................................... 11/19/2004 2. 40 at Charlotte........................................... 11/20/2006 3. 41 at Appalachian State............................. 12/18/2004 4. 42 at Furman ..................................................1/8/1997 42 at Clemson ........................................... 12/30/1998 42 at Furman ............................................... 1/31/2004 7. 43 at Tulane ...............................................12/28/2002 43 at Virginia ............................................. 11/21/2003 43 at Georgia Southern................................ 1/10/2004 10. 44 at Charlotte .........................................11/16/2001 MOST POINTS ALLOWED 1. 131 by North Carolina State ......................... 2/22/1979 2. 119 by Kent State ...................................... 12/29/1993 3. 116 by North Carolina State ....................... 11/28/1978 4. 111 by North Carolina State ............................2/5/1979 5. 109 by East Carolina.................................... 1/29/1979 6. 105 by Providence ..................................... 12/21/1994 7. 103 by Concordia (MN)................................. 3/18/1988 103 by UNC Chapel Hill .............................. 11/30/2006 9. 102 by Winthrop ...........................................1/27/1979 102 by North Carolina Wesleyan......................2/9/1981 MOST POINTS ALLOWED (DIVISION I ERA) 1. 119 by Kent State ...................................... 12/29/1993 2. 105 by Providence ..................................... 12/21/1994 3. 103 by UNC Chapel Hill .............................. 11/30/2006 4. 98 by Duke ................................................ 11/24/1996 98 by Arizona ............................................... 12/4/2004 6. 97 by Wake Forest........................................ 12/6/1995 7. 94 by Alabama............................................. 3/13/1998 8. 93 by College of Charleston............................ 2/2/1992 9. 92 by Davidson ............................................ 2/27/1999 10. 91 by Appalachian State ............................ 1/20/1993 FEWEST POINTS ALLOWED 1. 21 by Wake Forest.........................................3/10/1970 21 by Bennett College .................................. 2/29/1972 3. 22 by Averett College ................................. 12/14/1985 4. 24 by Livingston........................................... 2/15/1972 5. 26 by Wake Forest...........................................2/3/1970 26 by High Point........................................... 1/19/1973 7. 29 by Catawba ................................................1/6/1972 8. 30 by Averett College ......................................2/8/1972 9. 31 by Averett College ....................................1/11/1972

FEWEST POINTS ALLOWED (DIVISION I ERA) 1. 35 by Elon.................................................... 1/21/2006 2. 38 by North Carolina A&T............................. 1/19/2000 3. 39 by Maryland-Eastern Shore ................... 11/25/1995 4. 40 by Elon.................................................... 1/20/2007 5. 41 by UNC Asheville ..................................... 2/11/1993 41 by College of Charleston.......................... 1/29/2000 41 by Appalachian State .............................. 1/25/2005 8. 42 by Davidson .............................................. 1/6/2001 42 by South Carolina State .............................1/4/1997 10. 43 by Wofford .............................................. 2/8/2003 LARGEST MARGIN OF VICTORY 1. 100 (139-39) vs. Averett College.................. 2/23/1988 2. 84 (120-36) at Averett College..................... 1/16/1988 3. 82 (104-22) vs. Averett College.................. 12/14/1985 4. 78 (116-38) vs. Averett College .................... 12/1/1984 5. 74 (125-51) vs. Averett College ...................... 2/8/1988 6. 68 (110-42) vs. Methodist College ............... 12/2/1981 7. 65 (116-51) vs. Methodist College................ 12/3/1983 65 (103-38) vs. Methodist College................ 2/15/1983 9. 63 (122-59) at Averett College..................... 1/10/1985 10. 62 (102-40) vs. Greensboro College........... 12/1/1982 LARGEST MARGIN OF VICTORY (DIVISION I ERA) 1. 57 (99-42) vs. South Carolina State ................1/4/1997 2. 48 (88-40) vs. Elon ...................................... 1/20/2007 3. 43 (88-45) at North Carolina A&T................. 1/16/2002 4. 41 (103-62) vs. Radford............................... 1/13/1997 5. 39 (80-41) at UNC Asheville ......................... 2/11/1993 39 (96-57) vs. Winthrop ............................... 1/20/1996 39 (81-42) vs. Davidson................................. 1/6/2001 8. 38 (104-66) vs. Coastal Carolina ..................1/11/1997 9. 37 (76-39) vs. Maryland-Eastern Shore ...... 11/25/1995 37 (95-58) vs. Wofford................................. 2/21/1999 FIELD GOALS MADE 1. 63 vs. Averett College................................... 2/23/1988 2. 54 vs. Averett College..................................... 2/8/1988 3. 51 vs. North Carolina Wesleyan .................... 2/20/1988 4. 50 vs. Averett College................................... 12/1/1984 50 vs. North Carolina Wesleyan.................... 2/16/1985 50 vs. Averett College................................... 2/24/1987 7. 46 vs. Averett College................................. 12/14/1985 8. 49 at Averett College.................................... 1/10/1985 49 at Averett College.................................... 1/16/1988 10. 48 at Averett College.................................. 2/20/1987 FIELD GOALS MADE (DIVISION I ERA) 1. 39 vs. Coastal Carolina ................................ 12/7/1991 39 vs. East Tennessee State ......................... 2/16/2002 3. 38 vs. Coastal Carolina .................................. 2/1/1993 38 at Campbell............................................ 2/13/1993 38 vs. Winthrop............................................ 1/20/1996 6. 37 vs. Appalachian State ............................. 12/4/1991 37 at UNC Wilmington.................................... 1/6/1992 37 at UNC Asheville...................................... 1/16/1992 37 vs. Coastal Carolina .................................1/11/1997 37 vs. Charleston Southern .......................... 1/25/1997 FIELD GOALS ATTEMPTED 1. 103 vs. Averett College................................. 2/23/1988 2. 100 vs. Averett College................................. 2/24/1987 3. 100 at Averett College.................................. 1/16/1988 4. 96 vs. Averett College................................... 12/1/1984 96 vs. Averett College..................................... 2/8/1988 6. 94 at Averett College.................................... 2/20/1987 7. 86 vs. North Carolina Wesleyan .................... 2/16/1985 8. 85 vs. Methodist College................................ 2/4/1987 9. 83 vs. Averett College................................. 12/14/1985 83 at St. Andrews College .............................. 2/2/1987 FIELD GOALS ATTEMPTED (DIVISION I ERA) 1. 82 vs. East Tennessee State ......................... 1/20/2001 2. 79 vs. Wofford ............................................... 1/9/2001 79 vs. Wofford ............................................... 2/5/2001 4. 77 vs. Fairleigh Dickinson........................... 12/29/1997 5. 76 vs. Radford ............................................. 1/13/1997 76 vs. Wofford.............................................. 2/26/1999 76 vs. East Tennessee State ......................... 2/16/2002

75 at Radford....................................................2/4/1997 75 at Elon ........................................................ 2/1/2005 75 at High Point ........................................... 11/29/2005 FIELD GOAL PERCENTAGE 1..719 (41-57) vs. UNC Asheville ...................... 2/11/1994 2. .660 (33-50) vs. Virginia Wesleyan............... 2/27/1988 3. .642 (43-67) vs. St. Andrews College ............. 1/8/1987 4. .623 (43-69) at North Carolina Wesleyan ..... 2/26/1988 5. .623 (38-61) at Campbell ............................ 2/13/1993 6. .622 (51-82) vs. North Carolina Wesleyan .... 2/20/1988 7. .620 (31-50) at Western Carolina ................. 12/4/1999 8. .612 (63-103) vs. Averett College................. 2/23/1988 .612 (41-67) at Wofford ..................................2/9/1991 10. .611 (33-54) vs. Coastal Carolina................. 3/4/1994 FIELD GOAL PERCENTAGE (DIVISION I ERA) 1. .623 (38-61) at Campbell ............................ 2/13/1993 2. .620 (31-50) at Western Carolina................. 12/4/1999 3. .611 (33-54) vs. Coastal Carolina................... 3/4/1994 4. .608 (31-51) vs. Wofford ................................ 2/8/2003 5. .604 (32-53) vs. Charleston Southern .......... 2/26/1993 6. .603 (38-63) vs. Coastal Carolina .................. 2/1/1993 .603 (38-63) vs. Winthrop............................ 1/20/1996 8. .600 (36-60) vs. Georgia Southern ............... 2/20/1999 9. .597 (28-47) vs. Towson............................... 1/22/1994 10. .595 (22-37) vs. Appalachian State...............1/2/1997 3-PT FIELD GOALS MADE 1. 12 vs. Illinois.............................................. 11/24/1995 12 vs. Radford ............................................. 1/13/1997 3. 11 at Radford..................................................2/4/1997 4. 10 at Georgia Southern .................................. 1/7/1998 10 at Marshall ........................................... 12/19/1999 10 vs. Appalachian State ............................... 3/3/2000 10 vs. Appalachian State ............................. 1/30/2001 8. 9, Five times FREE THROWS MADE 1. 37 at Elon .................................................... 12/2/1998 37 vs. Davidson.............................................. 1/9/1999 3. 34 vs. Hartford........................................... 12/30/1995 34 at UNC Asheville ......................................1/16/1997 5. 33 vs. College of Charleston........................... 2/9/2004 6. 32 vs. South Carolina State.............................1/4/1997 7. 31 vs. Greensboro College ............................ 12/9/1997 31 vs. Towson............................................... 3/12/1993 9. 29 at North Carolina Central .......................... 2/1/1990 FREE THROWS MADE (DIVISION I ERA) 1. 37 at Elon .................................................... 12/2/1998 37 vs. Davidson.............................................. 1/9/1999 3. 34 vs. Hartford........................................... 12/30/1995 34 at UNC Asheville ......................................1/16/1997 5. 33 vs. College of Charleston........................... 2/9/2004 6. 32 vs. South Carolina State.............................1/4/1997 7. 31 vs. Greensboro College ............................ 12/9/1997 31 vs. Towson............................................... 3/12/1993 9. 29 vs. Charlotte ......................................... 11/20/2000 10. 28 at Coastal Carolina ..................................2/8/1997 FREE THROWS ATTEMPTED 1. 55 vs. Hartford........................................... 12/30/1995 2. 50 at Elon .................................................... 12/2/1998 3. 48 at UNC Asheville ......................................1/16/1997 4. 47 vs. UNC Asheville................................... 11/18/1998 47 vs. Davidson.............................................. 1/9/1999 6. 44 vs. South Carolina State.............................1/4/1997 7. 42 at Wofford.............................................12/30/2004 8. 41 at Charlotte............................................. 12/2/1995 9. 40 vs. St. Augustine’s..................................... 2/6/1990 10. 39 at UMBC............................................... 1/11/1988 FREE THROWS ATTEMPTED (DIVISION I ERA) 1. 55 vs. Hartford........................................... 12/30/1995 2. 50 at Elon .................................................... 12/2/1998 3. 48 at UNC Asheville ......................................1/16/1997 4. 47 vs. UNC Asheville................................... 11/18/1998 5. 47 vs. Davidson.............................................. 1/9/1999 6. 44 vs. South Carolina State.............................1/4/1997 7. 42 at Wofford.............................................12/30/2004 8. 41 at Charlotte............................................. 12/2/1995

2007-08 UNCG Women’s Basketball Media Guide • 77

Spartan Record Book

MOST POINTS SCORED (DIVISION I ERA) 1. 104 vs. Coastal Carolina ...............................1/11/1997 2. 103 vs. Radford ........................................... 1/13/1997 3. 101 at Radford................................................2/4/1997 4. 100 vs. Providence (LL 105-100) ................. 12/21/1994 5. 99 vs. South Carolina State.............................1/4/1997 6. 96 at UNC Wilmington.................................... 1/6/1992 96 vs. Winthrop............................................ 1/20/1996 8. 95 vs. Georgia Southern............................... 2/20/1999 95 vs. Wofford ............................................. 2/21/1999 10. 94 vs. Radford ............................................. 2/7/1996

10. 31 by Western Carolina .................................2/9/1973

UNCGSpartans.com • UNCGSpartans.com • UNCG

Top 10 Single Game Performances - Team


CGSpartans.com • UNCGSpartans.com • UNCG

Spartan Record Book

Top 10 Single Game Performances - Team 9. 39 vs. Towson ............................................ 11/28/1998 10. 39 vs. College of Charleston......................... 2/9/2004 FREE THROW PERCENTAGE (min. 10 attempts) 1. 1.000 (13-13) vs. Liberty ............................. 1/23/1992 .1.000 (11-11) vs. Campbell ......................... 1/29/1992 3. .939 (31-33) vs. Greensboro ........................ 12/9/1987 4. .917 (11-121) vs. Centre College .................... 3/6/1987 5. .913 (21-23) vs. UNC Wilmington ................. 12/7/1989 6. .913 (21-23) vs. Radford.............................. 2/29/1996 7. .909 (10-11) at St. Andrews............................ 2/9/1983 8. .900 (9-10) at Appalachian State................... 2/7/1998 9. .894 (17-19) vs. Virginia Wesleyan ................1/17/1986 10. .889 (24-27) vs. Holy Cross .......................... 1/1/1995 FREE THROW PERCENTAGE (min. 10 attempts) - DIV. I ERA 1.1.000 (13-13) vs. Liberty .............................. 1/23/1992 1.000 (11-11) vs. Campbell .......................... 1/29/1992 2. .913 (21-23) vs. Radford.............................. 2/29/1996 3. .900 (9-10) at Appalachian State................... 2/7/1998 4. .889 (24-27) vs. Holy Cross ............................ 1/1/1995 5. .889 (16-18) vs. Davidson............................ 2/15/2005 6. .882 (30-34) vs. Charleston Southern .......... 2/24/1996 7. .882 (15-17) vs. Winthrop............................... 3/8/1996 8. .880 (22-25) at Appalachian State................. 2/5/2000 .880 (22-25) vs. Davidson ............................ 2/12/2000 REBOUNDS 1. 71 vs. Guilford............................................ 11/22/1985 2. 62 vs. Towson .............................................. 1/22/1995 3. 60 at Coastal Carolina ................................... 2/1/1993 60 vs. Davidson ........................................... 12/4/1994 60 vs. Georgia Southern................................. 1/8/2005 6. 58 vs. Radford ............................................... 2/7/1996 58 at Radford .............................................. 2/26/1996 58 vs. North Carolina A&T ............................ 1/16/2002 9. 57 vs. Davidson.............................................. 1/6/2001 57 at Wofford............................................... 2/10/2001

22 at Mary Washington................................. 1/10/1987 9. 21 vs. Averett ............................................... 2/19/1985 21 at Virginia Wesleyan ................................ 1/24/1987 STEALS (DIVISION I ERA) 1. 27 vs. UNC Wilmington............................... 11/12/2006 2. 25 vs. College of Charleston....................... 12/29/1999 3. 21 vs. Chattanooga...................................... 1/16/1999 21 vs. North Carolina A&T ............................. 1/16/2002 5. 20 at Wofford............................................... 2/12/1999 6. 20 at Furman ................................................. 1/2/2005 7. 19 at UNC Asheville...................................... 2/11/1993 19 vs. Maryland-Eastern Shore ................... 11/25/1995 19 at Georgia Southern................................. 1/15/2001 19 vs. Appalachian State .............................. 1/30/2001 BLOCKS 1. 9 vs. Greensboro College.............................. 1/31/1986 9 vs. Wofford................................................ 2/16/1998 9 vs. Wofford................................................ 1/24/2006 4. 8 at Western Carolina................................. 11/25/1991 8 at Wofford..................................................1/17/1998 8 vs. Chattanooga........................................ 1/13/2001 8 at Davidson................................................. 2/4/2003 8 vs. Georgia Southern................................... 1/8/2007 9. 7 at Christopher Newport ............................. 1/25/1987 10. 7 at Averett ................................................ 1/16/1988 BLOCKS (DIVISION I ERA) 1. 9 vs. Wofford................................................ 2/16/1998 9 vs. Wofford................................................ 1/24/2006 9 vs. Georgia Southern .................................. 1/8/2007 4. 8 at Western Carolina................................. 11/25/1991 8 at Wofford..................................................1/17/1998 8 vs. Chattanooga........................................ 1/13/2001 8 at Davidson................................................. 2/4/2003 8. 7 at Winthrop............................................... 2/24/1992 7 vs. Radford ................................................. 1/4/1995 7 vs. Appalachian State ............................. 12/19/2001

Ruby Smith

REBOUNDS (DIVISION I ERA) 1. 62 vs. Towson .............................................. 1/22/1995 2. 60 at Coastal Carolina ................................... 2/1/1993 60 vs. Davidson ........................................... 12/4/1994 60 vs. Georgia Southern................................. 1/8/2005 5. 58 vs. Radford ............................................... 2/7/1996 58 at Radford .............................................. 2/26/1996 58 vs. North Carolina A&T ............................ 1/16/2002 8. 57 vs. Davidson.............................................. 1/6/2001 57 at Wofford............................................... 2/10/2001 57 vs. College of Charleston ........................... 3/1/2002 ASSISTS 1. 32 vs. Averett ............................................... 2/24/1987 2. 31 vs. Averett ............................................. 12/14/1985 3. 30 at Christopher Newport ........................... 2/28/1987 30 vs. Winthrop.............................................2/17/1993 30 vs. College of Charleston....................... 12/29/2000 6. 29 vs. Christopher Newport .......................... 2/23/1985 29 vs. Averett............................................... 2/23/1988 29 vs. UNC Asheville .................................... 2/20/1992 9. 28 vs. St. Andrews........................................ 2/14/1984 28 vs. Greensboro College ........................... 2/22/1985 ASSISTS (DIVISION I ERA) 1. 30 vs. Winthrop.............................................2/17/1993 30 vs. College of Charleston....................... 12/29/2000 3. 29 vs. UNC Asheville .................................... 2/20/1992 4. 28 at Coastal Carolina ................................... 2/1/1993 28 at Campbell............................................ 2/13/1993 28 vs. Fairleigh Dickinson .......................... 11/29/1997 28 at Furman ................................................. 2/9/1998 8. 27 vs. Liberty ............................................... 1/23/1992 27 vs. Campbell ........................................... 1/29/1992 10. 26 at Winthrop........................................... 2/24/1992 STEALS 1. 27 vs. UNC Wilmington............................... 11/12/2006 2. 25 vs. Averett................................................1/17/1987 25 vs. College of Charleston........................ 12/29/1999 4. 23 vs. St. Andrews.......................................... 1/4/1986 23 vs. Christopher Newport .......................... 1/23/1988 6. 22 vs. Averett............................................... 1/13/1984 7. 22 vs. Averett ............................................. 12/14/1985

78 • 2007-08 UNCG Women’s Basketball Media Guide

Alisa Moore

Biz Brediger


FIELD GOALS MADE Year Player 2006-07 Jasmine Byrd 2005-06 Irene Otamiri 2004-05 Jasmine Byrd 2003-04 Jacinda Lambert 2002-03 Jacinda Lambert 2001-02 Jacinda Lambert 2000-01 Brianne Dodgen 1999-00 Brianne Dodgen 1998-99 Melinda Goodson 1997-98 Biz Brediger 1996-97 Melinda Goodson 1995-96 Alisa Moore 1994-95 Alisa Moore 1993-94 Vickie Henson 1992-93 Vickie Henson 1991-92 Kymm Elliott 1990-91 Shannon Young 1989-90 Donna Snead 1988-89 Angie Polk 1987-88 Angie Polk 1986-87 Angie Polk 1985-86 Natalie Conner 1984-85 Wendy Engelmann 1983-84 Wendy Engelmann 1982-83 Michele Blazevich 1981-82 Carol Peschel 1980-81 Jody Mangus 1979-80 Jody Mangus

Pts. 450 332 298 379 334 391 354 422 139 497 470 456 373 480 479 488 379 442 338 354 554 447 412 472 425 413 478 342 415 414 344 369 264 418 292 275 362 346 161

Avg. 15.0 12.8 10.6 13.5 12.4 12.6 11.8 14.6 15.4 17.8 15.7 15.7 14.3 15.5 16.5 16.8 14.0 14.7 13.5 14.8 16.8 14.9 14.7 16.9 14.7 14.8 17.1 14.9 18.9 21.8 15.6 19.4 13.9 22.0 18.3 16.2 17.2 17.3 14.6

FGs 160 106 90 137 133 162 127 147 178 196 168 142 184 187 199 153 172 129 154 230 191 183 216 184 182 220 138 173

FIELD GOAL PERCENTAGE (min. 100 FGA) Year Player FGA-FGM Pct. 2006-07 Jasmine Byrd 160-392. 408 2005-06 KaLeah Latham 93-190 .489 2004-05 Ashley Current 65-134 .485 2003-04 Megan Honeycutt 54-108 .500 2002-03 Lindsey Reed 92-185 .497 2001-02 Jennifer Hart 81-136 .596 2000-01 Jessica Williams 96-198 .485 Sandi Reid 63-130 .485 1999-00 Melinda Goodson 56-111 .505 1998-99 Melinda Goodson 178-351 .507 1997-98 Biz Brediger 196-344 .570 1996-97 Melinda Goodson 168-298 .564 1995-96 Alisa Moore 142-252 .563 1994-95 Alisa Moore 184-302 .609

1993-94 1992-93 1991-92 1990-91 1989-90 1988-89 1987-88 1986-87 1985-86 1984-85 1983-84 1982-83 1981-82 1980-81 1979-80

Vickie Henson Vickie Henson Jana Henderson Julie Bright Jana Henderson Julie Bright Chris Holec Angie Polk Ruby Smith Renee Coltrane Shawne Frazier Renee Coltrane Michele Blazevich Sue Reep Sandra Lemon

187-317 199-339 122-188 125-234 74-131 67-114 163-259 191-344 163-318 172-325 118-201 107-197 147-246 77-187 163-293

3-POINT FIELD GOALS MADE Year Player 2006-07 Jasmine Byrd 2005-06 Jasmine Byrd 2004-05 Amanda Eaton 2003-04 Amanda Eaton 2002-03 Amanda Eaton 2001-02 Amanda Eaton 2000-01 ChoRhonda Gwaltney 1999-00 Belinda Goodson 1998-99 ChoRhonda Gwaltney 1997-98 Sam Ferguson 1996-97 Sam Ferguson 1995-96 Sam Ferguson 1994-95 Jai Cole 1993-94 Jo Zerger 1992-93 Mickey Haywood 1991-92 Gail White 1990-91 Gail White 1989-90 Stephanie Johnson Beth Durrill 1988-89 Beth Durrill 1987-88 Stephanie Johnson 3-PT FIELD GOAL PCT (min. 50 3FGA) Year Player 3FGA-FGM 2006-07 Jasmine Byrd 77-208 2005-06 Kemena Brooks 22-64 2004-05 Amanda Eaton 41-137 2003-04 Amanda Eaton 51-161 2002-03 Amanda Eaton 48-135 2001-02 Amanda Eaton 29-84 2000-01 ChoRhonda Gwaltney 42-112 1999-00 Brianne Dodgen 26-58. 1998-99 Katie DelCampo 23-57 1997-98 Rebecca Viverette 33-83 1996-97 Sadie Ochs 29-69 1995-96 Sam Ferguson 65-163 1994-95 Sadie Ochs 28-74 1993-94 NO ONE QUALIFIED (Jo Zergerr 18-42, .429) 1992-93 Mickey Haywood 39-94 1991-92 NO ONE QUALIFIED (Gail White 18-44, .409) 1990-91 Gail White 28-51 1989-90 Stephanie Johnson 22-54 1988-89 Beth Durrill 26-71 1987-88 Stephanie Johnson 25-91 FREE THROWS MADE Year Player 2006-07 Kristen Boone 2005-06 Kristen Boone 2004-05 Kristen Boone 2003-04 Jacinda Lambert 2002-03 Nicole Murray 2001-02 Brianne Dodgen 2000-01 ChoRhonda Gwaltney 1999-00 Brianne Dodgen 1998-99 Melinda Goodson 1997-98 Melinda Goodson 1996-97 Melinda Goodson 1995-96 Alisa Moore 1994-95 Alisa Moore 1993-94 Vickie Henson 1992-93 Vickie Henson 1991-92 Kymm Elliott 1990-91 Gail White 1989-90 Donna Snead 1988-89 Kathleen Tompkins 1987-88 Angie Polk 1986-87 Angie Polk 1985-86 Lisa Seidel

.590 .587 .649 .534 .565 .588 .629 .555 .513 .529 .587 .543 .598 .412 .556

3-FGs 77 49 41 51 48 29 42 57 33 37 33 65 34 18 39 18 28 22 22 26 25

Pct. .370 .344 .299 .317 .356 .345 .375 448 .404 .398 .420 .399 .378

.415

.549 .407 .366 .275

FTs 90 117 102 87 66 83 85 102 138 102 120 89 112 105 90 73 109 80 57 94 65 71

1984-85 1983-84 1982-83 1981-82 1980-81 1979-80

Renee Coltrane Renee Coltrane Renee Coltrane Renee Coltrane Jody Mangus Jody Mangus

113 86 57 46 66 69

FREE THROW PERCENTAGE (min. 50 FTA) Year Player FTA-FTM 2006-07 Jasmine Byrd 53-62 2005-06 Kristen Boone 117-147 2004-05 Jasmine Byrd 81-99 2003-04 Amanda Eaton 61-71 2002-03 Nicole Murray 66-86 Amanda Eaton 46-60 2001-02 Brianne Dodgen 83-109 2000-01 Samika Foster 53-69 1999-00 Sandi Reid 52-67 1998-99 Melinda Goodson 138-190 1997-98 Rebecca Viverette 100-114 1996-97 Rebecca Viverette 67-93 1995-96 Sadie Ochs 72-102 1994-95 Serena King 50-59 1993-94 Serena King 45-58 1992-93 Micky Haywood 64-81 1991-92 Gail White 72-89 1990-91 Gail White 109-137 1989-90 Tracey Young 50-59 1988-89 Karen Jordan 42-56 1987-88 Denise Mannon 53-64 1986-87 Natalie Connor 47-59 1985-86 Natalie Connor 46-58 1984-85 Wendy Engelmann 40-57 1983-84 Wendy Engelmann 57-73 1982-83 Wendy Engelmann 40-54 1981-82 Jody Mangus 35-53 1980-81 Jody Mangus 66-87

Pct. .855 .796 .818 .859 .767 .767 .761 .768 .776 .726 .877 .720 .706 .847 .776 .790 .809 .796 .848 .750 .828 .797 .793 .740 .781 .741 .660

1979-80 Marie Crawley

45-62

REBOUNDS / REBOUNDING AVERAGE Year Player G Reb 2006-07 KaLeah Latham 30 215 2005-06 KaLeah Latham 30 184 2004-05 KaLeah Latham 26 144 2003-04 Lindsey Reed 28 170 2002-03 Lindsey Reed 27 165 2001-02 Sandi Reid 31 197 2000-01 Brianne Dodgen 30 197 1999-00 Sandi Reid 27 173 1998-99 Melinda Goodson 28 195 1997-98 Melinda Goodson 28 202 1996-97 Melinda Goodson 29 235 1995-96 Alisa Moore 26 227 1994-95 Julie Moore 31 256 1993-94 Vickie Henson 29 213 1992-93 Vickie Henson 29 211 1991-92 Kymm Elliott 27 182 1990-91 Shannon Young 30 265 1989-90 Julie Bright 25 178 1988-89 Angie Polk 24 191 1987-88 Angie Polk 33 285 1986-87 Angie Polk 30 289 1985-86 Angie Polk 28 237 1984-85 Renee Coltrane 28 379 1983-84 Renee Coltrane 29 367 1982-83 Renee Coltrane 28 280 1981-82 Carol Peschel 28 214 1980-81 Jody Mangus 23 185 1979-80 Sandra Lemon 22 293 ASSISTS Year 2006-07 2005-06 2004-05 2003-04 2002-03 2001-02 2000-01 1999-00 1998-99 1997-98 1996-97 1995-96 1994-95 1993-94 1992-93 1991-92

Player Kristen Boone Kristen Boone Kristen Boone Amanda Eaton Nicole Murray Samika Foster ChoRhonda Gwaltney Samika Foster ChoRhonda Gwaltney Katrina Smith Jai Cole Sam Ferguson Jai Cole Cescili Drake Mickey Haywood Jo Zerger Jo Zerger

G 30 26 28 28 27 31 30 29 28 28 29 26 31 29 29 26 27

.759 .726

Avg. 7.2 6.1 5.5 6.1 6.1 6.4 6.6 6.4 7.0 7.2 8.1 8.7 8.3 7.3 7.3 6.7 8.8 7.1 8.0 8.6 9.6 8.5 13.5 12.7 10.0 7.6 8.0 13.3

Ast 121 122 77 76 84 110 110 120 110 121 91 97 148 120 114 114 122

1990-91 1989-90 1988-89 1987-88 1986-87 1985-86 1984-85 1983-84 1982-83 1981-82 1980-81 1979-80 STEALS Year 2006-07 2005-06 2004-05 2003-04 2002-03 2001-02 2000-01 1999-00 1998-99 1997-98 1996-97 1995-96 1994-95 1993-94 1992-93 1991-92 1990-91 1989-90 1988-89 1987-88 1986-87 1985-86 1984-85 1983-84 1982-83 1981-82 1980-81 1979-80

Gail White Stephanie Johnson Stephanie Johnson Stephanie Johnson Ruby Smith Ruby Smith Wendy Engelmann Wendy Engelmann Brenda Tolbert Wendy Engelmann Marie Cawley not available

30 24 24 33 30 28 28 29 28 28 20

Player Kristen Boone Kristen Boone Kristen Boone Jasmine Byrd Nicole Murray Samika Foster Samika Foster Samika Foster Samika Foster ChoRhonda Gwaltney Melinda Goodson Sam Ferguson Alisa Moore Cescili Drake Tina Wilson Jo Zerger Tina Wilson Shannon Young Stephanie Johnson Stephanie Johnson Stephanie Johnson Angie Polk Not Available Not Available Not Available Not Available Not Available Jackie Maffucci Not Available

BLOCKED SHOTS Year Player

2006-07 2005-06 2004-05 2003-04 2002-03 2001-02 2000-01 1999-00 1998-99 1997-98 1996-97 1995-96 1994-95 1993-94 1992-93 1991-92 1990-91 1989-90 1988-89 1987-88 1986-87 1985-86 1984-85 1983-84 1982-83 1981-82 1980-81 1979-80

Brittany Frazier Meghan Chamberlain Meghan Chamberlain Lindsey Reed Lindsey Reed Kellan Law Sandi Reid Sandi Reid Sandi Reid Katie DelCampo Rebecca Viverette Rebecca Viverette Rebecca Viverette Alisa Moore Alisa Moore Julie Moore Kristin Lavelle Shannon Young Jana Henderson Angie Polk Chris Holec Angie Polk Not Available Not Available Not Available Not Available Not Available Sue Reep Not Available

85 112 105 146 153 144 134 170 139 140 54

G 30 26 28 28 27 31 30 29 28 29 29 26 31 29 29 27 27 30 24 24 33 30

Stl 87 101 121 59 68 55 74 78 72 59 62 58 50 42 79 49 49 48 55 56 83 91

23

39

G Blk 30 28 30 35 27 21 28 23 27 24 27 24 31 15 27 30 27 20 28 9 30 49 29 43 27 27 31 22 29 16 29 10 25 10 30 13 25 11 24 9 32 7 30 29

23

17

2007-08 UNCG Women’s Basketball Media Guide • 79

Spartan Record Book

SCORING AVERAGE Year Player G 2006-07 Jasmine Byrd 30 2005-06 Kristen Boone 26 2004-05 Jasmine Byrd 28 2003-04 Jacinda Lambert 28 2002-03 Jacinda Lambert 27 2001-02 Jacinda Lambert 31 2000-01 Brianne Dodgen 30 1999-00 Brianne Dodgen 29 NOTE: Melinda Goodson 9 1998-99 Melinda Goodson 28 1997-98 Biz Brediger 30 1996-97 Melinda Goodson 29 1995-96 Alisa Moore 26 1994-95 Alisa Moore 31 1993-94 Vickie Henson 29 1992-93 Vickie Henson 29 1991-92 Kymm Elliott 27 1990-91 Shannon Young 30 1989-90 Donna Snead 25 1988-89 Angie Polk 24 1987-88 Angie Polk 33 1986-87 Angie Polk 30 1985-86 Natalie Connor 28 1984-85 Wendy Engelmann 28 1983-84 Wendy Engelmann 29 1982-83 Michele Blazevich 28 1981-82 Carol Peschel 28 1980-81 Jody Mangus 23 1979-80 Jody Mangus 22 1978-79 Anna Parker 19 1977-78 Cathy Strange 22 1976-77 Cathy Strange 19 1975-76 Cathy Strange 19 1974-75 Rita Wiggs 19 1973-74 Rita Wiggs 16 1972-73 Rita Wiggs 17 1971-72 Rita Wiggs 21 1970-71 Mary Lida Alexander 20 1969-70 Mary Lida Alexander 11

UNCGSpartans.com • UNCGSpartans.com • UNCG

Year-By-Year Statistical Leaders


UNCG All-Time Honors Divison I (1991-Present) NCAA TOURNAMENTT APPEARANCE.................................1998 NIT TOURNAMENT APPEARANCE.....................................2002 SOCON CHAMPIONSHIPS Tournament .....................................................................1998 Regular Season........................................... 1998, 1999, 2002 BIG SOUTH CHAMPIONSHIPS Regular Season.......................1993, 1994, 1995, 1996, 1997 TOURNAMENTT CHAMPIONSHIPS Cornell Tournament..........................................................1991 South Florida Tournament ................................................1992 UNCG Classic........................ ..1992, 1995, 1998, 2002, 2003 UNCG Thanksgiving Tournament.......................................2007 SOCON FRESHMAN OF THE YEAR 2004-05 ............................................................Kristen Boone

All-Time Honors

PRE-SEASON SOCON PLAYER OF THE YEAR 2002-03.........................................................Jacinda Lambert ALL-SOCON MEDIA A ASSOCIATION TEAM 2000-01.................................ChoRhonda Gwaltney, First Team ......................................... ........Brianne Dodgen, Second Team 2001-02........................................Jacinda Lambert, First Team ............................................. ....Brianne Dodgen, Second Team ....................................................Samika Foster, Second Team 2003-04 ............................... ...Jacinda Lambert, Second Team 2005-06............................................Kristen Boone, First Team 2006-07............................................Kristen Boone, First Team .................................................... ..Jasmine Byrd, Second Team ALL-SOUTHERN CONFERENCE 1997-98...............................................Biz Brediger, First Team ....................................................Rebecca Viverette, First Team 1998-99......................................Melinda Goodson, First Team ......................................... ChoRhonda Gwaltney, Second Team 1999-00............................... .ChoRhonda Gwaltney, First Team

2000-01.........................................Brianne Dodgen, First Team .............................................. ChoRhonda Gwaltney, First Team 2001-02....................................... Jacinda Lambert, First Team ......................................................Samika Foster, First Team 2003-04 ...................................... Jacinda Lambert, First Team 2005-06.......................................... .Kristen Boone, First Team 2006-07.......................................... .Kristen Boone, First Team ..................................................... Jasmine Byrd, Second Team ALL-SOCON FRESHMAN TEAM 2003-04 .............................................................Jasmine Byrd 2004-05 .......................................................... ..Kristen Boone ALL-SOCON TOURNAMENTT TEAM 1997-98...............................................Biz Brediger, First Team .................................................... Melinda Goodson, First Team .............................................. .Rebecca Viverette, Second Team 1998-99......................................Melinda Goodson, First Team 1999-00.........................................Brianne Dodgen, First Team ............................................. .ChoRhonda Gwaltney, First Team .................................................... Samika Foster, Second Team 2000-01............................... .ChoRhonda Gwaltney, First Team .................................................Brianne Dodgen, Second Team .................................................. ..Samika Foster, Second Team ..........................................................Sandi Reid, Second Team 2001-02........................................Brianne Dodgen, First Team .................................................... .Jacinda Lambert, First Team .........................................................Sandi Reid, Second Team 2005-06............................................Kristen Boone, First Team .......................................................... .Irene Otamiri, First Team ................................................. .KaLeah Latham, Second Team 2006-07................................... ...Kristen Boone, Second Team SOCON TOURNAMENTT MVP 1999-00......................................................... Brianne Dodgen 2000-01.................................................. ChoRhonda Gwaltney SOCON COACH OF THE YEAR 1998-99, 2001-02.................................................Lynne Agee

BIG SOUTH PLAYER OF THE YEAR 1993-94.............................................................Vickie Henson ALL-BIG SOUTH 1992-93.......................................... .Vickie Henson, First Team ALL-BIG SOUTH 1992-93...........................................Vickie Henson, First Team ..................................................Micky Haywood, Second Team 1993-94...........................................Vickie Henson, First Team 1994-95..........................................Alisa Moore, Second Team ........................................................Julie Moore, Second Team 1995-96...............................................Alisa Moore, First Team .........................................................Julie Moore, Second Team 1996-97...................................... Melinda Goodson, First Team ALL-BIG SOUTH ROOKIE TEAM 1993-94............................................................... Serena King 1995-96............................................................Sam Ferguson 1996-97.......................................................Melinda Goodson BIG SOUTH COACH OF THE YEAR 1992-93............................................................... .Lynne Agee ALL-BIG SOUTH TOURNAMENTT TEAM 1992-93...........................................................Micky Haywood ...........................................................................Vickie Henson 1993-94.............................................................Vickie Henson ............................................................................. Alisa Moore 1994-95......................................................................Jai Cole ............................................................................. Alisa Moore 1996-97...................................................... .Melinda Goodson BIG SOUTH TOURNAMENTT MVP 1994-95............................................................... Alisa Moore ALL-BIG SOUTH ACADEMIC TEAM 1996-97............................................................ Jennifer Lewis

Pre-NCAA A (1969-81), Division III (1981-89), Division II (1989-91) AIAW TOURNAMENTT APPEARANCE 1972 NCAA DIVISION III TOURNAMENTT APPEARANCES 1982, 1983, 1984, 1985, 1986, 1987, 1988 NCAA DIVISION II TOURNAMENTT APPEARANCES 1991 DIXIE CONFERENCE CHAMPIONSHIPS (DIVISION III) Tournament ................. 1982, 1983, 1984, 1985, 1987, 1988 Regular Season........... 1982, 1983, 1985, 1986, 1987, 1988 TOURNAMENTT CHAMPIONSHIP (AIAW) Winthrop Tournament......................................................1972 KODAK K ALL-AMERICANS (DIVISION III) 1982-83.................................... .Michele Blazevich, First Team 1983-84....................................... .Renee Coltrane, Third Team .................................................. Wendy Engelmann, Third Team 1987-88.................................................Angie Polk, First Team KODAK K ALL-REGION (DIVISION II) 1988-89............................................... ..Angie Polk, First Team AWSF ALL-AMERICANS (DIVISION III) 1981-82............................................Carol Peschel, First Team ............................................. Jody Mangus, Honorable Mention ALL-SOUTH (DIVISION III) 1982-83.......................................................Michele Blazevich 1983-84........................................................... Renee Coltrane .................................................................... Wendy Engelmann 1985-86..................................................................Angie Polk ..........................................................................Natalie Conner 1986-87.................................................................. Angie Polk 1987-88..................................................................Angie Polk

80 • 2007-08 UNCG Women’s Basketball Media Guide

ALL-DIXIE CONFERENCE (DIVISION III) 1981-82............................................. Jody Mangus, First Team ..........................................................Carol Peschel, First Team 1982-83.....................................Michele Blazevich, First Team ...................................................Renee Coltrane, Second Team .................................................... Sherry Sydney, Second Team 1983-84..........................................Renee Coltrane, First Team .................................................. Wendy Engelmann, First Team ...............................................Michele Blazevich, Second Team 1984-85..........................................Renee Coltrane, First Team .................................................. Wendy Engelmann, First Team 1985-86................................................Lisa Seidel, First Team ....................................................Natalie Conner, Second Team ........................................................ Ruby Smith, Second Team 1986-87......................................... Natalie Conner, First Team .............................................................Ruby Smith, First Team ..........................................................Angie Polk, Second Team 1987-88.................................................Angie Polk,First Team ........................................................ Chris Holec, Second Team ALL-DIXIE TOURNAMENTT TEAM (DIVISION III) 1982-83.......................................................Michele Blazevich ...........................................................................Marie Cawley ..........................................................................Brenda Tolbert ......................................................................... Jody Mangus ....................................................................... ....Carol Peschel 1983-84................................................... ...Michele Blazevich .........................................................................Renee Coltrane .............................................................. ......Wendy Engelmann ..........................................................................Brenda Tolbert 1984-85...........................................................Renee Coltrane ............................................................................. ..Lisa Seidel 1985-86.................................................................Ruby Smith 1986-87........................................................ ...Natalie Conner ............................................................................. ...Angie Polk ..............................................................................Julia Weaver

1987-88................................................ .....Stephanie Johnson ................................................................................Angie Polk DIXIE TOURNAMENTT MVP (DIVISION III) 1981-82..............................................................Carol Peschel 1982-83......................................................... .....Marie Cawley 1986-87.............................................................. ....Angie Polk DIXIE COACH OF THE YEAR (DIVISION III) 1981-82, 1985-86, 1986-87, 1987-88............... ...Lynne Agee


F

M

3 10 12 20 21 3 10 12

LYNCHBURG........ W 41-33 at Wake Forest .... W 34-26 HIGH POINT.......................... W 56-37 WINTHROP ........................... W 50-46 vs. Tennessee*..................... W 53-47 vs. East Tennessee State* .... L 37-39 at Lynchburg ........................ W 61-50 MARS HILL........................... W 45-40 WAKE FOREST ...................... W 50-21 at High Point ........................ W 41-37 WESTERN CAROLINA............ L 39-52

M

9 10 13 14 16 17 17 20 23 2

J

F

M

1973-74 Record: 9-7 Head Coach: Marilyn Gibbs

AVERETT............................... W 42-37 EAST CAROLINA ................... L 42-53 at Lynchburg ........................ W 55-52 at High Point ........................ L 32-47 WINTHROP ........................... W 40-35 at Averett ............................. W 53-49 at North Carolina.................. W 58-42 LYNCHBURG......................... W 58-35 vs. East Tennessee State* .... W 65-43 vs. South Carolina*.............. W 58-51 s. Western Carolina* ............ L 66-74 HIGH POINT.......................... W 42-36 vs. Western Carolina# .......... L 51-62 at Mars Hill .......................... L 44-57 NORTH CAROLINA ................ W 46-41 at Winthrop .......................... L 47-52 vs. Illinois State%................. W 63-39 vs. Kansas State%................ W 53-47 vs. Mississippi State%.......... L 43-66 vs. So. Connecticut St.%....... L 47-54

* Winthrop Tournament (Rock Hill, SC) # at Mars Hill, NC % National Invitational Women’s Intercollegiate Tournament, at Cullowhee, NC (4th) NIWIT Fourth Place 1971-72 Record: 17-4 Head Coach: June Galloway J F

M

6 11 1 3 8 10 15 16 18 19 19 22 25 26 29 3 4 4 7 10 10

CATAWBA............................. W 50-29 at Averett ............................. W 59-31 at North Carolina.................. W 52-38 WINTHROP ........................... L 45-57 AVERETT............................... W 53-30 at Duke ................................ W 55-41 LIVINGSTONE ....................... W 67-24 APPALACHIAN STATE ............ W 50-46 vs. East Tennessee State* .... W 79-50 vs. Appalachian State* ........ W 52-35 vs. Tennessee*..................... W 51-36 at East Carolina.................... L 47-48 WESTERN CAROLINA............ L 47-53 MARS HILL........................... W 57-47 BENNETT.............................. W 60-21 CAMPBELL........................... W 56-35 vs. Catawba# ....................... W 56-41 vs. Western Carolina# .......... W 57-52 DUKE ................................... W 40-36 South Carolina% .................. W 54-38 Tennessee-Martin%.............. L 50-54

J

F

J

F

13 19 23 25 30 1 3 6

at Longwood ........................ W 59-52 HIGH POINT.......................... W 52-26 at Winthrop .......................... W 52-40 NORTH CAROLINA ................ W 59-55 at Appalachian State............ W 62-57 at Catawba .......................... W 53-44 ELON ................................... W 57-51 EAST CAROLINA ................... L 55-69

LONGWOOD ......................... W 51-36 HIGH POINT.......................... W 58-44 at East Carolina.................... W 52-45 at North Carolina.................. L 44-54 WESTERN CAROLINA............ L 65-69 MARS HILL........................... W 61-47 at Elon ................................. L 59-72 APPALACHIAN STATE ............ W 53-52 WINTHROP ........................... W 55-38 at Wake Forest ..................... L 60-62 vs. Appalachian State* ........ L 51-59 vs. East Tennesseee State* .. W 60-54 vs. Western Carolina* .......... L 52-53 EAST CAROLINA# ................. W 63-50 ELON# ................................. L 50-64 NORTH CAROLINA# .............. W 66-64

* Winthrop Tournament (Rock Hill, SC) # NCAIAW Tournament (Greensboro, NC) 1974-75 Record: 8-11 Head Coach: Marilyn Gibbs J

F

18 21 23 24 28 31 1 4 7 8 11 14 14 15 18 20 22 24 27

at Longwood ........................ W 70-50 at High Point ........................ W 68-57 at Winthrop .......................... L 52-64 SOUTH CAROLINA ................ L 54-70 at Elon ................................. L 55-82 vs. South Carolina*.............. L 66-71 vs. East Carolina* ................ L 61-68 EAST CAROLINA ................... L 62-63 at Mars Hill .......................... L 52-57 vs. Western Carolina# .......... W 76-73 NORTH CAROLINA ................ L 57-71 vs. South Carolina% ............. W 86-84 vs. Winthrop% ...................... W 79-70 vs. College of Charleston% ... L 64-80 at Appalachian State............ W 76-70 ELON ................................... L 76-91 APPALACHIAN STATE ............ W 74-67 WAKE FOREST ...................... W 77-61 Western Carolina^ ............... L 66-82

* Elon Tournament (Elon College, NC) # at Mars Hill % at Winthrop Tournament (Rock Hill, SC) ^ NCAIAW Tournament (Boone, NC) 1975-76 Record: 4-15 Head Coach: Marilyn Gibbs D

* Winthrop Tournament (Rock Hill, SC) # at High Point, NC % AIAW Regionals (Boone, NC) 1972-73 Record: 14-4 Head Coach: Marilyn Gibbs

19 24 26 29 1 2 5 7 9 12 15 16 16 22 22 23

F

M

10 17 22 26 28 30 30 31 3 6 7 12 13 13 17 19 24 1 4

at High Point ........................ L 73-97 LONGWOOD ......................... L 57-75 NC STATE ............................. L 71-80 HIGH POINT.......................... L 72-97 APPALACHIAN STATE ............ L 54-68 vs. Radford* ........................ W 68-54 at Elon* ............................... W 71-60 vs. East Carolina* ................ L 57-69 at East Carolina.................... L 68-86 WESTERN CAROLINA............ L 60-82 MARS HILL........................... W 68-62 at Wake Forest ..................... L 67-69 vs. Tennessee#..................... W 81-79 vs. Appalachian State# ........ L 58-66 at North Carolina.................. L 45-66 WINTHROP ........................... L 69-74 at Elon ................................. L 72-76 at Appalachian State............ L 66-75 Western Carolina%............... L 61-75

* NCAIAW Division I games # NCAIAW Tournament (Boone, NC) 1979-80 Record: 20-5 (11-1 NCAIAW) Head Coach: Ditty Speeler/ Jim Swiggett

1976-77 Record: 3-16 (1-7 NCAIAW) Head Coach: Marilyn Gibbs D J

F

10 13 15 18 20 22 25 28 29 1 4 5 10 12 15 18 18 21 24

at Appalachian State* ......... L 68-81 EAST TENNESSEE STATE ....... L 92-93 at Longwood ........................ L 66-67 at East Carolina* ................. W 92-86 NORTH CAROLINA* .............. L 75-95 at Winthrop ......... ................L 77-101 at High Point ........................ L 47-86 EAST CAROLINA* ................. L 65-77 No. 14 NC STATE* ................ L 61-84 at North Carolina* ............... L 45-74 at Western Carolina.............. L 60-68 at Mars Hill .......................... L 68-87 ELON ................................... W 80-72 APPALACHIAN STATE*.......... L 54-66 at No. 9 NC State* ............... L 49-81 at Winthrop#........................ L 74-81 vs. Western Carolina# .......... L 58-67 WAKE FOREST ...................... W 65-59 vs. East Carolina%................ L 71-73

N D

J

F

* NCAIAW Division I games # Winthrop Tournament (Rock Hill, SC) % NCAIAW Tournament (Raleigh, NC) 1977-78 Record: 6-16 (2-8 NCAIAW) Head Coach: Jan Donohue N

D J

F

29

11 17

26 28 31 3 6 7 9 10 14 17 20 23

M

25 2

at Elon ................................. L 75-77 at Duke*.............................. W 82-55 LONGWOOD ......................... L 64-75 at No. 6 NC State* ............... L 41-98 WAKE FOREST ...................... W 86-52 HIGH POINT.......................... L 58-90 EAST CAROLINA* ................. L 48-75 at Appalachian State* ......... L 74-83 DUKE*................................. W 81-63 at Charlotte.......................... W 66-55 No. 2 NC STATE* .................. L 50-77 at Western Carolina.............. L 59-91 MARS HILL........................... W 80-73 at North Carolina A & T......... (OT) W ......................................... 69-68 vs. Florida State# ................. L 57-65 vs. East Carolina# ................ L 55-79 NORTH CAROLINA* .............. L 69-76 WINTHROP ........................... L 64-69 at East Carolina* ................. L 57-87 APPALACHIAN STATE*.......... (OT) L ......................................... 78-84 at North Carolina* ............... L 68-92 vs. Appalachian State%........ (OT) L ......................................... 76-80

27 30 1 4 6 8 10 15 10 12 14 19 24 26 29 31 2 5 7 11 14 16 19 22 23

* NCAIAW Division III games # NCAIAW Tournament (Jim Swiggett coached the lastt 17 games) 1980-81 Record: 9-14 (6-4 NCAIAW) Head Coach: Robin Joseph N D

2 3 6 10 12

J

12 17 19 21 24

F

31 2 5 7 9 12

* NCAIAW Division I games # Winthrop Tournament (Rock Hill, SC) % NCAIAW Tournament 1978-79 Record: 1-20 (0-12 NCAIAW) Head Coach: Ditty Speeler N D J

F

15 28 2 9 12 16 17 19 20 22 25 27 29 31 2 5 12 15 17 22

LONGWOOD ......................... L 68-74 NC STATE* ......... ...............L 39-116 at Longwood ........................ L 50-69 EAST CAROLINA* ................L 55-100 MARS HILL........................... L 61-74 DUKE*................................. L 51-65 DAVIDSON ........................... W 58-52 at Appalachian State* ......... L 49-91 at Western Carolina*............ L 62-83 NORTH CAROLINA ................ L 40-99 MERCER .............................. L 55-94 at Winthrop ......... ...............L 58-102 at East Carolina... L 43-109 at Duke*.............................. L 52-64 UNC PEMBROKE .................. L 56-89 at NC State* ....... .................L 34-111 at Davidson.......................... L 44-67 at Wake Forest* ................... L 76-84 at North Carolina* ............... L 57-99 NORTH CAROLINA A & T ....... L 63-67 vs. NC State# ...................... L 47-131

WINGATE.............................. W 88-70 at Methodist* ...................... W 87-60 at Meredith .......................... W 84-57 at Elon ................................. L 56-84 at St. Andrews*.................... W 88-79 LONGWOOD ......................... L 68-85 at Greensboro* .................... W 72-56 CATAWBA............................. W 80-57 at Roanoke .......................... W 87-80 WARREN WILSON................. W 73-49 ST. ANDREWS* .................... W 59-57 BENNETT*............................ L 69-77 MEREDITH............................ W 66-52 at NC Wesleyan* .................. W 73-71 at Davidson*........................ W 69-50 GUILFORD............................ W 77-76 at Bennett*.......................... W 84-73 DAVIDSON* ......................... W 74-60 NC WESLEYAN*.................... W 78-62 DUKE ................................... L 74-82 GREENSBORO*.................... W 65-56 METHODIST* ....................... W 75-62 GREENSBORO#.................... W 65-56 ST. ANDREWS# .................... W 86-79 METHODIST# ....................... L 78-85

at Wingate ........................... L 48-76 at St. Andrews*.................... L 57-73 at Meredith .......................... W 60-45 at Appalachian State............ L 56-75 GREENSBORO #................... W 2-0 LONGWOOD ......................... L 51-68 at Davidson.......................... W 55-54 ST. ANDREWS* .................... W 71-54 at Guilford............................ L 51-61 at Methodist* ...................... W 76-65 at Bennett*.......................... L 50-76 at Greensboro# .................... W 2-0 at NC Wesleyan* .................. L 76-82 DAVIDSON ........................... W 72-59 PFEIFFER ............................. L 55-74 METHODIST* ....................... W 71-57 NC WESLEYAN*... ...............W 102-82 MEREDITH............................ W 68-50 BENNETT*............................ L 43-64 at Longwood ........................ L 50-72 at Wake Forest ..................... L 56-92 at Barber-Scotia................... L 73-84 vs.Methodist% ..................... W 83-60 vs. Bennett%........................ L 52-68 vs. St. Andrews%.................. L 74-93

* NCAIAW Division III games # forfeit wins (not counted) % NCAIAW Tournament (Rocky Mount, NC) 1981-82 Record: 25-3 (12-0 DIAC, 1st) Head Coach: Lynne Agee N N D

J

F

21 22 24 2 4 8 14 18 22 23 25 27 30 2 4

FERRUM .............................. W 82-73 BENNETT.............................. W 70-52 VIRGINIA.............................. L 39-78 METHODIST* ...... ................W 110-42 at Averett .......................... W 95-47 at Greensboro* .................... W 80-59 at Davidson.......................... W 67-40 at Pfeiffer............................. W 80-74 CHRIST. NEWPORT* ............. W 98-70 VIRGINIA WESLEYAN* .......... W 83-58 DAVIDSON ........................... W 69-56 at St. Andrews*.................... W 86-82 NC WESLEYAN*.................... W 71-68 GUILFORD............................ W 94-74 ATLANTIC CHRISTIAN............ L 90-93

2007-08 UNCG Women’s Basketball Media Guide • 81

All-Time Results

12 14 16 2 4 9 11 16 19 20 20 2 5 6 9 11 24 25 26 27

* Winthrop Tournament (Rock Hill, SC) # Elon Tournament (Elon College, NC) % NCAIAW Tournament (Chapel Hill, NC)

* at Cullowhee, NC # Winthrop Tournament (Rock Hill, SC) % NCAIAW Tournament (Elon College, NC)

* Winthrop Tournament (Rock Hill, SC) 1970-71 Record: 12-8 Head Coach: June Galloway

at Western Carolina.............. W 41-31 Mars Hill* ............................ L 54-61 APPALACHIAN STATE ............ W 49-44 at High Point ........................ W 55-45 at Winthrop#........................ L 42-61 vs. East Tennessee State# .... W 54-46 vs. South Carolina#.............. W 67-60 WINTHROP ........................... W 48-43 NC STATE ............................. W 75-52 High Point% ......................... L 44-51

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.c

1969-70 Record: 9-2 Head Coach: June Galloway


M

23 1 2

vs. Christopher Newport# ..... W 72-65 vs. LeMoyne-Owen^ ............. W 84-77 at Rust^............................... L 66-70

^ NCAA South Regional (Holly Springs, MS) DIAC Regular Season Champions DIAC Tournament Champions NCAA Div. III Tournament

* Dixie Conference games + East Connecticut State Tournament # Dixie Conference Tournament ^ NCAA South Regional (Holly Springs, MS) DIAC Tournament Champions NCAA Div. III Tournament 1985-86 Record: 24-4 (14-0 DIAC, 1st) Head Coach: Lynne Agee N The 1982-83 team won both the DIAC Regular Season and Tournament Championships and made a trip to the NCAA Tournament for the second of seven straight seasons.

6 9 12 13 15 16 18

M

All-Time Results

19 20

at Longwood ........................ W 74-67 ST. ANDREWS* .................... W 74-67 at Christopher Newport* ...... W 75-56 at Virginia Wesleyan*........... W 68-55 at Methodist* ..... ...............W 103-52 GREENSBORO*.................... W 90-33 at NC Wesleyan* .................. W 79-70 vs. NC Wesleyan#................. W 69-66 vs. St. Andrews#................... W 91-73 ST. ANDREWS+ .................... W 71-63 SUSQUEHANNA+ ................. W 74-66 vs. Pomona-Pitzer+ .............. W 77-66 at Elizabethtown! ............(OT) L 66-67

1983-84 Record: 22-7 (11-3 DIAC, 2nd) Head Coach: Lynne Agee N D

J

* Dixie Conference games # Dixie Conference Tournament + NCAA Tournament ! NCAA DIII National Championship game DIAC Regular Season Champions DIAC Tournament Champions NCAA Div. III Tourn. Runner-up

F

1982-83 Record: 21-7 (11-1 DIAC, 1st) Head Coach: Lynne Agee N D

J

F

M

20 29 1 3 7 17 18 14 17 19 21 22 24 26 29 1 3 5 9 11 12 15 18 20 25 26 3 4

at Guilford............................ W 90-83 at Virginia ............................ L 50-92 GREENSBORO*... ...............W 102-40 at Methodist* ...................... W 97-54 at Bennett............................ W 94-45 vs. Central Missouri State#... L 61-94 vs. Mesa# ............................ W 71-62 WILLIAM & MARY ................. W 89-60 PFEIFFER ............................. W 81-52 GUILFORD............................ W 83-64 at Virginia Wesleyan*........... W 73-53 at Christopher Newport* ...... W 78-60 at Greensboro* .................... W 76-32 ST. ANDREWS* .................... W 90-67 at NC Wesleyan* .................. W 78-60 at Elon ................................. L 64-68 at Lenoir-Rhyne.................... L 59-67 LONGWOOD ......................... W 63-47 at St. Andrews*.................... L 74-77 CHRIST. NEWPORT* ............. W 76-70 VIRGINIA WESLEYAN* .......... W 81-60 METHODIST* ...... ...............W 103-38 NC WESLEYAN*.................... W 84-61 UNC WILMINGTON................ L 67-84 vs. St. Andrews%.................. W 75-47 vs. Virginia Wesleyan% ......... W 80-64 KNOXVILLE+......................... L 71-74 RUST+ .............................. W 68-61

GUILFORD............................ W 85-66 at UNC Wilmington...............L 69-100 at Greensboro* .................... W 81-50 METHODIST* ...... ................W 116-51 at Averett* .......... ...............W 102-68 at Richmond ........................ L 72-82 at William & Mary (OT) ......... W 61-56 AVERETT*............................. W 94-37 MARY WASHINGTON............. W 76-61 at Methodist* ...................... W 94-59 VIRGINIA WESLEYAN* .......... L 68-76 CHRIST. NEWPORT* ............. W 75-71 at St. Andrews*.................... L 67-72 GREENSBORO*.................... W 80-64 NC WESLEYAN*.................... W 78-72 at Guilford............................ W 88-74 at Elon(OT) .......................... L 78-79 at Longwood ........................ W 66-64 LENOIR-RHYNE..................... W 90-71 at Christopher Newport* ...... W 60-46 at Virginia Wesleyan(OT).......L 93-100 ST. ANDREWS* .................... W 93-80 VA. COMMONWEALTH .......... W 83-69 at NC Wesleyan* .................. W 98-93 GREENSBORO#.................... W 77-59 vs. St. Andrews#................... W 91-67 vs. Virginia Wesleyan#.......... W 85-80 vs. Knoxville% ...................... L 74-82 vs. Virginia Wesleyan% ......... W 70-69

* Dixie Conference games # Dixie Conference Tournament % NCAA South Regional (Holly Springs, MS) DIAC Tournament Champions NCAA Div. III Tournament 1984-85 Record: 21-7 (10-2 DIAC, 2nd) Head Coach: Lynne Agee N

D

J

* Dixie Conference games # Northern Colorado Tournament % Dixie Conference Tournament + NCAA South Regional DIAC Regular Season Champions DIAC Tournament Champions NCAA Div. III Tournament

19 22 1 3 7 9 10 13 14 18 20 21 24 26 28 31 2 4 7 10 11 14 17 18 21 24 25

F

17 18 27 29 1 4 7 8 10 12 15 18

23 26 28 31 2 8 9 13 16 19 22

vs. Buffalo State+ ................ .L 71-80 vs. Cortland State+..............W 83-57 at Methodist* ...................... W 90-60 GREENSBORO*.................... W 70-32 AVERETT*............ ................W 116-38 at Elon ................................. W 74-56 at Catholic ........................... W 60-59 at Gettysburg ....................... L 77-81 at Averett* .......... ...............W 122-59 at Mary Washington ............. W 85-69 METHODIST* ....................... W 71-44 at Virginia Wesleyan*........... W 83-59 at Christopher Newport* ...... W 66-64 at Guilford............................ L 63-66 ELON ................................... W 71-64 at NC Wesleyan* .................. W 79-65 ROANOKE ............................ W 93-79 at Greensboro* .................... L 69-76 GUILFORD............................ W 87-79 CHRIST. NEWPORT* ............. L 83-85 VIRGINIA WESLEYAN* .......... W 94-69 LONGWOOD ......................... L 76-97 NC WESLEYAN*... ...............W 106-88 AVERETT*............................. W 96-54 vs. Greensboro#................... W 68-49

82 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

D

J

F

M

22 23 3 6 7 10 14 4 5 8 11 13 17 18 21 23 25 29 31 3 7 8 11 15 18 21 28 1

GUILFORD............................ L 81-59 vs. Lenoir-Rhyne+................. W 84-75 ELON ................................... W 95-60 EASTERN MENNONITE.......... W 69-66 at Catholic ........................... L 72-90 GREENSBORO*.................... W 85-73 AVERETT*............ ...............W 104-22 ST. ANDREWS* .................... W 73-44 TRENTON STATE.................... W 76-68 at Averett* ........................... W 73-32 MARY WASHINGTON............. W 91-63 at Roanoke .......................... W 76-61 VIRGINIA WESLEYAN* .......... W 87-77 CHRIST. NEWPORT ............... W 73-64 METHODIST* ....................... W 76-60 at St. Andrews...................... W 90-49 NC WESLEYAN*.................... W 85-82 at Elon ................................. W 55-53 at Greensboro ...................... W 68-56 at Methodist* ...................... W 76-73 at Christopher Newport* ...... W 75-74 at Virginia Wesleyan*........... W 61-58 FERRUM .............................. W 96-76 at NC Wesleyan* .................. W 86-59 AVERETT#............................. W 98-45 vs. Christopher Newport# ..... L 67-69 at Virginia Wesleyan^ ........... W 84-75 vs. Rust^.............................. L 61-99

* Dixie Conference games + at Greensboro College # Dixie Conference Tournament ^ NCAA South Regional

1987-88 Record: 26-7 (13-1 DIAC, 1st) Head Coach: Lynne Agee N

D

J

F

M

21 22 24 1 4 5 7 9 12 9 11 13 16 19 22 23 27 30 2 4 8 12 13 16 20 23 26 27 2 3 11 18 19

* Dixie Conference games + at East Connecticut State Tournament & at Greensboro College # Dixie Conference Tournament ^ NCAA Tournament

DIAC Regular Season Champions NCAA Div. III Tourn. Second Round

DIAC Regular Season Champions DIAC Tournament Champions NCAA Div. III Tourn.Third Place

1986-87 Record: 27-3 (14-0 DIAC, 1st) Head Coach: Lynne Agee N

D

J

F

M

21 22 25 3 6 9 11 5 8 10 13 17 20 23 24 27 29 2 4 10 13 14 18 20 21 24 27 28 6 7

HIGH POINT.......................... L 73-96 vs. Lenoir-Rhyne+ (OT) ......... W 71-68 at Guilford............................ W 71-66 at Elon ................................. L 68-81 EASTERN MENNONITE.......... W 89-60 at Greensboro* .................... W 71-61 BELMONT ABBEY.................. W 65-63 at Coastal Carolina .............. W 73-50 ST. ANDREWS* ... ...............W 103-46 at Mary Washington ............. W 81-44 ROANOKE ............................ W 81-49 AVERETT*............................. W 88-47 at Methodist* ...................... W 84-52 at Virginia Wesleyan*........... W 78-65 at Christopher Newport* ...... W 60-58 NC WESLEYAN*.................... W 89-74 GREENSBORO*.................... W 72-57 at St. Andrews*... ................W 100-51 METHODIST* ...... ...............W 102-60 at Ferrum ............................. W 97-84 CHRIST. NEWPORT* ............. W 82-80 VIRGINIA WESLEYAN* .......... W 84-57 LIBERTY ............................... W 87-75 at Averett* .......... ...............W 103-56 at NC Wesleyan* .................. W 95-80 AVERETT*............ ...............W 112-56 vs. Greensboro#................... W 92-56 vs. Christopher Newport# ..... W 93-75 vs. Centre^........................... L 69-79 vs. Buffalo State^ ................ W 83-74

* Dixie Conference games + at Greensboro College # Dixie Conference Tournament

vs. Kean+............................. L 71-74 vs. Muhlenberg+ .................. W 81-39 LONGWOOD ......................... W 78-77 ELON ................................... W 83-80 vs. Guilford&........................ W 66-61 FERRUM ............. ...............W 101-42 at North Carolina A & T ........ L 60-79 GREENSBORO*.................... W 84-64 at Coastal Carolina .............. L 62-65 at Longwood ........................ W 74-71 at UMBC .............................. L 81-83 at St. Andrews*.................... W 80-63 at Averett* .......... ...............W 120-36 METHODIST* ....................... W 99-54 VIRGINIA WESLEYAN* .......... W 89-66 CHRIST. NEWPORT* ............. W 85-58 at Greensboro* .................... L 74-84 at NC Wesleyan* .................. W 90-82 ST. ANDREWS* .................... W 94-59 at Methodist* ...................... W 85-66 AVERETT*............ ...............W 125-51 at Christopher Newport........W 101-87 at Virginia Wesleyan ............. W 80-78 at Liberty.............................. L 90-96 NC WESLEYAN*... ...............W 121-89 AVERETT#............ ...............W 139-39 vs. NC Wesleyan# ...............W 103-64 vs. Virginia Wesleyan#.......... W 75-72 at Centre^............................ W 81-77 vs. Rust^.............................. W 66-64 at Luther^ ............................ W 55-52 at Concordia (MN)^..............L 66-103 vs. Southern Maine^ ............ W 68-66

1988-89 Record: 16-8 Head Coach: Lynne Agee N

D

J

18 19 22 29 1 3 9 10 20 4 5 12 14 19 20 25

PFEIFFER ............................. W 96-61 ST. AUGUSTINEâ&#x20AC;&#x2122;S ................. W 83-82 at Longwood ........................ W 82-58 NORTH CAROLINA A&T ........ W 80-56 UNC WILMINGTON................ W 86-76 ÂŹNC CENTRAL ...................... W 89-71 at Towson............................. W 90-87 at Navy................................. W 73-66 at Coastal Carolina .............. L 62-68 at South Florida ................... L 66-96 at Tampa.............................. W 89-63 GUILFORD............................ W 84-58 LONGWOOD ......................... W 86-72 at William & Mary................. W 73-59 at Randolph-Macon ............. W 87-71 at North Carolina A&T .......... L 65-67

7KH  FOXE Ă&#x20AC;QLVKHG WKLUG LQ WKH NCAA Division III Tournament in the SparWDQV Ă&#x20AC;QDO VHDVRQ DW WKDW OHYHO EHIRUH making the transition to Division I.


M

30 2 8 14 16 20 27 1

WINTHROP ........................... W 87-65 UNC PEMBROKE .................. W 89-76 at St. Augustineâ&#x20AC;&#x2122;s ................. L 67-72 CHARLOTTE.......................... L 67-84 at Liberty.............................. L 86-95 at UNC Pembroke................. L 77-92 at UNC Wilmington............... W 92-89 at Charlotte.......................... L 66-83

J

1989-90 Record: 18-7 Head Coach: Lynne Agee N D

J

F

LONGWOOD ......................... W 96-70 at Missouri-Rolla*................ W 66-53 at Cameron*........................ W 88-74 at West Texas State* ............ L 75-83 CATAWBA............................. W 82-58 UNC WILMINGTON................ W 97-87 NORTH CAROLINA A & T ....... W 80-66 at Cal.-Riverside.. ...............W 100-90 at Cal Poly Pomona .............. L 61-93 at Chapman ......................... L 55-90 LINCOLN MEMORIAL ............ W 98-97 BAPTIST ............................... W 90-65 at Longwood ........................ W 89-79 at Davis & Elkins .................. W 81-71 CHARLOTTE.......................... L 63-78 at North Carolina A & T ........ L 54-67 at UNC Pembroke................. W 76-66 at NC Central ....................... W 80-66 ST. AUGUSTINEâ&#x20AC;&#x2122;S ................W 105-91 USC SPARTANBURG............. L 56-66 ELON .................. ...............W 100-56 at Catawba .......................... W 84-69 at Winthrop .......................... W 73-63 UNC PEMBROKE .................. W 93-62 at Charlotte.......................... L 71-98

F

M

N

D

J

F

M

23 24 27 30 1 4 10 29 31 4 5 8 15 19 21 23 26 28 31 2 6 9 13 16 20 21 26 28 7 8

1992-93 Record: 19-10 (14-2 Big South, 1st) Head Coach: Lynne Agee D

J

vs. No. 16 Mississippi%........ L 58-90 vs. Morgan State% ............... W 61-55 at St. Augustineâ&#x20AC;&#x2122;s ................. W 92-81 vs. Bridgeport# .................... W 93-52 at Pitt-Johnstown# ............... L 87-93 CATAWBA............................. W 70-53 UNC PEMBROKE .................. W 77-68 USC SPARTANBURG............. W 73-69 NORFOLK STATE ................... L 73-75 at Bentley ............................ L 67-79 vs. Lock Haven+ ................... W 71-66 VIRGINIA STATE .................... W 91-61 LONGWOOD ......................... W 95-49 WINTHROP ........................... W 95-79 at Catawba .......................... W 80-58 NORTH CAROLINA A & T(OT) ...L 64-65 at Longwood ....... ................W 101-82 COASTAL CAROLINA............. W 83-52 at Virginia State ................... L 69-81 DAVIS & ELKINS ................... W 89-33 at Charlotte.......................... L 56-72 at Wofford............................ W 97-56 at USC Spartanburg ............. W 72-66 PITT-JOHNSTOWN................. W 80-73 at Lincoln Memorial ............. W 76-74 at Western Carolina.............. W 84-71 WOFFORD ............................ W 95-50 at UNC Wilmington............... L 70-86 vs. Hampton^....................... W 72-63 at Norfolk State^ ................. L 62-72

% Appalachian State Tournament # Mountain Cat Classic (Johnstown, PA) + at Waltham, MA ^ NCAA South Atlantic Regional (Norfolk, VA)

F

M

N

D

25 29 30 2

at Western Carolina.............. W vs. Loyola (MD)+................... W vs. UMass+ .......................... W CHARLESTON SOUTHERN ..... W

Big South Reg. Season Champions

at Liberty* ........................... W 50-48 at Southwest Texas State#.... L 56-80 vs. South Alabama# ............. L 70-73 DUKE ................................... L 76-80 STETSON.............................. W 69-62 vs. Akron% ........................... W 68-50 at South Florida%................. W 74-67 vs. South Alabama^ ............. L 62-66 vs. Morehead State^ ............ L 61-72 CORNELL+ ........................... W 70-61 EAST CAROLINA+ ................. L 59-76 VIRGINIA TECH* ................... W 63-54 UNC WILMINGTON* ............. W 72-54 at James Madison* .............. L 45-63 at Appalachian State* ......... L 61-91 UNC ASHEVILLE*................. W 81-67 vs. North Carolina A & T (C)* W 64-48 at Coastal Carolina* ............ W 87-52 at UNC Wilmington*............. W 70-56 at UNC Asheville*................. W 80-41 at Campbell* ....................... W 87-74 WINTHROP*......................... W 88-48 LIBERTY ............................... W 77-52 CHARLESTON SOUTHERN*... W 83-59 at Clemson........................... L 66-75 RADFORD* .......................... W 74-57 vs. Charleston Southern&..... W 58-55 vs. Towson& ......................... W 81-69 at Radford&......................... L 57-62

1995-96 Record: 17-10 (12-2 Big South, 1st) Head Coach: Lynne Agee N D

J

F

1994-95 Record: 21-10 (14-2 Big South, 1st) Head Coach: Lynne Agee N D

J

F

M

30 3 4 7 19 20 21 31 1 4 14 16 20 22 25 28 31 2 8 14 17 19 22 25 28 2 4 9 10 11

APPALACHIAN STATE ............ L 53-69 vs. Loyola (MD)#................... L 68-76 vs. Davidson#....................... W 60-57 at Wake Forest ..................... L 67-71 at Alaska-Anchorage% ......... W 83-76 vs. UCLA%............................ L 70-72 vs. Providence% .. ...............LL 100-105 WESTERN CAROLINA^.......... W 78-66 HOLY CROSS^...................... W 86-78 at Radford* ......................... W 71-57 8 MONTANA STATE............... L 56-90 at UNC Asheville*................. W 67-61 WINTHROP*......................... W 83-76 UMBC*................................ L 57-59 TOWSON*............................ W 71-58 vs. North Carolina A & T (C)... W 79-69 CHARLESTON SOUTHERN*... W 74-70 CHARLOTTE.......................... L 58-61 at Coastal Carolina* ............ W 81-53 at Winthrop*........................ W 68-60 at Liberty* ........................... W 67-57 at UMBC* ............................ W 55-50 at Towson*(3 OT) ................. L 70-72 RADFORD* .......................... W 79-71 at Charleston Southern* ...... W 77-69 UNC ASHEVILLE* ................. W 86-72 LIBERTY*............................. W 74-54 COASTAL CAROLINA*........... W 72-66 vs. Charleston Southern+ ..... W 78-70 vs. Coastal Carolina+ ........... W 85-57 at Radford+ ......................... L 63-68

* Big South Conference game # Powerbar Invitational (Providence, RI) % Northern Lights Invit. (Anchorage, AK) (C) at Greensboro Coliseum ^ UNCG Marriott Classic + Big South Tournament (Radford, VA) Big South Reg. Season Champions

M

24 25 2 6 9 12 21 22 30 31 4 9 13 17 20 27 30 4 7 10 13 16 21 24 29 7 8

vs. Illinois#........................... L 71-88 vs. MD-Eastern Shore#......... W 76-39 at Charlotte.......................... L 72-84 vs. Wake Forest+ .................. L 55-97 vs. North Carolina A & T (C)... W 69-57 DAVIDSON ........................... W 79-69 vs. No. 18 Alabama% ........... L 62-87 vs. San Diego%(OT) .............. L 67-70 HARTFORD$......................... W 83-75 TULANE$.............................. L 69-71 at Appalachian State............ L 65-72 LIBERTY*............................. W 84-63 at Coastal Carolina* ............ L 76-88 UNC ASHEVILLE* ................. W 73-54 WINTHROP*......................... W 96-57 at Charleston Southern* ...... W 75-73 at Liberty* ........................... W 76-55 UMBC*................................ W 68-50 RADFORD* .......................... W 94-79 COASTAL CAROLINA*........... W 81-56 at UNC ASHEVILLE*.............. L 53-71 at Winthrop*(OT).................. W 86-85 at UMBC* ............................ W 49-45 CHARLESTON SOUTHERN*... W 90-71 at Radford* ......................... W 71-64 vs. Liberty&.......................... W 84-60 vs. Winthrop& ...................... L 69-72

* Big South Conference game # Comfort Inn Downtown Classic (Atlanta, GA) (C) at Greensboro Coliseum % Howard Bank Classic (Burlington, VT) $ Marriott Classic (Greensboro, NC) & Big South Tournament (Radford, VA) Big South Reg. Season Champions 1996-97 Record: 20-9 (13-1 Big South, 1st) Head Coach: Lynne Agee N

D

J

F

21 24 29 30 4 7 17 28 29 2 4 8 11 13 16 18 22 25 28 1 4 8 10 15

at Virginia Tech..................... L 86-89 No. 17 DUKE ........................ L 68-98 at Montana State#............... L 60-68 vs. Air Force# ....................... W 64-58 at Davidson.......................... L 48-60 vs. North Carolina A & T (C)... W 63-54 COLLEGE OF CHARLESTON ... W 69-54 at Tulane% ........................... L 46-89 vs. Rhode Island%................ W 87-63 APPALACHIAN STATE ........... L 51-71 SOUTH CAROLINA STATE ...... W 99-42 at Furman ............................ L 42-73 COASTAL CAROLINA*..........W 104-66 RADFORD* ......... ...............W 103-62 at UNC Asheville*................. W 76-72 at Winthrop*........................ L 68-74 at UMBC* ............................ W 71-51 CHARLESTON SOUTHERN*... W 91-64 LIBERTY*............................. W 80-64 UMBC*................................ W 76-52 at Radford* ........ ...............W 101-68 at Coastal Carolina* ............ W 87-76 UNC ASHEVILLE* ................. W 70-52 WINTHROP*......................... W 90-65

Big South Reg. Season Champions 1993-94 Record: 17-12 (13-5 Big South, 1st) Head Coach: Lynne Agee N D

J

87-79 93-71 72-59 91-65

1 4 5 11 15 18 19 29 30 3 4 6 9 13 20 23 28 1 6 11 13 17 23 26 1 4 11 12 21

* Big South Conference game # at Southwest Texas Tournament (San Marcos, TX) % at South Florida Holiday Classic (Tampa, FL) ^ at Georgia Southern Tournament (Statesboro, GA) + Marriott Classic at UNCG (C) at Greensboro Coliseum & Big South Tournament (Radford, VA)

NCAA Div. II Tournament 1991-92 Record: 21-6 Head Coach: Lynne Agee

22 TOWSON*............................ W 70-48 26 vs. North Carolina A & T (C)(OT) W 86-84 28 at Coastal Carolina* ............ L 69-76 29 at Charleston Southern* ...... W 76-70 F 5 at Campbell* ....................... W 69-68 11 UNC ASHEVILLE* ................. W 90-54 12 WINTHROP*......................... W 84-67 18 at Liberty* ........................... W 64-59 19 at Radford* ......................... L 69-71 25 at UMBC* ............................ L 51-53 26 at Towson*........................... L 63-76 M 4 COASTAL CAROLINA*........... W 78-55 5 CHARLESTON SOUTHERN*... W 84-55 10 UNC ASHEVILLE%................. W 77-74 11 TOWSON% ........................... W 74-69 12 RADFORD%.......................... L 78-83 * Big South Conference game # Marriott Classic at UNCG (C) at Greensboro Coliseum % Big South Tournament (Greensboro, NC)

+ at Cornell Tournament (Ithaca, NY) # at Virginia Tech Tournament (Blacksburg, VA) % Marriott Classic at UNCG

* at West Texas State Tournament 1990-91 Record: 21-9 Head Coach: Lynne Agee

APPALACHIAN STATE ............ W 90-74 COASTAL CAROLINA ............. W 87-73 at Duke ................................ L 76-87 MICHIGAN STATE.................. L 71-90 vs. Austin Peay#................... W 76-70 at Virginia Tech# .................. L 65-84 MD-EASTERN SHORE% ........ W 80-61 COLLEGE OF CHARLESTON% W 76-60 at UNC Wilmington............... W 96-61 at UNC Asheville................... W 85-72 WESTERN CAROLINA............ W 74-60 LIBERTY ............................... W 79-72 SOUTH FLORIDA ................... L 71-84 CAMPBELL........................... W 84-69 at College of Charleston ....... L 62-93 at Charleston Southern......... W 73-56 CHARLOTTE.......................... L 60-87 at Appalachian State(OT) ........W W 82-81 UNC ASHEVILLE ................... W 86-74 at Winthrop .......................... W 84-81 at Liberty.............................. W 67-47 UNC WILMINGTON................ W 85-82 JAMES MADISON ................. W 68-65

28 1 18 20 29 30 2 3 7 8 14 15 21

UNC WILMINGTON................ W 77-54 at Charlotte.......................... L 48-61 CAMPBELL*......................... W 54-46 SOUTHWEST TEXAS STATE .... L 48-64 at Kent State....... ................L 68-119 at Dayton ............................. L 65-82 IOWA STATE# ....................... L 66-72 TEMPLE#(OT) ....................... L 72-77 at UNC Asheville*................. W 86-69 at Winthrop*........................ W 68-58 LIBERTY*............................. L 61-67 RADFORD* .......................... W 78-61 UMBC*................................ W 74-56

,QLWVĂ&#x20AC;UVWVHDVRQLQWKH%LJ6RXWK&RQIHUHQFHWKHFOXEZRQWKHUHJXODUVHDson crown. Vickie Henson (15) was named the Big South Player of the Year.

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 83

All-Time Results

28 30 1 2 6 7 11 3 5 6 10 13 17 20 22 24 29 1 6 8 12 15 17 19 27

4 7 14 17 29 30 3 4 8 16 18 23 27 29 2 3 5 10 20 24 27 3 5

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.c

F


1999-2000 Record: 18-11 (11-7 SoCon, 4th) Head Coach: Lynne Agee N

D

J

F

All-Time Results

M

The 1997-98 team celebrates its SoCon Tournament Championship.

20at Liberty*........................................ W 86-70 22 at Charleston Southern* ...... W 69-61 27 vs. UMBC& .......................... W 68-50 28 vs. Radford&........................ W 83-70 M 1 vs. Liberty&.......................... L 82-89

(C) at Greensboro Coliseum % Marriott Classic at UNCG 6R&RQ7RXUQDPHQW *UHHQVERUR1&Ă&#x20AC;UVWURXQG DQGTXDUWHUĂ&#x20AC;QDODW81&*VHPLĂ&#x20AC;QDOVDQGĂ&#x20AC;QDODW Greensboro Coliseum) ^ NCAA First Round (Tuscaloosa, AL) SoCon Reg. Season Champions SoCon Tourn. Champions NCAA Tournament

* Big South Conference game # State Farm Lady Cat Classic (Bozeman, MT) (C) at Greensboro Coliseum % Tulane Doubletree Classic (New Orleans, LA) & Big South Tournament (Lynchburg, VA)

1998-99 Record: 20-8 (14-4 SoCon, 1st) Head Coach: Lynne Agee

Big South Reg. Season Champions 1997-98 Record: 21-9 (12-4 SoCon, 1st) Head Coach: Lynne Agee N

D

J

F

M

17 19 28 29 4 6 14 20 29 30 3 7 10 12 14 17 19 23 29 2 7 10 14 16 18 21 27 28 1 13

at UNC Asheville................... W 78-61 at No. 19 Duke ..................... L 51-78 vs. Montana#....................... L 48-70 vs. Georgia Southern#.......... W 91-65 VIRGINIA TECH ..................... L 74-88 vs. North Carolina A&T (C) .... W 79-52 at North Carolina State........ L 61-85 ELON ................................... W 66-53 FAIRLEIGH DICKINSON% ...... W 88-64 CAMPBELL%........................ W 84-76 at Western Carolina*............ W 81-61 at Georgia Southern* ........... L 65-80 FURMAN*............................ W 77-74 at Davidson*........................ L 72-87 APPALACHIAN STATE*.......... W 62-52 at Wofford*(OT) ................... W 93-86 at Chattanooga* ................. W 72-60 GEORGIA SOUTHERN*.......... W 82-67 EAST TENNESSEE STATE*..... L 66-67 WESTERN CAROLINA*.......... W 90-48 at Appalachian State* ......... L 59-63 at Furman* .......................... W 78-68 DAVIDSON* ......................... W 78-67 WOFFORD*.......................... W 74-53 at East Tennessee State* ..... W 75-62 CHATTANOOGA*................... W 72-65 WESTERN CAROLINA $ ......... W 86-54 vs. Davidson$+ .................... W 78-75 vs. Georgia Southern$+ ....... W 75-69 vs. No. 11 Alabama^ ............ L 46-94

* Southern Conference game # Arkansas Dial Classic (Fayetteville, AR)

N

D

J

F

14 18 24 28 29 2 5 8 12 17 28 30 5 9 11 16 18 22 26 30 1 6 8 12 15 20 26 27

at Maryland ......................... W 63-45 UNC ASHEVILLE ................... W 69-53 at Appalachian State* ......... W 72-57 vs. Towson#.......................... L 76-77 vs. Radford# ........................ L 64-68 at Elon ................................. W 83-65 vs. North Carolina A&T (C) .... W 58-52 MARSHALL........................... W 91-75 WESTERN CAROLINA*.......... W 74-56 COLLEGE OF CHARLESTON*. W 77-55 at East Tennessee State* ..... L 58-82 at No. 10 Clemson ............... L 42-59 at Furman* .......................... W 78-70 DAVIDSON* ......................... W 90-79 WOFFORD*.......................... W 90-59 CHATTANOOGA*................... W 87-74 at Georgia Southern* ........... L 70-75 EAST TENNESSEE STATE*..... W 75-59 at College of Charleston* ..... W 54-50 at Western Carolina*............ L 63-75 APPALACHIAN STATE*.......... L 76-81 FURMAN*............................ W 80-65 at Davidson*........................ W 64-61 at Wofford*.......................... W 66-63 at Chattanooga*.................. W 70-66 GEORGIA SOUTHERN*.......... W 95-75 WOFFORD$.......................... W 95-58 vs. Davidson$ (C) ................. L 91-92

* Southern Conference game # Christmas City Classic (Bethlehem, PA) (C) at Greensboro Coliseum 6R&RQ7RXUQDPHQW *UHHQVERUR1&Ă&#x20AC;UVWURXQG DQGTXDUWHUĂ&#x20AC;QDODW81&*VHPLĂ&#x20AC;QDOVDQGĂ&#x20AC;QDODW Greensboro Coliseum) SoCon Regular Season Champions

84 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

15 20 21 26 27 4 19 21 29 5 8 10 14 17 19 22 24 29 1 5 8 12 15 19 21 25 2 4 5

at No. 22 Duke#................... L 47-72 vs. Washington$................... W 67-57 at North Carolina State$...... L 58-75 at St. Maryâ&#x20AC;&#x2122;s%...................... L 56-69 vs. St. Bonaventure%............ W 65-57 at Western Carolina*............ W 85-51 at Marshall .......................... W 71-68 CLEMSON(OT) ...................... W 78-67 COLLEGE OF CHARLESTON*. W 87-47 APPALACHIAN STATE*.......... L 72-83 FURMAN* (OT) ..................... W 70-69 at Davidson*........................ W 71-69 at Wofford*.......................... W 60-50 CHATTANOOGA*................... L 56-60 vs. North Carolina A&T(C) ..... W 74-38 at Georgia Southern* ........... L 69-72 at East Tennessee State* ..... L 62-66 at College of Charleston* ..... W 63-41 WESTERN CAROLINA*.......... W 78-65 at Appalachian State* ......... W 77-71 at Furman* .......................... L 66-81 DAVIDSON* ......................... W 75-57 WOFFORD*.......................... W 64-61 at Chattanooga*.................. L 66-83 GEORGIA SOUTHERN*.......... W 79-73 EAST TENNESSEE STATE*..... W 70-65 vs. Appalachian State&........ W 92-75 vs. Chattanooga& ................ W 73-67 vs. Furman&......................... L 49-68

D

J

F

M

SoCon Regular Season Champions WNIT Tournament 2002-03 Record: 14-13 (10-8 SoCon, 5th) Head Coach: Lynne Agee N

N

D

J

F

M

17 20 24 25 28 30 16 21 22 30 3 6 9 13 15 17 20 23 27 30 3 5 10 12 17 19 23 2 3 4

at Campbell ......................... W 60-56 CHARLOTTE.......................... W 81-70 MANHATTAN#....................... W 82-62 RICE# .................................. L 46-50 at East Carolina.................... W 66-53 at Appalachian State* ......... W 75-51 at Clemson........................... L 65-89 vs. Middle Tennessee$ ......... L 66-69 vs. Appalachian State$ ........ W 86-77 WESTERN CAROLINA*.......... W 67-60 at Furman* .......................... W 62-52 DAVIDSON* ......................... W 81-42 WOFFORD*.......................... W 77-50 CHATTANOOGA*................... L 63-79 at Georgia Southern* ........... W 59-45 vs. North Carolina A&T(C) ..... W 85-57 EAST TENNESSEE STATE*..... W 73-58 COLLEGE OF CHARLESTON*. W 89-56 at Western Carolina*............ W 71-45 APPALACHIAN STATE*.......... W 88-60 FURMAN*............................ W 60-58 at Davidson*........................ W 72-60 at Wofford*.......................... W 61-47 at Chattanooga*.................. L 55-77 GEORGIA SOUTHERN*.......... L 66-71 at East Tennessee State* ..... L 51-53 at College of Charleston* ..... W 53-52 vs. East Tennessee State&.... W 85-53 vs. Georgia Southern& ......... W 70-66 vs. Chattanooga& ................ L 63-64

* Southern Conference game # UNCG Marriott Classic (Greensboro, NC) $ UCF Holiday Classic (Orlando, FL) (C) at Greensboro Coliseum & SoCon Tournament (Greenville, SC)

D

J

F

M

16 20 23 24

at Charlotte.......................... L 44-60 CAMPBELL........................... W 69-46 CANISIUS# .......................... W 87-66 DELAWARE#......................... W 67-62

22 29 30 9 14 20 28 29 2 4 6 11 13 18 21 25 28 1 4 8 10 15 18 22 24 1 6

at Virginia Tech..................... L 46-54 LOYOLA (MD)#...................... W 61-47 EAST CAROLINA# ................. W 85-62 at Campbell ......................... W 61-57 ELON ................................... W 64-51 FLORIDA INTERNATIONAL ..... L 64-71 at Tulane % .......................... L 43-63 vs. SMU %............................ L 49-62 at Furman* .......................... L 66-74 DAVIDSON* ......................... W 71-69 at Wofford*.......................... L 50-61 EAST TENNESSEE STATE*..... W 71-60 at Georgia Southern* ........... W 60-58 CHATTANOOGA*................... L 54-76 COLLEGE OF CHARLESTON*. W 63-57 at Western Carolina*............ L 74-82 APPALACHIAN STATE*.......... W 75-62 FURMAN*............................ L 49-68 at Davidson*........................ W 70-63 WOFFORD*.......................... W 76-43 at Chattanooga*.................. L 54-84 GEORGIA SOUTHERN*.......... L 54-64 at East Tennessee State* ..... W 73-62 WESTERN CAROLINA*.......... L 54-64 at College of Charleston* ..... W 75-70 at Appalachian State* ......... W 85-78 vs. Furman &........................ L 51-65

* Southern Conference game % Doubletree Classic (New Orleans, LA) # UNCG Tournament (Greensboro, NC) & SoCon Tournament (Greenville, SC) 2003-04 Record: 9-19 (9-11 SoCon, 7th) Head Coach: Lynne Agee N D

2001-02 Record: 21-10 (14-4 SoCon, 1st) Head Coach: Lynne Agee N

at Rice$ ............................... L 47-61 vs. Maine$ ........................... L 59-62 EAST CAROLINA ................... W 60-46 at No. 8 Duke ....................... L 58-90 APPALACHIAN STATE*.......... W 79-51 FURMAN*............................ W 73-64 WOFFORD*.......................... W 81-75 at Chattanooga*.................. L 59-62 GEORGIA SOUTHERN*.......... W 75-57 at East Tennessee State* ..... W 77-50 vs. North Carolina A&T(C) ..... W 88-45 at College of Charleston* ..... W 73-58 WESTERN CAROLINA*.......... W 74-70 at Appalachian State* ......... W 83-66 at Furman* .......................... W 66-57 DAVIDSON* ......................... W 71-44 at Wofford*.......................... W 67-61 CHATTANOOGA*(OT) ............ L 69-73 at Georgia Southern* ........... L 72-73 at Davidson*........................ W 84-73 EAST TENNESSEE STATE*..... W 91-58 COLLEGE OF CHARLESTON*. W 60-50 at Western Carolina*............ L 67-69 vs. College of Charleston& ... W 77-51 vs. Furman&......................... W 71-62 vs. Chattanooga& ................ L 69-77 vs. Virginia Tech^ ................. L 46-51

* Southern Conference game # UNCG Marriott Classic (Greensboro, NC) $ Gene Hackerman Invitational (Dallas, TX) & SoCon Tournament (Charleston, SC) ^ WNIT First Round (Blacksburg, VA)

* Southern Conference game # Pre-season Womenâ&#x20AC;&#x2122;s NIT $ NC State Womenâ&#x20AC;&#x2122;s Tournament (Raleigh, NC) % Thanksgiving Classic (Moraga, CA) (C) at Greensboro Coliseum & SoCon Tournament (Greenville, SC) 2000-01 Record: 22-8 (14-4 SoCon, 3rd) Head Coach: Lynne Agee

30 1 8 16 19 29 5 7 12 14 16 20 22 26 29 2 5 9 11 14 16 19 23 1 2 3 13

J

21 23 3 6 7 13 18 20 22 28 30 3 5

at Virginia ............................ L 44-71 ST. FRANCIS (PA).................. L 55-80 WOFFORD*.......................... W 62-50 vs. Coastal Carolina# ........... L 65-66 vs. Coppin State#................. L 49-54 at East Tennessee State* ..... L 72-83 at Chattanooga*.................. L 57-68 CAMPBELL........................... L 56-61 APPALACHIAN STATE*.......... W 79-66 at No. 25 Boston College...... L 53-84 at UMass ............................. L 49-63 FURMAN*............................ W 63-60 at Elon* ............................... L 66-77


M

at Georgia Southern* ........... L 43-54 at College of Charleston* ..... W 73-56 WESTERN CAROLINA*.......... W 66-53 DAVIDSON* ......................... L 55-68 at Appalachian State* ......... L 68-73 at Furman* .......................... L 42-89 ELON* ................................. W 69-56 GEORGIA SOUTHERN*.......... W 78-43 COLLEGE OF CHARLESTON*. W 78-63 at Western Carolina*............ L 44-66 at Davidson*........................ L 45-59 EAST TENNESSEE STATE*..... L 60-65 CHATTANOOGA*................... L 54-70 at Wofford*.......................... W 59-53 vs. College of Charleston& ... L 50-59

* Southern Conference game

Conf. 2006-07 Record: 20-10 (13-5 SoCon, 4th) Head Coach: Lynne Agee N

D * Southern Conference game # East Carolina Tournament (Greenville, NC) & SoCon Tournament (Charleston, SC) 2004-05 Record: 14-14 (11-9 SoCon, 4th) Head Coach: Lynne Agee at West Virginia... ................ L 39-67 WINTHROP^........ ....... ......... W 62-52 PITTSBURGH^..... . ............... L 55-62 at No. 25 Arizona# ............... L 48-98 vs. Delaware#....... ............... L59-69 HIGH POINT.......................... W 70-54 CHATTANOOGA*.. ................ L 62-71 at Appalachian State* ......... L 41-69 UNC WILMINGTON................ W 79-68 at Wofford*.......................... W 69-52 at Furman*........... ............... L 50-52 ELON*.................. ............... W 60-54 GEORGIA SOUTHERN*.......... W 63-49 COLLEGE OF CHARLESTON*. W 71-50 at Western Carolina*............ W 72-58 at Davidson*........................ W 78-66 at East Tennessee State* ..... L 63-75 APPALACHIAN STATE*.......... W 55-41 FURMAN*............................ W 70-65 at Elon*............... ................ L 59-65 at Georgia Southern* ........... W 77-63 at College of Charleston* ..... L 52-65 WESTERN CAROLINA*.......... L 51-55 DAVIDSON*(2OT) ................ W 90-87 EAST TENNESSEE STATE*(OT) L 67-70 at Chattanooga*.................. L 57-70 WOFFORD*.......................... W 70-55 vs. Georgia Southern& ......... L 48-55

* Southern Conference game ^ UNCG Tournament (Greensboro, NC) # Fiesta Bowl Classic (Tucson, AZ) & SoCon Tournament (Chattanooga, TN)

2005-06 Record: 18-12 (12-6 SoCon, 2nd) Head Coach: Lynne Agee N 18 25 26 29 D 3 10 14 19 21 31 J 2 7 9 14 16 18 21 24 28 30 F 4 6 11 13 18 21 25

M 3 4 5

at North Carolina State........ L 46-76 LONGWOOD^....................... L 66-69 OHIO^...................................W 69-52 at High Point(OT).................... L 63-65 WEST VIRGINIA.......... .......... W 72-70 CAMPBELL............................W 78-55 at Wake Forest......................W 70-64 DAVIDSON*............................L 57-69 at UNC Wilmington............... L 54-65 at Coastal Carolina .............. L 54-68 CHATTANOOGA*.....................L 75-82 at Furman*...........................W 69-66 at Georgia Southern* ........... L 63-74 APPALACHIAN STATE*.......... W 85-71 COLLEGE OF CHARLESTON*. (OT) ................. ...L67-70 at Western Carolina*............ W 69-60 at Elon*................................W 56-35 WOFFORD*...........................W 84-64 at Davidson*(OT).................. W 63-62 at Chattanooga* ...................L 68-72 FURMAN*.............................W 72-48 GEORGIA SOUTHERN*.......... W 72-62 at Appalachian State* ......... L 84-85 at College of Charleston* ..... W 59-58 ELON*..................................W 53-45 at Wofford*...........................W 67-55

12 17 20 24 25 30 4 16 18

UNC WILMINGTON................ W 74-46 at Campbell ......................... W 84-68 at Charlotte.......................... L 40-86 LONGWOOD^....................... W 81-50 PROVIDENCE^ ..................... W 72-68 at North Carolina.................. L 48-103 at Davidson.......................... L 59-73 COASTAL CAROLINA............. W 64-54 HIGH POINT.......................... W 63--

20 29 30 2 6 8 10 13 15 20 22 27 29 3 5 10 12 17 19 24 1

WESTERN CAROLINA*.......... L 52-53 at Maryland# ....................... L 57-92 vs. Liberty# .......................... W 67-59 at Chattanooga*.................. W 71-68 FURMAN*............................ W 67-56 GEORGIA SOUTHERN*.......... W 80-55 Virginia Tech ........................ L 45-50 at Appalachian State* ......... W 66-61 at College of Charleston* ..... L 73-61 Elon*................................... W 88-40 at Wofford*.......................... W 62-54 DAVIDSON* ......................... W 78-55 CHATTANOOGA..................... L 66-83 at Furman* .......................... W 65-58 at Georgia Southern* ........... W 68-60 APPALACHIAN STATE*.......... W 81-62 COLLEGE OF CHARLESTON*. W 70-61 at Elon* ............................... W 57-48 WOFFORD*(OT) .................. W71-66 at Western Carolina*............ L 67-73 vs. Georgia Southern& ......... L 64-81

53

J

F

M

* Southern Conference game ^ UNCG Tournament (Greensboro, NC) # Maryland Tournament (College Park, MD) & SoCon Tournament (Charleston, SC)

Year

Coach

W

Overall L

W

L

Pct.

Conf. Finish

JUNE GALLOWA WAY (38-14, .731, THREE SEASONS) 1969-70

June Galloway

--

--

9

2

.818

1970-71

June Galloway

--

--

12

8

.600 NIWIT 4th place

1971-72

June Galloway

--

--

17

4

.810

MARILYN GIBBS (38-53, .731, FIVE SEASONS) 1972-73

Marilyn Gibbs

--

--

14

4

.778

1973-74

Marilyn Gibbs

--

--

9

7

.563

1974-75

Marilyn Gibbs

--

--

8

11

.421

1975-76

Marilyn Gibbs

--

--

4

15

.211

1976-77

Marilyn Gibbs

1

7

3

16

.158

1977-78

Jan Donohue

1978-79

Ditty Speeler

1979-80

Ditty Speeler/

JAN DONOHUE (2-8, .200, ONE SEASON) 2

8

6

16

.273

DITTY SPEELER (7-21, .250, TWO SEASONS) 0

12

1

20

.048

JIM SWIGGETT (14-3, .823, ONE SEASON*) Jim Swiggett

11

1

20

5

.800

ROBIN JOSEPH (9-14, .391, ONE SEASON) 1980-81

Robin Joseph

6

4

9

14

.391

1981-82

LynneAgee

12

0

25

3

.893

1st(Dixie)

1982-83

LynneAgee

11

1

21

7

.750

1st(Dixie)

1983-84

LynneAgee

11

3

22

7

.759

2nd(Dixie)

1984-85

LynneAgee

10

2

21

7

.750

2nd(Dixie)

1985-86

LynneAgee

14

0

24

4

.857

1st(Dixie)

1986-87

LynneAgee

14

0

27

3

.900

1st(Dixie)

1987-88

LynneAgee

13

1

26

7

.788

1st(Dixie)

1988-89

LynneAgee

--

--

16

8

.667

1989-90

LynneAgee

--

--

18

7

.720

1990-91

LynneAgee

--

--

21

9

.700

1991-92

LynneAgee

--

--

21

6

.778

1992-93

LynneAgee

14

2

19

10

.655

1st(BigSouth)

1993-94

LynneAgee

13

5

17

12

.583

1st(BigSouth)

1994-95

LynneAgee

14

2

21

10

.677

1st(BigSouth)

1995-96

LynneAgee

12

2

17

10

.630

1st(BigSouth)

1996-97

LynneAgee

13

1

20

9

.690

1st(BigSouth)

1997-98

LynneAgee

12

4

21

9

.700

1st(SoCon)

1998-99

LynneAgee

14

4

20

8

.714

1st(SoCon)

1999-00

LynneAgee

11

7

18

11

.621

4th(SoCon)

2000-01

LynneAgee

14

4

22

8

.733

3rd(SoCon)

2001-02

LynneAgee

14

4

21

10

.677

1st(SoCon)

2002-03

LynneAgee

10

8

14

13

.518

5th(SoCon)

2003-04

LynneAgee

9

11

9

19

.321

7th(SoCon)

2004-05

LynneAgee

11

9

14

14

.500

4th(SoCon)

2005-06

LynneAgee

12

6

18

12

.600

2nd(SoCon)

2006-07

LynneAgee

13

5

20

10

.677

4th(SoCon)

L LYNNE AGEE (513-233, .687, 26 SEASONS)

'LWW\6SHHOHUFRDFKHGWKHÃ&#x20AC;UVWHLJKWJDPHVRIWKHVHDVRQ

WESTERN CAROLINA* ..............W 72-57

vs. Georgia Southern& ......... W 68-56 vs. Davidson&.......................W 69-58 vs. Chattanooga& ...................L 79-91

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;¢ 85

All-Time Results

N 19 26 27 D 4 5 11 15 18 20 30 J 2 5 8 10 15 18 20 25 29 F 1 5 7 12 15 19 21 26 M 3

All-time Coaches / Year-by-Year Records

^ UNCG Tournament (Greensboro, NC) & SoCon Tournament (Chattanooga, TN)

UNCGSpartans.com â&#x20AC;¢ UNCGSpartans.com â&#x20AC;¢ UNCGSpartans.com â&#x20AC;¢ UNCGSpartans.c

F

10 12 17 20 29 31 3 7 9 14 17 21 23 28 3


ll-Time Series History Air Force 1-0 1996-97..........(N).... W, 64-58 Alaska-Anchorage 1-0 1994-95..........(A).....W, 83-76 Alabama 0-2 1995-96..........(N)..... L, 62-89 1997-98..........(A)..... L, 46-94

All-Time Results

Akron 1-0 1992-93..........(N).... W, 68-50 Appalachian State 25-21 1971-72..........(H).... W, 50-46 1971-72..........(N).... W, 52-35 1972-73..........(A).....W, 62-57 1972-73..........(H).... W, 49-44 1973-74 ..........(H).... W, 53-52 1973-74 ..........(A)......L, 51-59 1974-75 ..........(A).....W, 76-70 1974-75 ..........(H).....W, 74-67 1975-76..........(H)..... L, 54-68 1975-76..........(N)..... L, 58-66 1975-76..........(A)..... L, 66-75 1976-77 ..........(A)......L, 68-81 1976-77 ..........(H)..... L, 54-66 1977-78..........(A)......L, 74-83 1977-78..........(H)L, 78-84 (ot) 1977-78..........(N)L, 76-80 (ot) 1978-79..........(A)......L, 49-91 1980-81..........(A)..... L, 56-75 1991-92..........(H).....W, 90-74 1991-92..........(A)W, 82-81 (ot) 1992-93..........(A)......L, 61-91 1994-95..........(H)..... L, 53-69 1995-96..........(A)..... L, 65-72 1996-97..........(H)......L, 51-71 1997-98..........(H).... W, 62-52 1997-98..........(A)..... L, 59-63 1998-99..........(A).....W, 72-57 1998-99..........(H)......L, 76-81 1999-00..........(H)..... L, 72-83 1999-00..........(A).....W, 77-71 1999-00..........(N).... W, 92-75 2000-01..........(A).....W, 75-51 2000-01..........(N).... W, 86-77 2000-01..........(H).... W, 88-60 2001-02..........(H).....W, 79-51 2001-02..........(A).... W, 83-66 2002-03..........(H).... W, 75-62 2002-03..........(A).... W, 85-78 2003-04..........(H).... W, 79-66 2003-04..........(A)..... L, 68-73 2004-05..........(A)......L, 41-69 2004-05..........(H).....W, 55-41 2005-06..........(H).....W, 85-71 2005-06..........(A)..... L, 84-85 2006-07..........(A).....W, 68-61 2006-07..........(H).....W, 81-62 Arizona 1-0 2004-05..........(A)..... L, 48-99 Atlantic Christian 0-1 1981-82..........(H)..... L, 90-93 Austin Peay 1-0 1991-92..........(N).....W, 76-70 Averett 19-0 1970-71..........(H).....W, 42-37 1970-71..........(A).... W, 53-49 1971-72..........(A).... W, 52-38 1971-72..........(H).... W, 53-30 1981-82..........(A).... W, 80-59 1983-84..........(A).... W, 80-59 1983-84..........(H).....W, 94-37 1984-85..........(H)...W, 116-38 1984-85..........(A).... W, 73-32 1984-85..........(H).... W, 96-54 1985-86..........(H).. W, 104-22 1985-86..........(A).... W, 73-32 1985-86..........(H).... W, 98-45 1986-87..........(H).....W, 88-47 1986-87..........(A).. W, 103-56 1986-87..........(H).. W, 112-56 1987-88..........(A).. W, 120-36 1987-88..........(H).. W, 125-51 1987-88..........(H).. W, 139-39 Baptist 1-0 1989-90..........(H).... W, 90-65 Barber-Scotia 0-1 1980-81..........(A)..... L, 73-84 Belmont Abbey 1-0 1986-87..........(H).... W, 65-63 Bennett 4-4 1971-72..........(H).....W, 60-21 1979-80..........(H)......L, 69-77 1979-80..........(A).... W, 73-84 1980-81..........(A)......L, 50-76 1980-81..........(H)..... L, 43-64 1980-81..........(A)..... L, 52-68 1981-82..........(H).... W, 70-52

1982-83..........(H).... W, 94-45 Bentley 0-1 1990-91..........(A)..... L, 67-79 Boston College 0-1 2003-04..........(A)..... L, 53-84 Bridgeport 1-0 1990-91..........(N).... W, 93-52 Buffalo State 1-1 1984-85..........(N)......L, 71-80 1986-87..........(N).....W, 83-74 Cal Poly Pomona 0-1 1989-90..........(A)......L, 61-93 California-Riverside 1-0 1989-90..........(A).. W, 100-90 Cameron 1-0 1989-90..........(A).....W, 88-74 Campbell 11-1 1971-72..........(H).... W, 56-35 1991-92..........(H).... W, 84-69 1992-93..........(A).... W, 87-84 1993-94..........(H).... W, 54-46 1993-94..........(A).... W, 69-68 1997-98..........(H).... W, 84-76 2000-01..........(A).... W, 60-56 2001-02..........(H).... W, 69-46 2002-03..........(A).....W, 61-57 2003-04..........(H)......L, 56-61 2005-06..........(H).... W, 78-55 2006-07..........(A).... W, 84-68 Canisius 1-0 2001-02..........(H).... W, 87-66 Catawba 8-0 1971-72..........(H).... W, 50-29 1971-72..........(N).....W, 56-41 1972-73..........(A).... W, 53-44 1979-80..........(H).....W, 80-57 1989-90..........(H).... W, 82-58 1989-90..........(A).... W, 84-69 1990-91..........(H).... W, 70-53 1990-91..........(A).... W, 80-58 Catholic 1-1 1984-85..........(A).... W, 60-59 1985-86..........(A)..... L, 72-90 Central Missouri State 0-1 1982-83..........(N)......L, 61-94 Centre (KY) 1-1 1986-87..........(N)..... L, 69-79 1987-88..........(A).....W, 81-77 Chapman (CA) 0-1 1989-90..........(A)..... L, 55-90 Charlotte 2-11 1977-78..........(A).... W, 66-55 1988-89..........(H)..... L, 67-84 1988-89..........(A)..... L, 66-83 1989-90..........(H)..... L, 63-78 1989-90..........(A)......L, 71-98 1990-91..........(A)..... L, 56-72 1991-92..........(H)......L, 60-87 1993-94..........(A)......L, 48-61 1994-95..........(H)......L, 58-61 1995-96..........(A)..... L, 72-84 2000-01..........(H).....W, 81-70 2001-02..........(A)..... L, 44-60 2006-07..........(A)..... L, 40-86 Charleston Southern 13-0 1991-92..........(H).....W, 91-65 1991-92..........(A).... W, 73-56 1992-93..........(H).... W, 83-59 1992-93..........(N).... W, 58-55 1993-94..........(A).....W, 76-70 1993-94..........(H).... W, 84-55 1994-95..........(H).....W, 74-70 1994-95..........(A).... W, 77-69 1994-95..........(N).... W, 78-70 1995-96..........(A).... W, 75-73 1995-96..........(H).....W, 90-71 1996-97..........(H).....W, 91-64 1996-97..........(A).....W, 69-61 Chattanooga 6-18 1997-98..........(A).... W, 72-60 1997-98..........(H).... W, 72-65 1998-99..........(H).....W, 87-74 1998-99..........(A).... W, 70-66 1999-00..........(H)..... L, 56-60 1999-00..........(A)..... L, 66-83 1999-00..........(N).... W, 73-67 2000-01..........(H)..... L, 63-79 2000-01..........(A)......L, 55-77 2000-01..........(N)..... L, 63-64 2001-02..........(A)..... L, 59-62 2001-02..........(H)L, 69-73 (ot)

86 • 2007-08 UNCG Women’s Basketball Media Guide

2001-02..........(N)......L, 69-77 2002-03..........(H)......L, 54-76 2002-03..........(A)..... L, 54-84 2003-04..........(A)......L, 57-68 2003-04..........(H)..... L, 54-70 2004-05..........(H)......L, 62-71 2004-05..........(A)......L, 57-70 2005-06..........(H)..... L, 75-82 2005-06..........(A)..... L, 68-72 2005-06..........(N)......L, 79-91 2006-07..........(A).....W, 71-68 2006-07..........(H)..... L, 66-83 Christopher Newport 15-2 1981-82..........(H).... W, 98-70 1981-82..........(A).... W, 75-56 1982-83..........(A).... W, 78-60 1982-83..........(H).....W, 76-70 1983-84..........(H).....W, 75-71 1983-84..........(A).... W, 60-46 1984-85..........(A).... W, 66-64 1984-85..........(H)..... L, 83-85 1984-85..........(N).... W, 72-65 1985-86..........(H).... W, 73-64 1985-86..........(A).....W, 75-74 1985-86..........(N)..... L, 67-69 1986-87..........(A).... W, 60-58 1986-87..........(H).... W, 82-80 1986-87..........(N).... W, 93-75 1987-88..........(H).... W, 85-58 1987-88..........(A)...W, 101-87 Clemson 1-3 1992-93..........(A)..... L, 66-75 1998-99..........(A)..... L, 42-59 1999-00..........(H)W, 78-67 (ot) 2000-01..........(A)..... L, 65-89 Coastal Carolina 12-6 1986-87..........(A).... W, 73-50 1987-88..........(A)..... L, 62-65 1988-89..........(A)..... L, 62-68 1990-91..........(H).... W, 83-52 1991-92..........(H).... W, 87-73 1992-93..........(A).... W, 87-52 1993-94..........(A)......L, 69-76 1993-94..........(H).... W, 78-55 1994-95..........(A).....W, 81-53 1994-95..........(H).... W, 72-66 1994-95..........(N).....W, 85-57 1995-96..........(A)......L, 76-88 1995-96..........(H).....W, 81-56 1996-97..........(H).. W, 104-66 1996-97..........(A).... W, 87-66 2003-04..........(N)..... L, 65-66 2005-06..........(A)..... L, 54-68 2006-07..........(H).... W, 64-54 College of Charleston 18-6 1974-75 ..........(N)..... L, 64-80 1991-92..........(H).....W, 76-60 1991-92..........(A)..... L, 62-93 1996-97..........(H).... W, 69-54 1998-99..........(H).... W, 77-55 1998-99..........(A).... W, 54-50 1999-00..........(H).....W, 87-47 1999-00..........(A).....W, 63-41 2000-01..........(H).... W, 89-56 2000-01..........(A).... W, 53-52 2001-02..........(A).... W, 73-58 2001-02..........(H).... W, 60-50 2001-02..........(N).....W, 77-51 2002-03..........(H).....W, 63-57 2002-03..........(A).... W, 75-70 2003-04..........(A).... W, 73-56 2003-04..........(H).... W, 78-63 2003-04..........(N)..... L, 50-59 2004-05..........(H).....W, 71-50 2004-05..........(A)..... L, 52-65 2005-06..........(H)L, 67-70 (ot) 2005-06..........(A).... W, 59-58 2006-07..........(A)......L, 61-73 2006-07..........(H).....W, 70-61 Concordia (MN) 0-1 1987-88..........(A)... L, 66-103 Coppin State 0-1 2003-04..........(N)..... L, 49-54 Cornell 1-0 1992-93..........(H).....W, 70-61 Cortland State (NY) 1-0 1984-85..........(N).....W, 83-57 Davidson 26-8 1978-79..........(H).... W, 58-52 1978-79..........(A)..... L, 44-67 1979-80..........(A).... W, 69-50 1979-80..........(H).....W, 74-60 1980-81..........(A).... W, 55-54 1980-81..........(H).... W, 72-59 1981-82..........(A).... W, 67-40 1981-82..........(H).... W, 69-56 1994-95..........(N).....W, 60-57 1995-96..........(H).... W, 79-69 1996-97..........(A)..... L, 48-60

1997-98..........(A)......L, 72-87 1997-98..........(H).... W, 78-67 1997-98..........(N).... W, 78-75 1998-99..........(H).... W, 90-79 1998-99..........(A).... W, 64-61 1998-99..........(N)......L, 91-92 1999-00..........(A).....W, 71-69 1999-00..........(H).....W, 75-57 2000-01..........(H).....W, 81-42 2000-01..........(A).... W, 72-60 2001-02..........(H).....W, 71-44 2001-02..........(A).... W, 84-73 2002-03..........(H).....W, 71-69 2002-03..........(A).... W, 70-63 2003-04..........(H)..... L, 55-68 2003-04..........(A)..... L, 45-59 2004-05..........(A).... W, 78-66 2004-05..........(H)W, 90-87 (2ot) 2005-06..........(H)..... L, 54-65 2005-06..........(A)W, 63-62 (ot) 2005-06..........(N).... W, 69-58 2006-07..........(A)..... L, 73-59 2006-07..........(H).... W, 78-55 Davis & Elkins 2-0 1989-90..........(A).....W, 81-71 1990-91..........(H).... W, 89-33 Dayton 0-1 1993-94..........(A)..... L, 65-82 Delaware 1-1 2001-02..........(H).... W, 67-62 2004-05..........(N)..... L, 59-69 Duke 4-8 1971-72..........(A).....W, 55-41 1971-72..........(H).... W, 40-36 1977-78..........(A).... W, 82-55 1977-78..........(H).....W, 81-63 1978-79..........(H)......L, 51-65 1978-79..........(A)..... L, 52-64 1979-80..........(H)......L, 74-82 1992-93..........(H)......L, 76-80 1996-97..........(H)..... L, 68-98 1997-98..........(A)......L, 51-78 1999-00..........(A)......L, 47-72 2001-02..........(A)..... L, 58-90 East Carolina 6-15 1970-71 ..........(H)..... L, 42-53 1971-72..........(H)......L, 47-48 1972-73..........(H)..... L, 55-69 1973-74 ..........(A).... W, 52-45 1973-74 ..........(H).... W, 63-50 1974-75 ..........(N)......L, 61-68 1974-75 ..........(H)......L, 52-57 1975-76..........(N)......L, 57-69 1975-76..........(A)..... L, 68-86 1976-77 ..........(A).... W, 92-86 1976-77 ..........(H)......L, 65-77 1976-77 ..........(N)......L, 71-73 1977-78..........(H)..... L, 48-75 1977-78..........(N)..... L, 55-79 1977-78..........(A)......L, 57-87 1978-79..........(H)... L, 55-100 1978-79..........(A)... L, 43-109 1992-93..........(H)......L, 59-76 2000-01..........(A).... W, 66-53 2001-02..........(H).... W, 60-46 2002-03..........(H).... W, 85-62 East Tennessee State 12-10 1969-70..........(N)......L, 37-39 1970-71 ..........(N).... W, 65-43 1971-72..........(N).... W, 79-50 1973-74 ..........(N).... W, 60-54 1976-77 ..........(H)..... L, 92-93 1997-98..........(H)..... L, 66-67 1997-98..........(A).... W, 75-62 1998-99..........(A)..... L, 58-82 1998-99..........(H).... W, 75-59 1999-00..........(A)..... L, 62-66 1999-00..........(H).... W, 70-65 2000-01..........(H).... W, 73-58 2000-01..........(A)......L, 51-53 2000-01..........(N).... W, 83-53 2001-02..........(A).... W, 77-50 2001-02..........(H).....W, 91-58 2002-03..........(H).....W, 71-60 2002-03..........(A).... W, 73-62 2003-04..........(A)..... L, 72-83 2003-04..........(H)..... L, 60-65 2004-05..........(A)..... L, 63-75 2004-05..........(H)L, 67-70 (ot) Eastern Mennonite 2-0 1985-86..........(H).... W, 69-66 1986-87..........(H).... W, 89-60 Elizabethtown (PA) 0-1 1981-82..........(N)L, 66-67 (ot) Elon 18-12 1972-73..........(H).....W, 57-51 1973-74 ..........(A)..... L, 59-72 1973-74 ..........(H)..... L, 50-64 1974-75 ..........(A)..... L, 55-82

1974-75 ..........(H)......L, 76-91 1975-76..........(N).....W, 71-60 1975-76..........(A)......L, 72-76 1976-77 ..........(H).... W, 80-72 1977-78..........(A)......L, 75-77 1979-80..........(A)..... L, 56-84 1982-83..........(A)..... L, 64-68 1983-84..........(A)L, 78-79 (ot) 1984-85..........(A).....W, 74-56 1984-85..........(H).....W, 71-64 1985-86..........(H).... W, 95-60 1985-86..........(A).... W, 55-53 1986-87..........(A)......L, 68-81 1987-88..........(H).... W, 83-80 1989-90..........(H).. W, 100-56 1997-98..........(H).... W, 66-53 1998-99..........(A).... W, 83-65 2002-03..........(H).....W, 64-51 2003-04..........(A)......L, 66-77 2003-04..........(H).... W, 69-56 2004-05..........(H).... W, 60-54 2004-05..........(A)..... L, 59-65 2005-06..........(A).... W, 56-35 2005-06..........(H).... W, 53-45 2006-07..........(H).... W, 88-40 2006-07..........(A).....W, 57-48 Fairleigh Dickinson 1-0 1997-98..........(H).... W, 88-64 Ferrum 4-0 1981-82..........(H).... W, 82-73 1985-86..........(H).....W, 96-76 1996-87..........(A).....W, 97-84 1987-88..........(H)...W, 101-42 Florida International 2002-03..........(H)......L, 64-71 Florida State 0-1 1977-78..........(N)......L, 57-65 Furman 16-8 1996-97..........(A)..... L, 42-73 1997-98..........(H).....W, 77-74 1997-98..........(A).... W, 78-68 1998-99..........(A).... W, 78-70 1998-99..........(H).... W, 80-65 1999-00..........(H)W, 70-69 (ot) 1999-00..........(A)......L, 66-81 1999-00..........(N)..... L, 49-68 2000-01..........(A).... W, 62-52 2000-01..........(H).... W, 60-58 2001-02..........(H).... W, 73-64 2001-02..........(A).....W, 66-57 2001-02..........(N).....W, 71-62 2002-03..........(A)......L, 66-74 2002-03..........(H)..... L, 49-68 2002-03..........(N)......L, 51-65 2003-04..........(H).... W, 63-60 2003-04..........(A)..... L, 42-89 2004-05..........(A)..... L, 50-52 2004-05..........(H).... W, 70-65 2005-06..........(A).... W, 69-66 2005-06..........(H).... W, 72-48 2006-07..........(H).... W, 67-53 2006-07..........(A).... W, 65-58 Georgia Southern 16-10 1997-98..........(N).....W, 91-65 1997-98..........(A)..... L, 65-80 1997-98..........(H).... W, 82-67 1997-98..........(N).... W, 75-69 1998-99..........(A)..... L, 70-75 1998-99..........(H).... W, 95-75 1999-00..........(A)..... L, 69-72 1999-00..........(H).... W, 79-73 2000-01..........(A).... W, 59-45 2000-01..........(H)......L, 66-71 2000-01..........(N).... W, 70-66 2001-02..........(H).....W, 75-57 2001-02..........(A)..... L, 72-73 2002-03..........(A).... W, 60-58 2002-03..........(H)..... L, 54-64 2003-04..........(A)..... L, 43-54 2003-04..........(H).... W, 78-43 2004-05..........(H).... W, 63-49 2004-05..........(A).... W, 77-63 2004-05..........(N)..... L, 48-55 2005-06..........(A)......L, 63-74 2005-06..........(H).... W, 72-62 2005-06..........(N).... W, 68-56 2006-07..........(H).... W, 80-55 2006-07..........(A).... W, 68-60 2006-07..........(N)......L, 64-81 Gettysburg 0-1 1984-85..........(A)......L, 77-81 Greensboro 19-2 1979-80..........(A).... W, 72-56 1979-80..........(H).... W, 65-56 1979-80..........(N).... W, 65-56 1980-81..........(H)W, 2-0 (forfeit) 1980-81..........(A)W, 2-0 (forfeit) 1981-82..........(A).... W, 80-59 1981-82..........(H).... W, 90-33 1982-83..........(H).. W, 102-40

1982-83..........(A).....W, 76-32 1983-84..........(A).....W, 81-50 1983-84..........(H).... W, 80-64 1984-85..........(H).... W, 70-32 1984-85..........(A)......L, 69-76 1984-85..........(N).... W, 68-49 1985-86..........(H).... W, 85-73 1985-86..........(A).... W, 68-56 1986-87..........(A).....W, 71-61 1986-87..........(H).....W, 72-57 1986-87..........(N).... W, 92-56 1987-88..........(H).... W, 84-64 1987-88..........(A)......L, 74-84 Guilford 11-2 1979-80..........(H).....W, 77-76 1980-81..........(A).....W, 76-65 1981-82..........(H).....W, 94-74 1982-83..........(A).... W, 90-83 1982-83..........(H).... W, 83-64 1983-84..........(H).... W, 85-66 1983-84..........(A).....W, 88-74 1984-85..........(A)..... L, 63-66 1984-85..........(H).... W, 87-79 1985-86..........(H)......L, 59-81 1986-87..........(A).....W, 71-66 1987-88..........(N).....W, 66-61 1988-89..........(H).... W, 84-53 Hampton 1-0 1990-91..........(N).... W, 72-63 Hartford 1-0 1995-96..........(H).... W, 83-75 High Point 9-8 1969-70..........(H).....W, 56-37 1969-70..........(A).....W, 41-37 1970-71 ..........(A)......L, 32-47 1970-71 ..........(H).... W, 42-36 1972-73..........(H).... W, 52-26 1972-73..........(A).... W, 55-45 1972-73..........(N)......L, 44-51 1973-74 ..........(H).... W, 58-44 1974-75 ..........(A).....W, 68-57 1975-76..........(H)......L, 73-97 1975-76..........(A)......L, 72-97 1976-77 ..........(A)......L, 47-86 1977-78..........(H)..... L, 58-90 1986-87..........(H)..... L, 73-96 2004-05..........(H).... W, 70-53 2005-06..........(A)L, 63-65 (ot) 2006-07..........(H).... W, 63-53 Holy Cross 1-0 1994-95..........(H).... W, 86-78 Illinois 0-1 1995-96..........(N)......L, 71-88 Illinois State 1-0 1970-71 ..........(N).... W, 63-39 Iowa State 0-1 1993-94..........(H)..... L, 66-72 James Madison 1-1 1991-92..........(H).... W, 68-65 1992-93..........(A)..... L, 45-63 Kansas State 1-0 1970-71 ..........(N).....W, 53-47 Kean (NJ) 0-1 1987-88..........(N)......L, 71-74 Kent State 0-1 1993-94..........(A)....L, 68-119 Knoxville 0-2 1982-83..........(N)......L, 71-74 1983-84..........(N)......L, 74-82 LeMoyne-Owen 1-0 1984-85..........(N).... W, 84-77 Lenoir-Rhyne 3-1 1982-83..........(A)..... L, 59-67 1983-84..........(H).....W, 90-71 1985-86..........(N).... W, 84-75 1986-87..........(N)W, 71-68 (ot) Liberty 14-4 1986-87..........(H).... W, 87-75 1987-88..........(A)..... L, 90-96 1988-89..........(A)..... L, 86-95 1991-92..........(H).... W, 79-72 1991-92..........(A).....W, 67-47 1992-93..........(A).... W, 50-48 1992-93..........(H).... W, 77-52 1993-94..........(H)......L, 61-67 1993-94..........(A).... W, 64-59 1994-95..........(A).....W, 67-57 1994-95..........(H).....W, 74-54 1995-96..........(H).... W, 84-63 1995-96..........(A).....W, 76-55 1995-96..........(N).... W, 84-60 1996-97..........(H).... W, 80-64


Lincoln Memorial 2-0 1989-90..........(H).....W, 98-97 1990-91..........(A).....W, 76-74 Livingstone 1-0 1971-72..........(H).....W, 67-24 Lock Haven (PA) 1-0 1990-91..........(N).....W, 71-66 Longwood 15-10 1972-73..........(A).... W, 59-52 1973-74 ..........(H).....W, 51-36 1974-75 ..........(A).... W, 70-50 1975-76..........(H)......L, 57-75 1976-77 ..........(A)..... L, 66-67 1977-78..........(H)..... L, 64-75 1978-79..........(H)......L, 68-74 1978-79..........(A)..... L, 50-69 1979-80..........(H)..... L, 68-85 1980-81..........(H)......L, 51-68 1980-81..........(A)..... L, 50-72 1981-82..........(A).....W, 74-67 1982-83..........(H).....W, 63-47 1983-84..........(A).... W, 66-64 1984-85..........(H)......L, 76-97 1987-88..........(H).... W, 78-77 1987-88..........(A).....W, 74-71 1988-89..........(A).... W, 82-58 1988-89..........(H).... W, 86-72 1989-90..........(H).... W, 96-70 1989-90..........(A).... W, 89-79 1990-91..........(H).... W, 95-49 1990-91..........(A)...W, 101-82 2005-06..........(H)..... L, 66-69 2006-07..........(H).....W, 81-50

Mesa (CO) 1-0 1982-83..........(N).....W, 71-62 Methodist 19-1 1979-80..........(A).... W, 87-60 1979-80..........(H).... W, 75-62 1979-80..........(N)..... L, 78-85 1980-81..........(A).....W, 76-65 1980-81..........(H).....W, 71-57 1980-81..........(N).... W, 83-60 1981-82..........(H)...W, 110-42 1981-82..........(A).. W, 103-52 1982-83..........(A).....W, 97-54 1982-83..........(H).. W, 103-38 1983-84..........(H)...W, 116-51 1983-84..........(A).... W, 94-59 1984-85..........(A).... W, 90-60 1984-85..........(H).....W, 71-44 1985-86..........(H).....W, 76-60 1985-86..........(A).....W, 76-73 1986-87..........(A).... W, 84-52 1986-87..........(H).. W, 102-60 1987-88..........(H).... W, 99-54 1987-88..........(A).... W, 85-66 Michigan State 0-1 1991-92..........(H)......L, 71-90 Middle Tennessee State 0-1 2000-01..........(N)..... L, 66-69 Mississippi 0-1 1990-91..........(N)..... L, 58-90 Mississippi State 0-1 1970-71..........(N)..... L, 43-66 Missouri-Rolla 1-0 1989-90..........(N).... W, 66-53

Luther (IA) 1-0 1987-88..........(N).... W, 55-52

Montana 0-1 1997-98..........(N)..... L, 48-70

Lynchburg 4-0 1969-70..........(H).....W, 41-33 1969-70..........(A).....W, 61-50 1970-71 ..........(A).... W, 55-52 1970-71 ..........(H).... W, 58-35

Montana State 0-2 1994-95..........(H)..... L, 56-90 1996-97..........(A)..... L, 60-68

Maine 0-1 2001-02..........(N)..... L, 59-62 Manhattan 1-0 2000-01..........(H).... W, 82-62 Marshall 2-0 1998-99..........(H).....W, 91-75 1999-00..........(A).....W, 71-68 Mars Hill 5-5 1969-70..........(H).... W, 45-40 1970-71 ..........(A)......L, 44-57 1971-72..........(H).....W, 57-47 1972-73..........(N)......L, 54-61 1973-74 ..........(H).....W, 61-47 1974-75 ..........(A)......L, 52-57 1975-76..........(H).... W, 68-62 1976-77 ..........(A)......L, 68-87 1977-78..........(H).... W, 80-73 1978-79..........(H)......L, 61-74 Mary Washington 4-0 1983-84..........(H).....W, 76-61 1984-85..........(A).... W, 85-69 1985-86..........(H).....W, 91-63 1986-87..........(A).....W, 81-44 Maryland 1-1 1998-99..........(A).... W, 63-45 2006-07..........(A)......L, 92-57 Maryland Baltimore County 7-3 1987-88..........(A)......L, 81-83 1993-94..........(H).....W, 74-56 1993-94..........(A)......L, 51-53 1994-95..........(H)......L, 57-59 1994-95..........(A).... W, 55-50 1995-96..........(H).... W, 68-50 1995-96..........(A).... W, 49-45 1996-97..........(A).....W, 71-51 1996-97..........(H).....W, 76-52 1996-97..........(N).... W, 68-50 Maryland-Eastern Shore 2-0 1991-92..........(H).....W, 80-61 1995-96..........(N).....W, 76-39 Massachusetts 1-1 1991-92..........(N).... W, 72-59 2003-04..........(A)..... L, 49-63 Mercer 0-1 1978-79..........(H)..... L, 55-94

Morehead State 0-1 1992-93..........(N)......L, 61-72 Morgan State 1-0 1990-91..........(N).....W, 61-55 Muhlenburg (PA) 1-0 1987-88..........(N).....W, 81-39 Navy 1-0 1988-89..........(A).... W, 73-66 North Carolina A&T 13-5 1977-78..........(A)W, 69-68 (ot) 1978-79..........(H)..... L, 63-67 1987-88..........(A)..... L, 60-79 1988-89..........(H).... W, 80-56 1988-89..........(A)..... L, 65-67 1989-90..........(H).... W, 80-66 1989-90..........(A)..... L, 54-67 1990-91..........(H)L, 64-65 (ot) 1992-93..........(N).... W, 64-48 1993-94..........(N).... W, 86-84 1994-95..........(N).... W, 79-69 1995-96..........(N).....W, 69-57 1996-97..........(N).... W, 63-54 1997-98..........(N).... W, 79-52 1998-99..........(N).... W, 58-52 1999-00..........(N).....W, 74-38 2000-01..........(N).....W, 85-57 2001-02..........(N).... W, 88-45 North Carolina Central 2-0 1988-89..........(H).....W, 89-71 1989-90..........(A).... W, 80-66 North Carolina State 1-11 1972-73..........(H).... W, 75-52 1975-76..........(H)......L, 71-80 1976-77 ..........(H)......L, 61-84 1976-77 ..........(A)......L, 49-81 1977-78..........(A)......L, 41-98 1977-78..........(H)......L, 50-77 1978-79..........(H)....L, 39-116 1978-79..........(A)....L, 34-111 1978-79..........(N)....L, 47-131 1997-98..........(A)......L, 61-85 1999-00..........(A)..... L, 58-75 2005-06..........(A)......L, 46-76 North Carolina Wesleyan 19-1 1979-80..........(A).....W, 73-71 1979-80..........(H).... W, 78-62 1980-81..........(A)......L, 76-82 1980-81..........(H).. W, 102-82 1981-82..........(H).....W, 71-68 1981-82..........(A).... W, 79-70

1981-82..........(N).... W, 69-66 1982-83..........(A).... W, 78-60 1982-83..........(H).... W, 84-61 1983-84..........(H).... W, 78-72 1983-84..........(A).... W, 98-93 1984-85..........(A).... W, 79-65 1984-85..........(H).. W, 106-88 1985-86..........(H).... W, 85-82 1985-86..........(A).... W, 86-59 1986-87..........(H).....W, 89-74 1986-87..........(A).... W, 95-80 1987-88..........(A).... W, 90-82 1987-88..........(H).. W, 121-89 1987-88..........(N).. W, 103-64 UNC Asheville 14-1 1991-92..........(A).... W, 85-72 1991-92..........(H).....W, 86-74 1992-93..........(H).....W, 81-67 1992-93..........(A).....W, 80-41 1993-94..........(A).... W, 86-69 1993-94..........(H).... W, 90-54 1993-94..........(N).....W, 77-74 1994-95..........(A).....W, 67-61 1994-95..........(H).... W, 86-72 1995-96..........(H).... W, 73-54 1995-96..........(A)......L, 53-71 1996-97..........(A).....W, 76-72 1996-97..........(H).... W, 70-52 1997-98..........(A).....W, 78-61 1998-99..........(H).... W, 69-53 UNC Chapel Hill 5-10 1970-71..........(A).... W, 58-42 1970-71..........(H).....W, 46-41 1971-72..........(A).... W, 52-38 1972-73..........(H).... W, 59-55 1973-74 ..........(A)..... L, 44-54 1973-74 ..........(H).... W, 66-64 1974-75 ..........(H)......L, 57-71 1975-76..........(A)..... L, 45-66 1976-77 ..........(H)..... L, 75-95 1976-77 ..........(A)......L, 45-74 1977-78..........(H)......L, 69-76 1977-78..........(A)..... L, 68-92 1978-79..........(H)..... L, 40-99 1978-79..........(A)......L, 57-99 2006-07..........(A)... L, 48-103 UNC Pembroke 4-2 1978-79..........(A)..... L, 56-89 1988-89..........(H).....W, 89-76 1988-89..........(A)......L, 77-92 1989-90..........(A).....W, 76-66 1989-90..........(H).... W, 93-62 1990-91..........(H).... W, 77-68 UNC Wilmington 10-4 1982-83..........(H)..... L, 67-84 1983-84..........(A)... L, 69-100 1988-89..........(H).....W, 86-76 1988-89..........(A).... W, 92-89 1989-90..........(H).....W, 97-87 1990-91..........(A)..... L, 70-86 1991-92..........(A).....W, 96-61 1991-92..........(H).... W, 85-82 1992-93..........(H).... W, 72-54 1992-93..........(A).... W, 70-56 1993-94..........(H).... W, 77-54 2004-05..........(H).... W, 79-68 2005-06..........(A)..... L, 54-65 2006-07..........(H).....W, 74-46

1995-96..........(A).....W, 71-64 1996-97..........(H).. W, 103-62 1996-97..........(A)...W, 101-68 1996-97..........(N).... W, 83-70 1998-99..........(N)..... L, 64-68

Tampa 1-0 1988-89..........(A).... W, 89-63

Randolph-Macon 1-0 1988-89..........(A).....W, 87-71

Temple 0-1 1993-94..........(H)L, 72-77 (ot)

Rhode Island 1-0 1996-97..........(N).... W, 87-63 Rice 0-2 2000-01..........(H)..... L, 46-50 2001-02..........(A)......L, 47-61 Richmond 0-1 1983-84..........(A)..... L, 72-82

Tennessee 3-0 1969-70..........(N).....W, 53-47 1971-72..........(N).....W, 51-36 1975-76..........(N).....W, 81-79

Roanoke 4-0 1979-80..........(A).... W, 87-80 1984-85..........(H).... W, 93-79 1985-86..........(A).....W, 76-61 1986-87..........(H).....W, 81-49

Towson 5-3 1988-89..........(A).... W, 90-87 1992-93..........(N).....W, 81-69 1993-94..........(H).... W, 70-48 1993-94..........(A)......L, 63-76 1993-94..........(N).....W, 74-69 1994-95..........(H).....W, 71-58 1994-95..........(A)L, 70-72 (3ot) 1998-99..........(N)......L, 76-77

Rust (MI) 2-2 1982-83..........(N).....W, 68-61 1984-85..........(A)..... L, 66-70 1985-86..........(N)......L, 61-99 1987-88..........(N).... W, 66-64 St. Andrews 18-4 1979-80..........(A).... W, 88-79 1979-80..........(H).....W, 59-57 1979-80..........(N).... W, 86-79 1980-81..........(A)......L, 57-73 1980-81..........(H).....W, 71-54 1980-81..........(N)......L, 74-93 1981-82..........(A).... W, 86-82 1981-82..........(H).....W, 74-67 1981-82..........(N).....W, 91-71 1981-82..........(N).....W, 71-63 1982-83..........(H).... W, 90-67 1982-83..........(A)......L, 74-77 1982-83..........(N).....W, 75-47 1983-84..........(A)..... L, 67-72 1983-84..........(H).... W, 93-80 1983-84..........(N).....W, 91-67 1985-86..........(H).... W, 73-44 1985-86..........(A).... W, 90-49 1986-87..........(H).. W, 103-46 1986-87..........(A)...W, 100-51 1987-88..........(A).... W, 80-63 1987-88..........(H).... W, 94-59 St. Augustine’s 3-1 1988-89..........(H).... W, 83-82 1988-89..........(A)..... L, 67-72 1989-90..........(H)...W, 105-91 1990-91..........(A).....W, 92-81 St. Bonaventure 1-0 1999-00..........(N).....W, 65-57 St. Francis (PA) 0-1 2003-04..........(H)..... L, 55-80 St. Mary’s (CA) 0-1 1999-00..........(A)..... L, 56-69

Norfolk State 0-2 1990-91..........(H)..... L, 73-75 1990-91..........(A)..... L, 62-72

South Carolina 4-2 1970-71 ..........(N).....W, 58-51 1971-72..........(N).... W, 54-38 1972-73..........(N).... W, 67-60 1974-75 ..........(H)..... L, 54-70 1974-75 ..........(A)......L, 66-71 1974-75 ..........(N).... W, 86-84

Ohio (1-0) 2005-06..........(H).... W, 69-52

South Carolina State 1-0 1996-97..........(H).... W, 99-42

Pfeiffer 3-1 1980-81..........(H)......L, 55-74 1981-82..........(A).....W, 80-74 1982-83..........(H).....W, 81-52 1988-89..........(H).....W, 96-61

USC Spartanburg 2-1 1989-90..........(H)..... L, 56-66 1990-91..........(H).... W, 73-69 1990-91..........(A).... W, 72-66

Pittsburgh 0-1 2004-05..........(H)..... L, 55-62 Pitt-Johnstown 1-1 1990-91..........(A)......L, 87-93 1990-91..........(H).... W, 80-73 Pomona-Pitzer (CA) 1-0 1981-82..........(N).... W, 77-66 Providence 1-1 1994-95..........(N). L, 100-105 2006-07..........(H).... W, 72-68 Radford 10-5 1975-76..........(N).... W, 68-54 1992-93..........(H).....W, 74-57 1992-93..........(A)......L, 57-62 1993-94..........(H).....W, 78-61 1993-94..........(A)......L, 69-71 1993-94..........(N)..... L, 78-83 1994-95..........(A).....W, 71-57 1994-95..........(H).....W, 79-71 1994-95..........(N)..... L, 63-68 1995-96..........(H).... W, 94-79

Susquehanna 1-0 1981-82..........(H).....W, 74-66

Tennessee-Martin 0-1 1971-72 .........(N)..... L, 50-54

Trenton State (NJ) 1-0 1985-86..........(H).....W, 76-68 Tulane 0-3 1995-96..........(H)......L, 69-71 1996-97..........(A)..... L, 46-89 2002-03..........(A)..... L, 43-63 UCLA 0-1 1994-95..........(N)..... L, 70-72 Virginia 0-3 1981-82..........(H)..... L, 39-78 1982-83..........(A)..... L, 50-92 2003-04..........(A)......L, 44-71 VA Commonwealth 1-0 1983-84..........(H).... W, 83-69 Virginia State 1-1 1990-91..........(H).....W, 91-61 1990-91..........(A)......L, 69-81 Virginia Tech 1-6 1991-92..........(A)..... L, 65-84 1992-93..........(H).... W, 63-54 1996-97..........(A)..... L, 86-89 1997-98..........(H)......L, 74-88 2001-02..........(A)......L, 46-51 2002-03..........(A)..... L, 46-54 2006-07..........(N)..... L, 45-56 Virginia Wesleyan 16-2 1981-82..........(H).... W, 83-58 1981-82..........(A).... W, 68-55 1982-83..........(A).... W, 73-53 1982-83..........(H).....W, 81-60 1983-84..........(H)......L, 68-76 1983-84..........(A)L, 93-100 (ot) 1983-84..........(N).... W, 85-80 1983-84..........(N).... W, 70-69 1984-85..........(A).... W, 83-59 1984-85..........(H).... W, 94-69 1985-86..........(H).....W, 87-77 1985-86..........(A).....W, 61-58 1985-86..........(A).... W, 84-75 1986-87..........(A).... W, 78-65 1986-87..........(H).... W, 84-57 1987-88..........(H).... W, 89-66 1987-88..........(A).... W, 80-78 1987-88..........(N).... W, 75-72

South Florida 1-2 1988-89..........(A)..... L, 66-96 1991-92..........(H)......L, 71-84 1992-93..........(A).....W, 74-67

Wake Forest 6-6 1969-70..........(A).... W, 34-26 1969-70..........(H).....W, 50-21 1973-74 ..........(A)..... L, 60-62 1974-75 ..........(H).....W, 77-61 1975-76..........(A)..... L, 67-69 1976-77 ..........(H).... W, 65-59 1977-78..........(H).... W, 86-52 1978-79..........(A)......L, 76-84 1980-81..........(A)..... L, 56-92 1994-95..........(A)......L, 67-71 1995-96..........(N)......L, 55-97 2005-06..........(A).... W, 70-64

Southern Connecticut State 0-1 1970-71 ..........(N)......L, 47-54

Warren Wilson 1-0 1979-80..........(H).... W, 73-49

Southern Maine 1-0 1987-88..........(N).... W, 68-66

Washington 1-0 1999-00..........(N).....W, 67-57

Southern Methodist 0-1 2002-03..........(N)..... L, 49-62

West Texas State 0-1 1989-90..........(N)..... L, 75-83

Southwest Texas State 0-2 1992-93..........(A)..... L, 56-80 1993-94..........(H)..... L, 48-64

West Virginia 1-1 2004-05..........(A)..... L, 39-67 2005-06..........(H).... W, 72-70

Stetson 1-0 1992-93..........(H).... W, 69-62

Western Carolina 21-21 1969-70..........(H)..... L, 39-52 1970-71 ..........(N)......L, 66-74 1970-71 ..........(N)......L, 51-62

South Alabama 0-2 1992-93..........(N)..... L, 70-73 1992-93..........(N)..... L, 62-66

1971-72..........(A)......L, 47-53 1971-72..........(N).....W, 57-52 1972-73..........(A).....W, 41-31 1973-74 ..........(H)..... L, 65-69 1973-74 ..........(N)..... L, 52-53 1974-75 ..........(N).....W, 76-73 1974-75 ..........(N)..... L, 66-82 1975-76..........(H)..... L, 60-82 1975-76..........(N)......L, 61-75 1976-77 ..........(A)..... L, 60-68 1976-77 ..........(N)..... L, 58-67 1977-78..........(A)......L, 59-91 1978-79..........(A)..... L, 62-83 1983-84..........(H).... W, 75-50 1990-91..........(A).....W, 84-71 1991-92..........(A).... W, 87-79 1991-92..........(H).....W, 74-60 1994-95..........(H).... W, 78-66 1997-98..........(A).....W, 81-61 1997-98..........(H).... W, 90-48 1997-98..........(N).... W, 86-54 1998-99..........(H).....W, 74-56 1998-99..........(A)..... L, 63-75 1999-00..........(A).....W, 85-51 1999-00..........(H).... W, 78-65 2000-01..........(H).... W, 67-60 2000-01..........(A).....W, 71-45 2001-02..........(H).....W, 74-70 2001-02..........(A)..... L, 67-69 2002-03..........(A)......L, 74-82 2002-03..........(H)..... L, 54-64 2003-04..........(H).... W, 66-53 2003-04..........(A)..... L, 44-66 2004-05..........(A).... W, 72-58 2004-05..........(H)......L, 51-55 2005-06..........(A).... W, 69-60 2005-06..........(H).....W, 72-57 2006-07..........(H)..... L, 53-52 2006-07..........(A)..... L, 67-73 William & Mary 3-0 1982-83..........(H).... W, 89-60 1983-84..........(A)W, 61-56 (ot) 1988-89..........(A).... W, 73-59 Wingate 1-1 1979-80..........(H).... W, 88-70 1980-81..........(A)......L, 48-76 Winthrop 19-11 1969-70..........(H).... W, 50-46 1970-71 ..........(H).... W, 40-35 1970-71 ..........(A)......L, 47-52 1971-72..........(H)......L, 45-57 1972-73..........(A).... W, 52-40 1972-73..........(A)......L, 42-61 1972-73..........(H).... W, 48-43 1973-74 ..........(H).... W, 55-38 1974-75 ..........(A)..... L, 52-64 1974-75 ..........(A).... W, 79-70 1975-76..........(H)......L, 69-74 1976-77 ..........(A)....L, 77-101 1976-77 ..........(A)......L, 74-81 1977-78..........(H)..... L, 64-69 1978-79..........(A)... L, 58-102 1988-89..........(H).... W, 87-65 1989-90..........(A).... W, 73-63 1990-91..........(H).... W, 95-79 1991-92..........(A).....W, 84-81 1992-93..........(H).... W, 88-48 1993-94..........(A).... W, 68-58 1993-94..........(H).... W, 84-67 1994-95..........(H).....W, 83-76 1994-95..........(A).... W, 68-60 1995-96..........(H).....W, 96-57 1995-96..........(A)W, 86-85 (ot) 1995-96..........(N)..... L, 69-72 1996-97..........(A)......L, 68-74 1996-97..........(H).... W, 90-65 2004-05..........(H).... W, 62-52 Wofford 22-1 1990-91..........(A).....W, 97-56 1990-91..........(H).... W, 95-50 1997-98..........(A)W, 93-86 (ot) 1997-98..........(H).....W, 74-53 1998-99..........(H).... W, 90-59 1998-99..........(A).... W, 66-63 1998-99..........(N).... W, 95-58 1999-00..........(A).... W, 60-50 1999-00..........(H).... W, 64-61 2000-01..........(H).... W, 77-50 2000-01..........(A).....W, 61-47 2001-02..........(H).....W, 81-75 2001-02..........(A).....W, 67-61 2002-03..........(A)......L, 50-61 2002-03..........(H).....W, 76-43 2003-04..........(H).... W, 62-50 2003-04..........(A).... W, 59-53 2004-05..........(A).... W, 69-52 2004-05..........(H).... W, 70-55 2005-06..........(H).... W, 84-64 2005-06..........(A).... W, 67-55 2006-07..........(A).... W, 62-54 2006-07..........(H)W ,71-66 (ot)

2007-08 UNCG Women’s Basketball Media Guide • 87

All-Time Results

Loyola (MD) 2-1 1991-92..........(N).....W, 93-71 1994-95..........(N)......L, 68-76 2002-03..........(H).....W, 61-47

Meredith 4-0 1979-80..........(A).... W, 84-57 1979-80..........(H).... W, 66-52 1980-81..........(A).... W, 60-45 1980-81..........(H).... W, 68-50

UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.c

1996-97..........(A).... W, 86-70 1996-97..........(N)..... L, 82-89 2006-07..........(N).... W, 67-59


AAAA Name Years Hometown (if available) Albergine, Nancy................................................................... Alexander, Mary Lida.............. 1969-71 ................................ Andrews, Pam........................ 1983-84. Roanoke Rapids, VA Armstrong, Nicky.................... 1997-01 Lincoln University, PA Augustine, Jeanie..........................................Greensboro, NC

All-Time Roster

BBBB Banner, TaShama................. 2007-...........Bladenboro, NC Barnhardt, Cindy................................................................... Bell, Jeanette......................... 1979-81 ............... Macon, NC Bell, Julie............................... 1985-86..............Raleigh, NC Blair, Caroline........................ 2002-06.................Trinity, NC Blazevich, Michele ................. 1981-84 .............. Sterling, VA Bodie, Peg ..............................................Clarence Center, NY Boggs, Jennifer ...................... 1984-85..........High Point, NC Boone, Kristen..................... 2004-....Upper Marlboro, MD Bowman, Debbie ................................................ Atlanta, GA Boyles, Shaaron..................... 1991-93 .............. Stanley, NC Brediger, Biz .......................... 1994-98...........Massillon, OH Bright, Julie............................ 1988-92..........Forest City, NC Britt, Stephanie ..................... 2001-05 ............... Wilson, NC Brooks, Kemena .................. 2004-............ Accokeek, MD Brown, Beth........................... 1980-81 ........Greensboro, NC Brown, Kenya......................... 1993-94............ Mt. Holly, NC Burnett, Cindy........................ 1978-79 .....St. Petersburg, FL Butler, Marybeth..............................................Cherry Hill, NJ Byrd, Jasmine ........................ 2003-07............ Dumfries, VA CCCC Capps, Jill.............................. 1981-85 ............. Raeford, NC Carlton, Sue........................................................ Stanley, NC Carter, Bev............................. 1980-81 .................. Elkin, NC Carter, Cheryl......................... 1984-88......... Winchester, VA Cauble, Sonja ........................ 1992-93.......Jeffersonville, IN Cawley, Marie ........................ 1979-83 ............ Scranton, PA &KDIĂ&#x20AC;Q9LYLDQ....................................................................... Chamberlain, Meghan.......... 2004-............. Lake Mary, FL Chlad, Cassie..................................................Timonium, MD Cole, Jai................................. 1993-97 ............... Reston, VA Coltrane, Renee ..................... 1981-85 ................Colfax, NC Connor, Natalie...................... 1982-87 ................ Vinton, VA Cook, Brandi.......................... 1998-99........Randleman, NC Corpening, Amy .......................................... Granite Falls, NC Crabtree, Stacy...................... 1995-96............. Durham, NC Crissman, Kathy.................................................................... Crouch, Karen........................ 1982-85............Asheville, NC Current, Ashley....................... 2002-06.............. Orlando, FL DDDD Degree, Janele ..................................................... Shelby, NC DelCampo, Katie.................... 1997-01 ...........Rehoboth, DE Dillard, Mary...................................................Cullowhee, NC Dixon, Jasmine .................... 2004-..................Reston, VA Dodgen, Brianne.................... 1998-02.......... Sevierville, TN Drake, Cescili ........................ 1991-95 ........Ellicott City, MD Durrill, Beth ........................... 1987-91 ..............Radford, VA EEEE Eaton, Amanda ...................... 2001-05 ........... Wheeling, WV Elliott, Kymm ......................... 1990-92............ Pinetops, NC Elmore, Margaret ................... 1976-78 ............ Madison, NC Engelmann, Wendy ................ 1981-85 ...........Manassas, VA Essex, Carnice........................ 1985-86...........Manassas, VA Essick, Ellen .......................... 1982-84...........Lexington, NC Evans, Mandy......................... 1988-89......Staffordsville, VA FFFF Ferguson, Sam....................... 1995-98..........Collinsville, VA Fisher, Denise ........................ 1979-81 .. Winston-Salem, NC Floyd, Monique .................... 2007-.............. Fairmont, NC Frazier, Brittany................... 2005-...................Powell, TN Frazier, Shawne...................... 1983-84.............Roanoke, VA French, Jacqueline ................. 1974-78 ....................Troy, NC Foster, Samika....................... 1998-02............. Durham, NC Fowler, Leslie ..............................................Silver Spring, MD GGGG Galvin, Kristen ....................... 1976-78 ................ Dover, MA Gillean, Jan............................ 1974-78 ........... Salisbury, NC Girstautaite, Agne ............... 2006-.......Kaunas, Lithuania Gold, Ginger........................... 1975-78 ........... Salisbury, NC Grimsley, Gini ...................... 2005-.............. Fairmont, NC Groff, Diane ........................... 1980-81 .............Concord, NC

88 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

Gwaltney, ChoRhonda............ 1997-01 ............... Dudley, NC Goodson, Belinda .................. 1996-00.........Timberlake, NC Goodson, Melinda.................. 1996-00.........Timberlake, NC HHHH Hackney, Marti............................................... Washington, NC Hart, Jennifer ......................... 1999-03............. Durham, NC Haywood, Micky..................... 1989-93.....Kill Devil Hills, NC Henderson, Jana .................... 1988-92. Colonial Heights, VA Henderson, Peggy .................. 1975-79 ...........Matthews, NC Henson, Vickie ....................... 1992-94.............. Canton, NC Hobbs, Avis............................ 1976-78 ........ Fayetteville, NC Holec, Chris ........................... 1986-90.......... Greenville, NC Honeycutt, Megan.................. 2000-04........... Salisbury, NC Horton, Donna .............................................. Jacksonville, FL Howard, Cindy....................................................................... Hyson, Lakiah...................... 2006-............ Accokeek, MD JJJJ Jackson, Becky ..................................................................... Jackson, Shanika................... 2002-06............ Hampton, VA Jernigan, Brenda................................................................... Johnson, Laura....................... 1976-79 ..............Raleigh, NC Johnson, Loretta .................... 1978-80 ............ Siler City, NC Johnson, Stephanie................ 1987-90 ..........High Point, NC Johnston, Cameron ...........................................Gastonia, NC Jolly, Susan............................................ Black Mountain, NC Jones, Dana ........................... 1992-97 ...........Reidsville, NC Jones, Deborah....................................... Winston-Salem, NC Jones, Ellie............................................................................ Jordan, Annika....................... 1997-99 .......... Lynchburg, VA Jordan, Karen ........................ 1986-90.................Huntly, VA Joyner, LaToya........................ 2002-04..............Windsor, CT KKKK Karriker, Miriam ..................... 1986-87 ........Mooresville, NC King, Serena .......................... 1993-96........ Mt. Sterling, KY Kreter, Natalie ....................... 1996-99......... Jenkintown, PA Knippenberg, Lisa.................. 1980-80......Cumberland, MD LLLL Lambert, Jacinda ................... 2000-04.............. Boston, MA Landis, Laurie ....................................................................... Lasley, Carrie ......................... 1985-86..........Burlington, NC Latham, KaLeah..................... 2003-07................Athens, TN Lavelle, Kristin ....................... 1989-92............ Liverpool, NY Law, Kellan ............................ 2001-04 ...... Morgantown, WV Lemon, Sandra ...................... 1977-80 ........Spring Lake, NC Lewis, Jennifer ....................... 1994-98.............Newport, NC Ling, Ashley ......................... 2005-............ Centreville, VA Lowe, Carol............................ 2002-04...... Rockingham, NC MMMM Maffucci, Jackie..................... 1980-83..........Glen Ridge, NJ Mangus, Jody......................... 1979-83 .......... Burlington, NJ Mannon, Denise..................... 1985-88.................. Floyd, VA Martin, Lindy .................................................. Crossnore, NC Marshall, Emmy ..........................................6XPPHUĂ&#x20AC;HOG1& McGuinn, Shawnelle .............. 1988-89 Highland Springs, VA Messick, Jo Ann ..................... 1972-76 ......... N. Augusta, SC Michael, Kim ......................... 1999-00........Greensboro, NC Minga, Zulene..............................................Spring Hope, NC Moon, Sue ...............................................Hendersonville, NC Moore, Alisa .......................... 1992-96........... Charlotte, NC Moore, Julie ........................... 1992-96...........Wadhams, NY Moose, Karen ....................................................................... Morgan, Kim.......................... 1975-78 ........... Salisbury, NC Morris, Donna............................................... Kannapolis, NC Mouberry, Joyce .............................................Cammeron, NC Mullins, Ashley .................... 2005-................Honaker, VA Murray, Nicole........................ 1999-03............ Rose Hill, NC

Polk, Angie ............................ 1985-89........Greensboro, NC Pope, Betty ........................................................................... Poupart, Bridget .................... 1985-86..............Roswell, GA Powell, Lynn........................... 1980-81 ........ Weaverville, NC Puckett, Brenda.................................................................... QQQQ Qually, Kim ............................ 1992-93............Olds, Alberta RRRR Reed, Lindsey ........................ 2000-04................ Dublin, VA Reep, Suzanne....................... 1979-82 ........ Jacksonville, FL Reid, Sandi............................ 1998-02..............Spencer, VA Rhodes, Mona ..............................................Greensboro, NC Richardson, Vanessa.............. 1980-81 ..............Kinston, NC Riddick, Sherrill .................................................................... Robertson, Lisa...................... 1978-81 ............Nashville, NC Robinson, Niki ....................... 1994-96........Greensboro, NC Rudy, Sherrill ......................... 1978-79 ........ Middletown, NJ SSSS Saunders, Christia ................. 1990-91 .........Charleston, WV Seidel, Lisa............................ 1983-86........Wyomissing, PA Seufert, Susan....................... 1984-88............ Bellmore, NY Shade, Cynthia ...................... 1993-94.........Morganton, NC Smith, Katrina........................ 1996-00....Morehead City, NC Smith, Kendra ..................... 2007-.............Columbus, GA Ruby Smith ............................ 1983-87 ........Appomattox, VA Snead, Donna........................ 1986-90...............Bassett, VA Sossman, Beth ..................................................................... Sousa, Kelsi........................... 2001-02 ..........Santa Ana, CA Strange, Cathy ....................... 1974-78 ........ Fayetteville, NC Strickland, Cristi .................... 2000-02...Hendersonville, NC Stowe, Melody ...................................................................... Sydney, Sherry ....................... 1981-83 ........ Fayetteville, NC TTTT Thomas, Cindy ....................... 1979-80 ......... Peachland, NC Tolbert, Brenda ...................... 1981-85 ..................Willis, VA Tompkins, Kathleen................ 1985-89 Pleasant Garden, NC Troutman, Vickie ............................................ Statesville, NC Tucker, Marty ................................................ Stokesdale, NC VVVV Viverette, Rebecca ................. 1994-98............... Wilson, NC WWWW Wadelington, Sharniece ....... 2006-............. Greenville, SC Walter, Stefanie ..................... 1992-96.....North Canton, OH Weaver, Julia.......................... 1984-88..........High Point, NC West, Amber .......................... 1996-98............Galesburg, IL White, Gail............................. 1990-92.................Trinity, NC Whitehurst, Christy................. 1987-90 . Colonial Heights, VA Wiggs, Rita ............................ 1971-75 ........ Fayetteville, NC Wilbanks, Alicia ..................... 1989-90.......... Carrollton, GA Wilhelmy, Cindy ..................... 1978-79 .......... Bethesda, MD Williams, Jessica.................... 2000-02........ Wilmington, NC Wilson, Tina ........................... 1990-93..........High Point, NC Womack, Johanna................ 2007-..........Jacksonville, NC YYYY Young, Shannon..................... 1990-91 .........Henderson, NC Young, Tracey......................... 1988-91 .........Henderson, NC ZZZZ Jo Zerger................................ 1990-94.............. Canton, OH

Current team members in bold

NNNN Norton, Candace................................................................... OOOO Ochs, Sadie ........................... 1994-98........ Garden City, KS Orsett, Jennifer ...................... 1978-80 ...................Cary, NC Otamiri, Irene......................... 2003-07.......... Lund, Sweden PPPP Parker, Anna .......................... 1976-79 ..............Monroe, NC Person, Gayle........................................................................ Peschel, Carol........................ 1981-82 .............Roanoke, VA Peters, Catey ......................... 1998-00........Greensboro, NC

This all-time roster, like all record documents in this publication, is a work in progress. Please contact the UNCG Sports Information staff if you have information that you feel would be helpful in building this guide.


This Is UNCG


University History The University has a rich history. It was chartered Feb. 18, 1891, as the State Normal and Industrial School (later ColOHJH WKHĂ&#x20AC;UVWVWDWHVXSSRUWHGVFKRROIRUWKHKLJKHUHGXFDWLRQRIZRPHQLQ1RUWK&DURlina. The institution came into being as a direct result of a crusade made by Charles Duncan McIver on behalf of the education of women. Other pioneers in public school education â&#x20AC;&#x201D; notably, Charles B. Aycock, Edwin A. Alderman, and James Y. Joyner â&#x20AC;&#x201D; came to Dr. McIverâ&#x20AC;&#x2122;s assistance; but more than any other individual, the University owes its foundation to him. In the past century the Universityâ&#x20AC;&#x2122;s mission has evolved, as suggested with its sequence RIQDPHV,WZDVNQRZQĂ&#x20AC;UVWDVWKH6WDWH1RUPDODQG,QGXVWULDO6FKRRODQGDIWHUDVWKH State Normal and Industrial College until 1919. During the period 1919-1931 it was known as the North Carolina College for Women, and was the Womanâ&#x20AC;&#x2122;s College of the University of North Carolina from 1932 to 1963. It is warmly remembered as â&#x20AC;&#x153;the WCâ&#x20AC;? by its many alumnae of the period. During the years 1932-1963 the University was one of the three branches of the Consolidated University of North Carolina. The other branches included The University of North Carolina (at Chapel Hill) and the North Carolina State College of Agriculture and Engineering (at Raleigh). In 1962, the Board of Trustees recommended that the Greensboro campus become coeducational at all levels of instruction beginning with the fall of 1964. Subsequently, by act of the General Assembly in the Spring of 1963, the name of the institution was changed to The University of North Carolina at Greensboro. In December of 1934, during the years of the Consolidated University, the Womanâ&#x20AC;&#x2122;s College Section of Phi Beta Kappa was installed. On February 17, 1956 Epsilon Chapter of North Carolina was installed as an extension of the UNC-Chapel Hill chapter. In 2006, the chapter was voted the Best in the Nation among public universities by the national society. UNCG is one of only six higher education institutions in the state with a chapter of Phi Beta Kappa. In October of 1971, the North Carolina General Assembly adopted legislation which combined all 16 of the state-supported institutions of higher education into a single University of North Carolina. The UNC system is governed by a Board of Governors and administered by a president. Each constituent institution has a separate Board of Trustees and is administered by a chancellor. The crusader for founding the institution, Charles Duncan McIver, served as LWVĂ&#x20AC;UVWFKLHIH[HFXWLYHRIĂ&#x20AC;FHUZLWKWKHWLWOHRI3UHVLGHQW%\DFWRIWKH%RDUGRI Trustees in 1945, the title was changed to Chancellor. Dr. Patricia A. Sullivan beFDPH81&*¡VĂ&#x20AC;UVWZRPDQFKDQFHOORULQ-DQXDU\VXFFHHGLQJ'U'HEUD: Stewart, Dean of the Graduate School at North Carolina State University, who was named Interim Chancellor in the summer of 1994. 'XULQJ LWV Ă&#x20AC;UVW VHYHQ GHFDGHV WKH LQVWLWXWLRQ¡V PLVVLRQ ZDV WR SUHSDUH women, primarily undergraduates, for the most effective living of that day. Today that goal â&#x20AC;&#x201C; effective living â&#x20AC;&#x201C; remains the same, but its scope has been greatly expanded. As UNCG, it now offers men and women 163 graduate and undergraduate programs and provides opportunities to apply classroom learning to real life situations through internships and practica. It also offers students the chance to tailor-make their own programs of study based on individual needs and goals. Although contemporary in its educational program, UNCG is also realistic. In its effort to prepare graduates for effective OLYLQJ LW KDV EXLOW LQWR LWV SURJUDP WKH Ă H[LELOLW\ QHHGHG WR meet the rapidly changing needs of society. UNCG, therefore, ZLOOUHPDLQDXQLYHUVLW\LQWUDQVLWLRQQRWVDWLVĂ&#x20AC;HGZLWK\HVWHUday or today, but always looking toward tomorrow.

This is UNCG

NCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

by â&#x20AC;&#x153;The Princeton Reviewâ&#x20AC;? among best bargain public universities

With a record number of 16,386 students enrolled for Fall 2007, a dedicated faculty and staff numbering more than 2,000, and exciting new developments underway, UNCG is rapidly taking its SODFHDVRQHRIWKHĂ&#x20AC;QHVWLQVWLWXWLRQVRIKLJKHUOHDUQLQJLQWKHFRXQWU\ 7KH 8QLYHUVLW\ RI 1RUWK &DUROLQD DW *UHHQVERUR LV FODVVLĂ&#x20AC;HG E\ 7KH &DUQHJLH )RXQGDtion as a Research University with High Research Activity. The University was established in 1891 and became coeducational in 1963. The 210-acre campus is located one mile from the center of Greensboro, a city of 240,995. The Greensboro/Winston-Salem/High Point Metropolitan Statistical Area, commonly known as â&#x20AC;&#x153;The Triadâ&#x20AC;? has a population of approximately 1.5 million.

90 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide


A statue of Charles McIver, the universityâ&#x20AC;&#x2122;s founder, sits in the middle of campus.

rated UNCG the second-best bargain in its â&#x20AC;&#x153;The Best Collegesâ&#x20AC;? guide. It marked the sixth-straight UNCG appeared in the guide, and its highestever rating. UNCG was also ranked in the Top 50 public universities by Consumerâ&#x20AC;&#x2122;s Digest, making it the only institution to appear in both rankings (Princeton Review and Consumerâ&#x20AC;&#x2122;s Digest). In October 2004, â&#x20AC;&#x153;Cosmo GIRLâ&#x20AC;?, a magazine geared towards young women, rated UNCG one of the Top 50 institutions in America. For its study, the magazine focused RQ VSHFLĂ&#x20AC;F IDFWRUV LPSRUWDQW WR IHPDOH VWXdents: small class size, prominent female faculty, strong womenâ&#x20AC;&#x2122;s athletic programs, a career center that facilitates internship opportunities, leadership options among clubs and activities and an active alumni network. 7KHĂ&#x20AC;QDOLVWVZHUHVHOHFWHGIURPFROOHJHV and universities. In-state tuition and room and board rates for UNCG are just over $10,000 per year, while out-ofstate rates are just over $20,000 per year. Campus life is enriched by a â&#x20AC;&#x153;small collegeâ&#x20AC;? atmosphere and many extracurricular and coeducational activities. There are more than 130 student organizations, an active Student Government, fraternities and sororities, and a Campus Recreation program 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guideâ&#x20AC;˘ 91

This is UNCG

Of the more than 16,300 students enrolled in the fall of 2007, 68 percent were female. In addition, 21 percent of the undergraduate student body and 14 percent of the graduate student body were minorities. Since 2000, UNCGâ&#x20AC;&#x2122;s enrollment has grown nearly 3,500 students. This fall, UNCG enrolled a record 2,446 new freshman, 45 percent of which ranked in the top quarter of their high school graduating class. In addition, 53 percent of the incoming freshman class had a high school GPA of 3.5 or higher (on a 4.0 scale). The University also enrolled 1,368 new transfer students. )URPWKRVHVWXGHQWVĂ&#x20AC;UVWHQUROOHGLQWKHIDOORISHUFHQWUHWXUQHG in the fall of 2006. Among the more than 16,300 students at UNCG, 31 percent of the student body lives in on-campus housing. Undergraduates have more than 100 areas of study from which to choose a major leading to one of six undergraduate degrees. In addition, there are 63 masterâ&#x20AC;&#x2122;s degrees and 23 doctoral degrees offered. Among the more than 1,000 members of the faculty, nearly three-fourths are full-time. Nearly 80 percent of the faculty hold doctorates or other terminal degrees. In the 2006 academic year, faculty engaged in 6,466 scholarly or creative works and published 56 books and 548 refereed articles. Faculty members earned 220 grants, as well. In all, the UNCG faculty submitted 316 research proposals totalling $99.7 million. Typically, UNCG awards more than 2,000 bachelorâ&#x20AC;&#x2122;s and nearly 1,000 masterâ&#x20AC;&#x2122;s degrees during graduation festivities held each December and May. In 2006-07 graduation ceremonies, the University granted 2,195 bachelorâ&#x20AC;&#x2122;s degrees, 908 masterâ&#x20AC;&#x2122;s degrees and 74 doctoral diplomas. UNCG has long had a reputation for academic excellence and student-athletes at UNCG are not an exception to the rule. At the end of each of the last three academic years, more than 40% of UNCG student-athletes held a grade-pointaverage of 3.0 or better. A record 54 percent of UNCGâ&#x20AC;&#x2122;s studentathletes made the Athletic Directorâ&#x20AC;&#x2122;s Honor Roll (3.0 GPA in a semester) in the Spring 2007 semester. This past September, UNCG was listed in Princeton Reviewâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Best 366 Colleges,â&#x20AC;? a distinctioned achieved by only 15 percent of the nationâ&#x20AC;&#x2122;s fouryear colleges. Approximately 120,000 students were surveyed nationwide, rating their individual schools in a variety of categories. In August 2005, The Princeton Review

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

The University Community


NCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

This is UNCG

UNCGâ&#x20AC;&#x2122;s brand new $16.9 million Moore Hall for Humanities and Research Administration, which opened last year, sits on Spring Garden St. in the heart of campus. which offers informal, intramural and club sports, as well as an extensive outdoor adventure program. 7KHPRUHWKDQEXLOGLQJVRQWKHFDPSXVUHĂ HFWWKH year history of the University. There are many new features, including a new, $26 million music building which opened in August 1999, and a total renovation of the Elliott University Center, which was completed in 2003. UNCG received approximately $166 million from the state for construction and renovation, based on voter approval of the North Carolina Higher Education Bonds. The $17.6 million Maud Gatewood Studio Arts Building and the $16.9 million Moore Humanities and Research Administration Building are the centerpieces of the project, along with the $40 million Science Building, which was opened in 2003. In addition, the 400-student Spring Garden Apartments residence hall was put into use during the 2006-07 academic year. Other recent renovation projects include the Gove Student Health Center, Aycock Auditorium and Petty, Brown and McNutt buildings, as well as a connector between Jackson Library and Elliott University Center. The many construction projects on campus show the growth of the university, while at the same time attempting to preserve many of the structures that have made the institution what it is today. In the Fall of 2004, the University launched the Students First Campaign, which has a fundraising goal of $100 million. The Students First Campaign will set aside $52 million for scholDUVKLSVWRPDNH81&*DĂ&#x20AC;UVWFKRLFHVFKRROIRUWRSKLJKVFKRRO students from North Carolina and elsewhere. Remaining funds will also be used for endowments that will create new professorships, expand university facilities and public services. UNCG expects to meet its goal by the year 2009. The Second Century Campaign for UNCG, which concluded 'HF   UDLVHG  PLOOLRQ RYHU D Ă&#x20AC;YH\HDU VSDQ WR create 77 new scholarship and fellowship funds, as well as funds for research, programs and acquisitions. UNCG is a member of the National Association of State Universities and Land Grant Colleges (NASULGC) and the American Association of Colleges and Universities (AASCU).

A look up College Avenue â&#x20AC;&#x201C; the heart of the UNCG campus. Once a main road through campus, it is now only open to pedestrian traffic.

92 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide


The University of North Carolina at Greensboro is one of the fastest growing universities around. With a record 16,300 students enrolled, including approximately 11,500 full-time undergraduates, the university has positioned itself for continued growth and success as the 21st century evolves. Despite record numbers of students, the student/faculty ratio is still just 17:1. Todayâ&#x20AC;&#x2122;s UNCG includes:

tries. These students work with more than 500 graduate faculty members who are actively engaged in reMr. James Norman Smith search, scholarship and creative activity. Dr. Carolyn R. Ferree â&#x20AC;˘ The School of Music, which was established in 1921, rated as one of the Top 20 in the country, comMs. Gwynn Swinson bines rigorous theory, history, and performance training with a broad liberal arts education. The University Mr. Randall Kaplan opened a $25.7 million state-of-the-art music facility in 1999. It is the only comprehensive slate of performance and music education degrees from the baccalaureate through the doctorate in North Carolina. 0U-RKQ%U\DQW H[RIĂ&#x20AC;FLR6*$3UHVLGHQW

â&#x20AC;˘ The School of Nursing, which was established in 1966, is the largest in North Carolina. It has three departments â&#x20AC;&#x201C; Adult Health, Parent-Child and Community Practice â&#x20AC;&#x201C; and is recognized for the excellence of its programs and the success of its graduates. The masterâ&#x20AC;&#x2122;s program in nurse anesthesia was ranked eighth QDWLRQDOO\E\861HZVDQG:RUOG5HSRUW,QDGGLWLRQ81&*LVWKHĂ&#x20AC;UVWLQVWLWXWLRQLQWKH81&V\VWHPWRRIIHUDFRPELQHG0DVWHURI6FLHQFHLQ1XUVLQJDQG0DVWHURI Business Administration in health management. â&#x20AC;˘ The Aubrey Paul & Georgia Garrison Lloyd International Honors College was established in 2006. It is named for the parents of Ms. Rebecca Lloyd, a patron of the College whose support has been invaluable in the formation of the Honors College. Ms. Lloydâ&#x20AC;&#x2122;s gift, a $4 million endowment, was the largest-ever alumni gift at UNCG. The Lloyd International Honors College offers enhanced academics, international and global perspectives, and a variety of extra-curricular activities that will give its students the skills and knowledge needed to be admitted to the most prestigious graduate schools, to compete for nationally competitive awards like the Fulbright, and to start exciting careers in the United States and abroad. Students in any major can choose from among its three different programs. All of these programs can be completed in the time it takes to earn a regular degree and offer a wide variety of small, innovative seminar-style courses that are the hallmark of a quality honors experience. A special characteristic of the IHC is its emphasis on international and global perspectives. In todayâ&#x20AC;&#x2122;s world, international and global perspectives are a necessary SDUWRIDFRPSOHWHXQLYHUVLW\HGXFDWLRQ$W,+&WKHVHSHUVSHFWLYHVDUHQRWLVRODWHGLQDVLQJOHFRXUVHRUWZR,QVWHDGVWXGHQWVFDQĂ&#x20AC;QGWKRVHSHUVSHFWLYHVWKURXJKRXW the Collegeâ&#x20AC;&#x2122;s programs â&#x20AC;&#x201C; in most of its courses, in its honors residence hall, and in a variety of extra- and co-curricular activities. For honors students who study abroad at one of UNCGâ&#x20AC;&#x2122;s partner universities, a travel fund is available. Finally, the IHC operates on the principle that while courses are important, its studentsâ&#x20AC;&#x2122; education is too important to be limited to the classroom. It offers its students a variety of special activities both at UNCG and abroad â&#x20AC;&#x201C; an honor residence hall, special advising, student symposia, guest lectures and performances, informal coffees, internships and enhanced study abroad experiences. 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guideâ&#x20AC;˘ 93

This is UNCG

â&#x20AC;˘ The College of Arts and Sciences, which is made up of the departments of Anthropology, Art, Biology, Broadcasting & Cinema, Chemistry & Biochemistry, Classical Studies, Communication Studies, Computer Science, English, Geography, German, Russian, Japanese & Chinese Studies, History, Mathematics & Statistics, Philosophy, Physics & Astronomy, Political Science, Psychology, Religious Studies, Romance Languages, Sociology, and Theatre. It also includes the Center for Creative Writing in the Arts, the Freshman Seminars Program and the Residential College. Other special programs include African American Studies, Freshman Seminars, Archaeology, the Bachelor of Liberal Studies, and Womenâ&#x20AC;&#x2122;s & Gender Studies. â&#x20AC;˘ The Joseph M. Bryan School of Business and Economics, which was established in 1969 as the School of Business and Economics and renamed in 1987. It is made up of the departments of Accounting & Finance, Business Administration, Economics, Information Systems & Operations Management, the Center for Applied Research, the Center for Economic Education, and the Center for Global Business Education and Research. The Bryan Schoolâ&#x20AC;&#x2122;s vision is to be recognized for the global business and information technology perspectives of its programs. â&#x20AC;˘ The School of Education, which is made up of the departments of Counseling & Educational Development, Curriculum & Instruction, Educational Leadership & Cultural Foundations, Educational Research Methodology, Library & Information Studies, and Specialized Education Services. The School of Education also includes The Collegium for the Advancement of Schools, Schooling Alumni House & Education, the Center for Educational Research & Evaluation, the Center for Educational Studies & Development and the Center for School Accountability, Staff Development & Teacher Quality. The schoolâ&#x20AC;&#x2122;s teacher education programs for elementary and middle grades are considered among the best in North Carolina and the Southeast. UNCG Board of Trustees â&#x20AC;˘ The School of Health and Human Performance, which was established in 1970 as the School of Health, Mr. Stephen C. Hassenfelt, Chairman Physical Education, Recreation, and Dance, was renamed in 1990. The school offers academic programs of Ms. Linda Carlisle, Vice Chairman GLVWLQFWLRQLQERWKWKHRU\DQGSHUIRUPDQFH,WLVPDGHXSRIĂ&#x20AC;YHGHSDUWPHQWV&RPPXQLFDWLRQ6FLHQFHV  Disorders; Dance; Exercise & Sport Science; Public Health Education; and Recreation, Tourism & Hospitality Mrs. Earlene Hardie Cox Management. Dr. Kate R. Barrett â&#x20AC;˘ The School of Human Environmental Sciences, which was established in 1949 as the School of Home Dr. Richard L. Moore (FRQRPLFVZDVUHQDPHGLQ,WSUHSDUHVVWXGHQWVIRUSURIHVVLRQDOFDUHHUVLQĂ&#x20AC;HOGVZKLFKLPSURYHWKH quality of life for individuals and families. The school is made up of the departments of Consumer, Apparel & Mr. William J. Pratt Retail Studies, Human Development & Family Studies, Interior Architecture, Nutrition, and Social Work. Ms. Jane Preyer â&#x20AC;˘ The Graduate School, which was established in 1921, is responsible for the welfare of all of the graduMs. Jean E. Davis ate programs on campus and approximately 3,600 graduate students from 33 states and 34 foreign coun-

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Todayâ&#x20AC;&#x2122;s UNCG


NCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

UNCG Administration

University Chancellor Dr. Patricia Sullivan

Dr. Patricia A. Sullivan, who has served as UNCGâ&#x20AC;&#x2122;s Chancellor since January 1, 1995, is the institutionâ&#x20AC;&#x2122;s ninth chief executive DQGWKHĂ&#x20AC;UVWZRPDQWRVHUYHLQWKHSRVLWLRQ Her leadership has sustained UNCGâ&#x20AC;&#x2122;s record of excellence and maintained a solid foundation for the future. UNCG was founded as State Normal and Industrial School, a college for women in 1891. The institution became coeducational in 1963. Today, UNCG offers a full range of undergraduate and graduate programs. Sullivan instituted a strategic planning process that SURGXFHGWKH81&*3ODQ&UHDWHGIRUĂ&#x20AC;YH\HDULQFUHPHQWVWKH Plan provides a framework for enhancing UNCGâ&#x20AC;&#x2122;s position as a diverse, student-centered research university, linking the Triad and North Carolina to the world through learning, discovery, and service. Under Dr. Sullivanâ&#x20AC;&#x2122;s leadership, enrollment at UNCG again exceeded 16,000 last year, while academic standards for admission have increased. The campus continues to lead the UNC system in minority enrollment, underscoring UNCGâ&#x20AC;&#x2122;s commitment to diversity. New undergraduate programs for freshman include the Lloyd International Honors College, Communication Across the Curriculum and the living-learning communities. Distinctive graduate programs include genetic counseling and management information systems, along with new Ph.D. programs in the areas of nursing, public health, economics, geography, history, information technology and special education. Funding to support research and community projects has continued to grow, along with giving by the Universityâ&#x20AC;&#x2122;s friends and supporters. UNCGâ&#x20AC;&#x2122;s new Students First Campaign is under way, with a goal of raising $100 million through 2009. The earlier Second Century Campaign for UNCG, which ended in December 1998, raised $55.4 million, far exceeding the original goal of $42.8 million. 94 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide


served on the Division I Menâ&#x20AC;&#x2122;s Soccer National Committee and had a two-year term as the chair of the NCAA Menâ&#x20AC;&#x2122;s and Womenâ&#x20AC;&#x2122;s Soccer Rules Committee. This academic year, Bobb will serve on four Southern Conference committees, serving on the Committee on Committees, Constitution and By-Laws, Audit Committee and the Menâ&#x20AC;&#x2122;s Soccer Sport Committee, of which he is the chair. On campus, Bobb is a member of the Chancellorâ&#x20AC;&#x2122;s Executive Staff and has been part of many governing bodies both inside and outside of athletics during his tenure. HeisoneoftheoriginalmembersoftheGreensboroSportsCommission,having servedinthebodysince 1989.HehasalsobeenamemberoftheGreensboroSports Council since 1983. He has presented twice each to the NCAA Convention and the NACDA Convention. UNCGstudent-athleteshavereceivednumerousawards.In 1984,heestablished the Chancellorâ&#x20AC;&#x2122;s Scholar-Athlete Award to honor the student-athlete(s) posting the highest grade-point average annually. Bobb, a native of Gahanna, OH, oversees a staff of more than 50 full and part-time employees with administrative divisions of administration and business, student welfare, facilities and operations and integrated public affairs within the department. BeforecomingtoUNCG,BobbservedasanassistantathleticdirectoratCornell 8QLYHUVLW\IRUĂ&#x20AC;YH\HDUV+HDOVRVHUYHGDVDQDVVLVWDQWIRRWEDOOFRDFKDW&RUQHOOIRU nine seasons. A 1970graduateofKentState(OH)withabachelorâ&#x20AC;&#x2122;sdegreeineducation,Bobb alsoholdsamasterâ&#x20AC;&#x2122;sdegreeinsecondaryeducationfromKent.Asanundergraduate, he was a three-year letterwinner on the football team as an offensive guard and earned All-Academic recognition from the Mid-American Conference as a junior. He was an all-conference choice his senior year. 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guideâ&#x20AC;˘ 95

UNCG Administration

Beginning his 25th year this fall as Director of Intercollegiate Athletics at UNCG, Nelson E. Bobb has developed a nationally recognized program that has continually succeeded in competition as well as in the classroom. %REEWKHĂ&#x20AC;UVWIXOO time athletic director at the University, is the primary architect of a program that now features 16 NCAA Division I teams, eight for men and eight for women. Earlier this summer, he was named to NACDAâ&#x20AC;&#x2122;s NCAA Division I-AAA Executive Committee as an at-large member. WhenhearrivedinJuly 1983,therewereeightteamscompetingontheDivisionIII level.TheUniversityauthorizedtheshifttoDivisionIinFebruary 1987andheguided WKHSURJUDPWKURXJKWKHXQSUHFHGHQWHGFKDQJHLQFRPSHWLWLYHVWDWXVLQRQO\Ă&#x20AC;YH years. UNCG is one of only a dozen institutions to ever compete in all three divisions. However, no other institution has made the complete shift of all teams from Division III to Division I in that time frame. During his tenure, he has watched over the construction or renovation of all of the Spartansâ&#x20AC;&#x2122; athletic venues. He began that process by serving on the committee that built Fleming Gymnasium and the HHP Building in 1989. He then moved onto the transformation of Campus Field in 1991 into what is today UNCG Soccer Stadiumâ&#x20AC;&#x201C;oneofthepremiervenuesinallofcollegesoccer.In 1999,heoversawthe construction of the UNCG Baseball Stadium and the renovation and lighting of the UNCGTennisCourts.Mostrecently,headdedtothelistthetransformationofUNCGâ&#x20AC;&#x2122;s VRIWEDOOIDFLOLW\WREHFRPHDWRSRIWKHOLQHVWDGLXPYHQXHDQGWKHUHFRQĂ&#x20AC;JXUDWLRQRI seatinginFlemingGym,whichaddedchairbackseatingonbothsidesandadditional stands under one of the baskets. UnderBobbâ&#x20AC;&#x2122;sguidance,Spartanstudent-athleteshaveconsistentlygraduated at a rate equal to or higher than the general student population at UNCG. Each of the last three academic years, more than 40 percent of UNCGâ&#x20AC;&#x2122;s student-athletes earned a 3.0 GPA or better. Last spring, 52 percent of student-athletes earned at least a 3.0 GPA in the semester, equalling the record set the previous spring. As of June2007,nearlyhalf(46percent)ofUNCGâ&#x20AC;&#x2122;s225student-athletesheldcumulative GPAs of 3.0 or better. Other recent program accomplishments include completing the NCAA FHUWLĂ&#x20AC;FDWLRQSURFHVVIRU'LYLVLRQ,LQVWLWXWLRQVWZLFHDQGVXFFHVVIXOO\WUDQVLWLRQLQJ the departmentâ&#x20AC;&#x2122;s teams into Southern Conference membership. 8QGHU%REE¡VOHDGHUVKLS81&*KRVWHGWKHĂ&#x20AC;QDOWZRURXQGVRIWKHDQG 1998 NCAA Division I Womenâ&#x20AC;&#x2122;s Soccer Championship, and was home to Olympic athletes from several countries for training prior to the Olympic Games in Atlanta in 1996. Bobb was also a member of the Olympic Torch run committee in Greensboro for the 1996 Games. During his tenure, UNCG teams have won 36 conference tournament titles, 27 as an NCAA Division I member. They have also won 65 conference regular season titles, 39 of those since moving to NCAA Division I. UNCG earned the Commissionerâ&#x20AC;&#x2122;s Cup for overall excellence in the Big South for three consecutive years. While Bobb was athletic director in the 1980â&#x20AC;&#x2122;s, the menâ&#x20AC;&#x2122;s soccer team won four Division III national championships and the womenâ&#x20AC;&#x2122;s EDVNHWEDOOWHDPPDGHĂ&#x20AC;YHFRQVHFXWLYH1&$$7RXUQDPHQWDSSHDUDQFHVZLWKD WKLUGSODFHĂ&#x20AC;QLVKLQ DuringhistenureatUNCG,BobbhasalsoservedinvariousNCAAappointments, LQFOXGLQJVHUYLQJRQRQHRIWKHĂ&#x20AC;UVW1&$$&HUWLĂ&#x20AC;FDWLRQWHDPV)URP KHVHUYHGRQWKH&HUWLĂ&#x20AC;FDWLRQ7HDPIRUIRXUVXFKHYHQWV0RVWUHFHQWO\%REE

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Director of Athletics Nelson Bobb


NCGSpartans.com • UNCGSpartans.com • UNCG

UNCG Administration

Terry Ackerman Faculty Athletics Rep.

Sylvia Mims Associate AD

Rod Wyatt Associate AD

Dick Stewart Associate AD

Cathy Roberts Associate AD

Christy Avent Associate AD

Stacey Kosciak Special Asst. to AD

James Shipp Assistant AD

Jennifer Aguillar Assistant AD

Jackie Walsh Assistant AD

Gary Ross Assistant AD

Gary Klutts Assistant AD

Mark Williams Strength & Cond. Coach

Mike Hirschman Sports Info. Director

Jessica Poole Asst. SID

Christy Kramer SID Intern

Jana Henderson Compliance Director

John Comer Ticket Operations

Joanna Camp Academic Enhancement

Kwadjo Steele Academic Compliance

Erica Thornton Assoc. Trainer

Daisy Kovach Asst. Trainer

Emily Snow Internal Relations

Paula Terrell %XVLQHVV2IÀFH

Linda Peronto Staff Secretary

Joann Cozart Staff Secretary

96 • 2007-08 UNCG Women’s Basketball Media Guide


Athletic Department Mailing Address: 1408 Walker Ave., 337 HHP Building, PO Box 26168, Greensboro, NC 27403 All Phones are area code (336) >:0@'HQRWHVRIÃ&#x20AC;FHORFDWHGDW:HVW0DUNHW6WUHHWEXLOGLQJ >++3@'HQRWHVRIÃ&#x20AC;FHORFDWHGDW++3%XLOGLQJ

Dr. Patricia Sullivan, Chancellor Dr. Terry Ackerman, Faculty Athletics Rep.

Phone E-mail 334-5266 334-3474 taackerm@uncg.edu

ATHLETICS ADMINISTRATION QHEREE#XQFJHGX VJPLPV#XQFJHGX csrobert@uncg.edu UHVWHZDU#XQFJHGX MUZ\DWW#XQFJHGX PFZLOVR#XQFJHGX sbmeadow@uncg.edu

Mike Gaski, Head Coach Chris Roberts, Asst. Coach Jamie Athas, Asst. Coach

334-3247 mggaski@uncg.edu 334-3247 cerober2@uncg.edu 334-3247 j_athas@uncg.edu

MENâ&#x20AC;&#x2122;S BASKETBALL 0LNH'HPHQW+HDG&RDFK>++3@ 5RG-HQVHQ$VVRFLDWH+HDG&RDFK>++3@ .HYLQ(DVOH\$VVW&RDFK>++3@ %ULDQ-XGVNL$VVW&RDFK>++3@ 7ULSS3HQGHUJDVW'LURI%DVNHWEDOO2SHUDWLRQV>++3@

    

EDVNHWEDOO#XQFJHGX UOMHQVHQ#XQFJHGX NGHDVOH\#XQFJHGX EDVNHWEDOO#XQFJHGX EDVNHWEDOO#XQFJHGX

   

OFDJHH#XQFJHGX FDSHVFKH#XQFJHGX MEKLQHV#XQFJHGX DEKD\HV#XQFJHGX

WOMENâ&#x20AC;&#x2122;S BASKETBALL /\QQH$JHH+HDG&RDFK>++3@ &DURO3HVFKHO$VVRFLDWH+HDG&RDFK>++3@ -RQ+LQHV$VVW&RDFK>++3@ $VKOH\+D\HV$VVW&RDFK>++3@

CROSS COUNTRY / TRACK & FIELD ACADEMIC ENHANCEMENT Joanna Camp, Academic Enhancement Director Kwadjo Steele, Academic Compliance Director

334-5172 jbcamp@uncg.edu 334-3465 kosteele@uncg.edu

/LQK1JX\HQ+HDG&RDFK>++3@ -HQQLIHU6HYHUQV$VVW&RDFK>++3@

 OWQJX\H#XQFJHGX  MPVHYHUQ#XQFJHGX

MENâ&#x20AC;&#x2122;S GOLF 7HUUDQFH6WHZDUW+HDG&RDFK>++3@

BUSINESS OFFICE -DFNLH:DOVK$VVW$'%XVLQHVV>++3@ 3DXOD7HUUHOO$FFRXQWDQW>++3@

 MDZDOVK#XQFJHGX  SDXODBWHUUHOO#XQFJHGX

 WFVWHZDU#XQFJHGX

WOMENâ&#x20AC;&#x2122;S GOLF (PLO\0DURQ+HDG&RDFK>++3@

 HOPDUURQ#XQFJHGX

COMPLIANCE 5RG:\DWW$VVRF$'6WXGHQW:HOIDUH>++3@ -DQD+HQGHUVRQ&RPSOLDQFH'LUHFWRU>++3@

 MUZ\DWW#XQFJHGX  MOKHQGHU#XQFJHGX

FACILITIES &DWK\5REHUWV$VVRF$')DFLOLWLHV>++3@ -HQQLIHU$JXLODU$VVW$')DFLOLWLHV>++3@ -DQH/RQJ(TXLSPHQW$VVLVWDQW>++3@

 FVUREHUW#XQFJHGX  MODJXLODU#XQFJHGX  MHORQJ#XQFJHGX

MENâ&#x20AC;&#x2122;S SOCCER 0LFKDHO3DUNHU+HDG&RDFK>++3@ -XVWLQ0DXOOLQ$VVW&RDFK>++3@ 6FRWW%ULWWVDQ$VVW&RDFK>++3@

 PKSDUNHU#XQFJHGX  MBPDXOOL#XQFJHGX 

WOMENâ&#x20AC;&#x2122;S SOCCER (GGLH5DGZDQVNL+HDG&RDFK>++3@ 6LUL0XOOLQL[$VVW&RDFK>++3@

 HGGLHBUDG#XQFJHGX  VBPXOOLQ#XQFJHGX

PUBLIC AFFAIRS - MARKETING 'LFN6WHZDUW$VVRF$'3XEOLF$IIDLUV>++3@ *DU\5RVV$VVW$'3XEOLF$IIDLUV>:0@ *DU\.OXWWV$VVW$'3XEOLF$IIDLUV PXOWLPHGLD >:0@ (PLO\6QRZ,QWHUQDO5HODWLRQV>:0@ WEST MARKET STREET OFFICE FAX

    334-3798

UHVWHZDU#XQFJHGX JPURVV#XQFJHGX JSNOXWWV#XQFJHGX HVQRZ#XQFJHGX

SOFTBALL -HQQLIHU+HU]LJ+HDG&RDFK>++3@ 6KDLQD(UYLQ$VVW&RDFK>++3@

 MOKHU]LJ#XQFJHGX  VPHUYLQ#XQFJHGX

MENâ&#x20AC;&#x2122;S TENNIS 7KRPDV0R]XU+HDG&RDFK>++3@

 WDPR]XU#XQFJHGX

SPARTAN CLUB 0LNH5RDFK6SDUWDQ&OXE'LUHFWRU>:0@ 'RQHJDQ5RRW$VVRFLDWH'LUHFWRU>:0@ +HOHQ6HGZLFN2IÃ&#x20AC;FH0DQDJHU>:0@

 MPURDFK#XQFJHGX  GBURRW#XQFJHGX  KBVHGZLF#XQFJHGX

WOMENâ&#x20AC;&#x2122;S TENNIS -HII7ULYHWWH+HDG&RDFK>++3@

 XQFJWHQQLV#XQFJHGX

WOMENâ&#x20AC;&#x2122;S VOLLEYBALL SPORTS INFORMATION 0LNH+LUVFKPDQ6SRUWV,QIRUPDWLRQ'LUHFWRU>++3@ (Menâ&#x20AC;&#x2122;s Soccer, Menâ&#x20AC;&#x2122;s Basketball, M/W Tennis, M/W Golf) 334-5615 mwhirsch@uncg.edu -HVVLFD3RROH$VVW6SRUWV,QIRUPDWLRQ'LUHFWRU>++3@ (Volleyball, Womenâ&#x20AC;&#x2122;s Basketball, Softball, M/W Track & XC) 334-5615 jepoole@uncg.edu &KULVW\.UDPHU6,',QWHUQ>++3@ (Womenâ&#x20AC;&#x2122;s Soccer, Wrestling, Baseball) SPORTS INFORMATION FAX

6KDZQ*DUXV+HDG&RDFK>++3@ 6N\GUD2U]HQ$VVW&RDFK>++3@

 VPJDUXV#XQFJHGX  VKRU]HQ#XQFJHGX

WRESTLING -DVRQ/RXNLGHV+HDG&RDFK>++3@ -RVK.HHIH$VVW&RDFK>++3@

 MFORXNLG#XQFJHGX 

334-5615 cmkramer@uncg.edu 334-3182

SPORTS MEDICINE -DPHV6KLSS$VVW$'$WKOHWLF7UDLQLQJ>++3@ (ULFD37KRUQWRQ$VVRF$WKOHWLF7UDLQHU>++3@ 'DLV\.RYDFK$VVLVWDQW$WKOHWLF7UDLQHU>++3@ 0DUN:LOOLDPV6WUHQJWK &RQGLWLRQLQJ&RDFK>++3@ $PDQGD+DUHQ$VVW6WUHQJWK &RQGLWLRQLQJ&RDFK>++3@ SPORTS MEDICINE FAX

     256-0407

MUVKLSS#XQFJHGX HDSHDUVR#XQFJHGX GPNRYDFK#XQFFJHGX PMZLOOLD#XQFJHGX DOKDUHQ#XQFJHGX

TICKETS -RKQ&RPHU7LFNHW0DQDJHU>++3@

 MIFRPHU#XQFJHGX

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guideâ&#x20AC;¢ 97

UNCG Administration

1HOVRQ%REE'LUHFWRURI$WKOHWLFV>++3@  ADMINISTRATION FAX 334-4063 6\OYLD0LPV$VVRF$'$GPLQLVWUDWLRQ>++3@  &DWK\5REHUWV$VVRF$')DFLOLWLHV,QWHUQDO2SHUDWLRQV>++3@ 334-5537 'LFN6WHZDUW$VVRF$'3XEOLF$IIDLUV>++3@  5RG:\DWW$VVRF$'6WXGHQW:HOIDUH>++3@  &KULVW\$YHQW$VVRF$'([WHUQDO2SHUDWLRQV>++3@  Stacy Kosciak, Special Asst. to the AD 256-1188

COACHING STAFFS %$6(%$// 2IÃ&#x20AC;FHORFDWHGLQVWDGLXP

UNCGSpartans.com â&#x20AC;¢ UNCGSpartans.com â&#x20AC;¢ UNCG

Spartan Athletics Phone / E-mail Directory


CGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘

UNCG Athletic History

The overnight success of the UNCG athletics program has been some 60 years in the makLQJ7KLV\HDUPDUNVWKH\HDUDQQLYHUVDU\RIWKHRIĂ&#x20AC;FLDOIRUPDWLRQRI81&*¡V,QWHUFROOHJLDWH Athletics Department. The success story however, began while UNCG was still the Womenâ&#x20AC;&#x2122;s College of the University of North Carolina and intercollegiate competition for women was still in its infancy.

1940s

0HQ¡VVRFFHUSOD\HU(GGLH5DGZDQVNLWKHĂ&#x20AC;UVWWZRWLPH$OO$PHULFDQLQWKHSURJUDP¡VKLVWRU\ ZDVWKHĂ&#x20AC;UVWSLFNLQWKH0DMRU,QGRRU6RFFHU/HDJXHGUDIWLQ 8QGHU0LFKDHO3DUNHU¡VGLUHFWLRQWKHPHQ¡VVRFFHUWHDPEHFDPHWKHĂ&#x20AC;UVWLQ1&$$KLVWRU\WR win three consecutive national championships, in 1985, 1986 and 1987.

1DQF\3RUWHUPD\KDYHEHHQWKHĂ&#x20AC;UVWVWXGHQWDWKOHWHLQWKHPRGHUQVHQVHRIWKHZRUGDW UNCG. The Ohio native competed in national womenâ&#x20AC;&#x2122;s golf tournaments as early as 1948.

In February of 1987, the University announced the elevation of the athletic program from Division III to Division I, an unprecedented move in NCAA history.

1950s

7KHZRPHQ¡VEDVNHWEDOOWHDPĂ&#x20AC;QLVKHGWKLUGLQWKHQDWLRQDIWHUHQWHULQJWKH1&$$7RXUQDPHQW unranked in 1988.

Womenâ&#x20AC;&#x2122;s College hosted the 10th national golf tournament in 1954 at Starmount Country &OXE 7KH &ROOHJH Ă&#x20AC;HOGHG UHJLRQDOO\ FRPSHWLWLYH WHDPV WKDW KDG WKHLU EHJLQQLQJV LQ FOXE sports, play days and other recreational events.

The Division II era began in 1988-89 and womenâ&#x20AC;&#x2122;s soccer was added to the program. The team was ranked No. 13 nationally before ever playing a game.

1960s 81&*ODXQFKHGZRPHQ¡VEDVNHWEDOOLQXQGHUFRDFK(OOHQ*ULIĂ&#x20AC;Q2WKHUHDUO\WHDPV ZHUHWHQQLVJROIDQGĂ&#x20AC;HOGKRFNH\ LPGA Hall of Famer Carol Mann was a student at UNCG. She left school early to turn professional.

The menâ&#x20AC;&#x2122;s soccer team was runner-up in the 1989 Division II national tournament and Jason Haupt led all divisions in scoring.

1990s The menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s soccer team were ranked No. 1 nationally in Division II at the same time in 1990.

The University became co-educational in 1963. Menâ&#x20AC;&#x2122;s athletics were added in 1967-68 and the intercollegiate program for men and women received formal recognition from the University. During the fall of 1967, the nickname SparWDQVZDVDGRSWHGJLYLQJWKHDWKOHWLFWHDPVD´Ă&#x20AC;HUFHPDVFRWZKLOHVWLOOSUHVHUYLQJWKHKHULtage of the WCâ&#x20AC;&#x2122;s Minerva mark.â&#x20AC;? Menâ&#x20AC;&#x2122;s teams joined the Dixie Conference in 1968. Bowling was one of the early menâ&#x20AC;&#x2122;s athletics teams.

1970s 7KHZRPHQ¡VEDVNHWEDOOWHDPĂ&#x20AC;QLVKHGIRXUWKLQWKH1DWLRQDO&ROOHJLDWH7RXUQDPHQWLQ 7KHWHDPZDVRQHRIWKHĂ&#x20AC;UVWWRFRPSHWHZLWKWKHĂ&#x20AC;YHSOD\HUUXOH 7KH ZRPHQ¡V JROI WHDP ZRQ WKH 8QLYHUVLW\¡V Ă&#x20AC;UVW WHDP QDWLRQDO FKDPSLRQVKLS LQ  coached by Nancy Porter and featuring future pro Donna Horton White. UNCG was a leader in forming the Association of Intercollegiate Athletics for Women (AIAW).

1980s The menâ&#x20AC;&#x2122;s basketball team, coached by Larry Hargett, won the Dixie Conference Championship and competed in the NCAA Division III Tournament in 1980. Ryan Fox won the 1981 individual national title in Division III menâ&#x20AC;&#x2122;s golf. In the spring of 1981, the University streamlined its program from 12 to eight teams, all competing at the NCAA Division III level. The 1981-82 DFDGHPLF\HDUZDVWKHĂ&#x20AC;UVWLQZKLFKWKH1&$$VSRQVRUHGZRPHQ¡VFKDPpionships. 7KHPHQ¡VVRFFHUWHDPZDVUDQNHGLQWKHQDWLRQDO7RSIRUWKHĂ&#x20AC;UVWWLPHLQ September of 1981. It did not leave the poll for another 10 years. &RDFKHGE\/\QQH$JHHLQKHUĂ&#x20AC;UVWVHDVRQWKHZRPHQ¡VEDVNHWEDOOWHDPĂ&#x20AC;Qished runner-up in the inaugural Division III championship in 1982. It was the Ă&#x20AC;UVWRIVHYHQVWUDLJKW1&$$WULSVIRUWKHWHDP :LWK0LNH%HUWLFHOOLDWWKHKHOP81&*FDSWXUHGLWVĂ&#x20AC;UVWPHQ¡VQDWLRQDOFKDPSLonship in soccer in 1982 and then repeated in 1983. The womenâ&#x20AC;&#x2122;s tennis team, under Ageeâ&#x20AC;&#x2122;s direction, was the national runner-up in 1983. 1HOVRQ(%REEZDVKLUHGDVWKHĂ&#x20AC;UVWIXOOWLPHDWKOHWLFGLUHFWRULQ The womenâ&#x20AC;&#x2122;s volleyball team posted a 34-3 record and reached the NCAA TXDUWHUĂ&#x20AC;QDOVLQ

98 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

T h e


Womenâ&#x20AC;&#x2122;s golf returned to the athletic program and baseball was added in 1990-91. UNCG Soccer Stadium, a $3.6 million facility, opens for its Ă&#x20AC;UVW JDPH RQ 6HSWHPEHU   DV WKH PHQ¡V WHDP GHfeated Campbell, 3-1. Four days later, the Spartans stunned No. 2 NC State, 2-1. Menâ&#x20AC;&#x2122;s soccerâ&#x20AC;&#x2122;s Mike Gailey led all Division I players in scoring in 1991.

Softball claimed the 1993 Big South regular season title. %ULDQ0RHKOHUEHFDPHWKHĂ&#x20AC;UVW6SDUWDQWRVLJQDSURIHVVLRQal baseball contract after being drafted in the sixth round of the 1993 Major League draft by the Detroit Tigers. He made KLV´ELJOHDJXHÂľGHEXWLQDQGSLWFKHGWKHĂ&#x20AC;UVWJDPH ever in Comerica Park in 2000. Menâ&#x20AC;&#x2122;s soccer won the 1993 Big South championship. Shawn Mahoney was named the tournamentâ&#x20AC;&#x2122;s MVP. Womenâ&#x20AC;&#x2122;s golf was ranked in the Top 20 nationally in the fall of 1993. Menâ&#x20AC;&#x2122;s soccer claims its second straight Big South championship on Nov. 5, 1994. Larry Feniger was named the tournament MVP. :RPHQ¡VEDVNHWEDOOFODLPHGĂ&#x20AC;YHVWUDLJKW%LJ6RXWKUHJXODU season titles in 1993, 1994, 1995, 1996 and 1997. Vickie Henson was named the leagueâ&#x20AC;&#x2122;s Player of the Year in 1993. Volleyball won the 1995 Big South regular season championship with a record of 7-0. Liz Gremillion was named the leagueâ&#x20AC;&#x2122;s MVP. Softball captured three consecutive Big South regular sea-

In just its fourth season, baseball claimed the Big South title and won two games in the 1994 NCAA Regionals. Mike Gaski was named Big South Coach of the Year. On April 15, 1995, menâ&#x20AC;&#x2122;s tennis captured the Big South Championship. On April 18, 1995, menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s golf sweep the Big South Tournament. Becky Morgan was named the leagueâ&#x20AC;&#x2122;s Player of the Year. Menâ&#x20AC;&#x2122;s basketball claimed back-to-back Big South regular season titles in 1995 and 1996. On March 2, 1996, menâ&#x20AC;&#x2122;s basketball knocked off Liberty, 79-53, to claim the Big South Tournament Championship DQG DGYDQFH WR WKH 1&$$ 7RXUQDPHQW IRU WKH Ă&#x20AC;UVW WLPH LQ Division I. The Spartans lost to Cincinnati in the NCAA TournaPHQW7KHĂ&#x20AC;YHVHQLRUVIURPWKHWHDPKDGWKHLUQXPEHUVKRQRUHG6FRWW+DUW]HOOĂ&#x20AC;QLVKHGKLVFDUHHUDVWKHPHQV basketballâ&#x20AC;&#x2122;s all-time leading scorer with 1,539. On April 15, 1996, womenâ&#x20AC;&#x2122;s Golf wins the Big South Tournament. Becky Morgan was once again named the leagueâ&#x20AC;&#x2122;s Player of the Year. One day later, the UNCG menâ&#x20AC;&#x2122;s golf team wontheBigSouthTournament.MichaelWaywastheleagueâ&#x20AC;&#x2122;s Player of the Year. Womenâ&#x20AC;&#x2122;s golfer Becky Morgan earned her third straight Big South Player of the Year award in April 1997. Womenâ&#x20AC;&#x2122;s tennis captured the 1997 Big South Womenâ&#x20AC;&#x2122;s Tennis championship on April 19, 1997. OnMay 18, 1997,theUNCGbaseballteamwontheBigSouth tournament championship with a 14-5 victory over Charleston Southern. Mike Gaski was named Big South Coach of the Year. Baseball earned a bid to the NCAA South I regional, and

Ă&#x20AC;QLVKHGZLWKDVFKRROUHFRUGZLQVLQFOXGLQJRQHDWWKH NCAA regional. Pitcher Jason Parsons led the nation with 15 wins and was named third-team All-America. :UHVWOLQJLQLWVĂ&#x20AC;UVW\HDULQWKH6RXWKHUQ&RQIHUHQFHWLHGIRU WKH6R&RQWLWOH-RH6WDQWRQEHFDPHWKHĂ&#x20AC;UVWDQGRQO\ WKUHHWLPH1&$$TXDOLĂ&#x20AC;HULQ81&*KLVWRU\ :RPHQ¡V 6RFFHU ZRQ LWV Ă&#x20AC;UVW 6RXWKHUQ &RQIHUHQFH &KDPpionship in 1997, while outscoring opponents, 24-0, in the 6R&RQ7RXUQDPHQW7KHWHDPHDUQHGLWVĂ&#x20AC;UVW1&$$ZLQZLWKD RYHUWLPHXSVHWRIĂ&#x20AC;IWKVHHGHG'XNH ,Q  6LJJL (\MROIVVRQ EHFRPHV WKH Ă&#x20AC;UVW )LUVW7HDP $OO American in UNCG menâ&#x20AC;&#x2122;s soccer Division I history. UNCG womenâ&#x20AC;&#x2122;s basketball defeated top-seeded Georgia Southern, 75-68, in the SoCon Tournament and earned its Ă&#x20AC;UVWHYHU1&$$'LYLVLRQ,7RXUQDPHQWELGLQ ,Q81&*PHQ¡VVRFFHUFODLPHGLWVĂ&#x20AC;UVW6R&RQWLWOHDQG Ă&#x20AC;UVW1&$$'LYLVLRQ,7RXUQDPHQWZLQDXSVHWDW:DVKLQJWRQLQWKHĂ&#x20AC;UVWURXQG In 1998, womenâ&#x20AC;&#x2122;s soccer won its second straight SoCon title, and made its third straight NCAA appearance. On Feb. 12, 1999, the UNCG Baseball Stadium, a $5.4 million facility, opened to a crowd of 1,835. On Dec. 21, 1999, Lynne Ageeâ&#x20AC;&#x2122;s womenâ&#x20AC;&#x2122;s basketball squad defeats defending ACC champion Clemson in a thrilling come-from-behind overtime contest in Fleming Gym, 78-67.

2000s In 2000, wrestler Dax Pecaro recorded his second straight undefeated season in the Southern Conference and won the 184-pound title for the second year as well. Pecaro became WKHĂ&#x20AC;IWK81&*ZUHVWOHUWRZLQDPDWFKDWWKH1&$$7RXUQDment. On Feb. 2, 2000, UNCG womenâ&#x20AC;&#x2122;s basketball claimed a 7771 victory at Appalachian State, the programâ&#x20AC;&#x2122;s 500th overall win.

Becky Morgan Alejandro Moreno

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guideâ&#x20AC;˘ 99

UNCG Athletic History

UNCG joined the Big South Conference in 1992, ending a four-year period as an independent.

son titles in 1995, 1996 and 1997. Erin Chandler was named the Player of the Year in 1995 and Christine Hornak was the Player of the Year in 1997. Softball also captured four straight Big South Tournament championships in 1994, 1995, 1996 and 1997.

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘

womenâ&#x20AC;&#x2122;s volleyball and basketball teams made Division II playoff appearances in 1990-91.


CGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘

UNCG Athletic History

,Q$SULO81&*ZRPHQ¡VJROIFDPHZLWKLQRQHVWURNHRQWKHĂ&#x20AC;QDOKROH of upsetting six-time champion Furman. The team set a new school-record for low round (292) and tournament (901) at the championship. November 2000, the womenâ&#x20AC;&#x2122;s soccer team won its third SoCon title in four \HDUVDQGXSVHW1R:LOOLDP 0DU\LQ*UHHQVERURLQWKHĂ&#x20AC;UVWURXQGRIWKH NCAA Tournament, becoming the only team in UNCG history to advance to the second round of an NCAA Division I Tournament twice. 2Q0DUFKWKHPHQ¡VEDVNHWEDOOWHDPZRQLWVĂ&#x20AC;UVW6RXWKHUQ&RQIHUence championship on David Schuckâ&#x20AC;&#x2122;s buzzer-beating layup. The team went National Championships RQWRSOD\WRSUDQNHG6WDQIRUGLQWKHĂ&#x20AC;UVWURXQGRIWKH1&$$7RXUQDPHQW LWVVHFRQGWULSWRWKH´%LJ'DQFHÂľLQĂ&#x20AC;YH\HDUV*XDUG1DWKDQ-DPHVRQZDV Womenâ&#x20AC;&#x2122;s Golf â&#x20AC;&#x201C; 1973 (AIAW) QDPHGĂ&#x20AC;UVWWHDP9HUL]RQ$FDGHPLF$OO$PHULFD Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1982 (NCAA III) In April 2001, the menâ&#x20AC;&#x2122;s tennis team tied for the SoCon regular season championship with Furman, after posting a 9-1 mark in league play. Head coach Jeff Trivette was named the SoCon Menâ&#x20AC;&#x2122;s Tennis Coach of the Year.

Menâ&#x20AC;&#x2122;s Menâ&#x20AC;&#x2122;s Menâ&#x20AC;&#x2122;s Menâ&#x20AC;&#x2122;s

,Q0D\/HLJK,UZLQWKH6R&RQ3OD\HURIWKH<HDULQĂ&#x20AC;QLVKHVKHU softball career as the only player in SoCon history to reach the century mark in stolen bases with 103.

Conference Tournament Titles (39 overall; 27 in NCAA Div. I)

In June 2001, golfer Karl Mitchell was named a second-team Academic AllAmerican. On Nov. 11, 2001, UNCG womenâ&#x20AC;&#x2122;s soccer captured the 2001 SoCon Tournament Championship and advanced to the NCAA Tournament to play North Carolina. Senior goalkeeper Kat Clewley was named the Tournament MVP. Fellow senior Lynsey McLean was named the leagueâ&#x20AC;&#x2122;s Player of the Year. On Feb. 11, 2002, menâ&#x20AC;&#x2122;s soccer player Alejandro Moreno was selected by the L.A. Galaxy in the third round of the 2002 MLS SuperDraft. On March 13 and 14, 2002, the menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s basketball teams both UHFHLYHG WKHLU Ă&#x20AC;UVWHYHU LQYLWDWLRQV WR WKH 1,7 DQG :1,7 UHVHSHFWLYHO\ 7KH menâ&#x20AC;&#x2122;s team played eventual-champion Memphis, while the womenâ&#x20AC;&#x2122;s team faced Virginia Tech. In November 2002, Chris Goos was named the SoCon Menâ&#x20AC;&#x2122;s Soccer Player of the Year after leading the nation in scoring with 60 points - 20 goals and 20 assists. Goos was also named a second-team All-American.

Soccer Soccer Soccer Soccer

â&#x20AC;&#x201C; â&#x20AC;&#x201C; â&#x20AC;&#x201C; â&#x20AC;&#x201C;

1983 1985 1986 1987

(NCAA (NCAA (NCAA (NCAA

(6)

III) III) III) III)

Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1981 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1982 Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1982 Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1983 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1983 Softball â&#x20AC;&#x201C; 1983 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1984 Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1984 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1985 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1987 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1988 Softball â&#x20AC;&#x201C; 1988 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1993 ** Softball â&#x20AC;&#x201C; 1994 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1994 ** Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1994 ** Softball â&#x20AC;&#x201C; 1995 ** Menâ&#x20AC;&#x2122;s Golf â&#x20AC;&#x201C; 1995 ** Womenâ&#x20AC;&#x2122;s Golf â&#x20AC;&#x201C; 1995 ** Menâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1995 ** Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1996 ** Menâ&#x20AC;&#x2122;s Golf â&#x20AC;&#x201C; 1996 ** Womenâ&#x20AC;&#x2122;s Golf â&#x20AC;&#x201C; 1996 ** Softball â&#x20AC;&#x201C; 1996 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C;1996 ** Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1996 ** Baseball â&#x20AC;&#x201C; 1997 ** Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1997 ** Softball â&#x20AC;&#x201C; 1997 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C;1997 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C;1998 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C;1998 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1998 Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C;2001 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2001 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2003 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2005 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2006 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2006

Conference Reg. Season Titles (73 overall; 39 in NCAA Div. I) Menâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1974 Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1981 Menâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1981 Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1981

Lynne Agee 100

omenâ&#x20AC;&#x2122;s Basketball Media Guide

Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1981 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1982 Softball â&#x20AC;&#x201C; 1982 Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1982 Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1982 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1983 Softball â&#x20AC;&#x201C; 1983 Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1983 Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1983 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1983 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1984 Softball â&#x20AC;&#x201C; 1984 Menâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1984 Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1984 Womenâ&#x20AC;&#x2122;s Volleyball â&#x20AC;&#x201C; 1984 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1984 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1985 Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1985 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1985 Menâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1986 Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1986 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1986 Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1987 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1987 Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1987 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1987 Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1988 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1988 Menâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1988 Womenâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 1988 Softball â&#x20AC;&#x201C; 1993 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1993 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1993 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1993 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1994 Baseball â&#x20AC;&#x201C; 1994 ** Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1994 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1994 Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1995 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1995 Softball â&#x20AC;&#x201C; 1995 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1995 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1995 Volleyball â&#x20AC;&#x201C; 1995 Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1996 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1996 Softball â&#x20AC;&#x201C; 1996 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1996 Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1996 Softball â&#x20AC;&#x201C; 1997 Baseball â&#x20AC;&#x201C; 1997 Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1997 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1997 ** Menâ&#x20AC;&#x2122;s Soccer - 1997 ** Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1998 ** Baseball â&#x20AC;&#x201C; 1998 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1998 ** Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 1998 ** Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 1999 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2000 ** Menâ&#x20AC;&#x2122;s Tennis â&#x20AC;&#x201C; 2001 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2001 ** Womenâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 2002 ** Menâ&#x20AC;&#x2122;s Basketball â&#x20AC;&#x201C; 2002 Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2004 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2004 ** Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2005 ** Womenâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2006 ** Menâ&#x20AC;&#x2122;s Soccer â&#x20AC;&#x201C; 2006 ** ** denotes officially recognized conference champion


On November 21, 2002, menâ&#x20AC;&#x2122;s soccer player Cliff Patterson was named third-team CoSIDA Academic All-American after scoring 17 goals on the season. On Feb. 23, 2003, softballâ&#x20AC;&#x2122;s Amber Watson tossed a perfect game against Toledo in a 2-0 win. Watson struck out 17 batWHUVLQFOXGLQJWKHJDPH¡VĂ&#x20AC;UVWQLQH

On May 7, 2003, Jennifer Hubbard was named the SoConâ&#x20AC;&#x2122;s SoftballPlayeroftheYearafterhitting.384with 10homeruns and 30 runs batted in. Penny Thompson ended her standout career as the SoConâ&#x20AC;&#x2122;s all-time home run leader with 36. 2Q 0D\   VRIWEDOO¡V -HQQLIHU 0RUDQ HDUQHG Ă&#x20AC;UVW team CoSIDA Academic All-American honors. 2Q 0D\   SLWFKHURXWĂ&#x20AC;HOGHU 5\DQ *RUGRQ ZDV QDPHGĂ&#x20AC;UVWWHDP$OO$PHULFDE\/RXLVYLOOH6OXJJHU7KHMXnior hit .416 on the season and captured the SoConâ&#x20AC;&#x2122;s batting FURZQWKHĂ&#x20AC;UVWLQVFKRROKLVWRU\WRGRVR*RUGRQZDVDOVR named third-team All-America by Baseball America. In November 2003, the UNCG womenâ&#x20AC;&#x2122;s soccer team won the Southern Conference Tournament title to earn its third trip to the NCAA Tournament in four years. The Spartans defeated arch-rival Furman, 2-0, to win the SoCon crown. UNCG folORZHGWKDWZLWKDĂ&#x20AC;UVWURXQG1&$$7RXUQDPHQWZLQRYHU:DNH Forest, 2-1, before losing to eventual-National Champion North Carolina in the second round. It marked the third time that the Spartans had advanced to the second round of the NCAA Tournament. On January 7, 2004, UNCG womenâ&#x20AC;&#x2122;s basketball coach Lynne Agee won her 500th game as a head coach when her Spartans defeated Furman, 63-60, in a SoCon tilt at Fleming Gymnasium. Agee became just the 23rd womenâ&#x20AC;&#x2122;s basketball coach in NCAA history to achieve the milestone, joining the likes of legends Jody Conradt of Texas, Tennesseeâ&#x20AC;&#x2122;s Pat Summit, UConnâ&#x20AC;&#x2122;s Geno Auriemma, Louisiana Techâ&#x20AC;&#x2122;s Leon Barmore, North Carolina Stateâ&#x20AC;&#x2122;s Kay Yow and North Carolinaâ&#x20AC;&#x2122;s Sylvia Hatchell.

On September 29, 2004, James Goodmanâ&#x20AC;&#x2122;s goal 28 minutes into the contest was the lone tally as UNCG defeated rivalUNC Chapel Hill, 1-0, in front of a crowd of 2,608 at the UNCG Soccer Stadium. The crowd was the largest at UNCG Soccer Stadium since 1999. The win gave UNCG its fourth win of the season over an ACC-member squad. Just 19 days later, on October 17, 2004, UNCG received its Ă&#x20AC;UVW1RQDWLRQDOUDQNLQJVLQFHPRYLQJWR'LYLVLRQ,7KH PHQ¡VVRFFHUWHDPZDVUDQNHG1RIRUWKHĂ&#x20AC;UVWWLPHWKDW day and became a consensus No. 1 a day later when all four major soccer polls â&#x20AC;&#x201C; College Soccer News, Soccer America, Soccer Times and the NSCAA Coachesâ&#x20AC;&#x2122; Poll â&#x20AC;&#x201C; all listed the Spartans atop the rankings. UNCG remained a consensus No. 1 for two more weeks and a top-ranked team for a fourth week before seeing its 18-match unbeaten streak snapped. 7KH 6SDUWDQV HYHYQWXDOO\ HDUQHG WKH 6R&RQ¡V Ă&#x20AC;UVWHYHU DW large bid to the NCAA Menâ&#x20AC;&#x2122;s Soccer Tournament, garnering a No. 8 seed. UNCG advanced to the third round of the tournament, before suffering a heartbreaking 1-0 overtime loss to UC Santa Barbara, the eventual national runner-up. On the heels of the outstanding season, Michael Parker was named the NSCAA South Region Coach of the Year. Parker was also named the Southern Conference Coach of the Year.

Freshmen Kyle Hines and Kristen Boone swept the SoConâ&#x20AC;&#x2122;s Menâ&#x20AC;&#x2122;s and Womenâ&#x20AC;&#x2122;s Basketball Freshman of fthe Year honors in February of 2005. Hines set school and SoCon records for blocks in a season with 106, while Boone recorded 121 steals to set a new school record. Her total was the fourthhighest single-season total recorded by a freshman in NCAA history. -RH.HPPHUHU'DUHQ%XUQVDQG-RH/RZHDOOTXDOLĂ&#x20AC;HGIRUWKH 2005 NCAA Wrestling Championships in March. Burns had WKHEHVWVKRZLQJRIWKHWKUHHDGYDQFLQJWRWKHTXDUWHUĂ&#x20AC;QDOV of the 197-lb. class. He wound up in the fourth round of the ZUHVWOHEDFNVDQGĂ&#x20AC;QLVKHGWKHVHDVRQZLWKDPDUN7ZR months later, Burns was the surprise of the Pan American :UHVWOLQJ &KDPSLRQVKLSV Ă&#x20AC;QLVKLQJ WKLUG IRU 7HDP 86$ DW the international competition held in Guatemala City, Guatemala. ,Q0D\RI&KDUOHV-RQHVEHFDPHWKHĂ&#x20AC;UVW6SDUWDQWR qualify for the NCAA Track and Field Championships. After winning the SoCon Championship in the triple jump to qualify for NCAA Regional competition, Jones outlasted a two-hour thunderstorm delay and recorded a jump of 15.35 meters to EUHDNDWLHIRUĂ&#x20AC;IWKSODFHDQGHDUQDXWRPDWLFTXDOLĂ&#x20AC;FDWLRQ into the National Championship meet in Sacramento. Earlier in the meet, Jones had leaped a school-record 15.50 meters. -RQHVHYHQWXDOO\Ă&#x20AC;QLVKHGWKHQDWLRQDOFKDPSLRQVKLSPHHWLQ 23rd place. In June of 2005, Chris Mason was drafted in the second round of the Major League Baseball Draft, being selected by the Tampa Bay Devil Rays.

On October 31, 2004, UNCG wrapped up its fourth Southern Conference womenâ&#x20AC;&#x2122;s soccer regular season crown in an eight-year span with a convincing 7-0 win over The Citadel in &KDUOHVWRQ5DNHO/RJDGRWWLUĂ&#x20AC;QLVKHGWKHVHDVRQDV81&*¡V all-time leader in career assists.

In August of 2005, Randi Patterson and Scott Jones became WKHĂ&#x20AC;UVW81&*SOD\HUVWREHQDPHGWRWKH´ZDWFKOLVWÂľIRU the Hermann Award, given annually to the Collegiate Soccer Player of the Year. Patterson was later named among 15 VHPLĂ&#x20AC;QDOLVWVIRUWKHDZDUG

On November 3, 2004, UNCGâ&#x20AC;&#x2122;s Amy Carnell and Karla Davis swept the 2004 SoCon Womenâ&#x20AC;&#x2122;s Soccer Player and Freshman of the Year honors. A week later, Randi Patterson and Matt Smith were named the 2004 SoCon Menâ&#x20AC;&#x2122;s Soccer PlayHUDQG)UHVKPDQRIWKH<HDUUHVSHFWLYHO\,WPDUNHGWKHĂ&#x20AC;UVW time one school had swept all four awards. Patterson went on to earn several All-American honors.

On October 30, 2005, Randi Patterson became the 13th SOD\HULQVFKRROKLVWRU\DQGMXVWWKHĂ&#x20AC;IWKMXQLRUWRUHFRUG career points in the Spartansâ&#x20AC;&#x2122; 3-0 menâ&#x20AC;&#x2122;s soccer win over Wofford. The win clinched a share of the Southern Conference regular season title. Two weeks later, UNCG added another Southern Conference Tournament championship trophy to the mantle with a 2-1 win over Davidson. UNCG eventually advanced to the NCAA Tournament Round of 16 â&#x20AC;&#x201C; its second

On January 31, 2004, UNCG defeated North Carolina for the Ă&#x20AC;UVWWLPHLQWKHVSRUWRI:UHVWOLQJ$IWHUWKHPDWFKHQGHGLQ a 20-20 tie, UNCG won the match on a tie-breaker, marking WKH Ă&#x20AC;UVW WLPH WKH 6SDUWDQV  KDG GHIHDWHG WKH 7DU +HHOV LQ VHYHQWULHV,WZDV81&*¡VĂ&#x20AC;UVWZLQRYHUDQ$&&VFKRROLQĂ&#x20AC;YH \HDUV.HYLQ$UWLV¡ZLQLQWKHĂ&#x20AC;QDOERXWRIWKHPDWFKWLHG the overall score and provided the only technical fall of the match, giving UNCG the edge in the tie-breaker. On February 23, 2004, Jay Joseph became UNCGâ&#x20AC;&#x2122;s all-time leading scorer, eclipsing the mark held by his former teamPDWH-DPHV0D\HVHWRQH\HDUHDUOLHU-RVHSKĂ&#x20AC;QLVKHGKLVFDUHHUZLWKSRLQWV+HDOVRĂ&#x20AC;QLVKHGĂ&#x20AC;UVWDOOWLPHDW81&* LQJDPHVSOD\HGĂ&#x20AC;HOGJRDOVPDGHDQGĂ&#x20AC;HOGJRDODWWHPSWV In March 2004, Darren Burns was named the SoCon FreshPDQ:UHVWOHURIWKH<HDU81&*¡VĂ&#x20AC;UVWZUHVWOLQJ)UHVKPDQRI the Year since joining the SoCon.

Brian Moehler

Chris Mason 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guideâ&#x20AC;˘ 101

UNCG Athletic History

On Feb. 27, 2003, James Maye broke the menâ&#x20AC;&#x2122;s basketball all-time scoring record with 17 points against Furman. Maye recorded a triple-double in the game with 17 points, 11 reERXQGV DQG  DVVLVWV +H Ă&#x20AC;QLVKHG KLV FDUHHU ZLWK  points.

2Q6HSWHPEHUDVSDUWRIWKHĂ&#x20AC;IWKLQGXFWLRQFODVV into the UNCG Athletics Hall of Fame, Lynne Agee became WKHĂ&#x20AC;UVWDFWLYHKHDGFRDFKWREHHQVKULQHGLQWKH81&*+DOO Agee was inducted along with the 1982 menâ&#x20AC;&#x2122;s soccer team, the 1973 womenâ&#x20AC;&#x2122;s golf team and deceased administrator David Knight.

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘

On November 19, 2002, the menâ&#x20AC;&#x2122;s basketball team defeated :DJQHU  LQ WKH Ă&#x20AC;UVW URXQG RI WKH 3UHVHDVRQ 1,7 LQ )OHPLQJ*\PQDVLXP,WPDUNHG81&*¡VĂ&#x20AC;UVWHYHUZLQLQWKH NIT. The Spartans advanced to play at Kansas in the second round.


CGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘

UNCG Athletic History

straight Round of 16 appearance. ,Q1RYHPEHU5DQGL3DWWHUVRQEHFDPHWKHĂ&#x20AC;UVWSOD\HU in 20 years to earn back-to-back Southern Conference Player of the Year awards. He and Scott Jones later earned All-American honors. In December 2005, UNCGâ&#x20AC;&#x2122;s womenâ&#x20AC;&#x2122;s basketball program enjoyed two of its greatest non-conference wins since moving to the Division I level. In a 12-day span, UNCG knocked off Big East foe West Virginia at home and ACC member Wake )RUHVWRQWKHURDG,WZDV81&*¡VĂ&#x20AC;UVWHYHUZLQRYHUD%LJ (DVWVFKRRODQGWKHSURJUDP¡VĂ&#x20AC;UVWYLFWRU\RYHU:DNH)RUHVW since 1977. On December 3, 2005, Kyle Hines grabbed 21 rebounds, the most by a Spartan in more than 30 years, to go along with 18 points in a 72-58 win over College of Charleston at Fleming Gym. The 21 rebounds were also a Fleming Gym record. Hines went onto earn All-Region honors from the US BasketEDOO:ULWHUVMRLQLQJĂ&#x20AC;YH$&&DOOVWDUV On December 31, 2005, UNCG hosted top-ranked Duke at the Greensboro Coliseum in front of a record crowd of 21,124. The near capacity crowd was the largest to ever see a UNCG athletic event. At the Southern Conference Indoor Track and Field Championships in February 2006, Jeff Williams earned his second consecutive conference title in the 800 meters, making him WKH Ă&#x20AC;UVW UHSHDW FKDPSLRQ LQ VFKRRO KLVWRU\ :LOOLDPV ODWHU went onto win the outdoor title in the 800 meters to qualify for the NCAA East Regional Outdoor Track & Field meet. UNCGâ&#x20AC;&#x2122;s wrestling team sent multiple wrestlers to the NCAA 7RXUQDPHQWIRUWKHWKLUGFRQVHFXWLYH\HDU7KH6SDUWDQVĂ&#x20AC;Qished tied for 31st, the programâ&#x20AC;&#x2122;s highest NCAA ChampionVKLSĂ&#x20AC;QLVKWRGDWH UNCG opened its remodeled softball venue on Wednesday, February 22 with a twinbill against Radford. The opening of the new $3 million facility was originally scheduled for 11 days earlier, but was postponed due to inclement weather. /DWHULQWKH\HDUWKH6SDUWDQVEHFDPHWKHĂ&#x20AC;UVW1RVHHGWR beat a top-seed in the SoCon Softball Tournament.

2Q$SULO81&*HDUQHGLWVĂ&#x20AC;UVWZLQRYHU a top-ranked team in any sport during the universityâ&#x20AC;&#x2122;s Division I era... and got to beat Big Brother in the process. The baseball team beat top-ranked North Carolina, 7-6, in front of a crowd of 1,033. After jumping out to a 4-1 lead, UNCG withstood several Tar Heel rallies, including a pair of runs in the top of the ninth inning before closer Patrick Currin slammed the door. Charles Jones joined Jeff Williams at NCAA East Regional Outdoor Track & Field meet, making -RQHVDWZRWLPHTXDOĂ&#x20AC;HULQWKHWULSOHMXPS-RQHV Ă&#x20AC;QLVKHGWKIDOOLQJVKRUWLQKLVDWWHPSWWRUHWXUQ to the national meet. -HUPDLQH0LWFKHOOGUDIWHGLQĂ&#x20AC;IWKURXQGRIWKH0Djor League Baseball First-Year Player Draft by the Oakland Aâ&#x20AC;&#x2122;s. Mitchell became the second-highest baseball player drafted behind Chris Mason in 2005. In addition, teammate Patrick Currin, who earned Second-Team Academic All-American honors, was also selected by Oakland the following day in Round 22. 81&* DOXPQ $QG\ %DUH TXDOLĂ&#x20AC;HG IRU WKH WK 862SHQEHFRPLQJWKHĂ&#x20AC;UVW6SDUWDQWRTXDOLI\ IRUDPDMRUJROIWRXUQDPHQW%DUHĂ&#x20AC;QLVKHGQLQWK Andy Bare in a sectional that drew national attention. Also naments. The menâ&#x20AC;&#x2122;s team advanced to the round of 16 for attempting to qualify at the same sectional was 0LFKHOOH:LHWU\LQJWREHFRPHWKHĂ&#x20AC;UVWIHPDOHWRSOD\LQWKH the third consecutive year, including a win over sixth-seeded West Virginia in Morgantown. The womenâ&#x20AC;&#x2122;s team gave OklaOpen. homa State all it could handle for 60 minutes before losing, While Bare was making his name on the pro scene nation- 2-0, in a match played at Clemson. ally, two UNCG golfers did so on the amateur national scene. Spartan golfers Nathan Stamey and Bradley Leeper appeared among 156 golfers at the 2006 USGA Public Links held at Gold Mountain GC in Bremerton, WA. Stamey qualiĂ&#x20AC;HGE\ZLQQLQJKLVVHFWLRQDOZKLOH/HHSHUHDUQHGDVSRWDV DQDOWHUQDWHDQGZDVDGGHGWRWKHĂ&#x20AC;HOGMXVWKRXUVSULRUWR it getting underway. In November 2006, the UNCG soccer teams completed a sweep of the SoCon soccer titles. The Spartans menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s teams won the regular season and tournament titles to earn automatic bids to their respective NCAA Tour-

6FRWW -RQHV EHFDPH WKH VFKRRO¡V Ă&#x20AC;UVW IRXUWLPH Ă&#x20AC;UVWWHDP all-conference selection in the sport of menâ&#x20AC;&#x2122;s soccer in November 2006. .\OH+LQHVEHFDPHWKHĂ&#x20AC;UVWPHQ¡VEDVNHWEDOOSOD\HUWRZLQ Conference Player of the Year honors in March 2007. Hines ZDVVHFRQGLQWKHOHDJXHLQVFRULQJDQGĂ&#x20AC;UVWLQUHERXQGLQJ which also earned him AP All-America Honorable Mention KRQRUV(DUOLHULQWKHVHDVRQ+LQHVEHFDPHWKHĂ&#x20AC;UVW81&* player to top the 30-point mark four times in the same seaVRQ+LQHVOHGWKHFRQIHUHQFHLQVFRULQJIRUWKHĂ&#x20AC;UVWGD\V RIWKHVHDVRQDQGĂ&#x20AC;QLVKHGWKH\HDUZLWKĂ&#x20AC;YHSRLQWJDPHV RQWKH\HDU+LVSSJDYHUDJHZDVWKHĂ&#x20AC;UVWWLPHD6SDUWDQ averaged more than 20 points per game since 1990-91. 2007 was a banner year for the UNCG menâ&#x20AC;&#x2122;s golf program. Freshman Drew Younts shot a school-record 63 in early March, breaking an 80-year-old record at El Campeon GC in Howey-in-the-Hills, FL. Six weeks later, senior J.D. Bass became just the fourth Spartan in 30 years to win an individual conference title when he won the SoCon Championship at the Country Club of South Carolina. 81&*¡VEDVHEDOOWHDPIRXQGTXLWHWKHZD\WRWXUQLWVĂ&#x20AC;UVW ever triple play on May 25, 2007. Playing in its second game of the Southern Conference Tournament, the Spartansâ&#x20AC;&#x2122; duo of Tim Carrier and Ricky Orton turned the trick to give the Spartans an 8-6 win over Georgia Southern. With the bases loaded Carrier, UNCGâ&#x20AC;&#x2122;s second baseman, caught a linedrive off the bat of Justin Klinger. Carrier stepped on second and WKHQĂ&#x20AC;UHGWR2UWRQIRUWKHJDPH¡VĂ&#x20AC;QDORXWDQGWKHĂ&#x20AC;UVWWULSOH play in school history.

UNCG vs. #1 Duke on December 31, 2005 at the Greensboro Coliseum in front of 21,124 spectators. 102 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide


UNCGSpartans.c

Team Inductions 1973 Womenâ&#x20AC;&#x2122;s Golf Team, 2004

1981-1982 Womenâ&#x20AC;&#x2122;s Basketball Team, 2007 1DWLRQDO 5XQQHUVXS LQ WKH Ă&#x20AC;UVWHYHU 1&$$ 'LYLVLRQ ,,, :RPHQ¡V %DVNHWEDOO 7RXUQDment... amassed a record of 25-3, losing in overtime at Elizabethtown College (PA).... began a run of seven consecutive 20-win seasons for the womenâ&#x20AC;&#x2122;s basketball program.

1982 Menâ&#x20AC;&#x2122;s Soccer Team, 2004 :RQWKH1&$$'LYLVLRQ,,,1DWLRQDO&KDPSLRQVKLSZLWKRXWDKRPHĂ&#x20AC;HOGIDFLOLWLHVDW UNCG were under renovation at the time, forcing the team to play its games at near-by *ULPVOH\+LJK6FKRROWKHWHDPĂ&#x20AC;QLVKHGLQFOXGLQJDZLQRYHU:DNH)RUHVW during the regular season and a 2-1 win over Plymouth State in double overtime in the 1&$$4XDUWHUĂ&#x20AC;QDOV

Individual Inductions Lynne Agee - Womenâ&#x20AC;&#x2122;s Basketball Coach, 2004 7KHĂ&#x20AC;UVWDFWLYHKHDGFRDFKWREHHQVKULQHGĂ&#x20AC;UVWFRDFKLQ1&$$KLVWRU\WROHDGKHUWHDP to the NCAA Tournament in all three divisions... more than 500 career wins to her credit.

Jim Allen - Administrator, 2003 Former vice chancellor for student affairs... had oversight on programâ&#x20AC;&#x2122;s move from Division III to I.

Maxine Allen - Amateur Athlete, 2001 Garnered national attention as duckpin bowler... set world records and earned a top national ranking.

Mike Berticelli - Menâ&#x20AC;&#x2122;s Soccer Coach, 2000 Led UNCG to Division III national championships in 1982 and 1983... guided UNCG to 70-9-5 record (86.3%) in four seasons.

Mike Burke - Supporter, 2001

Lynne Agee

Jim Allen

Maxine Allen

Mike Berticelli

Mike Burke

Marge Burns

/HG 81&*¡V FKDUJH LQ VFKRODUVKLS IXQGUDLVLQJ FUHDWHG Ă&#x20AC;UVW DWKOHWLF HQGRZPHQW LQ 1987... raised funds toward a total endowment now valued at more than $4 million.

Marge Burns - Amateur Athlete, 2000 Holds record of 10 North Carolina State Amateur Golf titles ... named Carolinas OutVWDQGLQJ$PDWHXUĂ&#x20AC;YHWLPHVTXDOLĂ&#x20AC;HGDQGSOD\HGLQ86*$$PDWHXU&KDPSLRQships, as well as six US Open Tournaments.

Renee Coltrane - Womenâ&#x20AC;&#x2122;s Basketball, 2001 $OO$PHULFDQDVDMXQLRUĂ&#x20AC;UVWZRPHQ¡VEDVNHWEDOOSOD\HUWRH[FHHG points and 1,000 rebounds in a career.

Wendy Engelmann-Gettings - Womenâ&#x20AC;&#x2122;s Basketball, 2002 Scored 1,378 points and dished out a school-record 574 assists.

Mike Fleming - Supporter, 2000 UNCG supporter for more than two decades ... UNCG named its basketball gymnasium the Michael Fleming Gymnasium on December 1, 1994.

Renee Coltrane

Wendy Engelmann-Gettings

Mike Fleming

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 103

UNCG Athletic Hall of Fame

:RQWKHĂ&#x20AC;UVWQDWLRQDOFKDPSLRQVKLSRIDQ\NLQGIRU81&*FRPSHWLQJLQWKH$,$:1DWLRQDO7RXUQDPHQWLQ0DVVDFKXVHWWV'HIHDWHG5ROOLQV&ROOHJHRQWKHĂ&#x20AC;QDOKROHIRUWKH championship.


GSpartans.com

UNCG Athletic Hall of Fame

Liz Gremillion - Volleyball, 2006 On of the best setters to ever play for the Spartans, recording over 4,000 assists in her career. Named 1995 Big South Conference Player of the Year.

Belmar Gunderson - Amateur Athlete, 2000 Participated from 1952-56 at Womenâ&#x20AC;&#x2122;s College ... competed in four Wimbledons and 11 United States Lawn Tennis National Championships (now U.S. Open).

Scott Hartzell - Menâ&#x20AC;&#x2122;s Basketball, 2006 /HG81&*WRLWVĂ&#x20AC;UVW'LYLVLRQ,1&$$0HQ¡V%DVNHWEDOO7RXUQDPHQWEHUWKLQZKLFK UNCG nearly upset Cincinnati. Graduated as schoolâ&#x20AC;&#x2122;s all-time leading scorer (menâ&#x20AC;&#x2122;s) and set every university three-point shooting standard in his career. Led the team in scoring in three of his four seasons.

Liz Gremillion

Belmar Gunderson

Scott Hartzell

Jason Haupt

Winn Hazlegrove

Pat Hielscher

Elizabeth House

Lewis Johnstone

Ellie Jones

Dock Kelly

Dr. David Knight

Ethel Martus Lawther

Jason Haupt - Menâ&#x20AC;&#x2122;s Soccer, 2001 7ZRWLPHĂ&#x20AC;UVWWHDP$OO$PHULFDQOHG81&*WRD'LYLVLRQ,,,QDWLRQDOFKDPSLonship in 1987... UNCGâ&#x20AC;&#x2122;s all-time leader in goals scored with 77.

Winn Hazlegrove - Softball, 2005 Three-time CoSIDA Academic All-American honoree... one of UNCGâ&#x20AC;&#x2122;s greatest softball players, still ranked in the Top 10 in 20 statistical catagories at the time of her induction (10 years after her graduation).

Pat Hielscher - Womenâ&#x20AC;&#x2122;s Volleyball Coach, 2001 &RDFKHG81&*¡VĂ&#x20AC;UVWYROOH\EDOOWHDPLQJXLGHG6SDUWDQVWRD record and a NCAIAW state title in 1974.

Elizabeth House - Media / Supporter, 2003 Former sports writer for The Carolinian and The News & Record covering UNCG athletics.

Lewis Johnstone - Menâ&#x20AC;&#x2122;s Soccer, 2000 Led UNCG to three straight national playoff appearances ... third all-time leading scorer in team history with 66 goals and 24 assists.

Ellie Jones - Womenâ&#x20AC;&#x2122;s Tennis, Womenâ&#x20AC;&#x2122;s Basketball, Field Hockey, 2003 One of UNCGâ&#x20AC;&#x2122;s most versatile student-athletes ever as she excelled in tennis, EDVNHWEDOODQGĂ&#x20AC;HOGKRFNH\IURP

Dock Kelly - Wrestling, 2006 2QHRI81&*¡VĂ&#x20AC;UVWHYHUTXDOLĂ&#x20AC;HUVIRUWKH1&$$:UHVWOLQJ&KDPSLRQVKLSV (1996), compiled a record of 50-34 despite competing with birth defects that left him without part of an arm and a leg. Honored by the National Wrestling Hall of Fame with its Medal of Courage.

Dr. David B. Knight - Administrator, 2004 Not only a leader in the transition from Division III to DIvision I, but a leader on the national scene as UNCGâ&#x20AC;&#x2122;s long-time Faculty Athletics Representative... became the only FAR to serve on the Division I, II and III levels... served as chair RIWKH1&$$¡VĂ&#x20AC;UVW'LYLVLRQ,$FDGHPLFV(OLJLELOLW\&RPSOLDQFH&DELQHWDQG served as a consultant to the NCAA on numerous academic reform issues (for whom the current Knight Commission was named.)

Ethel Martus Lawther - Administrator, 2003 Served 26 years as head of Department of Physical Education (1948-71)... developed both menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s intercollegiate athletic programs after Womenâ&#x20AC;&#x2122;s College became UNCG in 1963.

104 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide


UNCGSpartans.c

Ali Lord - Womenâ&#x20AC;&#x2122;s Soccer, 2007

Carol Mann - Womenâ&#x20AC;&#x2122;s Golf, 2002 LPGA Hall of Fame member... earned 38 LPGA victories in 22 years on tour.

Tom Martin - Menâ&#x20AC;&#x2122;s Basketball / Supporter, 2002

Ali Lord

Carol Mann

Ton Martin

Jill Masterman

Tonka Maynor

Andrew Mehalko

Jo Ann Messick

Brian Moehler

William Moran

Becky Morgan

Laura Mussulman

Michael Parker

81&*¡VĂ&#x20AC;UVWPDOHSUHVLGHQWRI$OXPQL%RDUGRI'LUHFWRUVVHUYHGDVWULFDSWDLQ RIWKHĂ&#x20AC;UVWWZR81&*PHQ¡VEDVNHWEDOOWHDPV

Jill Masterman - Field Hockey, 2000 3OD\HGRQĂ&#x20AC;HOGKRFNH\WHDPIRUIRXU\HDUVDQGZDVDFRFDSWDLQDVDVHQLRULQ 1977.

Tonka Maynor - Baseball, 2007 Ten years after graduation, still ranks on the Top 10 list at UNCG in every offensive statistical category... hit .363 in his four seasons at UNCG, logging 239 hits... holds UNCG record for career RBI with 171.

Andrew Mehalko - Menâ&#x20AC;&#x2122;s Soccer, 2002 Led UNCG to 1983, 1985 and 1986 NCAA Division III National Championships.

Jo Ann Messick - Womenâ&#x20AC;&#x2122;s Basketball, Womenâ&#x20AC;&#x2122;s Tennis, Field Hockey, 2006 Three-sport competitor at UNCG in the early day of womenâ&#x20AC;&#x2122;s athletics at UNCG ¡V )RXU\HDUVWDQGRXWLQĂ&#x20AC;HOGKRFNH\HDUQLQJ'HHS6RXWK$OO6WDU accolades three times. Six-time participant in National Field Hockey Festivals, including three while at UNCG.

Brian Moehler - Baseball, 2005 81&*¡VĂ&#x20AC;UVWSOD\HUWREHGUDIWHGLQ0DMRU/HDJXH%DVHEDOO¡V)LUVW<HDU3OD\HU 'UDIWHDUQHG81&*¡VĂ&#x20AC;UVWHYHUZLQRYHUD'LYLVLRQ,RSSRQHQWDQGZHQWRQWR pitch for Detroit and Florida in the major leagues.

Becky Morgan - Womenâ&#x20AC;&#x2122;s Golf, 2007 One of the most notable athletic alumni in school history as a member of the LPGA Tour... won the Big South individual championship three times and earned Big South Player of the Year honors all three of those years (1995, 1996, 1997)... a three-time All-American, won medalist honors 10 times during her FROOHJLDWHFDUHHUTXDOLĂ&#x20AC;HGIRUWKH1&$$5HJLRQDODOOIRXU\HDUVDW81&* earning a spot in the national event three times... an Academic All-American in 1997...holds the UNCG records for lowest 18, 36 and 54-hole scores.

Chancellor Emeritus, William E. Moran - Administrator, 2000 Served as Chancellor from 1979-94... guided UNCG from Division III to Division I in 1991... created the Spartan Club.

Laura Mussulman - Womenâ&#x20AC;&#x2122;s Soccer, 2002 0HPEHURIĂ&#x20AC;UVWZRPHQ¡VVRFFHUWHDP81&*¡VĂ&#x20AC;UVWJUHDWJRDONHHSHU ZRPHQ¡V soccer) with 18 career shutouts.

Michael Parker - Menâ&#x20AC;&#x2122;s Soccer Coach, 2005 6HFRQGDFWLYHFRDFKWREHLQGXFWHG Ă&#x20AC;UVWPDOH ZLQQHURIPRUHWKDQ collegiate matches, including more than 300 at UNCG... led Spartans to NCAA Division III National Championship in 1985, 1986 and 1987.

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 105

UNCG Athletic Hall of Fame

UNCGâ&#x20AC;&#x2122;s record holder for single-season and career goals scored... tallied 20 or more goals in three seasons... had a single-season record 26 goals in 1996, earning All-American honors... Big South Player of the Year in 1996 and Southern Conference Player of the Year in 1998.


GSpartans.com

UNCG Athletic Hall of Fame

Angie Polk-Jones - Womenâ&#x20AC;&#x2122;s Basketball, 2000 Led UNCG to a 93-22 mark in her four years (1985-89) ... Division III All-American as a junior... UNCGâ&#x20AC;&#x2122;s all-time leading scorer with 1,585 points.

Nancy Porter, Womenâ&#x20AC;&#x2122;s Golf Coach, 2005 One of the pioneers of womenâ&#x20AC;&#x2122;s athletics at UNCG... coached the UNCG womenâ&#x20AC;&#x2122;s JROIWHDPWRWKHQDWLRQDOFKDPSLRQVKLSDOVRFRQVLGHUHGRQHRI81&*¡VĂ&#x20AC;UVW student-athletes, participating in womenâ&#x20AC;&#x2122;s golf in the 1940â&#x20AC;&#x2122;s. Angie Polk-Jones

Eddie Radwanski - Menâ&#x20AC;&#x2122;s Soccer, 2000

Nancy Porter

Eddie Radwanski

Led UNCG to back-to-back Division III national championships in 1982 and 1983... two-time Division III All-American (1983 and 1984) ... No. 1 draft pick in the 1985 Major Indoor Soccer League draft by the Dallas Sidekicks.

Bruce Shaw - Menâ&#x20AC;&#x2122;s Basketball, 2000 /HG81&*¡VĂ&#x20AC;UVWHYHUPHQ¡VEDVNHWEDOOWHDPVVFRUHGSRLQWVEHFRPLQJ 81&*¡VĂ&#x20AC;UVWSRLQWVFRUHUWZRWLPH$OO'L[LH&RQIHUHQFHKRQRUHe.

Mike Sweeney - Menâ&#x20AC;&#x2122;s Soccer, 2003 Amassed 55 goals and 27 assists in his three seasons at UNCG (1980-83)... member of 1982 and 1983 NCAA III National Championship teams... led the team in VFRULQJLQDQGDQGZDVDĂ&#x20AC;UVWWHDP$OO$PHULFDQLQ

Bruce Shaw

Mike E. Sweeney

Jim Swiggett

Donna Friesen Wigton

Rita Wiggs

Stanley Frank

Chuck Hayes

Jim Melvin

Charlie Reid

Mike Weaver

Jim Swiggett - Coach, Administrator, 2006 Pioneer in menâ&#x20AC;&#x2122;s athletics at UNCG... served as menâ&#x20AC;&#x2122;s basketball coach from 196875 and started menâ&#x20AC;&#x2122;s golf program, serving as coach from 1967-79... also served as the universityâ&#x20AC;&#x2122;s second Menâ&#x20AC;&#x2122;s Intercollegiate Division Coordinator (modern day Athletic Director).

Rita Wiggs - Womenâ&#x20AC;&#x2122;s Basketball, 2000 Led UNCG to state NCAIAW title and AIAW Regional appearance in 1972 ... led 81&*LQVFRULQJIRUIRXUVWUDLJKWVHDVRQVDQGĂ&#x20AC;QLVKHGZLWKFDUHHUSRLQWV

Donna Friesen Wigton - Volleyball, 2003 Volleyball standout at UNCG (1970-73) ... active contributor to the sport through FRDFKLQJSDUWRIRIĂ&#x20AC;FLDWLQJFUHZDW2O\PQSLFVDQG:RUOG8QLYHUVLW\ Games.

â&#x20AC;&#x153;The Big Fiveâ&#x20AC;? Chuck Hayes - Supporter, 2000 Jim Melvin - Supporter, 2000 Charlie Reid - Supporter, 2000

Mike Weaver - Supporter, 2000 Stanley Frank - Supporter, 2000

Helped establish NCAA Division I athletic programs at UNCG through scholarship funding and support.

The purpose of the UNCG Athletics Hall of Fame is to recognize and honor those special individuals, who through their superior athletic achievements or by their outstanding service, have made long-lasting, exemplary contributions to the UNCG athletics program. Persons to be recognized for the excellence of their achievements may include former athletes, coaches, administrators and other individuals who brought recognition and honor to both themselves and to UNCG.

106 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

Nominations should be sent to: Hall of Fame Committee - c/o Stacey Kosciak UNCG Department of Athletics PO Box 26168 Greensboro, NC 27402 Additional Information Available Through: E-mail: sbmeadow@uncg.edu or on-line at www.uncgspartans.com


Fleming Gym All-Time Records

Team

Individual

All-Time Record 172-43 (.788)..................................... 17 years

Most points scored 31 ............... Debbie Hoskins, Lincoln Memorial ...................................................Jan. 10, 1990 Most Rebounds 19 .......................................Julie Moore, UNCG ................. vs. Western Carolina, Dec. 31, 1994 19 ..................................... Alisa Moore, UNCG ....................... vs. UNC Asheville, Jan. 17, 1996

Longest Winning Streak 12 games ..............Feb. 2, 1998-Jan. 22, 1999 Most points scored by UNCG 105 ................vs. St. Augustineâ&#x20AC;&#x2122;s, Feb. 6, 1990

Most Assists 12 ...........................................Jo Zerger, UNCG ............................. vs. Winthrop, Feb. 17, 1993

Most points scored by an Opponent 98 ...............................vs. Duke, Feb. 24, 1996

Most Steals 11 ...................................Kristen Boone, UNCG .................. vs. UNC Wilmington, Nov. 12, 2006

Most combined points scored 196 ................... UNCG 105, St. Augustineâ&#x20AC;&#x2122;s 91 .................................................... Feb. 6, 1990

Most Blocks 7 ...............................Rebecca Viverette, UNCG ............................... vs. Wofford, Feb. 16, 1998 Largest womenâ&#x20AC;&#x2122;s basketball crowd 646 ................................. vs. Georgia Southern .................................................... Feb. 7, 2004

UNCG at Fleming Gym Year 1989-90 1990-91 1991-92 1992-93 1993-94 1994-95 1995-96 1996-97 1997-98

W 9 10 11 9 9 9 9 9 11

L 2 1 3 2 4 4 1 2 2

Pct. .818 .909 .786 .818 .692 .692 .900 .818 .846

Year W 1998-99 11 1999-00 8 2000-01 9 2001-02 12 2002-03 8 2003-04 7 2004-05 10 2005-06 9 2006-07 12 Total 172

L 1 2 3 1 5 5 4 4 3 46

Pct. .917 .800 .750 .923 .615 .583 .714 .692 .800 .788

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide â&#x20AC;˘ 107

UNCG Athletic Facilities

Best Single-Season Record 12-1 (.923)........................................ 2001-02

UNCGSpartans.com â&#x20AC;˘ UNCGSpa

Michael B. Fleming Gymnasium is located in the Health and Human Performance Building, a $16.2 million facility which opened on campus in June of 1989. ,Q2FWREHUWKHJ\PXQGHUZHQWWKHĂ&#x20AC;UVWSKDVHRIDWZR part renovation with the installation of new seating on the west side bleachers. The new seating includes chairback seating on the lower half with bleacher bench seating in the upper half. The following summer, the east side received a similar renovation DQGDGGLWLRQDOVHDWLQJZDVDGGHGLQWKH6RXWK(QG=RQHRQĂ RRU level. The gymnasium, which has seating for 1,870 in its new FKDLUEDFNFRQĂ&#x20AC;JXUDWLRQZDVQDPHGIRU*UHHQVERURFLYLFOHDGHU and one of the most ardent supporters of UNCG athletics on Dec. 1, 1994. Spartan teams are in their 19th year in the gymnasium, as it ZDVĂ&#x20AC;UVWRFFXSLHGGXULQJWKHDFDGHPLF\HDU The menâ&#x20AC;&#x2122;s team is 134-65 (.673) in the facility. UNCG earned its 150th win at Fleming when it defeated Davidson, in a thrilling 90-87 double overtime victory on February 15, 2006. The largest crowd to see an athletic contest in the gym was 2,302 for a menâ&#x20AC;&#x2122;s basketball game against Charleston Southern, Feb. 25, 1995. The Spartans won, 98-70. Fleming Gymnasium has played host to various conference championship tournaments, including Big South volleyball in 1994 and 1995, Big South womenâ&#x20AC;&#x2122;s basketball in 1994, SoCon womenâ&#x20AC;&#x2122;s basketball in 1998 and 1999, SoCon wrestling in 1999 and SoCon volleyball in 2001. In 2006, it played host to the SoCon / ACC Wrestling Championships, also known as MatJam. Prior to the 1996-97 season, the Boston Celtics held their pre-season training camp in the gym. For intercollegiate athletics, the HHP Building offers the following facilities: â&#x20AC;˘ Two large gyms, a three-court (Fleming) and a two-court, which is used for a variety of practices. â&#x20AC;˘ A newly-renovated weight training area that includes Nautilus equipment and free weights. â&#x20AC;˘ A spacious sports medicine area, with modern equipment to serve the Universityâ&#x20AC;&#x2122;s 16 teams. â&#x20AC;˘ Locker rooms for the athletic teams, including several team URRPVDQGORFNHUURRPVIRUYLVLWLQJWHDPVDQGRIĂ&#x20AC;FLDOV â&#x20AC;˘ A practice room for wrestling. Â&#x2021;2IĂ&#x20AC;FHVIRUFRDFKHVDQGDWKOHWLFVVWDIIRQWKHWKLUG PDLQ  Ă RRULQWZRVXLWHV Â&#x2021;$WLFNHWRIĂ&#x20AC;FHDQGFRQFHVVLRQVDUHDVQHDUWKHWKLUGĂ RRU entrance to the building.


7KH6SDUWDQ&OXELVDQRQSURĂ&#x20AC;WRUJDQL]DWLRQZKRVHSULPDU\SXUSRVHLVWRVHFXUH scholarship support for the more than 225 student-athletes who compete in 16 menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s NCAA Division I athletic programs at UNCG. UNCG proudly proclaims that 100 percent of Spartan Club contributions go directly to athletic scholarships for deserving student-athletes.

Methods of Giving Cash, Checks and Credit Card Gifts: 3URYLGHWKH\HDUO\Ă&#x20AC;QDQFLDOUHVRXUFHVQHHGHGWRRSHUDWHWKHDWKOHWLFSURJUDP3D\PHQWVPD\EHVSUHDGRYHUWKHFRXUVHRIDĂ&#x20AC;VFDO\HDU -XO\-XQH EXWDOOSOHGJHV must be paid by June 30. The University accepts cash, checks and credit cards (American Express, MasterCard, Visa).

Employer Matching Gifts: Matching gifts double or triple the impact of your gift and increase your membership level. Be sure to enclose your matching gift form with application and donation and DVVRFLDWHEHQHĂ&#x20AC;WV

The Spartan Club

These provide tuition, room, melas, books and fees on an annual basis for a studentathlete. Pay tribute to someoneâ&#x20AC;&#x2122;s life and accomplishments or leave your own legacy while strengthening UNCGâ&#x20AC;&#x2122;s athletic program.

Planned and Estate Gifts: These gifts include life income arrangements from trusts, annuities, income funds, as well as life insurance policies and individual estate bequests, such as cash or real estate.

Endowed Athletic Scholarships

Annual Scholarships

A named endowment to support athletic scholarships may be created with a commitment of $50,000 or more. The endowment generates income that is awarded to student-athletes on an annual basis.

Dr. Richard & Sharon Beavers - Menâ&#x20AC;&#x2122;s Basketball Mary and Art Winstead - Womenâ&#x20AC;&#x2122;s Golf David L. and Martha P. Brown - Menâ&#x20AC;&#x2122;s Basketball John Emrich - Womenâ&#x20AC;&#x2122;s Soccer Bob and Laura Pitts - Menâ&#x20AC;&#x2122;s Soccer Carolyn and Art Green - Menâ&#x20AC;&#x2122;s Basketball First Citizens Bank - Menâ&#x20AC;&#x2122;s Golf George Hoyle - Menâ&#x20AC;&#x2122;s Soccer Alan and Laura Pike - Menâ&#x20AC;&#x2122;s Basketball Jerry & Ellyn Steinhorn - Menâ&#x20AC;&#x2122;s Tennis Kurt and Joy Kronenfeld -Womenâ&#x20AC;&#x2122;s Soccer Shamrock Corporation - Menâ&#x20AC;&#x2122;s Tennis Shamrock Corporation - Womenâ&#x20AC;&#x2122;s Tennis Leaton Harris - Womenâ&#x20AC;&#x2122;s Soccer Rod Wyatt - Cross Country Mayer Textile Machine Corporation - Menâ&#x20AC;&#x2122;s Basketball Randy Clarida - Womenâ&#x20AC;&#x2122;s Basketball

Lynne C. Agee Fund James H. Allen Fund Alma W. Barrier Fund Smith Barrier Fund Irwin Belk Fund Aaron Michael Bobb Fund Mike and Nancy Burke Fund The Michael B. Fleming Athletic Scholarship Fund Robert A. and Mary C. Fleming Fund Stanley and Dorothy Frank Fund J. Douglas Galyon Fund (OOHQ*ULIĂ&#x20AC;Q)XQG Lester Earl Gross III Athletic Scholarship Fund Charles A. Hayes Fund

David Bates Knight Endowment C. Thomas and Mary Martin Fund Karl Mayer Fund Jim Melvin Fund Charles C. Moyer Fund Victor M. Nussbaum, Jr. Fund Nancy Ann Porter Fund Charles M. Reid Fund Rayna Matea Taylor Fund H. Michael Weaver Fund

Five additional funds that are on their way to reaching endowment status include: Dr. Richard and Sharon Beavers Scholarship Fund The Rich Brenner Endowed Fund Nathan W. and Robyn E. Jameson Fund Gary, Marilyn and Jordan Smith Fund Patricia A. Hielscher Volleyball Athletic Scholarship

The Spartan Club PO Box 41230 Greensboro, NC 27404-1230 'LUHFWRU0LNH5RDFK

$VVRFLDWH'LUHFWRU'RQQHJDQ5RRW

www.spartanclub.org 108 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

Phone: (336) 334-5156 Fax: (336) 334-5319

2IĂ&#x20AC;FH0DQDJHU+HOHQ6HGZLFN


Window Decal Spartan Club Auto Tag (First Time Members) Ticket Priority Invitations to Special Events SoCon Tournament Ticket Priority Exclusive Varsity Club Lapel Pin (First Time Varsity Club Members) Spartan Spirit Season Ticket Opportunity Pre-Game Socials (16-20 a year) Lapel Pin (First Time Members) Honor Wall Recognition Campus Recreation Center Privilege* Basketball Program Recognition Car Flag Invitations to Special University Events Web Site Recognition Priority for Spartan Club Special Events MVP Season Ticket Opportunity Campus Recreation Center Membership** Naming an Annual Scholarship Scholarship Wall Recognition Annual Scholarship Plaque Chancellorâ&#x20AC;&#x2122;s Society Membership

Annual Scholarship Level ($10,000 4 year pledge)

D D D D D D D D D D D D D D D D D D D D D D

Golden Spartans

Spartan 200

Fighting Spartans

Blue and Gold

Century Spartans and Varsity Club

($2,500)

($1,000)

($500)

($250)

($100)

D D D D D D D D D D D D D D D D D D

D D D D D D D D D D D D D D D D D

D D D D D D D D D D D D

D D D D D D D D D D

D D D D D D D

* Members contributing $250 or more annually are eligible for membership at the Campus Recreation Center for an additional $200 per person. ** Campus Recreation Center membership available at no extra cost. Call the Spartan Club for details

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.co

6SDUWDQ&OXE0HPEHUVKLS%HQHĂ&#x20AC;WV

The Spartan Club

Spartan Club Executive Committee Chair: George Hoyle, â&#x20AC;&#x2DC;90 - Managing Partner, Compass Financial Partners LLC Jack Arehart, â&#x20AC;&#x2DC;76 - Senior Vice President, Compass Capital Corporation William Barrier - President, Greensboro Solutions, Inc. Dr. Richard Beavers, â&#x20AC;&#x2DC;76 - Beavers & Keating, DDS John Bielski Randy Clarida â&#x20AC;&#x2DC;98 - Investigator/CSO, Food & Drug Administration Katie Dannemiller - Vice President of Operations, Greensboro Grasshoppe Michael H. Godwin - Schell, Bray, Aycock, Abel & Livingston, PLLC Carolyn T. Green â&#x20AC;&#x2DC;70 - Executive Director, Piedmont Senior Care Kurt Kronenfeld â&#x20AC;&#x2DC;79 - Vice President, Senn Dunn Insurance Dean Little, III - Yost & Little Kevin McCoy - Vice President, South Atlantic Lumber 5REHUW03LWWVÂś3ULQFLSDO7KH6XWKHUODQG%HQHĂ&#x20AC;W*URXS Chris Relos â&#x20AC;&#x2DC;84 - Registered Rep, Plybon & Associates, Inc. Dr. Patti Stewart - Vice Chancellor for University Advancement, UNCG Marc Bush - President, Greensboro Sports Commission Dick Stewart, Associate Director of Athletics, UNCG Dr. Terry Ackerman, Faculty Athletics Rep, UNCG C. Thomas Martin â&#x20AC;&#x2DC;70 - Former Director of Planning, City of Greensboro Nelson Bobb - Director of Athletics, UNCG

UNCG Women s Basketball Media Guide â&#x20AC;˘ 109


UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Media Information

Working Credentials

UNCG Sports Information

Credentialswillbeissueduponrequesttoworkingmembersoftheprintandbroadcast media.Internet-basedmediamemberswillbeprovidedcredentialsonaspace-availDEOHEDVLV7KH81&*VSRUWVLQIRUPDWLRQRIĂ&#x20AC;FHUHWDLQVWKHULJKWWRGHQ\RUUHYRNH FUHGHQWLDOVWRPHGLDRXWOHWVRUDVSHFLĂ&#x20AC;FPHPEHURIWKHPHGLD All requests for credentials must be received no later than the day before the game. Credential requests made on the day of the game can not be guaranteed and should be avoided. For games on the UNCG campus, credentials can be picked up at the will call gate of UNCGâ&#x20AC;&#x2122;s Fleming Gymnasium. $Q\RXWOHWWKDWLVLVVXHGDVHDVRQFUHGHQWLDOVKRXOGVWLOOFRQWDFWWKH6,'RIĂ&#x20AC;FHWR obtain courtside seating for all events. 3URIHVVLRQDOVFRXWVVKRXOGFRQWDFWWKHVSRUWVLQIRUPDWLRQRIĂ&#x20AC;FHIRUSUHVVURZVSDFH Professional scouts will be required to buy a ticket and shall only receive space on press row if seats are available. Spouses, dates and children will not be granted working credentials. Non-working media will only be issued credentials on a space-available basis. RequestsformediacredentialsshouldbesenttoJessicaPoole,UNCGSportsInformaWLRQ2IĂ&#x20AC;FH32%R[*UHHQVERUR1&RUHPDLOWRMHSRROH#XQFJHGX

Media Parking Limited parking is available for media members behind Fleming Gymnasium. Media PHPEHUVVKRXOGDOHUWWKHVSRUWVLQIRUPDWLRQRIĂ&#x20AC;FHZKHQUHTXHVWLQJFUHGHQWLDOVRI DQ\QHHGIRUSDUNLQJSDVVHV2YHUĂ RZSDUNLQJIRUPHGLDLVDYDLODEOHLQWKH:DONHU Parking deck. In the event of inclement winter weather, parking in Walker Decker is recommended for media to make for easier accomodations.

Photographers Accredited photographers may shoot from either baseline, but must contact the 81&*6,'2IĂ&#x20AC;FHIRUFUHGHQWLDOV3KRWRJUDSK\IURPSUHVVURZLVQRWDOORZHGZLWKRXW the expressed consent of a UNCG Sports Information staff member. Due to a limited number of phone lines on press row, telephone lines for use by photographers must be ordered in advanced and may require an installation fee to be paid by the outlet.

Mike Hirschman

Notes, releases, statistics and other pertinent informaWLRQDUHDYDLODEOHRQWKH81&*RIĂ&#x20AC;FLDO:HEVLWH ZZZ uncgspartans.com). Statistics are updated approximately one hour after each game. Notes are available within 24 hours of tip-off for each game. FOR ADVANCE COPY OF GAME NOTES (PRIOR TO POSTING ON WEBSITE), E MEDIA MEMBERS SHOULD CONTACT THE SPORTS INFORMATION OFFICE.

110 â&#x20AC;˘ 2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

Christy Kramer

Interviews Gameday Head coach Lynne Agee will be available for postgame interviews in the UNCG Media Room following his commitment to radio interviews. Requested players will be available after a 10-minute â&#x20AC;&#x153;cooling offâ&#x20AC;? period. Up to three players will be brought to the media room for games played at Fleming Gym. THE UNCG LOCKER ROOM IS CLOSED TO THE MEDIA. 8QOHVVH[SUHVVHGSHUPLVVLRQLVJLYHQE\WKHVSRUWVLQIRUPDWLRQRIĂ&#x20AC;FHSOD\HUVDUH notavailablepriortoacontest.Requestsforpre-gameinterviewswithcoachingstaff members should be communicated to a member of the sports information staff as early as possible. Practice Each day prior to the start of practice, selected players can be made available for LQWHUYLHZVE\FDOOLQJWKHVSRUWVLQIRUPDWLRQRIĂ&#x20AC;FHEHIRUHQRRQ$OOLQWHUYLHZVPXVW becompleted15minutesbeforethestartofpractice.ForinterviewswithCoachAgee, FRQWDFWWKHVSRUWVLQIRUPDWLRQRIĂ&#x20AC;FH Practices are generally open to the media, but may be closed at the discretion of the coachingstaff.Newscameratapingofpracticecanbedeniedatthediscretionofthe FRDFKLQJVWDII)RUSUDFWLFHVFKHGXOHVSOHDVHFRQWDFWWKH6,'RIĂ&#x20AC;FH

UNCG Web site â&#x20AC;˘ www.uncgspartans.com UNCGSpartans.com, designed in a partnership with XOS Technologies, combines the usual reliability of scores, stats, game previews and reviews with some new features and cutting-edge technology. It also includes multimedia features, including live and tape-delayed game footage, coach and game video features, an online store to buy tickets and the latest â&#x20AC;&#x153;Spartan Gearâ&#x20AC;? and much, much more.

Jessica Poole


7KH81&*VSRUWVLQIRUPDWLRQRIĂ&#x20AC;FHZLOOGRHYHU\WKLQJSRVVLEOHWRDFFRPRGDWH the needs of media covering Spartan athletics. A series of phone lines are available courtside for use by media members. For those wishing to make long distance calls, it is mandated by the UNCG sports LQIRUPDWLRQRIĂ&#x20AC;FHWKDWWKRVHFDOOVVKRXOGEHFROOHFWZLWKDFDOOLQJFDUGRUYLDD toll-free number. Exceptions may only be granted by the sports information staff andshouldberequestedbeforegameday.Inthecaseofexceptions,mediaoutlets will be billed for toll calls made. Print media (including photographers) wishing to have dedicated phone lines VKRXOGFRQWDFWWKH81&*VSRUWVLQIRUPDWLRQRIĂ&#x20AC;FHDWOHDVWRQHZHHNLQDGYDQFH of gameday. All installation charges will be billed to the media outlet. Wireless ,QWHUQHWLVDOVRDYDLODEOHRQDWHPSRUDU\EDVLV3OHDVHFRQWDFWWKH6,'RIĂ&#x20AC;FHIRU details.

Internet media outlets provided with credentials will only be provided phone lines if available. Media outlets may also request box scores / AP-style agates to be faxed or ePDLOHGWRWKHLURIĂ&#x20AC;FHV6XFKUHTXHVWVVKRXOGEHPDGHSULRUWRWLSRII Sports Information staff members will provide in-game statistics to members of the media on press row via printed box scores and/or courtside stat monitors.

SoCon On The Web â&#x20AC;˘ www.soconsports.com The SoCon site on the Internet is available at www.soconsports.com. The site contains current information on all facets of the Southern Conference. Please FRQWDFW0LNH%DOOZHJRU-RQDWKDQ&DVNH\LQWKH6R&RQ2IĂ&#x20AC;FHDW for more information.

Spartan Radio Network All UNCG menâ&#x20AC;&#x2122;s basketball and select womenâ&#x20AC;&#x2122;s basketball home game are broadcast on the Spartan Radio Network. Scott Pryzwansky and Dick Stewart call the action. The complete list of stations for the network can be found in the menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s basketball game notes. Games can also be heard on the Internet at uncgspartans.com.

UNCG Policy on Injury Reports Due to circumstances surrounding the Family Education Rights and Privacy Act (FERPA)andtheHealthInsurancePortabilityandAccountabilityAct(HIPAA),UNC Greensboro has developed a policy regarding the release of injury information. UNCG student-athletes have the right to hold all injury information, except ERG\SDUWDQGSOD\LQJVWDWXVFRQĂ&#x20AC;GHQWLDODQGSULYDWH$VDVWDQGDUGRSHUDWLQJ procedure, coaches, sports information staff, and other athletic department SHUVRQQHOVKRXOGUHIUDLQIURPVKDULQJVSHFLĂ&#x20AC;FLQMXU\LQIRUPDWLRQZLWKWKHPHGLD However, in certain occasions, injury information could be released at the discretion of the sports information department after authorization is obtained from the student-athlete.

Print Associated Press 4020 Westchase Blvd., Suite 300, Raleigh, NC 27606 E-mail: apraleigh@ap.org P: 800-662-7075 F: 919-834-1078 News & Record PO Box 20848, Greensboro, NC 27420-0848 Rob Daniels, Beat writer E-mail: sports@news-record.com P: 336373-7062 F: 336-373-7067 Winston-Salem Journal PO Box 3159, Winston Salem, NC 27102 Tommy Bowman, writer E-mail: jbowman@wsjournal.com P: 336-727-7320 F: 336-727-4083 High Point Enterprise PO Box 1009, High Point, NC 27261 Benny Phillips, Sports Editor P: 336-888-3500, x256

E-mail: sportsroom@hpe.com F: 336-841-5165

The Charlotte Observer PO Box 32188, Charlotte, NC 28232 Harry Pickett, Sports Editor P: 704-358-5125 / 5127

E-mail: obsports@charlotteobserver.com F: 704-358-5110

Raleigh News & Observer PO Box 191, Raleigh, NC 27602 Sherry Johnson, Sports Editor P: 800-873-4500 / 919-829-4560

E-mail: sports@newsobserver.com F: 919-829-4888

The Durham Herald-Sun PO Box 2092, Durham, NC 27702 Staff P: 919-419-6674

E-mail: jfurlong@herald-sun.com F: 919-419-6889

Burlington Times-News 707 S. Main St., Burlington, NC 27215 Bob Sutton, Sports Editor E-mail: bob_sutton@link.freedom.com P: 800-488-0085 F: 336-229-2463 The Carolinian Room 212, Elliott University Center UNCG, Greensboro, NC 27412 P: 336-334-5752

E-mail: carolinian_sports@yahoo.com

Electronic WFMY-TV (CBS) 115 Phillips Ave., Greensboro, NC 27420 Greg Kerr, Sports Director E-mail: gkerr@wfmy.gannett.com P: 336-379-9369 F: 336-230-0971 WGHP-TV (FOX) 2005 Francis St. High Point, NC 27263 Rich Brenner, Sports Director P: 336-821-1182/1166

E-mail: rbrenner@wghp.com F: 336-887-8236

WXII-TV (NBC) PO Box 11847 Winston-Salem, NC 27116 Dave Goren, Sports Director P: 336-721-9944

E-mail: dgoren@hearst.com F: 336-721-0856

It is the policy of the UNCG athletic training staff to not address the media unless it is absolutely necessary. Therefore, inquiries by the media regarding medical VLWXDWLRQVVKRXOGEHDGGUHVVHGWRWKHVSRUWVLQIRUPDWLRQRIĂ&#x20AC;FH

2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guideâ&#x20AC;˘ 111

Media Information

Visiting broadcast media are provided two telephone lines and an ISDN line per Southern Conference policy. Non-conference schools wishing to use ISDN will EHUHTXLUHGWRSD\DXVDJHIHH &RQWDFWWKH6,'RIĂ&#x20AC;FHIRUGHWDLOV 5HTXHVWVIRU additional phone lines should be made well in advance of gameday. Additional phonelineswillbeprovidedifavailable.Ifnot,themediaoutletwillberesponsible for the installation and all applicable charges.

UNCG Media Outlets

UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCG

Gameday Services


NCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘ UNCGSpartans.com â&#x20AC;˘

Getting to UNCG

rom the North and East (Burlington, Raleigh/Durham, Richmond, VA): From I-40/85, follow I-40/Business 85 towards Greensboro/Winston-Salem. Take the Freeman Mill Road/Coliseum Area exit, and turn right on Freeman Mill Rd. Turn left at WKHĂ&#x20AC;UVWVWRSOLJKWRQWR&ROLVHXP%RXOHYDUG)ROORZIRUDSSUR[LPDWHO\PLOHVDQGWXUQ right at third stoplight onto Spring Garden Street. Turn left on Stirling Street, and the Walker Avenue Parking Deck will be on your left at the corner of Stirling and Theta Streets, approximately .7 miles.

the South (Salisbury, Charlotte, Atlanta, GA): From I-85 North, follow Business 85 towards Greensboro, then take the Holden Road exit and turn right on Holden Road. Follow Holden for approximately 4.5 miles and turn right on Market Street. Follow Market Street for approximately 1.5 miles. Turn right on Aycock Street South. At the second stoplight, turn left on Spring Garden Street. Turn left on Stirling Street, and the Walker Avenue Parking Deck will be on your left at the corner of Stirling and Theta Streets, approximately .7 miles.

rom the West (Winston-Salem, Asheville, Knoxville, TN): From I-40 East, take the Wendover Avenue East exit. Follow Wendover to the exit for Market Street (3.5 miles). Turn right on Market Street and follow for less than 1 mile. Turn right on Aycock Street South. At second stoplight, turn left on Spring Garden Street. Turn left on Stirling Street, and the Walker Avenue Parking Deck will be on your left at the corner of Stirling and Theta Streets.

rom the North on Highway 220 (Eden, Martinsville, Roanoke, VA): Highway 220 South becomes Battleground Avenue. Stay on Battleground until you cross the intersection of Cornwallis Drive. Immediately bear right on Westover Terrace. (Battleground Avenue and Highway 220 will bear left.) Stay on Westover as it becomes Aycock Street. At the Ă&#x20AC;IWKVWRSOLJKWWXUQOHIWRQWR6SULQJ*DUGHQ6WUHHW7XUQOHIWRQ6WLUOLQJ6WUHHWDQGWKH:DONHU Avenue Parking Deck will be on your left at the corner of Stirling and Theta Streets.

112 â&#x20AC;˘2007-08 UNCG Womenâ&#x20AC;&#x2122;s Basketball Media Guide

From the South on Highway 220 (Asheboro, Rockingham): From Highway 220 North, follow the signs to the Coliseum area. Turn left at the stoplight onto Coliseum Boulevard. Follow for approximately 1.5 miles and turn right at third stoplight onto Spring Garden Street. Turn left on Stirling Street, and the Walker Avenue Parking Deck will be on your left at the corner of Stirling and Theta Streets, approximately .7 miles.

From the North on Highway 29 (Reidsville, Danville, VA): From Highway 29 South take the Wendover Avenue West/Hospital Exit. Follow Wendover for approximately 2.6 miles and take the Westover Terrace exit. Follow the exit to the right, and merge right, following the Coliseum sign. Stay on Westover as it becomes Aycock Street. Turn left at the fourth stoplight onto Spring Garden Street. Turn left on Stirling Street, and the Walker Avenue Parking Deck will be on your left at the corner of Stirling and Theta Streets.

From the South on Highway 421 (Sanford, Fayetteville): From highway 421 North, take I-40 West towards Winston-Salem. Take the Freeman Mill 5RDG&ROLVHXP$UHDH[LWDQGWXUQULJKWLQ)UHHPDQ0LOO5G7XUQOHIWDWWKHĂ&#x20AC;UVWVWRSOLJKW onto Coliseum Boulevard. Follow for approximately 1.5 miles and turn right at third stoplight onto Spring Garden Street. Turn left on Stirling Street, and the Walker Avenue Parking Deck will be on your left at the corner of Stirling and Theta Streets, approximately .7 miles.


UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans.com • UNCGSpartans • UNCG

Radio/TV Chart

#10 Sharniece Wadelington Fr.-r • G • 5-6 Greenville, SC J.L. Mann HS

#15 Monique Floyd Fr. • G • 5-9 Fairmont, NC Fairmont HS

#22 Kemena Brooks Sr. • G • 5-8 Accokeek, MD Gwynn Park HS

#31 Ashley Mullins Jr. • F • 5-11 Honaker, VA Honaker HS

#41 Agne Girstautaite Fr.-r • C • 6-4 Kaunas, Lithuania Holy Cross HS [VA]

#3

Jasmine Dixon

Sr. • F • 5-11 Reston, VA South Lakes HS

#14

TaShama Banner

Fr.-r• G • 5-7 Bladenboro, NC West Bladen HS

#21

Kristen Boone

Sr. • G • 5-5 Up. Marlboro, MD Gwynn Park HS

#30

Gini Grimsley

Jr. • G/F • 6-0 Fairmont, NC Fairmont HS

#40

Brittany Frazier

Sr. • F • 6-0 Powell, TN Oak Ridge HS (Walters State CC)

Sr. • C • 6-3 Lake Mary, FL Lake Mary HS

Meghan Chamberlain

#44

Fr. • F • 6-1 Columbus, GA Kendrick HS

Kendra Smith

#33

Jr. • G • 5-6 Centreville, VA Centreville HS

Ashley Ling

#23

Fr. • F • 5-10 Jacksonville, NC Northside HS

Johanna Womack

#20

So. • G • 5-7 Accokeek, MD Gwynn Park HS

Lakiah Hyson

#12

Profile for UNCG Athletics

2007-08 UNCG Women's Basketball Media Guide  

2007-08 UNCG Women's Basketball Media Guide

2007-08 UNCG Women's Basketball Media Guide  

2007-08 UNCG Women's Basketball Media Guide

Profile for uncgsid
Advertisement