Page 1

ribun Lampung










Rp 1.000




Ikhwan dan Endang Tertunda Jadi Anggota DPRD Jadwal Pelantikan  18 Agustus 2009  Bandar Lampung  Metro  Lampung Utara  Lampung Tengah  Tanggamus  Lampung Timur  19 Agustus 2009  Tulangbawang  Way Kanan  Lampung Barat  Lampung Selatan  20 Agustus 2009  Pesawaran

BANDAR LAMPUNG, TRIBUN - Anggota DPRD tingkat kabupaten/kota di enam kabupaten /kota di Provinsi Lampung dilantik Selasa (18/8). Pelantikan anggota DPRD periode 2009-2014 itu tidak diikuti Ikhwan Fadil Ibrahim caleg terpilih dari Bandar Lampung, dan Endang Rahayu Ningsih dari Metro. Di Bandar Lampung dari 45 anggota legislatif, hanya 44 orang yang akan diambil sumpahnya oleh Ketua Pengadilan Negeri Tanjung-

karang, Robert Simorangkir. “Hanya terdapat 44 anggota yang akan dilantik besok (hari ini). Namanama tersebut kami terima dari Gubernur Lampung,” kata Sekretaris DPRD Bandar Lampung, Effendi Yusuf, Senin (17/8). Effendi mengaku, tidak mengetahui pasti penundaan pelantikan Ikhwan, caleg terpilih Partai Gerindra. Pihaknya hanya mengundang 44 caleg terpilih yang tercantum dalam Surat Keputusan (SK) Guber-

nur nomor G.529/B.II/HK/2009 untuk gladi resik serta pelantikan. Dalam SK tersebut terdapat dua lampiran. Satu lampiran merinci nama-nama anggota DPRD periode baru, dan tidak terdapat nama Ikhwan. “Sedangkan satu lampiran lagi berisi nama-nama anggota DPRD periode 2004-2009 yang habis masa jabatannya,” ujarnya. Menurutnya, satu anggota yang  ke halaman 7

Diki Histeris Tiga Temannya Tewas  Tenggelam Saat Belajar Renang di Kolam


PERANG BANTAL - Dua warga Gedong Pakuon, Telukbetung Selatan, sedang beradu dalam lomba perang bantal memeriahkan hari ulang ke-64 kemerdekaan Republik Indonesia, Senin(17/8). Selain perang bantal, warga setempat mengadakan lomba balap sampan dan panjat pinang.

Gempa Merembet ke Arah Bengkulu PADANG, TRIBUN - Gempa susulan berskala rendah mewarnai peringatan Hari Ulang Tahun (HUT) ke-64 RI di Kota Padang, Sumatera Barat, Senin (17/8). Badan Meteorologi Klimatologi dan Geofisika mencatat gempa kelima terjadi pada pukul 07.33 WIB dengan kekuatan 5,2 Skala Richter (SR). Namun demikian, aktivitas warga di Kota Padang dan Sumatera Barat pada umumnya tetap berjalan normal. Gempa terbaru tersebut berada pada posisi 1.51 LS - 99.43 atau 67 km tenggara Siberut Mentawai, dengan kedalaman 10 km. Sebelumnya, secara berturut-turut terjadi gempa pada pukul 02.53 WIB, 03.23 WIB, dan pukul 04.53 WIB, dengan kekuatan 5,3 SR. Ketiga gempa ini berpusat di Siberut, Mentawai. Gempa keempat yang terjadi pada pukul 07.07 WIB dengan kekuatan 5,0 SR, berpusat di 74 km sebelah barat Bengkulu. Koordinator Satkorlak Penanggulangan Bencana Sumatera Barat Ade Edwar mengatakan, sejauh ini belum ada

Ancaman Gempa Makin Meningkat  Warga di Pesisir Barat

Sumatra Harus Waspada PADANG, TRIBUN - Pakar gempa dari Lembaga Ilmu Pengetahuan Indonesia (LIPI) Dr Danny Hilman Natawidjaja mengatakan, gempa yang terjadi di Mentawai, Sumatera Barat, Minggu (16/8), dan Senin (17/8), masih rangkaian gempa tahun 2007. “Dari penelitian kami di Mentawai, kawasan ini menyimpan energi gempa yang masih banyak,” kata Danny di Jakata, Senin. Sebelumnya, LIPI berdasarkan penelitian beberapa tahun terakhir, pernah mengungkapkan temuan bakal terjadinya gempa besar Sumatera yang perlu diwaspadai. “Masyarakat yang bermukim di pantai barat Sumatera memang perlu waspada. Namun jangan sampai panik,” kata Danny yang ikut dalam penelitian bersama Kerry Sieh,

 ke halaman 7

 ke halaman 7

KOTABUMI, TRIBUN - Tiga bocah warga Dusun Wonojoyo, Desa Trimodadi, Kecamatan Abung Selatan, Lampung Utara, tewas saat berenang di rawa desa setempat, Senin (17/8), pukul 14.00 WIB. Ketiga korban yang masih duduk di bangku SD itu adalah kakak adik Irfan Al hakim (9) dan Rifki Fadilah (6), anak pasangan Purnomo (40) dan Sunarti (40). Kemudian Sunu Dwi Jayanto (9), putra pasangan Dirman (40) dan Marsiati (39). Diki yang ikut berenang, dan pertama kali melihat kejadian ini, histeris menyaksikan tiga sahabatnya tewas tenggelam. Belum diketahui pasti penyebab tenggelamnya ketiga bocah itu. Kuat dugaan mereka tenggelam karena tidak bisa berenang saat mandi di rawa yang kedalamannya sekitar dua meter tersebut. Berdasarkan informasi yang dihimpun Tribun Lampung, saat itu ketiga korban dan Diki (6) yang selamat dari peristiwa naas tersebut, sengaja mandi di rawa yang tak jauh dari kediaman Sunu. Tiba-tiba Diki menjerit minta tolong. Murkali alias Bandot (33), warga setempat yang saat itu berada 300 meter dari lokasi, mendengar jeritan Diki. Lalu, Bandot berlari menuju ke arah jeritan suara. Sampai di sana, Bandot mendapati ketiga korban telah tewas mengambang di rawa. Sementara, Diki yang juga ikut mandi berada di bibir rawa menjerit sambil menangis. ”Saya tidak tahu secara jelas kejadiannya. Saat saya datang ketiga anak itu sudah tewas. Sedangkan Diki berada di pinggir rawa, lalu saya menyelamatkannya,” kata Bandot. Bandot juga membawa ketiga bocah yang mengambang ke pinggir rawa. Namun, nyawa mereka tidak tertolong lagi. ”Sadar kalau mereka sudah meninggal, saya kemudian memberitahu keluarga mereka,” aku Bandot diamini Sukirno (38), tetangga korban. Sementara Sunarti ketika ditemui di rumah duka sangat terpukul atas meninggalnya kedua anaknya. Ia tidak menyangka dan tidak memiliki firasat apapun sebelum ditinggalkan Irfan yang masih kelas dua SD, dan Rifki, kelas satu SD. ”Memang mereka sering main di rawa itu. Dan selama ini saya kira mereka tidak mungkin berenang di rawa itu. Ternyata Tuhan berkehendak lain. Kedua anak saya meninggal tenggelam di sana,” ujarnya singkat. Jenazah Irfan dan Rifki langsung dikebumikan Senin sore (17/8), di pemakaman desa setempat. Sedangkan jenazah Sunu rencananya akan dikebumikan Selasa (18/8). ”Dari hasil olah TKP, diperkirakan ketiga korban tewas sekitar pukul 14.30 WIB,” kata Kapolsek Abung Selatan AKP Azarianto.(ang)

UMURNYA baru 50, tapi setidaknya tiga jenis penyakit degeneratif t e l a h mengganggu Nyonya Sumarni Sumarni sejak tiga tahun belakangan. Asam urat tinggi, kolesterol tinggi, dan tekanan darah tinggi telah membuat ibu rumah tangga dengan empat anak ini sulit berjalan. Bahkan tahun 2008 lalu ia sempat tak bisa berjalan sama sekali selama sepekan. Tapi, bukan hanya itu. Kaki dan jemari tangannya sering berdenyutdenyut. Akibatnya, “Pantangan

makanan sangat banyak,” ujar nenek satu cucu ini. Untuk itu, sudah ke mana-mana warga Jalan Kamboja, Kelurahan Labuhan Dalam, Kecamatan Tanjung Senang, Kota Bandarlampung, ini mencari pengobatan. Namun, hasil yang diharapkannya tak juga ia peroleh. “Tahun lalu, ada yang menawarkan bubuk kedelai kepada saya, tapi saya tidak suka rasanya. Kemudian, dua bulan yang lalu ada yang menawarkan ZENA600. Setelah saya coba, ternyata rasanya enak.” Dan setelah dua bulan meminum sari bubuk kacang hijau plus kedelai itu dua kali sehari, ia mulai merasakan hasilnya. “Sudah banyak berkurangnya. Berjalan sudah lancar. Tadinya,

berjalan pakai sandal saya tidak bisa. Tapi sekarang sudah,” ucapnya, April lalu. Pada sebagian wanita, usia di atas empat puluh lima – apalagi sudah mencapai lima puluh – telah menjadi periode yang mengkhawatirkan. Karena, tanda-tanda mereka akan memasuki menopause sudah mulai terlihat. Menurut istilah kedokteran, masa ini disebut perimenopause. Berkaitan dengan ini, sebuah perusahaan distribusi kedelai bubuk instan pernah melakukan kerja sama dengan Fakultas Kedokteran Universitas Indonesia meneliti pengaruh pemberian susu kedelai terhadap kasus

Sekitar 15 menit kemudian Sunu berenang ke arah kedalaman sekitar dua meter. Tiba-tiba Sunu tenggelam dan diduga menarik Irfan tapi keduanya ternyata kurang lihai berenang


Rifki mencoba menolong Irfan dan Sunu, tetapi tidak bisa dan ketiganya tenggelam. Diki yang berenang di rawa yang tak dalam, menjerit minta tolong ketika melihat ketiga temannya tak muncul ke permukaan


Korban diperkirakan tewas sekitar pukul 14.30 WIB


Murkalis alias Bandot seorang warga yang dekat dengan lokasi kejadian mendengar teriakan Diki, bergegas ke lokasi dan langsung menolong bocah tersebut. Tetapi malang, sampai di lokasi Bandot mendapati bocah-bocah itu sudah mengapung di atas air


Bandot pun mengangkat ketiga korban ke tepi rawa dan melaporkan kejadian kepada keluarga korban. Masing-masing keluarga membawa pulang jenazah ke rumah Rumah Sunu Rumah Irfan dan Rifki Rumah Bandot


Lokasi kejadian Rawa Ds Wonojoyo Sumber:


k Abung


Tobong Bata




Sunu Anak Periang SUASANA duka tampak di kediaman almarhum Irfan Al Hakim dan Rifki Fadilah, di Dusun Wonojoyo, Desa Trimodadi, Kecamatan Abung Selatan, Lampung Utara. Kerabat dan tetangga berdatangan ke kediaman putra pasangan Purnomo dan Sunarti untuk melayat, dan sebagian melantunkan Surat Yasin. Raut wajah duka tampak dari orangtua Irfan dan Rifki. Mereka hanya bisa memandangi jasad anaknya yang terbungkus kain kafan. Sunarti tak menyangka anak kesayangannya akan pergi begitu cepat. Kepergian Irfan dan Rifki merupakan pukulan berat yang dialami Purnomo dan istrinya. Sebab, anak pertamanya terlebih dahulu menghadap Sang Khalik.

Sunarti juga masih terlihat shock. Duka yang mendalam juga terlihat di rumah Sunu Dwi Jayanto, yang berjarak sekitar 500 meter dari rumah Irfan. Putra pasangan Dirman dan Marsiati ini, juga menjadi korban tenggelam bersama Irfan dan Rifki. Tunggal, kakak korban, menuturkan, Sunu termasuk anak yang periang dan sangat disayang keluarga. “Sunu sangat dicintai keluarga,” ujar Tatung sapaan akrab Tunggal. Menurut rencana, Sunu baru akan dimakamkan hari ini Selasa (18/8). Berdasarkan keterangan Kapolsek Abung  ke halaman 7

Dua Rekor Dunia Baru dari Teluk Manado


Sekarang Sudah Bisa Berjalan Pakai Sandal

Maut di Rawa Wonojoyo Sekitar pukul 14.00 WIB empat bocah Irfan Al Hakim, Rifki Fadilah, Sunu Dwi Jayanto,dan Diki, berenang dan mandi di rawa di Dusun Wonojoyo.

Upacara di dalam Air Berjalan 45 Menit Manado jadi ajang pemecahan dua rekor dunia menyelam dan upacara bendera di bawah air. Perairan Teluk Manado jadi sentrum kegiatan yang digagas Departemen Kelautan dan Perikanan serta TNI AL. Ada begitu banyak partisipan asing datang, menjawab semua keraguan tentang situasi keamanan di Indonesia. Hari ini, Rabu (19/8), kapal raksasa pengangkut armada tempur USS George Washington juga akan masuk perairan Manado mengikuti Sail Bunaken 2009.

”INI hadiah kemerdekaan bagi Indonesia dan warga negaranya,” kata Lusia Sinigagliesi, Adjudication Manager Guinness World Record saat menyerahkan pengakuan rekor baru dunia upacara pengibaran bendera di bawah laut yang tercipta bertepatan dengan ulang tahun ke-64 kemerdekaan Indonesia, Senin (17/8).

„ ke Halaman 2  ke halaman 7

TELEPON SEMUA BAGIAN: 0721-704777 (5 LINE)  IKLAN: 0721-3585522  SIRKULASI: 0721-3585533, 08127211010 HOTLINE PUBLIC SERVICE: 08127212211



FLYING PASS - Tiga jet tempur Sukhoi 30 TNI AU terbang lintas di atas perairan Teluk Manado, Senin (17/8). Hari ini mereka akan mengikuti parade Sail Bunaken 2009.



tribun finance


Tribun Lampung

Rupiah Tertahan di Level 9.900 Nilai tukar rupiah bergerak anomali, hanya bergeser sebentar di level 10.000 lalu melemah menjadi 9.890 kemudian menguat kembali sebesar 9.900 FARIAL ANWAR Managing Director Currency Management Group TRIBUN LAMPUNG/SITI NURYANI

SEMINAR KEUANGAN - Dalam peringatan ulang tahunnya yang ke-37, Bank Eka menggelar customer gathering dan penarikan undian deposito berhadiah pada Jumat (14/8) bertempat di Hotel Sheraton, Bandar Lampung. Sebagai bagian acara ini digelar pula seminar keuangan yang menghadirkan perencana keuangan Mike Rini Sutikno sebagai pembicara tentang “Cara Efektif Mengelola Keuangan Keluarga.”

Pengamat: Alokasi Tabungan dan Investasi 10-30 Persen BANDAR LAMPUNG, TRIBUN - Kemampuan mengatur keuangan yang diperoleh bisa menjadi hambatan untuk mengalokasikan pemasukan menjadi investasi. Jika semua orang memiliki kesadaran mengatur pemasukan dan tahu tujuan hidupnya, akan lebih mudah untuk menambah penghasilan. Seperti inilah pesan yang disampaikan perencana keuangan, Mike Rini Sutikno, dalam seminar keuangan yang digelar pada customer gathering Bank Eka, Jumat (14/8). Mike menerapkan konsep perencanaan keuangan yang seimbang antara pengembangan kualitas teknis dan kualitas sikap mental terhadap uang dan masalah keuangan. Menurut Mike, seseorang ha-

rus cermat mengalokasikan sejumlah tertentu dari total pemasukannya. Pembagian pengeluaran dapat dilakukan dengan perhitungan pengeluaran tabungan dan investasi sebesar 10 sampai 30 persen. “Ini bertujuan menyimpan uang untuk digunakan lagi di masa depan, misalnya alokasi dana di sektor riil, portofolio, dan komoditas,” kata dia. Kedua, lanjut Mike, cicilan hutang dengan besar maksimal 30 persen. Pengeluaran ini mengurangi kewajiban hutang dan meningkatkan kekayaan bersih. Contohnya, kredit pemilikan rumah (KPR), kredit usaha, dan kartu kredit. Selanjutnya, proteksi sebesar 5 hingga 15 persen untuk mendapat pemasukan insidentil,

proteksi penghasilan dan kekayaan dari resiko keuangan. Misalnya asuransi resiko harta benda, jiwa, dan kesehatan. “Terakhir, biaya hidup yang berkisar antara 40 sampai 60 persen untuk mendukung kelancaran aktivitas harian. Empat poin inilah yang dinamakan budget efektif dalam mengelola keuangan keluarga,” terang Mike. (yan)

Mengelola Keuangan Pribadi  Darimana - ke mana - berapa

- apa hasilnya  Bukan berapa yang dihasilkan, tapi berapa yang bisa disimpan dan terus dikembangkan  Kekayaan dimulai dengan me-

nggunakan uang, bukan menghabiskan uang

BANDAR LAMPUNG, TRIBUN - Nilai tukar rupiah terhadap dolar Amerika Serikat sulit bergerak leluasa. Perdagangan berkisar pada level 9.900 dengan penguatan berkisar antara 25 poin hingga 90 poin. Menurut pengamat mata uang, Managing Director Currency Management Group, Farial Anwar, penguatan rupiah cukup terbatas

meskipun pasar modal melenggang cukup tajam. “Nilai tukar rupiah bergerak anomali, hanya bergeser sebentar di level 10.000 lalu melemah menjadi 9.890 kemudian menguat kembali sebesar 9.900,” terangnya, Senin (17/8). Farial menuturkan sepertinya Bank Indonesia (BI) juga tidak

menginginkan rupiah menguat, sebab pihak bank juga punya kepentingan. Di antara kepentingan itu, lanjutnya, pendapatan yang diperoleh dari cadangan devisa di luar negeri terhimpun dalam bentuk dolar. Trading rate nilai tukar rupiah pada pekan ini diprediksikan tetap pada level 9.900 hingga 9.975.

Masih bisa terjadi peningkatan rupiah apabila BI tidak menahannahan rupiah. “Jika kondisi ini terus berlanjut, akan memberikan pengaruh negatif terhadap masyarakat. Sebab, potensi minyak dunia akan naik, dolar mahal, akibatnya subsidi bahan bakar minyak (BBM) melambung,” sambung Farial.(yan)

IHSG Cenderung Melemah MENURUT analis saham, Kepala Riset Ekuitas Mega Capital Indonesia, Felix Sindhunata, minggu lalu indeks harga saham gabungan (IHSG) sempat berada di kisaran 2.300 hingga 2.400. Hal ini disebabkan bursa Amerika yang berada di atas satu persen dan bursa Asia yang cenderung menurun. Felix memprediksikan indeks saham akan melemah minggu

ini. Penurunan ini dikarenakan harga minyak dunia yang menurun, bursa Asia, dan dari sisi domestik belum muncul berita-berita baru. Turunnya harga minyak akan berpengaruh pada saham-saham energi di Amerika yang tidak terlalu menopang. Hal ini bisa menekan sektor energi Indonesia terutama batubara. Melemahnya indeks, lanjutnya, juga didukung

sentimen libur panjang akhir pekan di mana trader mengamankan profit mereka terlebih dahulu sebagai antisipasi dari kemungkinan munculnya berita negatif pada hari Senin, saat bursa Indonesia libur hari kemerdekaan. “Pekan ini merupakan waktu yang baik bagi investor untuk mengakomodasi saham-saham yan blue chip,” kata dia. (yan yan)

the executive

Kemerdekaan di Mata Sri Mulyani KEMERDEKAAN bagi seorang Menteri Perekonomian Sri Mulyani Indrawati adalah membebaskan rakyat Indonesia dari kemiskinan. Dan untuk mencapainya, hal itu bukan saja menjadi tugas pemerintah dan BUMN. “Arti kemerdekaan adalah suatu misi untuk membangun negara karena kalau kita merdeka dari penjajahan berarti kita harus merdeka dari kemiskinan,” kata Sri Mulyani di Gedung Menko Perekonomian, Jakarta, Senin (17/ 8). Menurut Sri Mulyani, kemerdekaan ini harus diisi dengan kompetisi kepandaian dan ilmu pengetahuan serta harus bisa mengatasi berbagai hal yang masih

mengancam satu kesatuan bangsa Indonesia dan mengurangi kesejahteraan rakyat. “Semua tentunya harus dilakukan bersama-sama untuk keselamatan rakyat. Bukan hanya BUMN, tapi juga swasta dan seluruh masyarakat dengan meningkatkan kinerja sehingga bisa berkontribusi bagi perekonomian kita. Itu yang kita harapkan.” ungkapnya. Sri Mulyani menyatakan, untuk tahun 2010 pemerintah akan berjuang untuk mencapai pertumbuhan ekonomi antara 5 hingga 6 persen. Namun ia menambahkan, saat ini pihaknya harus melihat terlebih dahulu perkembangan ekonomi semes-

ter I tahun ini. “Kondisi semester I tidak seburuk seperti yang dibayangkan, dan semester kedua kita akan hati-hati, meskipun dari sisi pendapatan pada sektor investasi kita harus tetap pantau dengan baik. Lebih dari lima persen bukanlah sesuatu yang tidak mungkin, namun kita akan terus melihat dari faktor yang menyumbangnya,” paparnya.(dtc)

Biofile  Sri Mulyani Indrawati  Lahir : 26 Agustus 1962, Tanjungkarang,

Lampung, Indonesia  Pekerjaan : Pengamat ekonomi, kepala

Bappenas, Menteri Keuangan, Menteri Koordinator Perekonomian PERSDANETWORK


Dari Halaman 1

Berjalan Pakai Sandal ...................... perimenopause, yang dilakukan dari bulan November 2007 hingga Maret 2008. Setiap peserta selama delapan minggu mengonsumsi kedelai bubuk secara rutin setiap hari 60 gram atau setara dengan 143 kkal/ hari. Selama menjalani penelitian, asupan makanan peserta dijaga. Artinya, mereka tak boleh memakan makanan atau meminum minuman yang menambah atau mengurangi kadar kolesterol dalam waktu cepat. Dari 19 perempuan yang diteliti, sebelum mengonsumsi kedelai bubuk itu gejala per-

imenopause mereka terdiri atas: minor 16 orang, ringan dua orang, dan sedang satu orang. Tetapi seusai penelitian, semuanya menjadi minor. Yang lebih menggembirakan, dari pemeriksaan laboratorium diperoleh data: terjadi penurunan kadar kolesterol total dari 198,68 ke 186,16 mg/dl, serta penurunan kolesterol LDL dari 134,32 ke 122,68 mg/dl. Secara uji statistik, kedua penurunan ini jelas signifikan. Dengan demikian, secara umum semua peserta menunjukkan perbaikan klinis perimenopause

setelah mengonsumsi kedelai bubuk. Nah, pada ZENA-600, bukan hanya kedelai yang terkandung, melainkan juga kacang hijau. Tentu saja manfaatnya menjadi ganda karena saling melengkapi. Meski demikian, menjaga pola hidup yang sehat tetap lebih penting untuk dilakukan. Kendati belum lama beredar, Zena-600 sudah laku di seluruh wilayah pemasarannya. Hal itu tak lepas dari manfaatnya yang nyata dan produknya yang diolah higienis.















(0852-698 81303)




Selain itu, formulanya merupakan penyempurnaan dari formula-formula kedelai bubuk yang selama ini mulai banyak beredar di pasaran. Dan ini amat ditunjang oleh mulai sadarnya masyarakat untuk beralih ke bahan-bahan nabati alami dalam memelihara kesehatan. Tapi, produk ini bukanlah obat melainkan makanan kesehatan untuk memelihara kondisi tubuh. Untuk konsultasi kunjungi segera atau telepon (021) 70288540



tribun bisnis


ribun Lampung



XCD 125 DTS-Si dari Bajaj  Motor Sporti dengan Dua Busi

BANDAR LAMPUNG, TRIBUN - Sukses dengan Pulsar 180 dan 200, Bajaj kembali meluncurkan produk teranyarnya, XCD 125 DTS-Si. Kendaraan sporti i n i resmi diluncurkan untuk pasar Lampung sejak kemarin (17/8). Areal Manager Bajaj Lampung dan Palembang Sony Ariefanjaya mengatakan, Lampung merupakan pasar prospektif untuk motor Bajaj.

Sebab, tingkat penggunaan motor masyarakatnya tinggi. “Kami menilai bahwa pasar di Lampung cukup prospektif untuk produkproduk motor sporti kami. Salah satunya karena jalan-jalan di Bandar Lampung cukup mendukung untuk pemakaian motor jenis ini,” ungkapnya. Dengan peluncuran produk ini, lanjut Sony, Bajaj ingin melakukan ekspansi ke pasar motor bebek di Lampung. Menurutnya, hal itu cukup potensial terwujud karena pihaknya menawarkan motor dengan teknologi yang lebih canggih dari bebek, tapi bisa didapatkan dengan harga motor bebek. “Untuk tahun-tahun awal ini kami belum mematok target, kami lebih fokus untuk melakukan brand image,” tutur Sony. Motor XCD 125 DTS-Si ini dipasarkan dengan harga Rp 13,5 juta. Peminatnya dapat membeli

secara langsung maupun kredit melalui main dealer Bajaj di Bandar Lampung dan Bandar Jaya. Untuk kredit, bisa melalui OTO Finance, WOM Finance, dan Bumi Finance. Sony menguraikan, keunggulan motor ini terletak pada tenaganya yang lebih maksimal karena ditunjang dengan dua busi. Mesin berteknologi dua busi ini merupakan inovasi Bajaj yang telah dipatenkan dan terbukti menghasilkan bahan bakar yang sangat hemat. XCD 125 DTS-Si juga dilengkapi dengan ride control. Fitur canggih ini berfungsi untuk mengatur kecepatan kendaraan yang ideal, sehingga pemakaian bahan bakar menjadi lebih efisien. Tingkat keamanannya cukup tinggi. Karena, XCD 125 DTS-Si dilengkapi dengan fitur disk brake. “Keiritan bahan bakarnya tidak kalah dengan motor bebek. Bajaj

XCD 125 DTS-Si  Memiliki 2 busi, sehingga tenaga lebih maksimal  Ride Control: untuk mengontrol laju kendaraan secara ideal  Fitur Disk Brake  Irit BBM: 1 liter bisa 104 km  Tersedia 4 warna: long beach blue, cocktail red, silver chrome, jet black  Harga: Rp 13,5 juta

XCD 125 DTS-Si menghabiskan satu liter bahan bakar untuk jarak 104 Kilometer,” jelas Sony. Ada empat pilihan warna, yaitu long beach blue, cocktail red, silver chrome, dan jet black. “Dalam waktu dekat ini, kami akan memberikan promo belanja gratis di mal tertentu di Bandar Lampung bagi pembeli Bajaj yang beruntung,” janji Sony. (din)

XL Resmikan BTS Ramah Lingkungan TERANYAR Bajaj resmi meluncurkan motor sporti terbarunya, XCD 125 DTS-Si, kemarin (17/8). TRIBUN LAMPUNG/M AKHIRUDIN

BANDAR LAMPUNG, TRIBUN - Bertepatan dengan HUT Ke-64 Kemerdekaan RI, PT Excelcomindo Pratama Tbk (XL) meresmikan beroperasinya BTS ke3045 di Sumatera yang terletak di Kecamatan Ilir Timur I, Palembang. XL juga mengoperasikan secara resmi BTS ramah lingkungan di Gabek, Pangkal Pinang,

Kepulauan Bangka Belitung. Tidak hanya itu, dalam rangka menyemarakan HUT ke-64 Kemerdekaan RI ini, XL menggelar program bertajuk XL Kobarkan Semangat Kebangsaan dan Cinta Tanah Air, Senin (17/8). Acara ini diselenggarakan secara serentak di semua kantor XL di Sumatera dengan mengadakan upacara ben-

Paket Farhan Restoran Bukit Randu BANDAR LAMPUNG, TRIBUN - Menyambut datangnya bulan ramadan, Restoran Bukit Randu mempersembahkan paket Family Ramadan (Farhan). Paket makan istimewa ini hanya ditawarkan sekitar Rp 350 ribu-Rp450 ribu. “Paket semacam ini sudah menjadi program rutin Bukit Randu setiap kali bulan ramadan datang. Variasi masing-masing program terletak pada nama paket dan menu yang disajikan,” ujar Sales and Marketing Manager Bukit Randu Raban, Senin (17/ 8). Paket Farhan ini diperuntukkan bagi enam orang dengan menu utama ayam goreng atau gurame goreng. Makanan ringan dan minuman khas buka puasa juga sudah termasuk dalam menu ini. “Pengunjung bisa memesannya menjelang buka puasa sampai malam hari,” jelas Raban. Bukit Randu juga menyiapkan paket buka puasa untuk korporasi. Paket buka bersama ini ditawarkan dengan harga Rp 85.000 untuk sajian per orang dengan minimal jumlah peserta 60 orang. Untuk memperkental nuansa ramadan, Bukit Randu juga menyediakan jasa penceramah untuk mengisi acara buka bersama korporasi tersebut. Jasa penceramah ini diberikan tanpa biaya. Dan, untuk menyemarakkan suasana, pihak restoran juga menyediakan fasilitas untuk

Paket Ramadan Bukit Randu  Paket Farhan (Family

Ramadan) Harga: Rp 350 ribu-Rp 450 ribu untuk enam orang Menu : makanan ringan dan minuman khas buka puasa, nasi dan sambal, sayur, lauk berupa ayam gorang atau ikan gurame goreng.  Paket buka puasa bersama

Harga: Rp 85 ribu untuk sajian per orang, minimal 60 orang Fasilitas: musik pengantar dan jasa penceramah  Tarif sewa kamar spesial

Ramadan Harga sewa: Rp 325 ribu untuk kamar standar dengan fasilitas regular

musik pengantar acara. “Paket buka bersama ini diberikan tanpa durasi tertentu, mereka bisa makan dan berkumpul selama mereka suka. Dan, jika mereka meminta, kami bisa menyediakan tempat salat selain musala yang sudah ada,” janji Raban. Hotel Bukit Randu selama bulan ramadan memberikan tarif sewa spesial untuk kamar-kamar standar. Harga yang ditawarkan yakni Rp 325 ribu, turun dari biasanya yang tarifnya sebesar Rp 525.000. (din)


UPACARA BERSAMA - Keluarga besar Bukit Randu menggelar upacara peringatan HUT Kemerdekaan RI, Senin (17/8).

Upacara Bendera Bersama BUKIT Randu Hotel dan Restoran memperingati hari kemerdekaan Republik Indonesia (RI) secara unik. Staf manajemen “memerdekakan” para karyawan dari tugasnya sehari-hari. “Kami ingin dalam peringatan hari kemerdekaan ini, staf kami bisa ikut merdeka. Maka tahun ini semua petugas rangkaian acara 17-an dipercayakan pada pengelola dari tingkat supervisor ke atas,” terang Yesti Herlena, manajer operasional Bukit Randu, Senin (17/8). Dalam upacara peringatan hari kemerdekaan yang digelar di halaman Hotel Bukit Randu kemarin, semua staf dengan jabatan di bawah supervisor menjadi peserta. Pada tahun-tahun sebelumnya, mereka menjadi petugas, kecuali untuk inspektur upacara. Usai upacara, sarapan pagi bersama seluruh karyawan Bukit Randu digelar di Restoran Kuring. Staf-staf setingkat supervisor dan di atasnya melayani bawahan mereka selama sarapan. “Tujuannya supaya kami semua bisa berbagi rasa dalam bekerja. Dengan demikian antarkaryawan Bukit Randu akan terjalin kebersamaan yang tentunya membawa dampak positif untuk menjalankan bisnis,” ujar Raban, sales and marketing manager (din) Bukit Randu.(din)

dera. GM Sales Operation XL Sumbagsel Haryo Wibowo, dalam rilis yang dikirim ke Tribun Lampung mengatakan, semua warga negara Indonesia mempunyai kewajiban untuk mempertahankan dan mengisi kemerdekaan ini dengan halhal yang bermanfaat, tidak terkecuali karyawan XL.

Bebas DP dari Vivi Furniture BANDAR LAMPUNG, TRIBUN - Vivi Furniture memberikan diskon 30-50 persen serta bebas uang muka untuk pembelian produknya selama pameran di Mal Kartini. Pameran digelar untuk menyambut momen 17-an dan bulan puasa. “Momentum ini menjanjikan customer yang banyak. Biasanya jelang puasa tren pembelian produk kami ini naik sekitar 10 persen,” tutur Dinna, marketing Vivi Furniture, Senin (17/ 8). Menurut Dinna, momentum 17 Agustus dan jelang bulan puasa merupakan saat yang potensial untuk menjaring pembeli. Apalagi pada masa long week end yang berlangsung sejak Jumat sampai kemarin (17/8) pengunjung mal semakin ramai. “Rata-rata produk kami terjual paling tidak empat unit setiap harinya,” kata Dinna. Selain momentum, pencapaian penjualan ini juga ditunjang oleh penawaran-penawaran istimewa yang diberikan oleh Vivi Furniture.


PROMO - Vivi Furniture memberikan diskon untuk pembelian produk selama pameran di Mal Kartini. Pembeliannya sendiri bisa dilakukan secara tunai dan kredit. Untuk layanan kredit, Vivi Furniture bekerja sama dengan Adira Finance dan Prima Finance. Produk-produk furniture yang disediakan meliputi rak tv, lemari, dan bed set. Mereknya

seperti Gold, Sigma, dan Graver. Untuk produk tersebut, Vivi Furniture memberikan diskon 30 persen. Untuk harga furniture mulai dari Rp 650 ribu. Untuk springbed diskonnya mulai dari 30-55 persen. Sementara harga berkisar Rp 2 Rp 7 juta. (din)

Permintaan Kendaraan Diperkirakan Naik  Auto 2000 Ingatkan Konsumen Segera Memesan BANDAR LAMPUNG, TRIBUN - Menjelang lebaran, permintaan jumlah kendaraan Toyota diperkirakan meningkat. Karena itu, customer diharapkan dapat memesan kendaraan sejak saat ini. Demikian pesan yang didapat dari customer gathering , Toyota, Auto 2000 Rabajasa, Jumat (14/8) malam lalu. “Menjelang lebaran biasanya jumlah pemesanan meningkat, jadi melalui gathering kali ini kami ingin mengingatkan kepada customer agar segera memutuskan untuk melakukan pemesanan, supaya kami bisa melayani secara lebih maksimal,” terang Setiawan Trijayanto, branch manager Auto 2000 Rajabasa. Menurut Setiawan, hal ini penting untuk dilakukan oleh para customer. Mengingat, traffic perdagangan menjelang lebaran pasti mengalami kenaikan yang signifikan. Sehingga, hal-hal terkait seperti suplai dan distribusi bisa saja terlambat.


Setiap karyawan XL juga mempunyai tanggung jawab untuk membangun bangsa ini, yaitu membangun jaringan telekomunikasi yang baik di seluruh kota, pulau, desa, dan daerah terpencil. Mengumandangkan kebebasan dan kemudahan berkomunikasi di seantero jagad ini.(tna)

Maka dari itu diharapkan kepada customer Toyota Auto 2000 Rajabasa agar mempercepat pemesanan. Karena, pihak Auto 2000 selalu ingin memberikan pelayanan maksimal kepada customer. Dalam gathering customer tersebut, Toyota Auto 2000 Rajabasa juga mengingatkan bahwa promo SpektakulAIR akan segera berakhir di penghujung bulan Agustus ini. Oleh karena itu, sebaiknya customer segera membeli salah satu dari mobil Avanza, Innova, atau Rush. “Banyak sekali keuntungan dan hadiah yang bisa didapatkan oleh customer dalam promo spektakluAIR ini. Maka, segeralah membeli Avanza, Innova, atau Rush,” harap Setiawan. Setiawan menambahkan dalam SpektalukAIR Auto 2000 Rajabasa memberikan DP ringan, harga murah, dan hadiah istimewa untuk setiap pembelian ketiga mobil tersebut.

Hadiah istimewa yang juga menjadi bonus untuk setiap pembelian mobil-mobil tersebut berupa 30 Kijang Innova, HP Blackberry, dan Ipod yang diundi setiap bulan. Auto 2000 Rajabasa pada malam itu memberikan hadiah terkait promo spektakulAIR kepada customer mereka. Hadiah berupa HP Blackberry Bold dan emas 25 gram yang diberikan kepada dua orang customer mereka merupakan hasil undian nasional promo spektakulAIR. “Beli mobil Toyota di sini pasti menguntungkan. Karena kualitas dan servis Toyota sudah terbukti kualitasnya,” ujar Setiawan berpromosi. Dia menambahkan, Auto 2000 Rajabasa juga menyediakan servis Toyota Home Service. Layanan ini memberikan servis panggilan kepada konsumen, sehingga mereka tak perlu datang ke bengkel Toyota.(din)





Tribun Lampung

 Aksi Noordin M Top di Mata Nasir Abas (2-Habis)

Buku Osama Jadi Bahan Cuci Otak MENURUT Nasir Abas, Noordin tidak bisa berbahasa Arab. Namun Noordin ialah orang yang pintar bicara (komunikatif) dan sangat ambisius untuk menjadi pemimpin. Selain itu, Noordin selalu menjadikan paham Osama bin Laden sebagai alasan melakukan aksi kekerasan. “Masih banyak aktivis muslim mengidolakan Osama bin Laden yang dianggap mujahid kabir (mujahid besar) zaman ini,” kata Nasir Abas. Menurutnya, buku mengenai paham Osama beredar di kalangan aktivis muslim. “Dengan demikian Noordin tidak perlu susah payah mengolah sendiri dalil-dalil Alquran dan Hadis Nabi Muhammad SAW untuk memperkuat alasan aksi kekerasan yang dilakukannya. Cukup dengan menggunakan buku Osama bin Laden dan pengaruh Osama dapat dipergunakan sebagai bahan untuk memengaruhi orang lain,” katanya. Nasir mengaku setiap kali berbincang dengan anggota jaringan Noordin yang ditangkap polisi, mereka selalu menyebutkan kebencian dan pembalasan dengan menghubungkan perjuangan Noordin sama dengan Osama. “Oleh karena itu selama masih ada orang yang setuju dengan paham Osama bin Laden yang membolehkan membunuh warga sipil, maka selama itu pula masih ada orang yang secara diam-diam bisa menjadi simpatisan atau

pendukung Noordin, atau bisa menjadi calon rekrut berikutnya,” katanya. Nasir mengaku mengenal baik Noordin M Top dan Dr Azahari sekitar 1996 di Johor Baru, Malaysia. Saat itu Noordin merupakan mahasiswa di Universitas Teknologi Malaysia, sedangkan Azahari tercatat sebagai dosen di perguruan tinggi tersebut. Nasir kemudian pindah ke Sabah, Malaysia, akhir 1997. “Sepengetahuan saya, pada akhir 2001 Polis Diraja Malaysia (PDRM) melakukan penangkapan terhadap orang-orang yang dianggap dekat dan memiliki hubungan dengan kegiatan Hambali,” katanya. Noordin dan Azahari ialah orang-orang yang berusaha menghindarkan diri dari penangkapan PDRM, sama seperti warga negara Malaysia atau Indonesia di Negeri Jiran itu. Mereka yang merasa mempunyai hubungan dengan kegiatan Hambali di Malaysia yaitu Ali Ghufron, Imam Samudra, Amrozi, Mas Salamat Kastari, Amran Mansor, Shamsul Bahri, dan lain-lain. Nasir Abas mengungkapkan, tempat paling aman dan sesuai untuk bersembunyi di Asia Tenggara adalah Indonesia karena:  Bahasa Indonesia lebih kurang sama dengan bahasa Malaysia  Terdapat anggota al Jamaah Al Islamiyah dari kalangan warga Indonesia yang bersedia

memberi bantuan untuk bertahan hidup  Pelaksanaan undang-undang serta sistem administrasi yang berlaku di Indonesia dinilai mendukung keinginan mereka (warga asing) untuk tinggal menetap di Indonesia “Dengan alasan tersebut berarti Thailand, Filipina, atau singapura bukanlah menjadi pilihan utama tempat persembunyian bagi anggota al Jamaah Al Islamiyah pada umumnya,” katanya. Kedatangan warga Malaysia tersebut disambut warga Indonesia yang mengenali mereka atau yang diperkenalkan kepada mereka. Atas dasar simpati dan solidaritas sesama anggota kelompok, warga Indonesia itu merasa bertanggungjawab untuk melindungi saudaranya agar tidak ditangkap PDRM atau Polri. Mereka memberi perlindungan dan mencarikan pekerjaan. Dapat Simpati Menurut keterangan anggota Al Jamaah Al Islamiyah, Dr Azahari mulai dilibatkan Hambali dalam aksi pengeboman malam Natal 2000. Kemudian Azahari melarikan diri ke Indonesia sekitar akhir 2001 setelah mengetahui kondisi keamanannya di Malaysia sangat terancam. Teman-teman Azahari dari Indonesia seperti Hambali, Imam Samudra, dan Ali Ghufron, mengetahui kemampuan meracik dan merakit bom berskala besar sebab Azahari pernah


mendapat latihan di kamp latihan al Qaeda pada akhir 1999 atas perintah Hambali. Sejak Noordin dan Azahari berada di Indonesia, mereka berdua tidak pernah bergerak sendiri. Dari riwayat kisah perjalanan mereka menghindarkan diri dari tangkapan polisi, menunjukkan bahwa di mana saja mereka berdua berada pasti akan ada simpatisan mereka dari warga Indonesia. Menurut kisah perjalanan yang diceritakan orang-orang yang sudah ditangkap polisi, menggambarkan dua orang warga Malaysia tersebut tidak pernah sendirian. Seluruh perjalanan dibantu oleh warga negara Indonesia yang sepaham dan setuju pada kegiatan mereka. Sebenarnya tidak mudah merekrut orang dan mempersiapkan mereka untuk mati mengorban-

kan diri. Tidak cukup hanya sekadar memberikan iming-iming surga, sehingga rekrutan baru akan segera menerima tawaran menjadi calon pengebom bunuh diri. “Tetapi keinginan tersebut sudah ada di dalam diri mereka sebelum bertemu Noordin dan Azahari. Semua orang yang ditangkap dan terbukti terlibat jaringan terorisme pernah menyatakan kagum kepada Noordin dan Azahari,” kata Nasir Abbas.. Ada tiga hal yang membuat para pelindungnya menjadi kagum kepada Noordin dan Azahari, yaitu:  Pengeboman yang mereka lakukan merupakan tindakan jihad  Kekhusukan mereka dalam beribadah  Kebencian terhadap polisi dan pemerintah Indonesia. (Persda Network/feb)

Ayin dan Urip Tri tak Dapat Remisi  Urip Protes Ketentuan Remisi tak Adil


UPACARA BAWAH LAUT - Sejumlah penyelam TNI AL mengibarkan bendera merah putih di bawah laut saat peringatan detik detik proklamasi kemerdekaan RI ke-64 di perairan Malalayang, Manado, Sulawesi Utara, Senin (17/8). Upacara bawah laut tersebut merupakan rekor dunia pertama sekaligus memecahkan kembali rekor dunia penyelaman massal dengan jumlah penyelam 2486 orang.

Pasien Gangguan Jiwa Turut 17-an BEKASI, TRIBUN - Ratusan penghuni Yayasan Galuh, Panti Rehabilitasi Cacat Mental, Kota Bekasi, Jawa Barat,mengikutirangkaianacaralomba untukmerayakanharikemerdekaan Republik Indonesia. Wakil Kepala Perawat Yayasan Galuh, Suharyono mengatakan, kegiatan tersebut diikuti oleh 120 pasien panti yang telah memasuki tahap kejiwaan yang relatif stabil. “Mereka mengikuti lomba panjat pinang, balap karung, dan menangkap bebek. Lomba yang sangat ramai dan kocak itu dimulai pukul 09.00 WIB hingga 17.00 WIB,” katanya, Senin (17/8). Pada sesi lomba balap karung, ta-

wa dan riuh tepuk tangan ratusan penonton memeriahkan acara tersebut, karena tidak sedikit peserta yang melanggar aturan bermain. Mulai dari berlari dengan menanggalkan karung, melompat keluar jalur lintasan, bahkan ada yang bercanda dengan sesama rekan panti tanpa menghiraukan lawan. Menjelang siang, kegiatan lomba dilanjutkan dengan panjat pohon pinang yang diikuti sekitar sembilan tim. Hadiah yang diperebutkan pun cukup bernilai, mulai dari radio, alat setrika, bantal dan guling, hingga sembako. “Namun, tidak ada peserta yang berhasil mendapatkan hadiah.

Akhirnya hadiah sembako kami bagi-bagikan secara rata ke semua penghuni panti, sementara sisanya kami gunakan untuk keperluan harian,” kata Yono. Pada sore hari, acara dilanjutkan dengan menangkap bebek yang mengundang tawa penonton. Para peserta menangkap seekor bebek di empang kecil hingga sekujur tubuhya basah kuyup. Dalam pertandingan ini panitia memberikan batas waktu selama 10 menit kepada peserta untuk menangkap bebek incarannya. “Pemenangnya diberi hadiah berupa bebek tangkapannya,” kata Yono.(kcm)

Waspadai Masuknya Garis Keras Melalui Sekolah MAGELANG, TRIBUN - Ajaran agama Islam garis keras disinyalir telah disebarkan ke generasi muda melalui pendidikan formal di sekolah-sekolah. Ajaran ini ditanamkan oleh organisasi-organisasi Islam tertentu kepada para siswa melalui berbagai kegiatan agama yang diselenggarakannya. KH Yusuf Chudlori yang juga akrab disapa Gus Yusuf, ulama dari Pondok Pesantren Asrama Perguruan Islam (API), Tegalrejo, Magelang, Jawa Tengah menyatakan, organisasi-organisasi itu juga mencoba mencuci otak para siswa dengan membenturkan antara agama dengan masalah nasionalis-

me. Hal ini, menurut dia, bahkan sudah terjadi di beberapa sekolah negeri di Kota Magelang. Dalam satu kasus di satu sekolah, para penyebar ajaran agama Islam yang keliru ini bahkan mencoba memengaruhi sekolah untuk mengingkari pemerintahan sekarang. “Organisasi yang menganut Islam garis keras itu hanya mengakui satu pemerintah, yaitu pemerintahan Islam, khilafah Islamiyah,” ujarnya, Senin (17/8). Hal serupa, menurut Gus Yusuf, juga rawan terjadi di kampus. Pasalnya,katadia,kelompokmahasiswa dari ilmu-ilmu eksak, yang terbiasa

berpikir logis dan simpel, paling rawandisusupipahamyangsalahini. “Ditambah dengan imingiming keluarganya akan disejahterakan dan janji akan masuk surga dengan disambut bidadari, mereka pun tidak keberatan melakoni segala persyaratan, termasuk menjadi pelaku bom bunuh diri,” ujarnya. Gus Yusuf menilai, bulan Ramadan berpotensi dimanfaatkan sebagai peluang masuknya ajaranajaran yang keliru untuk menyebarkan pemahaman Islam garis keras melalui program pelatihan agama ataupun semacam pesantren kilat.(kcm)

JAKARTA, TRIBUN - Si Ratu Suap, Artalyta Suryani alias Ayin tidak mendapat remisi pada hari ulang tahun (HUT) Kemerdekaan RI ke-64. Pasalnya, Ayin belum menjalani sepertiga dari masa hukumannya. “Dia (Artalyta) enggakdapat remisi karena belum menjalani sepertiga masa pemidanaannya,” kata Sarju Wibowo, Kepala Rumah Tahanan Negara (Rutan) Pondok Bambu, Jakarta Timur. Artalyta yang akrab dipanggil Ayin juga tidak hadir dalam upacara 17 Agustus di lapangan Rutan Pondok Bambu. Mantan jaksa Urip Tri Gunawan dan dua mantan Gubernur Bank Indonesia (BI) yakni Sjahril Sabiril Sabirin dan Burhanuddin Abdullah juga tidak mendapatkan remisi. Nasib serupa dialami empat mantan Deputi Gubernur Bank Indonesia (BI), yakni Aulia T Pohan, Maman Somantri, Bun-

EMP AT JALUR KA JABAR DIAKTIFKAN KEMBALI EMPA Dinas Perhubungan Jawa Barat berencana mengaktifkan kembali empat jalur kereta api pada tahun 2010 nanti. Adapun inventarisasi aset keempat jalur KA itu ditargetkan rampung tahun ini.

dengan Persda Network di Jakarta, Sabtu (17/8). Selain itu, PP ini bertentangan dengan tujuan pemidanaan, yakni agar terpidana diharapkan menjadi baik. “Dengan peraturan yang pilih kasih ini, dapat menyebabkan napi menjadi apatis dan tidak peduli pada lingkungan bersama maupun pemerintahan,” sambung Urip. Aulia Pohan yang juga besan dari Presiden Susilo Bambang Yudhoyono (SBY), belum diberikan remisi karena ia masih mengajukan upaya hukum Banding. “Bandingnya sudah saya kirim ke Pengadilan Tinggi (PT),” tulis OC Kaligis melalui SMS yang dikirim ke Persda Network. Humas Ditjen Pemasyarakatan Depkumham Chandra Nestiono membenarkan Aulia Pohan belum diberikan remisi. “Pak Aulia Pohan belum ada remisi. Kasusnya belum memi-

liki putusan hukum yang tetap (inkracht),” ujar Chandra. Baik Urip Tri Gunawan dan Sjahril Sabirin yang kini menghuni LP Cipinang, memilih tidak menghadiri upacara 17 Agustus yang digelar di dalam LP kelas I Cipinang. Upacara hari Kemerdekaan RI tersebut hanya dihadiri 300 dari 3142 narapidana dan tahanan yang bermukim disana. Dari 300 itu, hanya tiga dari 80 koruptor yang ikut upacara. Ketiga orang yang divonis korupsi adalah Pudji Siswanto, Suhada Effendi, dan Abdul Chalik Saleh. Sementara Jaksa Urip, Sjahril Sabirin, Rokhmin Dahuri serta koruptor lainnya memilih tetap berada di dalam sel. “Hanya perwakilan saja. Kalau semuanya ikut upacara, lapangan kami tidak cukup,” ungkap Kepala Lapas Cipinang Haviluddin. (persda network/cr1/cr2/yls)

Terpidana Terorisme Terima Remisi 4-6 Bulan SEBANYAK enam narapidana kasus teroris jaringan Noordin M Top dan Dr Azahari (almarhum) mendapat remisi atau pengurangan masa hukuman hari ulang tahun (HUT) Kemerdekaan RI ke64 , Senin (17/7). Pengurangan masa tahanan yang diberikan antara 4 hingga 6 bulan. Para terpidana teroris tersebut antara lain, Ahmad Rafiq Ridho menerima 2 bulan remisi, Hasanuddin (5 bulan), Ismail (5 bulan), Lilik Purnomo (4 bulan),

newsflash GUDANG SENJA TA POLRI TERBAKAR - Tempat SENJAT penyimpanan senjata di Sekolah Calon Perwira Polri, Kota Sukabumi, Jawa Barat, Senin (17/8) sekitar pukul 18.30, terbakar. Sebanyak 22 pucuk senjata jenis revolver dilaporkan terbakar. Kepala Secapa Polri Brigjen Edi Prawoto mengatakan, kebakaran diduga dari hubungan pendek arus listrik. Warga sekitar Secapa mengaku mendengar ada ledakan dari tempat kebakaran. “Suaranya seperti petasan, mungkin lima menit lebih,” kata seorang warga. Namun, Kepala Secapa membantah terjadinya ledakan. “Semua sudah diantisipasi,” kata Edi. Kepala Kepolisian Resor Kota Sukabumi AKBP Moch Hendra Suhatyono mengatakan, pihaknya masih terus menyelidiki kepastian penyebab kebakaran. (kcm)

bunan EJ Hutapea dan Aslim Tadjudin. Dari koruptor yang belum mendapat remisi, suara paling keras dilontarkan Jaksa Urip Tri Gunawan. Urip adalah terpidana kasus korupsi, yakni menerima suap 660.000 dolar AS dari Artalyta Suryani. Ia telah divonis 20 tahun penjara oleh Mahkamah Agung (MA) pada 11 Maret 2009. Sedangkan Artalyta Suryani divonis 5 tahun penjara. Menurut Urip, PP Nomor 28 Tahun 2007 yang mengatur pemberian remisi bagi narapidana narkotika, teroris dan kasus korupsi, pengurangan hukuman yang diberikan setelah menjalani sepertiga dari masa pemidanaan adalah diskriminatif. “Peraturan ini telah melanggar HAM dan hak dasar narapidana, dimana setiap warga negara memiliki kesamaan dalam kedudukan hukum,” tegas Urip dalam perbincangan

Jalur KA yang akan diaktifkan kembali itu adalah jalur Rancaekek-Jatinangor-TanjungsariKertajati (Bandung-Majalengka), jalur BandungSoreang-Ciwidey (Bandung-Bandung Selatan), jalur Banjar-Cijulang (Banjar-Ciamis), serta jalur Cirebon-Kadipaten-Kertajati (Cirebon-Majalengka). “Diharapkan bisa meningkatkan percepatan perpindahan orang dan barang di Jabar,” kata Kepala Dinas Perhubungan Jabar Dodi Cahyadi, Senin (17/8), di Bandung. (kcm) JAMUAN KENEGARAAN KACAU - Akibat hujan deras mendadak yang mengguyur Jakarta, jamuan kenegaraan yang berlangsung di halaman tengah Istana Negara sempat kacau. Air hujan mengguyur meja dan kursi serta membuat persiapan jamuan usai upacara perayaan HUT Kemerdekaan RI, di Jakarta, Senin (17/8) berantakan. Air hujan membasahi hampir seluruh areal jamuan kenegaraan. Saat hujan berhenti, karena ruangan tak bisa menampung para tamu dan duta besar, akhirnya para tamu tersebut keluar menuju areal jamuan kenegaraan. Mereka langsung (kcm) menyerbu makanan yang disediakan.(kcm) cmyk

Masykur Abdul Kadir (6 bulan), dan Syaiful Bahri (5 bulan). Sedangkan terpidana yang langsung bebas setelah mendapat remisi yaitu Arifin alias Apin pelaku teror bom di Gedung XL, kawasan Mega Kuningan, Jakarta, dua tahun yang lalu. Kala itu Apin mengirim 26 pesan singkat berisi ancaman peledakan. Ia ditangkap di kampungnya, Petumbukan, Kecamatan Galang, Kabupaten Deli Serdang, Sumatera Utara, tahun 2007 lalu.

Ahmad Rafiq Ridho dan Syaiful Bahri alias Apuy merupakan terpidana peledakan bom Kedubes Austalia, Jakarta, tahun 2004. Ahmad Rafiq divonis 8 tahun, sedangkan Syaiful Bahri alias Apuy divonis 10 tahun penjara. Ismail (29) alias M Ikhwan alias Agus alias Iwan alias Ridwan alias Zaki alias Ari Kumala (29), terpidana kasus bom Hotel JW Marriott I, divonis 12 tahun penjara. Ismail terbukti membawa bahan peledak dari Lampung ke Ja-

karta, mencari rumah kontrakan, merakit bom bersama Dr Azahari, dan membeli motor untuk survei ke beberapa sasaran. Setelah peledakan Hotel JW Marriott, 5 Agustus 2003, ia membonceng Dr Azahari ke tempat persembunyiannya di Bandung. Masykur Abdul Kadir, merupakan satu-satunya terpidana asal Bali dalam kasus bom Bali I. Masykur yang divonis 15 tahun penjara, mendapat remisi 6 bulan. (Persda Network/cr1/cr2/mun)




ribun Lampung



Tahapan Pilkada Mesuji dan TBB Awal November Pemkab dan KPU Tuba Sudah Koordinasi

BANDAR LAMPUNG, TRIBUN - Pemilihan kepala daerah (pilkada) di daerah otonomi baru (DOB), Mesuji dan Tulangbawang Barat mulai dipersiapkan Pemerintah Kabupaten Tulangbawang pada awal November 2009. “Pilkada dua DOB sedang kami persiapkan. Mungkin awal November depan, setelah pelantikan Presiden dan Wakil Presiden terpilih,” kata Bupati Tulangbawang Abdurrahman Sarbini di HKBP Tanjungkarang, Minggu (16/8). Dia mengatakan, pihaknya telah berkomunikasi dengan KPU setempat terkait persiapan pilkada dua kabupaten hasil pemekaran Tulangbawang itu. Menurutnya, KPU bersama Pemkab Tulangbawang siap menggelar pilkada di dua daerah baru tersebut. “Yang akan kami persiapkan adalah tahapan-tahapannya,” kata pria yang akrab disapa Mance itu. Tahapan yang akan dilakukan, kata Abdurrahman, di antaranya pemutakhiran data pemilih serta pengangkatan penyelenggara. Mengenai anggaran, Abdur-



Kami sudah bagibagi DPS mana untuk Mesuji, dan yang mana untuk Tulangbawang Barat NOVI MARZANI Ketua KPU Tulangbawang

rahman menjelaskan, Tulangbawang sebagai kabupaten induk tidak harus mengeluarkan seluruh biaya penyelenggaraan. “Namun kami tetap mengeluarkan biaya. Ya, kami membantu dana saja,” ujarnya. Sementara, Ketua KPU Tulangbawang Novi Marzani mengatakan, pihaknya akan memulai tahapan pilkada usai pelaksanaan penghitungan ulang suara DPR RI di Tulangbawang, Kamis (20/ 8) mendatang. “Sekarang kami akan fokuskan penghitungan suara ulang dulu,” katanya akhir pekan lalu. Novi membenarkan, pihaknya telah berkomunikasi dengan pemkab membicarakan kesiapan pelaksanaan pilkada di dua DOB

tersebut. Menurutnya, KPU Tulangbawang siap jika diminta menjadi penyelenggara. Menurut dia, tahapan pertama yang akan dilakukan KPU adalah pemutakhiran data pemilih. Untuk keperluan itu, jelas Novi, pihaknya menggunakan Daftar Pemilih Tetap (DPT) pemilu presiden (pilpres) sebagai Daftar Pemilih Sementara (DPS). “Kami sudah bagi-bagi DPS mana untuk Mesuji, dan yang mana untuk Tulangbawang Barat,” tukasnya. “Tapahan lain yang akan kami lakukan berupa pengangkatan perangkat penyelenggara, mulai dari PPK hingga Panwaslu. Setelah itu persiapan pendaftaran calon, verifikasi calon, sampai kampanye,” pungkas Novi.(zid)

Hari Ini KPU Tetapkan SBY-Boediono JAKARTA, TRIBUN- KPU hari ini, Selasa (18/8), akan mengukuhkan Susilo Bambang Yudhoyono dan Boediono sebagai calon presiden dan calon wakil presiden terpilih dalam rapat pleno terbuka. Rapat pleno terbuka tersebut dijadwalkan mulai pukul 10.00 WIB. KPU juga telah mengundang sejumlah pemimpin lembaga negara seperti Mahkamah Konstitusi (MK), Mahkamah Agung (MA), Dewan Perwakilan Rakyat (DPR), Majelis Permusyawaratan Rakyat (MPR), Dewan Perwakilan Daerah (DPD) danperwakilanketigatimkampanye capres cawapres untuk menghadiri acara penetapan tersebut. Sesuai dengan ketentuan dalam UU Nomor 42 Tahun 2008 tentang Pilpres, KPU juga akan menyampaikan berita-berita acara hasil pemilu presiden dan wakil presiden kepada MPR, DPR, DPD, MK, MA, Presiden, partai politik atau gabungan partai politik yang mengusulkan calon, serta presiden dan wakil presiden terpilih. Sebelumnya, pada 12 Agustus, MK telah menolak seluruhnya


permohonan sengketa perselisihan hasil pemilu yang diajukan pasangan Megawati Soekarnoputri-Prabowo Subianto dan Jusuf Kalla-Wiranto. Dengan demikian, KPU dapat langsung menetapkan pasangan capres-cawapres terpilih. Hasil pemungutan suara pilpres pada 5 Juli 2009 lalu, menempatkan pasangan SBY-Boediono sebagai pemenang dengan perolehan 73.874.562 suara atau 60,80 persen. Berada di posisi kedua, pasangan Megawati Soekarnoputri-Prabowo Subianto yang memperoleh 32.548.105 suara atau 26,79 persen. Sedang-

kan posisi ketiga ditempati pasangan Jusuf Kalla-Wiranto yang memperoleh 15.081.814 suara atau 12,41 persen. Mengingat perolehan suara pasangan nomor urut dua, SBYBoediono, lebih dari 50 persen dari suara sah nasional, sesuai ketentuan apabilaperolehansuaracalondiatas 20 persen atau lebih, pilpres dilaksanakan hanya satu putaran. Selanjutnya, KPU juga akan menetapkan perolehan jumlah kursi dan calon legislator terpilih dalam rapat pleno terbuka di kantor KPU, Jum’at (21/8).(Persda Network/cr2)

JOGED JERUK - Dua wanita warga negara asing mengikuti lomba joged jeruk, di Jalan Jaksa, Jakarta, Senin (17/8). Berbagai perlombaan yang diikuti para wisatawan mancanegara dan warga setempat digelar di kawasan wisata Jalan Jaksa untuk memeriahkan peringatan HUT ke-64 Kemerdekaan RI.

Infrastruktur Harus Jadi Prioritas

 Penyusunan APBD-P 2009  Jalan dan Bangunan Sekolah

B ANDAR L AMPUNG , T RIBUN - Sejumlah anggota DPRD Lampung menyatakan infrastruktur merupakan sektor yang mesti diprioritaskan dalam penyusunan APBD Perubahan 2009. Infrastruktur dimaksud bukan hanya berupa jalan, tapi juga sarana pendidikan khususnya bangunan sekolah. “Yang paling penting infrastruktur,” ujar anggota Fraksi PKB Daroini Ali kepada Tribun, Senin (17/8) siang. “Misalnya jalan. Kalau jalan sudah bagus, maka bisa berdampak positif terhadap aktivitas ekonomi masyarakat, terutama bagi masyarakat pedesaan yang mata pencahariannya bersumber dari pertanian.” Menurut Daroini, Fraksi PKB sudah menyampaikan hal ini pada pandangan akhir fraksi terhadap LPj Pelaksanaan APBD 2008. Hal senada disampaikan Abdullah Fadri Auli. Menurutnya, 30-35 persen kualitas jalan di Lampung, terutama jalan provinsi, masih buruk. “Jalan banyak yang hancur. Jadi, wajar saja harga kebutuhan pokok mahal akibat besarnya biaya transportasi,” tukas anggota Fraksi PAN itu. Dalam pandangan akhir, kata Fadri, Fraksi PAN bahkan meminta adanya peningkatan anggaran dalam APBD-P 2009 dan APBD 2010, khusus untuk pembangunan dan pemeliharaan jalan provinsi. Pria yang akrab disapa Aab ini menambahkan, prioritas di bidang infrastruktur sebenarnya tak cuma menyangkut jalan semata. Namun, juga berkaitan dengan infrastruktur pendidikan, seperti

Baru-baru ini ada bangunan sekolah runtuh dan menyebabkan seorang siswa meninggal dunia. Ini bukti masih buruknya infrastruktur di bidang pendidikan ABDULLAH FADRI AULI Anggota Fraksi PAN

bangunan sekolah. “Baru-baru ini ada bangunan sekolah runtuh dan menyebabkan seorang siswa meninggal dunia. Ini bukti masih buruknya infrastruktur di bidang pendidikan,” tandasnya. Anggota Fraksi Partai Demokrat Yandri Nazir, selain menyoroti soal infrastruktur, juga memberi perhatian khusus untuk bidang pertanian. “Bidang ini perlu mendapat perhatian serius, khususnya karena akan datangnya ancaman dari cuaca ekstrim,” ujarnya. “Harus ada antisipasi, jangan sampai target produksi menjadi rendah.” Imbuh aggota DPRD terpilih periode 2009-2014 ini. Berdasarkan jadwal, Selasa (18/8), DPRD Lampung berencana membahas Kebijakan Umum Anggaran (KUA) dan Prioritas Plafon Anggaran (PPA). “Mudah-mudahan dalam pembahasan KUA dan PPA besok banyak muncul saran yang memprioritaskan anggaran di bidang infrastruktur,” tukas Yandri.(yos)

KPU Siap Hadapi Gugatan Demokrat JAKARTA, TRIBUN- Mekanisme penghitungan kursi tahap kedua kembali dipersoalkan. Hal ini menyusul desakan Lembaga Advokasi dan Bantuan Hukum Partai Demokrat agar KPU menghitung kursi tahap kedua sesuai Putusan Mahkamah Agung (MA) atas permohonan kader Demokrat Zaenal Ma’rif cs. Karena itu, hingga kini KPU belum menggelar rapat pleno untuk penetapan calon legislatif terpilih. KPU sendiri baru akan menggelar rapat pleno untuk membahas penetapan caleg terpilih. Agenda yang akan dibahas dalam rapat untuk mensinkronkan putusan MA dan Mahkamah Konstitusi (MK). “Itu yang sekarang sedang disinkronisasi oleh Biro Hukum. Kita akan ikuti keduaduanya, baik MK maupun MA. Tapi bagaimana memadukan itu biar tidak bertentangan,” kata anggota KPU Syamsul Bahri, di Jakarta, Senin (17/8). Sebelumnya, Wakil Ketua DPP Partai Demokrat Bidang Advokasi Utomo A Karim menyambangi Kantor KPU, Sabtu (15/8), menyampaikan surat agar KPU melaksanakan putusan MA. Perwakilan Demokrat ini juga mengancam, jika KPU tidak menjalankan putusan MA, pihaknya akan kembali melayangkan gugatan. Tidak hanya itu, dia juga akan melaporkan MK ke Komisi Yudisial. Menanggapi hal ini, Syamsul mengatakan, pihaknya siap jika memang benar Demokrat akan mengajukan gugatan kembali. “Ya, KPU kan harus siap dengan itu. Makanya kita akan kaji lagi,” cetusnya.(kcm)

PPIB Resah Ketidakpastian Kursi Budiyanto BANDAR LAMPUNG, TRIBUN - Partai Perjuangan Indonesia Baru (PPIB) Lampung hingga kini masih resah menunggu kepastian pelantikan salah seorang kadernya, Budiyanto, sebagai anggota DPRD Tulangbawang 2009-2014. “Kami masih wait and see,” ujar Ketua Badan Pemenangan Pemilu (Bappilu) DPD PPIB Lampung Asep Priwanto kepada Tribun, Senin (17/8) siang. Asep menuturkan, pihaknya

telah menyurati Badan Kesbangpol Provinsi Lampung, Biro Otonomi Daerah Pemprov, serta KPU Lampung. Isinya, sambung dia, menyampaikan amar putusan Mahkamah Konstitusi (MK) yang telah memenangkan gugatan PPIB Lampung. “Amar putusan MK menyatakan perolehan PPIB di DP 4 Tulangbawang yang benar berjumlah 4.119 suara, bukan 3.953 suara. Sementara suara PKPB

(Partai Karya Peduli Bangsa) berkurang menjadi 3.959 suara dari sebelumnya 4.138 suara,” tukas Asep. “Dan, MK menyatakan PPIB berhak mendapatkan satu kursi di DPRD Tulangbawang atas nama Budiyanto. Sedangkan PKPB, tidak berhak atas satu kursi itu.” Namun, Asep mengutarakan, hingga kini pihaknya belum mendapat informasi mengenai kepastian pelantikan Budiyanto.

Padahal, kata dia, jadwal pelantikan anggota DPRD Tulangbawang periode 2009-2014 direncanakan pada Rabu (19/8). Catatan Tribun, KPU Lampung telah menyurati Gubernur Lampung berisi penundaan pelantikan anggota DPRD Tulangbawang terpilih dari PKPB karena adanya gugatan dari PPIB. Begitu pula anggota DPRD Bandar Lampung terpilih dari Partai Gerindra karena gugatan dari PPRN.(yos)

Mega Kembali tak Datang ke Istana JAKARTA, TRIBUN- Kehadiran mantan presiden berikut keluarganya selalu dinanti dan menjadi penyemarak peringatan detikdetik Proklamasi Kemerdekaan Republik Indonesia di halaman Istana Merdeka. Dalam peringatan detik-detik Proklamasi Kemerdekaan RI ke-64, Senin (17/8), lima anggota keluarga mantan Presiden Soekarno hadir di antara ribuan undangan. Kelima anggota klan Soekarno itu ialah Dewi Soekarno (salah satu isteri Soekarno), dan empat anak Soekarno, yaitu Rachmawati Soekarnoputri, Sukmawati Soekarnoputri, Guruh Soekarnoputra, dan Bayu Soekarnoputra. Dewi yang berkebaya putih dan berkain biru muda datang pertama. Menyusul kemudian Rachmawati dan Bayu. Sukma yang memakai topi dengan hiasan bulu datang bersamaan dengan Guruh. Saat pulang, Dewi dan Rachma yang keluar dari Istana Merdeka menjelang akhir acara naik mobil golf yang dikemudikan pasukan pengamanan presiden. Di antara keluarga besar Soekarno, hanya Megawati Soekarnoputri yang dalam lima tahun terakhir tidak cmyk


muncul di Istana Merdeka. Megawati yang juga mantan presiden RI selalu mengikuti peringatan detik-detik Proklamasi Kemerdekaan RI di Kebagusan, Jakarta Selatan. Bukan cuma Megawati. Dalam upacara di Istana Merdeka kemarin, tidak satupun mantan RI-1 yang hadir. Ini adalah kali pertama

peringatan HUT RI tidak dihadiri satu pun mantan presiden. Mantan presiden yang pada tahuntahun sebelumnya pernah datang antara lain BJ Habibie dan KH Abdurrahman Wahid. Habibie dikabarkan masih berada di Jerman sementara Abdurrahman disebut-sebut masih dalam perawatan karena sakit.(kcm)


Tribun Lampung

6  SELASA, 18 AGUSTUS 2009


(HUT) Republik Indonesia (RI) ke64, Senin (17/8) ini. Di seluruh pelosok negeri, gegap-gempita perayaan HUT RI ke-64 terasa hangat. Bersama dengan pengibaran bendera pusaka yang bertempat di Istana Negara, di berbagai daerah tirakatan dan upacara bendera pun berlangsung dengan khidmat sejak malam sebelum hari kemerdekaan, Minggu (16/8).

Berbagai kegiatan pun berlangsung seru. Mulai dari berbagai parade, festival, hingga kegiatan-kegiatan lomba yang menawarkan beragam jenis hadiah. Seluruh lapisan masyarakat terlibat di dalamnya, kaya-miskin, pria-wanita, tua-muda, hingga anakanak pun ikut merasakan semaraknya hari kelahiran bangsa ini. Tetapi benarkah kita sudah sungguh-sungguh merdeka? Di tengah hiruk-pikuknya perayaan hari kemerdekaan ini, benarkah

bangsa kita sudah benar-benar terbebas dari belenggu penjajahan bangsabangsa asing? Kemiskinan masih merajalela di negeri ini, rupiah masih tidak berdaya di kancah perekonomian dunia, para koruptor masih bebas berkeliaran karena tidak terjangkau oleh aparat. Begitulah wajah negeri ini di usianya yang ke-64 sekarang. Di balik senyum yang tersungging dari meriahnya perayaan hari kemerdekaan, masih ada kewajiban bagi kita semua untuk menjawab persoalan-persoalan tersebut...(dwn)



1 5

4 Keterangan Foto: 1.LOMBA PANJAT PINANG - RT 01 , KampungKembatan Beton, Teluk Betung Selatan memeriahkan HUTRI ke-64 2.PAKAIAN ADAT- Sejumlah Narapidana Lapas Rajabasa mengenakan pakaian adat untuk menyambut Gubernur dalam acara pemberian Remisi di Lapas Rajabasa. 3.KUDA LUMPING - Seorang pemain kuda lumping kesurupan setan dan memakan bara api yang diadakan Taman Wisata Lembah Hijau. 4.LOMBA JOGET - Peserta Lomba joget asik bergoyang dalam acara perlombaan yang digelar RS Khusus kebidanan dan penyakit kandungan Anugrah Medika di Jalan Tulang Bawang Kelurahan Enggal. 5.TAHAN- Seorang peserta lomba panjat pinang menahan beban kedua temannya dalam perlombaan panjat pinang yang di selenggarakan di tempat wisata Lembah Hijau. 6.LOMBA BALAP PERAHU- Ibu-ibu warga RT 02 Kp kali Belahu , Gedong Pakuon Kec.TBS. beradu kecepatan mendayung perahu. 7.PENURUNAN BENDERA- Pasukan pengibar bendera menurunkan bendera merah putih di Stadion Pahoman, Senin(17/08)





tribun line 7 T Yayan Demam Hebat Setelah Diringkus SELAS 18 AGUSTUS 2009

ribun Lampung

 Mengaku tak Kenali Satu Pun Foto Teroris yang Diburu Polisi TE R

JAKARTA, TRIBUN - Suryana alias Yayan (28), tak pernah meMBURU ME nyangka dirinya diciduk tim Densus 88 Antiteror pada 5 Agustus lalu. Yayan yang saat itu baru pulang kerumahnya, sekitar pukul 16.30 WIB, didatangi sekitar 10 polisi berpakaian preman dan bersenjata. Mereka langsung masuk ke kamarnya. Yayan lalu digelandang ke dalam mobil dengan kepala ditutup kain putih dan tangan diikat tali segel plastik. Yayan mengungkapkan penangkapan ORIS

tersebut karena Densus 88 menduga dirinya terkait dengan kegiatan terorisme. Polisi mengintai kediaman dan gerak-geriknya semenjak tiga hari sebelum penangkapan. Sebelum penangkapan, Yayan mengaku kedatangan seorang tamu bernama Joko. Sayang Yayan tidak bersedia menjelaskan siapa sebenarnya Joko. Tamu itu kemudian pamit beberapa saat sebelum penggerebekan. Yayan harus menjalani tujuh hari pemeriksaan. Ketika ditemui di rumahnya, Jalan Balai Rakyat, RT 014, RW 03, Kampung Mangga, Tugu Selatan, Koja, Jakarta Utara, Yayan mengaku saat

menjalani pemeriksaan didera sakit demam hebat disertai flu. Beruntung Yayan mendapatkan perlakuan baik dari anggota Densus 88. “Di antara mereka banyak yang pintar. Mereka bisa menyembuhkan penyakit. Saya hanya disuruh tengkurap lalu seorang di antara mereka memegang sekujur tubuh bagian belakang saya. Seketika saya langsung sembuh. Badan saya bugar, seperti lepas semua (penyakit),” kata Yayan, Minggu (16/8). Dalampemeriksaan,Yayandiberondong pertanyaan seputar kegiatannya seharihari juga lingkup pergaulannya. Yayan juga ditanyai seputar perkenalannya dengan

Tampil Apik Meski Ada Kendala BANDAR LAMPUNG, TRIBUN Konser band Drive di Graha Parahita Hotel Marcopolo Bandar Lampung, Senin (17/ 8) tidak berjalan mulus. Amplifier yang digunakan Budi, gitaris Drive kerap mengalami gangguan, tidak mengeluarkan suara. Anji, vokalis Drive cepat mengalihkan perhatian dengan berinteraksi ke penonton agar tidak kecewa . ”Kami mohon maaf dengan kesalahan teknis ini. Semua di luar perkiraan kami,” kata Anji kepada penonton yang menghadiri konser tersebut. Penonton yang hadir seakan tidak mempedulikan kendala teknis tersebut, lagu-lagu yang dibawakan Drive mampu memikat hati

mereka. Bersama Bintang, Tak Terbalas dan Kedua menjadi lagu yang mendapat sambutan meriah dari penonton. Band yang diawaki oleh Anji (vokal), Budi (gitar), Dygo (bass) dan Adi (drum) tampil apik membawakan sembilan lagu dari album pertama dan kedua mereka. Konser kali ini dalan rangka Twin Spark Celebration Motor Bajaj, dan ini merupakan kunjungan kedua di Bandar Lampung. Adi, drummer Drive menjelaskan, sembilan lagu yang dibawakan untuk konser di Bandar Lampung sengaja dipilih yang bertempo medium dan low beat. ”Penonton yang hadir kebetulan dari komunitas

motor, ini konser eksklusif, venue nya juga di dalam ruangan,” tambahnya. Personel Drive yang ditemui Tribun dalam wawancara eksklusif di hotel tempat mereka menginap dan juga di backstage mengungkapkan, senang bisa datang lagi ke Bandar Lampung. “Pas pertama kali ke sini tahun 2008, belum sempat coba kripik pisang, sekarang, kami borong 40 bungkus kripik pisang,” kata Budi, gitaris Drive. Maraknya band asal Lampung yang bisa menembus dapur rekaman di Jakarta seperti Kangen Band, Hijau Daun, The Potters dan Beage menurut personel Drive, sangat positif. Dygo, bassist Drive mengatakan musik Indonesia kini bukan hanya milik band-band dari Pulau Jawa. ”Mau dari daerah mana saja, asal band nya punya lagu yang bagus dan ada kesempatan pasti bisa rekaman. Selama kami konser di berbagai kota di Indonesia, band-band lokal bagus-bagus, “ ungkap Budi (tin)

beberapa nama orang yang terlibat dan terindikasi jaringan teroris. Satu di antaranya foto Amir Abdillah, yang ditangkap di Semper, Jakarta Utara. “Saya nggak kenal mereka,” ujar Yayan sembari mengatakan dirinya juga ditunjukkan foto-foto beberapa orang yang disebutkan oleh anggota Densus. Yayan akhirnya dipulangkan pada 11 Agustus sore karena tidak terbukti terlibat dalam suatu kegiatan jaringan terorisme. “Alhamdulilah anak kami dipulangkan dalam keadaan baik. Nggak ada luka fisik sama sekali,” ujar Syariffudin (57) dan Euis (56), orang tua Yayan. Setelah

Sunu Anak Periang  dari halaman 1

Selatan AKP Azarianto, tiga bocah tersebut sekitar pukul 14.00 WIB,

Ikhwan dan Endang Tertunda Jadi Anggota DPRD  dari halaman 1

belum diresmikan bisa menyusul prosesi pelantikan setelah terbitnya SK Gubernur. Ketua KPU Bandar Lampung As’ad Muzzammil mengatakan, penundaan pelantikan Ikhwan karena masih adanya perbedaan pandangan antara KPU Kota Bandar Lampung dan KPU Lampung. Namun, polemik diserahkan ke KPU provinsi. “Satu nama yang bermasalah memang telah kami serahkan sepenuhnya ke KPU Provinsi, dan sekarang telah menjadi kewenangan Gubernur untuk mengeluarkan SK atau tidak untuk

Upacara di dalam Air Berjalan 45 Menit  dari halaman 1


DRIVE- Anji, vokalis grup band Drive, tampil memukau ratusan penonton pada acara "Twin Spark Celebration" yang di selenggarakan Bajaj Sugih Perdana Motor di Graha Parahita Marcopolo Senin (17/8).

Gempa Merembet ke Arah Bengkulu  dari halaman 1

laporan korban jiwa akibat gempa. Sedangkan data korban luka-luka masih sama dengan data Minggu, yakni enam orang. Korban luka ringan yang tertimpa plafon di Plaza Andalas, di Padang, yakni Dely Putri (47), Sarila (61), Yulia (17), Yuci (18) dan Salsa (11) mengalami kasleo. Kemudian Firdaus (36), warga Siteba Padang mengalami luka ringan saat lari ketika guncangan gempa pertama sekitar pukul

Ancaman Gempa Makin Meningkat  dari halaman 1

ahli geologi dari Institut Teknologi California (Caltech), pada 2008. Penelitian berdasarkan sejarah kegempaan di sekitar Kepulauan Mentawai. Para peneliti menemukan empat siklus tsunami selama 700 tahun terakhir, yakni peristiwa tahun 1350 ke 1380, tahun 1606 ke 1685, dan tahun 1797 ke 1833. Tim mempelajari karang yang tumbuh di sepanjang 700 kilometer di sebelah selatan pusat gempa Aceh, terutama di Kepulauan Mentawai, Sumatra Barat. Danny mengakui saat ini ancaman gempa di Sumbar memiliki kecenderungan meningkat. Lokasinya bahkan semakin

Kado istimewa itu pecah di perairan Malalayang Dua, Kota Manado, Sulawesi Utara. Sebanyak 2.486 penyelam mengikuti upacara bendera di bawah air pada kedalaman 9-15 meter dengan waktu 45,28 menit sejak pukul 10.00 Wita. Upacara bendera memperingati detik-detik proklamasi tersebut lengkap dengan tata urutan serta perangkat upacaranya. Rekor tersebut merupakan sebuah kategori rekor baru (the most scuba diving simulatanously nationally) di Guinness World Record. Tapi sekaligus memperbarui rekor sehari sebelumnya, Minggu (16/8), yang diciptakan di lokasi yang sama, yakni selam dengan peserta terbanyak (the large scuba diving lesson) yang diikuti 2.465 penyelam. Rekor penyelaman dengan peserta terbanyak sebelumnya diciptakan di Maladewa (Maldiva) pada 25 Februari 2006 yang diikuti 979 penyelam

14.38 WIB. Hingga Senin pukul 07.40 WIB, kondisi Kota Padang masih normal, pasca gempa 6,9 SR yang menimpa Padang dan sekitarnya. Gempa hebat pernah terjadi di Sumbar pada Maret 2007, disusul kemudian 12-13 September 2007. Sumbar dikenal sebagai daerah rawan gempa di Indonesia akibat Pulau Sumatra berada di atas patahan besar Sumatra atau patahan semangko. Situasi di Siberut Ratusan warga dari tiga desa di Kecamatan Siberut Selatan, Kabupaten Kepulauan Mentawai, Sumbar yang sempat mengungsi

ke bukit-bukit akibat gempa Minggu sore, akhirnya pada Senin pagi sudah mulai pulang ke rumah masing-masing. Camat Siberut Selatan Arifianto S yang dihubungi melalui telepon selulernya dari Padang, mengatakan, warga yang sempat mengungsi ke bukit-bukit tersebut yakni, warga Desa Muara Siberut, Meilepet, dan Munte, yang bermukim di pinggiran pantai. Mereka sebagian besar mengungsi ke Bukit Puro, Meilepet dan perbukitan di Muara Siberut. “Sebagian warga tadi pagi sudah pulang dan beraktivitas seperti biasa. Namun sebagian lagi masih

bertahan di perbukitan,” kata Arifianto. Ia mengakui warga saat ini sudah mulai tenang. Namun sehari sebelumnya sempat panik karena pusat gempa berada di Siberut. Di samping itu, air laut bergejolak karena goyangan gempa. Namun tidak terjadi tsunami. Kecamatan Siberut termasuk bahagian dari Kabupaten Kepulauan Mentawai, Sumbar, yang terletak di pantai barat Sumatera Barat, atau berhadapan langsung dengan Lautan Hindia. Kabupaten Kepulauan Mentawai memiliki penduduk 66.332 jiwa lebih.(ant)

mendekat ke sumber yang bisa menimbulkan gempa besar. Gempa-gempa yang terjadi saat ini berpusat di pinggiran yang besar, di bawah laut sekitar Siberut. Sebagian inti yang mengancam dan bisa menyebabkan gempa besar tersebut berada di antara Siberut-Sipora- Padang. “Itu yang yang perlui diwaspadai. Namun sekali lagi masyarakat jangan sampai panik,” kata doktor lulusan Institut Teknologi California itu. Menurut Danny, pihaknya tidak bisa memprediksi kapan gempa besar Sumatra terjadi. Bisa dua tahun atau 10 tahun lagi. “Untuk itu, masyarakat dan pemerintah daerah perlu meningkatkan kewaspadaan,” katanya, mengingatkan. Kepada masyarakat diimbau agar berusaha melatih diri untuk menyelamatkan diri

dan keluarga disaat gempa. Sementara pemerintah dan pihak terkait dari sekarang secara bersama-sama harus memfasilitasi masyarakat dalam upaya evakuasi ke tempat yang aman. Selama Minggu dan Senin, sudah terjadi 14 gempa di Sumatera Barat yang sebagian besar berpusat di Siberut. Gempa terkuat terjadi Minggu, pukul 14.38.22 WIB, dengan kekuatan 6,9 skala richter di 43 kilometer sebelah tenggara Siberut. Gunung Talang Pascagempa besar di Siberut, aktivitas Gunung Talang di Kabupaten Solok, Sumatera Barat meningkat yang menimbulkan gempa tremor meningkat dengan kekuatan 3 sampai 4 SR. “Namun tidak terlihat adanya letusanatausemburanabuakibatgempa tremor dari Gunung Talang ters-

ebut,” kata Koordinator Satkorlak Penanggulangan Bencana (Satkorlat PB) Sumatera Barat Ade Edwar. Gempa tremor dirasakan masyarakat yang berada di sekitar kawasan Gunung Talang sebanyak dua ratus kali. Masyarakat diimbau untuk tetap tenang dan mengikuti arahan serta informasi dari petugas Satlak PB dan Satkorlak PB. “Jangan terpancing oleh isu yang tidak bertanggung jawab mengenai gempa bumi dan tsunami,” ujarnya. Dia menambahkan, gempa bumi ini tidak menimbulkan tsunami, karena walaupun pusatnya berada di bawah dasar laut namun energinya tidak cukup kuat untuk memicu terjadinya tsunami. Dia meminta, masyarakat tetap waspada dengan kejadian gempa susulan, yang diperkirakan kekuatannya lebih kecil.(ant) cmyk

dibebaskan, Yayan disambut gembira oleh warga setempat. Di Masjid Nurish yang tak jauh dari rumahnya, terpampang spanduk bertuliskan “Yayan Sudah Kembali.” Syariffudin mengungkapkan banyak warga yang meneteskan air mata melihat kepulangan Yayan. Yayan mengaku akan pulang ke kampung halamannya. Kepala koki Hotel Gran Melia, Jakarta Selatan, itu menegaskan dirinya tidak akan memilih pulang ke daerah Jawa. “Di daerah Jawa masih basis (teroris). Saya takut,” ungkapnya. Yayan belum dapat memastikan apakah akan menetap selamanya di

wilayah baru yang akan ditujunya, atau akan kembali lagi ke Jakarta. Yayan mengakui telah dipanggil kembali oleh pihak hotel agar kembali bekerja. Yayan diberi waktu hingga satu bulan kedepan oleh Hotel Gran Melia untuk menentukan sikap. Dalam waktu dekat bapak seorang anak itu akan mencoba menaklukkan Gunung Kerinci bersama teman-temannya, grup pecinta alam masa kuliahnya di Akademi Pariwisata Pertiwi. “Hanya gunung di daerah Sumatera yang belum pernah saya taklukkan. Saya akan mencobanya. Saya dan temanteman sudah merencanakannya,” tuturnya. (Persda Network/cr1)

berenang dan mandi di rawa di Dusun Wonojoyo. Sekitar 15 menit kemudian Sunu, seorang korban, bermain ke arah kedalaman sekitar dua meter. Namun tiba-tiba saja Sunu tenggelam lalu menarik Irfan.

Keduanya diduga sama-sama kurang lihai berenang. Dan Rifki mencoba menolong kedua korban tetapi juga tidak berhasil. Dan kemudian, ketiganya tenggelam di rawa. Melihat ketiganya tenggelam, Diki teman

korban panik dan menjerit minta tolong kepada warga sekitar. Bandot, warga yang mendengar jeritan Diki, langsung datang menolong. Setelah itu memberitahu keluar ga korban. (ang)

Ikhwan,” kata As’ad. Menurut As’ad, pihaknya telah menjalankan kewenangan sesuai dengan aturan hukum. Kewenangan tersebut, yakni menetapkan 45 nama caleg terpilih DPRD Bandar Lampung. “Prinsipnya, kewenangan kami telah kami sampaikan ke KPU provinsi,” imbuhnya. Ikhwan ketika dihubungi Tribun mengaku telah mengetahui informasi penundaan pelantikannya. Bersama Partai Gerindra, ia masih menunggu langkahlangkah yang akan dilakukan terkait permasalahan itu. “Saya masih menunggu bagaimana langkah-langkah partai. Saya sudah dapat informasi bahwa saya di-pending pelantikannya, dan saya belum tahu permasalahannya apa,” ujar Ikhwan. Sementara dari Metro, usulan nama pengganti caleg terpilih Partai Golkar, Endang Rahayu

Ningsih, yang menggantikan A Rozi Yasin, tidak keluar dalam daftar nama anggota DPRD Kota Metro periode 2009-2014. Pasalnya usulan peresmian anggota dewan ke Gubernur Lampung tidak dilengkapi dokumen-dokumen administrasi sesuai ketentuan. “Dalam penyelesaiannya gubernur meminta untuk diselesaikan oleh KPU Kota Metro dan KPU Provinsi. Sehubungan dengan hal itu, maka gubernur meminta kepada Wali Kota agar memfasilitasi penyelesaiannya. Setelah selesai maka agar secepatnya diusulkan kembali peresmiannya kepada gubernur,” kata Ketua KPU Kota Metro, Buyung Syukron. Ia mengatakan, penetapan 24 calon anggota dewan itu didasarkan pada Keputusan Gubernur Lampung No G/530/B.II/HK/ 2009 tertanggal 14 Agustus 2009,

tentang peresmian keanggotaan DPRD Kota Metro 2009-2014 dan persemian pemberhentian anggota DPRD periode sebelumnya. “Jadi berdasarkan SK tersebut maka hanya 24 dari 25 orang yang dilantik,” ujar Buyung. Dalam daftar nama anggota dewan baru yang tercantum dalam surat keputusan gubernur, ada enam perempuan yang akan duduk di parlemen kota Metro. Munculnya srikandi ini, merupakan sejarah baru. Pada periode sebelumnya satu pun tidak ada anggota dewan perempuan. “Seharusnya ada tujuh dengan Endang, tetapi karena pelantikannya ditunda maka tidak muncul,” kata Buyung. Mereka yang akan duduk di legislatif mewakili perempuan adalah, Sudarti (Hanura), Wiwin Septiani (PAN), Suprihatin (PKB), Megasari (PIS), Anna Morinda (PDIP), dan Widi Astuti (PKNU). (zid/nas)

selama 30 menit. Sebelumnya, Thailand (2003) diikuti 722 penyelam, dan Australia (2001) diikuti 525 penyelam. Dua rekor yang dicapai dalam dua hari berturut-turut, tercatat dalam katalog Guinness World Record Ltd, London Inggris dengan nomor ID Claim 244387 dan ID Keanggotaan 215331. Pemecahan rekor baru ini dinilai langsung oleh juri penilai Guinness World Record, Ms Lusia Sinigagliesi. Ia dibantu dua saksi, Lurah Malalayang Dua Dra Lenda Pelealu Msi, dan Jantje Tengko sebagai saksi notaris. “I’m very-very happy today, which re-meet you all here. For today, I wanna say you, congratulation for the new Guinness World Record, the most scuba diving simultanously national day. Thank you!,” kata Lusia. (Saya sangat berbahagia kembali berada di sini, dimana boleh bertemu dengan anda sekalian. Saya ucapkan selamat atas tercapainya rekor baru, yakni penyelaman bawah laut sambil melakukan upacara. Terima kasih!).” Seusai pidato singkat Lusia, empat dentuman meriam menyambutnya, menghentak

ribuan warga dan penyelam yang berada di lokasi. Euforia kegembiraan berada di manamana. Saat itu, Lusia diampingi Wakil KSAL Laksamana Madya Moekhlas Sidik, Danlantamal VIII Manado Laksma Willem Rampangilei, dan Kadispenal Laksma Iskandar Sitompul SE, serta beberapa pejabat utama TNI AL. Tak hanya tepuk tangan dan sorakan nyaring, masih ditambah dengan raungan sirine ambulance, rentetan klakson mobil serta klakson dari tiga kapal perang TNI AL yang buang sauh di sekitar lokasi acara. Pertama Kali Laksamana Pertama (Laksma) Iskandar Sitompul mengungkapkan, upacara bawah laut tersebut dijadikan rekor karena belum satu negara atau pihak yang melakukannya. “Awalnya kita hanya akan memecahkan (rekor) yang pertama, penyelaman dengan peserta terbanyak,” kata Sitompul. “Di dalam air kita melaksanakan tata urutan sebuah upacara sebagaimana biasanya. Perangkatnya pun lengkap. Ada laporan ke komandan upacara, penghormatan, pengibaran bendera, pembacaan teks proklamasi, hening cipta, dan

laporan lagi,” tuturnya. Terkait pemecahan rekor kemarin, dari Guinness World Book memberikan persyaratan, waktu penyelaman tak boleh kurang dari satu menit. Namun, syarat itu berhasil terlampaui. “Luar biasa memang, kami hanya memberikan syarat satu menit, tapi ini mencatat lebih dari itu,” kata Lusia. Total waktu yang diperlukan penyelaman kemarin hampir sejam, dihitung sejak turunnya peserta ke kedalaman antara 915 meter hingga munculnya penyelam pertama ke permukaan. Moekhlas Sidik yang bertindak selaku inspektur upacara merupakan penyelam pertama yang ke permukaan. Saat Wakasal muncul ke permukaan, waktu itulah yang dijadikan patokan rekor dunia. Pemecahan rekor dunia kedua kemarin, beberapa pejabat utama yang sehari sebelumnya ikut menyelam, tak bisa hadir karena ada tugas yang tak bisa ditinggalkan, terkait peringatan HUT Kemerdekaan RI. Antara lain Gubernur Sulut Sinyo H Sarundajang dan Kapolda Sulut Brigjen Pol Bekto Soeprapto, yang harus memimpin upacara di kantor masingmasing.(TM/Fernando Lumowa) ADVETORIAL

DERITA RUTIN TELAH PERGI, KERJA MAKIN OKE JIKA dicermati slogan back to nature sesuai dengan petuah sesepuh yang menganjurkan meng konsumsi produk alami untuk hidup yang sehat. Minum Gula Aren adalah anjuran yang telah lama kita abaikan, akibatnya tumbuh generasi yang loyo dan rentan terhadap berbagai penyakit. Pengalaman Adang B. S.Ag ,Kades Desa Kersamanah, Kab. Garut patut disimak. Saat itu, dia bekerja sebagai pelaut kapal motor di Selat Sunda. Angin laut yang berhembus deras membuatnya sering masuk angin hingga badan menggigil, perut kembung dan tulang nyeri .Waktu makan yang tak teratur membuat sakit maag sering kambuh terasa perih. Syukurlah rekan , penyanyi di

kapal itu. memberinya Gula Aren Gentong Mas. “ Meski awalnya ragu, akhirnya saya terima setelah dia mengatakan sudah men coba dan merasakan sendiri manfaatnya “ tutur Adang. Tiga hari setelah rutin minum Gentong Mas masuk angin yang biasa mendera perlahan reda “bah kan serangan maag yang acap menyiksa juga berangsur hilang dan tak muncul lagi” ungkap sarjana ilmu agama ini. Belajar dari pengalaman diatas, Adang merasa perlu dan harus untuk rutin minum Gentong Mas setiap hari. “Alhamdulillah setelah rutin minum Gentong Mas penyakit langganan pergi, badan lebih fit dan semangat kerja oke. Gentong Mas memang cara nikmat menjadi sehat “ ucap pak Adang mengakhiri percakapan.

Menurut Jeff Gunnent dalam bukunya Permaculture Plant (2004), Gula Aren mengandung zat yang berfungsi membersihkan saluran pencernaan. Selain itu Riboflavin yang melancarkan metabolisme, dan memperbaiki fungsi sel sehingga stamina dan vitalitas prima. Tapi pola hidup sehat dan makan teratur tak boleh diabaikan. Gentong Mas diproduksi dengan pengawasan ketat sehingga hanya Gula Aren murni pilihan yang menjadi bahan bakunya. Gentong Mas juga diproses dengan higienis. Menurut Manajer Marketing PD Gentong Mas, kini makin banyak masyarakat merasakan manfaat Gentong Mas, sehingga tingkat permintaan terus melonjak secara signifikan. Untuk informasi lebih lanjut hubungi telp: 0721 3625019/0812 1088 3349. P-IRT No. 812320501114


Aptk. Rosa

Pasar Untung

Aptk. Untung

Jl. Teuku Umar

Aptk. Mitra. Aptk. Rosa Delima,

Pasar Tugu

Aptk. Tugu

Aptk. Kita, Aptk. K24

Pasar Panjang

Aptk. Panjang, Aptk. METRO,

Jl. Raden Intan

Aptk. Enggal, Aptk. Gemari

Jl. Urip. Sumoharjo

Aptk. Nova

Jl. Ki Maja

Aptk. Anugerah

Jl. Pahlawan

Aptk. Pahlawan

Jl. Cut Nyak Dien

Aptk. D.E.D Palapa

Jl. P. Antasari

Aptk. Sinar Fajar,



Aptk. Marpa, Aptk. Nakula, Aptk. Sari.


TO All-Lyah

Subdis Metro (081272262280), Aptk. Saras, Aptk. Waras,

Aptk. Berkah, Aptk. Albesta Farma.,

Apkt.Tina Husada,

Aptk. Restu

Aptk. Sari Waras, Apt. Naupal,


Aptk. Mutiara

Aptk. Kurnia, Aptk. Jodo,


Aptk. Eka Farma. Aptk. Karimun,

Aptk. Az-Zahra, Aptk. Mandiri, TO Sumber Sehat.

Aptk. Rosa Dua

Aptk. Keluarga


Aptk. Sentosa

Wolter Monginsidi

Aptk. Indra Jaya


Aptk. Mawar, Aptk. Florence, TO. Mulia,

Pasar Bambu Kuning

Aptk. Bambu Kuning


Apt. Anza, Apt.Rahayu, Apt. Marisa


Apt. Ceria, Apt. Abung Fr,

Panglima Polim

Aptk. Aa Fiah


Aptk. Alpha

Pasar Tengah

Aptk. Ade Farma


Aptk. Kurnia, Aptk.Gading Farma,

Apt.Intan Baru, Apt. Nanda,

Pasar Way Halim

Aptk. Sido Waras.

Aptk. Ibnu Sina, TO. Sari Waras,

TO Anugerah, TO Djapuri,

Aptk. Santa

TO. Borobudur

TO Harmonis


Tribun Lampung SELASA, 18 AGUSTUS 2009 | HALAMAN 8 TELEPON SEMUA BAGIAN: 0721-704777 (5 LINE)  IKLAN: 0721-3585522  SIRKULASI: 0721-3585533, 08127211010 HOTLINE PUBLIC SERVICE: 08127212211

Sagala PTUN-Kan Menteri Dalam Negeri  Kisruh Pilwabup Lampung Selatan Solusi itu merupakan solusi sepihak dari Mendagri, tanpa mau melihat keinginan dari pihak Lamsel sendiri. Contohnya begini, bagaimana mau menyelenggarakan pilwabup ulang, jika sekarang saja anggaran Lamsel sedang defisit IRSANUDIN SAGALA Cawabup Lamsel

BANDAR LAMPUNG, TRIBUN-Calon wakil bupati (cawabup) terpilih Lampung Selatan (Lamsel) Irsanudin Sagala menggugat Menteri Dalam Negeri (Mendagri) Mardiyanto melalui Pengadilan Tata Usaha Negara (PTUN). Berkas gugatan telah diserahkan kepada PTUN Jakarta, Jumat (14/ 8) lalu. “Jumat (14/8) lalu, saya sudah memasukkan berkas gugatan di PTUN Jakarta. Ini saya lakukan, karena setelah dikaji, Mendagri seharusnya tidak menolak hasil

sidang paripurna pilwabup kedua pada 22 April. Alasan-alasan yang dia (Mendagri) kemukakan juga tidak tepat,” ujar Irsanudin Sagala, kepada Tribun via telepon, Senin (17/8). Menurutnya, gugatan ini merupakan upaya hukum lanjutan setelah Mendagri tidak menggubris surat protes dari DPRD Lampung Selatan yang dikirim 10 Agustus lalu. Apalagi, kata Sagala, dirinya telah melampirkan pendapat hukum dari Prof Dr Philipus M Hadjon SH, pakar hukum dari

Universitas Airlangga, Surabaya. Sagala mengatakan, hingga kini ia tidak tahu persis alasan Mendagri menolak pelantikan dirinya menjadi Wakil Bupati Lamsel. Pasalnya, kata dia, sidang paripurna pilwabup pada 22 April yang memenangkan dirinya, telah dilakukan sesuai prosedur dan tata tertib sidang DPRD. “Saya tidak tahu apa sebabnya. Yang pasti, Mendagri sepertinya hanya mencari-cari alasan saja untuk menolak pengesahan hasil

sidang paripurna kedua pilwabup itu. Apalagi ada anggapan saya melakukan intervensi ke Depdagri,” imbuhnya. Lebih jauh Sagala menilai, surat Mendagri yang meminta Pemprov Lampung memfasilitasi pilwabup ulang pun tidak dapat dikatakan sebagai solusi yang tepat. “Itu malah memperkeruh situasi politik di Lamsel,” sesalnya. Dia beranggapan, meskipun Pemprov Lampung merupakan wakil pemerintah pusat, namun kewenangan untuk memutuskan apakah diperlukan pilwabup ulang atau tidak, tetap berada pada Pemkab dan DPRD Lamsel. “Solusi itu merupakan solusi sepihak dari Mendagri, tanpa mau melihat keinginan dari pihak Lamsel sendiri. Contohnya begini, bagaimana mau menyelenggarakan pilwabup ulang, jika sekarang saja anggaran Lamsel sedang defisit,” ujarnya.(rez)


IKUT BAPAK - Seorang pemulung menarik gerobak yang ditumpangi kedua anaknya di Jalan Diponegoro, Bandar Lampung, Jumat (14/8) siang.

DKL Gelar Parade Monolog BANDAR LAMPUNG, TRIBUN - Sebanyak 16 peserta akan tampil membacakannaskahciptaanpengarang luar negeri dalam Parade Monolog se-Lampung yang digelar Komite Teater Dewan Kesenian Lampung (DKL) di Taman Budaya Lampung, Selasa (18/8). “Para peserta akan membawakan naskah monolog yang sudah ditetapkan panitia, di antaranya Di Hamparan Salju, Kenangan Seorang Perempuan Pemalu, Hati yang Meracau, dan Pagi yang Brengsek,” ujar Ketua Komite Teater DKL Ahmad Zilalin, melalui pers rilisnya, Senin (17/8). Soal naskah monolog yang bera-

sal dari pengarang luar negeri, Zilalin menuturkan, hal tersebut disebabkan Komite Teater DKL kesulitan mendapatkan naskah dari pengarang Indonesia. “Kami pilih naskah-naskah dari pengarang Barat karena lebih banyak tantangannya, selain karena memang kekurangan naskah monolog dari pengarang Indonesia,” jelas Zilalin. Alasan ini dibenarkan anggota Komite Teater DKL Iin Muthmainah. “Sulitnya mendapatkan naskah monolog dari pengarang Indonesia membuat parade kali ini mengambil naskah dari pengarang luar negeri,” tukasnya. Zilalin mengutarakan, dewan juri

yang akan menilai parade ialah Oyos Saroso HN, Ari Pahala Hutabarat, dan Imas Sobariah. “Kami sengaja memilih ketiganya karena kapabilitasnya sudah diakui di daerah ini,” kata Alin, sapaan akrabnya, seraya memastikan parade akan dibuka pagi hari oleh Ketua Umum DKL Syafariah Widianti. Zilalin menerangkan, Parade Monolog se-Lampung yang dihelat setahun sekali ini bertujuan menumbuhkan minat generasi muda dalam dunia teater. “Selain itu Komite Teater DKL ingin mencari aktor berbakat untuk menyemarakkan dunia perteateran di Lampung,” imbuhnya.(yos)

Kalau DPRD Lamsel memang tidak mau menggelar pilwabub ulang, harusnya mereka menyatakan sikap itu, bukan diam-diam saja RISMAN SESUNAN

CAWABUP terpilih Lamsel pada sidang paripurna pilwabub pertama Risman Sesunan meminta pemimpin DPRD Lamsel segera menyatakan sikap terkait rencana sidang paripurna pilwabub ulang. Pasalnya, masa jabatan anggota

Dewan 2004-2009 akan berakhir 19 Agustus. “Masa jabatan anggota Dewan berakhir 19 Agustus, jadi tinggal dua hari lagi. Kalau DPRD Lamsel memang tidak mau menggelar pilwabub ulang, harusnya mereka menyatakan sikap itu, bukan diam-diam saja,” ujar Risman kepada Tribun via telepon, Senin (17/8) siang. Hingga hari ini, kata dia, DPRD Lamsel belum pernah menyatakan sikap tegas apakah akan menggelar sidang paripurna pilwabup ulang atau tidak. Ia khawatir, bila DPRD tidak segera bersikap, masyarakat akan menilai mereka sengaja mengulur-ulur

waktu menyelesaikan polemik pilwabub di tanah berjuluk Ragom Mufakat tersebut. Menurut Risman, jika DPRD Lamsel akan menggelar sidang paripurna pilwabub ulang seperti kesepakatan enam fraksi dengan Pemprov Lampung pada 7 Agustus, waktu dua hari yang tersisa dapat dioptimalkan. “Persiapan sidang paripurna itu kan hanya membutuhkan waktu sehari saja,” tandasnya. Namun demikian, sambung Risman, jika tidak mau menggelar pilwabub ulang, DPRD diharapkan bisa memberikan jawaban tegas kepada Mendagri maupun Gubernur Lampung sebagai fasilitator

pilwabup ulang. “Dilakukan atau tidak, pilwabup ulang itu kan ada resiko politiknya. Jangan sampai, surat Mendagri maupun keputusan enam fraksi yang disaksikan Wakil Gubernur, dibiarkan begitu saja. Jika begitu, nanti DPRD Lamsel akan dikatakan melecehkan kedua instansi tersebut,” paparnya. Risman sendiri menyatakan akan tetap mengikuti keputusan Mendagri, mengikuti pilwabub ulang. “Sebaiknya tidak ada pekerjaan yang belum selesai sebelum masa jabatan Dewan berakhir,” tegasnya.(rez)

Enam Pekon di Tanggamus Terisolir  Harus Dicapai Lewat Jalur Laut

BANDAR LAMPUNG, TRIBUN - DPRD Tanggamus mengingatkan Pemkab setempat agar memprioritaskan anggaran untuk pembangunan di bidang infrastruktur dalam APBD 2010 mendatang. Ini diungkapkan Wakil Ketua DPRD Tanggamus Akhmadi Sumaryanto, kepada Tribun, Senin (17/8) malam. “Ke depan, bidang infrastruktur, terutama soal jalur transportasi darat, perlu diprioritaskan dalam APBD 2010,” ujarnya. Prioritas tersebut menurut Akhmadi mutlak karena masih terdapat enam pekon (desa) yang terisolir karena tidak bisa diakses melalui jalur darat. “Enam pekon itu berada di Kecamatan Pematang Sawah yang harus dilalui lewat laut,” jelas politisi asal PKS ini. Sebenarnya, jelas Akhmadi, jalan menuju enam pekon tersebut bisa dilalui lewat jalur darat. “Memang bisa lewat jalan darat. Tapi medannya sangat sulit karena harus melewati punggung Bukit Barisan,” kata mantan calon



Jarak tempuhnya sekitar 100 kilometer. Medannya naik turun dan mengitari punggung Bukit Barisan AKHMADI SUMAR YANTO SUMARY Wakil Ketua DPRD Tanggamus

gubernur Lampung 2009-2014 ini. Jalur tersebut, sambung Akhmadi, hingga kini tidak bisa diakses karena belum tersentuh pembangunan. “Jarak tempuhnya sekitar 100 kilometer. Medannya

naik turun dan mengitari punggung Bukit Barisan,” terangnya. “Sampai sekarang belum ada pembangunan jalan. Rencana sudah ada, tapi baru sebatas rencana,” imbuhnya. Akhmadi mengungkapkan, selain enam pekon tersebut masih ada daerah lain di Tanggamus yang belum bisa diakses lewat jalur darat, yakni di Kecamatan Bandar Negeri Semuong. “Untuk ke sana harus lewat sungai,” ucapnya. Selain itu, lanjut Akhmadi, hingga kini juga belum terdapat jalan yang menghubungkan Kecamatan Kelumbayan Barat dan Kelumbayan dengan wilayah lain di Kabupaten Tanggamus. “Untuk menuju Kelumbayan Barat dan Kelumbayan mesti memutar lewat Bandar Lampung dan Pesawaran. Padahal ke sana bisa lewat Kecamatan Cukuh Balak. Tapi, sampai sekarang jalan antara Cukuh Balak dan dua kecamatan itu belum dibangun,” tandasnya. Akhmadi mengutarakan, untuk membuka akses daerah terisolir

Pemkab mesti meminimalisasi pos-pos lain di APBD yang belum mendesak. “Misalnya anggaran pengadaan sembilan kendaraan dinas Pemkab yang terealisasi dalam APBD 2009 sebelum perubahan. Itu kan sebenarnya belum mendesak,” tulasnya.(yos)



TELEPON SEMUA BAGIAN: 0721-704777 (5 LINE) IKLAN: 0721-3585522 SIRKULASI: 0721-3585533, 08127211010 HOTLINE PUBLIC SERVICE: 08127212211

ribun Lampung


Semua Bergembira Sambut Hari Merdeka

Harus Tutup Tanpa Kecuali  Tak Ada Toleransi untuk Tempat Hiburan BANDAR LAMPUNG, TRIBUN - Ketua Majelis Ulama Indonesia (MUI) Lampung Mawardi AS mengim-

Tunggu Depag MUI hingga kemarin belum menetapkan kapan tepatnya tanggal 1 Ramadan. Untuk menetapkan 1 Ramadan, Mawardi menjelaskan, pihaknya masih menunggu keputusan Departemen Agama. “Sampai sekarang memang belum ada,” tutur Mawardi. Berbeda dengan Mawardi, Nurvaif mengemukakan Muhammadiyah pusat telah menetapkan satu Ramadan  ke halaman 15

Pemkot Bandar Lampung harus segera mengeluarkan keputusan penutupan tersebut MAWARDI AS Ketua MUI Lampung

bau pemerintah menutup total tempat hiburan selama Bulan Ramadan. Sehingga, aktivitas umat Islam dalam beribadah tidak terganggu. “(Hal ini) untuk menghormati Bulan Ramadan dan orang yang menjalankan ibadah puasa,” tegas Mawardi, Senin (17/8).

Pemkot Bandar Lampung, lanjut Mawardi, harus segera mengeluarkan keputusan penutupan tersebut. Hal serupa disampaikan Ketua PW Muhammadiyah Lampung Nurvaif Chaniago. “Itu harus dilakukan dan kami akan mendukung,” jelas Nurvaif. Tempat hiburan, sambung Nurvaif, harus ditutup supaya tidak mengganggu ibadah umat muslim selama Ramadan. “Kami mengimbau pemerintah supaya bisa memberikan ketenangan ibadah kepada umat Islam.  ke halaman 15 TRIBUN LAMPUNG/PERDIANSYAH/MARZULI ARIWIBOWO


Never Expired MENJADI guru vokal private artis seperti Acha Septriasa, Asmirandah, Revalina S Temat, Intan Nuraini, Indah Kalalo, hingga Ivan Gunawan menjadi tantangan tersendiri bagi Baina Ivo. Selain karena mereka orang terkenal, para artis tersebut memang tertarik terjun di dunia tarik suara. Ina, biasa cewek berusia 28 tahun ini disapa, bercerita, melatih vokal artis tidak untuk membuat suara mereka merdu. Tetapi lebih kepada membentuk karakter vokal. Selain itu, mereka belajar mengatur pernapasan dan teknik dasar bernyanyi.  ke halaman 15

Biofile  LAHIR: 9

Februari 1981  PROFESI:

Penyanyi dan Guru Vokal


 ALBUM: Damai Mimpi (2000), I’m Dreamer(2009)

MERIAH - Peringatan HUT ke-64 RI, Senin (17/8), di Bandar Lampung berlangsung meriah. Setiap sudut kota diramaikan perlombaan unik. Di Rawa Laut, dua anak harus menjaga bola di wajah mereka tidak jatuh saat berjoget mengikuti irama musik. Di ujung bom, saling menjatuhkan dengan memukul lawan di atas sungai menjadi tontotan menarik.

BANDAR LAMPUNG, TRIBUN - Warga Bandar Lampung, Senin (17/8), merayakan HUT ke-64 kemerdekaan Indonesia dengan gembira dalam beragam cara. Hampir di setiap sisi kota ramai oleh perlombaan dan kegiatan. Di Jalan Radin Intan, Komunitas Lampung Street Art (LSA) mengisi perayaan dengan membuat grafiti atau istilah mereka “mengebom”. Mereka mencoret tembok di seberang Tunas Dwipa Matra, main dealer motor Honda Lampung. “Ini ungkapan simbolis dari seniman jalanan atas HUT ke-64 kemerdekaan Indonesia,” kata David Irwandi, anggota komunitas tersebut. David menjelaskan, grafiti yang dibuat mengekspresikan dukungan bagi Indonesia untuk bersatu dan bangkit. Dalam membuat grafiti tersebut, David bahu membahu bersama tujuh temannya. “Kami sudah mulai berkumpul di sini (Jalan Radin Intan) sejak pukul 05.30 WIB,” kata David. Tetapi, mereka harus mengulang “mengebom” karena hujan deras  ke halaman 15

Dua Orang Tewas di Hari Kemerdekaan

Rasa Nasionalisme Mengalami Degradasi

BANDAR LAMPUNG, TRIBUN - Hari peringatan HUT ke-64 kemerdekaan RI, Senin (17/8), diwarnai dua kecelakaan lalu lintas yang menewaskan dua orang di dua tempat berbeda. Dian Kurniawan (20), dilarikan ke Rumah Sakit Umum Daerah Abdoel Moeloek (RSUAM) dengan napas tersengal-sengal. Dari hidungnya terjulur selang yang membantunya bernapas. Sayangnya, korban kecelakaan ini hanya mampu bertahan tak lebih dari 20 menit di Ruang Instalasi Gawat Darurat (IGD) RSUDAM. Sebelum dirawat di IGD, warga Pringsewu ini menjalani perawatan di Rumah Sakit Daerah Pringsewu sekitar tiga jam. Pria lajang ini tertabrak mobil Hardtop saat ia duduk di atas motor di dekat rumahnya. Akibat insiden yang terjadi sekitar pukul 11.00 WIB itu, Dian

BANDAR LAMPUNG, TRIBUN - Pemerintah sudah seharusnya memperhatikan nasib veteran. “Prihatin kalau melihat teman-teman,” kata Soehardjo Haryanto (81), anggota legiun veteran Bandar Lampung, Senin (17/8). Soehardjo menjelaskan, banyak di antara teman-temannya yang veteran tidak memiliki pekerjaan. Sebab, mereka tidak mempunyai kemampuan. “Selain itu, banyak juga yang cacat,” tutur Soehardjo. Soehardjo merupakan seorang veteran yang masih beruntung.

 ke halaman 15

Selepas tugas dari militer, kakek 14 cucu itu memutuskan berwiraswata. “Kami (veteran) dahulu berjuang tanpa pamrih. Kami tidak mau meminta ke pemerintah sehingga seolah-olah mau pamrih,” kata suami Nurbaiti (73) ini usai mengikuti upacara di Stadion Pahoman. Saat ini, lanjut Soehardjo, tidak banyak teman yang bisa ia temui. Hanya satu atau dua orang yang masih bertemu.  ke halaman 15

Upacara Tetap Khidmat di Bawah Guyuran Hujan BANDAR LAMPUNG, TRIBUN - Upacara memperingati HUT ke-64 kemerdekaan RI di Bandar Lampung, Senin (17/8) berlangsung di bawah guyuran hujan. Namun, seluruh sekolah, sebagian instansi, dan Pemkot Bandar Lampung tetap melakukan upacara. Gubernur Lampung Sjachroedin ZP menjadi inspektur upacara di Stadion Pahoman. Upacara berlangsung khidmat meskipun peserta harus berdiri di atas lapangan yang tergenang air. Pasukan pengebar bendera pun harus melintasi trek stadion yang becek. Namun secara umum, upacara berlangsung tertib dan tidak ada peserta upacara yang meninggalkan lapangan. Di tengah upacara, hujan berhenti. Tetapi tetap saja para peserta upacara meninggalkan lapangan dengan kondisi basah dan pakaian kotor terkena lumpur. Sebelum pengibaran bendera dilakukan, Ketua DPRD Provinsi Lampung Indra Karyadi membaca ke halaman 15



SERAHKAN BENDERA - Siswi SMAN 17 Bandar Lampung Santika menyerahkan Sang Saka Merah Putih kepada Komandan Korem 043 Garuda Hitam Kolonel Inf Nugroho Widyotomo dalam upacara penurunan bendera di Stadion Pahoman, Senin (17/8) sore.




h tline public service Anda menghadapi masalah gangguan telepon, listrik, air bersih, perparkiran, perizinan, dan pelayanan umum lainnya, kirimkan informasinya kepada kami. Keluhan akan kami teruskan ke penanggungjawab pelayanan publik terkait, untuk dicarikan jawaban dan solusinya. Hubungi Oci di Telp: 0721-704777 ext.200. Faks: 0721-788276 SURAT : Tribun Lampung, Jalan ZA Pagaralam No 83, Gedong Meneng, Rajabasa, Bandar Lampung. E-MAIL :


Selamat Datang DPRD Baru SELAMAT datang wakil rakyat. Hari ini, sebanyak 44 anggota legislatif Bandar Lampung periode 2009-2014 dilantik. Mereka akan diambil sumpahnya oleh Ketua Pengadilan Negeri Tanjungkarang Robert Simorangkir. Mestinya ada 45 anggota parlemen yang iktu pelantikan. Tapi berdasarkan surat keputusan Gubernur Lampung Sjachroedin ZP, anggota dewan yang dilantik hanya 44 orang. Satu caleg terpilih atas nama Ikhwan Fadil Ibrahim, dari Partai Gerindra tidak diikutkan dalam pelantikan. Penundaan pelantikan karena adanya perbedaan pandangan antara KPU Bandar Lampung dan KPU Lampung. Ikhwan pun sudah mengetahui dirinya tidak ikut dilantik, dan tetap diserahkan kepada mekanisme partai. Pelantikan anggota dewan juga dilakukan di Metro. Sama dengan Bandar Lampung, di Metro usulan pengganti caleg terpilih dari Partai Golkar, Endang Rahayu Ningsih yang menggantikan A Rozi Yasin, tidak keluar dalam daftar nama anggota DPRD Kota Metro periode 2009-2014. Penyebabnya usulan ke Gubernur Lampung tidak dilengkapi dokumen-dokumen administrasi sesuai ketentuan. Jadi, yang dilantik hanya 24 orang bukan 25 anggota dewan. Dalam daftar nama anggota dewan baru yang tercantum dalam SK gubernur, DPRD Metro akan diwakili enam anggota dewan dari perempuan. Ini sejarah baru, mengingat pada periode sebelumnya tak satupun keterwakilan perempuan di legislatif. Kita berharap, plus minus pelantikan anggota dewan tidak mempengaruhi kinerja wakil rakyat lima tahun mendatang. Anggota legislatif tetap bekerja berdasarkan kepentingan rakyat. Bekerja sama dengan eksekutif merumuskan kebijakankebijakan yang prorakyat. Tidak saling melempar tanggung jawab dengan pemerintah kota. Boleh saja antara dewan dan pemerintah berbeda pandangan. Tapi sepanjang untuk kepentingan rakyat banyak, hal ini tentu tak masalah. Yang tidak boleh adalah, menyusupkan kepentigan pribadi atau golongan masing-masing dalam sebuah kebijakan yang diputuskan bersama. Oleh karena itu, marilah bekerja berdasarkan kebutuhan dan skala prioritas. Dan mudahmudahan 50 persen lebih wajah baru di DPRD kota Bandar Lampung memberikan harapan baru bagi kemajuan Bandar Lampung. Begitupula daerah lain yang akan segera mendapat anggota dewan baru. (*)

gara-gara ada iyem kalii..

abis mandi neng??!!

lho pak?! sekarang nyuci disini juga to!!?


PNPM Koperasi Peminjaman Usaha Kecil

Program Penanggulangan Kemiskinan


CEK SAMBUNGAN - Seorang pegawai PLN sedang mengecek sambungan listrik baru di Way Halim.

TERIMA kasih atas pertanyaannya. Perlu kami sampaikan bahwa PNPM Madiri adalah program nasional untuk program penanggulangan kemiskinan berbasis pemberdayaan masyarakat. Komponen program yang ada dalam PNPM Mandiri adalah sebagai berikut:  Pengembangan ma-

Beli Motor Mati Pajak

Bawa Kelengkapan Surat Kendaraan TERIMA kasih atas pertanyaannya. Untuk menghitung biaya pajak beserta dendanya, kami perlu menggetahui biaya yang tertera dalam surat ketetapan pajak daerah. Untuk balik nama saudara bisa langsung datang ke kantor Samsat Rajabasa dengan membawa kelengkapan motor

diem luu.. gara-gara elu nih tadi nggak pamit ama emak.. mbul.. kayaknya motormu nggak cuma pajeknya aja yang dah koit..



Syarat Gadai Emas HALO hotline public service. Saya ingin menanyakan syarat untuk mengadaikan emas di Pegadaian Syariah. Apa saja syaratnya. Terima kasih. Pengirim +628527916XXX



Samsat Bandar Lampung, Jalan Pramuka nomor 20 Bandar Lampung. Darmawan S Register (Pusat Informasi Samsat) Kantor Bersama Samsat Bandarlampung, Jalan Pramuka nomor 20 Bandar Lampung

kesuwadayaan yang diberikan kepada kelompok masyarakat untuk membiayai sebagian kegiatan yang direncanakan oleh masyarakat dalam rangka meningkatkan kesejahteraan terutama masyarakat miskin.  Peningkatan kapasitas pemerintahan dan pelaku lokal komponen adalah serangkaian kegiatan yang meningkatkan kapasitas pemerintah daerah dan pelaku lokal/kelompok perduli lainnya, agar mampu menciptakan kondisi yang kondusif dan sinergi yang positif bagi masyarakat, terutama kelompok miskin dalam menyelenggarakan hidupnya secara layak. Kegiatan terkait dalam komponen ini diantaranya seminar, pelatihan, lokakarya, kunjungan lapangan yang dilakukan secara selektif dan sebagainya.  Bantuan Pengelolaan dan Pengembangan Program Komponen ini, meliputi

kegiatan-kegiatan untuk mendukung pemerintah dan berbagai kelompok peduli lainnya dalam pengelolaan kegiatan, seperti penyediaan konsultan manajemen, pengendalian mutu, evaluasi dan pengembangan program. Perlu kami sampaikan bahwa PNPM bukan koperasi untuk pengembangan usaha kecil. Karena ruang lingkup program PNPM-MANDIRI pada dasarnya untuk kegiatan penanggulangan kemiskinan, seperti Penyediaan dan perbaikan pasarana/sarana lingkungan permukiman, sosial dan ekonomi secara kegiatan padat karya. Penyediaan dan perbaikan pasarana/sarana lingkungan permukiman, sosial dan ekonomi secara kegiatan padat karya. Reza Fahlevi ST Konsultan PNPM mandiri Jalan Ratu Dibalau Bandar Lampung Nomor 45

TERIMA kasih atas pertanyaanya. Pegadaian Syariah memiliki produk RAHN, yaitu produk jasa gadai yang berlandaskan pada prinsip syariah, nasabah hanya akan dipungut biaya administrasi dan ijaroh (biaya jasa simpan dan pemeliharaan barang jaminan). Untuk persyaratan, cukup membawa barang emas milik Anda. Persyaratan sebagai berikut:  Membawa fotokopi KTP atau identitas lainnya (SIM, Paspor, dll).  Mengisi formulir permintaan Rahn.  Menyerahkan barang jaminan (marhun) emas  Petugas pegadaian menaksir (marhun) agunan yang diserahkan.  Besarnya pinjaman/ marhun bih adalah sebesar 90 persen dari taksiran marhun.  Apabila disepakati besarnya pinjaman, nasabah menandatanggani akad dan menerima uang pinjaman. Dona Pegawai Pegadaian Syariah Raden Intan


Cara Mendapatkan Layanan T-Cash SAYA pelanggan Telkomsel. Saya ingin tanya bagaimana cara mendapatkan layanan T-Cash ditempat yang berlogo merchant T-Cash. Sebab karyawan tidak bisa menjelaskan. Terima kasih. Pengirim +6285269700XXX

HALO hotline public service. Saya ingin tanya bagaimana mendapatkan layanan T- Cash Telkomsel. Saya sudah melakukan registrasi, namun tidak aktif-aktif. Terima kasih. Pengirim +6281379965XXX

. rr..

anda :  STNK  BPKB  KTP  Cek fisik kendaraan di kantor Samsat terdekat/ datang langsung ke Kantor Samsat Rajabasa Bandar Lampung. Untuk informasi dan keterangan lebih lanjut anda bisa datang ke Kantor Bersama

syarakat yang mencakup serangkaian kegiatan untuk membangun kesadaran kritis dan kemandirian masyarakat yang terdiri dari pemetaan potensi, masalah dan kebutuhan masyarakat, perencanaan partisipatif, pengorganisasian, pemanfaatan sumber daya, pemantauan dan pemeliharaan hasil-hasil yang telah dicapai. Kegiatan ini disediakan dana pendukung kegiatan pembelajaran masyarakat, pengembangan relawan dan operasional pendampingan masyarakat dan fasilitator, pengembangan kapasitas, mediasi serta advokasi. Peran fasilitator terutama pada saat awal pemberdayaan, sedangkan relawan masyarakat adalah yang utama sebagai motor penggerak masyarakat di wilayahnya.  Bantuan Langsung Masyarakat Komponen Bantuan Langsung Masyarakat (BLM) adalah dana stimulan

Mendaftar Layanan T-Cash

.... rrr brr brrr.. brr


Menyerahkan Barang Jaminan

HALO hotline public service. Saya ingin tanya apa benar PNPM merupakan koperasi peminjaman bagi para usaha kecil. Bagaimanakah prosedurnya.Karena untuk pinjam di Bank atau koperasi pasar harus ada jaminan.Terima kasih. Pengirm +6285279566XXX

YTH Kantor Samsat Bandar Lampung. Saya beli motor tiga bulan yang lalu, keluaran tahun 2007. Pada waktu saya membeli motor sudah mati pajak. Rencana saya akan bayar pada November nanti. Yang ingin saya tanyakan berapa biaya dan dendanya. Apakah saya bisa langsung balik nama atas nama saya. Saya mohon penjelasannya. Terima kasih. Pengirim: +6281272575xxx

yaaaah sejak dibikin tampungan air dari PNPM ini ya mending nyuci disini laah..

S Ho MS P tlin Se ublice rvi ce

Tunjukan MSISDN kepada Kasir TERIMA kasih atas pertanyaannya. Telkomsel Cash adalah suatu layanan yang memungkinkan pelanggan untuk menggunakan mobile phone-


nya (MSISDN) melakukan transaksi, seperti pembelian, pembayaran. Layanan baru ini dapat dinikmati melalui dua cara, yaitu secara offline atau secara online. Secara offline, pelanggan dapat menggunakan kartu yang berisi sejumlah nilai uang, yang bisa digunakan untuk melakukan transaksi pada merchant-merchant yang telah bekerja sama dengan Telkomsel. Secara online, layanan ini dapat dinikmati melalui USSD, SMS. Salah satu keuntungan praktis lain dari layanan ini adalah, bahwa pelanggan tidak perlu membawa uang tunai untuk melakukan pembelian. Pelanggan T-Cash dibedakan menjadi dua berdasar pencatatan database layanan yang diterima, yaitu full service, data pelanggan telah tercatat sebagai pelanggan Telkomsel, di kartuHALO, simPATI (simPATI Zone) dan As (GenASik). Maka pelanggan akan memiliki akun full service, dimana pelanggan dapat menikmati seluruh layanan T-Cash. Layanan yang dapat digunakan adalah cash in, cek saldo terakhir, purchase (pembelian), check lima transaksi terakhir, ganti PIN,

reset PIN, top up pulsa, unregister. Basic service, pelanggan datanya tidak atau belum sesuai dengan database yang ada di Telkomsel. Layanan yang diterima hampir sama dengan pelanggan full service, kecuali ganti PIN, reset PIN, top up pulsa, unregister. Untuk bisa memanfaatkan fasilitas ini, pelanggan perlu registrasi via SMS, dengan cara sbb : Ketik SMS : Reg<spasi>TCash<spasi><nama >#<TanggalLahir(ddmmyyyy)>#<Nama Ibu Kandung> lalu kirim ke 2828 Contoh : REG TCASH ALIF#27051983#Halimah Setelah itu Sistem akan membuat akun Telkomsel Cash untuk pelanggan, berdasarkan atas data valid pelanggan yang sudah tercatat di Telkomsel. Apabila data pelanggan telah tercatat sebagai pelanggan Telkomsel, baik di kartu HALO, simPATI (simPATI Zone) dan As (GenASik), maka pelanggan akan memiliki akun full service, dimana pelanggan dapat menikmati seluruh layanan TCash. Namun bagi pelanggan yang datanya tidak sesuai dengan

data di Telkomsel, maka pelanggan akan memiliki akun basic service. Fasilitas yang bisa pelanggan nikmati dengan menjadi pengguna Telkomsel Cash antara lain : Cash-in (penukaran uang tunai menjadi uang elektronik) Apabila pelanggan ingin memasukkan sejumlah uang ke akun Telkomsel Cash (Cash-In)nya, pelanggan bisa melakukan di merchant yang telah ditunjuk oleh Telkomsel. Check balance (cek status sisa saldo)Pelanggan bisa melihat berapa saldo terakhir yang tersisa dalam akun Telkomsel Cash pelanggan dengan cara sebagai berikut : Dial *885*Pin # atau SMS Ketik SAL<spasi><PIN> lalu kirim ke 2828 Untuk pembelian / purchasing pelanggan bisa melakukan pembelian pada merchantmerchant yang telah menjalin kerjasama dengan Telkomsel. Saudara cukup memberitahukan menunjukan MSISDNnya kepada penjual (kasir) untuk memulai proses pembelian. Raya Customer Service Telkomsel


crime story


ribun Lampung



Dua Oknum Polisi Jadi Tersangka  BANDAR LAMPUNG, TRIBUN - Poltabes Bandar Lampung menetapkan dua anggotanya sebagai tersangka terkait kaburnya tahanan dari sel Poltabes pada Minggu (9/8) lalu. Keduanya masing-masing berinisial Rn dan Rz. Ditetapkannya kedua oknum anggota polisi sebagai tersangka, setelah Satuan Reserse dan Kriminal melakukan pemeriksaan terhadap keduanya sejak Jumat (14/8). Selain Rn dan Rz, Sat Reskrim juga memeriksa dua anggota lainnya, yaitu Sg dan Rm. “Dari pemeriksaan terhadap empat anggota, dua orang sudah memenuhi unsur pidana dan siap diajukan ke proses

Kasus Tahanan Kabur di Poltabes

sidang peradilan umum,” kata Kasat Reskrim Kompol Ardian Indra Nurinta, saat ditemui di Poltabes Bandar Lampung, Senin (17/8). Dua anggota yang sudah ditetapkan sebagai tersangka, dikenakan pasal 426 KUHP dan terancam pidana penjara paling lama empat tahun. Untuk Sg dan Rm, sampai saat ini statusnya masih sebagai saksi. Namun, kata Ardian, tidak menutup kemungkinan status keduanya naik menjadi tersangka. “Tergantung hasil pemeriksaan nanti,” katanya. Seperti diketahui, Al Kodri, tahanan Poltabes kabur dari

sel. Al Kodri adalah tahanan titipan dari Polsek Kemiling yang dititipkan ke Poltabes. Kaburnya Al Kodri ini awalnya diduga melibatkan empat orang anggota polisi. Tiga orang adalah anggota yang sedang jaga tahanan sedangkan satu anggota dari Sentra Pelayanan Kepolisian (SPK). Menurut keterangan Kepala Unit P3D AKP M Yamin, Al Kodri meminta kepada seorang anggota untuk mengeluarkannya sebentar dari sel guna menjenguk orangtuanya yang sakit di Jagabaya. Merasa kasihan, anggota pun mengeluarkannya dengan dijanjikan sebuah ponsel.

Keempat anggota ini telah menjalani pemeriksaan di Unit Pelayanan Pengaduan Penegakan Disiplin (P3D). Kapoltabes Bandar Lampung Kombes Syauqie Ahmad mengatakan, tidak menutup kemungkinan keempat anggota ini akan dikenakan sanksi pemberhentian tidak dengan hormat (PTDH). Sat Reskrim Poltabes juga sudah melakukan perburuan terhadap Al Kodri di tiga lokasi, namun belum menemukan titik terang keberadaan warga Pulau Panggung, Tanggamus ini. Tiga lokasi yang sudah disisir Poltabes adalah Pulau Panggung Tanggamus, Talangpadang, dan Hajimena.(kos)

Polisi Baku Tembak dengan Pencuri Sepeda Motor BANDAR LAMPUNG, TRIBUN - Tim buru sergap (buser) Poltabes Bandar Lampung menembak tiga pencuri sepeda motor, Sabtu (15/ 8) pukul 23.00 WIB. Abdul Rahman (20) dan Ali Husein (21) berhasil dilumpuhkan, sedangkan HM lolos dari sergapan. Sebelum polisi melesatkan tembakan ke arah para pelaku yang kabur mengendarai dua sepeda motor, HM sempat meletuskan dua tembakan ke arah polisi, tapi tidak mengenai sasaran. Lalu polisi membalas tembakan HM. Alhasil, Abdul Rahman dan Ali Husein yang berboncengan mengendarai sepeda motor curian, roboh tertembus puluru polisi. Dua timah panas bersarang di tubuh Abdul. Dan lima peluru bersarang di tubuh Ali. Peristiwa baku tembak itu berawal dari pencurian sepeda motor di PKOR Way Halim, Bandar Lampung. Polisi mendapat laporan kehilangan dari Sukri (22). Ketika hendak pulang sehabis menonton Pameran Pembangunan, warga Sepang Jaya, Way Halim ini tidak mendapati lagi sepeda motornya di parkiran. Mendapat laporan Sukri, polisi langsung berkoordinasi. Dari hasil penyelidikan singkat, polisi mendapat informasi adanya tiga pengendara sepeda motor yang mencurigakan sedang melaju di daerah Pulau Legundi, Sukarame. Satu orang mengendarai sepeda motor sendirian, dan dua lainnya

berboncengan. Tim buser yang berhasil mengejar para pelaku, mendapat sambutan panas berupa dua tembakan yang diletuskan HM yang berhasil kabur. Polisi akhirnya hanya dapat meringkus dua tersangka, Abdul dan Ali. Akibat luka tembak, Abdul dan Ali dirujuk ke Rumah Sakit Umum Daerah Abdoel Moeloek (RSUDAM) dengan kawalan ketat polisi. Menurut Kapoltabes Kombes Syauqie Ahmad, dua tersangka terpaksa ditembak karena mencoba melawan. Meski sudah diberi tembakan peringatan, pelaku tetap melarikan diri dan meletuskan tembakan ke arah polisi. Syauqie mengungkapkan, sebelum membawa lari sepeda

motor milik Sukri, pelaku sempat merusak sepeda motor yang diparkir di sebelah sepeda motor korban. “Sepeda motor tersebut telah rusak di bagian lubang kunci stang akibat dibuka paksa,” ujar Syauqie, Senin (17/8). Menanggapi maraknya kasus pencurian kendaraan bermotor di Bandar Lampung, Syauqie mengungkapkan, banyaknya warga yang bersedia membeli sepeda motor tanpa suarat-surat menjadi salah satu penyebab kasus pencurian sepeda motor sulit diberantas. Karena itu, ia mengimbau pada masyarakat agar tidak membeli kendaraan yang ditawarkan dengan harga murah, namun tidak memiliki surat-surat kendaraan yang lengkap.(her)

Dua Tersangka Dijaga Ketat EMP AT belas anggota Unit Tangkal Satuan Samapta Poltabes EMPA nampak di depan Ruang Gelatik, Rumah Sakit Umum Abdoel Moeloek Bandar Lampung pada Senin (17/8) kemarin. Mereka berjaga untuk memastikan kedua tersangka mendapat perlakuan yang layak. Penambahan jumlah polisi ini sangat kontras dengan keadaan hari pertama saat Ali Husin (21) dan Abdur rahman (20) dirawat pada Minggu (16/8) kemarin lusa. Kedua pencuri motor yang mengalami luka tembak di beberapa bagian ini hanya dijaga seorang anggota polisi berpakaian sipil. Kondisi Ali Husin (21) dan Abdul Rahman (20) semakin membaik setelah dua hari menjalani perawatan di Ruang Gelatik. Dua warga Serikat Pemukiman (SP) Empat ini, mengalami luka tembak setelah berhasil mencuri motor milik Syukri di PKOR Way Halim Bandar Lampung. Sedang peristiwanya sendiri terjadi pada Sabtu (15/8) lalu menjelang tengah malam usai penutupan Pameran Promosi Pembangunan Provinsi Lampung. Senin (17/8) keduanya masih berada di Ruang Gelatik dengan tangan terikat pada sisi ranjang. Selain luka tembak, kaki mereka berdua patah dan terbalut kain perban. Saat ini keduanya sudah bisa makan secara normal. (jok)


REMISI - Gubernur Lampung Sjachroedin ZP melihat cinderamata yang diberikan oleh warga binaan Lapas Rajabasa disela-sela remisi di Aula Lapas Rajabasa, Senin (17/8).

Sjachroedin ZP Berikan Remisi 683 Napi BANDAR LAMPUNG, TRIBUN - Gubernur Lampung Sjachroedin ZP memberikan remisi kepada 683 narapidana (napi) di Lembaga Pemasyarakatan (Lapas) kelas I Rajabasa, Senin (17/8). Remisi tersebut diberikan untuk menyambut HUT RI ke-64. Dari 683 napi, 633 orang mendapatkan remisi umum satu (RU)I atau pengurangan sebagian masa pidana. Sedangkan 50 orang menerima remisi umum dua (RU) II alias langsung bebas. 48 dari 50 napi itu, sebelumnya menjalani hukuman pidana umum, sedangkan dua orang sisanya menjalani pidana khusus. 50 napi yang menerima RU I itu terdiri dari 42 orang yang langsung bebas, satu orang meninggal dunia, tiga orang bebas karena cuti bersyarat, serta empat orang karena menjalani hukuman subsider. Menurut Sjachroedin, 50 napi yang langsung bebas tersebut telah dibina agar bisa kembali ke masyarakat. “Mereka telah dilatih seperti membuat batik dan bermusik. Kita memang harus memikirkan bagaimana membina mereka agar siap kembali ke masyarakat. Mereka warga Lampung juga, dan berhak hidup normal. Semoga masyarakat

bisa menerima mereka,” ujarnya. Suhaili, salah seorang napi yang mendapat remisi dan langsung bebas, mengaku senang bisa kembali menghirup udara bebas. Ia dipidana satu tahun karena membacok seseorang dalam sebuah perkelahian. “Saya ingin bisa kerja lagi dan berkumpul bersama keluarga. Dulu saya kerja di sebuah perusahaan otobus. Selama dipenjara,

saya dianggap berkelakuan baik sehingga bisa dibebaskan hari ini,” kata warga Kecamatan Rajabasa. Lampung memiliki tujuh lapas dan Lima Rumah Tahanan (Rutan). Ada 2.975 napi dan 1.730 tahanan yang menghuni ke-12 tempat pembinaan orang-orang yang bermasalah hukum tersebut. Secara keseluruhan, pada HUT RI tahun ini, terdapat 2.450 napi yang

mendapat remisi. 2.265 orang diantaranya mendapat RU I, dan 185 orang mendapatkan RU II. Di Bandar Lampung, terdadat tiga lapas dan satu rutan, dengan jumlah napi sebanyak 1.344, dan 725 orang tahanan. Khusus di hari kemerdekaan ini, 1.154 orang mendapatkan remisi. 1082 orang diantaranya menerima RU I, sedangkan 72 orang mendapatkan RU II. (pen)

Kelebihan Capai 62,80 Persen TUJUH Lembaga Pemasyarakatan (Lapas) dan Lima Rumah Tahanan (Rutan) di Lampung mengalami over capacity alias kelebihan penghuni.Kelebihan narapidana (napi) dan tahanan itu mencapai 62,80 persen. Kepala Kantor Wilayah (Kanwil) Departemen Hukum dan Hak Asasi Manusia (HAM) Lampung, I Gede Widhiarta, menyampaikan hal tersebut, Senin (17/8). Menurutnya, masalah over capacity bukan hanya problem yang dialami di Lampung saja, namun juga hampir di seluruh provinsi di Indonesia. “Di Lapas Rajabasa, kapasitasnya hanya bisa menampung 620 napi, tapi sekarang ada 870 napi di sini.

Itu artinya ada kelebihan daya tampung sekitar 30 persen. Secara keseluruhan, lapas dan rutan di Lampung mengalami over capacity sebesar 62,80 persen,” ujarnya Kelebihan penghuni paling besar, kata Widhiarta, terdapat di Rutan Way Huwi dan Lapas Rajabasa. Beberapa tindakan telah dilakukan untuk mengatasi masalah tersebut. Antara lain melakukan mutasi atau pemindahan napi dan tahanan dari satu lapas/rutan, ke lapas/rutan yang lain. “Secara bertahap, kami juga telah memindahkan napi dan tahanan wanita dari Lapas Kelas I ke Lapas Kelas II. Kami juga sudah memutasi beberapa napi dan tahanan ke daerah

lain di Jawa, seperti ke Lapas Nusakambangan,” jelasnya. Solusi lain untuk mengatasi kelebihan penghuni, Kanwil Depkumham Lampung juga akan memberdayakan para napi untuk bekerja sosial. Napi yang akan dimanfaatkan untuk kerja sosial tersebut adalah napi yang menjalani pidana ringan dan berkelakuan baik. Pada 2010 juga akan dibangun lapas untuk anakanak dan lapas terbuka. Lapas terbuka diperuntukkan bagi para napi yang akan segera bebas. Lapas tersebut akan dibangun di Tegineneng, Lampung Selatan dengan lahan seluas sekitar lima hektar. pen) (pen)

Dana Pemulangan Korban Ditanggung Damar


BARANG BUKTI - Polisi mengamankan satu sepada motor merek Honda Supra. Dua tersangka Berhasil berhasil dibekuk polisi, sementara satu orang berhasil lolos

BANDAR LAMPUNG,TRIBUN-Kasus penipuan berkedok Penyalur Jasa Tenaga Kerja (PJTKI) di Lampung kian marak. Kasus penipuan tersebut tidak hanya terjadi pada lembaga PJTKI yang ilegal, tapi banyak juga terjadi pada lembaga PJTKI yang legal secara hukum. “PJTKI yang legal saja banyak penipuan, apalagi yang ilegal”, ujar Lela. Ia menambahkan dalam rentang waktu Januari hingga


Agustus 2009 sudah tercatat sepuluh kasus perdagangan perempuan (trafficking), melalui jasa PJTKI Lampung ke beberapa wilayah di dalam maupun luar negeri.Demikian disampaikan Direktur Lembaga Advokasi Perempuan Damar, Siti Nurlaela SH, belum lama ini. Menurutnya dari sepuluh kasus trafficking, baru empat kasus yangtelah selesai ditangani.

Rinciannya, tiga orang mahasiswi PTS di Bandar Lampung yang di pulangkan dari Batam dan satu orang warga Bandar Lampung dari Pekan Baru Riau. Para korban, kini sudah dipulangkan ke daerah asal. Sementara enam kasus lainnya tengah dalam proses pemulangan. Lela menyesalkan sikap pemerintah daerah yang kurang perhatian dalam mengurus kepulangan

para korban. Menurutnya proses pemulangan korban dari wilayah asal membutuhkan dana yang besar. “Saat ini dana pemulangan korban masih ditanggung oleh Damar. Harusnya pemerintah punya alokasi dana pemulangan bagi para korban”, ujar Lela. Dosen Sosiologi FISIP Unila, Dra Mulyaningsih Msi mengatakan, maraknya kasus trafficking di Lampung tidak terlepas dari kurang seriusnya pemerintah daerah dalam menangani hal tersebut. Menurutnya, belum ada upaya prefentif dari pemerintah untuk mencegah terjadinya kasus trafficking. Pemerintah baru menangani setelah kasus ini terjadi. Selain faktor kemiskinan, kata Handi, kasus trafficking juga turut didorong oleh tingkat pendidikan yang rendah dan minimnya akses informasi masyarakat tentang pekerjaan yang legal. Handi juga menyinggung kinerja Dinas Tenaga Kerja Provinsi Lampung, yang lemah dalam memonitor dan mendata perusahaan PJTKI di Lampung. Hal tersebut kemudianberimbaspadamaraknyaPJTKI illegal yang beroprasi di wilayah Lampung. “Keberadaan PJTKI itu harus diketahui dan terpantau oleh pemerintah”, ujar Handi. Handi menambahkan, kini Indonesia sudah memiliki undangundang tentang penanganan kasus trafficking, namun belum serius dijalankan pemerintah.(*/tar)



pringsewu region


Tribun Lampung

Masdulhaq Perkenalkan Logo Pemkab Baru  Peringatan HUT RI ke 64

HUT RI Pj Bupati Masdulhaq memimpin Upacara HUT RI di lapangan Kuncup, Pringsewu, Senin (17/ 8).


Pedagang Keluhkan Penimbunan Sampah  Pasar Gadingrejo GADINGREJO, TRIBUN - Pedagang Pasar Inpres Gadingrejo mengeluhkan penumpukan sampah yang berada di sekitar kawasan pasar dan belum terangkut petugas kebersihan. Selain menyebabkan bau tak sedap, tumpukan sampah juga sedikit mengganggu kendaraan yang lalu lalang. Ibu warti (30), pedagang pasar, mengeluhkan bau sampah yang berasal dari tempat penampungan dan letaknya persis di samping lapak dagangannya. Apalagi, menurut warga Gadingrejo ini, dalam beberapa hari terakhir,


akibat turunnya hujan telah mengakibatkan sampah mengeluarkan bau menyengat.”Baunya sangat mengusik pedagang dan pembeli karena sampah dibiarkan menumpuk di pinggir jalan tanpa tempat penampungan khusus,” ujarnya, Senin (17/8). Hariadi (35), pedagang lainnya juga mengatakan, penumpukan sampah telah membuat lalu lalang kendaraan terganggu. Pasalnya, menurut Hariadi, jalan yang dilalui kendaraan sekitar pasar menjadi sempit akibat tumpukan sampah tersebut.


ALAT-ALAT ALAT-ALAT PESTA ZAM-ZAM TARUB Mnyewakn Tenda Dekorasi,Pgung,Kubah & Kursi Hub Dr.H.Melli Hermawan081272729200-9769997 00001490B

ALAT MUSIK NATA MUSIC Shop.Serba Mrh! Band Equipment:Olp,Spears,Ibanez,Korg PA50,Rockwell,Silvercrest,Maxamps,Twister,Soundsystem:Poweramply,Mixer,Speaker,Soundprocesor,Karaoke System,Mic,Wireless Dll.DISC 10-30%Tlp(0721)268681/7586058 00001062B

JualKey KORG PA-50 500,Ymh S900,450,GtrIbnz,Fender,Cort,Olp,Musicman, Pkt Stdio,Sound System,PwrAbsolute,Crown,ME,A&Q,Bringer,Soundcraft hny d GM MUSIK Jl.GajahMada 69 Tlp:0721-269407,9912610,081310415106 00001294B

SCAFFOLDING SCAFFOLDING, Rental Scaffolding:Main / Ladder Frame, Utk Head, Jbase,Catwalk, Roda Hub:482950/7140828 00001433B

ALAT BANGUNAN Mnyediakn Kayu Bngunan,Brmcm jns& smua ukrn,hrg mrh/nego.Jl.EndoSuratmin Gg.Bintara II No.52(7509121/0812721871/08154066121) 00001305B

SPARE PART DANIL TEKNIK Jual mcm2 alat SukuCdg Pendingin(AC rmh/mbl) Jl.CutMutia No.2 Hub:484017/7597720 00001299B


PsgBr/Scnd/Prwtn/Srvc smua jns Mbl Erpa/Jpg dll.Mrh&Bgrsi,isi freon 65rb.SpclPrize u Rntl Mbl.Sdia gnti oli&aksris.Hb:TRI DELTA SERVICE AC MOBILJl.P.Antsri129(smpgBCA)7455566 00001431B

ELEKTRONIK FAMILY ELEKTRONIK Mnyediakan RIQ &HT.Hub:0721-780153/08127914542 00001396B

KOMPUTER 88COMP Spcialist Pnjualn Printer&Pmsngan Tnta Infus Bgrnsi Jl Ikan Gurame Dpn Tk Kancil 7364168 00001104B

P4 1,6+mon 15"950rb,P3+mon 15" 675rb,trm srvice Komp Pgl 9760503 00001340B

ZAM-ZAM COM,P3+MON 15"=625,P4+MON 15"=1.050 HDD10/30/40=85/140/ 185 Hb:3537219 00001468B

HEWAN PELIHARAAN Djual 2ekr anjingdoberman btna 5bln&jntn2th.Spkwn brsrtfkt/brstmbum. Medi 3543330


“Tumpukan sampah hampir menutupi medan jalan sekitar pasar. Kendaraan jadi susah lewat, apalagi kalau situasi pasar ramai,” katanya. Padahal, lanjut Hariadi, para pedagang di pasar itu kerap dimintai retribusi sebesar Rp 1.000 oleh petugas Kantor Pasar Inpres Gadingrejo. “Alasan mereka retribusi dipergunakan untuk operasional mengangkut sampah dari pasar ke tempat pembuangan sampah (TPS),” ujarnya. Hariadi menginginkan sampah dapat secepatnya diangkut ke TPS dan tidak menumpuk.(end)

Srvice P.Steering Hb.AWING MOTORJl.ZA pagar Alam No.46 sbrrg Darma Bangsa 9766217-0852769566067 00001261B

CV.MAJU JAYA TEKNIK Mjl AC bbgaimerk(br/skn)srvce cpt bgrnsi,trmcci,steam AC rmh/ktr 472834/7333700


JASA FINANCE Bth Dana Cpt Hub:Endang Nurhadi Tlp:0721-9973083 / 081272320010 00001464B

Bth Dana Tunai dgn Bunga Murah &Prss cpt.Mau kredit Mtr kwn/siapapun Hub:07217511395(Yaya ADIRA) 00001501B

BIRO JASA AGUNG LESTARI:Kendaraan BBN,Bar STNK, Mutasi Kendaraa, KIR, Izin Usaha, SIM,Tlp 268181 00001108B

BR JS/PRVT Stir WIDI MANDIRI antrjmpt,grts. Bhdh urs STNK SeIndonesia,KIR, SIM, PASPOR, SIUP 782999/ 7477333 00001344B

GAJAHMADA, BIRO JASA- Stir MobilMontir Spd Motor,Urus SIM,STNK,BBNBaru,Mutasi,KIR,SITU-SIUPdll.Extra murah,aman,terpercaya.Jl.Diponegoro No.118 T.Betung B.LPG Tlp.0721485943 Tlp/SMS 07217533737 00001499B


INTERIOR SABILA CARPET’S sdia crpet TURKIBELGIA & CRYSTAL(asli) Jl. AR Hakim(Dpn RM Kayu)W.Halim 0721-7544942 00001349B

LAUNDRY Q-LOAN Laundry:Dbuka ksmptn u jd Agen,keuntungn bsr,tdk rpt,plynnprma.Trm cci siap antr jmpt.Grtsbila tdk tpt wkt.7311112/7585665 00001455B

PERCETAKAN Prctkn CV AL-IMAN ctk undgn,krtunm,nota,spnduk,kaossklh,prtai,sovnr,sblon,pena glas,Id card,kntng plstk tlp.262327/085279206538 00001135B

Prctkn Jastra:Trma ctk undangan Jl.Dewi Sartika No.15 BDL.Tlp.0721481522/081369691100/9955600

SEDOT WC Sedot WC penuh,pipa2&wastafel mampet tanpa bongkar Hub:7400060


RENOVASI BTH Renovasi Rumah,Gdg,Ktr,&Bgn Baru Cat,Lstrk 08153808588/7370345




KACA PATRI ASRI GLASS Trm Psnn Kc Patri,Kc Inlay, Gravir,Jasa BVL,Bhn Kaca Patri Hub 07217568868 00001507B

KURSUS MEKANIK MOTOR GAJAH MADA Kursus Mekanik Spd Motor 1motor 1Siswa Belajar Sampai Bisa Smua Merk Mtr2Tak 4Tak Manual&Matic Trbru Utk Smua Usia&Pendidikn,Bisa Cept Krja/Usaha Jl Diponegoro No118 T.Betung B.LmpgTlp0721485943,Tlp& Sms 07217533737 00001496B

HIPNOTIS 5 Menit Menguasai Hipnotis seperti di TV.SMS Centre 08117201600


TERAPI Trpi sgl mcm skt JW/MDS:Stres trauma, Dpresi cms,Glsh,Tkt,EmosianPanik, Latah,Krg PD,Slt tdr,Problem Sek Homo/LSB,Mandul,Mual/NgdmLiver,Gnjl,Mgren,Vrtigo,Asma Maag,Alrgi,Drh Tggi, Jntg, Stroke,Kngkr,Tmr,Kista,Gula, Kmplks.WIDI 7477333/08154030006 00001355B

HERBAL Herbal Plus Teknologi Nano Mengobati Brbagai Pnykit 081379345345 00001384B

TEKHNISI Mau Jadi Tekhnisi HP Handal JagoUkur,Jumper,Analisa,Flash,Semua Type HP & HP Cina.Hub SEMOGA JAYA 0816406788,07219991999,7399333Perum Pesona Indah Sejahtera Blok A No1 Sukarame Grs Pasti Bisa!



kegembiraannya atas pelaksanaan upacara tersebut. Ia bersyukur dengan pencapaian dan kemajuan yang telah dicapai bangsa Indonesia saat ini. (ded)

Harga Kebutuhan Pokok Merangkak Naik  Jelang Ramadan



AIR MINUM Terima Pesanan Air Minum Tangki dgn Bermacam Ukuran dari Sumber Mata Air,Harga Damai/Bersahabat Tlp.07217629188/7444393


RUMAH DIJUAL Bangunan Baru LT/LB= 404/215,3KT3KM(FULLKRMK),2DPR,GRSI 2 MBL,d P.Panggung Way Knds.Nego Hub: 0721705124/087899473707





OBAT AIR BIO ENERGI Trpi U Smua PnyktD’FNet Dpn Chndra Wy Hlm 085269628254



sewu, tokoh masyarakat, dan para veteran perang yang berdomisili di Pringsewu. Cipto (82), veteran perang kemerdekaan, mengungkapkan

Gadingrejo, Minggu (17/8), kenaikan beberapa harga kebutuhan pokok sudah berlangsung sekitar sepekan terakhir. “Mungkin karena akan masuk bulan suci Ramadan, harganya kemudian dipermainkan distributor,” katanya. Untuk mengatasi persoalan ini, Hermanto dan pedagang lainnya meminta Pemkab Pringsewu dapat melakukan pemantauan harga sembako. Tujuannya, menurut Hermanto, kenaikan harga di tingkat distributor dapat ditekan.”Sampai sekarang dinas terkait belum turun ke pasar-pasar untuk memantau dan menekan harga sembako menjelang bulan puasa,” imbuh Hermanto. (end)

GIGI PALSU DUNIA DENTAL Jual Peralatan & Bahan Gigi Harga Jkt Hub 0721 771952,7303145,9913510


Upacara peringatan HUT RI kali ini dimulai tepat pada pukul 09.30 WIB, dan berlangsung sekitar satu jam. Hadir dalam upacara itu, jajaran Muspida Kabupaten Pring-

dalam keadaan tergantung. Anto (10), peserta lomba, mengatakan, ia dan kelompoknya sangat senang mengikuti lomba ini meski tubuh mereka dipenuhi lumpur. “Sulit untuk bisa mencapai puncak karena licin,” ujarnya. Lomba ini merupakan lomba yang mengandalkan strategi dan kerjasama kelompok. Peserta yang memiliki tubuh besar dan kuat akan menggendong temannya yang lebih ringan untuk dapat memanjat untuk menuju puncak. Tak jarang, ketika sudah hampir mencapai puncak, para peserta kembali berjatuhan ke lumpur yang memang sudah disediakan di (ded) sekitar arena lomba.(ded)

harga cabe merah masih berkisar pada angka Rp 8 ribu perkilogram. Selain cabe merah, gula putih didapati naik dari Rp 8 ribu per kilogram pada pekan lalu menjadi Rp 8.600. Harga kebutuhan pokok lainnya justru tidak mengalami kenaikan.Bawang merah tetap berada pada tataran harga Rp 10 ribu per kilogram. Selanjutnya, harga kentang juga tetap diangka Rp 6.500 per kilogram, sedangkan harga wortel super juga tetap aman di angka Rp 5 ribu per kilogram, dan cabe rawit juga tetap stabil pada angka Rp 12 ribu per kilogram. Menurut Hermanto (50), pedagang sembako Pasar Inpres

Jual & srvice Komp&Printer,isi ulgtnta&toner, Cartridge bks merk Canon&HP.Jl.P.Antasri142 Hb:780838


Dimeriahkan Panjat Batang Pohon Pisang PERINGA TAN HUT RI ke 64 tahun ini di PERINGAT Pringsewu terasa semakin meriah dengan diadakannya berbagai perlombaan. Salah satunya ialah lomba panjat batang pohon pisang yang digantung dan diadakan RT 09 di lapangan Kuncup, Pringsewu, Senin (17/8). Lomba ini mirip dengan lomba panjat pinang. Namun berbeda dengan panjat pinang yang menggunakan sarana pohon kelapa, dalam lomba ini batang pohon pisang yang menjadi sarana memanjat untuk mengambil hadiah yang tergantung di pucuk pohon. Perbedaan lainnya, jika dalam panjat pinang posisi pohon tertancap di dalam tanah, maka dalam lomba ini batang pisang

GADINGREJO, TRIBUN - Harga kebutuhan pokok di Pasar Inpres Gadingrejo relatif stabil sepekan menjelang datangnya bulan suci Ramadan. Kendati relatif stabil, beberapa harga kebutuhan pokok, seperti bawang putih, cabe merah, gula putih, dan minyak goreng kemasan mulai merangkak naik. Harga bawang putih naik dari sebelumnya Rp 3.500 menjadi Rp 12 ribu per kilogram. Kenaikan juga terjadi pada minyak goreng kemasan yang kini berada pada kisaran harga Rp 8.700 per kilogram dari harga sebelumnya, yakni Rp 8 ribu. Sementara, cabe merah mengalami kenaikan menjadi Rp 12 ribu perkilogram. Pada pekan lalu,



Service pggl:W.Heater,AC,kulkas, M.Cuci Hub:Mitra Sentosa 7462827

newsflash ANJAT T PINANG LMP - Guna PANJA menyemarakkan HUT RI ke64, Pengurus Cabang Laskar Merah Putih (LMP) Pesawaran menggelar lomba panjat pinang bagi masyarakat Gedongtataan di halaman Sekretariat LMP, Senin (17/8). Lomba tersebut dibagi dalam dua kategori dan dimulai pukul 13.00 WIB. Markas LMP mulai didatangi warga sekitar yang ingin menyaksikan lomba yang rutin digelar setiap HUT RI tiba. Seperti biasa, dalam lomba panjat pinang itu gemuruh suara tawa penonton terdengar tiap kali tubuh peserta lomba panjat pinang melorot dari pohon pinang yang telah dilumuri oli. Perlombaan tersebut menjadi tontonan yang menarik bagi (end) warga sekitar.(end)

CENTRAL SERVICE Kompor Gas semua merk grnsi 1th.081272167289

SERVICE YOONG MOTOR spesialis baret kaca&cuci lampu mbl Jl.P.Antasari 10/7C± 100m dr Villa Citra 7477123


PRINGSEWU, TRIBUN - Pemerintah Kabupaten Pringsewu menjadikan Upacara HUT RI ke-64 sebagai ajang untuk memperkenalkan logo baru kabupaten tersebut. Pj Bupati Masdulhaq memperkenalkan logo pemkab bertuliskan Jejama Secancanan itu usai upacara dan parade marching band dari beberapa sekolah, baik dari tingkat SD maupun SMA, setelah sebelumnya tertutup dengan kain tirai panjang. Terhitung sejak Senin (17/8) kemarin, Pringsewu resmi memiliki logo yang menjadi identitas kabupaten. Sementara, meski diguyur rintik hujan sejak subuh, Pemkab Pringsewu tetap menggelar Upacara Peringatan HUT RI ke- 64 dengan khidmat di lapangan Kuncup, Pringsewu, Senin (17/ 8). Bertindak selaku inspektur upacara, Pj Bupati Pringsewu, Masdulhaq.

Lu2r Bali,Ear cndl,Sb Sreh/Susu Teh Jati Blnda 7566513/7365561/7489074


SALON SAM Salon rias pengantin lngkp, ctring&alt pesta.Hub:08127904020


ANDRISLN&SPA,llr,Msusu,Mrmph,rtsfcl,ttkwjh,smbgrbt dis 20%,khss SPA7fck hr sls&rb Jl.Kimaja No. 14A1 Hb:7471869 00001157B

PIJAT & LULUR ARMIANA Trm urut slrh bdn.Rflksilu2r,ksleo,pngbtnKjntnn.Hb:Jl R.Dibalau Gg.Damai Ry TjSnng 781346


Jasa Tkg Urut”SEHAT KELUARGA”UtkPjt Tradisional Terkilir Balita Anak Lulur Hub 263752 KM AKN DTG


MOBIL DIJUAL DAIHATSU PAKET KREDIT DAIHATSU BARU 2009 BUNGA 3,5% LEBARAN Akn Tiba Buruan Ambil Mbl: Xenia LI Dp18jtan Ang3,4jtan 4thTerios Dp 22jt ang 4,2jtan 4 th PU GranMax Dp9jtan Ang 2,5jt 4th Dalam & Luar Kota Proses Cepat Hub:Simon0721-7343981,081272194536 00001226B

PAKET LEBARAN BUNGA RINGAN .....Xenia DP 16 Jt-an...... .....Terios DP 22 Jt-an..... .....Luxio DP 14 Jt-an...... .....Pick Up DP 8 Jt-an..... Berminat Hub : Sdr Rudian Tlp : 0721-7407702/0812-7914672


MITSUBISHI GRANDIA’02 DISEL 2,5.Mrhcrem,LkpSound Systm.Hb:0811795198 - 7444447


RENTAL MOBIL MOBIL RENTAL:Avanza,Xenia,dll.Hrga 50rb -250rb Hb:Flexi 0721-9808018


ALFAN RENTCAR:Avanza,Kjng,Innova Xenia,Sedan.Hb:7525657/081369705657 00001415B

********OONK RENTAL CAR********* Sewakn Mbl Innv,Avnza,Xenia,Kuda7471813/0811799813


**RAJA MOBIL** AVANZA, XEN, APV, KDA, PU 150-300.Murah 125-250;7344447-267713 00001486B

JUAL BELI JUAL BELI MOTOR Anda Butuh Sepeda Motor Yamaha All New Hub Andika Tlp 7341348/087899904909 Cash dan kredit 00000359B

RAFI MOTOR Jual Bli/Tkr Tmbh MtrScond Cash/Krdt Hb7568943/081272445005 00001069B

Dijual Mtr CS1 th08 Merah kndisimulus 13,5jt Ngo.Hb:7499968 Arif 00001369B

Mtr Yamaha, Honda, Suzuki. DP + Angs Rgn proses cepat Hb:7546392 Toni


Dijual Rmh LT308 LB140,3KT,2KM, Bngnan br.Parkir Ls Jl.P.Singkep57 Skbmi.Hb:7467788/081272434888


BAHAN BANGUNAN TOKO NATUNA Jual:PAKU Seri 3/4 s/ d 6" Ember Cor SM 89 TC14 - TC18 Kar pet Talang 55CM - 90CM TLP:0721 - 471766 00001548B

TANAH DIJUAL Tnh djual Jl.Proklamator smping barata BJaya Ls730m² ,lksi strtgs(dpn Bank BCA&panin) ngo 7316529 00001130B

Lahan djual mrh cck u sawit,karet.LS800Ha min pmblian20Ha.Harga 10jt/ Ha.Lkasi Dumai 081264784448 00001188B

Dijual tnh 800m² Jl.Kelapa blkg Perum Way Halim Indah.Prospek bagus nego.Hub:0817173919


Jual tnh Ls1.35HA Lksi SinarLautPnggir Laut ad Gdg&Mes 0811720458




Djual tnh Ls765m² Jl.Ambon Permata Biru & tnh Ls4000m d Blkg GolfHrg Nego. Hub:081541156411/702964

KONVEKSI Konveksi AD JAYA Mnrma Bordir,Konvksi Dn Sablon Jl T Umar Dpn GgSatria Hub 0721 978022

Jual tnh 2950m² Jl.Sukarno HattaSmpg Polsek Kedaton.Ada Mes,RukoGdg.Hb.Rangga 0818273313,Ari 0811725134,Nego!



PAKAIAN ASIA KONVEKSI trm psnn kaos,jkt,bordir, sablon, spnduk dll.Jl.SltnAgung 1 tlp:7423776/081379114611 00001038B

PENGUMUMAN LOWONGAN KERJA Dibutuhkan tehnisi AC Hub:LintasSurya telp.241101/7410054 00001109B

Dcri SPG Shwroom MustikaJati Single SMA/Sdrjt.Atr k Jl.P.Tirtayasa58 Skbmi.Hb:7467788/081272082333 00001482B

Dibutuhkan sgr 1org manager u/ rmh mkn Padang.Pengalaman min.5th,profesional, ulet,jujur,punya jiwa kepemimpinan. Bisa bekerja dgn target hub: 081379296437 00001547B

UNDANGAN Spesial ctk undgn mwh hrg mrh.HbAyana Card 7308923/085279222148 00001202B




YAMAHA Butuh Motor Baru Yamaha Cash/Kredit Hub:081279467778/07217532627

RUKO DIJUAL Dijual cpt Ruko 2 pintu 3 lantaidi Kedaton Hub:0811798424



Rmh siap huni Jl.Madrasah WayhuiLB/ LT150/425m² ,135jt.085269618230



ABADI ALUMINIUM Specialis Kusen Pintu,Jendela,Partisi,Kaca dan Penjualan Bahan Aluminium Jl.P.Antasari 19A.Hb:0721- 253468/0721-7498929


DIJUAL JUAL KAYU JATI LOG± 300m3 HARGA NEGO.HUB:081379044331/0721-7174331


ROHIM Beli TV bekas kondisi bagus/ rusak Hub:07219987805 dijemput


FURNITURE RAFI JAYA specialis kitchen set,mnrima psnan setting room,offce,kmr set,dll. & Mnydiakn aksesoris/HPL:7334948081272166609


MADU Madu Lebah Liar Hutan Sumatra Grosir dan Eceran Hub 081379345345


TAKSI MOBIL / MOTOR ANTR JMPT ABODMN,Sklh,Psr,Krj,Expedisi Hub:Samania7364050/7388820 00001089B

PELUANG USAHA Ingin Bk Usaha:HAPPY CORN-Jagung Manis pkt counter Lkp+B.baku siap jualan 8Jt.SWEET TEA-Es Teh siap saji pkt counter lkp+B.baku siap jualn 4Jt.Untg bsr mdl cpt kmbli Hb.7629200/ 081540021222


Jual tnh 400m Jl.PerintisI Waydadi Korpri jlr2 081541341406 Nego

Invst200rb dpt pls 25rb&vchr blnja25rb.Krjsm Alfa&Indomaret+ksmptn agnpls,phsln tdktbts.Wirabest081272432244

WALLPAPER Tersedia Banyak koleksi & Corak Harga Grosir Hub Citra Jaya Jl. Laks. Malahayati No 26 482435

CANOPY & ALUMUNIUM Maju Makmur:Trm psn Canopystnlisbs pgr, kusen al,foldinggate,kreyJl.P.Morotai69 Hb:7471238/7506855

BAJA RINGAN MULTITRUSS Rngka Atp Baja Ringanbrkualitas kuat,anti krt rgn presisi mdh&ekonomis 7410068/08154020511






ANEKA KUNCI TK.TANJAYA.Kunci,Engsel.Jl.Ikan Hiu(Prapatn Chnda SM)T.Btung481273 00001078B

RUPA-RUPA ATAP ALUMUNIUM Sedia Atap Zincalume BHP,Zincolor,Platshet 0,3-0,7mm Hub: AdamasJl. Kartini 138 Bdl Tlp: 263220 00001050B

ALUMUNIUM KARYA MURNI Jual Alt2 Hordng,RakAL,Roling,Folding,Kusen,Vrtcl Blnd,Canopy,Expnd,etalase,Auning,Dll,Jl.T.Umr Ps Koga no1 Hb782601.Jl.Ry Ntr Dkt Ps Ntr no 42 Hb 92767




RESTOURANT MY BENTO.Jl.Kartini 58B T.Karang(0721)263060-252774.Sdia mkn Jpgspt:Chickatsu;Chicteriyaki;Ekkado;Tempura; Bentowing8500 dll.100%Halal,Hrg Tjngkau;Trm Pesanantar


KIOS PULSA Grosir Pulsa Elektrik GAFANISTELmurah,cepat,amanah.Dicari MasterDealer Hub:072194656/08127277096


SUMATERA UTARA RUPA-RUPA PUPUK Jual pupuk(SUPER)mrh,NPK,SP35,tablet, frmlsi khsus,kwlts Exprt,Test Suci Fin do.ALEX 081264784448




kotabumi region


ribun Lampung



Jalan Kalicinta Mencekam  Empat Rampok Hadang Truk  Rampas Uang Rp 15 Juta

POCO-POCO - Istri Bupati Tulangbawang Abdurrachman Sarbini sedang senam pocopoco bersama para narapidana, Senin (17/8).

KOTABUMI, T RIBUN - Aksi kejahatan kembali terjadi di Jalan Raya Desa Kalicinta, Kecamatan Kotabumi Utara, Lampung Utara (Lampura). Terbukti, Rabu (17/ 8) pukul 09.30 WIB, empat perampok beraksi di daerah itu. Mereka berhasil merampas uang tunai Rp 15 juta milik Rukmana (52), warga Desa Pakuan Baru, Kecamataan Pakuan Ratu, Waykanan. Berdasarkan data yang berhasil dihimpun, kejadian berawal saat Rukmana yang kesehariannya bekerja sebagai pedagang, bersama anaknya Suwanto (25),

hendak belanja ke Bandarjaya, Lampung Tengah. Namun di tengah perjalanan truk BE 9088 WA yang mereka tumpangi diikuti empat pelaku dengan mengendarai mobil. Saat melintas di Jalan Raya Desa Kalicinta, Kecamatan Kotabumi Utara, mobil pelaku tiba-tiba menyalip truk dan menghadangnya. Sontak, sopir truk Suwanto (25), menghentikan kendaraannya. ’’Keempat perampok langsung mendatangi truk yang kami tumpangi. Kemudian menodongkan senjata tajam kepada kami. Di-

bawah ancaman saya terpaksa menyerahkan uang Rp 15 juta yang akan digunakan untuk membeli kebutuhan pokok,” ujar Rukmana. Kapolsek Kotabumi Utara Ipda Edy Arhansyah mewakili Kapolres Lampura AKBP Budi Wibowo membenarkan kejadian tersebut. Setelah mendapat informasi telah terjadi perampokan, pihaknya langsung mendatangi lokasi kejadian. Sementara petugas yang lain melakukan pengejaran terhadap pelaku. ’’Saat ini polisi masih meyelidiki motif perampokan. Diduga, pela-

kunya adalah warga dari Way Kanan dan Kotabumi,” pungkas Kapolsek. Sekadar mengingatkan, sebelumnya Senin (11/8), Sutrisno (49), warga Doro Wati Penagan Ratu, Kecamatan Abung Timur, Kabupaten Lampura dibegal oleh dua orang tidak dikenal di daerah yang sama. Sutrisno yang rencananya hendak berangkat ke Lampung Tengah ini menderita kerugian satu unit motor yang ia kendarai serta uang tunai Rp 1 juta. Sutrisno juga sempat ditodong senjata api oleh pelaku.(bon)

acara pemberian remisi kepada 67 napi di Rutan Menggala, Senin (17/8). Lanjut Benny, operasi tersebut sudah membuahkan hasil. Di antaranya penyitaan miras dari beberapa pedagang, tiga sanjata tajam, termasuk (dik) juga mucikari.(dik)

upacara Proklamasi Kemerdekaan HUT RI di halaman Pemkab setempat. Tanda kehormatan ini diberikan khusus kepada PNS yang dalam menjalankan tugasnya telah menunjukkan kesetiaan, pengabdian, kecakapan, kejujuran, dan kedisiplinan.Dalam penyerahan tanda kehormatan itu juga diberikan piagam yang ditandatangani oleh Presiden (dik) Susilo Bambang Yudhoyono.(dik)

memberikan suasana berbeda pada pelantikan calon anggota dewan terpilih pada Rabu (19/ 8) mendatang. Kegiatan yang dirangkaikan dengan pelepasan anggota dewan periode 2005-2009 ini, Mance —sapaan akrab Abdurrachman Sarbini — selain memberikan piagam penghargaan, juga menghadirkan gajah dari Lampung Timur. ’’Ini untuk menyambut anggota dewan yang baru, juga untuk memberikan penghargaan kepada anggota dewan yang lama,” ujar Mance, Senin (17/ (dik) 8).(dik)



67 Napi Peroleh Remisi MENGGALA, TRIBUN - Sedikitnya 67 narapidana Rutan Bawang Latak, Menggala, Kabupaten Tulangbawang memperoleh remisi, Senin (17/8). Demikian diungkapkan Plh Kepala Rutan Viktor, Senin (17/ 8). ’’Dari 67 narapidana tersebut, 10 orang dapat remisi bebas dan 57 orang dapat potongan masa tahanan dari satu bulan sampai enam bulan,” tukasnya.

Menurut Viktor, pemberian remisi ini mengacu pada Permen Hukum dan Ham RI No: M. 01.PK.04-10 tahun 2007. Secara subtansif persyaratan yang harus dipenuhi narapidana adalah berkelakuan baik selama menjalani masa tahanan. Selain itu, lanjut Viktor, pemberian remisi merupakan Keputusan Presiden RI Nomor 174 tahun 1999 tentang pemberian hak dan penghormatan kepada setiap penghuni Lapas

yang telah berkelakuan baik. Pemberian remisi dilakukan usai pelaksanaan upacara Proklamasi Kemerdekaan HUT RI ke 64 di halaman Pemkab Tulangbawang. Dan secara simbolis remisi diberikan Bupati Abdurrachman Sarbini kepada dua perwakilan narapidana. Acara itu dihadiri oleh Wakil Bupati Agus Mardihartono, Kapolres Tulangbawang AKBP Benny Ali, muspida plus, dan ibu-ibu PKK.(dik)

POLRES AKAN RAZIA PET ASAN PETASAN Polres Tulangbawang akan merazia petasan dan kembang api yang mempunyai daya ledak besar. Ini dilakukan dalam menjaga keamanan dan ketertiban di wilayah Tulangbawang dan dua kabupaten pemekaran, Tulangbawang Barat dan Mesuji menjelang bulan suci Ramadan. ’’Razia petasan merupakan salah satu sasaran dari operasi pekat, selain premanisme, pornografi, pornoaksi, dan penyakit masyarakat lainnya,” kata Kapolres Tulangbawang AKBP Benny Ali usai menghadiri

PEGA WAI DAP AT PENGHARPEGAW DAPA GAAN - Sebanyak 91 pegawai Pemkab Tulangbawang menerima penghargaan Satya Lencana Karya Satya, Senin (17/8). Penghargaan itu diberikan Bupati Abdurrachman Sarbini usai melaksanakan

GAJAH SAMBUT PELANTIKAN DEWAN - Bupati Tulangbawang Abdurrachman Sarbini akan

HUB : (0721) 704777



(Tampak Depan) Rumah dijual Jl. Endo Suratmin No.52 Sukarame Luas tanah 1050 meter, 2 toko, 1 kantor, 1 rumah. Harga 1,2 Milyar Tlp: 0721-9807899

(Tampak Samping) Rumah dijual Jl. Endo Suratmin No.52 Sukarame Luas tanah 1050 meter, 2 toko, 1 kantor, 1 rumah. Harga 1,2 Milyar Tlp: 0721-9807899




Honda Grand Civic LX th'88 BE, hijau, AC,Tape, VR Hrga 36 juta Tlp:0721-9807899 COU001524

JUAL CEPAT RUKO 3 LT, SHM,NEGO. HUB: 087899479148 /9789930




Opel Blazer Dohc Th 2000, B, Abu-abu, kembaliin 38 juta Angsuran 23 x 1.900.000. Tlp: 0812 7214 8543 COU001525

Dijual cepat ruko ukuran 4 x 16 x 2,5 Lt. SHM. Lokasi Jl.ZA Pagar Alam Rajabasa (sebelah pom bensin) strategis. Cocok usaha apa saja, parker luas. Hrga 525 juta. Tlp:0813 7929 6437 / 0811 722 088




Mazda Astina th 1991, Hijau, BE, AC, CD, Bagasi Full Audio VR 16, Gaul. Hrga 40 Juta. Tlp:0812 7206 7899 COU001526

Jual cepat rumah mewah beserta seluruh isinyaJl.Purnawirawan, LB/LT 500 m2 / 2332 m2, SHM. Hrga 1,85 Milyar. Hub:0811 722 088 / 0811 721 728





Dijual cepat ruko uk. 4 x 16 x 2,5 Lt, SHM. Lokasi Jl.ZA Pagar Alam Rajabasa (sebelum pramuka) strategis. Cocok usaha apa saja, parker luas. Hrga 525 juta. Tlp:0813 7929 6437 / 0811 722 088


Isuzu Panther LS 2001, Silver, AC Double, TP, VR, Siap pakai. Hrga 114 juta. Tlp:0812 7214 8543 COU001528






Toyota Kijang LGX 1,8 Th 2003. B, Biru, AC, TP, VR, Full Variasi Hrga 136 juta. Tlp:0721 980 7899


INOVA E th 2005 bln 8, BE, hitam, kayak INOVA G, AC DOBLE. FOGLAM, BAN BESAR. DP=31,7 juta angsuran 3.959.000 x 35 bln. Hub:0813 6938 1117





Suzuki X-ROAT SX 4 2008, Metik, BE, Hitam, AC, TP, VR Hrga 165 juta. Tlp:0812 7206 7899

Mitsubhisi Galant 2003, Silver, BE, AC, TP, VR Hrga 110 juta istimewa. Tlp:0721 980 7899

Honda CRV B 2003, Metik Biru, B, AC, TP, VR 16 Ban baru. Hrga 163 juta. Tlp:0812 7214 8543








kalianda region

Tribun Lampung

Besok DPRD Baru akan Dilantik  SK Gubernur Turun 16 Agustus KALIANDA, TRIBUN - Sebanyak 45 calon anggota legislatif hasil Pileg 2009 dipastikan akan menghuni gedung DPRD Lamsel dan dilantik pada 19 Agustus besok. Hal ini terkait dengan turunnya surat keputusan (SK) pelantikan dari Gubernur Lampung pada 16 Agustus lalu. Sebelumnya pelantikan sempat tidak jelas akibat belum turunnya SK tersebut. Sekretaris DPRD Lamsel, Thoharuddin mengatakan, pelantikan anggota DPRD Lamsel periode 2009-2014 direncanakan akan berlangsung pada 19 Agustus 2009. Penentuan pelantikan itu bertepatan dengan berakhirnya

masa kerja anggota legislatif periode sebelumnya. ”Insya Allah tidak berubah. Pelantikan pun telah siap secara administrasi, termasuk mempersiapkan undangan,” tutur Thoha, Senin (17/8). Namun, meskipun Sekretariat DPRD telah mendapat kepastian pelantikan, caleg terpilih, Azmi Azis dan A Bakri sampai kemarin mengakui belum mendapatkan SK dan undangan dari sekretariat terkait rencana pelantikan tersebut. ”Sampai saat ini kami belum menerima SK pelantikan dan undangan. Kami belum me-

ngetahui mengenai rencana pelantikan dewan pada tanggal tersebut,” ujarnya.(fer)

Kepastian Pelantikan  45 calon anggota legislatif hasil Pileg 2009 di pastikan akan menghuni gedung DPRD Lamsel dan dilantik pada 19 Agustus besok  surat keputusan (SK) pelantikan dari Gubernur Lampung turun pada 16 Agustus lalu  Penentuan pelantikan bertepatan dengan berakhirnya masa kerja anggota legislatif periode sebelumnya  Caleg terpilih, Azmi Azis dan A Bakri sampai kemarin mengakui belum mendapatkan SK dan undangan dari sekretariat terkait rencana pelantikan

Menghindari Kevakuman ANGGOTA KPU Lamsel, Dwi Riyanto mengatakan, sebagai penyelenggara KPU hanya mengantarkan caleg dalam tahapan penetapan caleg terpilih, setelah sebelumnya melalui mekanisme yang telah ditetapkan. Menurutnya, pelantikan anggota dewan merupakan kewenangan gubernur. Namun, sesuai dengan Surat Edaran KPU tentang ketepatan

waktu pelantikan DPRD Lamsel, pelantikan anggota DPRD pada 19 Agustus dinilai wajar karena sesuai dengan waktu pelantikan anggota dewan sebelumnya yang juga bertepatan dengan tanggal 19 Agustus, lima tahun silam. Pelantikan itu, menurut Dwi, dapat menghindari kevakuman DPRD Lamsel. Pasalnya, pada tanggal itu DPRD periode sebelumnya akan berakhir masa jaba-

tannya. “Bila jadwal pelantikannya molor, dikhawatirkan akan terjadi kevakuman,” ujarnya.(fer)

Kewenangan Gubernur  Pelantikan anggota dewan

merupakan kewenangan gubernur  Waktu pelantikan pada 19 Agustus dinilai wajar karena bertepatan dengan berakhirnya masa kerja DPRD periode sebelumnya  Dinilai tepat karena dapat menghindari kevakuman DPRD

Indonesia Fery Dirikan Plang Informasi


TABUR BUNGA - Usai Upacara Peringatan HUT RI, Bupati Lampung Selatan Wendy Melfa berziarah dan melakukan tabur bunga di Taman Makam Pahlawan Kesuma Bangsa, Kalianda, Senin (17/8). Tabur bunga bertujuan untuk menghormati jasa para pahlawan.

Berperan Menentukan Titik Pondasi JSS  Kantor Statistik Pemekaran dari Bappeda

 Atasi Lonjakan Penumpang Angkutan Lebaran KALIANDA, TRIBUN-Guna mematangkan persiapan menghadapi angkutan lebaran di tahun ini, PT Indonesia Ferry cabang Bakauheni dan Polres Lampung Selatan menggelar rapat koordinasi di Kantor PT Indonesia Ferry, Bakauheni, belum lama ini. “Semua dinas dan instansi terkait dilibatkan untuk kelancaran arus mudik dan balik tahun ini,” kata AKBP Kapolres Lamsel, Drs Umar Dani. Rapat berlangsung di Ruang Rapat PT Indonesia Ferry Bakauheni dan diikuti jajaran Polres Lamsel, PT Indonesia Ferry, Gabungan Pengusaha Angkutan Sungai Darat Laut (Gapasdap),

Administrasi Pelayaran (Adpel), TNI, Denpom Bakauheni, Pengurus Truk dan Bus, Dinas Perhubungan Lamsel dan Pesawaran, dan Pramuka. Kepala Cabang PT Indonesia Ferry Bakauheni, Adam Dedi Indrajit mengatakan, bersama beberapa unsur, pihaknya merencanakan mendirikan plang informasi di Jalintim, tepat di Pos Polisi Desa Tamansari, Kecamatan Ketapang dan jalan Trans Sumatra Kalianda. Fungsi plang ini, kata Adam, untuk memberitahukan penumpang yang akan menuju Bakauheni. “Jika kondisi penumpang padat, disarankan penumpang un-

Polres Siapkan 14 Kantung Parkir UNTUK mengatasi kemacetan, Polres Lamsel juga telah mempersiapkan 14 kantung parkir sepanjang Jalinsum dari Kalianda hingga pintu masuk pelabuhan. Kasatlantas Polres Lamsel, Iptu Panjiyoga mengatakan, setiap kantung parkir mampu menampung 1.095 kendaraan. “Kantung parkir ada karena kerjasama dengan rumah makan di sepanjang Jalinsum,” katanya. Dalam Operasi Ketupat Angkutan Lebaran nanti, Polres Lamsel juga akan men-

dirikan 11 pos pengamanan di sepanjang Jalinsum dan Jalintim. “Pos pengamanan ini berada dari pelabuhan Bakauheni hingga perbatasan Lamteng, Lamtim dan Tanggamus,” katanya. Dia menambahkan, pos pengamanan akan didirikan di persimpangan Pasar Bakauheni, Simpang Lima Kecamatan Ketapang, Merak Belantung, Pasir Putih, Bandara Radin Intan dan Tegineneng. “Sifat pos tersebut merupakan pos simpatik,”ujarnya.(tri)

tuk istirahat di kantung-kantung parkir,” ujar Adam. Adam memprediksi, puncak arus mudik dan arus balik penumpang dari Lampung-Jawa, dan sebaliknya akan terjadi pada H-3 dan H+3. Guna mengantisipasinya, pihaknya akan mengoperasikan 33 kapal roro dan empat kapal cepat. Ia juga mengatakan, Indonesia Fery akan mempersiapkan demaga 1, 2, 3, dan 4 tempat bersandarnya kapal dan akan mengoperasikan 24 kapal. “Jika terjadi penumpukan penumpang, Dermaga Plensengan akan difungsikan untuk mengatasi penumpukan,” kata Adam.(tri)

Persiapan Angkutan Lebaran

K ALIANDA , T RIBUN - Struktur Pemerintahan Pemkab Lampung Selatan kini bertambah seiring dengan berdirinya Kantor Statistik dan Penelitian Pengembangan. Kepala Kantor Statistik dan Penelitian Pengembangan, Novandra mengatakan, badan ini merupakan pecahan dari Badan Perencanaan Pembangunan Daerah (Bappeda). “Kami berdiri sejak Januari 2009,” ujarnya belum lama ini. Dia menjelaskan, badan ini memiliki dua peran, yakni sebagai badan statistik daerah dan penelitian dan pengembangan daerah. Cakupan obyek statistik badan ini hanya berada di ruang lingkup lokal, sedangkan untuk penda-

taan yang lebih global akan memakai data dari BPS. “Data kami tidak bisa digunakan untuk dana nasional,” kata Novandra. Menurutnya, peran badan ini berada pada studi awal yang meliputi penelitian dan pengembangan. Ia juga mengatakan, Kantor Statistik dan Penelitian Pengembangan akan menjadi ujung tombak menggantikan peran yang sebelumnya dipegang Bappeda. Ia memberi contoh, rencana pemindahan ibukota Lampung ke Jati Agung bisa dikategorikan menjadi bagian dari program kerja instansi tersebut. “Kami yang akan meneliti kelayakannya, baru kemudian PU

tambahnya. Kades Seleretno, Masdari mengatakan, Pemkab Lamsel seharusnya tanggap atas kebutuhan kades tersebut. Kades, menurut Masdari, merupakan unjung tombak yang langsung berhadapan dengan masyarakat. Arti merdeka itu, kata dia, selain masyarakat sejahtera dan merasa aman, salah satunya adalah dengan menyejahterakan aparat desa. “Jika insentif saja hingga kini belum keluar, bagiamana kami mau bilang merdeka,” ujarnya. Masdari mengatakan, seluruh

 Diikuti jajaran Polres Lamsel, PT Indonesia Ferry, Gabungan Pengusaha Angkutan Sungai Darat Laut (Gapasdap), Administrasi Pelayaran (Adpel), TNI, Denpom Bakauheni, Pengurus Truk dan Bus, Dinas Perhubungan Lamsel dan Pesawaran, dan Pramuka

 Pemkab Gelar Renungan Suci

 Bersama beberapa unsur, Indonesia Fery merencanakan mendirikan plang informasi  Plang berfungsi memberitahukan penumpang yang akan menuju Bakauheni

kades melalui Apdesi sudah mempertanyakan persoalan insentif tersebut kepada Pemkab Lamsel. Saat itu, kata Masdari, pemkab mengaku, tertundanya pencairan insentif akibat defisit anggaran yang dialami pemkab. Namun, menurut dia, pemkab menanggapinya dengan berjanji akan membayar seluruh insentif kades pada awal Agustus. “Nyatanya, hingga kini kami belum terima insentif,” ujarnya. Persoalan pembayaran insentif, kata dia, sudah berulang kali ditanyakan ke pemkab.(fer)


MERIAH -Menyemarakkan HUT RI, warga Kecamatan Sidomulyo mengikuti lomba panjat pinang, Senin

258 Napi Dapat Remisi HUT RI KALIANDA, TRIBUN - Bupati Wendy Melfa beserta Muspida Lamsel mengunjungi Lembaga Pemasyarakatan Kelas IIA Kalianda, Senin (17/8). Dalam kunjungan itu, para rombongan bermaksud memberikan remisi bagi para penghuni lapas. Pada pemberian remisi kali ini, selain memberi remisi pengurangan hukuman pada para napi, Departemen Hukum dan HAM juga memberikan remisi bebas sesuai dengan habisnya waktu penahanan. “Kebetulan yang mendapat remisi berjumlah 258 dan yang dinyatakan bebas 27 napi,” kata Gunarso, Kepala Lapas Kalianda. Sebelumnya, lapas mengajukan 274 untuk mendapatkan remisi. Remisi hanya diberikan bagi napi

yang berstatus tahanan. Adapun penghuni lapas yang masih berstatus titipan tidak mendapatkan remisi. Pada kunjungan Bupati dan Muspida plus kemarin, Gunarso juga mengatakan bahwa Lapas Kalianda saat ini masih mengalami kekurangan perosonel dan ruang tahanan.Personel lapas, kata Gunarso, saat ini sejumlah 57 pegawai. Tugas mereka meliputi pengamanan, pembinaan, dan ketatausahaan. “Untungnya selama ini tidak ada kasus pelarian serta keributan,” katanya. Lapas Kalianda juga kini mengalami over kapasitas. Sejatinya, daya tampung lapas lapas hanya mampu menampung 300 orang. Sedangkan, menurut Gunarso, warga binaan di lapas 534 orang. Dengan perincian, 329 napi ber-

badan ini hanya sebatas memenuhi undangan atau permintaan dari pemkab. “Misalkan pemkab akan membangun pasar, maka pemkab akan mengundang kami untuk mensurvei lokasi yang bakal menjadi pasar,” katanya. Sampai saat ini, Kantor Statistik dan Penelitian Pengembangan memiliki keterbatasan. Novandra mengutarakan, instansinya belum dipenuhi dengan SDM yang mumpuni. “Kami masih menumpang di Dinas Penanaman Modal,” katanya. Ia juga mengimbau pemkab dan BKD agar mampu merekrut tenaga peneliti untuk memegang jabatan tenaga fungsional.(tri)

Pawai Obor Warnai HUT RI

 PT Indonesia Ferry cabang Bakauheni dan Polres Lampung Selatan menggelar rapat koordinasi menghadapi angkutan lebaran tahun ini

Insentif Kades Mandek Enam Bulan SIDOMULYO, TRIBUN - Sejumlah kepala desa di Kecamatan Sidomulyo mengeluhkan molornya pemberian insentif kades sebesar Rp 600 ribu per bulan. Para kades mengaku tidak menerima insentif itu selama enam bulan. “Bagaimana kita mau bilang merdeka, jika insentif kami sebagai perangkat desa hampir enam bulan belum keluar,” sindir Rahmat Witoto, Kades Sidodadi, Senin (17/8). “Kami berharap Pemkab Lamsel dapat segera mencairkan insentif kami yang hampir dua triwulan mandek,”

dan instansi terkait lainnya yang menyusul,” ujarnya. Novandra juga menjelaskan, sejatinya badan yang kini dikomandoinya memiliki peran paling awal dalam menentukan lokasi titik pondasi untuk proyek Jembatan Selat Sunda (JSS). Namun sampai kini, menurut Novandra, badan tersebut belum dilibatkan pada proyek itu karena Kantor Statistik dan Penelitian Pengembangan tergolong instansi yang baru. “Tapi pasti nanti menyusul,” ujarnya. Tugas badan ini, kata dia, nantinya juga akan meneliti potensi suatu daerah dan mendata potensi penduduk di 17 kecamatan. Sifat keterlibatan dari

status tahanan, dan 205 penghuni berstatus titipan dan sedang menjalani proses peradilan. Saat itu juga Wendy yang membacakan pidato dari Mentri Hukum dan HAM, Andi Matalata menghimbau kepada pihak Lapas agar mengajukan kekurangan ruang kepada pemkab. “Nanti kita akan bangun lagi Lapas, Pemkab menyediakan tanahnya, sedangkan Departemen Hukum dan HAM membangun bagunannya. Sehingga tahanannya dapat dibagi dua rutan,” kata Wendy. Bupati Lamsel, Wendy Melfa mengatakan, remisi kepada napi merupakan wujud kepedulian negara . Wendy meminta, para napi dapat meningkatkan pembinaan baik pada diri sendiri dan lingkungan rutan.(tri) cmyk

KALIANDA, TRIBUN - Masyarakat kota Kalianda menyambut perayaan HUT RI ke 64 dengan antusias. Sebelumnya persiapan dilakukan dengan pemasangan umbul umbul dan bendera di tiap rumah dan perkantoran. Dalam menyambut malam perayaan 17 Agustus, Pemkab Lamsel bersama segenap unsur masyarakat tumpah ruah di jalan protokol guna menyaksikan pawai obor yang melibatkan dinas dan pelajar se-Kalianda. Dengan disertai aksi marching band, pawai obor dimulai Minggu (16/8) malam pukul 20.00 WIB dengan menyusuri jalan protokol menuju rumah dinas bupati.berdasarkan pantauan Tribun sekitar lima ribu ma-syarakat berkumpul di tepi jalan untuk menyaksikan pawai tersebut. Kabag Humas Pemkab Lamsel, Darmawan mengatakan, pawai tersebut merupakan bagian dari rangkaian acara yang menjadi agenda rutin pemkab.

“Selain pawai obor, pemkab juga mengadakan upacara pada pukul 24.00 WIB sekaligus renungan malam di Taman Makam Pahlawan Kesuma Bangsa, Kalianda,” ujarnya, Senin (17/8). Dia mengatakan, renungan suci bertujuan memberikan penghormatan kepada para pahlawan yang telah gugur di medan juang. Upacara berlangsung selama 30 menit dan diikuti unsur dan dipimpin Dandim Lamsel, Letnan Kolonel Inf Syarifuddin. Usai upacara malam, keesokan paginya acara berlanjut dengan upacara pengibaran bendera merah putih di Lapangan Raden Intan, Kalianda, yang dilanjutkan dengan tabur bunga di Taman Makam Pahlawan Kesuma Bangsa. Sementara, sebanyak 258 tahanan Lapas Kalianda dalam perayaan 17 Agustus mendapat keringanan hukuman (remisi). Sebanyak 27 napi mendapat remisi bebas pada Senin (17/ 8) kemarin.(fer)


metro region


ribun Lampung



Curi Motor, Siswa SMP Ditangkap BANDAR JAYA, TRIBUN - Hb (14) harus berurusan dengan penegak hukum. Warga Kecubung, Kecamatan Terbanggi Besar, Lampung Tengah, ini ditangkap aparat Polsek Terbanggi Besar, Senin (17/ 8), karena diduga mencuri sepeda motor Yamaha Vega R bersama dua rekannya, yakni J (25) dan R (30). Kapolsek Terbanggi Besar AKP Dennie Andreas Darmawan mengatakan, tersangka Hb ditangkap di Terminal Bandar Jaya, Se-

nin (17/8). Sedangkan dua pelaku lainnya saat ini sedang dalam pengejaran. Menurut pengakuan Hb, mereka mencuri sepeda motor milik karyawan PT Great Giant Pineapple (GGP) tersebut di areal perkebunan nanas Humas Jaya, Terbanggi Besar, Minggu (16/8). “Kemudian motor itu dibawa oleh kawan saya,” ujar pelajar kelas 1 sebuah SMP di Bandar Jaya ini. Hb juga mengatakan, dirinya

ikut mencuri sepeda motor tersebut karena diajak dua tetangganya yang umurnya jauh lebih tua tersebut. “Mereka yang melakukan pencurian dan menjualnya. Sedangkan saya hanya menunggui,” jelasnya. Lebih jauh, Hb juga mengakui sebelumnya sudah pernah mencuri sepeda motor bersama rekannya tersebut, tepatnya sebulan lalu. Ketika itu mereka juga mencuri motor Yamaha Vega R di Per-

umahan BTN Humas Jaya. “Dari hasil pencurian sepeda motor itu, saya mendapat bagian Rp 350 ribu. Uangnya saya habiskan untuk membeli keperluan pribadi, termasuk membeli minuman keras,” ujar dia seraya menyebutkan penyesalannya. Selama ini, kata Hb, ayahnya tidak pernah memberikan nafkah, baik kepadanya maupun keluarganya. “Bapak sudah kawin lagi,” ujarnya polos.(leo)

Pernah Juara Satu Nasional


PARTISIPASI - Paduan suara dari SMA Kristen Metro memeriahkan upacara bendera HUT Ke-64 RI di Stadion Tejosari Kota Metro, Senin (17/8).

Semua Bergembira Sambut Hari Merdeka  dari halaman 9

melunturkan cat yang di tembok. Dalam pembuatan grafiti tersebut, LSA menghabiskan sekitar 20 kaleng cat dan 30 cat semprot. David mengungkapkan, LSA selalu “mengebom” setiap ada hari besar nasional. “Untuk di Lampung masih free (mengebom). Kalau di kota-kota lain mungkin tidak boleh. Lampung mungkin satu-satunya kota di Indonesia,” jelas David. Perayaan berbeda terdapat di RT 03 Lingkungan 6 Kedaton. Enam ibu rumah tangga mengenakan pakaian olahraga lengkap dengan sepatu. Mereka yang terbagi menjadi dua tim bersiap di sebuah lapangan. Para ibu tersebut menunggu peluit tanda pertandingan sepakbola dimulai. Tidak kalah dengan laki-laki, para ibu bersemangat mengejar bola. Saling mengumpan dan berusaha melakukan gerak tipu terhadap lawan. Para penonton pun bersorak

Dua Orang Tewas di Hari Kemerdekaan  dari halaman 9

mengalami luka serius di kepala dan leher. Untuk bernapas, selain menggunakan selang oksigen, korban juga dibantu penyangga leher. Ayah dan beberapa keluarga Dian turut mengantar ke RSUDAM. Sesaat sebelum Dian mengembuskan napas terakhirnya, suasana ruang IGD sangat hening. Namun begitu melihat Dian tak bernapas lagi, suara tangis belasan orang pecah seketika. Tak lama kemudian, datang ibu dan paman Dian yang menyusul ke RSDUAM mengendarai sepe-

Upacara Tetap Khidmat di Bawah Guyuran Hujan  dari halaman 9

kan teks proklamasi kemerdekaan Indonesia. Di Balai Kota, mulai 08.00 WIB Pemkot Bandar Lampung juga melaksanakan upacara di bawah guyuran hujan. Pada kesempatan tersebut, Wali Kota Eddy Sutrisno menyerahkan 985 tanda Kehormatan Satya Lancana Karya Satya. Penyerahan diberikan kepada pegawai negeri sipil (PNS) di lingkungan Pemkot Bandar Lampung. Tanda kehormatan Satya Lancana Karya Satya sepuluh tahun diberikan kepada 203 PNS. Sebanyak 590 PNS mendapat Satya Lancana Karya Satya 20 tahun. Sedangkan, Satya Lancana Karya Satya tiga puluh tahun diberikan kepada 192 PNS.(rid)

ketika sebuah gol tercipta. Ibu rumah tangga lainnya tampak bersemangat di RT 1 Lingkungan 1 Kebon Jahe, Tanjungkarang Pusat. Mereka mengadu kekuatan fisik dan strategi dalam lomba tarik tambang yang diselenggarakan panitia. Lokasi pertandingan yang tepat bersebelahan dengan rel kereta api tidak membuat mereka merasa terganggu. “Dari tadi pagi, beberapa kali sudah lewat keretanya. (Hal itu) tidak mengganggu perlombaan yang diadakan,” kata Herison, warga setempat. Tidak hanya kaum ibu, anakanak pun merayakan HUT kemerdekaan dengan berbagai lomba, mulai dari balap karung, makan kerupuk, lari kelereng, dan banyak lagi macamnya. Di Jalan KH Mas Mansyur Gang Aster I Rawa Laut, warga juga merayakan kemerdekaan dengan menggelar berbagai seperti sepakbola, makankerupuk,jogetbola,domino, serta lomba mengambil bola dalam terigu. Warga juga mengadakan jalan sehat pada pagi harinya. “Kamimemberikanhadiahhandphone, kipas angin, DVD player, gelas dan peralatan sekolah. Panitia juga memberikan uang tunai Rp150

ribu untuk juara lomba sepakbola,” ujar Ketua Panitia Lomba Dwi. Karyawan, keluarga pasien, dan warga sekitar Rumah Sakit Anugerah Medika, Enggal, juga menggelar berbagai lomba. Lomba makan kerupuk, menangkap belut, dan tarik tambang adalah beberapa lomba yang diadakan rumah sakit khusus kebidanan dan penyakit kandungan itu. Hadiah yang diberikan berupa peralatan rumah tangga dan mainan anak-anak. Lomba seperti itu selalu rutin diadakan tiap tahun oleh pihak rumah sakit. “Bukan cuma juara yang dapat hadiah. Yang ikut lomba dan tidak juara pun dapat, bahkan semua yang hadir dan sekadar menonton pun kami berikan hadiah,” kata Ketua Panitia Lomba Ari Kustini. Di Telukbetung, kemeriahan juga tergambar. Warga bertenis Tionghoa juga menggelar aneka lomba dan berbaur dengan masyarakat lainnya. “Kami tidak berbeda dengan warga yang lain. Kami juga bangsa Indonesia, meski secara fisik kami memang terlihat berbeda dengan warga asli,” ujar Irawan, warga beretnis Tionghoa yang ikut lomba balap karung.(rid/pen)

da motor. Begitu masuk, perempuan berjilbab itu langsung menangis histeris. Ia tak kuasa melihat anaknya terbujur kaku. Ayah Dian berusaha menenangkan istrinya sembari menghapus air matanya. Ia memberi pelukan untuk mengurangi ruang gerak istrinya yang terus meronta. Lelah menangis, ibu paruh baya itu pingsan. Pada waktu hampir bersamaan, di Garuntang, Telukbetung Selatan, Bandar Lampung, terjadi tabrak lari. Seorang sopir angkot mengaku berusaha menyelamatkan pria berumur sekitar 65 tahun dengan membawanya ke RS Bumi Waras. Namun begitu sampai di RS Bumi Waras, korban sudah tak bernyawa. Dengan alasan menghu-

bungi keluarga korban, sopir angkot itu pun menghilang. Paramedis di RS Bumi Waras menuturkan sopir angkot itu mengaku menemukan korban tergeletak di Jalan Gatot Subroto. Pihak RS Bumi Waras kemudian membawa mayat tanpa identitas itu ke RSUDAM. Usai visum di kamar mayat RSUAM, diketahui korban mengalami luka benturan di bagian belakang kepala. Selain itu, mayat berbaju putih dan bercelana hijau tua ini mengalami pendarahan di telinganya. Paramedis memperkirakan usia korban sekitar 65 tahun dengan tinggi badan 169 sentimeter dan berat 50 kilogram. Selain itu, tidak ada ciri-ciri khusus yang nampak selain kumis dan rambut yang telah memutih.(jok)

Rasa Nasionalisme Mengalami degradasi

Pendidikan masa kini, tuturnya, terkontaminasi budaya impor. Kontaminasi tersebut ternyata tidak bisa dipilah bangsa Indonesia. “Mereka berpikir budaya tersebut modern. Padahal yang seharusnya diambil adalah cara berpikir yang modern,” jelas anggota Dewan Harian Daerah ’45 di Gedung Juang. Meskipun demikian, Soehardjo mengungkapkan, baik pada masa lalu maupun sekarang, pendidikan di Indonesia memiliki nilai yang baik dan buruk. “Tinggal bagaimana kita mengelolanya dengan memperbaiki keburukan yang ada,” ungkap Soehardjo. Soehardjo berpesan kepada generasi sekarang untuk tidak melupakan perjuangan para veteran pada masa lalu. “Zaman perjuangan penuh dengan tenggang rasa,” tuturnya.(rid)

 dari halaman 9

Soehardjo melihat telah terjadi degradasi nilai nasionalisme pada generasi muda sekarang. “Nasionalisme mulai turun,” ungkap Soehardjo. Tetapi, dirinya berharap HUT ke-64 kemerdekaan Indonesia bisa mengubah hal tersebut. Jiwa proklamasi ’45, jelasnya, yang memiliki nilai persatuan dan kesatuan, harus diwariskan kepada generasi penerus. Dalam pendidikan, Soehardjo berpendapat, pada masa lalu nilai disiplin dan dedikasi untuk belajar sangat ditanamkan. “Sehingga, kami menjadi giat,” tuturnya.

PEMKOT dan Pokja I PKK Kota Metro menggelar lomba asah terampil pengetahuan mengenai kepahaman mereka terhadap produk hukum. Sebanyak 150 orang penggerak PPK yang terdiri dari 30 orang dari lima kecamatan hadir menyemarakkan acara tersebut. Mereka merupakan hasil seleksi dari kelurahan yang kemudian diambil untuk maju mewakili kecamatan masing-masing. Tujuannya untuk mengetahui sejauh mana keluarga sadar terhadap hukum, produk hukum, dan supremasi hukum. “Awalnya kegiatan semacam ini kita lakukan berkeliling di tiap-tiap kelurahan. Tetapi, karena ingin lebih baik, makanya kita selenggarakan acara seperti ini,” kata Ketua PKK Metro Neti Herawati beberapa waktu lalu. Ia mengatakan, dengan dikumpulkannya

tiap-tiap kecamatan menjadi satu tempat, harapannya mereka bisa saling menyimak dan memperhatikan penguasaan hukum kelompok lainnya. “Dengan cara seperti ini, pembinaan kita akan lebih mudah. Sebab, nantinya para kader ini kan sebagai ujung tombak keluarga sadar hukum. Ya minimal untuk keluarganya dahulu lah,” ungkapnya. Dengan adanya gebrakan ini, diharapkan ada pengaruh terhadap pemahaman hukum masyarakat, mulai dari kelurahan, kecamatan, dan bahkan tingkat kota. “Kegiatan seperti ini sudah ada pengaruhnya kok. Ini terbukti dari sekian persen saja orang Metro yang menghuni lapas. Jumlahnya tidak sampai 10 persen,” jelas Neti. Menurutnya, acara yang digalakkan sejak beberapa tahun lalu ini sempat meraih juara

satu tingkat nasional tahun 2008. Selain itu, kadarkum binaan PKK Metro ini selalu menjadi permintaan provinsi setiap ada even yang berkaitan dengan kadarkum. Kadarkum Kota Metro merupakan salah satu poksi PKK yang dimaksudkan untuk menunjang tujuan utama 10 program PKK untuk mewujudkan masyarakat yang sejahtera. “Di setiap kelurahan sudah kita bentuk masing-masing satu dengan jumlah anggotanya 20 orang per kelompok,” katanya. Kelompok kadarkum tingkat kelurahan itu dimaksudkan sebagai motivator tugas mereka di keluarga masing-masing. Dengan terbentuknya kesadaran hukum mulai dari keluarga, harapannya tidak ada lagi masyarakat yang melanggar hukum, sehingga kepolisian tinggal menjaga keamanan saja.(nashrullah haqiyuddin)

UTB Bangun Kampus 11 Lantai  Mahasiswa Lakukan Peletakan Batu Pertama

BANDAR LAMPUNG TRIBUN - Biasanya, peletakan batu pertama dalam pembangunan sebuah bangunan adalah pejabat institusi bersangkutan. Namun itu tidak berlaku di Universitas Tulangbawang (UTB). Peletakan batu pertama gedung kampus itu, Senin (17/8), dilakukan mahasiswanya. Rektor UTB Mohammad Machrus SE Msi mengatakan, peletakan batu pertama diserahkan kepada mahasiswa sebagai bentuk penghargaan kepada mahasiswa yang selama ini menjadi salah satu pendukung dari pembangunan gedung mereka. Machrus menambahkan, pembangunan kampus UTB dibagi dua tahap. Pertama, pembangunan empat lantai yang terdiri dari 18 ruang kelas kuliah dengan luas bangunan 2.051 meter persegi. Diperkirakan, tahap pertama memakan waktu 1, 5 tahun. Pengembangan tahap kedua yaitu tujuh lantai terdiri yang dari 26 ruang kuliah, ruang auditori-

um, parkir, dan sarana lainnya seluas 6.419 meter persegi. Pembangunan yang direncanakan memakan waktu 3,5 tahun ini menempati areal seluas 8.470 meter persegi dengan dana berasal dari mahasiswa, alumni, serta pihak lain. Ke depan, Machrus mengatakan, tidak tertutup kemungkinan UTB akan memiliki program pascasarjana sebagai langkah mengembangkan pendidikan di Lampung. Menanggapi upaya UTB menghadapi persaingan antarperguruan tinggi swasta yang yang saat ini semakin menjamur, Machrus mengatakan, “UTB tidak melihat PTS sebagai bentuk persaingan, namun mitra untuk meningkatkan pendidikan tinggi di Lampung,” tukasnya. Machrus yakin jika PTS di Lampung masing-masing mengembangkan pendidikannya, maka Lampung akan menjadi provinsi atau wilayah tujuan pendidikan. Sebab, orientasi pendidikan tinggi

Harus Tutup Tanpa Kecuali  dari halaman 9

caranya, pemerintah harus tegas menutup tempat-tempat hiburan yang dekat dengan perbuatan maksiat. Semuanya tanpa kecuali,” ujar Nurvaif. Hingga kemarin, Pemkot Bandar Lampung belum mengeluarkan surat instruksi penutupan tempat hiburan umum selama Bulan Ramadan. Mengacu tahun 2008, instruksi penutupan tempat hiburan umum selama Bulan Ramadan baru ditetapkan tiga hari menjelang 1 Syawal. Tempat hiburan yang mendapat instruksi untuk tutup adalah

Never Expired  dari halaman 9

“Hampir semua artis yang saya latih vokalnya sudah rekaman. Mau dibilang mereka aji mumpung, ya terserah opini masyarakat saja. Saya kan cuma melatih vokal mereka,” ujar Ina tersenyum saat ditemui dalam rangkaian Tour Sumatera Sensasi Hits, pekan lalu. Adik kandung Astri Ivo ini mulai terjun dalam dunia tarik suara saat berumur enam tahun. Ina sempat membuat album anak-anak. Tahun 2000, Ina meluncurkan album berjudul Damai Mimpi. Sayang, penjualan album tersebut kurang sukses. Selepas merilis Damai Mimpi, tahun ini Ina meluncurkan mini album. Single pertama sama dengan nama albumnya, I’m cmyk


BATU PERTAMA - Perwakilan mahasiswa Universitas Tulangbawang (UTB) melakukan peletakan batu pertama pembangunan kampus tersebut, Senin (17/8). selama ini berada di Pulau Jawa. UTB yang merupakan pengembangan dari STIAL-STISIPOL saat ini memiliki 1.510 mahasiswa, sembilanlaboratorium,limafakultas dengan tujuh program studi. Acara peletakan batu pertama kemarin dihadiri alumni, mahasiswa, dan pengurus Badan Ekse-

kutif Mahasiswa (BEM) , karyawan, serta puluhan undangan lainnya. Setelah peletakan batu pertama, acara dilanjutkan dengan pembukaan baliho gambar maket gedung baru oleh rektor beserta mahasiswa dan ketua ikatan alumni.(rri)

panti pijat, diskotik, karaoke, pub atau bar, kafe, dan spa. Semua tempat tersebut harus tutup total selama Bulan Ramadan. Pemkot sendiri langsung menerapkan sanksi jika ada tempat hiburan yang melakukan pelanggaran. Sanksi tersebut mulai dari surat peringatan sampai pada penutupan tempat hiburan. Selain itu, pemilik atau pengusaha pun bisa terkena sanksi administrasi berupa pencabutan surat izin tempat usaha (SITU) dan surat izin usaha kepariwisataan (SIUK). Selain pemerintah, sambung Nurvaif, pihak keamanan (polisi) juga harus bertindak tegas dalam mengawasi keberadaan petasan yang jelas-jelas sudah dilarang.

Kepada umat Islam, Nurvaif mengimbau agar menjadikan Ramadan untuk meningkatkan kesadaran kepada Allah. Setiap hari, jelas Nurvaif, lima kali sehari kesadaran orang muslim diingatkan. “Sebulan dalam setahun intensifitas kesadaran dinaikkan. Hak-hak pribadi kita untuk beberapa jam diminta Allah. Siapa yang rela berarti telah memiliki kesadaran tinggi,” kata Nurvaif. Sedangkan Mawardi mengimbau masyarakat yang tidak menjalankan ibadah puasa untuk Bulan Ramadan. “Umat Islam sebaiknya mengisi Ramadan dengan kegiatan-kegiatan yang baik,” pungkas Mawardi.(rid)

Tunggu Depag jatuh pada Sabtu, 22 Agustus. “Penetapan telah disampaikan sepekan yang lalu dari Pimpinan Pusat (PP) Muhamadiyah,” jelas Nurvaif. PP Muhammadiyah pekan lalu menetapkan 1 Ramadan 1430 H jatuh pada 22 Agustus 2009. Diperkirakan, awal Ramadan versi Muhammadiyah tidak berbeda dengan pemerintah. Muhammadiyah menetapkan awal Ramadan berdasarkan perhitungan hisab yang dilakukan Majelis Tarjih dan Tajdid PP Muhammadiyah. Sementara untuk 1 Syawal, atau Idul Fitri, lanjut Nurvaif, PP Muhamadiyah juga telah menetapkan jatuh pada pada (rid) 20 September.(rid)

Dreamer. Video klip I’m Dreamer disutradarai Darius Sinartrya. Darius juga berperan sebagai storyboard dan model video klip. Keinginan Ina promosi lagu lewat video klip agar bisa ditayangkan di stasiun televisi bertepuk sebelah tangan. Lirik lagu I’m Dreamer yang berbahasa Inggris ditolak stasiun televisi nasional. “Pas tahu video klipnya ditolak, sedih banget, sampai nangis, dan nggak semangat bernyanyi. Nidji dan D’Cinnamons juga punya lagu berbahasa Inggris, tapi video klipnya tampil di tv, kenapa saya ditolak,” tukas Ina. Bungsu dari 12 bersaudara ini mengatakan, keluarga dan juga Darius Sinartrya selaku sutradara video klip menguatkan dirinya. Mereka memberinya semangat untuk terus bernyanyi. Masih

ada kesempatan untuk membuat video klip lagu lain dan tetap bekarya di jalur musik. Bakat menyanyi Ina membuatnya tertarik untuk mengikuti Asia Bagus 1997 dan Indonesian Idol 2008. Cewek yang hobi traveling ini sering menerima tawaran menyanyi di beberapa negara Eropa dan Asia. Bahkan, Ina menjadi backing vokal Rossa saat konser di beberapa kota di Indonesia Ada satu pengalaman berkesan yang dirasakan Ina gara-gara dia mempunyai bakat menyanyi. Tahun 2008, Ina berkunjung ke Bukit Bintang, Malaysia. Saat itu Ina sedang duduk di halte bus dan memperhatikan beberapa pengamen bernyanyi Pengamen yang bermodalkan gitar akustik menarik perhatian Ina karena lagu-lagu yang

dibawakan disukainya. Ina ikut bernyanyi dan para pengamen itu mengajak Ina untuk jam bersama “Kaget juga tiba-tiba mereka minta nge-jam bareng gitu. Ya udah saya jadi ikutan ngamen. Respon orang-orang yang melihat kami juga baik dan mereka kasih applaus,” kenang Ina Halte bus itu dekat dengan Cafe Starbucks. Karena melihat banyak penonton yang mengerumuni jam session dadakan itu, pengunjung kafe ikut keluar dan melihat penampilan mereka. “Senang banget bisa dapat apresiasi seperti itu. Apalagi spontan, menyanyi memang nggak ada expired day-nya. Dengan menyanyi kita bisa menghibur orang, bisa pergi ke banyak tempat, dan mendapatkan pengalaman berkesan,” pungkas Ina.(tin)

 dari halaman 9



Halaman 16



TELEPON SEMUA BAGIAN: 0721-704777 (5 LINE)  IKLAN: 0721-3585522  SIRKULASI: 0721-3585533, 08127211010 HOTLINE PUBLIC SERVICE: 08127212211

Tribun Lampung

Lamtim dan Way Kanan Raih Satyalancana  SBY Serahkan Penghargaan kepada 25 Bupati JAKARTA, TRIBUN - Sebanyak 18 bupati seluruh Indonesia memperoleh penghargaan Satyalancana Pembangunan. Anugerah tersebut diberikan Presiden Susilo Bambang Yudhoyono (SBY) dalam rangka HUT Ke-64 RI. Dari 18 bupati itu, dua di antaranya dari Lampung, yaitu Way Kanan dan Lampung Timur. Penyerahan sekaligus penyematan tanda kehormatan ini dilakukan oleh Menteri Dalam Negeri (Mendagri) Mardiyanto mewakili presiden di Gedung Depdagri, Senin (17/8). “Satyalancana Pembangunan merupakan tanda kehormatan yang diberikan khusus kepada

WNI (warga negara Indonesia) yang berjasa besar bagi negara dan masyarakat dalam bidang pembangunan,” kata Mardiyanto. Ke-18 bupati penerima gelar kehormatan tersebut adalah Zainul Azhar (Tanah Tumbu), Tamanuri (Way Kanan), Nurdin Basirun (Karimun), Albert H Torey (Teluk Wondama), Sjafei Kahar (Buton), Warman Suwardi (Kaur), Daria (Lingga), Nasrul Abit (Pesisir Selatan), Wellington Wenda (Pegunungan Bintang) dan A Nawir (Pinrang). Lalu, Kalamudin (Muara Enim), Theddy Tengko (Kepulauan Aru), Gusmal (Solok), Su-

karmis (Kuantan Singingi), Anwar Hafid (Morowali), Abdullah Vanath (Seram Timur), Noverisman Subing (Lampung Timur), serta Eduard Fonataba (Sarmi). Selain itu, presiden juga memberikan penghargaan Satyalancana Wirakarya kepada tujuh bupati dan dua wali kota. Yakni Erry Nuradi (Serdang Bedagai), Ahmad Hidayat (Kepulauan Sula), Justiar Noer (Bangka Selatan, Moh Ma’ruf Bantilan (Tolitoli), Dani Budiarto (Bogor), Burhanuddin Mahir (Muaro Jambi), Budiman Arifin (Bulungan), Rusdy Mastura (Palu), dan Tengku Mukhtaruddin (Kepulauan Anambas).(dtc)

Empat Penjudi Diringkus BANDAR JAYA, TRIBUN - Nasib sial menghampiri empat pemuda. Mereka tepergok aparat Polsek Terbanggi Besar sedang bermain judi kartu remi di Jalan Yos Sudarso, Bandar Jaya, Lamteng, Minggu (16/8). Tanpa perlawanan, keempatnya ditangkap dan digelandang ke mapolsek. Kapolsek Terbanggi Besar AKP Dennie Andreas menerangkan, keempat tersangka adalah Antonius Budi (31), warga Jalan Yos

Sudarso, Bandar Jaya; Dwi Hertanto (31), warga Jalan Jenderal Sudirman, Bandar Jaya; Y Sudarmanto (35),warga Jalan S Parman, Bandar Jaya; dan Heru Riyadi (36), warga Jalan Jenderal Sudirman, Bandar Jaya. “Keempat tersangka ditangkap ketika sedang bermain judi di konter HP milik Antonius di Jalan Yos Sudarso, Bandar Jaya, sekitar pukul 16.30. Saat itu mereka sedang bermain judi leng,” jelas

Kapolsek. Selain membekuk empat tersangka, polisi juga menyita barang bukti berupa dua set kartu remi, karpet warna biru, dan uang Rp 75 ribu. Mereka akan dijerat pasal 303 KUHP. Dennie menuturkan, mereka terjaring dalam Operasi Pekat yang digalakkan aparatnya. Saat ini keempatnya ditahan di Mapolsek Terbanggi Besar untuk menjalani pemeriksaan.(leo)

METRO, TRIBUN - Pemkot Metro dinilai tidak mampu berkoordinasi dengan Pemprov Lampung, terutama dalam hal perbaikan jalan. Sebab, banyak sekali jalan yang rusak dan perlu diperbaiki. Hal itu disampaikan Bung Hasan, pejuang angkatan 45 yang mewakili para veteran, saat bersilaturahmi ke rumah dinas Wali Kota Metro Lukman Hakim, Senin (17/8). Untuk itu, dia meminta pemkot segera merealisasikan perbaikan jalan tersebut. Selain itu, Hasan juga menyampaikan kabar gembira kepada para veteran atau pun keluarganya yang belum mendapatkan bantuan. “Segera cepat mengajukan karena pemerintah memberikan bantuan Rp 250 ribu kepada setiap veteran maupun keluarganya. Meskipun kecil, sifatnya berkelanjutan,” ujarnya. Menanggapinya, Wali Kota Lukman Hakim mengaku sangat mengapresiasi masukan dan kritikan tersebut. Menurutnya, memang saat ini pemerintah sedang berupaya menyelesaikan perbaikan berbagai infrastruktur, termasuk jalan. “Kami akan berusaha sedikit demi sedikit memperbaiki apa yang kurang tersebut,” jawabnya. Dalam kesempatan itu, Lukman juga mengajak warga agar terus mengembangkan rasa patriotisme dan mengucapkan rasa terima kasih atas dharmabakti

para pejuang yang telah berjuang untuk membawa bangsa ini menuju kemerdekaan. “Kalau tidak ada para pejuang dahulu, apalah jadinya kita sekarang,” tegasnya. Selain itu, sebagai bentuk penghargaan dan penghormatan terhadap jasa-jasa para pahlawan, ia juga mengajak untuk selalu mengisi kemerdekaan dengan sebaik-baiknya. “Yang kita lakukan sekarang ini belumlah seberapa jika dibandingkan dengan para pejuang kita dahulu. Untuk itulah, sebagai bentuk penghargaan karena bangsa yang besar adalah bangsa yang menghargai jasa para pahlawannya, maka kita harus mengisi kemerdekaan ini dengan sebaik mungkin,” paparnya. Silaturahmi dengan para veteran tersebut berlangsung seusai wali kota beserta jajarannya mengikuti upacara bendera di Stadion Tejosari dan tabur bunga di Taman Makam Pahlawan Metro. Dalam upacara tersebut, wali kota menjadi inspektur upacara dan Danramil 0411/07 Punggur Kapten CHB Heri Saputro sebagai komandan upacara. Lalu, naskah proklamasi dibacakan oleh Ketua DPRD Metro Amir Hamzah dan tugas pembina upacara diamanahkan kepada Danramil 0411/16 Metro Kapten Inf Zaiful Rahman. Sedangkan pembawa bendera dipercayakan kepada siswa SMAN 4 Metro Dita Carolina.(nas)


DIPERCANTIK - Gedung DPRD Metro telah dipersiapkan sedemikian rupa menyambut acara pelantikan para wakil rakyat hari ini (18/ 8). Selain mempercantik gedung, personel keamanan juga disiapkan guna mengantisipasi hal-hal yang tidak diinginkan.

Sudarsono Ketua DPRD Metro Veteran Ajukan Perbaikan Jalan Gelar Aneka Lomba PERA YAAN HUT Ke-64 RI PERAY juga disambut meriah warga Lampung Tengah. Aneka perlombaan khas HUT RI digelar untuk turut merayakan hari kemerdekaan di daerahdaerah, Senin (17/8). Pagi harinya, upacara peringatan HUT RI dipusatkan di Lapangan Gunung Sugih. Selain pegawai pemkab, upacara juga dihadiri seluruh unsur Muspida Lamteng, kepolisian, TNI, serta siswa dari beberapa sekolah. Seusai upacara, lapangan tersebut menjadi ajang berbagai perlombaan. Pantauan Tribun di beberapa daerah di Lamteng, seperti Gunung Sugih, Bandar Jaya, Poncowati, dan Punggur, HUT RI disambut meriah warga setempat. Mereka menggelar bermacam lomba, seperti panjat pinang, tarik tambang, makan kerupuk, dan lomba khas 17 Agustus (leo) lainnya.(leo)


METRO, TRIBUN - Akhirnya, Sudarsono dipastikan menduduki kursi ketua DPRD Kota Metro periode 2009-2014. Kader Partai Demokrat itu akan didampingi Supriadi Dharma (Partai Golkar) sebagai wakil ketua. Hal itu berdasarkan Surat Edaran Menteri Dalam Negeri No 161/2898/VIII/SJ tentang Pemberhentian dan Pengangkatan Anggota DPRD Kabupaten/Kota. Dalam surat edaran tersebut dinyatakan bahwa pimpinan dewan sementara berasal dari partai yang memiliki suara terbanyak dan wakilnya dari partai yang mempunyai suara terbanyak kedua. Anggota KPU Metro Rahmatul Ummah, Senin (17/8), mengatakan, KPU kali ini bertugas memediasi penetapan wakil ketua sementara. Pasalnya, dalam Pileg 2009, pemilik kursi terbanyak yang berhak menduduki jabatan

Izin Bantar Masykur Terganjal MENURUT rencana, hari ini anggota DPRD Metro periode 2009-2014 dilantik. Kepastian tersebut didapat setelah terbitnya SK Gubernur Lampung Nomor G/530/B.II/HK/2009 bertanggal 14 Agustus 2009 tentang Peresmian Keanggotaan DPRD Kota Metro 2009-2014 dan Peresmian Pemberhentian Anggota DPRD Periode Sebelumnya. Ketua KPU Metro Buyung Syukron, Senin (17/8), menga-


TABUR BUNGA - Wali Kota Lukman Hakim menaburkan bunga di Taman Makam Pahlawan Metro seusai upacara peringatan HUT Ke64 RI (foto kiri). Ketua DPRD Metro Amir Hamzah memberikan bingkisan secara simbolis kepada para veteran yang diwakili oleh Bung Hasan di rumah dinas wali kota, Senin (17/8).

Pemberian Tali Asih untuk Veteran SEBANYAK 315 orang veteran, angkatan 45, warakawuri, dan perintis kemerdekaan bersilaturahmi ke rumah dinas wali kota Metro, Senin (17/8). Dalam silaturahmi tersebut, pemkot memberikan bingkisan kepada para pejuang tersebut yang berisi sarung dan uang senilai Rp 50 ribu. “Ini merupakan bentuk tali asih pemkot. Ke-315 orang ter-

sebut terdiri dari 60 orang veteran, 60 orang angkatan 45, 195 warakawuri (janda veteran), dan lima orang perintis kemerdekaan. Hal semacam ini merupakan hal rutin yang kita berikan kepada mereka setiap tahun,” kata Kabid Sosial Disosnaker dan Pemberdayaan Masyarakat Metro Burhanuddin Suit mendampingi Asisten I Syaiful Tomi,

Senin (17/8). Menurutnya, selain pemberian bingkisan yang bertepatan dengan HUT Ke-64 RI ini, pemerintah pun selalu memberikan dukungan kepada organisasi veteran. Seperti membantu melalui sekretariat mereka masing-masing setiap ada even. “Dan kali ini bagi para veteran yang masih sanggup mengikuti

wakil ketua diduduki tiga partai, yakni PDIP, Golkar, dan PAN. “Sebenarnya bukan KPU yang menetapkan. Tetapi, partaipartai tersebutlah yang seharusnya memutuskan berdasarkan musyawarah di antara mereka,” jelas Rahmatul. Tetapi, lanjutnya, PDIP tidak mengusulkan seorang pun sebagai wakil ketua. Sedangkan PAN belum bisa memutuskan dan mengalami deadlock. Sehingga PAN meminta KPU untuk memediasi. “Berdasarkan hasil yang diperoleh, kami menetapkan Supriadi dari Golkar sebagai wakil. Karena hanya Golkar yang mengusulkan dan mampu menyelesaikan usulan tersebut,” ujarnya.(nas)

ucapara, kami menyediakan satu bus khusus untuk membawa mereka ke Tejosari,” jelasnya. Hal sama dikatakan Wali Kota Metro Lukman Hakim. Menurutnya, pemkot sudah mengalokasikan dana hibah untuk membantu organisasi para veteran di Kota Metro secara rutin. “Hal ini sudah berjalan sepanjang tahun,” ujarnya.(nas) cmyk

takan, dalam daftar anggota dewan baru tersebut, ada enam nama perempuan yang dalam periode sebelumnya tidak ada. Mereka adalah Sudarti dari Hanura, Wiwin Septiani (PAN), Suprihatin (PKB), Megasari (PIS), Anna Morinda (PDIP), dan Widi Astuti (PKNU). Selain itu, menurut Buyung, caleg Partai Demokrat Masykur yang terpilih dalam daerah pemilihan 2 masih menunggu hasil

pengusulan pelantikannya. “Kami dari KPU sudah mengusahakan pembatarannya (cuti tahanan), tetapi tidak berhasil. Dan kami masih menunggu kepastian perizinan dari kuasa hukumnya kepada kejaksaan,” ungkapnya. Rekomendasi pembataran yang diajukan KPU mentah. Sebab, kejaksaan tidak bisa hanya melakukan pembataran terhadap salah satu dari empat tersangka dugaan kasus korupsi di RSUD Ahmad

Yani Metro tersebut. “Kata Kajari, kalau mau pembataran, harus semuanya,” ujar Buyung. Sedangkan masalah pergantian caleg Partai Demokrat Roslina Elisa oleh Fahmi Anwar akhirnya tuntas. Dengan demikian, Fahmi melengkapi lima kursi anggota dewan yang merupakan jatah kursi partai tersebut. Selain Fahmi, wakil Demokrat lainnya adalah Sudarsono, Andra Saputra, Masykur, dan Solehan. (nas)

Super Ball cmyk

Selasa, 18 Agustus 2009 Senin, 18 2009

Halaman 17

SELAIN rajin membeli para pemain bintang, Barcelona juga tak henti menelorkan para pemain bertalenta. Setelah Bojan Krkic, dan Sergi Busquet, akademi Barca kini mementaskan bintang baru bertalenta: Pedro Rodriguez Ledesma (22). Winger kelahiran Santra Cruz de Tenerife 28 Juli 1987 ini datang pada saat tepat. Barcelona memang kehilangan para penyerang utama ketika ditantang Athletic Bilbao di leg pertama Piala Supercopa Spanyol, di Stadion San Mames, Bilbao, kemarin. Zlatan Ibrahimovic, Lionel Messi, dan Andres Iniesta, absen karena cedera ringan. Nah, kesempatan itu dimanfaatkan sebaik mungkin oleh Pedro, demikian ia lebih sering disapa, untuk tebar pesona. Hasilnya dahsyat. Di partai resmi pertama untuk Barca musim ini, selain menyumbangkan assist untuk gol Xavi Hernandez, ia pun menyarangkan gol spektakuler pembawa kemenangan Barca 2-1. Tak heran, pelatih Pep Guardiola berani memberi garansi akan lebih sering menurunkan pemain berjuluk Pedrito (yang artinya Pedro kecil, Red) pada musim ini. Musim lalu pemain yang punya postur relatif kecil untuk ukuran Eropa ini (tinggi 169 cm, berat 64 kg) hanya sempat dua kali mencicipi laga La Liga. Pasukan El Barca sempat dikejutkan dengan gol pembuka Bilbao. Striker Oscar de Marcos berhasil memecah kebuntuan Bilbao dengan mencetak gol di menit ke44. Marcos sukses melewati barisan pertahanan El Barca yang dipimpin Gerard Pique dan Daniel Alves, untuk kemudian menaklukkan kiper Victor Valdes. Ketinggalan satu gol membuat Barcelona berupaya membalas. Hasilnya di menit ke58, El Barca berhasil menyamakan kedudukan melalui Xavi. Umpan silang Eric Abidal dari sisi kiri gawang diterima Pedro. Dengan cerdik, ia


Pernikahan Pura-pura MODEL glamor yang pernah menyatakan obsesi ingin hidup bareng Cristiano Ronaldo, Katie Price, buka kartu. Dia mengaku, lima tahun pernikahannya dengan suaminya terdahulu sebagai kehidupan perkawinan yang penuh dengan kepura-puraan dan kebohongan. Model berusia 31 tahun ini mengaku selama menjalani rumah tangganya dengan Peter Andre, dia berusaha tampil menjadi istri yang baik karena semata demi menyenangkan Peter Andre sebelum akhirnya bercerai. halaman


ribun Lampung


memberi assist pada Xavi yang berdiri bebas, dan sukses mengeksekusinya. Sepuluh menit kemudian, Pedro menunjukkan kebintangannya. Menguasai bola sendirian, ia melewati penjagaan bek lawan Markel Susaeta. Dari jarak sekitar 20 meter dari gawang, Pedro melepaskan tendangan geledek. Dan gol! Gol ini spektakuler lantaran sejatinya senjata andalan Pedro adalah kaki kiri, dan karenanya ia sering ditempatkan sebagai winger kiri. Hebatnya, sepakan kaki kanannya pun ternyata tak kalah saktinya seperti ditunjukkan dalam laga kemarin. “Saya hanya beruntung, bisa mencetak gol. Rekan-rekan saya tampil luar biasa dan segalanya berjalan dengan baik. Kini kami berharap bisa main bagus di kandang sendiri dan memenangkan Piala Super Spanyol,” kata Pedro seperti dikutip dari Canadian Press. Sejauh ini, Pedro terus menunjukkan konsistensi. Dari tiga kali penampilan selama pramusim Barca, ia menyumbangkan dua gol, dan sebuah assist. Tak pelak, Pedrito adalah mutiara baru yang begitu dibanggakan oleh pelatih Pep Guardiola. “Pergerakannya bagus. Dan ia punya tendangan keras. Pedrito jelas sangat membantu kita di lini tengah. Dan tahun ini kita bisa berharap banyak padanya,” ujar Guardiola tentang pemain yang besar di Barcelona B, dan baru




masuk Barcelona A sejak musim 2007/2008 dengan statistik 17 kali tampil di berbagai kompetisi, dan baru satu kali mencetak gol ini. Kemenangan di leg pertama membuka pintu lebar bagi Barcelona untuk melengkapi koleksi trofi juara , setelah musim lalu sukses menggondol treble. Sebaliknya bagi Bilbao, kekalahan ini menipiskan harapan merebut trofi Supercopa Spanyol setelah terakhir kali memenanginya pada 1984 silam. Kedua tim akan saling bertemu di leg kedua Piala Supercopa Spanyol pada 23 Agustus mendatang, dengan Barcelona menjadi tuan rumah di Camp Nou.(Persda Network/den)

Rapor Pemain ATHLETIC BILBAO Iraizoz 8 --Melakukan sejumlah penyelamatan gemilang Iraola 6 - Bek sejati hingga sama sekali tak berani naik membantu penyerangan 7.5 Ocio 7 .5 - Babak pertama tampil begitu menggila Ustaritz 6.5 - Gol pertama Barca lahir dari kelengahannya Koikili 7 - Konsisten mengamankan sisi kiri pertahanan Susaeta 6.5 - Berupaya keras tapi belum maksimal Gurpegui 7 - Performa solid tapi kurang didukung rekannya Orbaiz 6.5 - Bekerja keras tapi pengaruhnya pada tim kurang terasa Gabilondo 6 - Beberapa kali mengetes kiper Valdes dengan tembakan terarah De Marcos 7 - Mencetak gol pertama setelah itu loyo Llorente 5.5 - Gagal manfaatkan peluang emas di babak pertama cadangan: Torquero - Castillo Etxeberria BARCELONA Valdes 7 - Penyelamatan gemilang pada babak kedua Alves 8 - Cemerlang di belakang, dan rajin menembus pertahanan lawan Puyol Puy ol 7 - Tetap jadi jenderal tangguh di lini belakang

Pedro Rodriguez Ledesma

ue 7 - Tampak semakin Piq Pique menikmati permainan Abidal 7 .5 - Memberi sejumlah 7.5 peluang kepada rekan-rekan untuk mengancam gawang lawan Xavi 7.5 Xa vi 7 .5 - Mencetak gol bagus, tapi masih tetap mencari irama tepat Toure 6.5 - Tampil jauh di bawah standar terbaiknya Keita 8 - Tak pernah berhenti berlari dan harusnya bisa mencetak gol Pedro 7- Menunjukkan intelejensia tinggi untuk mendampingi Cavi, dan mencetak gol spektakuler Bojan 6.5 - Senantiasa energik tapi belum masuk irama tim Henry 6 - Kehilangan kecepatan tapi tetap menebar ancaman Cadangan: Jeffren - Busquets -

„ Ulasan Caparros

Merinding Dapat Standing Ovation


Misi Sulit SEPER TINY A makin sulit untuk SEPERTINY TINYA meraih kemenangan sekarang karena kita nanti akan bertanding di Camp Nou. Kita tak sudi menyerah tapi skor 1-2 memang membuat leg kedua nanti lebih sulit. Kita bermain bagus, tapi hasil akhir (den) mengecewakan.(den) *) Joaquin Caparros Caparros, pelatih Athletic Bilbao dikutip dari Goal


Xavi Hernandez

SEPASANG mata Xavi Hernandez berkacakaca. Menit 81 ketika melangkah ke luar lapangan untuk digantikan Sergi Busquets, Xavi terkejut lantaran mendapat sambutan luar biasa dari pendukung tim tuan rumah, Athletic Bilbao. Ya, tanpa dinyana, para pendukung Bilbao yang memenuhi Stadion San Memes justru memberi tepuk tangan panjang sembari berdiri alias standing ovation untuk maestro gelandang Barca ini. Terpuk tangan membahana mengiringi setiap langkah Xavi menuju bangku cadangan. Saat tersadar standing ovation itu memang ditunjukkan untuknya, gelandang timnas Spanyol ini pun membalas dengan melambaikan tangan ke arah penoton. Bukan tanpa sebab pastinya. Sepanjang pertandingan, Xavi memang tampil cemerlang. Absennya Andreas Iniesta, dan Lionel Messi, serta Zlatan Ibrahimovic membuat sinar terangnya semakin kentara.


Walhasil, publik tuan rumah pun tak tahan memberinya pujian. Mendapat sambutan sedemikian hangat dari publik lawan, Xavi pun merinding. “Sebuah kehormatan bagiku. Ini penonton yang luar biasa, dan begitu sportif, serta stadion yang sungguh fantastis,” ujar Xavi dikutip dari Goal. Tak lupa, Xavi memberikan pujian untuk tim lawan. “Kita sama-sama ditangani pelatih bagus, sama-sama menjalani metode latihan keras, dan sama-sama menampilkan permainan menyerang,” ujarnya. Pelatih Barcelona, Pep Guardiola pun ikutikutan terharu menyaksikan pemandangan yang jarang terjadi itu. “Fantastis melihatnya. Standing ovation itu sebuah pengakuan bukan hanya atas penampilan Xavi hari ini (kemarin, Red), lebih dari itu adalah pengakuan terhadap kariernya yang gemilang,” kata Guardiola.(Persda Network/den)

„ Ulasan Guardiola


Lebih Baik BILBAO adalah tim luar biasa, dan para pemainnya mengerahkan tenaga ekstra untuk kehormatan tim. Kami, karenanya, harus berjuang ekstra keras juga untuk mengimbangi mereka. Kita memang di atas angin. Tapi, kita akan lebih baik (den) lagi leg kedua nanti.(den) *) Pep Guardiola Guardiola, pelatih Barcelona dikutip dari Goal



soccer hot news


Tribun Lampung


Rekor Gerrad-Torres Tumbang

Rekor GerrardTorres MUSIM 200 7/2008 07 Main








MUSIM 2008/2009 Main 14 Menang Seri


TUMBANG - Duet Fernando Torres (kanan), dan Steven Gerrard yang jika tampil sebagai starter tak pernah terkalahkan sejak 115 hari lalu, akhirnya tumbang ketika Liverpool ditekuk Tottenham Hotspur 1-2 di White Heart Lane, kemarin

DUET maut Steven Gerrrard dan Fernando Torres adalah senjata pamungkas untuk kedigjayaan Liverpool. Jika duo ini berlaga sejak menit pertama, yang sayangnya hal itu jarang terjadi, kemenangan seperti menjadi garansi. Maka, menjadi petaka ketika duo ini tampil sebagai starter di White Hart Lane namun tetap juga tumbang oleh Tottenham Hotspur 1-2, kemarin. Lebih memalukan lagi, Liverpool menjadi satusatunya personel The Big Four yang kalah di laga perdana Premire League. Tiga tim rival mereka menang meyakinkan. Arsenal menggilas Everton 61. Chelsea menyikat Hull City 2-1, dan Manchester United memecundangi Birmingham 1-0. Duet Gerrard- Torres sebagai starter kemarin adalah yang ke-42 kali sejak Torres bergabung dengan The Reds dua tahun silam. Sialnya, kemarin juga menjadi kekalahan pertama duet maut ini sejak 511 hari silam. Kekalahan terakhir yang keduanya alami terjadi pada 23 Maret 2008 di kandang Manchester United. Hotspur memahami betul kekuatan dua pemain ini. Spurs memberikan sedikit ruang kepada Gerarrd agar tidak leluasa menyuplai bola kepada Torres sekaligus

menghalau gelandang timnas Inggris itu melakukan tembakan keras. Strategi ini sangat jitu. Torres yang tidak mendapat suplai dari sang kapten jadi kelimpungan. Sementara Gerarrd sendiri juga tak bisa beraksi melakukan tendangan keras karena selalu dihalangi lawan. Gerrard memang mencetak gol di laga ini pada menit 56 tapi itu melalui titik putih penalti. Sebelumnya, Liverpool kecolongan lebih dulu melalui gol Benoit Assou-Ekotto di

Lini Belakang Keropos MANAJER Liverpool, Rafael Benitez mengakui pasukannya tampil buruk di babak pertama. Tetapi, mereka akhirnya mampu memperbaikinya di babak kedua. Benitez pun mengungkapkan rasa AP PHOTO kecewanya dengan kekalahan itu. “Sangat disayangkan ketika Anda Rafael Benitez mencetak gol dan menyamakan kedudukan, tetapi setelahnya Anda kebobolan lagi lewat sebuah tendangan bebas. Ini sangat sulit dan saya sangat kecewa karena saya pikir di babak kedua kami telah bekerja keras,” kata Benitez dilansir Sky Sports. Pelatih asal Spanyol ini menilai, faktor kelemahan di lini belakangnya menjadi penyebab kegagalan timnya menuai kekalahan di laga perdana Premier League. “Saya pikir permainan kami di babak kedua lebih baik. Kami memiliki dua atau tiga peluang emas yang membahayakan. Namun kami masih memiliki masalah yang harus dengan dua bek tengah kami,” katanya. Benitez juga menyesalkan kinerja wasit Phil Dowd yang tidak memberikan hadiah penalti kedua. Menurutnya, Liverpool berhak atas penalti kedua setelah terjadi pelanggaran. Namun wasit Phil Dowd tidak menganggap adanya pelanggaran. Benitez menyatakan bek Spurs Benoit AssouEkotto terlihat jelas mendorong striker Andriy Voronin. “Itu benar-benar penalti. 100 persen penalti. Setiap orang bisa melihat bahwa itu satu penalti,” kata Benitez.. (Persda Network/cen)

Tantangan 20 Gol untuk Rooney


GOL ROONEY - Pemain Manchester United, Wayne Rooney (kiri) mencetak gol ke gawang Birmingham City yang dijaga Joe Hart di Old Trafford, Minggu (17/8). Rooney ditantang Sir Alex Ferguson bisa membuat 20 gol di Liga Inggris musim ini. mendulang gol kepada Ronaldo. Sedangkan Rooney harus puas berperan sebagai pendukung; termasuk dengan menempatkannya sebagai sayap kiri. Sebenarnya masih ada

penyerang-penyerang hebat di barisan skuad MU, tetapi Rooney tetap menjadi pilihan utama di lini depan. Konsekuensi logisnya, tugas mencetak gol kini diemban oleh Rooney. Ferguson pun

ada lima assist dari pasangan tersebut. Pada musim 2007/08, Gerrard-Torres masuk starting line-up sebanyak 27 kali di Premier League. Duet gelandang dan striker itu menghasilkan 16 kemenangan, tujuh hasil seri, dan empat kekalahan bagi “The Reds”. Duet keduanya juga mencatatkan 49 gol (30 gol dari Torres) dan 17 assist.(Persda Network/cen) HASIL PER TANDING AN (1 7/8) PERT ANDINGAN (17/8) er pool Benoit ttenham Liver erpool To tt enham 2-1 Liv Assou-Ekotto (’44);Steven Gerrard (pen ’56); Sebastien Bassong (’59) Manchester United 1- 0 Birmingham Wayne Rooney (’11) KLASEMEN SEMENT ARA: SEMENTARA: Arsenal 1 1 0 0 6-1 3 Manc City Stoke City

1 1 0 0 2-0 3 1 1 0 0 2-0 3

West Ham

1 1 0 0 2-0 3


1 1 0 0 2-0 3


1 1 0 0 2-1 3


1 1 0 0 2-1 3


1 1 0 0 1-0 3


1 1 0 0 1-0 3


1 1 0 0 1-0 3

Hull City

1 0 0 1 1-2 0


1 0 0 1 1-2 0


1 0 0 1 0-1 0


1 0 0 1 0-1 0


1 0 0 1 0-1 0

Aston Villa

1 0 0 1 0-2 0


1 0 0 1 0-2 0


1 0 0 1 0-2 0


1 0 0 1 0-2 0


1 0 0 1 1-6 0

TOP SKOR: 2 gol: Cesc Fabregas (Chelsea), Didier Drogba (Chelsea)

Barca Tawar Vidic


WAYNE Rooney menjadi penyelamat Manchester United (MU). Gol tunggalnya menit 34 ke gawang Birmingham City di Stadion Old Trafford kemarin menghindarkan The Red Devils dari hasil seri pada laga pertama mereka di Liga Primer. Tak pelak, setelah kepergian Cristiano Ronaldo ke Real Madrid, Roo, demikian striker bengal ini biasa disapa, menjadi tumpuan pelatih MU, Alex Ferguson. Dan Roo sukses membuktikan dengan tampilannya yang gemilang kemarin. “Rooney mencetak gol dengan baik. Sundulannya bagus dan dia bereaksi dengan bagus, dia cepat menyongsong bola. Dia berada di jalan yang benar dan kami berharap total golnya akan signifikan bagi kami,” ujar Ferguson di situs klub. Dalam dua atau tiga musim belakangan, MU memang bagai menggantungkan asa

menit 44. Usaha Gerrard menyamakan skor menjadi sia-sia setelah Sebastien Bassong kembali menjebol gawang Liverpool di menit 59. Musim lalu kebersamaan mereka berkurang menyusul cedera yang membelit salah satu atau kedua pemain tersebut. Hasilnya, mereka hanya berteman sebanyak 14 kali sebagai starter. Hebatnya, The Kop tak pernah kalah dan meraih 11 kemenangan. Jumlah gol turun menjadi 19 (10 dari Torres) dan hanya

menetapkan target 20 gol atau lebih untuk dicetak oleh Rooney. Pelatih Birmingham, Alex McLeish bahkan melontarkan pujian bombastis, “Ia pemain bertalenta rakasa. Dilahirkan


untuk jadi pesepakbola sejati. Paduan Zinedine Zidane, dan Michael Platini,” ujarnya. Dalam laga yang tidak diperkuat oleh kapten Rio Ferdinand karena cedera betis yang dialaminya di sesi latihan membuat Sir Alex Ferguson menurunkan John O’Shea sebagai kapten andalannya dalam laga itu serta berpartner dengan Johny Evans. Dua kali gawang Birmingham terancam namun keseluruhannya tidak ada yang membuahkan satu gol pun. Kecuali gol Rooney tadi. Kegemilangan kiper Johnson dalam memblok tendangan penyerang MU patut diacungi jempol. Memasuki babak kedua tempo permainan tetap berkembang bagi kubu tuan rumah dimana Ferguson menarik Evans, Nani dan Berbatov, guna memberikan kepercayaan Weshley Brown, Ryan Giggs dan striker anyar Michael Owen.(Persda Network/cen)

BURSA transfer pemain musim panas ini belum ditutup. Masih ada kesempatan bagi tim-tim yang mengincar pemain baru hingga 31 Agustus mendatang. Tak terkecuali Barcelona yang sedang mengincar bek tangguh Manchester United, Nemanja Vidic. Meskipun telah menjadi klub terhebat di Eropa, Barca terus berbenah memperbaiki kekurangannya. Pelatih Pep Guardiola menilai kekurangan timnya saat ini terletak di lini belakang. Saat ini, fokus perhatian Guardiola adalah bek tengah. Barcelona sempat menggelar negosiasi dengan bek Shakhtar Donetsk, Dmytro Chygrynskiy. Negosiasi perwakilan kedua klub buntu setelah tidak terjalin kesepakatan. Barcelona pun mengalihkan bidikannya kepada Vidic. Seperti dilansir The Sun, Senin (17/8) pemain 27 tahun tersebut menjadi buruan utama Guardiola meski masih dalam pemulihan cedera.


Nemanja Vidic dan Sir Alex Fergusson Guardiola sangat terkesan dengan penampilan impresif Vidic musim lalu. Pelatih MU Sir Alex Ferguson tidak mungkin merelakan pemain yang dipinang dari Spartak Moskow dengan banderol 7 juta poundsterling meninggalkan Old Trafford. Pasalnya, Vidic telah menjalin kerjasama yang solid dengan Rio Ferdinand.(Persda Network/cen)


Video Porno, Manohara Tuding Kelantan BEBERAP A bulan terakhir, sebuah BEBERAPA video yang cukup menghebohkan beredar di dunia maya. Video tersebut memperlihatkan seorang perempuan tengah berdiri dalam keadaan bugil. Wajah perempuan tersebut tak terlihat jelas, namun dalam judul video tertulis nama Manohara. Saat dikonfirmasi, Manohara tetap tenang. Dengan santai ia menjelaskan bahwa perempuan di video tersebut bukan dirinya. “Itu kebetulan mirip Mano,” tegasnya saat ditemui di Rumah Sakit

Dharmais di Jl . Letjen S. Parman Kav. 84-86 Slipi Jakarta, Minggu (16/ 8). Model cantik ini malah menduga bahwa Kerajaan Kelantan-lah yang merupakan dalang dari peredaran video tersebut. Menurutnya itu adalah usaha dari Tengku Fakhry suaminya, untuk memperburuk citra, serta mengalihkan kasusnya. “Saya percaya itu dari pihak Kelantan. Dari kemarin (mereka) terus saja mencari-cari cara untuk mengalihkan (dth) (kasus),” tegasnya.(dth)

● Gossip of the Day!

Tribun Lampung




Kangen Lomba Balap Karung BIARPUN separuh badannya mengalir darah bule Jerman, namun penyanyi dan pesinetron Cinta Laura Kiehl mengaku negeri yang sangat dicintainya adalah Indonesia. Ia merasa Jerman itu hanya sebagai negara tempat dia ‘numpang lahir’ saja. Begitu cintanya pada Indonesia, dara manis ini merasa betah tinggal di Indonesia dan mengembangkan karir di republik ini hingga sekarang. Bukan cuma itu, tiap tanggal 17 Agustus tiba, Cinta selalu terkangen-kangen untuk nimbrung dalam kegiatan seru tingkat RT seperti lomba balap karung, makan kerupuk atau lomba memasukkan jarum atau cabe dalam lubang botol. Cinta rajin mengikuti lomba-lomba 17 Agustusan itu sejak dirinya masih tinggal di luar negeri bersama kedua orang tuanya yakni Michael Kiehl (asli Jerman) dan Herdiana (Indonesia). Bintang sinetron Oh Baby itu mendatangi Kantor Kedutaan

Besar RI (Kedubes RI) di Jerman atau kantor-kantor perwakilan lainnya, hanya untuk ikut-ikutan lomba 17 Agustusan yang digelar di tempat tersebut. “Biarpun baru beberapa tahun tinggal di Jakarta, tapi aku sudah tahu celebration (maksudnya perayaan 17 Agustusan). Aku sudah sering ikut lomba balap karung, makan kerupuk dan masukin cabe dalam botol. Itu semua bikin rindu, “ gumam Cinta Laura saat merayakan ulang tahun Ke-16 yang kebetulan jatuh persis pada Hari Ulang Tahun (HUT) RI 17 Agustus 2009 kemarin. Kecintaannya terhadap Indonesia tentu bukan hanya sekedar ucapan tanpa bukti belaka. Dara kelahiran Quackenburg Jerman, 17 Agustus 1993 rela merogoh uang tabungan pribadinya untuk membangun sembilan gedung Sekolah Dasar (SD) dan dua gedung SMP serta menyantuni dana pendidikan anak-anak miskin di kawasan Bogor, Jawa Barat. Dibantu oleh sebuah yayasan internasional, Cinta Laura ikut memantau peremajaan fasilitas pendidikan yang dia bangun bersama. “Jadi kalau aku bilang love much to Indonesia, itu aku nggak


cuma ngomong saja, tapi aku lakuin. Cause I love this country so much. Aku ingin tunjukin Indonesia sebagai negara number one di dunia, “ tutur bintang sinetron Upik Abu dan Laura itu, dalam logat bahasa Indonesia yang kebule-bulean. Di awal kehadirannya di dunia entertainment, Cinta Laura yang keturunan Jerman-Indonesia memang langsung menyedot perhatian publik lewat gaya bicaranya yang unik. Hal ini disebabkan karena sejak kecil ia memang tinggal di luar negeri. “Aku memang tidak bisa bahasa Indonesia yang bagus, terus aku nggak tahu nasional anthem of Indonesia Raya, tapi yang paling penting action (tindakan) aku. Banyak orang Indonesia

yang lancar bahasa, tahu Pancasila, Indonesia Raya tapi mereka belum lakukan apa-apa buat negerinya, “ ujarnya, bernada mengritik. Artis yang jadi relawan pengajar bahasa Inggris untuk siswa-siswa kurang mampu itu merasa bangga dan bersyukur hari lahirnya persis jatuh pada 17 Agustus. Dalam nada berkelakar, ia merasa seluruh rakyat Indonesia ikut merayakan ulang tahunnya dirinya. “Aku selalu merasa it’s my birthday. Di luar negeri sendiri nggak ada hari liburan spesial 17 Agustus, aku baru tahu ketika pindah ke Indonesia. Yang pasti it’s pretty cool bisa bareng independent day,” imbuhnya.(Persda Network/abs/*)

Syahrini Ingin Merdeka Berkarya PERSDA NETWORK/ ISMANTO

Cinta Laura

Hidung Berdarah-darah AKIBAT kecelakaan mobil yang menimpanya pada Minggu pagi (16/8) di Surabaya, Mulan Jameela mengalami pendarahan di hidung. Pendarahan terjadi akibat hidungnya terbentur-bentur ketika ban mobil yang ditumpanginya pecah saat melaju menuju Bandara Juanda. Namun pelantun lagu Makhluk Tuhan Paling Seksi itu dipastikan tak mengalami luka-luka serius. Dokter tidak mengharuskannya menjalani rawat inap. “Memang hidungnya sempat berdarah, tetapi dia baik-baik saja,” kata Mira , manajer Mulan saat dihubungi melalui telepon, Senin (17/8) kemarin. Mira mengatakan Mulan tidak mengalami luka parah di bagian lain selain hidung. Sampai di Jakarta, artis ini langsung menuju ke rumah sakit Pondok Indah untuk memeriksakan diri setelah mengalami kecelakaan tersebut. Mulan mengalami kecelakaan pada saat dirinya ingin menuju ke Bandara Juanda. Mulan buru-buru menuju ke Jakarta karena harus mengisi acara musik di salah satu stasiun televisi. Di tengah jalan, ban mobil yang ditumpangi Mulan pecah dan mengakibatkan kecelakaan. Mobil sempat terguling PERSDA NETWORK/ beberapa kali. Tetapi, kondisi ISMANTO Mulan dan penumpang Mulan Jameela lainnya tidak ada yang terluka parah. Karena tergolong luka ringan, mantan vokalis duo Ratu (sekarang bernama Duo Maia) itu langsung diperbolehkan pulang setelah diperiksa dokter.(vvn)

KARENA negerinya sudah terbebas dari penjajahan, penyanyi Syahrini mencoba memaknai hari kemerdekaan 17 Agustus dari sisi pandang dirinya sebagai artis penyanyi. Pelantun lagu Bohong itu ingin ada kemerdekaan berkarya bagi para artis. Selain itu, Syahrini juga masih belum merasa merdeka dari belenggu pembajakan karya cipta. Karena compact disc dan kaset lagu-lagunya banyak yang dipalsukan dalam versi bajakan nan murah meriah di

emperan toko. “Kalau buat aku, merdeka itu bukan hanya terbebas dari penjajahan. Tapi juga dilihat dari segala aspek. Misalnya dalam hal berkarya. Coba, sekarang para artis dan musisi itu sudah bebas belum dari pembajakan. Sekali lagi pembajakan, bukan penjajahan, karena era sudah berubah, “ tuturnya. Sebagai generasi muda, Syahrini pun ingin meneruskan perjuangan para pahlawan terdahulu. Namun ia melakukannya tanpa mengangkat senjata.

Baginya membuat karya yang terbaik pun merupakan salah satu bentuk perjuangan mengisi kemerdekaan. Lalu apa harapan Syahrini bagi Indonesia ke depan? “Ya semoga Indonesia menjadi lebih baik, merdeka dari aksi terorisme, merdeka dari problem kemiskinan, hargaharga kebutuhan pokok murah, pengangguran berkurang, korupsi semakin diberantas. Itu yang namanya kita merdeka dalam arti sebenar-benarnya, “ tandas (abs/*) dara berkulit putih itu.(abs/*)



Sayang BelumTentu Cinta KEDEKATAN Julia Perez (Jupe) dengan pesepakbola asal Argentina Gaston Castano memang bukan cerita baru lagi. Yang belum terjawab hingga sekarang adalah, akankah pasangan beda negara ini melanjutkan hubungan ke pelaminan? Entahlah! Yang jelas, Jupe, panggilan akrabnya, yang sebelum dikabarkan sempat retak dengan Gaston kini nongol bareng lagi dengan bahasa kemesraan yang mereka pertontonkan. Seperti ketika menghadiri suatu acara akhir pekan lalu, keduanya tampil mesra tanpa sungkan lagi mengumbar senyum kepada semua orang yang menyapanya. Terlihat baik Jupe maupun Gaston bak pasangan yang memang sudah resmi menikah saja.Di acara Jupe tampak sok mesra, sok romantis dengan saling berpegangan tangan dan melingkarkan tangan di pinggang pasangannya. Tak jarang Jupe yang memang cukup akrab


Julia Perez dan Gaston Castano

dengan para wartawan tak sungkan berpose mesra di depan moncong kamera para fotografer. “Kita berdua saling sayang. Ya sebagai seorang temanlah. Pertemanan lebih enak kalau didasari rasa sayang. Dibilang dekat, ya dekat banget. Tuh (sambil memepetkan tubuhnya ke badan Gaston) deket kan! Kalau cinta,

gini. Sayang itu belum tentu cinta. Itu aja deh. Cinta kan urusannya dalem banget, sama hati. Terus ada itungitungannya. Nah, kalau berteman kan enggak ada itung-itungannya,” papar Jupe yang malam itu mengenakan baju hitam ketat. Disinggung tentang ibunya yang kurang setuju dengan kedekatannya

dengan Gaston. Jupe membantahnya. Ia justru mengklaim ibunya sudah merestui hubungan mereka. Pelantun lagu Belah Duren itu juga mengklaim kedatangan mereka ke acara malam itu pun diketahui ibunya. Jadi, menurutnya, tidak seperti yang diberitakan di media kalau dia dan ibunya berseteru. “Mama, baik-baik aja. Dia tahu kok aku ke sini sama Gaston. Hubungan kita baik lagi,” katanya. Mengenai dandanan yang cukup menarik perhatian, Jupe berdalih kalau baju yang dikenakannya biasa saja. Ia berdalih menyesuaikan dandanan Gaston. Menurut Jupe, dandanan Gaston malam itu seksi dan hot, jadi ia mencoba menyelaraskannya. Jupe pun mengaku sempat meminta pendapat Gaston sebelum pergi ke acara tersebut. “Dia bilang oke dan seksi. Ya, sudah..., “ tutur Jupe dengan gaya `nakal’ -nya sambil menjulurkan lidah. (Persda Network/dic)

Akui Dipacari Fandy Christian LEPAS dari dekapan vokalis Ada Band, Donnie Sibarani, model dan aktris cantik Uli Auliani kini jatuh kepelukan aktor muda Fandy Christian. Setelah sering kepergok beberapa kali selalu berduaan dalam suatu acara, akhir pekan lalu keduanya tampak mesra menghadiri suatu acara. Kali ini, baik Uli maupun Fandy tak bias mengelak lagi dari kejaran wartawan dan mereka pun akhirnya mengakui berpacaran. “Akhirnya. Kenal sih sudah dua tahun. Pendekatan ya sekitar lima bulanlah. Kalau ditanya hubungan resminya, ya mungkin adalah sekitar tujuh bulan kali ya? “ tutur Fandy sambil menggandeng Uli disampingnya. Uli sendiri mengaku akhirnya menjatuhkan hatinya pada Fandy karena melihat kesungguhannya dalam mendekati dan mencoba membina hubungan

yang serius dengannya. Menurutnya, hal itu yang dirasa berbeda dan membuat hati Uli `tersentuh’. Semula memang Uli menganggap Fandy sebatas teman curhat karena memang jauh sebelumnya mereka sempat terlibat dalam sebuah produksi film. “Yang jelas, aku sangat respek banget dengan kesungguhan dia (Fandy). Biasanya kan cowok tuh ya cuma awalnya aja. Terus kesini-kesini baru ketahuan deh sifat aslinya. Sampai sejauh ini, kalau dia (Fandy) sudah menunjukan kesungguhan dan keseriusannya. Jadi, ya kenapa enggak aku juga ingin serius,” tutur cewek jangkung kelahiran Bandung 20 Nopember 1985 ini. Baik Uli maupun Fandy merasa cocok dari sifat cuek mereka. Termasuk juga masalah urusan hobby makan yang keduanya mengaku tidak pilih-pilih


dan menyukai film bergenre komedi. Di luar itu, rupanya diam-diam ibunya Fandy sendiri yang berada di Medan, Sumatera Utara sudah mengetahui hubungan keduanya dan tak jarang mengirim makanan kepada Uli. Tentu hal ini sempat melambungkan spekulasi lain, bahwa Uli dan Fandy sebenarnya sudah bertunangan. Pasalnya, selain mamanya Fandy yang sering mengirimi makanan, juga ternyata diam-diam Uli sering bolak-balik ke Medan dan menginap di rumah Fandy. “Tunangan? Wah, belum ke sana deh. Kita masih menikmati masa pacaran dulu. Kalau mamanya Fandy sering kirim makanan ya itu sebagai wujud sayang aja. Belum ada rencana apa-apa. Masih jauh,” kata Uli yang diamini Fandy. (Persda Network/dic)


Uli Auliani dan Fandy Christian

Seluler Plus cmyk



Tribun Lampung

Masa Keemasan Netbook ■ Perangkat Antara Ponsel dan Notebook KRISIS keuangan global yang melanda dunia jelas berimbas pada penjualan komputer. Sejumlah produsen komputer bahkan terang-terangan menyebut penurunan penjualan lebih dari 30 persen. Komputer dari jenis desktop maupun laptop yang selama tiga tahun sebelum krisis menjadi produk “hero” banyak manufaktur terbukti tak memberi kontribusi pendapatan. Di tanah air, lonjakan nilai tukar rupiah terhadap dollar, ikut mendorong turunnya daya beli. Padahal, setahun silam masih di atas angin. Kini banyak toko komputer berusaha keras menahan harga dengan kurs Rp 12.000,- per dollar agar tak mengalami kerugian. Pada saat kondisi mengkhawatirkan ini, diam-diam ternyata netbook justru menyita perhatian. Netbook yang bisa diartikan sebagai sebuah perangkat ‘notebook’ yang mengutamakan pemakaian internet serentak berubah jadi produk unggulan. Harga yang dibanderol untuk sebuah netbook memang sangat miring.

Inilah faktor kunci mengapa ia menjadi produk yang sangat dilirik. Dibandingkan notebook

paling murah, selisih harga di antara keduanya mencapai kisaran Rp 1 hingga

Rp 2 juta. Adalah Asus yang pertama kali mengusung konsep komputer jinjing murah. Alat elektronik yang dikemas pabrikan asal Taiwan ini sebetulnya dibuat dalam rangka memenuhi imbauan UNESCO pada industri komputer untuk meluncurkan komputer murah agar lebih banyak anak sekolah melek teknologi. Asus mengendus potensi tinggi di Asia, khususnya di beberapa negara berkembang, Produk Asus pertama bernama EeePC masuk ke Indonesia dengan memori 2 GB seharga Rp 4 juta ternyata laris manis. Toh jika merunut kemauan UNESCO, harga ini masih kelewat mahal. UNESCO mentargetkan harga komputer mini murah itu sekitar 100 dollar. Agak susah memenuhi angka ini, mengingat tak semua industri (termasuk pemasok sistem operasi dan semikonduktor) belum memiliki pemikiran yang seragam. Yang terjadi adalah pengurangan spesifikasi produk. Namun hal ini ditolak oleh banyak A EW IM IST pabrikan. a at ka m bu Karena itu, em m ng tbook ya netbook pionir ne luler. C, eP Ee se Asus bukanlah dan ter pu m ko industri sebuah notebook

Kecanduan Guyon di Twitter


TORA Sudiro, terbantu BlackBerry untuk push email dan Twitter.

APALAGI aktivitas pria satu ini setelah kondang jadi pemain film, presenter, dan komedian di layar kaca? Main musik! Ini bukan cerita baru sebenarnya. Sebab, dulu pun Tora pernah bikin band yang memang belum pula sempat naik daun. Kini, angannya seolah hendak terwujud. Bareng Vincent Rompies dan Deddy Mahendra Desta, ia tengah sibuk menyiapkan album baru dengan nama band baru juga. The Cash namanya. Artinya sederhana saja, agar kalau ketika mereka manggung honor pembayarannya musti kontan. Kontak dengan dua awak Club Eighties itu ia lakukan dengan memanfaatkan BlackBerry Bold yang ia peroleh secara gratis dari Indosat. Perangkat ini ternyata begitu membantu aktivitasnya, khususnya push email. “Misalkan ada script dikirim, dulu sampainya bisa satu atau dua hari. Sementara dengan BB, mereka bisa kirim langsung bisa baca,” ujarnya. Yang ia maksud ”mereka” tak lain adalah pihak yang menawarkan dirinya untuk bermain film. Itu satu. Belakangan ia juga rutin meng-up date Twitter. Topik yang diangkat tentulah bukan persoalan berat. Cukuplah untuk melontarkan becanda soal rambut teman musisi yang baru dicukur. Ya, guyon memang salah satu hobi yang tak bisa ia lewatkan. Termasuk ketika Twitter-an. (*)

yang komponennya dikurangi agar memenuhi harga murah. Netbook adalah kategori baru dari kelompok personal computer (PC). Spesifikasi netbook awalnya antara lain berukuran lebih mungil ketimbang notebook. Pemangkasan itu berefek pada ukuran diagonal layar lebih kecil (8 sampai 10 inci), persentase ukuran keyboard yang meringkas (90 sampai 98 persen), dan tidak tergantung pada system operasi Microsoft. Dengan OS bukan Microsoft, harga bisa ditekan karena tidak membayar lisensi (nilainya sekitar Rp 1 juta per komputer). EeePC memakai OS Linux. Kemudian, memori yang disediakan diset dalam bentuk flash yang secara harga jauh lebih murah. Langkah selanjutnya adalah meniadakan disc drive CD/VCD/DVD. Fungsi multimedia di sini bukan berarti dibuang. Asus jeli mengaplikasikan digitalisasi pada audio dan video. Lagipula netbook tetap memiliki audio dan video player. Hanya saja untuk memutarnya tak memerlukan CD. Gantinya adalah flashdisc yang dapat dikoneksikan ke rongga USB. Tak heran jika port ini jumlahnya bisa lebih dari dua buah, meski kemudian muncul peripheral berupa multiUSB port. (Tim Forsel)

Operator CDMA Ogah Ketinggalan


Netbook Haier yang dijual Smart, memakai modem internal dan slot kartu SIM di dalam.

MENGANTUNGI sertifikasi jaringan CDMA 2000 1X-EVDO di frekuensi 1900 MHz membuat Mobile-8 dan Smart lebih andal menyajikan layanan lebih dari sekadar voice dan SMS. Jaringan ini sesungguhnya setara dengan 3G yang ditawarkan oleh GSM. Sayang bila tak dipakai untuk keperluan mengusung data. Sejak Juni silam, paket baru ditawarkan Smart berupa netbook murah buatan Haier plus modem internal dan paket kartu perdana. Paket prabayar dijual seharga Rp 4,7 juta,

sedangkan paket pascabayar dapat dicicil sebesar Rp 499 ribu per bulan selama setahun. Anda tinggal menyisipkan kartu SIM Smart ke slot yang disediakan di dekat baterai. Sementara Mobile-8 menggandeng Advance, produsen pendatang baru di sektor netbook yang cukup gencar menawarkan produknya. Hanya saja, Mobile-8 menjual modem eksternal beserta kartu perdana. Modem ini tinggal ditancapkan saja ke port USB. Harganya lebih murah, di angka Rp 3,8 juta. (*)


Pilih yang Ukuran Keyboard 98 Persen 1.Carilah netbook yang memiliki layar di atas 10 inci. Hal ini akan membuat Anda lebih nyaman ketika membuka web page. 2.Disarankan untuk memakai netbook dengan ukuran keyboard 98 persen dibanding notebook biasa demi kenyamanan mengetik. 3.Sekarang para produsen netbook tengah berlomba membuat produk yang memiliki daya tahan baterai lebih lama. Misalnya minimal empat jam, bahkan ada yang memberi garansi sampai delapan jam non stop. 4.Ruang memori memang bisa jadi prioritas ke sekian, karena bisa diwakili oleh flashdisc yang sekarang berdaya simpan besar (high capacity). Namun memilih yang minimal 4 GB tak ada salahnya. 5.Koneksi yang multi amat penting. Setidaknya selain modem juga tambahan akses Wi-Fi. Akses kedua ini bermanfaat ketika Anda menemukan hotspot gratis. 6.Pastikan tersedia webcam untuk memenuhi kebutuhan chatting yang lebih menarik. (*) ISTIMEWA





ribun Lampung



Jurus Sukses Kontes Adenium Bonggol

Maraknya kontes adenium di berbagai kota seolah menjadi bukti dunia adenium mulai bangkit kembali. Adenium bonggol tampil mendominasi arena kontes.


FENOMENA seperti ini terlihat pada ajang kontes adenium bertajuk Budiluhur Flona Adenium Kontes 2009, pada Juni 2009 lalu di Universitas Budi Luhur, Jakarta. Diikuti 500 adenium bonggol istimewa dan bunga. Begitupun pada kontes adenium di sejumlah kota, adenium bonggol nampak dominan. Selain mendongkrak penjualan bonggol prospek, kontes juga memunculkan tren baru adenium. Thai Spider, misalnya, setelah menang kontes langsung ramai dibicarakan. Ada juga Thai Soco. Bahkan Yadi Setiadi, pemilik Java Soco Nursery di Tangerang, menyebut Thai Soco sebagai jenis paling dicari. “Karakter Thai Soco sangat kuat. Terutama pada bagian perakaran,” ungkapnya. RCN juga banyak digemari. Tongkrongan bonggol dan percabangan proporsional. Sifat rantingnya mudah diprogram. Apalagi ia mampu berbunga secara serentak. Berbicara karakter percabangan dan bonggol kurang afdol bila tak menyebut Obesum. Bandel dan mampu beradaptasi dengan aneka jenis entres. Apalagi belakangan ini Obesum sering juara di kontes. Patut juga

Butuh Panas Matahari Tapi Jangan Banyak Air TANAMAN gurun ini menghendaki media tanam harus porous (gembur) sehingga lingkungan tanaman tetap kering dan akar tak gampang membusuk. Bahan media tanam antara lain sekam bakar, sekam biasa, arang, cocopeat, pasir, dan pupuk. Sementara media pada bagian dasar pot, bisa menggunakan arang, styrofoam (gabus sintetis), atau batu apung. Media tanam bisa berupa ramuan dari bahan pasir malang, sekam bakar, dan pupuk (komposisi 2:1:1). Ada juga campuran arang sekam (37%), cocopeat (30%), pasir sungai (30%), zeolit (2%), dan pupuk dasar (1%). Atau, campuran pasir malang, cocopeat (kokopit), arang sekam, dan pupuk organik (komposisi 3:3:3:1). Pasir malang, arang, dan pupuk (1:1:1). Bisa juga pasir (2 bagian), pupuk kandang (2 bagian), arang sekam (1 bagian), dan batu apung (1 bagian). Media tanam perlu diganti jika akar memenuhi seluruh permukaan media tanam. Umumnya hobiis mengganti media tanam sekali dalam setahun. Ukuran pot harus sesuai. Bonggol tinggi butuh pot berbentuk tinggi pula. Bonggol pendek melebar butuh pot ceper. Adenium sebaiknya menggunakan pot khusus ukuran medium, tingginya sekitar 2/3 – ¾ pot

biasa. Sekadar contoh, adenium ukuran sekitar 80 cm, setidaknya perlu pot ukuran 40-60 cm. Berdasar bahan bakunya, ada pot plastik, keramik atau pot gerabah (tanah). Letakkan adenium di tempat yang terkena sinar matahari langsung. Disiram sekali sehari (cuaca panas), 2-3 hari sekali (hujan). Lakukan pemupukan (pupuk organik) 2 bulan sekali, sebulan sekali (NPK), dan dekastar 3-4 bulan sekali. Sesekali semprotkan pestisida untuk mencegah hama dan penyakit. Juga lakukan pemangkasan secara berkala.

dicatat, Adenium arabicum sang pelopor tampilan bonggol dan percabangan aduhai. Adenium bisa tampil aduhai, karena telah mengalami modifikasi postur lewat pelbagai teknik. Antara lain, trekking, menarik cabang utama dengan bentangan kawat. Wiring, melilitkan kawat pada ranting. Ada juga teknik trekking – wiring, pelilitan kawat di ranting sekaligus menarik cabang utama. Kalau untuk memperbesar dan mempercantik bonggol, ada teknik pengangkatan, yakni mengangkat sebagian bonggol yang terkubur media. Sehingga bagian caudex itu terlihat di permukaan media tanam. Langkah ini dilanjutkan dengan training pada bagian akar. Teknik lain yang sempat bikin heboh komunitas pencinta adenium adalah extreme shock (ada juga yang menamakan extreme graft). Yakni penyambungan secara serentak. Mulai dari percabangan utama, anak cabang, ranting, hingga cucu ranting. Hasilnya, tampilan adenium bakal terlihat tua seketika. Teknik itu dianggap sah. Buktinya, extreme shock (ES) milik Utaka nursery sukses berjaya dan menyabet gelar Juara I dan II di kelas prospek pada kontes Budiluhur Flona Adenium Kontes. Harga jual pun terdongkrak. Extreme shock untuk

tanaman kecil dihargai Rp 350.000. Jika telah dirawat tiga bulan bisa laku Rp 1 jutaan. “Tadinya obesum hanya dihargai Rp 1,5 juta. Setelah dishock 3-4 bulan dan keluar bunga, bandrolnya bisa mencapai Rp 3-4 juta, ” kata Hartono pemilik Taiwanesse Release di Kediri, Jawa Timur. Jurus memodifikasi bonggol tak hanya ES. Langkah pemotongan bonggol juga kerap dilakoni para trainer untuk memperoleh kakikaki kokoh. Salah satunya adalah adenium kaki gurita. Pada pertengahan tahun 2005, model seperti ini sempat menggemparkan jagat penggemar adenium. Langkah pemotongan itu kini mulai mewabah kembali. Jenis yang digunakan adalah RCN. “Istilahnya RCN cutting,” papar Frans Harjono, grower adenium di Tangerang. Dengan teknik modifikasi ini, tanaman bisa tampil lebih rimbun sehingga terlihat lebih bagus. Teknik lain yang kerap dilakukan untuk mempercantik penampilan tanaman ialah dengan cara groupping. Jurus ini memudahkan timbulnya efek ruang tiga dimensi pada pohon. Tentu tantangan untuk memunculkan kesan itu berpulang kepada keahlian si trainer untuk mengatur tata letak yang tepat. Sehingga alur percabangan terlihat selaras. (Majalah Flona/ Foto: Dok. Flona)

Bonggol Bisa Dibentuk Aneka Binatang BONGGOL adenium juga bisa dibikin unik sesuai imajinasi kreatornya. Semisal batang atau bonggol adenium dibentuk menyerupai aneka binatang. Seperti buaya, udang, ikan, dan sabagainya. Kreasi itu tidak termasuk bentuk unik alami. Misalnya bentuk bonggol yang (maaf) menyerupai pantat manusia. Lalu ada juga mirip sepasang manusia tengah berpelukan. Ada juga kreasi yang dianggap kebablasan. Bila pada mulanya campur tangan manusia diusahakan seminim mungkin, kini malah terlihat lebih menonjol. Misalnya saja penggunaan aksesoris yang semula hanya sebagai alat bantu untuk mempertajam tema, kini berkembang jadi bagian dominan. Bahkan terakhir, banyak kreator adenium menggunakan cat untuk memperjelas bentuk, tema, dan model yang ingin disampaikan. “Penggunakan cat tidak


boleh, karena cat pada dasarnya adalah unsur kimia yang bisa merusak pohon, ” kata Nizam Z Kafid, dedengkot adenium asal Gresik, Jawa Timur. Bahkan, jika ketahuan menggunakan cat akan langsung didiskualifikasi dari arena kontes. Adanya kecenderungan para hobiis untuk mempercantik tampilan adenium, merangsang tumbuhnya ‘bengkel’ adenium. Salah seorang yang ketiban rezeki dari fenomena ini adalah Icsan dari Kota Bambu, Jakarta Barat. Kesukaannya berkreasi dengan aneka bonggol membuat ia juga punya keterampilan tambahan, memperbaiki penampilan adenium. Ia kerap menerima order untuk membuat adenium berkarakter mirip bonsai. Dalam sebulan ia bisa menghasilkan 200 tanaman berukuran 15-30 cm. Jika ukurannya besar, kreasi hanya 20-25 tanaman dalam

sebulan. Menjelang kontes kesibukannya bakal semakin bertambah. Lahan seluas 250 m2 miliknya dipenuhi oleh aneka kreasi bonggol. Ada Obesum, Arabicum, RCN, Thai Soco, Cabang Seribu, Kristata, dan

bonggol emas. Bisnis bengkel semacam ini lumayan menggiurkan. Dengan bahan adenium seharga Rp 25.000, ia bisa jual Rp 250.000 setelah dimodifikasi. (Majalah Flona/Foto: Dok. Flona)



Tribun Lampung SELASA 18 AGUSTUS 2009

Ririn Dwi Ariyanti

Siap Jadi Nyonya Aldi PESINETRON dan model iklan Ririn Dwi Ariyanti tampaknya semakin mematangkan persiapan mentalnya menjadi calon istri baru Reynaldi Hutomo Wahab alias Aldi ‘Bragi.’ Memang, dari bibir Ririn dan Aldi belum pernah terucap kepastian rencana mereka menuju kursi pelaminan. Namun paling tidak, dari gelagat dan bahasa tubuh keduanya, sepertinya pasangan ini sudah siap menjadi pasangan suami istri. Betapa tidak? Ririn sudah

tampak begitu akrab dengan Siti Adira Kania, calon anak tirinya. Siti Adira yang merupakan anak hasil pernikahan Aldi dengan pedangdut Ikke Nurjanah itu diperlakukan begitu istimewa. Di depan Aldi, Ririn menampakkan kesiapannya menjadi ibu yang baik untuk Siti Adira. Gelagat itu tampak saat Ririn mendampingi Aldi menghadiri perhelatan SCTV Awards, akhir pekan lalu. Siti Adiri rupanya dibawa serta ke tempat acara. Saat menikmati hidangan yang tersaji di acara itu, Ririn dengan penuh kelembutan mengambilkan makanan untuk Siti Adira. “Ini sayang, buat kamu, “ ucap Ririn kepada Siti Adira. Si bocah mungil itu lantas menyunggingkan senyum kepada calon ibu tirinya itu. Ketika Adira meminta tolong untuk

mengambilkan minum, Ririn pun dengan sigap meladeni Adira. Panggilan ‘sayang’ untuk Adira kerap terlontar dari bibir pesinetron yang paling pintar melakukan adegan menangis dalam berbagai sinetron itu. Hubungan Ririn dan Aldi pun tampak makin mesra. Sesekali keduanya melempar senyum, bahkan memperbolehkan berfoto bersama anaknya. Namun beberapa kali diminta wawancara, beberapa kali itu pula keduanya menolak dengan alasan mereka tengah menikmati hidangan dulu. “Nanti ya. Kita mau makan dulu,” demikian cara Ririn melancarkan jurus berkelit dari todongan pertanyaan seputar rencana menikah dengan vokalis grup musik Bragi itu. Para wartawan pun sampai rela menunggu Ririn - Aldi makan. Selesai makan,

keduanya bersama anak Aldy sempat memperbolehkan para wartawan mengabadikan mereka lagi. Namun, lagi-lagi, ketika diminta waktu wawancara, keduanya malah kabur masuk ruangan. Karuan saja aksi ini membuat kecewa para wartawan yang sudah cukup lama bersabar menanti mereka sejak sebelumnya makan. Pasangan ini tambah menghindar ketika disentil kecurigaan sebagian orang yang menduga pasangan ini sudah menikah secara siri. “Waduh! No comment deh masalah itu. Maaf, kita sudah kelamaan di luar. Harus masuk dulu, enggak enak sama yang punya acara. Terima kasih ya,” tutur Ririn diikuti Aldi dan anaknya meninggalkan para wartawan yang cuma bisa gigit jari melihat ‘buruannya’ lolos. (Persda Network/dic)

Laris Manis di Sinetron SIAPAKAH Ririn Dwi Ariyanti, calon istri Aldi ‘Bragi’ sekaligus pengganti Ikke Nurjanah? Wajahnya tentu sudah tidak asing lagi bagi para penikmat tontonan sinetron, mengingat kapasitas Ririn yang cukup laris manis di jagat sinetron. Ririn lahir di Jakarta, 1 November 1979. Bungsu dari dua bersaudara pasangan Amelia Rusanti dan Sudiman Riantonoto ini mulai terkenal sejak bermain sebagai Cinta di sinetron Ada Apa Dengan Cinta. Sinetron lain yang kemudian dibintanginya, antara lain Bukan Diriku, Cincin, Impian Cinderella, Manusia Bodoh, Matahari Cinta, Pintu Hidayah, Maha Kasih, Maha Cinta, Janji, Cahaya. Selain sinetron, Ririn juga pernah

Dengan kata lain, Ririn termasuk sedikit dari artis-artis Indonesia yang berhasil merampungkan pendidikan sarjananya di tengah menumpuknya kesibukan syuting. Ririn pernah menjalin kasih dengan Benny Mulya. Namun hubungan mereka kandas setelah pacaran selama empat tahun. Belakangan, Ririn makin serius berhubungan dengan Aldi ‘Bragi’, putra Dimas Wahab, tokoh industri musik pop Indonesia.(dic)

menjadi presenter infotainment di TV7 serta sebelumnya menjadi presenter Kamar Kita-Kita di SCTV. Ririn adalah alumnus dari SMP Negeri 19 Jakarta, SMA Negeri 6 Jakarta dan menyelesaikan kuliah di Universitas Paramadina Jakarta. Ririn berhasil mempertahankan skripsinya yang berjudul Efektivitas Special Event Terhadap Pembentukan Citra EO Store di Mata Khalayak di hadapan dosen penguji Universitas Paramadina Jakarta.


Aldi ‘Bragi’ dan Ririn Dwi Ariyanti


Nadine Chandrawinata

Seleb Flash

DENGAN mantap empat anak muda yang mengusung nama Azura Band melangkah pasti siap ‘bertarung’ di kancah musik Indonesia dengan mengedepankan konsep musik bergenre melayu alternatif. Yup! Mereka yang terdiri atas Elmo (vokal), Milo (gitar), Fauzi (bass) dan Bay (keyboard) yang belum lama ini merilis album perdana di bawah bendera Musica Studio dengan melempar single hits lagu pertama, Pilih Saja Aku. Genre musik melayu alternatif yang coba Azura tawarkan kepada publik musik tanah air, dirasa cukup menjanjikan. Betapa tidak, dengan konsep

Kibarkan Bendera di Depan Hiu

yang matang, Elmo dan kawan-kawan siap menebarkan virus M1A1. Ya. Virus Azura yang siap ‘mencengkram’ hati penikmat musik di tanah air. Tanpa bermaksud mengekor virus mematikan yang belakangan merenggut jiwa manusia, H1N1 atau flu babi. Yang jelas, ide kreatif Azura diakui para personelnya terkadang datang secara tiba-tiba termasuk konsep promo yang kini tengah mereka persiapkan. “Musik kita bisa dikatakan peralihan antara pop alternatif dan melayu yang belakangan lagi digemari, “ papar Elmo mewakili teman-temannya saat ditemui di Musica Studio, akhir pekan lalu. (dic) BELUM lama putus pacaran dengan Anji ‘Drive’, Rini Wulandari alias Rini ‘Idol’ sepertinya menunjukkan tanda-tanda balik lagi ke pelukan vokalis grup musik Drive itu. Rini mengakui, status hubungannya sebenarnya cuma break sementara. Itu karena dia dan Anji sama-sama sibuk dan nyaris tak ada waktu santai-santai bersama. Namun di hati kecilnya, Rini mengaku masih mencintai mantan pacarnya itu. “Aku dibilang putus nggak, jadian juga nggak sih. Masih dekat banget. Masih saling kontak,” ujar pelantun lagu Aku Bukan Boneka itu. Mengenai niatan balik ke Anji, Rini pun tak menampik. Ia mengaku hingga kini masih membuka hatinya untuk KAPANLAGI Anji. “Ya, kalau Rini ‘Idol’ dan Anji memang harus ‘Drive’ balikan lagi, nggak ada salahnya,” ujarnya biduan muda bersuara merdu itu. Disisi lain, Anji yang bernama asli Erdian Aji Prihartanto juga mengaku masih sering dilanda kangen pada Rini. “Sekarang ini aku tengah berusaha untuk bisa kembali (menjadi pacarnya. red),” ungkap Anji, secara terpisah. (esy)


BINT ANG ExtravaBINTANG ganza Tora Sudiro kini tidak hanya main komedi baik di layar kaca atau film layar lebar. Pria yang badannya penuh tato tersebut kini tertantang untuk menjadi pembawa acara di ANTV bertajuk 4M Makin malam Makin Mantap setiap Senin sampai Jumat, mulai pukul 20.00 WIB. KAPANLAGI Program berdurasi satu Tora Sudiro setengah jam ini digawangi oleh Tora Sudiro, Vincent “Club 80’s” dan Ayu Dewi, dan ada tokoh “Suster Hepi” yang diperankan oleh Dwi Putrantiwi. 4M terdiri dari tujuh segmen yang diantaranya ada penampilan musik dari musisi ternama atau legenda atau yang sedang naik daun di panggung musik dan obrolan host dengan para bintang tamu dengan gaya yang santai dan kocak di panggung talkshow. Selain itu, 4M juga menyajikan parodi musik dan ‘Kegap Abizz’, yaitu segmen liputan yang sifatnya dadakan untuk nge-gap pelaku langsung di tempat kejadian, misalnya ngegap orang yang menyeberang jalan sembarangan atau orang yang sedang berkelahi di pinggir jalan. Di akhir acara, bintang tamu akan memberikan kenangkenangan untuk dipajang di Hall of Fame 4M. 4M yang ditayangkan sejak tanggal 3 Agustus ini telah menghadirkan Kuburan Band, Wali, The Dance Company, Julia Perez, Angelique, Anita Hara dan Sarah Azhari. (yon)

KETIKA banyak orang menghadiri upacara pengibaran bendera merah putih di lapangan, aktris dan model Nadine Chandrawinata memilih merayakan hari ulang tahun RI dengan caranya sendiri. Nadine mengibarkan bendera merah putih di depan 26 ekor ikan hiu yang berenang-renang di sisi kiri kanannya. Aksi itu dilakukannya di akuarium raksasa bernama Sea World di Kompleks Ancol Jakarta Utara, Senin (17/8) kemarin. Bagaimana perasaannya berhadapan dengan hiuhiu lapar di bawah

permukaan air laut yang asin itu? “Saat berada di dalam kolam ikan sempat juga was-was namun karena sejak awal telah dikasih tahu trik-trik aman melalui proses latihan yang cukup lama, akhirnya saya bisa mengatasi perasaan takut. Lega rasanya bisa berhasil mengibarkan bendera merah putih di depan hiu-hiur, “ ungkapnya usai berlaga. Menghadapi aksinya itu, Nadine telah mempelajari karakter-karakter ikan, khususnya ikan hiu yang dikenal sangat berbahaya, selain juga melakukan latihan diving. Agar bisa berjalan sukses mantan puteri Indonesia 2005 ini mengajak sang ikan hiu untuk berbicara dan meminta izin untuk mengibarkan bendera. Diakuinya, sebelum bermain di Sea World, dia pernah pula berenang dengan hiu di laut. Namun yang sangat membedakan, dalam peristiwa pengibaran bendera di dalam akuarium itu jumlah ikan

hiunya lebih banyak. “Ini memang tantangan asyik buatku, “ gumam kakak kandung si kembar Marcel dan Mischa Chandrawinata itu. Keberhasilan mengibarkan bendera merah putih tidak hanya membanggakan dirinya namun juga keluarga besarnya. Maklum saja, saat mengibarkan bendera merah putih untuk memperingati HUT Kemerdekaan RI ke-64 ini dia ditemani kedua adik kembarnya itu. “Ya jelas bangga dong. Apalagi tugas yang diberikan bisa kami jalankan dengan sebaik-baiknya tanpa ada gangguan dari ikan-ikan hiu yang super ganas itu, “ tuturnya. Sejak lama Nadine memang dikenal hobi menyelam di dasar laut. Bila sedang berlibur, dara yang pernah berlaga di kontes Miss Universe itu menghabiskan waktu dengan menyelam di pantai, menikmati keindahan terumbu karang.(Persda Network/esy)

Gugun Gondrong

Impikan Anak jadi Bintang Bola PRESENTER Gugun Gondrong yang pernah mengalami koma lantaran tumor otak yang menderanya kini kesehatannya semakin membaik. Gugun Gondrong tampak segar bugar saat perayaan tujuh bulanan usia kehamilan sang istri, Ana Marissa. Mulai dari prosesi siraman, sungkeman, sampai jualan rujak dilalui Gugun dengan mulus. Tapi uniknya, Ana mengaku tidak tahu maksud dari prosesi tersebut, karena dia bukan orang Jawa. “Tidak tahu, hanya ikutan saja. Masalahnya itu Jawa banget. Ribet ritualnya banyak banget,” aku Ana Marissa secara jujur. Dalam jumpa pers, Ana didampingi Gugun yang terlihat berangsur-angsur membaik cmyk

kondisi kesehatannya. “Dia (Gugun) sudah banyak kemajuan,” terang Ana. Sejak kandungan Ana berusia dua bulan, Gugun telah menunjukkan respon yang positif menunjukkan rasa sayang dengan kerap mengajak janin ngobrol dan mengeluselus perut Ana. “Kalau elus-elus perut dia tertawa kalau ada respon dari janin karena memang terasa banget, jadi dia (Gugun) bisa ngerasain,” kata Ana sumringah. Ketika diajak bercanda, mantan penyiar radio dan presenter itu sempat melontarkan cita-cita mengajak anaknya menjadi pemain bola yang handal seperti Christiano Ronaldo. Gugun dan istrinya, Anna Marissa memang


Gugun Gondrong saat acara tujuh bulanan kehamilan istrinya. sedang menanti kehadiran buah hati mereka. Saat ini, usia kehamilan Anna sudah memasuki usia tujuh bulan. Menurut hasil USG, calon bayi dijanin Anna itu diperkirakan laki-laki. Tentu Gugun sangat berbahagia

lantaran dirinya memang sangat mendambakan hadirnya putra lelaki. Gugun pun sudah tak sabar menunggu kelahiran anak pertamanya itu. (Persda Network/kpl)


soccer hot news


ribun Lampung

Kallio Rusak Dua Motor

DEBUT Mika Kallio bersama Ducati Marlboro tidak berjalan mulus. Di pekan pertama, dari tiga rencana bergabung dengan tim pabrikan untuk menggantikan posisi Casey Stoner, dia sudah merusak dua motor. Pertama terjadi di sesi kualifikasi dan yang kedua berlangsung saat balapan. Kallio terlibat satu insiden dengan pembalap Hayate, Marco Melandri di penghujung laga. Keduanya sama-sama terlempar ke gravel dan tidak bisa kembali ke trek karena motornya hancur. Kallio, yang sebelumnya membalap dengan tim Pramag Racing, memiliki tanda-tanda bagus selama akhir pekan. Dalam dua free practice, dia berada di posisi tujuh dan delapan, selalu di depan pembalap Ducati lainnya, Nicky Hayden. Dia

Mika Kallio


pun start dari posisi 10, terbaik musim ini meski terjatuh di kualifikasi. Pembalap muda Finlandia ini berharap bisa mendapat hasil balapan lebih baik dari posisi delapan dalam kariernya. Dia juga bertarung untuk posisi lima. Sempat melorot ke posisi 11, Kallio secara konstan berada tempat 10, tiga tempat di

belakang Hayden. Setelah mampu menyalip Alex de Angelis dan Jorge Lorenzo jatuh, dia di posisi delapan. Namun dia ditekan Melandri, pembalap Ducati 2008, sebelum akhirnya terjadi tabrakan. “Melandri mencoba melewati saya di mana itu mustahil,” kata Kallio yang terlihat marah kepada Melandri saat kejadian seperti dilansir crash. Melandri membela diri. Dia mengatakan mampu menyalip Kallio dengan baik meski kemudian tak tahu apa yang terjadi. “Dia tidak melihat saya. Dia hanya menutup garis sangat cepat. Saya pikir dia datang untuk minta maaf, tapi faktanya dia sangat marah dengan saya. Dia mengatakan saya salah. Mungkin dia sangat lelah dan dia tidak bisa berpikir dengan baik,” keta Melandri.(Persda Network/rie)

Bautista Susul Simoncelli AL VAR O Bautista menyusul ALV ARO langkah Marco Simoncelli. Bautista akan bertarung di kelas MotoGP musim depan. Suzuki mengumumkan secara resmi perekrutan tersebut usai GP Rep Ceko di Sirkuit Brno. Pembalap Spanyol, berusia 24 tahun itu dikontrak selama dua musim, mulai tahun 2010. Simoncelli merupakan pembalap 250cc pertama yang naik kelas dan bergabung dengan Gresini Honda musim depan. “Bautista merupakan salah satu pembalap yang memiliki sinar terang dalam balapan Grand Prix,” demikian pernyataan Suzuki.

Bautista saat ini sedang berjuang menjadi juara dunia kelas 250cc. Bersama tim Aprilia, dia berada di peringkat dua klasemen sementara di belakang Hiroshi Aoyama (Scot Racing). Dengan 160 poin, dia terpaut 12 poin. Bautista adalah juara dunia kelas 125cc pada tahun 2006. Prestasi tertingginya di kelas 250cc adalah posisi kedua di musim 2008. Sebelum dicaplok Suzuki, Bautista sebenarnya sudah dilirik Ducati untuk mengisi tim satelitnya, Namun dia memilih menjadi pembalap pabrikan Suzuki, satu-satunya pabrikan

■ Finis Kedua di Brno ■ Lorenzo Minta Maaf tertinggal 11,766 detik setempat. Klasemen sementara (setelah 11 dari 17 seri) “Saya akan dari The Doctor yang 1. Valentino Rossi Fiat Yamaha 212 mencoba mengamankan 2. Jorge Lorenzo Fiat Yamaha 162 meningkatkan kemenangan kelima 3. Casey Stoner Ducati Marlboro 150 musim ini dan semua daerah di 4. Dani Pedrosa Repsol Honda 135 mana saya tidak semakin kokoh di 5. Colin Edwards Yamaha Tech 3 112 begitu cepat puncak klasemen. Saat 6. A.Dovizioso Repsol Honda 107 balapan tersisa enam sekarang sehingga 7. Randy De Puniet LCR Honda 80 seri, Rossi mengoleksi saya dapat lebih 8. Marco Melandri Hayate Racing 79 kuat di perlombaan 212 poin, unggul 50 9. Loris Capirossi Rizla Suzuki 77 berikutnya. Kami poin dari Lorenzo. Dan 10.Chris Vermeulen Rizla Suzuki 72 bagi Lorenzo, memiliki beberapa item baru untuk kecelakan tersebut dicoba dan saya harap dapat membuatnya absen mendapat awal saya mencoba bersama poin seperti yang terjadi di seri mengambil keuntungan,” mereka tapi setiap putaran sebelumnya, di Donington ucapnya. mereka lebih cepat. Saya tak Selain Pedrosa, ada satu lagi (Inggris) dan juga di Jerez bisa menjaga langkah dan pembalap yang sangat kecewa (Spanyol). kemudian saya sendirian di “Sangat bagus berada di dengan balapan di Brno. Dia posisi tiga,” kata Pedrosa yang tak lain adalah Lorenzo. posisi dua tapi sial saya tak unggul 8,99 detik dari Mengaku akan melakukan bisa secepat Yamaha. Di pembalap Honda balapan dengan baik setelah Gresini Toni Elias yang libur dua pekan dan belajar finis keempat seperti dari kejadian di Donington, dilansir crash. Lorenzo lagi-lagi terjatuh lima Pembalap yang lap menjelang finis. barus sekali merasakan Kecelakaan yang kemenangan musim ini menimpanya terjadi karena saat balapan di Laguna dia gagal mengatasi tekanan Seca (Amerika), masih dari Rossi saat dia berhasil berada di peringkat empat menyalip rekan setimnya klasemen sementara. tersebut dan ditempel ketat. Mengoleksi 135 poin, dia Usai balapan, dia mengaku tertinggal 15 poin dari bahwa performanya menurun. Casey Stoner (Ducati “Saya lebih lambat Marlboro), yang memutuskan dibandingkan dengan saat absen selama tiga seri. Sedang latihan dan ini bukanlah dari Lorenzo, Pedrosa sesuatu yang saya harapkan. tertinggal 27 poin. Saya meminta maaf kepada Merasa ada yang harus tim dan Yamaha. Saya akan diperbaiki, pria asal Spanyol melakukan yang terbaik untuk tersebut bertekad melakukan MOTOSPORT.COM bisa berhasil di Amerika evaluasi sebaik mungkin saat (Sirkuit Indianapolis),” Dani Pedrosa sesi uji coba hari Senin waktu ucapnya.(Persda Network/rie)

FINIS kedua di Sirkuit Brno, Rep Ceko, Minggu (16/8) tak membuat Dani Pedrosa senang. Pembalap Repsol Honda tersebut merasa kecewa karena motornya tak bisa diajak bertarung melawan dua rider Fiat Yamaha, Valentino Rossi dan Jorge Lorenzo. Sempat memimpin lomba beberapa saat, Pedrosa gagal memberi perlawananan. Posisi kedua yang didapat pun karena keberuntungan setelah Lorenzo yang bertarung dengan Rossi di barisan depan, terjatuh. Otomatis, Pedrosa yang berada di posisi tiga dan jauh dari pembalap dibelakangnya menjadi runner up. Pedrosa terpaut jarak yang cukup jauh dibandingkan Rossi. Dia

yang tak punya tim satelit. Hanya tim pabrikan Suzuki yang bisa merekrut pembalap rookie sesuai regulasi MotoGP. Bergabungnya Bautista akan menimbulkan tanda tanya terhadap masa depan Chris Vermeulen di Suzuki. Dia akan diplot untuk mendampingi Loris Capirossi yang notabene lebih baik dari Vermeulen meski dia satu-satunya permbalap yang pernah menang bersama GSV-R. Capirossi dikabarkan mendapat kontrak tambahan satu tahun (Persda bersama tim.(Persda Network/rie)

Hanya Untuk Tujuan Promosi

■ Jankovic Menang Mudah Atas Safina benar-benar tidak bisa memperlihatkan permainan terbaik saya,” kata Safina. Jankovic sempat berada dalam kondisi mengkhawatirkan pada set kedua ketika kaki kirinya keseleo karena salah langkah. Tapi itu tak membuatnya menyerah. Semangatnya terus membara hingga akhirnya memenangkan pertandingan. Hasil ini membuat mantan ratu tenis tersebut naik peringkat. Dia akan menduduki posisi empat (sekarang lima), pada pengumuman posisi selanjutnya. “Saya senang saya kembali. Saya kembali ke grup pemain ini (empat besar),” sambutnya. Ya, ini adalah sebuah

kesuksesan besar untuknya. Setelah disingkirkan petenis remaja Melanie Oudin pada babak ketiga Wimbledon lalu, Jankovic kemudian istirahat dari turnamen, sekaligus untuk mendampingi ibunya yang sakit. Sebelum menerima piala kristal, dia berjalan ke atas dan memeluk ayahnya, Veselin. Sementara ibunya berada di Serbia, masih menjalani proses penyembuhan setelah operasi. “Saya mendedikasikan kemenangan ini untuk dia (ibu). Saya ingin membuat dia bahagia. Tapi untuk ayah saya, Anda tahu, ini sulit baginya melihat pertandingan. Dia sangat gelisah di sana,” katanya.(PersdaNetwork/rie)

■ Badoer Coba F60 Jelang GP Valencia

Jelena Jankovic


Murray Lengkapi Kesuksesan KEBAHAGIAAN tambahan didapat Andy Murray di Rogers Cup di Montreal (Kanada). Berhasil menggeser Rafael Nadal dari peringkat dua dunia saat mencapai final, Murray akhirnya menjadi juara. Andy Murray Pada laga pamungkas, dia menunjukkan ketangguhannya. Bertarung ketat melawan Juan Martin Del Potro, petenis asal Skotlandia itu menang dengan skor 6-7, 7-6, 6-1. “Saya senang memenangkan turnamen dan setiap pemain akan mengatakan hal yang

sama kepada Anda. Tapi ini sulit karena saya tak pernah menjadi petenis peringkat dua dunia sebelumnya. So, ini sesuatu yang baru untuk saya,” kata Murray dilansir yahoosports. Dengan tambahan 400 poin atas kemenangan ini, AP PHOTO Murray mengoleksi 9.250 poin, lebih baik dari Nadal 8.665. Roger Federer masih berada di puncak dengan 11.040 poin. Bagi Murray, yang menjadi petenis Inggris Raya pertama mencapai peringkat dua dunia, gelar ini merupakan yang kelima sepanjang 2009. Dia juga memiliki


Pedrosa Kecewa

Gelar Untuk Ibu Tercinta

KEJUTAN besar terjadi di final Western & Southern Women’s Open di Cincinnati (Amerika Serikat). Petenis Serbia, Jelena Jankovic di luar dugaan menang mudah 6-4, 6-2 atas petenis nomor satu dunia Dinara Safina asal Rusia. Kemenangan di turnamen berhadiah total dua juta dolar AS itu semakin membangkitkan harapan Jankovic untuk melanjutkan sukses di turnamen Grand Slam AS Terbuka bulan depan. “Senyum saya kembali dan saya sangat menikmati pertandingan. Saya kehilangan ini mungkin tujuh bulan tahun ini,” kata Jankovic. Jankovic bangkit dari pertarungan ketat di semifinal Minggu, untuk merebut gelar kedua sepanjang 2009. Gelar pertama dia dapat di turnamen tanah liat di Marbela pada April. “Ketika saya bangun pagi, seluruh badan saya terasa sakit karena saya baru tidur pukul dua,” kata Jankovic yang memerlukan hampir tiga jam untuk mengatasi perlawanan Elene Dementieva di semifinal. Tapi di pertandingan final, Jankovic tidak memperlihatkan tanda-tanda kelelahan dan hanya melakukan sembilan unforced error untuk merebut set pertama. “Saya kehilangan irama permainan saya hari ini. Padahal saya cukup percaya diri saat melangkah memasuki lapangan, tapi kemudian saya


rekor 11-4 saat berhadapan dengan petenis peringkat sepuluh besar tahun ini. Kekalahan membuat Del Potro (Argentina), gagal meriah gelar kedua secara beruntun setelah kemenangan di Washington. Namun begitu dia akan melewati Andy Roddick untuk menempati peringkat lima dunia. Del Potro masih belum puas atasi capaiannya tersebut. Dia berkata belum mencapai titik di mana ia dapat menganggap dirinya berada di kelas yang sama seperti Murray, Nadal atau Federer. “Saya harus meningkatkan permainan lebih banyak jika saya ingin menjadi top-four, atau top-two bahkan menjadi (Persda nomor satu,” tegasnya.(Persda Network/rie)


TEST driver Ferrari, Luca Badoer dapat membiasakan diri mengendarai mobil F60 jelang balapan di GP Valencia, akhir pekan ini. Dia akan berada di balik kokpit pada hari Senin dan Selasa di Fiorano, untuk tujuan promosi. Pembalap Italia, 38 tahun tersebut dijadwalkan menggantikan Felipe Massa yang masih menjalani pemulihan atas cedera yang didapat di Hungaroring (Hungaria), 25 Juli lalu. Michael Schumacher adalah pilihan utama menggantikan Massa. Tapi karena pembalap Jerman tersebut masih bermasalah dengan cedera leher, Badoer yang ketiban kesempatan. Seiring larangan melakukan kegiatan uji coba musim ini, Badoer tidak bisa mencoba mobil sebelum free practice pertama Jumat nanti. Mengenai apa yang dilakukan dua hari ini, Ferrari menjelaskan, itu bukan bagian dari uji coba melainkan untuk promosi saja. Ferrari pun tak diperbolehkan melewati 100 km dalam promosi menggunakan ban ultra keras di salah satu harinya. “Ketika Felipe melakukan pemulihan di Brasil, besok Scuderia akan melakukan pekerjaan setelah dua minggu istirahat dengan persetujuan tim lainnya. Selama tiga hari tim akan berkonsentrasi pada persiapan untuk

Luca Badoer


balapan di Spanyol dan Belgia, yang akan dilaksanakan pada dua minggu terakhir Agustus,” begitu bunyi penyataan tim Kuda Jingkrak dalam website mereka seperti dilansir autosport. “Luca Badoer akan memulai balapan, debut sebagai pembalap resmi Scuderia. Besok dan Selasa, Luca akan menjadi bagian pengambilan gambar untuk tujuan promosi di belakang F60 di trek Fiorano.” Badoer akan mendapat kesempatan membalap untuk Ferrari, setelah lebih sembilan tahun menjadi test driver.(Persda Network/rie)

Domenicali: Progres Massa Bagus KONDISI Felipe Massa dikabarkan terus membaik. Rubens Barrichello mengatakan, Massa sudah seperti orang normal kebanyakan dan kali ini Team Principal Ferrari, Stefano Domenicali turut memberi kabar Massa terus membuat kemajuan yang baik dalam pemulihan cedera kepala. Massa sudah berada di

Sao Paulo (Brasil), pascakecelakaan di Hungaria dan mendapat perawatan di Rumah Sakit AEK di Budapest. Dia juga sempat mendapat perawatan di Rumah Sakit Albert Einstein di Sao Paulo, 12 hari lalu. “Felipe dalam bentuk yang sangat baik dan pemulihan berjalan sangat baik!” ujar Domenicali dilansir autosport.

“Pemeriksaan medis yang telah dilakukan selama dua minggu terus menerus menjadi sangat berarti.” Domenicali menjelaskan, yang terpenting sekarang adalah bersabar dan melangkah tanpa terburuburu. Belum jelas berapa lama lagi Massa harus menunggu untuk kembali mendapatkan mobilnya di trek.(Persda Network/rie)



Tribun Lampung SELASA 18 AGUSTUS 2009

Pernikahan Pura-pura ZIMBIO

Jamie dan Louise Redknapp

Tangan Nakal Suami PENAMPILAN Louise Redknapp, istri mantan pesepakbola Inggris, Jamie Redknapp, masih terlihat langsing dan memesona layaknya gadis belia meski baru saja melahirkan anak keduanya, seorang bayi lakilaki, beberapa waktu lalu. Tak heran, Jamie terlihat selalu lengket dengan Louise. Misalnya seperti dipergoki sejumlah wartawan dan fotografer di sebuah kesempatan acara dinner mereka di sebuah klub tenar di kalangan selebriti Inggris, Nobu, dua hari lalu. Tangan Jamie terlihat tak pernah lepas merangkul mesra pinggang Louse. Entah disengaja atau tidak, tangan kanan Jamie sampai terlihat memegang --maaf-- payudara istrinya itu, tanpa risih. Sadar bahwa kelakuan sang suami jadi pusat perhatian fotografer, Louise buru-buru langsung mengeluarkan joke

untuk mengalihkan perhatian. Pasangan ini memang selalu tampil mesra. Boleh dibilang rumah tangga mantan pemain bola bernama lengkap Jamie Frank Redknapp kelahiran Barton-on-Sea, Hampshire, Inggris, 36 tahun lalu ini bisa menjadi teladan bagi para pemain bola Inggris lainnya. Karir Redknapp di lapangan hijau berkibar sejak tahun 1989 sampai 2005. Dia biasa bermain di posisi gelandang. Karir bola Redknapp tak lepas dari darah bola yang mengalir deras dari ayahnya, yang manajer di klub Portsmouth, Harry Redknapp. Boleh dibilang Redknapp adalah keluarga pemain bola. Saudara sepupunya, Frank Lampard adalah gelandang Chelsea. Sementara, pamannya, Frank Lampard Sr., adalah mantan pelatih. Usai menggantung sepatu ola alias pensiun, dia kini aktif sebagai komentator sepak bola di Sky Sports.(PersdaNetwork/fin)

MODEL glamor yang pernah menyatakan obsesi ingin hidup bareng Cristiano Ronaldo, Katie Price, buka kartu. Dia mengaku, lima tahun pernikahannya dengan suaminya terdahulu sebagai kehidupan perkawinan yang penuh dengan kepura-puraan dan kebohongan. Model berusia 31 tahun ini mengaku selama menjalani rumah tangganya dengan Peter Andre, dia berusaha tampil menjadi istri yang baik karena semata demi menyenangkan Peter Andre sebelum dia dan Andre kemudian bercerai. Kepada News of The World, Katie berujar, “Aku telah berusaha dan mencoba, selama lima tahun pernikahan bersama Ande untuk bisa menjadi istri yang berarti di depan dia karena aku ingin kehidupan pernikahan kami bisa berjalan baik. Aku dulu memang mencintai dia, tapi aku mengakhiri pernikahan itu dengan pemberontakan,” ujar model yang juga punya nama julukan Jordan ini. Kepada seorang teman dekatnya, Jordan pernah curhat bahwa dirinya tak peduli jika sikapnya itu menyakiti hati Peter Andre.

“Aku telah berbicara dengan pengacaraku, aku ingin menceraikan dia. Aku telah hidup dalam kebohongan terlalu lama di depan dia,” tutur Jordan. Jordan dan Peter Andre

pernah mencoba berusaha mendatangi konsultan pernikahan demi menyelamatkan perkawinan mereka sebelum kemudian memutuskan cerai. Namun upaya itu tetap sia-sia.


Katie Price dan Peter Andre dengan anak-anak mereka, beberapa waktu yang lalu.

Kelakukannya Aneh-aneh KA TIE memang tipe perempuan KATIE aneh. Ada saja kelakuannya yang membuat mantan suaminya, Peter Andre yang produser televisi itu marah dan geram. Baru-baru ini Peter Andre marah bukan kepalang karena kelakuan Katie Price yang melarang salah satu anaknya yang cacat hasil pernikahan dengan Andre yang bernama Har vey, tampil di acara televisi dokumenter televisi yang diproduseri Peter Andre. Banyak yang mengatakan, Katie meminta agar semua rekaman gambar yang menayangkan wajah bocah berusia tujuh tahun itu dihapus. Peter Andre memang baru saja membuat sebuah acara dokumenter televisi berjudul Moving On yang tayang di stasiun televisi tenar di Inggris, ITV.(fin)

Pose Mirip Gay

Mabuk dan Dugem Jelang Premiership ADA-ADA saja tingkah pemain di Premiership. Menjelang tanding musim baru Premiership dimulai, wajarnya pemain di masing-masing klub menyiapkan stamina seprima mungkin, mengatur pola makan dengan memperbanyak salad, jam tidur dan sebagainya agar benar-benar siap tempur. Tapi itu tak berlaku buat Hermann Hreidarsson. Pemain bertahan Portsmouth asal Iceland ini malah memilih asyik berdugem ria. Sebuah tempat hiburan malam mewah di Inggris menjadi klub yang dia pilih untuk dugem bersama temantemannya hang out, minum, berdansa sampai atraksi jungkir balik di atas meja. Pemain berusia 35 tahun ini terlihat asyik-masyuk dengan sejumlah clubbers cewek, sesekali diselingi canda dan tawa dengan teman-temannya. Kebiasaan kongkow di klub malam seperti Hermann Hreidarsson lakukan sebenarnya hal yang dianggap wajar di kalangan masyarakat Inggris dan di mata media. Namun tingkahnya itu menjadi terlihat ganjil karena pada saat yang bersamaan, Portsmouth kini sedang dilanda rumor tak sedap. Kesebelasan ini dikabarkan bakal mengalami degradasi musim ini. Jadi logikanya, Hermann Hreidarsson semestinya bisa menjaga kelakuannya demi nasib klubnya yang diambang penurunan pangkat ketimbang pergi ke tempat hiburan malam. Hermann Hreidarsson memang terkenal menyukai dunia malam. Saat dipergoki di Iceland International, dia terlihat tengah asyik duduk di atas meja dengan dikelilingi puluhan botol minuman beralkohol, termasuk jenis spirits dan bir dan minuman energi. Dia terlihat mabuk berat. Dia sempat terlihat melemparkan sesuatu ke lantai sebelum kemudian kemudian berjingkrak dan berakrobat.


PACAR BARU -Katie Price bersama Alex Reid jogging bareng di bibir pantai Brighton.

“Dulu aku sudah berusaha keras. Aku tak pernah mencoba untuk meninggalkan dia karena aku yakin semua akan kembali berjalan baik. Tapi itu tidak untuk saat sekarang. Sekarang (pascacerai) aku merasa seperti baru saja lepas dari beban hidup yang sangat berat. Kalau aku sekarang merasa hidup tenang, apa aku harus kembali menoleh ke belakang? Rasa-rasanya itu tak mungkin aku lakukan,” papar Jordan. Sejak perceraian itu, model ibu dari tiga orang anak ini seperti menghilang begitu saja. Dan memang benar, Katie Price memang melarikan diri untuk melupakan kehidupan kelam rumah tangganya dengan berlibur ke Ibiza. Tak butuh waktu lama buat dia untuk mencari kekasih baru pengganti Peter Andre. Saat berlibur ke Ibiza, Katie sudah menggandeng Alex Reid. Selama liburan ini, pasangan ini tak segan mengumbar kemsraan di depan publik. Mulai dari pelukan, ciuman dan sebagainya. Misalnya seperti yang dipergoki media ketika mereka tengah jogging bersama di bibir pantai Brighton.(Persda Network/fin)

MUSIM balapan ini sepertinya bukan menjadi keberuntungan buat Lewis Hamilton. Berbagai problem dia hadapi bertubitubi. Mulai dari mobilnya yang bermasalah, tuduhan dirinya berbohong sampai ancaman dia kehilangan mahkota juara musim yang pernah dia sandang tahun lalu dan tahun ini harus terpaksa dia serahkan kepada sesama pembalap Inggris dari tim rival Brawn GP, Jenson Button. Tapi ada kejadian unik dan aneh di mata sejumlah jurnalis dengan tingkah Hamilton baru-baru ini di lapangan balap Saat fotogafer memintanya untuk berfoto dengan pose duduk diatas ban-ban mobil F1 McLaren-nya, Hamilton langsung menolak. Dia beralasan, pose seperti itu mengesankan dirinya seperti gay. “Pose duduk diatas tumpukan ban kesannya seperti gay,” ujar Hamilton baru-baru ini. Tak seperti biasanya pembalap berusia 24 tahun ini


TINGKAHNYA JADI ANEH - Lewis Hamilton dan kekasihnya Nicole Scherzinger mengeluarkan kalimat ceplosan seperti itu. Biasanya setiap kata yang meluncur dari mulutnya selalu dia jaga dan berkesan hati-hati. Sekilas, penampilan fisik Hamilton saat ini lebih langsung, kalau tidak menyebut kurus, jika dibandingkan dengan penampilan fisiknya yang lalu-lalu.

Bocoran dari orang McLaren Mercedes menyebutkan, sejak prestasinya di musim ini merosot, Hamilton memang jadi kurang bersikap terbuka, termasuk kepada media. Dia baru akan bersedia merespon ajakan wawancara atau obrolan jika orang di depannya itu mencitrakan sisi positif. Karena itu, menjadi cukup

sulit untuk mencari tahu apa yang sebenarnya yang terjadi dengan timnya dari bibir Hamilton. Masyarakat pecinta balap F1 di Eropa, terutama Inggris, sepertinya mulai mahfum dengan merosotnya prestasi Hamilton dan McLaren Mercedes musim ini. Paul Parker, seorang pengemudi truk barang mengatakan, musim ini menjadi giliran Jenson Button sebagai juaranya. “Sekarang giliran Jenson Button. Lewis sudah kalah,” ujar Paul Parker sambil melambaikan bendera bergambar wajah Jenson Button dari tim Brawn GP. Untuk membuktikan seperti apa prestasi final Hamilton di musim ini, dan apakah dia dan timnya bisa bangkit dari keterpurukan, sepertinya kita perlu mencermatinya di sisasisa balapan nanti. Yang jelas, pada seri balapan di Budapest, Hungaria, 26 Juli lalu, Hamilton sudah mulai unjuk gigi.(Persda Network/ fin)

Tifosi Harus Bawa Kartu Suporter DAYLIFE

Hermann Hreidarsson Tak jelas, seperti apa perasaan istri Hermann Hreidarsson, Ragna Lóa Stefánsdóttir, jika melihat foto-foto kelakuan ganjil suaminya itu.(Persda Network/fin)


Roberto Maroni


DEPARTEMEN Dalam Negeri Italia terus berusaha menekan praktik kekerasan di sepakbola. Caranya, dengan membuat regulasi baru yang diharapkan bisa mencegah suporter bola tak bertanggung jawab memasuki stadion atau berada di area stadion. Siapa saja pencinta bola di negeri pizza itu yang ingin menyaksikan laga tandang tim kesayangannya, kini wajib

mengantongi kartu suporter khusus. Aturan ini mulai berlaku tahun depan. “Mulai 1 Januari (2010), fans sepakbola hanya dapat menonton langsung pertandingan tandang timnya jika mereka punya kartu suporter,” kata Menteri Dalam Negeri Italia, Roberto Maroni, dalam sebuah konferensi pers. Pemerintah Italia yakin, aturan baru ini akan

mempermudah kepolisian melacak para pembuat onar di pertandingan sekaligus mengurangi aksi hooliganisme suporter bola. Sejauh ini, Pemerintah Italia telah menjalankan sejumlah peraturan untuk mengurangi masalah, diantaranya dengan melarang fans tim tandang masuk stadion pada pertandingan yang beresiko rusuh tinggi.(Persda Network/ fin/*)



Read more
Read more
Similar to
Popular now
Just for you