Issuu on Google+

Harga Eceran

Rp 2.000 Langganan: Rp 55.000/bulan (Luar Samarinda dan Balikpapan ditambah Ongkos Kirim)

Minggu 14 Desember 2008 No.211/Tahun 5

INDEPENDEN & KREDIBEL

24 Halaman

Berlangganan Hub: 0542-7020151, 0541-202416

Awang Juara Khusus ● Farewall Game Golf Bankaltim di Padang Golf Tanah Merah SAMARINDA, TRIBUN - Penjabat (Pj) Gubernur Kalimantan Timur, Tarmizi Abdul Karim dan Gubernur Kaltim terpilih Awang Faroek Ishak didaulat menjadi juara khusus pada Farewall Game Golf yang digelar ● Bersambung Hal 7

Diamankan 800 Polisi

TRIBUN KALTIM/REZA RASYID UMAR

Penjabat (Pj) Gubernur Kaltim, Tarmizi Abdul Karim, dan Gubernur Kaltim terpilih, Awang Faroek Ishak, bermain golf di Padang Golf Tanah Merah Samarinda, Sabtu (13/12). Ini merupakan Farewall Game Golf yang digelar Bankaltim sebagai pertandingan perpisahan dengan Tarmizi sekaligus menyambut Awang.

● Pelantikan Gubernur Kaltim 17 Desember

Hati Saya di Kaltim... PENJABAT (Pj) Gubernur Kaltim, Tarmizi Abdul Karim, membuat puluhan golfers (pemain golf) yang mengikuti Farewall Game Golf Bankaltim di Padang Golf Tanah Merah, Sabtu (13/12) kemarin terpana.

SAMBUTANNYA tentang kesan-kesan selama menjabat Pj Gubernur di Kaltim kurang lebih lima bulan menjabat begitu menjadi perhatian peserta Farewall termasuk Gubernur Terpilih Awang Faroek Ishak. “Ini hari berat buat saya. Kalau kemarin-kemarin saya TRIBUN KALTIM/REZA RASYID UMAR

● Bersambung Hal 7

SAMARINDA, TRIBUN - Untuk kelancaran pelantikan Gubernur dan Wakil Gubernur Kaltim terpilih, Awang Faroek Ishak-Farid Wadjdy (AFI), 17 Desember nanti, Poltabes Samarinda akan menurunkan 800 personel. Jumlah itu paling maksimal dan sesuai prosedur tetap standar kepolisian. “Kami lakukan sesuai dengan protap (prosedur tetap) yakni yaitu pengamanan awal melibatkan satuan gegana penjinak bom dengan mensterilkan

tempat pelantikan, yakni gedung DPRD Kaltim dari bahan ledakan berbahaya dan melaksanakan pemeriksaan detail setiap pengunjung undangan yang akan datang dengan memasang metal detector,” jelas Kabag Ops Poltabes Samarinda, Kompol Sigid Haryadi SIK, kemarin. Selain itu, pengamanan pelantikan orang nomor satu di tingkat Provinsi Kaltim ini akan dilaksanakan gladi resik pada ● Bersambung Hal 7

Togel Singapura Masuk Kaltim ● Sembilan Tersangka Ditahan di Samarinda SAMARINDA, TRIBUN- Lagi, jaringan perjudian di Samarinda terbongkar. Poltabes Samarinda berhasil menangkap sembilan tersangka perjudian di wilayah Kecamatan Samarinda Utara, Samarinda, Kalimantan Timur. Perjudian itu diduga terkait dengan jaringan perjudian besar di Singapura. Penangkapan ini merupakan yang terbesar di Kaltim tahun 2008. Kesembilan tersangka masing-masing Romze, Ardian, Marini, Robi, Heri, Said, Udin, Syukur, dan Iwan. Mereka di-

Obama Cari Rumah Kontrakan KEDUA putri Barack Obama akan memulai sekolahnya di Washington’s Private Sidwell Friend School pada 5 Januari 2009. Presiden terpilih Amerika Serikat itu pun berencana pindah ke Washington pada awal Januari 2009.

● Bersambung Hal 7

NEWS ANALYSIS

Ulama Teriak Komentar Mereka

KETUA Majelis Ulama Indonesia (MUI) Samarinda, KH Zaini Naim, menilai selama ini pemerintah dan aparat tidak tegas memberantas perjudian. Kalaupun ada, kata Zaini, hanya berupa lip service semata. Karena itu tidak heran jika judi saat ini menjadi salah satu pekerjaan yang diidolakan banyak masyarakat, termasuk di Kaltim sendiri.

Versi Anak-anak

FENOMENA maraknya judi togel atau kupon putih di Samarinda memang cukup memprihatinkan. Praktik perjudian ini pun kini menjadi sorotan berbagai pihak karena keberadaan judi togel ini dianggap sudah meresahkan masyarakat. Wakil Ketua DPRD Samarinda, Siswadi, mengatakan maraknya praktik judi togel disebabkan salah satunya akibat kurangnya lapangan kerja.

PERJUDIAN sudah menjadi budaya sebagian masyarakat kita. Ini merupakan penyakit masyarakat yang harus diberantas. Awalnya, masyarakat berjudi karena iseng dengan berharap mendapat uang besar dengan cara yang cepat. Lama-lama berProf Sarosa lanjut terus. Hamongpranoto Orang berjudi ya Pengamat Sosial Kaltim mempertaruhkan uangnya untuk mendapat penghasilan lebih besar dari sebelumnya. Perjudian di Indonesia telah di larang keras oleh pemerintah. Namun masih tetap tumbuh dimasyarakat. Ini perlu tindakan tegas aparat penegak hukum sehingga menimbulkan efek jera bagi pelakunya. Dalam memberantas judi tidak hanya polisi yang berperan. Seluruh elemen masyarakat harus turut berpartisipasi membantu aparat penegak

● Bersambung Hal 7

● Bersambung Hal 7

● Bersambung Hal 7

Lapangan Kerja

OBAMA dan istrinya, Michelle sedang berusaha untuk mencari rumah sementara untuk tempat tinggal sampai mereka pindah ke Gedung Putih pada 20 Januari 2009. Ide yang muncul adalah Blair House, sebuah guest house yang berada tak jauh dari Gedung Putih. “Kami sedang berusaha anak-anak dapat memulai sekolahnya sesuai jadwal,” kata salah satu tim transisi Obama seperti dilansir Reuters, Sabtu (13/ 12). Namun sayang, rencana itu sepertinya sulit terealisasi. Blair House, yang

dipilih Obama dan Michelle telah dipesan untuk beberapa acara dan resepsi. Blair House baru akan tersedia untuk Obama pada 15 Januari 2009. “Gedung itu sudah dipesan sebelumnya dan kami mengira, acaraacara itu tidak bisa dipindahkan. Gedung putih telah mengusahakan yang dibutuhkan keluarga Obama,” lanjutnya. Jika Obama dan istrinya tidak keberatan, keluarga Presiden AS terpilih itu akan pindah ke Blair House beberapa hari mereka pindah AP/ALEX BRANDON

● Bersambung Hal 7

Obama bersama dua putrinya, Malia Ann (10) dan Sasha (7)

Pembuatan Film Lastri Dihentikan

Kemenangan Saya Berikan kepada Kalian AKHIRNYA proses pembuatan film Lastri dihentikan. Sutradara Lastri, Eros Djarot mengatakan ada beberapa hal yang menyebabkan penghentian proses syuting yang telah menghasilkan sekitar 12 scene tersebut. Selain sulitnya perizinan untuk proses syuting, Eros menyebutkan musibah yang menimpa pemeran utama Lastri, yaitu Marcella Zalianty. “Mudah-mudahan, penahanan Marcella tidak ada hubungannya de-

ngan ini (sulitnya perizinan). Tapi kepada siapa pun, pihak mana pun yang ingin memberhentikan Lastri, Saya nyatakan hari ini (kemarin) bahwa yah untuk sementara kemenangan saya berikan kepada kalian,” ungkap Eros dalam konferensi pers yang digelar di Teater Populer, Jalan Kebon Pala I, Tanah Abang, Jakarta Pusat, Sabtu (13/12). “Tapi ingat, saya catat dalam negeri ● Bersambung Hal 7

Spirit Sukses Gde Sugianyar Dwi Putra (3)

Happy Night Journalist to Gde

50 Wartawan Terharu ORANG baik dan bersahabat itu banyak temannya. Inilah yang terlihat di acara Happy Night Journalist to Gde Sugianyar, yang diadakan wartawan media cetak dan elektronik, Sabtu (13/12) pukul 20.00 di Ocean Restaurant Ruko Bandar Balikpapan. Sekitar 50-an wartawan Balikpapan menghadiri perpisahan dengan Kepala Sekolah Kepolisian Negeri (SPN) Balikpapan. Mulai 1 Januari 2009, AKBP Gde Sugianyar Dwi Putra akan bertugas di Polda Bali, sebagai Kabid Humas

Bikin Perpustakaan dalam Penjara Memberi kepuasan terhadap orang lain adalah ibadah. Dengan kesempatan yang diberikan, Gde Sugianyar berusaha mewujudkannya dalam setiap lingkungan tempat ia bertugas. Diantaranya adalah membenahi Kantor Pelayanan Samsat dan membuat perpustakaan di dalam penjara Polresta Balikpapan.

dengan pangkat Komisaris Besar Polisi (Kombes Pol). Perpisahaan ini berbeda dari biasanya. Umumnya, yang membuat acara adalah orang yang akan berpisah. Tapi untuk Pak Gde--begitu kalau disapa-- justru wartawan dan para sahabatnya yang mengadakannya. Menghadiri acara yang diprakarsai para wartawan dan sahabatnya, suami dari Lina ini, terkejut dan sangat berterima kasih. “Sungguh saya agak

KUNCI keberhasilan hidup itu menurut saya, apapun yang kita dapatkan dan diberikan saat itu atau saat ini dalam hal tugas, diberi jabatan apa, TRIBUN KALTIM/HO/DOK GDE SUGIANYAR

● Bersambung Hal 7

Gde Sugianyar membenahi fasilitas sel tahanan di Polresta Balikpapan.

● Bersambung Hal 7


Halaman 2

■ PNI MARHAEN-NYA SUKMAWATI DUKUNG SUTIYOSO - Satu persatu dukungan terhadap mantan Gubernur DKI Jakarta Sutiyoso untuk maju sebagai calon presiden (Capres) pada pemilu 2009 mendatang terus bertambah. Setelah Partai Indonesia Sejahtera (PIS) berkomitmen mendukung penuh Sutiyoso, kini giliran PNI Marhaen pimpinan Sukmawati Sukarno Putri memberi tambahan dukungan. (persda network/ugi) ■ KASUS NEWMONT BELUM DIAMBIL ALIH PEMERINTAH - Menteri Energi dan Sumber Daya Mineral Purnomo Yusgiantoro mengatakan, pemerintah belum berencana mengambil alih kontrak karya PT Newmont Nusa Tenggara (NTT). Pemerintah masih mengupayakan penyelesaian ke arbitrase internasional

Minggu, 14 Desember 2008 terkait dugaan kegagalan Newont melaksanakan kewajiban divestasi saham 2006 dan 2007, sesuai dengan perjanjian Kontrak Karya NNT dan Indonesia pada 2 Desember 1986. (persda network/ade) ■ MARWAN: DATA SKANDAL BLBI DISEMBUNYIKAN - Anggota Gerakan Rakyat Menggugat Skandal Bantuan Likuiditas Bank Indonesia (GRMS-BLBI), Marwan Batubara menegaskan data-data atau dokumen skandal BLBI yang bernilai ratusan triliun rupiah yang kini membebani APBN tidak hilang. Pihaknya bakal membantu Komisi Pemberantasan Korupsi (KPK) untuk melacak data-data yang diduga sengaja disembunyikan pihak-pihak tertentu yang memiliki kepentingan. (persda network/ndr) ■ PANITIA ANGKET DPR AGENDAKAN UNDANG PERTAMINA SOAL ISC Panitia Hak Angket DPR berencana agendakan

pememanggilan terhadap Pertamina terkait pembentukan Integrated Supply Chian (ISC). Rencana pemanggilan Pertamina ini diungkapkan oleh anggota Panitia Hak Angket DPR, dari Fraksi PDI Perjuangan, Ganjar Pranowo di Jakarta, Sabtu (13/12). Sejauh ini, kata Ganjar Panitia Angket DPR terkesan tanpa hipotesis. Beberapa kali hipotesis disodorkan ditolak dan terkesan terjadi pengembosan dari dalam, sesama anggota panitia angket DPR. (persda network/yat) ■ RIO TINTO MASIH BERMASALAH DENGAN PEMDA - Kontrak karya (KK) PT Rio Tinto Indonesia untuk tambang nikel Lasamphala di perbatasan Sulawesi Tengah dan Sulawesi Tenggara, belum bisa ditandatangani segera. Pasalnya, Rio Tinto masih memiliki permasalahan krusial dengan pemerintah daerah. Menteri Energi dan Sumber Daya Mineral Purnomo Yusgiantoro usai mengikuti rapat terbatas di Kantor Presiden, Jakarta, Jumat (12/12) lalu mengatakan, bila juga tak kunjung selesai hingga Undang-Undang Mineral dan Batu Bara (Minerba) disepakati, kontrak karya terpaksa dilakukan dengan menggunakan ijin baru. (persda network/ade) ■ KETUA MPR DIMINTA CABUT PERMINTAAN FATWA HARAM GOLPUT Pernyataan Ketua MPR Hidayat Nurwahid yang meminta agar ada fatwa yang melarang golput, Hidayat secara terang- terangan dianggap sebagai seorang politisi yang tidak demokratis lataran meminta MUI, NU dan Muhammadiyah agar mengeluarkan fatwa haram. (persda network/yat)

Probo Minta PKS Jadi Pelopor ● Soal Pencabutan TAP MPR tentang Soeharto JAKARTA, TRIBUN - Munculnya iklan PKS yang menyatakan Soerharto sebagai guru bangsa, ternyata hingga kini masih mengusik keluarga Cendana. Melalui adik tiri mantan Presiden Soeharto, Probosutejo, keluarga Cendana meminta PKS melalui fraksinya di DPR untuk memelopori pencabutan TAP/MPR/XI/1998 tentang Soeharto. Hal ini dikatakan Probosutejo, tidak lain untuk meminta ketegasan kepada PKS dalam bersikap. “Dulu, pada saat Pak Harto dilengserkan, banyak orangorang dari PKS yang ikut menurunkan. Sekarang, seakan ingin dekat. Saya meminta kepada PKS di DPR untuk memprakarsai dicabutnya TAP MPR No 11 Tahun 1998 itu. Kalau memang mau membela Pak Harto, kenapa baru sekarang?” kata Probosutejo kepada para wartawan, Sabtu (13/12). Ia membantah, bila saat ini PKS sudah mendekati kelurga

Dulu, pada saat Pak Harto dilengserkan, banyak orangorang dari PKS yang ikut menurunkan. Sekarang, seakan ingin dekat. Saya meminta kepada PKS di DPR untuk memprakarsai dicabutnya TAP MPR No 11 Tahun 1998 itu. Kalau memang mau membela Pak Harto, kenapa baru sekarang? Probosutejo, Keluarga Cendana Soeharto. Termasuk dirinya. Apa yang ia minta dari PKS adalah hanya persoalan sikap. “Orang-orang PKS kan dulu juga ikut menghujat Soeharto. Dan Pak Harto tak perlu diberi gelar pahlawan karena beliau sudah menjadi milik rakyat Indonesia. Saya banyak bertanya kepada rakyat, dan banyak yang bilang lebih enak saat zaman Pak Harto, tidak seperti sekarang,” kata Probosutejo. “Nah, cobalah PKS meme-

lopori TAP MPR Tahun 1998 itu. Karena apa yang dituduhkan, sampai saat ini buktibuktinya juga tidak ada. Sekarang semua kelurga pak Harto dipecat dari Golkar, termasuk saya. Pak Harto juga sempat bertanya langsung kepada pak Jusuf Kalla, kenapa TAP MPR itu belum juga dicabut. Jadi, kalau mau menghargai jasa Pak Harto, tolong dicabut TAP itu. Dan sampai saat ini kami tidak dekat dengan PKS,” akunya.

Hingga kini TAP/ MPR/ 1998 belum juga dicabut. Pada Pasal 4 TAP No. XI/MPR/1998 menyebutkan, upaya pemberantasan KKN harus dilakukan secara tegas terhadap siapa pun, baik pejabat negara, mantan pejabat negara, keluarga, dan kroninya maupun pihak swasta/ konglomerat, termasuk mantan Presiden Soeharto dengan tetap memperhatikan prinsip praduga tak bersalah dan hak asasi manusia. (Persda Network/yat/ade)

PKS Tanggapi Dingin WAKIL Sekretaris Jenderal (Sekjen) Partai Keadilan Sejahtera (PKS) Fahri Hamzah menanggapi dingin permintaan adik tiri mantan Presiden Soeharto, Probosutedjo. Permintaan Probosutedjo agar PKS menjadi pioner di

parlemen untuk menghapuskan Ketetapan MPR Nomor 11 Tahun 1998 sebagai imbal atas penggunaan nama Soeharto pada iklan PKS beberapa waktu lalu, “Itukan sama dengan mengubah UUD 1945. Pak

Probo, nggak perlu terlalu jauh ke situ,” kata Wakil Sekjen PKS Fahri Hamzah saat dihubungi di Jakarta, Sabtu (13/12) sore. Fahmi menegaskan, penggunaan nama besar Soeharto pada Probosutedjo iklan layanan masyarakat PKS tidak ada sangkut pautnya dengan upaya PKS membersihkan nama baik Soeharto yang sempat dicemooh pada 1998. “Tiak ada urusan dengan itu. Statement Pak Probo itu miss leading,” ucapnya. TAP MPR No.11 tahun 1998 mengatur tentang penyelenggaraan negara yang bersih dan bebas KKN yang mensyaratkan pengusutan mantan Presiden Soeharto dan kroninya. Pencabutan TAP MPR ini sempat menghangat kembali ketika mantan Presiden Soeharto tengah bergelut dengan sakit parah yang kerap kambuh. Hingga mantan Presiden Soeharto menemui sang Ilahi, TAP MPR 11/1998 tak kunjung diberhangus.

Sementara itu anggota Fraksi PKS Soeripto justru memilih untuk tak mengemukakan pendapat perihal permintaan pengusaha Probosutedjo. “Tentu bicarakan dulu, DOK kalau soal itu. Saya tidak bisa mempunyai pendapat sendiri. Itu perlu kita bahas, karena itu suatu ketetapan TAP MPR tentang Soeharto dan kronikroninya,” ungkap Soeripto. Kendati demikian, Soeripto memastikan, PKS sendiri tidak ada niat mengupayakan pencabutan TAP MPR 11/1998 saat menggaet nama mantan Presiden Soeharto pada iklan PKS. “Tidak ada pembicaraan ke arah itu (pencabutan TAP MPR 11/1998),” jelasnya seraya berharap, Probosutedjo menemui langsung pimpinan PKS mengenai masalah tersebut. “Mestinya Probo menghubungi, atau berbicara dengan pimpinan resmi PKS dong,” tandasnya. (persda network/ade)


Minggu, 14 Desember 2008

Halaman 3

UNTUK PEMASANGAN IKLAN

HUBUNGI : 0542 - 7020152 0541 - 202417


4

Minggu, 14 Desember 2008

BPN

BPN

Djl tanah Di Jl Prona Gg Rukun Sepinggan Uk 15m x 15m SHGB Hub:08125411458

Jual / Take Over Rmh Baru Type 45/ 182 Gang PLN Jl. MT.Haryono RingRoad Hub : 0542 – 7099933 / 0811535851

117863/17 des

BPN

Rumah Dijual Cepat di Bhumi Nirwana Indah No: C-5 Balikpapan. LT/LB – 180/112 M2. 4 KT, 3 KM, RT, RK, Carport untuk 2 mobil. Listrik, Air, 2 Lantai, siap huni. Harga nego. Hub: 08161301687 / (0542)5639105117863/16

BPN

Dijual Rumah di Jl.Mulawarman RT 41 No.74 LT/LB – 195/108 M2. Fasilitas: 2 KT, 2 KM, PLN 1300 Watt, PDAM, Harga nego. Hub: 081254089918

117863/17 des

BPN

BPN

des

Disewakan Rumah Kost Mulai 350Ribuan, Lokasi Dekat Plaza Rapak, Bangunan Baru, Uk. Kmr Luas Hub: 081253140982 117863/15 des

SMD

des

SMD

Dijual Tanah Kebun Luas 1,8 ha & 0,5 ha Lok. Depan Pom Bensin Tanah Merah Hub. 08125516029 / 0541-7137832 smd/14 des

SMD

smd/14 des

SMD

smd/14 des

SMD

smd/14 des

BPN

SMD

smd/14 des

SMD

Take Over Sidekick Dragone Th’2000.hijau Met.ac/Tape/Vr.kondisi Istimewa.nego.hub.0812 5800 896 smd/14 des

SMD

SMD

smd/16 des

BPN

BPN

117863/17 des

BPN

Dijual Peugeot STI’96 Wrn Hitam Mesin Ok Tape,AC Dingin Siap pakai Hub:081347102211/ 7101023 117863/17 des

SMD

Dijual Avanza Type G VVT-I Hitam, Th’2006 Akhir, Jarang Pakai, KM 20rb, Asli Bukan Rubahan, Jok Kulit, Mulus Terawat, Hrg Nego Hub. 08125845933 NO SMS smd/16

SMD

des

SMD

Dijual Taruna CSX 2002 Wrn Merah Silver, Mulus, AC Dingin, Tape, PW, PS, CL, Jok Baru, Hrg 110jt Nego Hub. 081254242535 smd/16

Dijual Honda Stream Matic Wrn Hitam Th’03 akhir Bln Okt’, STNK Diperpanjang, VR 18’ Crom, Ada TV Slender, Bagus Terawat, Hrg Nego Hub. 081350599036 smd/16

Dijual Cepat / Take Over Kredit. Toyota Corolla Altis type G Automatic Warna Silver bln Juli 2008, Km.4800. Uang muka 180 Juta. Angsuran 8.273.000 (18x) Hub: 0542-7087875 / 08125839237 117863/17 des

des

Dijual Mits. Eterna ’92 Lengkap, AC, Tape, MP3, PW, PS, VR, Body King Mulus, Terawat, Abu-abu Metalik, Hrg Nego Hub. 081253853357 (TP)

smd/16 des

des

smd/14 des

smd/14 des

SGT

smd/16 des

smd/16 des

des

smd/16 des

SMD

Dijual Kijang Type G h’96 AC, Tape, VR, Ban Radial, Siap Pakai Hub. 262088 / 08125536622 smd/16 des

smd/16 des

SMD

Dijual Nissan X-Trail X-ST 2005 Barang Istimewa, Cat Original, Mulus, KM Rendah, An. Sendiri, Plat 2 Angka, Hub. 262088 / 081346659322 smd/16 des

smd/14 des

Dijual Xenia Li th’2007.Silver.PS PW Body mulus Mesin terawat.Pemakai Pribadi.Nego.Hub.081253362366 smd/16 des

smd/16 des

smd/14 des

Dijual L200 Super PU th’2005.Putih.Mulus.Mesin Ok.Siap pakai.Harga smd/16 Nego.Hub.081253362366

des

SMD

Dijual KIA Picanto th’07.Silver.Kondisi mulus.Lngkp.Variasi.Sound sistem.DVD.CD.Hrg.96jt Nego.Hub.08125376095 smd/16 des

Dijual cepat DAIHATSU GRANDMAX MINIBUS th’2008 awal.Biru.Fas.AC CD.Hrg.89jt Nego.Bisa Tkr Tmbh.Hub.0813 466 35657

smd/16 des

SMD

Dijual Panther Touring 2002, Cat original, Mulus, Siap Pakai, Hub. 262088 / 08125536622

Dijual Mits. Kuda Super Exceed 2000 Bensin Fas. AC, PW, PS, Tape, TV, Body Mulus, Mesin Terawat, Hrg 85jt Nego Hub. 0811585720

smd/16 des

smd/16 des

SMD

Dijual Toyota Vios Tahun 2003 Tipe E Warna Silver Harga Rp 125 Jt/ nego Hub. 0811586586

Dijual Yaris Tahun 2006 Warna Biru Tipe S Harga Rp 150 Jt/nego Hub. 081347188914

smd/17 des

Dijual Hiline Pick Up Th’96 Wrn Putih, Fas. AC, PS, Mesin & Transfer Bagus, Siap Pakai, Hrg. 55jt Nego Hub. 085250407331 smd/16 des

SMD

Dijual Kijang Krista Th’2001 Original Cat, Mulus, Bagus, Siap Pakai, Hub. 262088 / 08125536622

Dijual Sedan Mits Lancer Th’90 Bulan 7 .putih.orisinil Cat.fas.ac Cd Sound Stnk Baru.siap Pakai.hrg Nego.hub.0813 5045 0128

SMD

SMD

Dijual Sedan Great Corolla Th’93 Wrn Merah Metalik, Hrg Nego, Hub.08125586843

smd/14 des

SMD

Dijual Kijang Pu 1.8 Th’2005.hitam.terawat.mulus.nego.hub.0812 5533 655

smd/16 des

SMD

Take Over Xenia Deluxe Plus.th’2005.merah Met.ac/Tape/ Pw/Vr.kondisi Bagus.hub.0812 550 8428

smd/14 des

SMD

Dijual Escudo 20i Th’01 Hijau Metalik, Barang Mulus, Full Variasi, Original Cat, KM Rendah, An. Sendiri Hub. 262088 / 081346659322

Dijual Xenia Li VVTi Th’06 Wrn Biru Metalik, Pajak Baru, Hrg Nego Hub. 081346397934

smd/16 des

SMD

Dijual CBR Th’2006 Akhir Wrn kuning Double Disk Depan, Full Monel 31jt Nego Hub. 081253835137

Dijual Honda Stream’03 Wrn Biru 137,5Jt Nego.Tnp Perantara Hub:081347355544 117863/17

smd/14 des

Take Over Nissan Terrano Grandroad Xt Th’97.silver.ac/Tape/Cd/Sound/Pw/ Ps/Em/Jok Kulit/Vr.kondisi Memuaskan.nego.hub.0812 530 1290

117863/17 des

SMD

Dijual Truck Mits. PS 120 Th’05 Kond. Bagus, Terawat, Hrg 162jt Nego Hub. 08195083818

SMD

SMD

Dijual Bus Ryno 115 PS 17 Seat th’2002 Warna Putih. Ada AC. Harga 135 Juta nego. Hub: 0811548023

117863/17 des

SMD

Dijual Opel Blazer Th’01 SOHC Model DOHC Limited Edition Wrn Hitam Metalik, Hrg 70jt Nego Hub. 08125569707 NO SMS

smd/16 des

117863/14 des

smd/14 des

SMD

BPN

BPN

Dijual Cepat Escudo 20i Th’01 Wrn Hijau Metalik, Fas. Full Variasi, Hrg Nego Hub. 085250989567 (TP)

smd/16 des

smd/16 des

Dijual Suzuki Vitara 4x4 th’93 Warna Hitam Metalik. Kondisi siap pakai. Harga 64 Juta nego. Hub: 08125829449 / 0542-5642215

Djl cepat Kos-kosan 27kmr+2Rmh fasilitas PLN+PDAM+Garasi,tempat strategis dibelakang ex shoping kbn sayur jln gng satu RT24/24 Hub:081350461951/0542-5670753

SMD

SMD

Dijual Cepat Daihatsu Taruna CSX Tahun 2000, Cat Asli, Mesin Bagus, Siap Pakai, Fas. AC, Tape, VR, PS, PW, Harga Rp 90 Jt/ Nego Hub. 08125844247 (Tanpa Perantara)

Dijual Sedan Timor th’96.Mulus.Siap pakai.Biru.AC Dingin & Tape.Hrg.45jt Nego.Hub.081350446740

BPN

Dijual Daihatsu Clasy Th’94 Wrn Putih, fas. AC, PW, PS, Elektrik Miror, Kond. Bagus, Hrg 35jt Hub. 08125539193

smd/14 des

SMD DIJUAL VISTO TH’02 TYPE ZIPDRIVE.FAS.LNGKP,WARNA ORISINIL EXS WANITA.HRG.67,5JT NEGO.HUB.081350952114/ 0541-7187278(TP)

Dijual Toyota Avanza th’2005 akhir type G.Silver met.Istimewa.Kilometer 21.000.Jarang pakai.Hrg.130jt Hub.081350721720

Dijual Suzuki Sidekick th’97 Warna Hijau Metalik. Fasilitas: AC, CD. Ganti DP 39 Juta nego. Angsuran 2.970.000 (Sisa 9 Kali). Hub: 081253680617 117863/17

Dijual Panther Royal 2.5 Th’96.biru Tua Met.ac Tip Vr.nego.hub.0812 5488 486 Jl.aw Syahranie Gg.158

smd/16 des

SMD

smd/14 des

BPN

SMD

SMD

Dijual Suzuki Swift Th’2008 ST, Warna silver, Fas, Lengkap, Asuransi Allrisk, harga 135 Jt, nego, Hub. 081350450128

SMD

SMD

smd/16 des

Dijual Mitsubishi Colt-Truck 120 PS Tahun 2003 Harga Rp 95 Jt (Bisa Nego) Hub. 081346255164 / 0541203050 smd/16

des

DIJUAL RUKO 3 LANTAI PEMBANGUNAN (VORVO) LETAK SGT STRATEGIS , 1 MENIT DARI MALL LEMBUSWANA HUB. 081520951287

smd/14 des

SMD

SMD

BPN

Dijual Daihatsu Ferosa Th’94 Wrn Hitam, Mulus, Cat Asli, Mesin Terawat, Body Memuaskan, Fas. AC, Tape, VR, PS, Dijamin Tidak Kecewa, Hrg 55jt Nego Hub. 08125806773

Dijual Mits. Strada GLS Th’05 Kond. Siap Pakai, Hrg 185jt Nego Hub. 085250680672 / 0541-203637

smd/14 des

Dijual RUMAH BARU LT.140/160/200 Tipe 48 Fas.2KT/1KM/LISTRIK/ PDAM/SHM/IMB.Lok. JL.Rapak Indah masuk Perum. PLN & Dkt Perum Smd Resident, BISA KPR. Hub. 0812 554 4988 / 0813 5065 1118 / 0541-273063 / 0541-7155468

SMD

Dijual Sedan Baleno Tahun 1996 Warna Biru Fas. Tape, CD, VR, Kondisi Sangat Bagus, Harga Nego Hub. 081347510987

smd/14 des

Dijual Sedan Lancer Dan-gan Th’89.hitam.ac Tip Vr.mulus Siap Pakai.nego.hub.0812 5488 486 Jl.aw Syahranie Gg.158 smd/14 des

5493/16 des

SMD

For Rent / Dikontrakkan Furnished Rumah Wahana Asri Blok W I / 07. LT/LB : 200/120M2, 2KT, 1 KP, 3 KM, , Telp, Indovision, PLN (2200VA), 3 AC, Kulkas, M.Cuci, TV, Perabotan, Air Wtp. Hub: 0542 - 874931 5493/13

smd/14 des

SMD

SMD

Dijual Grand Escudo Xl7 Th’2003 Bulan Desember.coklat Muda Met.stnk 1 Thn.ac/Tape/Cd/Mp3/Jok Kulit 3baris.hub.0811585679(tp)

smd/16 des

des

des

SMD

SMD

SMD

des

smd/16 des

smd/14 des

Dijual Daihatsu Espass Tahun 2000 Warna Merah Metalik, Fas. AC, Tape, Jok Kulit, Kondisi Mulus, Siap Pakai, Harga Nego Hub. 081346697920

SMD

DIJUAL TANAH LUAS 400M2,SHM,JL.AW SYAHRANI GG.45.HRG NEGO.TELP. 0812 537 11780

smd/13 des

SMD

Dijual Kuda Super Exeed Th’01 Jarang Pakai Wrn Hijau Lumut Hrg 80jt Nego Hub. 0541-250295

SMD

Dijual Daihatsu Zebra Th’91 4 Cil, Bak Jumbo, 3 Pintu, Warna Coklat, harga 13 Jt, nego, Bisa TT Spd Mtr, Hub. 085250818420 smd/14

DIJUAL RUMAH KOMP. PERUM PELITA INDAH NO. 64 SEPINGGAN LT.193 LB.100 KT.4 KM.2 PLN, PDAM, TELP, SHM HRG NEGO HUB. 081227581818/ (0293) 313177

smd/15 des

SMD

Djl Katana Th’90 Wrn Hitam, Mesin Prima, Butuh Dana Hrg 27jt Hub. 081350741769

smd/14 des

BPN

DIJUAL CEPAT KOS-KOSAN PUTRI DI PRAMUKA 6 + 20M DARI UNMUL + MOBIL XENIA HUB. 081347013929 / 05417217677

BPN

117863/15 des

Djl Cpt Rumah Tngkat 2 Di Komp. Graha Indah Blok A No.12B Balikpapan, Fas. 3KT, 2KM, RT, RK, DPR Luas, Teras, Pagar,Lstrik, Air, Hrg NG Serius Hub. 0542860317/ 085246061617 (TP, No Sms)

smd/15 des

SMD

Djl Cpt Rumah Tngkat 2 Di Komp. Graha Indah Blok A No.12B Balikpapan, Fas. 3KT, 2KM, RT, RK, DPR Luas, Teras, Pagar,Lstrik, Air, Hrg NG Serius Hub. 0542860317/ 085246061617 (TP, No Sms) smd/15 des

5493/23 des

BPN

SMD

smd/14 des

smd/14 des

SMD

Dijual Cepat Mobil Suzuki Sidekick th’1995 Warna Hijau Metalik. Fasilitas lengkap. Harga 70 Juta nego. Berminat bisa hubungi HP NO.08125857922 117863/17 des

Dijual Aveo LT Th’2004 Wrn Hitam Metalik, Masih Mulus, Fas. Komplit, Ada TV, Hrg Damai, Hub. 081346407563

SMD

BPN

Dijual Daihatsu Xenia Li VVTi th’2007 Sporty Warna Hijau Lumut. Harga nego. Hub: 081347335999

117863/17 des

des

Dijual Isuzu Touring th’2003.Warna Astra Blue.Fas.lngkp.Hrg.132jt Nego.Hub.0541-7750988

BPN

Dijual Kijang LGX Diesel th’2002 Warna Silver. Lengkap. A/N pribadi. Harga nego. Hub: 08164582772

Dijual Suzuki Carry 1000 Pick Up Th’87, Fas. Standar, harga nego, Hub. 081346658682 smd/14

smd/16 des

BPP

DIJUAL KIJANG INNOVA TYPE G TH.06 BLN 10 DI BONTANG, WRN HIJAU METALIK, KM RENDAH (39000) KONDISI MULUS,TERAWAT (081347394245

SMD

SMD

SMD

Dijual Bis Mits PS 135 th’2003.Enam Roda.PS, kursi 40 buah.Mesin Ok.Body bagus.Hrg.130jt Nego.Hub.0816209137

117863/15 des

5493/13 des

SMD

Dijual Sidekick ‘98, STNK An. Sendiri Baru, Hitam Metalik, 99 Orisinil Cat, Bodi Kaleng, PS, CL, Alarm, AC dingin, Tape, CD, 83jt Hub. 08125535945 / smd/14 des 0541-9125462

smd/14 des

DIJUAL TANAH (SHM) UKURAN 1730 M2, JL. PUPUK, DEKAT UNIBA, HUB : 081952374888

117863/21 des

117863/15 des

SMD

Dijual Honda Crv Th’2003 Akhir.hitam.matic.fas.lngkp.mulus.terawat.hrg Nego.hub.0812 5429 9951

Dijual Panther LM Smart.th’2005.Biru.PS PW Sound sistem VR.Hrg Nego.Hub.081347306797

5493/14 des

Dijual Rumah Dekat Pantai Lamaru Ukuran 7x18m2 fasilitas: Lengkap Depan Jalan Besar Lengkap Dengan Isi Dagangan Telp. 790705/081347413732

smd/21 des

DIJUAL CEPAT RUMAH TYPE 48 LT. 196M2, FAS. 2KT, 1KM, LISTRIK, AIR, POSISI HOOK, HAL. LUAS, LOK. JL. INPRES PERUM BUMI SEMPAJA BLOK. DC NO. 10 SMD, HRG NEGO HUB. 081346221818

BPN

RUKO DJL DI PANTAI MAS PERMAI BLOK A NO.18 2LT, UKR. 5X12, LIST 3500WATT, PDAM, TLP 8 LINE, AKTE, IMB, HRG NEGO HUB: 0811541081/5619452

BPN

SMD

Dijual: Tnh Luas 300m, Lks Jl.Ruhui Rahayu, dkt Waduk/ DOME, Sertifikat HGB Hub. 0542-780220

Take Over Xenia Xi 1300cc Deluxe Plus.ganti Dp 50jt.angsuran Kurang 33x.angsuran 3,7jt.hub.05417108507/081545429507

SMD

SMD

BPN

Dijual TTanah anah 10 x 26 Jl. MT MT.. Haryono Dalam, Hub : 5627717

des

117863/21 des

BPN

SMD

Take Over Kijang Lx 1.8 Th’2002.hijau Met.ac D/Blower/ Cd.kondisi Bagus.hrg. nego.hub.0813 4656 1988 smd/14

des

des

SMD

Dijual Carry 1000 Station Th’85, Velg Racing, Fas, Tape, Siap pakai, harga nego, Hub. 081346658682

smd/18 des

Dijual Rumah 2 Lantai di Pupuk Timur I. LT/LB – 335/150 M2. Harga nego. Hub: 0542-7139969 / 08125597599

SMD

Dijual Sidekick ‘98, STNK An. Sendiri Baru, Hitam Metalik, 99 Orisinil Cat, Bodi Kaleng, PS, CL, Alarm, AC dingin, Tape, CD, 83jt Hub. 08125535945 / 0541-9125462 smd/14 des

117863/14 des

BPN

Dijual Rumah + Perabot Lengkap Siap LT/LB : 300/72 M², SHGB, IMB, PLN, PAM, Tlp, 2KT, 2KM, AC, RT, RK, Dapur, Hrg 360jt Nego Hub. 081253853357 (TP) smd/14

Dijual Mau Pindah. Ruko 2 pintu 2 ½ lantai di Jl.Jend.Sudirman RT40 No.481 Stalkuda, Balikpapan. LT/LB – 208/360 M2. PLN 5500 Watt, PDAM. Harga nego. Hub: 0542-7135000 / 5493/23dese 08125423315

SMD

Dijual Kijang LGX Solar Th.2002, Wrn Biru, Fas Lengkap, Hrg nego, Cat Asli, Hub : 081350965924

Djl Rmh Siap Huni Di Perum Daksa Kota Hijau Jl. Daksa Timur 6 No.6 LT.150 M2 Bangunan 2 Lt Fas : List, Air, WTP, Srtfkt, 2 KT, 1 KM, Carport, Hrg 215 Jt nego, Hub : 081347801105, TP 117863/14 des

Tanah Dijual Uk. 10x20M, Hrg 80jt Jl. Ery Suprajan di Belakang Masjid, Stasiun Pemancar TVRI, M. Yamin Hub. Hadi 081347720580

smd/17des

Dijual Ruko Di Jl. A. Yani 22, 3 Lantai Pinggir Jalan, Letak Sangat Strategis Hub. 05417133701

BPN

SMD

BPN

SMD

Dijual Innova G Fasilitas V Th’2005 Pemakaian 2006 Wrn Hitam, Plat 3 Angka, Hrg 167jt Hub. 08125539887 Bs tukar Tambah

117863/14 des

SMD

Dijual Cepat Rumah Perum BPD Batu Butok No.103 SHM, Luas 17x21, 3Kamar Tidur, 2Kamar Mandi, Harga Nego Hub: 0542-7160077/ 117863/14 des 081347016187

117863/15 des

BPN

des

smd/14 des

Dijual Ruko Bangunan & Isi Barang (Mau Pindah) Lok. Pinggir Jalan Raya LT/LB : 525M2 / 12X25X2 + Isi Total Barang Bangunan (@ + 1,5 M) Sudah banyak Pelanggan, Surat-surat Lengkap (SHM), Ass, Fas. Air, Listrik, 2 Saluran, 2Unit Genset Premium & Solar, 5KT, 3KM + WC, Jl. AW. Long Senopati Tenggarong Hrg Nego (TP) Hub. 0541-7118953 / 0541-662963 (Bonus Mobil PU T120SS Th’05)

5493/16 Des

SMD

DJL RMH DI GN. MALANG RT 31 NO.E-98 LT/LB.300/225, 3KT, 2KM, 2 DPR, RT, RM, RK, R.SAMPING, GRS, LIST 2200, TANDON AIR 6M3, SHM, IMB, TLP, HRG NEGO HUB: 081520302113/5619452/7204580

Dijual Rumah 2 Lantai di Balikpapan Baru. LT/LB – 150/150 M2. Fasilitas: 2 KM, 3 KT, Garasi, PLN 2200 Watt, PDAM, Telp. Harga nego. Hub: 081346443881 117863/15 des

TGR

DIJUAL RMH SAMARINDA SEBRANG KOMP GEMILANG 2/PERUM BRIMOP, LT.188 LB.60 FAS : AIR, LIST, PINGGIR JLN ASPAL,TNH BLKNG SDH PONDASI, DKT SMPN 8, HRG NETT, TP, 225 JT HUB : 08125887635

5493/30 des

BPN

BPN

TANAH DIJUAL, SHM, LOKASI GN.TEMBAK LUAS 21.600 M2, HRG 17.500/M NEGO HUB : KSU BINA KARYA 081350550978

117863/15 des

de

Dijual Ruko Balikpapan Permai (BP) 6X20X2 Lantai Hub. 0811872037

BPN

SMD

JUALTANAH&BANGUNAN 532 M2 JL.BLORA II RT 07 NO.47 BLKG BANK DANAMON PSR BARU KLANDASAN ILIR BPN.HUB:021-8860674 HP.085710017445/02133274203 BP FACHMI AZIZ.T.PERANTARA

Jual Rumah di Inpres 4 Gang Karya Bersama RT 5 No.33 LT/LB – 348/ 300 M2. Air, Listrik, Garasi, 3 KT, Gudang, Garasi. Harga nego. Hub: 0542-7013032, 5605049, 081347550025 5493/29

117863/16 des

Dijual Kios Pasar Pandansari Yang Baru, Murah, BU, Tidak Menerima SMS, Tanpa Perantara, Hub : 081350455409

Dikontrakkan Rumah Jl.RE Martadinata RT 052 No.11 Komplek Prevab. Fasilitas: 3 KT, 2 KM, Garasi, Full Furnished, PDAM, PLN 2200 Watt. Harga 35 Juta/tahun nego. Hub: 0542424911, 422538 / 081346441258

Dijual Cepat Rumah Type 48 LT. 196M2, Fas. 2KT, 1KM, Listrik, Air, Posisi Hook, Hal. Luas, Lok. Jl. Inpres Perum Bumi Sempaja Blok. DC No. 10 Smd, Hrg Nego Hub. smd/14 081346221818

BPN

Dijual Daihatsu Charade (Cerio) Kapsul Th’88 Kond. Tidak Mengecewakan, AC, Tape, Ban Baru 5 Buah, VR, Hrg 23jt Nego Hub. 081254297255

des

BPN

BPN

DIJUAL CEPAT” Ruko Komp. BB (cck utk kantor & Usaha)LT/LB 75 / 150 m2, 2 ¼ Lantai, Full Bangunan, PLN 5.500 W, Hdp Tmr, AC. HUB : ENGEL 7117067 / 081346667000

BPN

BPN

Dijual Tanah Kavling Siap Bangun Uk. 10X20 m² Jln Kav 8 M Dekat Gedung DPR Karang Paci Hrg 12,5jt Bs Bayar 3X Hub. 0541-7097094 / 081347819779

Dijual Kav Siap Bangun Dkt SMU 4 Sepinggan, Lokasi Tinggi, Bebas Banjir, Bersertifikat, Hub : 7021557 / 0811998828 117863/16 BPN

Dijual Rumah + Perabot Lengkap Siap LT/LB : 300/72 M², SHGB, IMB, PLN, PAM, Tlp, 2KT, 2KM, AC, RT, RK, Dapur, Hrg 360jt Nego Hub. smd/15 081253853357 (TP)

117863/17 des

BPN

117863/16 des

TGR

BPN

Dijual/Disewakan Rmh Wika Blok C414 ,Listrik,P DAM, 2 KT, 2KM. Hub:081347256789/ 0811534949

117863/17 des

Dikontr. Rmh Samping Telkom Ring Road Gg. Tanjung No. 50, 3KT, Fas: 2AC, PDAM, PLN, Garasi Hrg Nego Hub: 08125422399/ 081347851908

BPN

Dijual Sedan Suzuki Esteem Th’95.abu-abu Met.fas.ac Tape Cd Vr.barang Istimewa.hrg Nego.hub.0812 5424 7406 smd/14

BPN

iwa/24 des

Halaman

Dijual Taruna OXXI 1,5 FGX Th’2005 Jarang Pakai, Wrn Hitam, Body Mulus, Fas. Lengkap, Tangan Pertama, Hrg 125jt Nego Hub. 085247070597 / 081347546805 smd/16 des

smd/17 des

SMD

Dijual Cepat BU Daihatsu Ferosa ’96 Original Body / Body Kaleng, AC, TP, VR, PS, Pakai Pribadi, Jarang Pakai, Kond. Siap Pakai, Hrg 54jt Nego Hub. 08125879730 NO SMS smd/16 des

SMD

Dijual Escudo 20i Th’06 Wrn Gold Metalik, Barang Mulus, Full Variasi Original Cat, KM Rendah, An. Sendiri, Hub. 262088 / 081346659322 smd/16 des


Halaman 5

Minggu,14 Desember 2008 BPN

BPN

Dijual Mobil Rocky Th.91 Akhir KT 899 BR Velg Racing, Radio Tape, AC, Harga Nego Hub. 081347845791 Tanpa Perantara 117863/18 des

BPN

BPN

Dijual Toyota Starlet 89 Wrn Hitam Metalik/ SMD Fas. AC, DVD/ USB & Power Hrg. 31,5jt Hub. 08125357222

Djl Kjg LGX Th.01 Bensin Siap Pakai Fas. Lengkap Hrg 115jt Nego Bisa Tkr Tambah Hub. 08125879547

117863/18 des

BPN

des

BPN

117863/17 des

Jual Cepat Aveo Th.2005 Wrn Hitam, Lengkap & Mulus, Berasuransi, Harga 92 Jt nego, Hub : 6157830

117863/17 des

BPN

117863/17 des

BPN

Dijual Pik Up Mitsubishi L-200 Tahun 2005 Pemakaian Agustus 2006, Wrn Silver, Mesin Ok (Bisa Kredit) Hub : 0542 – 427366 / 0542 – 5646872 (No SMS)

117863/17 des

BPN

des

SMD

BPN

117863/17 des

BPN

Jual take over Escudo biru met th94dp48jtangs 1.900,cat asli fulvar istimewa ban pelek baru,cpt pajak baru 081346222519 117863/15

117863/16 des

des

BPN

des

BPN

Dijual Innova G 2.0 Th.2005 Wrn Hitam, Km + 27.000 Service Rutin Auto 2000, Terawat, Hub : 0542 - 5694012 117863/15 des

TGR

SMD

Dijual Mits. Eterna ’92 Lengkap, AC, Tape, MP3, PW, PS, VR, Body King Mulus, Terawat, Abu-abu Metalik, Hrg Nego Hub. 081253853357 (TP) smd/15 des

SMD

Dijual Escudo Th’96 Kond. Bagus, Orisinil Cat, Merah Marun, Mesin Halus, AC, Tape, Lengkap, Hrg Nego Hub. 085250912409 smd/15

Dijual Xenia XI VVTi Th’06 Wrn Hijau Muda Metalik, Milik Pribadi, Terawat Hrg Nego Hub. 081346214223 (TP) des

smd/15 des

SMD

des

SMD

Dijual Truck 4 ban Elf 77 PS BOX UERO 1 Plat Surabaya, Barang sangat istimewa, KM 23 rb, AC, Radio Tape, harga 125 Jt, nego, Hub.081254214115 smd/15

SMD

BPN

smd/14 des

BPN

Dijual Toyota Hi-Lux Double Cabin 3.0 Turbo th’2006 Kondisi Ok. Harga nego. Hub: 0811548023 117863/14 des

BPN

Dijual Daihatsu Zebra PU thn 92/93 – CDI Kond. Siap Pakai, Mesin Sangat Prima, Harga 14,5 Juta Hub : 0542 5624801 117863/14 des

BPN

117863/14 des

BPN

117863/14 des

BPN

Dijual Mobil Mazda MR Th.1992, Wrn Merah, Hrg nett 22,5 Jt Hub : 08125413560, TP 5493/18 des

Djl Tyt Kjg Th.90/91, STNK Baru, Wrn Hijau, Kond Msn Prima + Hls, Irit BBM, Fas : AC Dingin, Tape, VR, Karpet Baru, Body Luar Dlm Mls, Trwt, Ex Wnt, Hrg 37,5 Jt nego Hub : 117863/14 des 081348449625

smd/16 des

smd/15 des

Dijual Mobil Kijang SGX Bensin 1,8 Th’2000 Wrn Biru Relaxa, Fas. VR, AC Double Blower, Mulus, Terawat, Plat Smd, Orisinil Cat, Pemakaian Pribadi Hub. 085246766857 / 081346645692 (NO SMS) smd/14 des

Mobil Mitsubishi Triton Gls Tahun 2007 Hub : 08164580854 5493/11

Dijual Daihatsu Zebra Minibus 94/95 Adiputro Merah. Ada tape, radio, kondisi mesin body prima, tinggal pakai, harga 26,5 jt, Hub : 081347867928 117863/14 des

BPN

Djl Kjg Gran Xtra Long Th.96 Akhir, Wrn Mrh Mtlk Mls, Msn Prima, Lkp : PS, PW, CL, AC, Double Blower, Tape Kenwood, Remote Alrm, VR R16, Full Variasi, Hrg 65,5 Jt nego, Tlp. 117863/14 des 085246441226 Tdk SMS

SMD

SMD

smd/14 des

BPN

Dijual Panther Pick Up Th’00 Wrn Hitam, VR, Standar, Jarang Muat Berat, HRg 57,5jt Nego Hub. 08125847136 smd/14

des

BPN

Jual Daihatsu Xenia Li Plus th’2005 Akhir. Fasilitas: CD JVC, Pwr stering, Pwr window, STNK baru, Plat No.pilihan, Asuransi All Risk = 101,5 Juta. Hub: 081350341670

117863/14 des

BPN

Jual Isuzu Panther Pick Up th’03/04 Pwr str, AC, Tape. Kondisi oke = 69,5 Juta. Hub: (0542)7007989 117863/14 des

des

SMD

smd/16 des

des

Djl Kjg LX Th.2002, Wrn Mrh Met, Pemakaian Pribadi, Km Rendah, Body Mls, Msn Hls, Msh Ass, Hrg 105 Jt nego, Hub : 117863/14 HP.085246471194

117863/14 des

Dijual Cepat Honda City VTec M/T Th 2004 Warna Hitam Metalik Mulus Terawat, Pajak Panjang Hrg 135Jt (Nego) TP. 081347141101

Dijual Cepat Honda New Stream ABS Thn 2006 Warna Silver Stone ganti DP Rp 65 Jt/Nego Sisa 34 bulan x Rp 5,4 Jt Berminat serius smd/15 Hub. 085250233555

des

SMD

des

smd/14 des

smd/15 des

BPN

Djl Kijang Grand Extra Kondisi prima lengkap, Full Variasi, Siap pakai. Harga 57,5 juta nego. Hub: Sdr AROEM 117863/14 des 08125344964

Dijual Kijang PU Th.2002, Wrn Hitam, Kondisi Terawat, Siap Pakai, Hrg 76 Jt nego, Hub : 0542 – 7184716, TP 117863/14 des

BPN

Dijual Suzuki Sidekick’96 AC, Tape, CD MP3, Pwr Window, Pwr Steriing, CL, VR Ring 18, Full Variasi Harga 82,5Jt Nego Hub: 0542-7148477/ 08115406364 117863/14

des

Dijual Isuzu Panther LS Th.2002 Oktober, Fas Lengkap, Hrg 115 Jt nego, TP, Hub : 5615793

117863/14 des

BPN

Dijual Toyota Kijang LGX Th 1999 Bensin Warna Coklat Metalik Mulus/Terawat Hrg 110Jt Nego Hub: 081347356181 117863/14 des

Dijual Kijang LX Bensin Th 2003 Kond. Siap Pakai Cat Asli, Mulus, Hrg Nego Hub: 0542-7105476

117863/14 des

SMD

Dijual Espass PU Th.2004, Wrn Hitam, Siap Pakai, Hrg 42 Jt nego, Hub : 0542 – 9171736, TP 117863/14 des

SMD

Dijual Kijang Lsx Th’2004.hitam Met.mulus.hub.0813 4742 0922

des

Dijual Take Over Mitsubishi T120SS Station Th’97/98, Ganti DP.20 Jt, sisa 12X, Rp.1.611.000/bln, Fas, lengkap, hub. 08125468931

BPN

Honda Civic Wonder Th.86 Pelag Racing, AC/Tape, Cat Mls, Ban Baru, Kond Siap Pakai, TP, Hrg nego, Hub : 0542 - 678407 117863/14 des

Dijual Colt T 120 ss Warna Putih Tahun 2003 Harga Rp 33 Jt (Bisa Nego) Hub. Hub. 081346255164 / 0541-203050 smd/15

SMD

Dijual Honda New Stream 1,7cc, Th’04 Manual, Cat Orisinil, CD, MP3, Ex. Wanita, Tangan Pertama, Mulus, Terawat, Hrg Nego Hub. 08125804158/ 05417750389 ( Bs Tukar Tmbah) smd/14

117863/14 des

smd/15 des

SMD

BPN

BPN

des

smd/15 des

BPN

Dijual Mobil Innova Th 2005 Type “V” M/ T Assesories Komplit/Mulus Warna Hitam Harga 173 Jt Nego ( Tanpa Perantara ) Hub: 08125802186

117863/14 des

BPN

Dijual cpt Dumptruk Mits PS135 th’06.Full panjang 420cm,tinggi 140cm.Siap pakai.Hrg bisa nego.Hub.081346476987

Dijual Chevrolet Aveo LT Sporty th’2005 Akhir. Warna Hitam Metalik. Harga 95 Juta nego. Hub: 081952503344 117863/14

BPN

Dijual Honda Jazz Thn 2005 Warna Silver Metalik, Type IDSI Manual, Kondisi Sangat Mulus Harga Nego Hub: 0542-7213025/08152021215

Dijual Mitsubishi Colt-Truck 120 PS Tahun 2003 Harga Rp 95 Jt (Bisa Nego) Hub. 081346255164 / 0541203050

BPN

BPN

BPN

Dijual Suzuki Katana GX Th.96, Wrn Hijau Botol, Fas : AC, Tape, VR, PS, Body Kaleng, Cat Asli, Hrg 52 Jt nego, Hub : 0542 - 9106744 117863/14

smd/14 des

smd/15 des

SMD

SMD

Dijual Ford Ranger 4X4 Double Cabin Th’03 Hub. 0811872037

smd/15 des

Dijual L300 STARWAGON th’2006.Putih.Kilometer 30rb.Jarang Pakai.Mulus.Terawat.Fas.lngkp.Hrg.135jt bisa Nego.Hub.0813 4706 1075

SMD

smd/15 des

Dijual Mobil Kijang LX Th’98 Akhir Wrn Biru, STNK Baru, Fas. AC, Tape, Mulus, Terawat, Hrg Nego 83jt, Hub. 08125514077 smd/15 des

SMD

Djl Katana Th’90 Wrn Hitam, Mesin Prima, Butuh Dana Hrg 27jt Hub. 081350741769

Dijual Isuzu Panther LV Warna Silver Tahun 2001 Harga Rp 50 Jt (Bisa Nego) Hub. Hub. 081346255164 / 0541-203050

117863/15 des

smd/15 des

smd/15 des

des

des

SMD

SMD

Dijual Suzuki Escudo th’95.Merah met.Fas.AC Tape+power.VR 17”.Jok depan modifikasi.Hrg Nego.Hub.0812 5533 791 smd/15

smd/15 des

BPN

des

smd/15 des

Dijual Kijang LSX Diesel Tahun 2002 Warna Silver Orisinil Cat Bisa Kredit DP Rp 35 Jt Harga Nego Hub. 081347001333 (No SMS)

Dijual Kijang LGX Th’2001 Evi 1,8 Wrn Biru, Plat Sangatta, Full Variasi, Kond. Terawat, Cat Orisinil, Pemakaian Pribadi, Hub. 085246766857 / 081346645692 (NO SMS)

smd/15 des

des

SMD

Dijual Opel Blazer Th’01 SOHC Model DOHC Limited Edition Wrn Hitam Metalik, Hrg 70jt Nego Hub. 08125569707 NO SMS smd/15

Dijual Xenia th’04 akhir.STNK baru.Kondisi mulus.Lngkp Variasi.AC Tip VR PW.Hrg.95jt Nego.Hub.0812 557 9223

SMD

SMD

BPN

Dijual Jeep Willys th’61 (4x4) Kondisi Antik Siap Pakai, Harga Rp. 16,5 Jt Hub : 0542 5676017

Dijual Strada L200 Mega Cabin th’2006 akhir.Mulus siap pakai.Silver.Nego.Hub.Chris 0812 550 7115

117863/15 des

Dijual Feroza SE th’94.Mulus.Siap pakai.Fas.DVD/MP4/VCD/AC dingin.Hrg.45jt Nego.Hub.0812 5391 3447

SMD

SMD

Dijual Mitsubishi L-300 Hi Roof Warna Putih Tahun 1997 Harga Rp 35 Jt (Bisa Nego) Hub. Hub. 081346255164 / 0541-203050

BPN

Dijual Toyota Kijang LX EFI th’2003 Warna Silver. Fasilitas: AC, Tape, VR, Km.rendah. Harga 105 Juta. Hub: 085246201110

smd/15 des

SMD

SMD

Dijual Honda Jazz IDSI Th’04 Bulan 12 Akhir Wrn Hitam, Fas. Full Variasi, Jok Kulit, Hrg 128,5jt Nego Hub. 081346444897

smd/14 des

des

Dijual Honda Jazz IDSi M/T Tahun 2008 Warna Silver Metalik, Ganti DP Rp 49 Jt Sisa 38 Bulan x Rp 4,7 Jt Berminat serius Hub. 08125318040

smd/15 des

SMD

Dijual Kijang Innova G Th’2004 Wrn Biru, Pajak Baru, Terawat, Hrg 150jt Nego (TP, No SMS) Hub. 081347797239

Dijual Kijang LSX th’97.Hitam.Kondisi Mulus.Siap Pakai.Hrg Nego.Anda Berminat Hub.0812 585 6869 / 0813 4704 smd/15 3779

117863/16 des

Dijual Toyota Kijang LGX th’2002/ 2003 Warna Biru Metalik. Kondisi bagus. Harga nego. Hub: 081253256299 117863/16

Dijual Honda Jazz IDSi Th.2005 Wrn Htm Fas Lengkap Ada TV & Sound, Kondisi Sangat Mulus & Terawat, Hrg 133 Jt nego, Hub : 0811597031

SMD

Dijual Cepat (BU) Panther Hi-Sporty Th’1997 Wrn Biru Silver, Mulus, Siap Pakai, Hrg Nego Hub. 08115804927 / 0541-7169365

Dijual Honda Genio Silver 94, VR, EM, Alarm, CD, MP3, Full Sound System, Sensor Parkir, Hrg 69jt Nego Hub. 08115802204

SMD

SMD

Dijual Toyota Kijang LX-Diesel Warna Merah Metalik Tahun 2001 Harga Rp 98 Jt (Bisa Nego) Hub. 081346255164 / 0541-203050 des

smd/15 des

SMD

Dijual HONDA NEW CITY.Merah Met.th’2003 akhir.Kondisi mulus.Kilometer rendah.Bisa tukar tambah.Hub.0813 4662 9777 (boleh smd/15 kredit)

Dijual KIA Carren II Th’04 Akhir Wrn Hitam, Kond. Orisinil Prima, Fas. Lengkap, Hrg Nego Hub. 085247456188 / 0541-7154277

smd/15 des

des

BPN

SMD

SMD

SMD

117863/16 des

Dijual Toyota Corolla SEG Th.2000 Wrn Hitam, Kondisi Baik, Hrg 95 Jt, Hub : HP. 087812202696

Dijual Hrg Terbaik Hanya 93jt Xenia Full Asesories, Plat cantik 3 Angka, Wrn Biru, Ban Ring 15, Segera Hub. 0811549707 / 0541-7070740

DIJUAL TOYOTA VIOS TYPE G TH’05 WRN: SILVER KONDISI ISTIMEWA HUB: 05427096996 ATAU 0811549549

Dijual Cepat Honda Tiger th’99 Warna Hitam Silver. Kondisi Sipp..!!! Berminat. Hub: 0816200799

117863/15 des

117863/15 des

Dijual Ford Ranger Double Cabin th’2007 Warna Silver Metalik. Cash & Credit. Hub: 0542-7206868 / 0816202166 (Jacky) 117863/15 des

SMD

Djl Espass PU Th’02 Bln 12 Wrn Putih Soun System Oke, Msn Oke, Pajak Panjang, Hrg 33Jt Hub: 05427142107

Dijual Visto KIA th’2003 Warna Hitam Metalik. Mulus, AC, Power Window, Power Stering, Tape, Siap pakai. Harga 82 Juta nego. Hub: 08125800153 117863/16

BPN

BPN

SMD

BPN

117863/16 des

117863/16 des

117863/17 des

BPN

BPN

BPN

Dijual Toyota Corolla Twin Cam Th’91 Fas: AC/Power Window Kond. Mesin Baik/TP murah Hub: 0542-7164748/ 08158958615 117863/16 des

117863/15 des

117863/16 des

des

des

Dijual Cepat Suzuki Katana th’86 Warna Biru. AC, Tape. Harga nego. Hub: 0542-417959 / 0818.277.432

Take Over Xenia 1.3 Duluxe Th.2007, Wrn Silver, Service Rutin Daihatsu, Ganti DP. 70 Jt nego, Sisa Angs.29x Hub : 0542 – 5640302 / 081347782030

Djl Isuzu Panther LM Smart Th 2006 Wrn Silver Kondisi Siap Pakai Hrg 124Jt Hub: 081254314014

BPN

SMD

SMD

Dijual Honda Jazz IDSI Th’2005 Wrn Biru, Fas. Lengkap, Hrg Nego Hub. 08115809249

des

117863/15 des

Dijual Cepat Butuh Dana Honda Jazz th’2005 bln 12. Pajak baru. Warna Biru Metalik. Harga nego. Hub: 081350510778 117863/16

Dijual Cepat Toyota Innova E20 2007 Warna Hitam Met Eksterior Innova V Hub:08125439339/ 0542-7074337

BPN

BPN

BPN

Dijual Kijang Kapsul LX 2003 Wrn Biru Met, Cat Asli/Mulus,AC, Tape, Hrg Nego Hub: 0542-7084059

Dijual Mitsubishi Maven GLS th’2007 Warna Hitam, Mulus, Double Blower. Harga nego. Hub: 0542-5629654, 7096847

117863/15 des

117863/16 des

BPN

Dijual Mobil Xenia 1.3 Deluxe Biru Metalik Ganti DP 65Jt/Angsuran 2,8/ Bln Sisa 32x Kondisi Oke Hub: 081253965770/7087666 117863/15

117863/17 des

des

Dijual Mobil L 200 Th 2008 Double Cabin Wrn Merah Take Over sisa 13x angs Rp 10.321.000 Hrg Nego Kondisi Mulus Jarang pakai Hub:05427129694/081347089559 117863/17 des

BPN

Dijual Suzuki Porsa Thn 89 Wrn Abu2 Mtl Pajak baru,PR<AC tape,PW Siap pakai Body Mulus Msn Halus Hrg 26,5Jt/Nego HP 117863/17 08125871726

117863/17 des

117863/17 des

BPN

Dijual Katana’89,AC Dingin,TP,VR,Msn Standar,Cat Mulus,Baru Decco,Dbl Gardan,Msn Halus Standar Hrg 28,5Jt.HP 081346243667 117863/17

Dijual Mobil Xenia 1.3 Xi Th.06 Sporty, EM, Full Variasi, Wrn Hitam, PS, PW, CL, Remote, Hrg nego Peminat Hub : 0542 - 7243280

Dijual Mobil Sedan Forsa th’86 Warna Merah. AC, Tape. Harga 28 Juta Bisa nego. Hub: 05425646788, 5618147

BPN

117863/16 des

BPN

Dijual Ford Everest 4x4 M/T th’2004 Warna Hijau Metalik. Cash & Credit. Hub: 0816202166 / 0542-7206868 (Jacky)

117863/16 des

Dijual Misth. Galant Th’93 V6 Hitam, Harga 55Jt Nego Hub: 085820561029

BPN

Djl Xenia XI Family 1.3 Th’05 Cat Asli, AC, Tape, VR, CL, PW, PS, EM Jok Kulit, Mesin Istimewa, Kond Seperti Baru Hrg (Nego) Hub: 0542780116/085247512594 117863/15

Dijual Cepat Mobil Isuzu Panther LM 2.5 th’2004. Ada TV & DVD. Harga 103 Juta nego. Hub: 0542-7033883

117863/17 des

BPN

BPN

BPN

BPN

Dijual Toyota Hardtop Th.82 Akhir, Wrn Merah Ferari, AC, Tape, PS, Kondisi Bagus & Terawat, Khusus Collector, Harga nego, Hub : 0542 7090861

BPN

117863/17 des

5493/16 des

117863/17 des

Dijual Mobil Panther Hi-Grade Th.1996, VR-VW, Tape, AC Double Blower, Harga 63 Jt nego, Hub : 081520335111

Jual Mercy A140 th’2002 Warna Hijau Botol, Airbag, KT Cantik 2 angka manual 1400 CC. Hub:08152010434

BPN

BPN

BPN

BPN

BPN

Dijual Toyota Hardtop Single Cabin Th.82 Ada Win Muka + Belakang, Ban Simex Ring 36, Ada AC, Siap Pakai, Hrg nego, Hub : 08125849267

Dijual Kia Carnival 2001 Matic, Kondisi Terawat, Sudah Over Houl, Harga 80 Jt nego, Telp. 0542 7156565

des

des

Djl Isuzu Black Panther LS Th’03 cat asli msn oke ac dobel tape(DVD,MP4,FM USB).Hrg 125Jt.Hub:0811541932

Dijual Corolla Twin cam Thn 88 akhir warna hitam ban radial velg racing 16" AC/Tape Power Window Central lock Remote komplit.Hrg 33Jt/ Nego.hub:085347006087 117863/17 des

BPN

Dijual Daihatsu Xenia Li th’2004 Warna Silver Metalik. Harga nego. Hub: 0542-5631779

Dijual Daihatsu Xenia Li th’2007 Warna Biru Muda Metalik. Harga nego. Hub: 081347833341 117863/17

117863/17 des

Jual Mercedes Bent C 180 Th. 94 ABS Hitam A/T An Sendiri Mesin Injection 1800cc. Hub:0816201499

Dijual Xenia Li 2004 PW,CL Body mulus wrn mwrah maron H.98Jt/ nego abis BU Hub:5601778/ 081520400369

BPN

Dijual Spd Motor Suzuki FXR 150cc 4 tak Thn 2002 Km baru 8600 sangat terawat sekali jarang pakai harga nego Hub:081350177477/ 117863/17 des 0542-5666667

BPN

BPN

BPN

BPN

Dijual Daihatsu Taft Independen th’96 Body kaleng, Double / Transmisi bagus. Harga nego. Hub: 081350888255 117863/17

smd/15des

117863/17 des

des

BPN

DIJUAL CEPAT/ TAKE OVER RP 150 JT RUMAH + MOBIL XENIA DI SAMARINDA RESIDENCE HUB. ROYAL REALTY 081347013929 / 05417217677

5493/13 des

Djl Jeep CJ.7 Spirit, Sumbu Lebar Th.87 Asli, Full Variasi (Fender Wrangler) Full Audio Visual TV 11" Ban 33 Hrg 75 Jt nego, Bs TT Hub : 117863/17 08125863405

Dijual Aveo LT Thn 2004 Akhir Warna Silver Cat Asli Mulus, Kondisi Bagus & Terawat Kilo Mtr 30Rb Hrg 95 Jt Nego Hub: 085246478673 ( Bisa Kredit ) 117863/18 des

Dijual Kijang Innova Tipe E th’2004 Warna Cokelat Tua Metalik. Harga 147,5 Juta nego. Hub: 0811535114

BPN

BPN

Jual Cash/Kredit Hyundai Accent 2001 Take Over Ang. 1,4 Jt/Bln Sisa 16 Bln Asuransi All Risk, Coklat Metalik, Hub : 0542 – 7099933 / 117863/17 0811535851

Dijual Kijang Kapsul LX Th 2002 Bensin, Wrn Biru Metalik Fas: AC, Tape, CD MP3, Kond. Mulus Hub: 08152015095 Hrg Nego

117863/17 des

BPN

BPN

Dijual Kijang Innova G th’2006 Warna Silver Metalik. Fasilitas lengkap. Harga 170 Juta nego. Hub: 081346616444

BPN

Dijual Xenia Xi Th.2005 Wrn Silver Kondisi Mulus Mesin Istimewa Hub : 0542 - 7083133

117863/18 des

BPN

Dijual Mitsubishi L300 Pick Up th’2006 Warna Cokelat Tembako. Kondisi terawat, bagus. Harga 105 Juta nego. Hub: 08152024645

BPN

Djl Timor Th. 2000 Fas. Audio Hrg 47,5jt Nego Warna Merah Hub. 081545761647

117863/18 des

BPN

Dijual Mitsubishi L200 Strada 4x4 Double Cabin th’2006 Warna Merah Silver, Pake pribadi, STNK 09/2009. Maaf cek unit jam kerja. Harga 227,5 Juta nego. Hub: Flexi 0542-5667388

Dijual Toyota Kijang LGX Diesel th’2003 Warna Merah hati. Harga 137,5 Juta. Cash & Credit. Masih ada Asuransi All Risk. Hub: Flexi 0542-5667388 117863/17

SMD

BPN

Take Over Kijang Krista Diesel Th’2003.biru Silvermet.ac/Tape/Cd/ Ps/Pw/Em/Remote/Vr.kondisi Bagus.ass.allrisk.nego.hub.0813 4656 1988 smd/14

Dijual Panther Touring Turbo Th’2002.biru Silver.fas. standar. mulus. terawat. nego.hub. 08125329832 smd/14

des

SMD

des

Take Over Kijang Sx 1.8 Th’2003.kuning Emas.ac/Tape/Pajak Baru.kondisi Bagus.nego.hub.0852 smd/14 4634 4284

des


Halaman

Minggu,14 Desember 2008 SMD

SMD

Dijual Rumah 2LT, 3+1 KT, 2+1 KM, Full Furniseda, 12X15 Pondok Surya Indah, Siap Huni, Hub. 7193398

BPN

Dijual / Disewakan Rumah 2LT, 3KT, 3KM, Taman Belakang, Type, 112/140, Pondok Surya Indah BF 1 No. 19 Hub. 7193398

smd/18 des

BPN

smd/18 des

SMD

Dijual Toyota Cressida Th’85 GLX Injection Kuning Emas, PW, PS, AC, 26Jt Hub: 08125579770

SMD

Dijual Sidekick Th’96 MErah MEtalik, Fas. AC, CD, DVD, USB, TV, Sound, Body Kit, VR 16, Kaca Film, Spectrum, Kond. Istimewa, Hrg 76,5jt Nego Hub. 08125301062 smd/18 des

SMD

SMD

BPN

Dijual /Take over Hyundai Trajet VVT th’2005.Merah Muda Met.Bagus Istimewa.Ganti DP 60jt Nego.Angs.perbln Rp.3.566.000x 32bln.Hub.0812 533 8898 (NO SMSTP) smd/18

des

SMD

Dijual Mitsubishi Strada L200 Double Cabin Th.2005 Warna Putih AC, Tape, Bagus=182Jt Hub: 05427247979/085247922226

5493/18 des

Dijual Bis Mits PS 135 th’2003.Enam Roda.PS, kursi 40 buah.Mesin Ok.Body bagus.Hrg.130jt smd/18 des Nego.Hub.0816209137

smd/16 des

smd/17 des

Dijual LGX Solar Th’2001 Wrn Hitam, Pemakaian 2002 GAnti DP. 60jt NEgo Sisa 20Bln X 3,6jt Hub. 05417004437 / 08115821927 / 0541-280687

GAnti Dp. 33jt Nego Sedan Soluna Th’00 Wrn Biru MEtalik, Pemakaian Pribadi, Tangan PErtama, Hub. 081350790660 / 081348034433smd/18

des

Dijual Isuzu Panther Minibus Th’97 Wrn Hijau, Metalik, Fas. VR, PW, AC Dingin, Bodi Mulus, MEsin Terawat Bs Kredit Minat, Hub. 081347589543

des

DiKontrakkan Rumah Di Jl. Jakarta Blok. W7 Perum Korpri Loa BAkung Smd, Fas. PLN, PAM, Tlp, Hub. 085246780422 / 081321396931

smd/17 des

des

00109943B

Dijual Aveo Tahun 2005 Tipe LT Warna Biru Harga Rp 105 Jt/nego Hub. 081347188914

smd/17 des

RENTAL GENSET

smd/17 des

Service Pnggl Komputer/Laptop/ Network ke Ktr/Rmh Hrg Mulai 50Rb Hub:7116728

Dcr Tenaga Kerja Cuci Mbl Remaja Ada Mess Tlp.7038885 Max 25Thn Rajin Bro

00109715B

00109945B

Service Komputer Panggilan Hanya 50Rb Hub:0542-7123987

Dbthkn Sgr S1/D3 Akuntansi Almt Jl.Soekarno Hatta Km 3,5 Rt 24 Tlp. 0542-9123106

00109902B

HONDA

00109996B

TOYOTA Djl Avanza’08 Tipe S Wrn Aqua Blue DP 30% Bs 3-4 Th Serius Hub:0811541147 00109995B

RENTAL MOBIL Tridea Rent:Innova, Terios, Avanza & Xenia250Rb HUb:0542-7113364/ 081253585443

JASA Service Kuklas M.Cuci Gas Dispenser ACWater Heater Dll Hub:08125310858 00107821B

Edo AC Service Rp 30Rb Mnrm B Psg AC Pendgn Lainnya H:742227/ 411993/5670932

00107833B

Rental Xenia Avanza Innova Terrios Harian/Bulanan Hub:081347833344 00107996B

NabilaRentCar:Innova,Avanza,LGX,Panther Hub:081347000460/410219 Blnan/ Harian 00108859B

Diswkn Avanza,Innova,Kjng,LGX Bw Sndri/Plus Supir Hub:08125362844 00109332B

CV A Perkasa Rent Innova Solar New Xenia LGX Strada.05425655548/08115404187 00109334B

Menyewakan Innova+Kijang Pick Up Plus Supir Hub:0542-761957/ 081346299131 00109337B

Nuvo Rent Xenia’07 250Rb/Hr/Blnan Hub:0542-5607448/7088216/ 081347996235 00109340B

CM Rental Terios Avanza&Xenia 0542-7184188/081350944373 Gn Malang Hrg Promo 00109684B

Disewakan Strada/Innova/Avanza/ Xenia Dll Hub:0542-7243266/ 081253462610 00109703B

Disewakan Mbl Honda Stream, Sedan Corolla Full Variasi Harian, jam2an, blnan. Hub:0542-7234744 (NoPol Istimewa) 00109719B

MOTOR DIJUAL YAMAHA Djl Mtr Jupiter MX Wrn Merah Th 2008 Hub:081253682688 00109897B

SUZUKI Dijual Motor Suzuki Spin Thn 2008 Hub. 7563404/ 7147378 0117938

ELEKTRONIK KOMPUTER

00109582B

Komputer Second Compaq D510 Rp 1,5Jt Spek:P4-2.4GHz, 512MB RAM ,40GB HDD, CDRom,17" CRT Mont, Keyboard, Mouse, Non OS,Bonus UPS Hub:0811541524 00109663B

00109953B

BIRO JASA Hapersat Spesialis Dokumen Kend.STNK/Kir Mutasi Nopol B/D/ H/L/N/AB/AD/DA Telp 05427151789/081347355473 00109928B

SEDOT WC Sedot WC/Kuras Tinja Hub:05427023423/081346315708

00109503B

TV Anda Rusak? Ingin Perbaikan Ditempat Segera Hub Kami 081253181243 00109808B

Trm Psg Parabola Ser vice Prog Ulang Bs gerak/Dream/MCOA Hub:081952554799

00109912B

KOST Bungas Pav Jl Panorama No.26 Kr Jati Bpp 081545517620 AC/Kmr Lgkp Parkir Ok!

10KVA s/d 150KVA Include Maintenance Tlp:0542-5628883 HP.08125840058

PROPERTI DESAIN ARSITEKTUR

Dbthkn Sgr Pss:SPV(S1) ,Cashier, Waiter, bartender (SMA),Teknisi(STM).Krm Lmrn Lgkp Ke NAV Karaoke Jl Jend Sudirman Komp Ruko Bandar Blok A No.1-2B Bpn Krg Lbh 2 Minggu/Tgl Terbit.

Menerima Desain Rumah Tinggal Ruko Restaurant Kntr Hotel Dll Hrg Rp10Rb/M2 Hp.085652040379/ 081347584414

Dicari Mekanik Motor Dan Mobil Hub Slamet Jaya Jln. A.Yani No.56 Bpn Tlp 0542 -421187/424161 00109810B

Dcr Kry Recept Pend SMK Pariwisata Pria Single usia 20-28Th Kristen Hub: 081520348595 00109898B

Dcr Pembantu Rmh Tangga Usia max 30Th Menginap Hub:05427174026 00109901B

Mnrm&Menylurkn Baby Sitter, Pt.J ompo,PRT Hub:Yysn Karunia Gn Polisi Rt 70 No.12 0542-419180/ 08115402271 00109904B

Dicari Administrasi&Office Boy SIM C Min SMA Kirim Ke Ruko BDI III No.16 Jl.MT Haryono Paling Lambat 3 hari 00109905B

Dicari karyawati u/ Terapis Di Persh Spa Ditujuakn Ke Jl.Bougenvil C1 No.8 Bpp Baru Telp 876623 00109906B

Dicari Tenaga Krj Wanita Lulusan SLTA Sederajat.Lmrn Ditujukan Ke PO BOX 236Balikpapan 00109907B

Dcr 2 Tng Safetyman SMU/SMK Usia 23-30Th Pny Srtfkt P3&Fire Pglmn.datang Lsg PT Mawar Mahakam Jl.MT Haryono Rt 27 No.2 Dam Bppn Dpn PT Kaltim Traktor Hub Pak Yo

00107962B

Anda Mau Bangun Renovasi Rumah Ruko Dll Harga Bersaing Hub:08195560485 00109496B

RUMAH DIJUAL Dijual Rmh BDL II(Perusda) H2 No.13 Bpn LB/LT 45/200 SHM.hub:081520312871

00109910B

Dbthkn Sgr Pengasuh Anak Muslim Usia ERROR[Basic syntax error] in:<3ERROR[Basic syntax error] in:0T> Dicari Operator Backhoelader Dan Operator GD Sior Kirim Ke PO BOX 408 Balikpapan

00109708B

Dijual/Dikontrak Rumah Ruko daerah BB Wika BDI Telp 085752252566/ 7092255 00109900B

Dijl Rmh Uk. 90 Ada List, Telp, TV Kabel, Air, Hrg Nego Hub. 081253964697 0117937

TANAH DIJUAL Dijual Tanah Luas 21719 M2 SHM Lokasi Berbatasan Dg Bpp Baru Hub: 0542-5625656 00107823B

Dijual Kavling Bisa Kredit Hub:05427025342/081347357249 00109516B

RUMAH DIKONTRAKKAN Dikontrakan Rmh+Isi Komplit BB Blok W3/20 Telp 0542-7128933

smd/17 des

Dijual Sedan Timor th’96.Mulus.Siap pakai.Biru.AC Dingin & Tape.Hrg.45jt Nego.Hub.081350446740 smd/18 des

des

Dijual Mitsubishi Strada L200 Double Cabin Th.2005 Warna Putih AC, Tape, Bagus=182Jt Hub: 05427247979/085247922226

5493/18 des

SMD Rumah Dijual BU, Permanen, SHM, Bebas Banjir, Jl. Siradj Salman Komp. PErmata Hijau Blok. C No. 2, Fas. 3KT, R. Tamu, R. Keluarga, Carport, Tlp, TV KAbel, PLN, PDAM (11/2 Lantai Bisa Nego) Hub. 18125858494

smd/17 des

SMD

Dijual Take over Daihatsu Terios TS Plus Warna hitam, Th’2007 pemakaian 2008 bln 2, ganti Dp.57,5 Jt, nego, Angs. 4.710.000 sisa 26 bln, asuransi Allrisk, hub. 081347761475 smd/17

smd/18 des

BPN

Dijual Honda Jazz Tipe RS Tahun 2008 Warna Silver Metalik Ganti DP Rp 72 Jt/Nego Angs. Rp 5.700.000 Sisa 35 smd/18 des Bulan Hub.081350284588

des

des

Dijual Daihatsu Espass Th’93/94, Warna Silver Fas, AC, Tape, harga nego, Hub.081346658682

Dijual Honda Civic Excelent th’77 Wrn Merah, Body Nyentrik, Mesin HAlus, Terawat, VR, Butuh Dana, Hrg 12jt NEgo Hub. 081350741769

00109936B

Dcr D1,S1,2 Pglmn 3-4 Bs Ngendarain Mtr Diutmkn Wnt Dialmt BDI Blok E/36 Telp.0542-860102/ 6132691 00109942B

Dicari Pembantu Rmh Tgg Dan Baby Sitter Gaji Rp600-Rp900rb/Bln H: LPK Bunda 0542-7014718/5683200 (Lgsng Kerja) 00109944B

Jual material Pasir Samboja,Pasir P a l u , b a t u Pecah,Sirtu.hub:087865077227/ 7105903/08195019992/861708 00109896B

Mncri krj saya Adlh llsn S1 Tehnik Listrik Umr 46Th Pglmn Pabrik kabel Sbg Sbg Quality Control & Quality AssuranceGji Bs Negosiasi Jika Menginginkan Pelamar Diatas Hub:Ara 08152025357 00109899B

Djl Alat Musik 2Gtr Melodi,1Bass,1Set Drum Isuzu,1Gtek Gtr 3Sound MonitorPrinces,Keyboard Hrg Ng.Hb:08125579770 00109997B

Direntalkan Ford Ranger & Ford Everest Hub. Jimmy 0541-7755088 / 08125490674 9 des

15 des

Rental / Carteran Innova, Avanza, Xenia, LGX, Dlm Kota-Luar Kota, Antar-Jemput Bandara Sepinggan Hub. 08125509989

Dbthkn Wnt Min SLTP,SLTA Lmrn Diantar Ke Queen Pop Corn SCP Lt.3 Hub: 081350442192

9 des

Dealer Resmi Yamaha Istana Mtr Smd Bth Marketing Officer (MO) Syrt: P/L, Umur 24th, Ijasah SD/ SLTP/SMU, Pnya Mtr, Jjr, Disiplin, Krjasma, Fas. Gaji, Tunj, Bnus, Lmrn Ditujukn, Istana, Motor (Yamaha) Jl. Di. Panjaitan No. 30 Samarinda

UD. NADYA J, Melayani Rental Mobil Xenia, Avanza, Harian/Blnan Hub. 081347189221 / 0541-7187855 10 des

Rental Mobil Kijang Innova / Kapsul, Bulanan, Harian Dijamin Murah Telp.081253996996 / 0541290304 14des

AJ Rental Menyewakan Mobil Innova, Avanza, Xenia, L200 Triton Dll, Harian/Mingguan/Bulanan 0541-7133456 / 771388 / 081347107671

0118455

B A L I K PA PA N

smd/18 des

SMD

Dijual Over kredit Espass Th’97 1600cc, Warna hijau metalik, lengkap, body kaleng, mesin ok, ganti Dp.17,5 Jt (angs.1.3 Jt sisa 12 bln) hub.081347553763 smd/17

des

Dijual Sidekick Th’96 MErah MEtalik, Fas. AC, CD, DVD, USB, TV, Sound, Body Kit, VR 16, Kaca Film, Spectrum, Kond. Istimewa, Hrg 76,5jt Nego Hub. 08125301062 smd/17 des

29 des

MOTOR DIJUAL SUZUKI

Djl Suzuki Thunder 04/05 Merah Hrg 8jt Nego Msh Bgs Hub. 081347793789 15 des

Djl Suzuki New Smash th’06/07 Merah Mulus Kond. Bgs skali, Hrg 8jt Nego Hub. 081253283296 15 des

24des

SAMARINDA

Djl Mtr Thunder 2005 Full Monel, Ban Batlax, Hrg Nego hub. 081347993005 18 des

KREDIT MOTOR Kredit Motor/Mbl Min. 92 / Pinjam Dana Mtr / Mbl Min. 92, 085250972037 / 0541-7219243 13 des

MOBIL DIJUAL Djl Kijang SX ’02 Silver Fas. Lengkap, VR, Brg Istimewa Hrg Nego Hub. 085250925384 15 des

Djl Aveo LT 2004 Silver Fas. Lengkap KM Rendah 20rb, Brg Istimewa Cat Asli Hrg Nego Hub. 081253108833 15 des

Dijual Suzuki Forsa Th’87 Fas. AC, Tape, VR, Siap Pakai, Hrg 26jt Nego Hub. 08125854703 Bisa TT 15 des

DAIHATSU Djl Taruna New CSX 05 Merah, 115jt Hub. 085246227382 15 des

Djl New Xenia 07 Li Family Hitam, 115jt All Risk Hub. 085250119512

LOWONGAN DiCari Marketing D’m@rket Usia Max 30 Th, Pend.SLTA, Pr ia / Wanita Kirim CV. Mitra Usaha Anda Jln. KH.Khlid No 42 Mall Mesra Indah LT.3 16 des]

Kontraktor Pertmbngan & Rental Bth Site Manager & Supervisor Operasional Pertambangan, Punya Sim A, Krm Lmrn Ke Jl. Kupang Baru 2 No. 12 Surabaya 30 des

Dicari Karyawati Penampilan Menarik,Min SMU Jl. Lambung Mangkurat No 18 C ( Link Cell) 30 des

Pmsngn Gipsum Walpaper, Vertikal /Horizontal, Woodblind Hub. 08125 483769/0541-748176

15 des

Dcri Design Grafis Tkting Online, Staff Akunting, Ahli, Bordir Komp. Di Degra Adv Jl. Kh. Wahid Hasyim no. 9 RT 11 Depan Gor Sempaja

TOKO DIKONTRAKKAN Djl/Dikontrakan Kios di Mall Lembuswana Ls.Krg Lbh 18m2 Di Lantai 2 No.37-38 Hub: 0813 46353958/081585148999(NO SMS) 00108769B

BIRO JASA

30 des

Dijl Berbagai Sansevieria Dan Aglaonema Lokal Atau Import Hub:0542-5625656 00108087B

PELUANG USAHA Dicari Mitra Agen Alarm Spd Mtor”Security”,Didaerah anda.Alarm Ini Murah Mdh Pmsngnnya,Keamanan Trjamin,Cra Krj”Security”Bila Kontak Dinyalakan Baik Pakai Duplikat/Kunci T,Klakson Berbunyi Keras & Mesin Otomatis mati.Produk Ini Sgt Laku Krs DgnKeuntungan Hingga 100% Dgn Mdl 1,5 Jt Saja.Berminat Hub: Kami 0542-7059777/08125417716 00109955B

31 des

Direntalkan/Dikontrakan Mobil Strada Triton Th’08 Wrn Hitam, Hrg 145jt/bln, Hub. 081347263888 / 7171199 25 nov

Fortuner Rent, Mnyediakan Kend. Trbaru, Xenia, Terios, Grand Max, hrg Lbh Murah dr biasanya, Dptkan Paket Keluarga Dgn Hrg Spesial hub. 081350085827 21 des

Mobil Carteran / Sewa dlm Kota / Luar Kota Hub. 085247057875 6des

24 des

Telah Hilang STNK Motor Honda KT 4520 NP, An. Ramadani - smd 15 des

Telah Hilang STNK Motor Yamaha KT 5180 KW, An. Nanin Oktaviani smd 15 des

Telah Hilang STNK Motor Daihatsu KT 2158 CB, An. Mase Baroak RT.4 - smd

15 des

15 des

15 des

15 des

Telah hilang STNK Mtr Honda NF 100 KT-4306-WZ, An. Hamdan 15 des

Telah hilang STNK Mtr Yamaha VegaR KT-5219-NO, An. Yatmaji 15 des

Telah hilang STNK Mtr Honda Prima KT-4149-BG, An. Achmad S 15 des

Telah hilang STNK Mtr Honda C100 KT-4815-MS, An. Agus R 15 des

Telah hilang STNK Mtr Suzuki FD 110 KT-3889-MJ, An. Eva S 15 des

Telah hilang STNK Mbl Mitsubishi L200 KT-8866-BR, An. PT.Rimba Raya L 15 des

Telah hilang STNK Mbl Mirsubishi L200 KT-8257-MB, An. PT.Rimba Karya R 15 des

Telah hilang STNK Mtr Suzuki FD 110 KT-3698-MK, An. Siti J 15 des

Telah hilang STNK Mtr Honda NC 110 KT-2908-M, An. Yenty 15 des

Telah hilang STNK Mtr Honda NF 125 KT-4003-NW, An. Yusni R 15 des

Telah hilang STNK Mtr Honda NF 100 KT-2003-M, An. Mamik H 15 des

Telah hilang STNK Mtr Honda Nf 100 KT-2058-MJ, An. M. Romadhan 15 des

15 des

15 des

Telah hilang STNK Mtr Honda NF 100 KT-4292-WO, An. Sutrinah

Telah hilang STNK Mtr Honda NF 100 KT-4420-MN, An. DRA Ernawati

18 des

TANAH DIJUAL Djl Tnh 10X20 Di Dlm Komp. Kav. Tnh Jl. Riam Dkt Jln Mnju Solong (Jl. Grilya) Hrg Nego Hub. 081347993005 18 des

KEHILANGAN Telah hilang STNK Mtr Suzuki Smash KT-3519-MN, An. Siswanto 14 des

Telah hilang STNK Mtr Yamaha VegaR KT-5112-WN, An. Lasmiati 14 des

Telah hilang STNK Mtr Yamaha Mio KT-5612-NJ, An. Fatwa

14 des

Telah hilang STNK Mtr Yamaha Jupiter Z KT-5060-WW, An. Antung E

14 des

Telah hilang STNK Mtr Yamaha VegaR KT-5742-WP, An. M.Dong 14 des

Telah hilang STNK Mtr Yamaha KT5005-NG, An. Supianur 14 des

Telah hilang STNK Mtr Honda NF 100 KT-4090-WQ, An. Mulyadi 14 des

Telah hilang STNK Mtr Suzuki FD 110 KT-3630-MI, An. Andri 14 des

Telah hilang STNK Mtr Honda NF 100 KT-4055-M, An. Abd Rachmansyah

15des

14 des

Dbthkn Sgr Tng Mekanik Utk Pabrik Klapa Sawit, Syart : Pria, Max 30Th, Pend. STM Mesin/Electrical, SMA IPA/Sdrjt, Lmrn Dilgkpi : Syrt Sehat Dr Dokter, SKKB Dr Kepolisian, Foto Brwrna 4X6 2Lbr, Foto Copy KTP,

Telah Hilang STNK Motor Honda KT 4802 WI, An. Zainal - smd 14 des

Telah Hilang STNK Motor Suzuki KT 3381 NM, An. Yoga Alfianur -

Telah hilang STNK Mtr Honda NF 100 KT-2276-MA, An. Sukmo P

15 des

15 des

Telah hilang STNK Mtr Yamaha KT5943-NU, An. Andi Faridah

Telah Hilang STNK Motor Yamaha KT 5109 WO, An. Amiruddin Sip smd

15 des

Telah hilang STNK Mtr Honda NF 100 KT-4181-NQ, An. Solikin GP 15 des

Telah hilang STNK Mtr Suzuki FL 125 KT-3877-NL, An. Ali F 15 des

14 des

Geraihalo Telkomsel Smd,Mbthkan Kryw : Supervisor, Syrt: P/ W,Single,Usia 25 th(fresh Grad),28th (pnglmn).pend.d3 Ipk 2,7 (univ.negeri) 3,00 (Univ.swasta), Kmnktf,Krjsm Tim,Jjr,Bs Bhs Inggris Aktif Lsn/Tlsn,Bs Komp. lmr n K Geraihalo Telkomsel, Jl.p.irian No.67 Smd,Plng Lmbt Seminggu Stlh Iklan Ini Terbit

15 des

15 des

Telah hilang STNK Mtr Yamaha VegaR KT-5278-WD, An. Buari P

Dijual Rumah Type 27 LT 181M2, Shm, Lok. Jl. HArun NAfsi RT. 26 Blok. A No. 19 Hrg NEgo Hub. 05419117792

Telah hilang STNK Mtr Yamaha VegaR KT-5048-WH, An. Syamsir

Semoja Jaya Rental Avanza, Innova, Xenia dlm & luar kota, harian/bulanan Hub. 0541-7110066081253062990

Telah Hilang STNK Motor Yamaha KT 5144 MZ, An. Muhammad Saleh – smd

15 des

Telah hilang STNK Mobil Daihatsu S91 KT-8054-CF, An. H.Purwoto

RUMAH DIJUAL

14 des

00109817B

15 des

15 des

Telah hilang STNK Mtr Kawasaki Ninja KT-7203-BH, An. Syahrun

Dcri tng Berpnglmn Dgn Jbatan Administrasi, Akunting, Kasir, Resepsionis, Room / Bell Boy, Waiter, Satpam, Koki, dll, Krm Lmrn e hotel Golden Season Hub. Via Tlp. 0541-33063, Fax. 0541-201425 / Dtg Lgsg Ke Jl. Gatot Subroto No. 68 Smd

TANAMAN

15 des

Telah Hilang STNK Motor Suzuki KT 3751 BV, An. Bakri - smd

Telah hilang STNK Mobil Suzuki jeep KT-1186-BH, An. Andi S

16des

31de

14 des

Telah Hilang STNK Motor Suzuki KT 3009 MA, An. Agus Fujianto smd

DANA CEPAT !!! cukup jaminkan BPKB motor/mobil anda, Proses Cepat,Bunga Ringan, BPKB Aman Hub. 081253064868

00109954B

Dijual Herder Betina 1,5Thn Stambom Terima Penitipan Anjing.Hub:0811532965

Telah Hilang STNK Mobil Daihatsu KT 2410 BB, An. Tabri - smd

Telah hilang STNK Mtr Yamaha Jupiter MX KT-5983-WL, An. Kusnul K

Djl Ruko 3Lt(Ex.Ktr) 5x1,5 Full Furnish Komp.B.Permai F1/40 H.08164809984

HEWAN PIARAAN

14 des

15 des

14 des

RENTAL MOBIL

14 des

Telah Hilang BPKB Motor Honda KT 4032 BW, An. Budi Santoso -smd

DANA CEPAT

Telah hilang STNK Mtr Yamaha Jupiter MX KT-5730-NR, An. Irawadi

APC Rental Innova-Avanza-Xenia harian, bulanan, kend. banyak Hub. 081347408545-0541-7737138

Telah Hilang BPKB Motor Suzuki KT 3230 NJ, An. Budi Santoso smd

Telah Hilang STNK Motor Honda KT 4621 MC, An. Suhailan - smd

28 januar

RUPA - RUPA

Telah hilang STNK Mtr Honda NF 125 KT-4935-NC, An. Abdul W.S

Bimb/Jasa Buat Skripsi S1 Eko : Mnj, Keu, Akunt, Hub. 085 250832979

Dibutuhkan Karyawan Wnt Min.SLTA,Usia Max.26 Th. Lmrn dikirim Ke : Studio Cosmo Ruko Cendrawasih Trade Center B3 Jl. A.Yani 0541-770936

RUKO DIJUAL

14 des

15 des

15 des

00109909B

Telah hilang STNK Mobil Daihatsu KT-2363-BC, An. Abdul F

14 des

19 des

Djl Suzuki Thunder 2006 Engkol Silver, Mulus, Siap Pakai, 10jt Nego Hub. 08125806773

15 des

Telah Hilang BPKB Motor Suzuki KT 3274 MQ, An. Budi Santoso smd

Telah Hilang STNK Motor Honda KT 4623 NA, An. Titik Suparti, Spd – smd

15 des

Disewakan Harian Mobil 4WD, Daihatsu Rocky, Mits. Strada Triton, Hub. 08125371992

KT-4555-BS, An. Hery Y 14 des

15 des

Yenprima Mebel Perabot Rmh & Kntor, Mmbthkn Supir, Sim B1, Usia Max. 40th, Helper, Marketing (Khusus Showroom) Diutamkn Brpenglmn, Lmrn Ditujukn Ke Yenprima Mebel Jl. A. Yani 678 Smd

15des

smd

Dcri Bbrp Krywn Salon 1). Kapster 2). Penata Rambut/Stylish 3). Terapis/Facial, Creambath, Lulur Hub. 08125834374 bs Dtg Lgsg ke Jl. P. Suryanata No. 60 RT. 15 Smd (Wrung Mkn Diana Putri)

14des

LOWONGAN Dibthkan Sgr: Supervisor Toko, Marketing, Kepala Gdng,Staf Gdng, Spm/G,Helper, Kasir. Syrt: Pnmplnmnrk, Kmnktf. lmrn K Po Box 637 Bpn

15 des

Rental Mobil Innova Harian / Bulanan Hub.081253996969 / 0541290304

15 des

Ingin Cpt Berkomunikasi Bhs Inggris Dgn Cepat Hub:05425651447

Lmrn Krm Ke PT. Smar t Tbk, Jl. Ring Road 3 No. 88 Smd Sblm 20 Des 2008

Ready Stock Sirion, Gran Max, Pick Up & Minibus, Xenia & Ter ios, Dapatkan Paket Akhir Tahun, Bunga Ringan, Cash Back & bonus Lainnya Hub. Misro 08125460946 / 0541-7125256

00109933B

Persh.Retail Sdg Berkmg Membthkn SPG&SPM Lmrn PO BOX 622 Bpp

00109815B

00109583B

Djl Rmh SHM PLN,PDAM,Telp Jl Gn kawi Hub:738271/08125805582 TP Hrg Nego

00109908B

Dbthkn Sgr Pengasuh Anak Brpglmn Usia ERROR[Basic syntax error] in:< 3ERROR[Basic syntax error] in:0T>

00109606B

Dijual Tabung LPG 12Kg baru Tbg+Isi Hub:CV Naira 0542-6100848/ 081334886632 Hrg Nego Persediaan Terbatas

KURSUS

00109903B

00109612B

Investasi Terbaik Saat Ini Khusus Menjual Dinar Irak H:BPN 05427064888/081346555888 SMD 081346359998/0541-7019993

00109998B

LOWONGAN

00109911B

MAU KURSUS-SERVICE-BELI C O M P U T E R - R E N TA L - P E N G ETIKAN-WARNET BERKUALITAS HARGA BERSAHABAT HUB:AXEL COMPUTER TELP.750017/442506/ 426666/8870124 BPP/05427200364 PENAJAM/0548-20789 BONTANG

Dicari Karyawan Untuk Jual Mie Ayam Keliling Hub: 081347483333 NO SMS

00109185B

Service 24Jam AC M.Cuci Kulkas K.Gas Pom Genset Air Listrik Dll Hub:5626275

00107732B

Yogja Rental Menyewakan Mbl Xenia,Avanza,innova Harian/ Bulanan Hub:0542-7130470/ 08125812896

00109952B

SERVICE

0118988

Djl Honda Jazz IDSI Th’05 Wrn Htm Km 50rban Kod Sgt Bgs Hrg Ng H:5613711

Dijual Suzuki Sidekick Th’97 Mulus, Orisinil, Cat Silver & Terawat, Plat Cantik, 2 Angka, Smd, Fas. LEngkap, AC, VR, Tape Kenwood, PS, Ban MAsih BAgus, Hrg NEgo Hub. 0813478506167 smd/17

Jual Daihatsu Xenia Xi 1.3 th’2004 pemakaian th’2005 Warna Gold Metalik. Kondisi sangat mulus, siap pakai. Harga nego. Hub: 05427171385 117863/18

SMD

SMD

SMD

smd/17 des

00109717B

Djl Mbl Xenia LI 1.0 VVti Th06 Akhir Bln 12 Dlm Wrn Ctrem DeluxPlus Mbl Wrn Htm Pwr Stering CL Pwrind Remot H.081347708339

smd/18 des

SMD

des

des

SMD

smd/18 des

Dijual Terios TX Tahun 2007 Warna Hitam harga Rp 165 Jt/nego Hub. 08125582629 smd/17

Jual Isuzu Panther Pick Up th’2006 Warna Hitam Metalik. Fasilitas: AC, Tape, VR. Harga nego. Hub: 08125417520 117863/18

smd/18 des

Djual Taruna CSX Tahun 2001 Akhir STNK Baru Warna Merah Silver Cat Masih Asli Mulus, Fas.VR,AC, PW,PS,Mirror, Sound System, Ban Bagus, Mesin Terawat, Harga Rp 95 Jt/ Nego Hub. 081350088562 (No SMS)

Dijual Honda CRV Th’05, 1998cc, Wrn Coklat Muda Metalik, Pemilik PErtama, Hrg 225jt NEgo Hub. 7090808 / 0811555302

RUPA RUPA

Djl Charade ’81 Wrn Biru Mls,Msn Bgs,VR NO SMS/TP Hrg Nego Hub: 081533785914

Dijual Kijang Innova Type V Th’04 Wrn Hitam, Hrg 175jt NEgo Hub. 08125544411

smd/18 des

BPN

SMD

SMD

Dijual Cepat Daihatsu Taruna CSX Tahun 2000, Cat Asli, Mesin Bagus, Siap Pakai, Fas. AC, Tape, VR, PS, PW, Harga Rp 90 Jt/Nego Hub. 08125844247 (Tanpa Perantara)

117863/18 des

BPN

Over Kredit Uang Muka 69 Juta angsuran 4.833.400/bln. Asuransi All Risk. Toyota Kijang Innova G 2.0 th’2004 Warna Hitam Metalik. Kondisi terawat, STNK 30-12-2009. Hub: 0542117863/18 des 7023135

Dijual Rumah DiPerum Bengkuring Jalan Bengkuring Raya Blok D no. 393 Uk. LB = 63 m² LT = 150 m² , SHM, Fas. 3 KT, 1 KM, Dpr, R. Keluarga, R.Tamu, PLN, PDAM, harga Rp 325 Jt/Nego Hub. 081347969933 “ TP & No SMS”

SMD

Dijual Avanza Tahun 2006 Tipe G Warna Hitam Harga Rp 130 Jt/nego Hub. 0811586586

DAIHATSU

Dijual Mits. Lancer Dan-gan Wrn Hitam Th’84 Kond. Mulus, Mesin BAgus, Fas. PS, Pw, AC Dingin, Hrg 38jt NEgo Hub. 081347793789 smd/18 des

SMD

00109713B

MOBIL DIJUAL

des

SMD

Dijual Peugeot Tahun 2004 Warna Merah Harga Rp 95 Jt/nego Hub. 0811586586 smd/17

117863/18 des

SMD

smd/18 des

DANA CEPAT

Balikpapan

Dijual Nissan X-Trail th’2004 Warna Cokelat Muda Metalik, STNK 25-062009. Service berkala bengkel Nissan. Harga 205 Juta nego. Hub: 0542-7023135 117863/18

SMD

Dijual Rumah di Belibis No.79 LT/LB – 250/100 M2. 3 KT, 2 KM, RM, DPR, RT, RK, AC 2 Unit. Hub: 08125411458 Tanpa Perantara

BPN

SMD

Jmnkn BPKB Motor Mobil Kredit Mobil Hub:Bambang 0542-5642304/ 085247218851 Dijual Kijang LGX Tahun 2002 Warna Merah Harga Rp 126 Jt/Nego Hub. 08125582629 smd/17

117863/18 des

SMD

SMD

smd/17 des

SMD

Dijual/Take Over Toyota Hilux Th 2008 Bln 5 Wrn Hitam, Ganti DP 70Jt Sisa 28Bln, Angs. 2.550.000/Bln Bisa Nego Hub: 08125889724 117863/18 des

BPN Dijual Ruko di Bpn Regency V3/3. LT/LB – 90/100. 2 Lantai, 2 KM. Hub: 08125411458

Dijual Rmh Komp. Bumi Nirwana km.5 Type 42/128 Fas: Listrik, Air WTP, (2KT, 1KM+Dapur ) Sudah Ada Tralis, Siap Pakai, Halaman Belakang Masih Luas, Bisa Cash/Kredit Bisa Nego Hub: 7032656/085216171885

BPN

SMD

Dijual Escudo Tahun 1996 Warna Merah Metalik, Interior Asli Sangat mulus Fas. Lengkap Harga Rp 80 Jt/nego Hub. 081545567635

BPN

117863/14 jan

SMD

SMD

Dijual Toyota Corolla Altis Tipe G Manual Th’2002 Kond. Siap PAkai, Double Airbag, Plat 3 Angka / Asli Smd, Hrg Damai, Hub. 08125843668

SMD

smd/18 des

SMD

SMD

Dijual Toyota Great Corolla SEG Th’93 Fas. Lengkap, Body Mulus, Hrg 60jt Nego Hub. 081347635935

Dijual Honda CRV Th’05 (Nov) , 1998cc Automatic, Wrn Coklat Muda Metalik, Pemilik Pertama, Hrg 225jt NEgo Hub. 7090808 / 0811555302

SMD

Dijual Opel Blazer Sports DOHC Th’02 Silver, Sound System, Ass. All Risk, Tangan PErtama, Kond. Terawat, Hub. 0811552968 smd/25 des

DJL TNH KAPLING INVESTASI DI KM 5 SAMPING BUKIT NIRWANA INDAH UK. 10 X 15=150M2 BERMNT / LIAT LOKASI HUB: BPK EDDY Y FLEXI: 0542-7111612/ 081253142888

SMD

smd/18 des

SMD

Dijual TAruna FGX Th’02 Body Mulus, Full VAriaasi Wrn Biru MEtalik, PW, VR, TV LAyar Sentuh Bisa Kredit Hub. 081347589543 smd/18 des

117863/18 des

SMD

Dijual Kijang Krista Diesel Th’2001 Original Cat, Mulus, Bagus, Siap Pakai, Hub. 262088 / 08125536622

BPN

BPN

smd/18 des

0112906/318 des

SMD

Dijual Rumah Komplek PGRI Ring Road ( Bukit Damai Lestari I ) LT.126m, LB.110m Certificate, IMB Fas: PLN, PDAM, Telp Harga 325 Jt/ Nego Hub: 0542-875708/0811549624 117863/18 des

BPN

INVESTASI TANAH DI LOK. STRATEGIS PASTI UNTUNG HUB. 085250925344 / 7112518 HRG MURAH CASH/KREDIT

Dijual Rmh Cash / Opr Kredit LB.60 LT.220 M2 Hrg 220 Jt nego Lok Wonorejo SHM IMB Hub : 5601778 / 081520400369

BPN

6

Telah hilang STNK Mtr Yamaha KT5739-NF, An. Rosyida 15 des

Telah hilang STNK Mtr Honda NF 100 KT-4658-NF, An. Sarlota Rupa

15 des

Telah Hilang STNK Motor Yamaha KT 5091 NP, An. Muh. Sammang smd 15 des

Telah Hilang STNK Motor Suzuki KT 3769 NN, An. Subiyanto jl. Kesehatan Dalam - smd 15 des

Telah hilang STNK Mtr Yamaha Jupiter MX KT-5397-NP, An. Ali Rachman 15 des

15 des

Telah hilang STNK Mtr Yamaha KT5738-WH, An.Hajirah 15 des

Telah hilang STNK Mtr Honda KT4666-MI, An.Gusti Rusdiansyah 15 des

Telah hilang STNK Mtr Kawasaki KT-7607-BE, An.Yeni Hendrawati 15 des

Telah hilang STNK Mobil Mits KT6166-BN, An.KIPLI 15 des

Telah Hilang STNK Motor Suzuki KT 3497 NA, An.Andrianto - smd 15 des

Telah hilang STNK Mtr Honda NF 100 KT-4051-MU, An. Rudy 15 des

Telah hilang STNK Mtr Yamaha Jupiter MX KT-5313-Mira Ariyani 15 des

Telah hilang STNK Mtr Yamaha Fiz R KT-5307-MK, An. Sopiansyah 15 des

Telah hilang STNK Mtr Yamaha Jupiter Z KT-5387-NK, An. Zulham Nur 15 des

Telah hilang STNK Mtr Yamaha Jupiter Z KT-5979-WU, An. Ispiansyah 15 des

Telah hilang STNK Mtr Honda C100

Telah hilang STNK Mtr Honda NF 125 KT-4619-WH, An. M.Thurkan S 15 des

Telah hilang STNK Mtr Honda NF 100 KT-4942-MO, An. Aly Chandra 15 des

Telah hilang STNK Mtr Yamaha VegaR KT-5072-WZ, An. Fatmawati 15 des

Telah hilang STNK Mtr Yamaha Jupiter Z KT-5767-WD, An. H.Manne 15 des

Telah hilang STNK Mtr Honda C100 KT-4451-MC, An. Adung KS Utomo 15 des

Telah Hilang STNK Motor Yamah KT 3708 WS, An. Nina Karunia -smd 18 des


Halaman

Minggu, 14 Desember 2008

Togel Singapura Masuk Kaltim ● Sambungan Hal 1

tangkap, berikut barang bukti berupa uang tunai Rp 30.143.000, 8 unit kalkulator, 23.000 bundel kupon, 2.600 bundel buku rekap, 2 buku tabungan, 3 kartu ATM, bukti transfer, alat tulis, serta 6 telepon seluler. Terungkapnya jaringan judi togel ini dari informasi masyarakat melalui SMS ke nomor hotline polisi. Petugas kemudian menyelidikinya sejak Kamis (11/ 12) hingga Jumat (12/12). “Kapolda (Irjen Pol Andi Masmiat) dan saya sebelumnya menerima pesan singkat adanya aktivitas perjudian besar di Samarinda. Mereka yang kami tangkap adalah pengedar dan pengepul judi togel,” kata Kapoltabes Sa-

Ulama Teriak ● Sambungan Hal 1

Zaini menerangkan, dari segi agama, judi berasal dari kata Maisir yang berarti mudah. Secara harfiah, judi diartikan sebagai suatu pekerjaan yang menghasilkan sesuatu dengan mudah. “Dalam surat Al Maidah : 90 disebutkan bahwa, sesungguhnya Maisir atau judi itu adalah perbuatan setan. Siapa yang menjauhinya akan beruntung,” urai Zaini. Sementara, lanjutnya, jika melihat definisi judi dari aparat bisa diartikan bahwa judi adalah penyakit masyarakat (pekat). “Jika masyarakat sudah sakit, maka yang harus menyembuhkan adalah masyarakat pula. Masyarakat di sini termasuk pemerintah dan aparat. Jadi kalau pemerintah dan aparat tidak serius, ya penyakit ini tidak akan pernah sembuh,” ujarnya. Ia menambahkan, melihat

Lapangan Kerja ● Sambungan Hal 1

“Sehingga orang cenderung mengambil jalan pintas. Mereka berani berspekulasi lewat judi togel dengan harapan mendapat uang dengan cepat dan mudah. Padahal ini tidak benar,” kata Siswadi, Sabtu (13/12). Menurut Siswadi, pemerintah mesti membuka peluang

Versi Anakanak ● Sambungan Hal 1

hukum. Caranya dengan memberikan informasi tentang aktivitas perjudian kepada aparat kepolisian secara berkelanjutan. Sebelum dilarang oleh pemerintah, judi sebenarnya diharamkan oleh agama. Masyara-

Kemenangan Saya Berikan kepada Kalian ● Sambungan Hal 1 ini bahwa keputusan kreatif hendaknya jangan dibunuh, jangan dimatikan. Kalau toh ini harus terjadi, saya minta ini yang terakhir. Walau pun kita, saya pribadi akan tetap memperjuangkan dalam bentuk yang lain,” tambahnya. Eros sendiri sebenarnya kurang begitu tahu pasti apa yang menjadi alasan utama untuk menghentikan Lastri. Hanya saja, Eros mengaku bahwainiadalahpertamakalinyadia harusmenghentikanprosespembuatan film yang disutradarainya. Sehubungan dengan protes yang terjadi di Solo, Jawa Tengah, Eros menceritakan kalau peristiwa serupa juga terjadi di sejumlah tempat yang hendak dijadikan lokasi syuting pengganti. Selain di Yogyakarta, Eros menyebutkan pihaknya terkendala perizinan di Sukabumi, Jawa Barat. Penolakan di sebuah pabrik di Sukabumi itu pun dinilai Eros agak janggal. “Setelah semuanya di-approach, semuanya selesai. Tiba-tiba satu hari sebelum Marcella mengalami musibah, si penjaga pabrik yang tadinya sudah oke, semua sudah dinyatakan iya, menyatakan tidak bisa karena dilarang dari pusat,” tutur Eros. Guna menunjukkan bahwa Lastri tidak seperti yang dituduhkan sejumlah pihak, Eros berencana menuangkannya dalam sebuah buku. Dia juga akan menyelesaikan 12 scene yang sudah

marinda Kombes Pol Abdul Kamil Razak di Mapolsekta Samarinda Utara, Sabtu (13/12). Menurut Razak, perjudian kali ini merupakan yang terbesar di Samarinda bahkan di Kaltim dalam setahun terakhir. Keberhasilan aparat berawal dari giat operasi penyakit masyarakat yang digelar Polsekta Samarinda Utara. Mereka mencurigai aktivitas sekelompok masyarakat di Jl PM Noor, Kelurahan Temindung Permai, Kecamatan Samarinda Utara, yang belakangan diketahui adalah kegiatan perjudian. “Dari situlah kemudian penyelidikan lebih dikembangkan dan akhirnya kita berhasil menangkap kesembilan tersangka. Judi merupakan penyakit masyarakat yang harus diberantas. Kami mengharapkan masyarakat segera melapor kepada kami bila menemukan praktek judi togel lagi,” ujar Razak. Saat ini, kata Razak, kepolisian sedang memburu ter-

sangka lainnya yang berada di Surabaya, Jawa Timur. Berdasar informasi dua tersangka berinisial T dan M merupakan bandar besar judi togel. Sebelumnya bandar judi serupa bernama Lie Chien ditangkap dan kini meringkuk di sel tahanan Polda Kaltim di Balikpapan. Mereka ditengarai memiliki jaringan internasional. Omzet perjudian itu mencapai miliaran rupiah yang berpusat di Singapura. Selain judi togel, T dan M juga merupakan bandar judi bola. “Kami terus selidiki dan pokoknya kami akan tangkap kedua orang itu,” tandas Razak. Sementara Kapolsekta Samarinda Utara,AKPAndrias Susanto mengatakan, kesembilan tersangka kini ditahan di sel Mapolsekta Samarinda Utara. Merekadijeratdenganpasal303KUHP tentang perjudian yang menjadi mata pencaharian. Pelaku perjudian ancaman hukumannya empat tahun penjara. (m20)

fenomena saat ini banyak ditemukan aparat pemerintah dan penegak hukum yang terangterangan membekingi perjudian. Karena, dengan membekingi perjudian, aparat tersebut mendapat uang lebih. “Jadi percuma ulama berteriak-teriak kalau aparatnya malah membekingi perjudian,” keluhnya. Menurut Zaini, latar belakang munculnya perjudian akibat faktor ekonomi. Buruknya tingkat perekonomian dan keterbatasan lapangan pekerjaan membuat banyak masyarakat ingin mencari pekerjaan yang mudah namun menghasilkan suatu yang besar. “Judi ini ibarat penyakit kronis. Penyembuhannya harus melibatkan semua pihak,” tambahnya. Dalam Agama Islam sendiri, kata Zaini sudah jelas disebutkan. “Jika kamu melihat kemaksiatan, maka ubahlah dengan tanganmu (kekuasaan). Yang dapat melakukan ini adalah pemerintah dan aparat yang

punya kekuasaan. Kemudian, jika kamu tidak punya kekuasaan, ubahlah dengan mulutmu (lisan). Dalam hal ini adalah ulama atau kiai-kiai yang dapat memberikan ceramah-ceramah. Kemudian, jika kamu tidak dapat mengubah dengan lisanmu, maka ubahlah dengan hatimu. Dalam hal ini adalah diri kita sendiri dengan merasa tidak suka dengan kemaksiatan yang terjadi,” terangnya. Secara garis besar, kata Zaini, pemberantasan judi melibatkan seluruh unsur masyarakat, termasuk pemerintah, aparat dan individunya masing-masing. “Untuk pemerintah, sebaiknya memperketat izin lokasi-lokasi usaha yang memberi peluang terjadinya perjudian seperti tempat-tempat hiburan seperti bilyard. Sebagai aparat Kepolisian hendaknya memberantas judi dengan benar jangan hanya lip service semata. Dan sebagai individu hendaknya menghindari perbuatan haram ini,” tandasnya.(eza)

kerja untuk mengurangi tingginya tingkat penggangguran di kawasan ini. Sebab umumnya pelaku judi togel ini didominasi warga berstatus pengangguran. Ia menyarankan kegiatan usaha menengah kecil dan mikro lebih digalakkan lagi. “Masyarakat diberikan kemudahan dalam meminjam modal. Pihak perbankan juga jangan mempersulit warga yang ingin mendapatkan pinjaman untuk mengembangkan usaha mereka,” kata Siswadi. Lagi-lagi, kata Siswadi, ini

menjadi tugas aparat kepolisian dalam memberantas praktik perjudian. “Polri sudah jelas menginstruksikan untuk memberantas perjudian di negeri ini. Meski kenyataannya, perjudian seperti togel masih dijumpai di kawasan ini,” kata Siswadi. Ia menyadari polisi sudah bekerja keras selama ini dalam upaya memberantas praktik judi. “Cumapolisimestilebihekstralagi dalam menangkap bandar gede judi togel ini. Sehingga masyarakat tidak memiliki akses melakukan judi togel,” sarannya. (top)

kat Indonesia adalah kaum beragama jadi sangat dilarang terlibat judi sebab keuntungan dari perjudian itu tidak wajar. Perjudian sangat merugikan masyarakat. Untuk di Samarinda, memang praktek perjudian sangat memprihatinkan. Tingginya kegiatan haram tersebut terlihat dari menjamurnya praktek perjudian di tempat-tempat keramaian. Tak hanya orang dewasa yang bermain judi. Ada

anak-anak di kotaini yang main judi dengan versinya sendiri. Kondisi seperti ini menjadi tantangan kepolisian untuk memberantasnya. Apabila mau melihat dan mengetahui praktek judi bisa dicari tempatnya. Biasanya orang-orang ramai berkumpul dan beristirahat. Daerah-daerah itu rawan dijadikan tempat judi untuk memperoleh uang tambahan dan polisi harus jeli dan komitmen memberantas judi. (m20)

diambil untuk selanjutkan dipertontonkan ke beberapa pihak. “Dengan itu kami ingin membuktikan bahwa kami tidak ada niat apa pun dalam hal yang dituduhkan kepada kami adalah benar. Itu tidak benar sama sekali. Dan kalau toh ada lembagalembaga tertentu yang melakukan tekanan-tekanan, saya berharap bahwa reformasi yang selama ini sudah kita bangun jangan sampai dikotori dengan pendekatan-pendekatan yang begitu sempit dan dangkal,” tegasnya yang meski Lasti dihentikan namun akan tetap berkomitmen untuk memperjuangan jiwa kreatifitas yang terkandung di dalamnya. “Itu komitmen yang saya berikan kepada Marcella,” kata Eros.

Marcella Kecewa Sementara itu Producer Lastri, Marcella Zalianty, mengaku kecewa dengan penghentian film Lastri. Namun, kenyataan itu harus diterima mengingat keadaannya yang masih mendekam di tahanan Mapolrestro Jakarta Pusat. “Kecewa sih pasti lah. Tapi apa boleh dikata, karena keadaan yang memaksa,” ungkap Olivia Zalianty, adik kandung Marcella, yang mendampingi Eros di konprensi pers kemarin. “Kalau kakak saya sih semangatnya tidak pernah putus. Cuma karena keadaan yang tidak memungkinkan, ya terpaksa produksi ini harus dihentikan. Kalau saya sendiri inginnya, Lastri ini ya memang adalah Marcella,” tambahnya. (Persda Network/mun)

Adegan Pemerkosaan? MENYEBARKAN paham komunisme atau banyak adegan kekerasan. Dua hal tersebut menjadi topik hangat yang melatarbelakangi ditolaknya film Lastri. Sebagai sutradara, Eros Djarot mengaku tidak pernah tahu alasan yang tepat dalam penolakan terhadap film yang diproduseri Marcella Zalianty tersebut. “Kalau menyebarkan paham komunisme itu harus jelas yang mana. Dialog yang mana? Di adegan yang mana? Ini terlalu mengada-ada. Yang jelas itu ada, apakah takut ada yang diperkosa itu banyak oleh aparat?,” kata Eros di Teater Populer, Jalan Kebon Pala I, Jakarta Pusat, Sabtu (13/12). “Kalau itu jangan direduksi

dong ke paham komunisme. Terang-terangan aja. Kalau memang takutnya adegan pemerkosaan, bilang dong sama saya. Jangan kayak apa ya... menurut saya tidak ksatria. Cobalah ngomong sama saya. Apalah susahnya ngomong sama saya. Kalau memang itu,” ujarnya. Eros menyebutkan adegan pemerkosaan bukan menjadi tema yang ditonjokkan dalam Lastri. Karenanya, Eros semakin tidak mengerti dengan penolakan terhadap film itu. “Jadi kalau saya ditanya, saya juga lagi bingung. Apa sih sebetulnya? Apa karena ayahnya? Apa karena katanya takut komunisme? Atau juga takut sisi lain?” imbuh Eros. (Persda Network/mun)

Diamankan 800 Polisi ● Sambungan Hal 1

H-3. Gladi bersih ini melibatkan pihak protokoler dari pemerintahan untuk menentukan susunan acara pelantikan. “Kami sudah ada empat kali rapat koordinasi dengan DPRD Kaltim,

dan nanti ada rapat lanjutan lagi untuk memastikan pengamanannya,” kata Sigid. Pengamanan pelantikan kali ini mempertimbangkan efesiensi dan efektifitas terhadap pengamanan undangan. Tamu undangan pejabat penting menjadi satu tempat VIP dengan pengawalan tersendiri. “Pengawalan dilakukan terpisah bagi tamu undangan VIP begitu juga ketika mereka datang ke lokasi pelanti-

Obama Cari Rumah Kontrakan ● Sambungan Hal 1

ke Gedung Putih. Namun dia tidak mengatakan apakah ada alternatif yang sedang dipikirkan keluarga Obama. Sementara, sesuai jadwal, Obama akan mundur dari kursi senat hari ini Minggu (14/12), karena ia akan

Awang Juara Khusus ● Sambungan Hal 1

Bankaltim di Padang Golf Tanah Merah Samarinda, Sabtu (13/ 12). Sebagai dua tokoh penting di Kaltim saat ini, membuat pengelola Padang Golf Tanah Merah dan Bankaltim memberikan penghargaan dan cenderamata kepada keduanya. Kegiatan ini diikuti 93 peserta dari seluruh pejabat pemerintahan di Kaltim dan nasabah Bankaltim. Selain Tarmizi dan Awang Faroek, hadir pula Pangdam IV / Tpr Mayjen TNI Tono Suratman, Wakapolda Kaltim Kombes Pol Bachrul Effendi, Walikota Samarinda Achmad Amins, Walikota Tarakan terpilih Udin Hianggio dan seluruh pejabat

Hati Saya di Kaltim ● Sambungan Hal 1

merasakan hari-hari yang menyenangkan di sini (Kaltim) hari ini, saya merasa ini hari-hari yang sangat berat karena saya akan meninggalkan teman-teman semua,” kata Tarmizi. Rabu (17/12) mendatang, Awang Faroek akan dilantik menjadi Gubernur Kaltim, itu artinya, Tarmizi pun harus melepas jabatannya sebagai Pj Gubernur yang sudah ia emban sejak dilantik Menteri Dalam Negeri

50 Wartawan Terharu ● Sambungan Hal 1

terkejut. Sebab selama 21 tahun saya bertugas di kepolisian, acara ini paling berkesan. Ini tidak mungkin saya lupakan seumur hidup. Untuk itu saya dan keluarga mengucapkan terima kasih banyak. Hanya Tuhan yang bisa membalas kebaikan teman-teman,” tuturnya. Albertus, wartawan Trans7 salah satu yang memprakasai

Bikin Perpustakaan dalam Penjara ● Sambungan Hal 1

diberi cobaan atau rezeki, kita harus mensyukuri dan melaksanakan dengan sebaik-baiknya. Termasuk juga saat saya diberi kesempatan itu, saya berusaha membuat orang lain senang dengan pekerjaan saya. Sewaktu saya menjabat Kasubditminregident, saya memposisikan diri sebagai masyarakat yang datang ke Kantor Samsat untuk mengurus surat kendaraan. Entah itu STNK atau BPKB. Tentu hal yang bertele, yang serba menunggu, tidak pasti pembayarannya, menjadi beban yang sangat berat. Saya lalu berpikir bagaimana caranya agar paradigma pelayanan ini bisa diubah. Waktu itu Balikpapan mendapat penghargaan Pelayanan Prima untuk pengurusan KTP. Saya terinspirasi dari itu, bagaimana bisa mewujudkan Kantor Samsat bisa menjadi seperti itu. Saya survei sendiri ke kantor kecamatan, saya foto kegiatannya, saya teliti dan perhatikan pelayanan seperti apa yang diberikan.

kan akan menjadi satu dalam bus sehingga mudah dikawal,” ujarnya. Aruslalu lintas sekitar gedung DPRD Kaltim Karang Paci Samarinda bakal terpengaruh. Saat pelantikan, Satlantas akan menerapkan satu arah saja kendaraan dari arah Karang Paci ke Jalan Batuah dan Jalan Ulin. “Pengamanan arus lalu lintas sekitar lokasi pelantikan akan dikendalikan oleh Satlantas Poltabes

memusatkan perhatian pada perpindahannya ke Gedung Putih. “Menjadi salah satu penghargaan dan kehormatan terbesar dalam hidup saya sudah melayani masyarakat Illinois di AS,” ujar Obama. Obama, yang akan dilantik sebagai presiden pada 20 Januari, mengatakan ia akan meninggalkan senat AS dan memulai tugas berat untuk memenuhi harapan sederhana dan impian bersama semua orang Amerika sebagai presiden. Itu berarti Obama, yang telah menja-

7

Samarinda. Selain itu juga mereka berada di depan untuk pengawalan kunjungan tamu pelantikan dengan kendaraan mobil dan motor patwal,” jelas Sigid. Sigid mengimbau kepada masyarakat luas yang tidak berkepentingan dalam pelantikan untuk tidak hadir. “Cukup menonton di televisi atau mendengar melalui siaran RRI saja. Ini demi keamanan juga,” tambah Sigid. (m20)

bat empat tahun dari masa jabatan enam tahunnya, tidak akan ikut serta dalam sidang senat pascapemilihan pekan depan. Senat yang dipimpin oleh partai Demokrat mengharapkan dalam sidang itu untuk mensahkan kemungkinan paket penyelamatan bagi industri mobil yang sedang berjuang dan paket stimulus ekonomi. Gubernur Illinois Rod Blagojevich, seorang Demokrat, akan menunjuk soerang pengganti untuk menyelesaikan masa jabatan Obama di senat.(dtc/ kompas.com)

Muspida Kaltim. Bankaltim sengaja menggelar Farewall Game sebagai pertandingan perpisahan untuk Tarmizi. Sebab, Penjabat kelahiran Aceh ini mulai Kamis (18/12) akan meningg a l k a n K a l t i m s e t e l a h d igantikan Gubernur terpilih Awang Faroek. “Ini sebagai ucapan terimakasih dari Bankaltim terhadap karya Pak Tarmizi yang selama ini banyak menyumbangkan pik i r a n n y a d e m i k e m a j uan Bankaltim,” kata Aminuddin, Direktur Bankaltim usai acara kemarin. Aminuddin menambahkan, salah satu sumbangsih pemikiran Tarmizi kepada Bankaltim adalah saat perubahan nama Bankaltim yang sebelumnya bernama BPD dan perubahan logo Bankaltim pada rapat umum pemengang saham beberapa waktu lalu. “Jadi acara

ini kami jadikan untuk mengantar Pak Tarmizi ke tempat tugas barunya, sekaligus kami menyambut Pak Awang sebagai Gubernur baru Kaltim,” lanjut Aminuddin. Ditemui usai mengikuti Farewall, Tarmizi mengaku senang dengan kegiatan ini. Bukan hanya sekedar acara Farewall, menurutnya yang lebih penting adalah kegiatan ini sekaligus dijadikan silaturahmi antara pejabat Muspida seKaltim dalam suasana santai. “Menurut saya bukan karena ini adalah acara perpisahan saya, tapi yang lebih penting, dengan adanya kegiatan ini semua bisa ketemu. Yang setiap harinya sibuk dengan pekerjaan, hari ini semua bisa berkumpul di lapangan golf ini, luar biasa sekali ini,” katanya. Bahkan Tarmizi mengakui dirinya rela meninggalkan rapat koordinasi (Rakor) Gubernur di

Departemen Dalam Negeri (Depdagri) di Jakarta untuk menghadiri acara ini. “Saya meninggalkan Rakor Gubernur demi acara ini. Tapi saya sampaikan ke Pak Menteri (Mendagri Mardiyanto, red) kalau saya mendapat undangan dengan Panglima (Mayjen TNI Tono Suratman, red), Pak Wakapolda (Kombes Pol Bachrul Effendi,red) dan lain-lain, saya tidak ngomong kalau saya dapat undangan main golf. Soalnya kalau saya bilang undangan main golf bisa nggak diizinkan nanti,” tambahnya. Tarmizi mengakui, sudah sekitar lima bulan ia tidak menyentuh stick golf. Karana itu, ia agak lupa dengan ilmu golfnya. “Ya agak canggung juga tadi soalnya saya sudah tidak main golf sekitar lima bulan. Tapi luar biasa, hari ini sangat menyenangkan sekali buat saya pribadi,” ujarnya.(eza)

Mardiyanto 3 Juli lalu di Jakarta. “Saya ke sini tanggal 5 Juli, berarti sekarang sudah lima bulan lebih seminggu. Tak terasa besok hari Rabu (17/12) Pak Awang akan dilantik jadi Gubernur Kaltim. Dan besoknya, Kamis (18/12) saya harus kembali ke Jakarta dan kembali bertugas di Departemen Dalam Negeri (Depdagri),” lanjutnya. Tarmizi mengaku berat meninggalkan Kaltim. Menurutnya, saat ini Kaltim terkenal dengan sebuah daerah yang kondusif, aman dan nyaman. “Semua orang tahu kalau Kaltim itu daerah yang aman dan kondusif. Ini semua tak lepas dari usaha

pengamanan yang dilakukan Panglima (Pangdam IV/Tpr) beserta jajarannya. Juga Pak Wakapolda, juga peran walikota seperti Pak Achmad Amins. Karena itu tak heran kalau banyak orang yang ingin datang ke Kaltim ini,” katanya. Tarmizi pun tak lupa mengucapkan terimakasihnya kepada Pangdam IV / Tpr Mayjen TNI Tono Suratman dan Wakapolda Kaltim Kombes Pol Bachrul Effendi yang turut memberikan keamanan saat Pilkada putaran kedua kemarin digelar. “Ini yang membuat saya berat sekali meninggalkan Kaltim, saya sudah

merasa senang bekerjasama dengan Panglima dengan Pak Wakapolda, dan dengan semuanya. Tapi apa boleh dibuat, ini semua untuk tugas,” lanjutnya. Sebelum menutup sambutannya Tarmizi mengatakan, meskipun secara fisik dirinya akan berpisah, namun secara hati, tetap berada di Kaltim. “Kalau penglihatan bisa hilang saat terpisah, penciuman juga bisa hilang kalau terpisah, tapi kalau hati, hati bisa menembus utara dan selatan. Percayalah, meskipun fisik kita terpisah, tapi hati saya tetap berada di Kaltim,” tambahnya.(eza)

acara ini mengungkapkan, acara ini sebagai bentuk penghargaan untuk Pak Gde yang selama bertugas di Balikpapan sangat dekat dengan kalangan wartawan. “Acara ini kami dedikasikan buat beliau. Sebab selama bertugas di Balikpapan dapat menjadi teman, sahabat, dan narasumber yang baik buat teman-teman wartawan,” tuturnya. Sementara Pemimpin Redaksi (Pemred) Tribun Kaltim, Achmad Subechi yang hadir dan mendapat kesempatan untuk menyampaikan kesan dan pesan mengung-

kapkan, kesan pertama saat berjumpa dengan Pak Gde adalah Pak Gde orang yang baik. “Mengapa saya bilang beliau orang baik. Ukurannya apa? Ia mampu memegang amanah, dapat dipercaya, antara lesan dan perbuatannya sama, rendah hati dan tulus dalam bergaul. Orang baik itu selalu dirindukan kehadirannya. Malam ini, alam pun turut menyambut acara yang khusus diadakan untuk orang baik. Buktinya tidak ada setetes air hujanpun yang turun. Itu tanda-tanda kehadiran orang baik

diterima alam,” katanya. Achmad Subechi berpesan, agar watak baik seperti ini bisa dicontoh oleh polisi di Indonesia. “Mudah-mudahan sikap seperti ini menjadi suritauladan buat anggota Polri dan teman-teman wartawan,” ungkapnya. Suasana tadi malam benar-benar akrab. Achmad Subechi dan Gde tampil duet melantunkan lagu Demi Waktu. Tak hanya itu. Bechi juga memberi kenangkenangan berupa sebuah gambar karikatur Gde yang mengenakan seragam kepolisian. (junisah)

Kemudian saya melihat kembali siapa pelanggan Samsat. Ternyata kebanyakan orang yang uangnya pas-pasan, tukang ojek, dan waktunya terbatas. Saya lalu coba benahi dengan mengkoordinasikan tiga instansi. Dari polisi, Dinas Pendapatan dan Jasa Raharja. Akhirnya pelayanan prima itu bisa terwujud. Menteri PAN (Pendayagunaan Aparatur Negara) sendiri sempat berkunjung dan mengatakan salut dengan itu. Ini prestasi besar buat saya.Apalagi setelah mendapat penghargaan Citra Pelayanan Prima. Itu kepuasan yang tidak bisa saya nilai dalam sejarah hidup saya. Bagi saya memberikan kepuasan kepada orang lain itu adalah ibadah buat saya. Kebahagiaan ini juga coba saya wujudkan sewaktu menjabat sebagai Kapolresta Balikpapan. Saya mencoba merubah pelayanan yang ada di sana, seperti pelayanan SIM. Saya coba terapkan pelayanan Samsat yang pernah saya tangani, agar pelayanan SIM jadi cepat, transparan dan biayanya jelas. Ada satu ruangan yang membuat hati saya miris ketika pertama kali masuk ke Polres, yaitu ruang penjara yang tampak kotor dan tidak terawat. Saya lalu membayangkan, kalau

saya dipenjara dengan kondisi yang pengab, kotor, mungkin itu tidak akan merubah saya menjadi lebih baik, tapi justru malah bisa bertambah jahat. Saya pun berpikir walaupun di penjara diberi fasilitas seenak apapun, tetap lebih enak berada di luar penjara. Kalau manusia sudah dikerangkeng kebebasannya pasti sangat tersiksa. Saya mencoba mengubah itu. Paling tidak standar HAM. Jadi kalau dia mandi, cuci baju dan ibadah bisa dijalani dengan layak. Tujuan mereka dipenjara itu bukan untuk menjadi penjahat, tapi bagaimana mereka yang dulunya berbuat jahat bisa menjadi baik. Itu tugas saya sebagai polisi. Saya lalu buatkan tempat ibadah, kemudian saya buat perpustakaan dengan menempatkan rak berisi puluhan buku, agar mereka saat di dalam bertambah wawasan dan ilmu pengetahuannya. Ternyata banyak yang merespon. Waktu itu banyak sekali telepon yang masuk memberikan ucapan terima kasih kepada saya, setelah media memberitakan perubahan ini. Salah satunya dari Pak Sutrisno, pemilik Trisula Collection. Dia bilang terharu dengan saya, kenapa Pak Gde yang tidak seiman dengan saya bisa berpikir sejauh itu, saya yang seumat jadi malu rasanya.

Pak Trisno lalu datang ke kantor saya dan memberikan bantuan. Dia beli karpet untuk sholat di dalam penjara. Dia juga membantu membuatkan toilet. Ada juga yang menyumbangkan buku ibadah untuk ditaruh pada rak. Saya juga merapikan lantainya agar tidak banjir kalau hujan datang. Perubahan ini ternyata juga mengundang perhatian orang luar. Pernah Tukul dan Ulfa datang ingin melihat langsung penjara ini, setelah menonton tayangannya di Trans7. Ketika jadi Kapolres saya juga berantas narkoba dan judi. Dalam satu tahun itu bisa diatas 100 kasus narkoba dan judi juga lebih dari 50 kasus. Saya juga sering terjun langsung ke masyarakat pada saat penggerebekan. Ini semua saya lakukan agar masyarakat merasa dekat dengan penegak hukum. Harapannya, kehidupan masyarakat bisa berjalan lebih tenang dan kondusif. Waktu itu saya selalu merespon setiap telepon dan SMS yang masuk dari warga. Saya punya prinsip kepercayaan yang diberikan orang lain itu dilaksanakan sebaik-baiknya. Bagi saya itu saja. Kita kan tidak bisa mengulangi waktu. sehingga pengabdian saya selama ini saya lakukan sebaik mungkin. (mohammad abduh)

PEMIMPIN UMUM (Plt): Agus Nugroho PEMIMPIN REDAKSI: Achmad Subechi REDAKTUR PELAKSANA A: IGN Sawabi, Priyo Suwarno MANAJER PRODUKSI: Arif Er Rachman WAKIL MANAJER PRODUKSI: Baskoro Muncar KOORDINATOR LIPUTAN: Fransina Luhukay STAF REDAKSII: H Sjamsul Kahar, H Herman Darmo, Uki M Kurdi, Achmad Subechi, IGN Sawabi, Priyo Suwarno, Arif Er Rachman, Baskoro Muncar, Fransina Luhukay, Iwan Apriansyah, Adhinata Kusuma, Dwi Haryanto SN, Sumarsono, Mathias M Ola, Perdata O Ginting, Charles I Komaling, Aloys GA Ebo, Trinilo Umardini, Hayati Maulana Nur, Safruddin, Catur Sulistyorini, Amalia Husnul A, Rita, Budi Hartono, Margaret Sarita, M Wikan Hendarman, Junisah, Joni Kusworo, Reza Rasyid Umar, Ahmad Bayasut, Fachmi Rachman, Kholish Cered, Feri Mei Effendi BIRO SAMARINDA, Jl Ulin No.106 Samarinda, Telepon: 0541 202416, 202417, fax: (0541) INDEPENDEN & KREDIBEL 769855: H Maturidi (kepala), Achmad Bintoro, Meinar F Sinurat, Abduh Kuddu, Katharina Siswi Widyawati, Khaidir, Maipah, M Syafiqurohman, Rahmat Taufik KUTAI KARTANEGARA A: Reonaldus KUTAI TIMUR R: Udin Dohang BONTANG G: Basir Daud PASIR:: Sarassani. PENAJAM PASER UTARA:: Samir TARAKAN N: Darajat Mazunus. KUTAI BARAT:: Alex Pardede. BIRO JAKARTA, Jl Palmerah Barat 29-33, Jakarta 10270, Telepon (021) 5356766:: Uki M Kurdi (Kepala), Agung Budi Santoso, Johnson Simanjuntak, Chairul Arifin, Ismanto, Heroe Baskoro, Rachmad Hidayat, Toni Bramantoro, Yulistyawan, Yoni Iskandar, Bian Harnansa, Hendra Gunawan, Sugiarto, Budi Prasetyo.DIREKTUR UTAMA:: Asih Winanti. DIREKTUR:: Sugeng H Santoso, H Herman Darmo, Uki A: Junie Rachmad (HP 08161924495), Doddy Setiawan (HP 08164859626) Jl Kejayaan I/30-C Jakarta 11140 Telepon: (021) 6335403, M Kurdi. PEMIMPIN PERUSAHAAN / MANAJER IKLAN:H Zainal Abidin. MANAJER SIRKULASI:: Iskandar. BAGIAN IKLAN JAKARTA 6338382, 6338383, 2601234 ext 1260/66, Fax/Modem: (021) 6338481. Tarif Iklan:: ■ Umum Display (B/W) Rp 17.000/mm kolom ■ Spot Colour (2 warna): Rp 27.000/mm kolom ■ Spot Colour (1 warna): Rp 25.000/mm kolom ■ Full Colour: Rp 30.000/mm kolom ■ Halaman 1 (B/W) Rp 60.000/mm kolom ■ Halaman 1 (F/C) Rp 90.000/mm kolom ■ Iklan Baris (2 s/d 10 baris): Rp 10.000/baris. Harga di atas belum termasuk PPN 10%.KANTOR PUSAT BALIKPAPAN N Jl Indrakila Straat III Dalam, RT 52 No 1 Kampung Timur, Balikpapan 76125. Telepon: (0542) 735015, 7020152, 7020151, Fax: (0542) 735013 No Rek 191.0724971 BCA Balikpapan a/n PT Mahakam Media Grafika. PENERBIT:: PT Mahakam Media Grafika. ISI DILUAR TANGGUNG JAWAB PER CETAKAN HARIAN PAGI

WARTAWAN “TRIBUN KALTIM” SELALU DIBEKALI TANDA PENGENAL DAN TIDAK DIPERKENANKAN MENERIMA/MEMINTA APA PUN DARI NARASUMBER


Halaman 8

Mi ggu, 14 Desember 2008

Thomas : Jaksa Harus Mampu Lindungi Masyarakat Disampaikan Saat Menghadiri Peresmian Kantor Kejaksaan Sendawar BUPATI KUTAI BARAT ATAS NAMA PEMERINTAH DAN MASYARAKAT KUTAI BARAT, menyampaikan selamat dengan diresmikan bangunan kantor Kejaksaan Negeri Sendawar yang berlokasi di jalan poros Barong Tongkok – Melak pada hari Kamis (11/ 12). Hal itu disampaikan Bupati Kubar, Ismail Thomas SH saat menghadiri peresmian kantor Kejaksaan Negeri oleh Kepala Kejaksaan Tinggi Kaltim Iskamto SH. LEBIH jauh dikatakan Thomas, semua pihak tahun bahwa secara fungsional bangunan kantor Kejaksaan Negeri Sendawar ini telah digunakan oleh jajaran Kejaksaan Negeri Sendawar melaksanakan kegiatan sehari-hari, walaupun peresmiannya baru bisa dilaksanakan pada saat ini. Namun, tanpa mengurangi makna penggunaan kantor ini, peresmian

pada saat ini merupakan momen yang sangat penting khususnya bagi rekan-rekan di jajaran Kejaksaan Negeri Sendawar agar lebih giat dan semangat lagi dalam melaksanakan tugasnya. Dalam proses melaksanakan roda pemerintahan dan pembangunan, tentunya pihak pemerintah daerah kabupaten sangat memerlukan dukungan baik dari masyarakat,

swasta, aparat pemerintah kabupaten sendiri, maupun jajaran instansi vertikal, salah satunya unsur Kejaksaan. Hal ini terkait dengan kewenangan-kewenangan yang dimiliki oleh instansi tersebut yang dilaksanakannya sesuai dengan amanat Undangundang. “Kutai Barat bersyukur bahwa saat ini unsur-unsur penting di sebuah kabupaten telah perlahan lengkap, dimana unsur-unsur vertikal sudah dimiliki. Kita telah memiliki Polres, Pengadilan, Kejaksaan yang definitif, dan bahkan Kodim telah resmi berdiri yang walaupun acara resmi acara peresmiannya belum dilakukan. Hal ini tentu sangat menggembirakan bagi kami di jajaran pemerintah daerah dimana tugas-tugas yang harus diemban oleh sebuah kabupaten yang diamanatkan Undang-Undang dapat dilakukan bersama,” ucap Thomas dengan penuh gembira. Perlu juga sedikit diketahui, lanjutnya, berkenaan dengan pemilihan lokasi dimana kantor ini berdiri. Pemerintah Kabupaten Kutai Barat memang telah merencanakan tempat-tempat bangunan kantor pemerintah, tempat pelayanan umum dengan maksud agar memberikan kemudahan bagi masyarakat untuk melakukan

Bupati Kubar Ismail Thomas SH dan Kajari Kubar HM Muhadjir SH menandatangani serahterima akta tanah kantor Kejaksaan Sendawar. urusan. Aspek yang juga sangat diperhatikan adalah kemudahan akses sehingga tidak menyulitkan untuk menjangkaunya. Penentuan lokasi ini juga tentu memiliki pertimbangan tersendiri dimana berdampingan dengan bangunan Pengadilan Kutai Barat, dengan anggapan bahwa sebaiknya bangunan instansi vertikal berdekatan apalagi kedua instansi ini memiliki keterkaitan dalam proses penyelesaian masalah-masalah yang berkaitan dengan hukum. Di sekitar lokasi ini inipun

Kajati Kaltim Iskamto SH menekan tombol tanda diresmikan penggunaan kantor Kejaksaan Negeri Sendawar.

Kajati Kaltim Iskamto SH dan Bupati Kutai Barat Ismail Thomas SH melihat dari dekat ruang kantor Kajari Sendawar.

Kajati Kaltim Iskamto SH, Bupati Kubar Ismail Thomas SH, Wakil Bupati Kubar H Didik Effendi Ssos, Ketua DPRD Kubar FX Yapan, Kajari Kubar HM Muhadjir SH, Kapolres Kubar AKBP I Wayan Sunartha melihat ruang serbaguna Kantor Kejaksaan Negeri Sendawar.

Bupati Kubar Ismail Thomas SH menyerahkan sertifikat akta tanah kantor Kejaksaan Sendawar kepada Kajari Kubar HM Muhadjir SH yang disaksikan langsung Kajati Kaltim Iskamto SH.

memang telah dibebaskan oleh pemerintah kabupaten untuk lokasi perkantoran, pusat pendidikan dan budaya juga pusat kegiatan olah raga. Oleh sebab itu, pemerintah kabupaten memberikan kemudahan kepada jajaran Kejaksaan Kaltim khususnya Kejaksaan Negeri Sendawar untuk membangun kantor ini dengan menghibahkan lokasi ini. Jangan sampai hanya karena kesusahan mencari lokasi, bangunan Kejaksaan ini akan jauh dan sulit dijangkau oleh masyarakat. Selanjutnya, berkenaan dengan keberadaan instansi penegak hukum di Kutai Barat ini, termasuk jajaran Kejaksaan, Pemkab Kubar memberikan apresiasi yang mendalam dimana komitmen pemerintah dalam proses penegakan supremasi hukum akan dapat lebih terlaksana dengan cepat dan baik. Karena selama ini khususnya diawal-awal pendirian kabupaten Kutai Barat ini, dimana unsur-unsur tersebut masih belum ada di Sendawar ini, ketika masih berada dalam wilayah Kutai Kertanegara, sedikit mengalami hambatan karena geografis yang cukup jauh. Namun sejak semua berada di ibukota Sendawar, beberapa persoalan yang memang menjadi kewenangan instansi

tersebut di Sendawar maka persoalan-persoalan dapat lebih singkat terselesaikan. Namun disisi lain perlu juga sampaikan bahwa ada pihak-pihak yang masih belum memahami dan mengerti pola kerja dan tanggung jawab pemerintah. Dimana masih ada masyarakat yang berpikir bahwa dengan semakin lengkapnya instansi penegak hukum termasuk kejaksaan justru menjadi ancaman bagi masyarakat, dimana ada yang berpikir bahwa hanya akan membuat banyak masya-

rakat yang dituntut dan dipenjara. Pandangan semacam ini haruslah dipahami sebagai fenomena masyarakat yang belum mengerti tentang tugas-tugas yang kita laksanakan. Namun ini merupakan tugas kita bersama, baik kami di jajaran pemerintah kabupaten maupun rekan-rekan di instansi penegak hukum agar pemikiran yang demikian pelan-pelan dapat hilang di kalangan masyarakat dan justru sebaliknya keberadaan instansi tersebut justru melindungi hak-hak hukum masyarakat. (Advertorial)

Camat Barong Tongkok Theresia Spd meletakkan batu pertama renovasi Masjid Baiturrahim

Anggota DPRD Kaltim HM Darlis Pattolongi S Hut meletakkan batu pertama renovasi Masjid Baitturahim

Plt Kakandepag Kubar Saini meletakkan batu pertama renovasi Masjid Baiturrahim

Kajati Kaltim Iskamto SH menandatangani prasasti peresmian Kantor Kejaksaan Negeri Sendawar yang disaksikan oleh Bupati Kubar Ismail Thomas SH

Wabup Resmikan Renovasi Masjid Baiturrahim WAKIL BUPATI KUBAR H Didik Effendi Ssos meminta kepada pengurus Masjid Baiturrahim Barong Tongkok untuk tetap bersemangat dalam mengumpulkan dana renovasi masjid Baiturrahim, karena yang namanya untuk kepentingan rumah ibadah akan Tuhan YME akan memberikan jalan keluar dengan mengirimkan hamba-hambanya untuk membantu penyelesaian renovasi tersebut. Hal itu disampaikannya pada saat peresmian renovasi dan peletakan batu pertama Masjid Baiturrahim Barong Tongkok, Ka-

mis (11/12). Dan acara tersebut dihadiri oleh anggota DPRD Kaltim HM Darlis Pattolongi S Hut dan Camat Barong Tongkok Theresia Spd. Lebih jauh dikatakannya, saat ini dari Pemerintah Propinsi Kaltim telah memberikan bantuan senilai Rp 400 juta untuk renovasi masjid dari total anggaran yang dibutuhkan senilai Rp 6 miliar. Mudahmudahan di tahun 2009 mendapat bantuan kembali dari pemerintah provinsi Kaltim sehingga pelaksanaan renovasi dapat terus berjalan dengan baik. Dan disatu sisi juga dengan melibatkan partisipasi

Wabup Kubar H Didik Effendi Ssos, Anggota DPRD Kaltim HM Darlis Pattolongi S Hut, Camat Barong Tongkok Theresia Spd menghadiri peresmian renovasi Masjid Baiturrahim Barong Tongkok.

umat Islam yang beribadah di Masjid Baiturrahim. Sementara itu Ketua Panitia Renovasi Masjid Baiturrahim Barong Tongkok H Edy Akhmadi menjelaskan, rencana renovasi ini dilakukan karena kondisi masjid sudah tidak memungkinkan lagi untuk menampung umat Islam yang menunaikan ibadah di dalam masjid. Masjid yang didirikan ini semasa Kutai Barat masih dalam wilayah Kukar, sehingga umat Islam yang beribadah sangat sedikit sekali namun ketika telah terbentuk menjadi kabupaten sendiri yang memisahkan diri dari Kukar semakin banyak umat Islam yang beribadah. “Mau tidak mau harus direnovasi masjid yang ada ini,” ujarnya. Ditambahkannya, luas bangunan yang ada ini 32 x 32 meter persegi dan berdiri di atas tanah 47 x 70 meter persegi. Dan dana yang dibutuhkan untuk pembangunan senilai Rp 6 miliar dan nominal itu belum tercapai. Meskipun belum terkumpul, pelaksanaan renovasi tetap dilakukan berdasarkan hasil sumbangan dari umat Islam yang beribadah di masjid ini serta donator yang ada. “Dan saldo sisa yang ada Rp 270 juta,” ungkapnya. (Advertorial)

Wakil Bupati Kubar H Didik Effendi Ssos meletakkan batu pertama renovasi Masjid Baiturrahim

Wakil Bupati Kubar H Didik Effendi Ssos, Anggota DPRD Kaltim HM Darlis Pattolongi S Hut, Camat Barong Tongkok Theresia Spd membuka selubung maket Masjid Baiturrahim yang akan direnovasi

Panitia Renovasi Masjid Baiturrahim menyerahkan proposal kepada Wakil Bupati Kubar H Didik Effendi Ssos.


Halaman 9

MINGGU, 14 DESEMBER 2008

Masih muda tapi ketinggalan jaman, waduh jangan sampai deh...Tapi, enam anak muda yang tergabung dalam grup band Assoi Geboi justru asyik mengusung irama dan penampilan yang terbilang jadul alias jaman dulu.

HAL 16

Futsal identik menjadi olahraga laki-laki. Walaupun kini perempuan juga banyak yang mengolah si kulit bundar ini. Sejak beberapa tahun lalu, permainan ini makin banyak digemari. Kini bahkan menjadi tren. Klub futsal tersebar di mana-mana. Lapangan futsal pun berdiri di mana-mana. Di Balikpapan tren itu juga mewabah. Bukan hanya kencangnya jadwal latihan, tapi juga soal koleksi sepatu hingga pamer seragam tim. Sehat sekaligus keren. Simak beritanya di hal 12 dan 13.

INDEKS FOTO

Motivasi itu perlu, Karena Hidup Hanya Satu Kali

HAL 14

Cantik dan Sehat dengan Kawat Gigi

HAL 11

HAL 10

Model: M Abduh Kuddu Properti: Pribadi Lokasi: Planet Futsal, Jl Syarifuddin Yoes Balikpapan Fotografer: M Wikan H

Si Manis untuk Akhir Pekan


10

MINGGU 14 DESEMBER 2008

Memakai Kawat Gigi

Tampil Cantik dan Tetap Sehat Jeni... Jeni... Jeni anak mami, Jeni... Jeni... pake kawat gigi LIRIK lagu bertajuk Jeni yang dibawakan \rif mengisahkan tentang seorang remaja perempuan yang bernama Jeni, anak rumahan yang sering diolok teman-temannya. Salah satunya karena menggunakan kawat gigi. Dulu, mungkin ada anggapan mengenakan kawat gigi itu tidak gaul. Tapi, saat ini kawat gigi sudah tampil dengan bentuk yang cantik dan menarik. Mengenakan kawat gigi menjadi tren tersendiri selain juga untuk menjaga kesehatan. SEBENARNYA kenapa sih harus memakai kawat gigi? Menurut drg Monica G. SpOrt, dokter spesialis ortodonti Rumah Sakit Balikpapan Husada (RSBH) , kawat gigi adalah salah satu piranti dalam ortodontik, yang merupakan salah satu cabang dari ilmu kedokteran gigi. “Ortodonti merawat maloklusi gigi atau lebih sering disebut dengan gigi berantakan. Seseorang yang mengalami maloklusi berarti terjadi disharmoni antara gigi geligi, bibir sebagai jaringan lunak, dan rahang, ataupun wajahnya,” kata dokter yang akrab disapa Monica ini. Untuk mengatasi hal tersebut,

seorang ortodontis menggunakan piranti ortodontik untuk memperbaiki susunan gigi dan rahang sehingga seseorang akan kembali mendapatkan senyum yang sehat dan menarik. Salah satu piranti ortodontik tersebut adalah kawat gigi. Disharmoni gigi geligi dengan organ lainnya ini merupakan masalah ortodontik yang dapat diperoleh karena genetis. “Misalnya, gigi berjejal, berjarak, tonggos, berlebih, atau hilang/tidak ada benis hingga masalah pada pertumbuhan rahang,” katanya. Tapi pertumbuhan gigi yang tidak baik juga dapat disebabkan karena kebiasaan buruk seperti mengisap jari, bernapas melalui mulut, pola penelanan yang tidak normal, kehilangan gigi sulung lebih cepat atau terlambat, kehilangan gigi tetap, kecelakaan dan faktor lainnya. Mengapa gigi dengan masalah ortodontik tersebut harus mendapatkan perawatan ortodontik? Menurut Monica, gigi yang tidak beraturan susunannya dan berjejal akan sulit untuk dibersihkan. “Hal ini dapat menyebabkan gigi berlubang, penyakit gusi hingga kehilangan gigi. Posisi gigitan yang tidak sesuai juga dapat mengakibatkan aus atau terkikisnya permukaan email gigi, kesulitan mengunyah dan atau

IST

berbicara. Sementara tekanan berlebih pada tulang penyangga dan gusi berpotensi menyebabkan gangguan sendi rahang,” katanya. Selain faktor kesehatan, ketidakrapian gigi juga akan merusak penampilan yang menyebabkan berkurangnya kepercayaan diri. “Baik anak ataupun orang dewasa yang tidak dirawat sering merasa rendah diri, mengaupkan bibir rapat-rapat saat tersenyum atau menutup bibir dengan tangan saat tersenyum,” katanya. Soal biaya perawatan gigi, Monica mengatakan, biaya perawatan ortodontik jauh lebih ringan dibandingkan biaya perawatan gigi yang diperlukan jika masalah berkembang lebih parah di kemudian hari. Sebenarnya, perawatan

Kawat gigi kini makin bermacammacam bentuk, warna, dan bahannya. Ada natural, warnawarni, bahkan transparan. Kawat gigi bukan hanya menjadi aksesori gigi, tetapi juga membuat gigi menjadi lebih sehat.

ortodontis ini sebaiknya dimulai sejak dini sebelum anak berusia tujuh tahun. Tapi, dokter Monica meyakinkan tidak pernah ada kata terlambat untuk memulai. Tak heran jika dalam beberapa tahun terakhir ini banyak masyarakat yang mengenakan kawat gigi. Bukan hanya masyarakat biasa, bahkan selebritis juga tak ketinggalan ikut menjadikan tren kawat gigi semakin cepat berkembang. Kawat gigi pun tidak lagi jadul alias jaman dulu atau ketinggalan jaman. Tampilan kawat gigi juga cantik bahkan ada yang menggunakan berlian, kawat yang berwarna-warni dan yang terbaru adalah kawat gigi transparan. Nah, kini dengan kawat gigi juga dapat tampil cantik. Pastinya penampilan cantik juga tetap diawali dengan keinginan untuk sehat. (cpk)

<<< Perhatikan >>> Makanan yang harus Dihindari: keras, lengket, dan permen karet Harus benar-benar dihindari: Gula-gula, karamel, es, permen karet, permen keras Berhati-hatilah terhadap: Popcorn, irisan apel, wortel, kacangkacangan, jagung tongkol, pizza crust, doritos Kurangi konsumsi gula: pop soda dan minuman dengan gula, es krim, permen, kue kering, dan cake (cpk)

drg Monica G SpOrt, RS Balikpapan Husada

Petunjuk - Hindari menggigit pensil, pena, maupun ujung kuku

- Jangan menggigit makanan dengan gigi depan. Sebaiknya gunakan pisau dan garpu untuk mengiris makanan (cpk)

TRIBUN KALTIM/MEI

Perawatan dan Pemeliharaan ❍ Gunakan sikat gigi ortodontis minimal dua kali sehari. Sikat lembut gigi atas dengan arah dari atas ke bawah dan sebaliknya untuk gigi bagian bawah sesuai dengan pola tumbuh gigi. m Gunakan interdental toothbrush untuk membersihkan bagian bawah dan sekitar kawat dan penjepit. Interdental toothbrush akan membantu membersihkan kawat gigi Anda sementara menjaga kesehatan gigi ❍ Pekailah waxed floss untuk membersihkan areal sekitar gigi dengan hati-hati. Tempatkan benang di belakang orthodontic wire, selipkan di areal antara, dan hilangkan plak dari gigi. ❍ Pergunakan mouthwash antibakteri untuk mengurangi radang di gusi dan pipi. Mouthwash ini membantu mencegah infeksi dan mengurangi iritasi yang mungkin terjadi akibat kawat gigi Anda. Gunakan mouthwash empat kali sehari sesuai dengan jadwal menggosok gigi, setelah makan, atau setelah pulang sekolah, dan sebelum tidur. ❍ Topical fluoride :yang membantu mencegah pembusukan gigi akibat mengenakan kawat gigi dengan membunuh bakteri dan menggantikan mineral pada email gigi. Penggunaan fluoride tidak untuk menggantikan gosok dan flossing gigi. Sebaiknya hindari makan atau minum selama tigapuluh menit setelah menggunakan fluoride. Ini penting untuk menjaga kandungan aktifnya tetap bertahan pada gigi. ❍ Segera pergi ke ortodontis Anda apabila kawat longgar atau terlepas. Mungkin saja kawat tersebut perlu segera diperbaiki sesegera mungkin. Dalam kondisi darurat, apabila Anda perlu memotong kawat, gunakan pemotong kuku yang telah dicuci dan disterilisasi dalam alkohol. ❍ Iritasi karena kawat gigi mungkin saja terjadi. Perhatikan cara untuk mengatasinya dengan menggunakan kain katun atau dengan sedikit wax. (cpk)

IST

Sikat gigi khusus untuk pengguna kawat gigi

Han ya PPeerl un anya rluu 1-3 Tah ahun MENGENAKAN kawat gigi memang bukan hal yang biasa. Untuk pertama kalinya memang perlu ada proses adaptasi. Tapi, lama kelamaan akan terbiasa juga. Berapa lama waktu mengenakan kawat gigi? Menurut drg Monica G. SpOrt, dokter spesialis ortodonti Rumah Sakit Balikpapan Husada (RSBH), rata-rata pasien mengenakan alat orotdontik selama satu hingga tiga tahun saja. “Lamanya perawatan bervariasi tergantung tingkat keparahan kasus serta kerjasama pasien sendiri dalam melaksanakan instruksi dari ortodontis,” katanya. Kesadaran untuk mengenakan kawat gigi tentu juga harus dibarengi dengan kesadaran menjaga pola makan dan hidup. “Bila pasien rajin membersihkan gigi, menghindari makanan keras dan lengket, rajin menggunakan karet elastis dan atau headgea seperti yang diinstruksikan dan tepat waktu untuk aktivasi setiap bulan, biasanya perawatan akan selesai tepat waktu dan hasilnya juga baik,” katanya. Berapa biaya untuk memasang kawat gigi? Untuk besaran biayanya, Monica menjelaskan hal tersebut baru dapat ditentukan setelah mengetahui kondisi pasien. “Besarnya biaya tergantung dari permasalahannya, kompleksitasnya dan juga lama perawatan. Sebaiknya diskusikan dengan ortodontis Anda sebelum memulai perawatan,” katanya. (cpk)


Buku R E S E N S I

MINGGU 14 Desember 2008

!! Perjalanan Sastra

!! Jiwa-jiwa Bercahaya

Biografi Pengarang Kalimantan Timur

Hanya Allah yang Patut Dicintai

KEBERADAAN karya sastra di tengah masyarakat tidak dapat dilepaskan dari sosok seorang pengarang. Karya sastra, yang merupakan hasil kerja kreatif pengarang berdasarkan rekaman pengalaman dan olah imajinasi, sering menampilkan realitas kehidupan pengarangnya. Hal tersebut menunjukkan terdapatnya hubungan yang erat antara latar belakang pengarang dan karyanya. Seperti yang terjadi di daerahdaerah lain di Indonesia, dunia kesastraan di Kalimantan Timur menunjukkan gerakan yang dinamis. Kehadiran sastra Indonesia yang tercatat paling awal di Kalimantan Timur adalah melalui penerbitan surat kabar Masyarakat Baru pada tahun 1946 (Dahlan dalam Antologi Menyambut Fajar, 2002 : 3-8). Surat kabar yang pada waktu itu di bawah pimpinan Umar Dahlan telah memuat karya sastra yang berupa puisi. Beberapa penyair yang aktif menulis puisi untuk Masyarakat Baru, di antaranya adalah H Amir, Ahmad Noor, Maswan Dahri, Burhan Dahlan, Ahmad Dahlan (D. Adham), Muhran Ismael (Suhana), dan lain-lain. Pada 1946 dapat disebut sebagai tonggak kelahiran sastra modern Indonesia di Kalimantan Timur karena puisi-pusi yang dimuat pada waktu itu menunjukkan ciri yang berbeda dengan sastra lama Indonesia. Tematema yag diangkat berisi cinta kasih, ketuhanan,

NOVEL religius setebal 335 halaman karya Wahyudi Asmaramany ini bercerita tentang kehidupan seorang aktivis dakwah kampus di Universitas Mulawarman, Samarinda, yang peduli dengan dakwah. Pemuda tersebut tidak hanya menegakkan syariat Islam dalam kehidupannya sehari-hari tetapi juga mengamalkan dan menjalankan syariat-syariat Islam dengan istiqamah. Pemuda tersebut bernama Salman Al-Farisi yang berasal dari keluarga yang sederhana. Faris, nama panggilan dalam tokoh novel Jiwa-Jiwa Bercahaya tersebut, adalah siswa teladan lulusan Madrasah Aliyah Tenggarong dan tergolong siswa yang cerdas dan pintar. Berkat kecerdasan yang dimilikinya dia diterima kuliah di Universitas Al-Azhar, Kairo. Namun, semua impiannya pupus ketika hendak berangkat ke Mesir. Faris mendapat surat wasiat dari ayahnya yang telah meninggal 2 tahun sebelumnya. Ayahnya menginginkan Faris masuk pesantren bila sudah lulus dari Madrasah Aliyah. Pesantren Rahmatullah yang terletak di Desa Lempake. Faris diminta ayahnya untuk tinggal selama 5 tahun di pesantren tersebut. Di Pesantren Rahmatullah Faris pun ternyata bisa melanjutkan kuliah di Universitas Mulawarman dengan biaya dari pesantren. Akhirnya rasa sedih yang semula menghantui perasaannya selama satu tahun belakangan karena gagal kuliah di Universitas Al-Azhar, Cairo, secara perlahan bisa diatasinya bahkan Faris bersyukur karena masih bisa kuliah di

semangat perjuangan, patriotisme, dan nasionalisme. Hal itu sangat berbeda dengan bentuk-bentuk puisi lama Indonesia yang masih kental mengangkat tema kedaerahan. Selain itu, bentuk pusinya juga terikat oleh rima dan baris seperti kebanyakan bentuk sastra Seiring perjalanan waktu, di Kalimantan Timur telah lahir banyak pengarang sastra Indonesia yang tersebar di berbagai wilayah kabupaten atau kota. Beberapa pengarang juga menerbitkan karyakaryanya dalam berbagai media massa, baik yang terbit di kota-kota di Kaltim maupun di luar Kaltim. Sayangnya, karya-karya tersebut tidak terdokumentasi secara baik.

Kondisi seperti itu menjadi kendala tersendiri bagi pihak-pihak yang berkeinginan untuk mendapatkan informasi kesastraan di Kaltim secara mudah, lengkap, dan cepat. Sampai dengan saat ini belum ditemukan adanya buku yang memuat gambaran jatidiri pengarang Kalimantan Timur dan karya-karyanya secara lengkap. Jika telah didokumentasikan pun, uraian terkait dengan jatidiri pengarang dan karya-karyanya belum memadai. Bahkan, selama ini sebagian besar dokumentasi sastra hanya difokuskan pada karya sastra yang dihasilkan oleh pengarang tertentu. Latar belakang pemikiran tersebut mendorong Kantor Bahasa Kaltim menyusun buku yang mampu memberikan informasi sastra secara lengkap melalui buku Biografi Pengarang Kalimantan Timur. Buku ini disusun dengan cukup jeli. Para penyusun yakni Mira Nurhayati, Aminudin Rifai, Misriani, Desi Ariani, Aquari dan Deri Ris Riana. Di antara 54 sastrawan yang dimuat dalam buku ini, ada 10 perempuan pengarang yang berkiprah dalam dunia sastra yakni Sri Maryati (3 Juli 1959) , Fatimah Asyari (3 Juni 1966), Siti Jumariyah (24 April 1967), Atik Sulistiowati (22 April 1968), Atik Sri Rahayu (28 November 1970), Sri Kartika Sari Aziz (6 Agustus 1972), Harsanti (21 Oktober 1972), Muthi’ Masfu’ah (15 Oktober 1975), Tri Wahyuni (1 Mei 1980) dan termuda Erna Wati (26 November 1983). (flp/art)

Unmul Di kampus barunya, Faris pun bergabung dengan Pusat Studi Islam Mahasiswa (Pusdima). Di kehidupan percintaan, Faris menerima pinangan dari Said Muhammad Yusuf Al-Hasani di Samarinda Seberang untuk menikahi anak perempuannya. Padahal Faris belum tahu wanita tersebut. Faris pun memasuki semester terakhir. Ia ditempatkan di sebuah desa di Kutai Barat untuk melakukan penelitian. Ada sembilan mahasiswa yang ikut penelitian, Faris selaku ketua kelompok, Enggo, Mukhtar, Jessrianto selaku teman dekat Faris, Munir, Farah, Nuri, Aini, dan Vina. Selama melakukan penelitian ternyata dua teman Faris, yakni Jessrianto dan Munir menaruh perasaan pada Aini mahasiswi Kedokteran yang cantik. Akan tetapi, Aini malah menyukai Faris. Bukan karena ketampanannya, tetapi karena hati dan akhlak yang dimiliki Faris.

11

Syeikh Yusuf pun mendatangi tempat Faris melakukan penelitian. Ia membawa anak perempuannya. Akhirnya Faris menikah dengan anak Syeikh Yusuf. Sedangkan Aini menyadari bahwa hanya Allah yang patut dicintai. (flp/art)

Wahyudi Asmaramany Lahir : Samarinda, 19 April 1986 Kuliah : Universitas Mulawarman Samarinda FMIPA Jurusan Matematika / Statistika Tingkat akhir. Masuk kuliah pada tahun 2004 melalui jalur PBUD (Penjaringan Bibit Unggul Daerah) Hobi : Membaca buku-buku Islami dan musik Favorit adalah Murottal Peagalaman Organisasi: 1. Ketua pelaksana Studi Islam Sains IV 2005, 2. Panitia Forum Silaturahmi Lembaga Dakwah Kampus Nasional (FSLDKN) UNMUL 2005 3. Ketua Pelaksana Olimpiade Matematika II Tingkat SMA Se-Kaltim di FMIPA UNMUL 2006 4. Koordinator pembuat soal Olimpiade Matematika III tingkat SMP & SMA Se-Kaltim di FMIPA UNMUL 2007 5. Wakil ketua HIMASTA periode 2006-2007 6. Pernah dipercaya menjadi asisten Dosen. E-mail : regas_ad_duha@yahoo.com

Motivasi itu perlu

Karena Hidup Hanya Satu Kali SETIAP manusia terlahir di dunia, pasti tidak lepas berhadapan dengan banyak masalah hidup, hanya orangorang yang cerdas bisa keluar dari masalah dengan senyum ketegaran, sebaliknya ketika tidak pandai menarik hikmah dari setiap masalah, bisa jadi terpuruk dalam pandangan sempit memadang dunia. Padahal masalah dan cobaan adalah bunga kehidupan orangorang beriman. Lalu, sudahkah kita tepat menempatkan diri? Sebuah paku saja akan menghadapi masalah pada tubuhnya bila tidak tepat menempatkan diri. Bila ia terletak di tanah basah, suatu saat ia akan berkarat, tidak memiliki guna, terinjak, bahkan mungkin suatu saat akan terkubur bersama karat yang menyelimutinya. Tapi bila manusia bisa menempatkannya di tempat yang tepat, menancapkan paku pada sebuah dinding, walaupun ia berkarat, paku itu berguna bagi manusia. Sebagai penyangga, tempat gantungan, atau sebagai penyatu berbagai benda.

IST

Maka, jangan menjadi paku yang terletak di tanah basah. Tapi jadilah paku yang dapat menyangga kehidupan manusia. Walaupun kecil, tanpa paku itu sebuah bangunan besar tidak akan pernah berdiri. Bukankah hidup di dunia ini hanya sekali, terlalu indah untuk kita lalui dengan sia-sia, karena memang Allah menciptakan makhluknya tidak untuk sia-sia. Betapa bahagianya hidup ini, bila kita jalani dengan penuh semangat dan optimisme yang tinggi. Betapa indahnya hidup ini

bila hari-hari manusia jalani dengan rasa syukur, senyum kebahagiaan dan sikap positif memandang masa depan. Betapa sejuknya bila manusia sabar dan ikhlas menghadapi setiap permasalahan, kemudian berusaha memecahkannya dan mengambil hikmah dari setiap kejadian. Karena semua yang ada di dunia ini adalah milik-Nya dan sudah pasti akan dikembalikan pada-Nya. Karena manusia hadir di dunia dengan tidak membawa apa-apa, manusia pun kembali ke pangkuan-

Nya juga tanpa membawa apa-apa, kecuali nilai amal shaleh yang kita ukir selama hidup di dunia. Karena hidup hanya satu kali, ukir prestasi, karya dan bakti untuk bangsa ini dengan kecintaan karena-Nya. “Life is not only for bread,” hidup bukan sekedar untuk sepotong roti. Karena terlalu naïf dan mudah bila manusia hidup hanya mengejar kenikmatan materi semata, karena manusia memiliki tugas yang sangat berat, namun sayangnya tak semua manusia memahami amanah yang diberikan untuknya, sebagai sosok penebar rahmat seluruh alam. Setidaknya ini yang bisa ditarik garis bawah, poin buku Karena Hidup Hanya 1 Kali (KHHK) yang ditulis oleh Muthi’ Masfu’ah yang terbit pada November 2008 dengan penerbit Rie View Jakarta. Harapan dengan terbitnya buku KHHK ini mengajak pembacanya agar tidak stagnan atau tidak berbuat dan menghasilkan apa-apa, tidak menghasilkan karya, karena buku ini ditulis dengan cinta, dengan semangat

berbagi oleh penulisnya, agar memberikan percikan imajinatif kepada siapa saja yang membacanya, dapat memberikan barakah dari Allah SWT hingga menjadi jalan kebaikan yang terus bertambah. Karena api besar dimulai dari percikan kecil, semoga percikan kecil imajinasi yang berada dalam lukisan buku ini, seperti harapan penulisnya, akan memperkaya dan memperdayakan potensi kita agar lebih termotivasi, mampu meretas sejuta tantangan dan meraih prestasi tinggi yang layak dicatat dalam sejarah. Walau, buku ini masih terkesan meloncat-loncat antara bab yang ada, mungkin lantaran terburu waktu dala menulisnya, tapi setidaknya buku ini mampu memotivasi siapa saja yang membacanya. Seperti harapan penulisnya, karena zaman terus beranjak tua, bumi akan terus berputar dengan kecapatan waktu yang terus meninggalkan manusia… Big think, start small, act now!

Menjadi akar oleh: Muthi’ Masfu’ah

ah, ternyata tidaklah mu Meski berada di bawah tan dah at, Karena ia rela tak terlih kegelapan bersama tanah am dal berada tersembunyi ngeluh, Karena ia tak pernah me hujam ke dalam bumi ng dengan kuat cakarnya me an menyangga batangbos ah Karena ia tak pern langit i batangnya menjulang ke elahan, mengalirkan sar kel ah rn pe tak ia Karena air ke batang-batangnya yang lezat hingga memberikan buah n henti untuk mengajarka Karena ia tak pernah ber hakekat keikhlasan yang sejati perlu dipuji tapi dengan Yang tak perlu terlihat, tak .. tulus melakukan tugasnya.

Berpikir besar, mulai dari yang kecil dan beraksi sekarang! Karena hidup hanya 1 kali… Sungguh... kita menjadi

ada di dunia adalah takdir Allah yang terindah. Sebab menjadi yang lain tentu tidaklah mudah...(flp/art)


12

MINGGU 14 Desember 2008

Gaya Lionel Messi di Lapangan Futsal

TRIBUN/ABDUH

BIODATA ● Nama: Paulus Meta Gracendy ● Lahir: 10 April 1985 ● SMA: Patra Dharma ● Kampus: Sekolah Tinggi Ilmu Ekonomi Malang (ABM) ● Prestasi: - Juara LA Cup bersama Dido King (2008) - Juara Beruang Madu Cup bersama Volker (2006 & 2007) - Pemain terbaik Unmer Futsal Competition (2007) - Juara Kelme Cup bersama Volker (2006) - Pemain terbaik Airlangga Cup (2003) (bdu)

DULU Paulus bercita-cita menjadi pemain sepakbola profesional. Apalagi sejak SD, ia sempat disekolahkan ayahnya di Klub Sepakbola Bina Bakat milik Persiba Balikpapan. Tapi niat Paulus itu tidak kesampaian, karena orangtuanya menginginkan agar Paulus memilih cita-cita lain. “Katanya sih, kalau sepakbola di Indonesia belum jelas kariernya,” kata Paulus saat ditemui di sela-sela latihan bersama Tim Dunia PS di Planet Futsal, Minggu kemarin. Meski begitu, Paulus masih bisa menyalurkan hobinya itu. Dalam beberapa kali kesempatan, ia sering meraih prestasi di bidang olahraga ini. Sewaktu SMA, Paulus pernah menjadi pemain terbaik se-Balikpapan dalam ajang futsal yang diadakan Kampus Airlangga tahun 2003. Kala kuliah di Malang, beberapa kali timnya, Volker, menjuarai kompetisi yang diadakan antarkampus. “Kami pernah dua kali juara lho,” tutur anak pertama dari tiga bersaudara ini. Futsal untuk Paulus bukan hanya sekedar olahraga, tapi juga gaya hidup. Maka tidak heran jika ia menghabiskan uang jutaan rupiah untuk membeli sepatu bola dan kostum. “Saya punya 7 pasang sepatu, lima pasang bermerk Nike, dua pasang Specs,” katanya. Ia juga bermain untuk dua tim, Dunia PS dan Dido King. Kalau di Dunia PS dengan sesama teman kuliah di Malang dulu, tapi kalau Dido King adalah tim futsal profesional. Bersama Dido King, Paulus sudah pernah meraih prestasi. “Kami dua kali juara LA Cup tahun ini,” kata penggemar berat striker Barcelona, Lionel Messi ini. Setiap bermain, Paulus kerap menirukan gaya Lionel Messi. Jari kelingking dan jempolnya diacungkan ke atas, untuk merayakan gol yang dicetak. (bdu)

Tren Futsal di Balikpapan

Sudah Menjadi

Gaya Hidup L

APANGAN Futsal kini mulai menjamur di Balikpapan. Dimana-mana ramai dibicarakan orang. Peminatnya pun banyak, mulai dari kalangan pelajar dan mahasiswa, masyarakat biasa sampai pebisnis dan profesional muda. Para penggila futsal ini memang tidak bermaksud menjadi pemain profesional. Mereka pun cenderung tidak terlalu peduli dengan perbedaan futsal dengan mini soccer. Yang jelas, permainan futsal tidak keras, tidak ada body touch dan bisa dimainkan sambil ledek-ledekan. Apalagi, biaya yang dikeluarkan setiap kali latihan, terjangkau. “Just for fun,” kata Amrie Fitrie, Manajer Tim Futsal Dunia PS, yang rutin berolahraga futsal bersama timnya setiap Minggu pagi, di Planet Futsal, Jl Syarifuddin Yoes, Balikpapan Selatan. Tim Dunia PS juga bukan diisi pemain sepakbola professsional. Pemainnya rata-rata adalah profesional muda. Beberapa ada yang bekerja sebagai karyawan bank swasta, PNS, sampai wiraswasta. “Ada yang teman main sejak kecil, tapi ada juga teman semasa kuliah dulu,” ujarnya. Tidak sekedar olahraga mencari keringat demi kesehatan, tapi olahraga dalam ruang ini rupanya juga sudah menjadi gaya hidup atau life style. Bahkan, banyak juga penggila futsal yang rela merogoh koceknya hingga ratusan ribu bahkan jutaan rupiah, hanya sekedar bergaya di lapangan. Muhajir misalnya. Karyawan salah satu perusahaan kontraktor migas di Jl Mulawarman ini, sampai menghabiskan ratusan ribu rupiah untuk membeli kostum sampai sepatu bola. Misalnya saja sepatu Adidas yang

TRIBUN/ABDUH

dikenakannya setiap kali bermain. “Saya belinya Rp 450 ribu. Kuat, kualitasnya juga terjamin. Merknya juga terkenal sih,” katanya seraya bergaya menendang bola. Menurutnya, penampilan atau gaya ketika bermain, juga mempengaruhi kualitas permainan. “Rasanya kurang sreg kalau pakai yang biasa, kurang semangat,” kata Hajir. Lain lagi dengan Yulis. PNS Pemkot Balikpapan ini bisa sampai tiga kali dalam seminggu bermain futsal.

Baginya, futsal bukan hanya sekedar olahraga tapi sudah menjadi gaya hidup. “Rasanya tidak enak kalau tidak main futsal dalam satu minggu,” ujarnya. Di sejumlah tempat, lapangan futsal justru dipenuhi oleh para profesional muda. Andrew, karyawan sebuah perusahaan bidang telekomunikasi rutin berfutsal seusai jam kerja. Dia bahkan sudah mengontrak lapangan dua kali dalam seminggu untuk 3 bulan di Planet Futsal. “Mainnya dengan

teman dari perusahaan lain dalam satu grup. Biarpun nggak ada yang jago futsal, tapi lumayanlah buat ngilangin stres dan bikin badan tetap bugar,” katanya sambil mengelap keringat di lehernya. Selain itu, futsal juga sering dijadikan ajang pertemuan bisnis. Seperti yang dilakukan Franky, pengusaha tekstil di Pandansari. Ia sering mengajak relasi bisnisnya bermain futsal. “Futsal membuat saya lebih akrab dan dekat dengan relasi,” tuturnya. (bdu)

Kata Mereka Ingin Main Sampai Puas

Seminggu Empat Kali

Tak Ada Budget Khusus

Amrie, wiraswasta

Muhajir, karyawan swasta “KALAU libur kerja tiba, satu minggu saya bisa main futsal sampai empat kali. Namanya juga hobi. TRIBUN/ABDUH Biasanya saya main dengan teman kantor yang mendapat tantangan bertanding dari perusahaan lain. Lumayan, cari keringat dan dapat tambahan relasi.” (bdu)

Yusdi, PNS

“SETIAP bulan, saya bersama temanteman di Futsal Dunia PS menyisihkan dana Rp 2 juta untuk menyewa TRIBUN/ABDUH lapangan futsal dan kebutuhan latihan. Bukan sekedar hobi, tapi futsal sudah menjadi kebiasaan dan gaya hidup saya. Niatnya sih ingin buat lapangan futsal sendiri. Jadi bisa main sendiri sampai puas.” (bdu)

“TIDAK ada budget khusus untuk futsal. Tapi dalam satu bulan saya biasa beli baju olahraga sampai tiga TRIBUN/ABDUH pasang. Untuk urusan sepatu, biar harganya mahal asalkan nyaman dipakai, tidak jadi soal. Koleksi sepatu saya ada tiga, Adidas, Diadora dan Nike.” (bdu)


MINGGU 14 Desember 2008

13

Bukan Sekadar Bisnis Olahraga ● Dunia Futsal Terapkan Aturan Olahraga tanpa Rokok SEPAK bola mini yang lebih dikenal dengan futsal juga banyak digemari di Kalimantan Timur. Di Balikpapan dan Samarinda saja, sudah banyak dibuka tempat penyewaan lapangan futsal. Maklumlah, olahraga ini digemari semua kalangan mulai dari anak-anak hingga orang dewasa, mulai pelajar hingga eksekutif muda bahkan juga para wanita tak ketinggalan beraksi di lapangan futsal. Apakah futsal menjadi bisnis baru yang menjanjikan?

TRIBUN KALTIM /WIK

Lapangan Planet Futsal Balikpapan di Jl Syarifudin Yoes.

Utamakan Keamanan Pengguna ● Dilengkapi CCTV ASYIK berolahraga, tapi pusing memikirkan keamanan barang bawaan? Di Planet Futsal hal ini tidak perlu terjadi. Hartono Gunawan, pemilik Planet Futsal Balikpapan menjelaskan, keamanan para pengguna adalah yang utama. “Kami melengkapi areal Planet Futsal dengan beberapa CCTV sekaligus yang tersebar di berbagai lokasi. Jadi, tindak kriminal yang mungkin terjadi dapat terkontrol. Ketahuan kalau ada yang mau iseng terhadap kendaraan tamu,” katanya.

❍ ❍

Kamera CCTV ini pun terhubung online dengan cabang lainnya. “Jadi, manajemen kami juga dipantau. Ketahuan tuh, berapa banyak tim yang main di lapangan,” katanya. Selain keamanan barang bawaan, Hartono juga menuturkan tengah menjajaki kemungkinan untuk menyediakan asuransi bagi para pemain yang bermain di Planet Futsal. “Jadi, supaya pengguna lapangan lebih aman dan nyaman saat berolahraga,” katanya. (cpk)

Kaya Manfaat

Ada beberapa faktor yang membantu pemain dalam mengembangkan kemampuan teknik bermain bola yang baik : ❏ Kecerdasan Inilah bedanya futsal dan sepak bola. Di futsal seorang pemain dituntut bisa melakukan sebuah improvisasi dalam menghadapi masalah dalam bermain. Jadi secara spontan pemain harus bisa mengeluarkan tekniknya. Futsal ini sangat ideal sebagai sarana mengembangkan intelegensi dalam bermain sepak bola. ❏ Keahlian teknik Teknik lebih berperan dari tenaga dalam bermain futsal. Jika teknik yang dimiliki pemain tidak memenuhi syarat, pemain tidak bisa melepaskan diri dari pressing lawan. Kondisi ini membuat pemain mau tidak mau harus meningkatkan skillnya. Baik dalam hal kontrol bola, pergerakan dengan dan tanpa bola, footwork, passing, dribbling dan shooting. ❏ Total football Di futsal, jumlah pemain yang sedikit membuat seluruh pemain bermain dengan total football. Jadi saat tim menyerang, tidak hanya pemain depan yang bekerja. Begitu pula saat bertahan, pemain depan juga turun membantu pertahanan. Maka dari itu, pemain futsal dituntut memiliki stamina yang prima, karena harus selalu bergerak. ❏ Kecepatan Ruang gerak yang sempit membuat aliran bola bergerak cepat di antara kaki pemain. Jadi pemain futsal dituntut untuk bermain cepat, baik dalam hal passing, gerak tipu dan shooting. Tentu hal ini menjadikan nilai lebih jika digunakan dalam bermain sepak bola lapangan besar. ❏ Hiburan Di futsal terjadinya gol jauh lebih sering daripada di sepak bola. Dengan skill pemain yang tinggi, pergerakan bola yang cepat dan seringnya terjadi gol, maka futsal menjadi tontonan yang menyenangkan. (infofutsal/cpk)

❍ ❍

Asal Mula

❍ ❍

❑ Futsal berasal dari bahasa Spanyol, yaitu futbol (sepak bola) dan sala (ruangan). Jika digabung artinya menjadi sepak bola dalam ruangan. ❑ Futsal dimulai tahun 1930, di Montevideo, Uruguay yang diperkenalkan oleh Juan Carlos Ceriani, seorang pelatih sepak bola asal Argentina. Ceriani kesal lantaran jadwal latihan yang telah disusun menjadi berantakan karena lapangan tergenang air. ❑ Ceriani sempat memaksa menggunakan 11 pemain. Tapi, karena lapangan sempit, jumlah pemain dikurangi menjadi lima orang tiap tim termasuk penjagwa gawang. ❑ Latihan di dalam ruangan ternyata sangat efektif dan efisien. Bahkan mampu menarik minat banyak masyarakat di Montevideo. Akhirnya, banyak penggemar bola di kota tersebut yang mencoba permainan baru ini. ❑ Sejarah futsal versi FIFA ini tidak serta merta diterima begitu saja. Ada beberapa negara yang mengklaim futsal berasal dari negara mereka masing-masing. ❑ Kanada dan Brazil termasuk negara yang mengklaim bahwa Futsal berasal dari negara mereka. ❑ Brazil mengklaim saat yang bersamaan dengan munculnya cerita Ceriani, pemain bola di Brazil sudah melakukan hal yang sama, namun di Brazil tidak menggunakan aturan baku, artinya aturan tiap daerah berbeda-beda. ❑ Sementara di Italia, futsal mulai dikenal pada tahun 1950an. Futsal di Italia diperkenalkan oleh pemain-pemain sepak bola impor dari Amerika Latin yang bermain di Seri A (Liga Italia). Di saat senggang, pemain-pemain tersebut bermain futsal. ❑ Beda halnya dengan di Inggris. Di Inggris pemain-pemain sepak bola sering melakukan latih tanding enam lawan enam di lapangan rumput. Futsal juga terkenal di Inggris, hingga suatu saat diselenggarakan turnamen futsal yang disponsori oleh London Express, salah satu harian terkemuka di London. ❑ Sedangkan di Spanyol, perkembangan futsal jauh lebih cepat. Hal ini bisa terjadi karena budaya dan gaya bermain bola di Spanyol sangat mirip dengan budaya Amerika Latin. ❑ Kompetisi internasional futsal pertama kali digelar di Indonesia tahun 1965 yang dimenangkan Paraguay. ❑ Piala dunia futsal edisi FIFA yang pertama digelar di Belanda pada 1989 dan yang kedua digelar di Hong Kong di tahun 1992, dengan Brazil sebagai juara di kedua event ini. ❑ Di Indonesia, futsal mulai marak pada tahun 2003 meski telah mulai dirintis sejak tahun 19992000-an. ❑ Bagi mereka yang tinggal diperkotaan, yang notabene sulit mendapatkan lapangan cukup luas untuk bermain bola, futsal di rasa menjadi alternatif olah raga yang pas. Tak heran bila penggemarnya tak hanya dari kalangan pelajar dan mahasiswa, tapi juga karyawan hingga selebriti. ❑ Untuk memainkan futsal juga tidak memerlukan begitu banyak pemain. Jadi, perusahaan juga tidak kesulitan untuk mencari pemain. Di kalangan eksekutif, futsal adalah pilihan olahraga yang tengah naik daun. (dariberbagaisumber/cpk)

Futsal vs Sepak Bola ❐ Futsal memiliki peranan penting bagi perkembangan bakat pemain sepak bola. Contoh nyata seperti pesepak bola Brasil. Sebagian besar pemain top Brasil bermain futsal di masa kecilnya. Seperti Ronaldinho, Pele, Zico, Socrates, dan Bebeto. Berkat bermain futsal mereka bisa memiliki kelincahan, kecepatan dan intuisi yang sangat bagus dalam mengolah si kulit bundar di lapangan. ❐ Jika dibandingkan dengan sepak bola, peraturan di Futsal jauh lebih ketat. Pemain dilarang melakukan sliding tackle (menjegal dari belakang) dan body charge (benturan badan), jadi pemain futsal bisa mengeluarkan kemampuan tekniknya tanpa takut dicederai lawan. (infotusal/cpk)

MUDAHNYA membangun lapangan futsal membuat banyak orang tertarik terjun di bisnis ini. Terpenting lapangan rata. Gawangnya pun juga mudah didapatkan. Salah satu persewaan lapangan futsal yang ada di Balikpapan dan Samarinda adalah milik sebuah kelompok waralaba Planet Futsal. Keistimewaan lapangan futsal yang ditawarkan Planet Futsal adalah menggunakan rumput sintetis. Rumput sintesis merupakan rumput yang bentuknya seperti tali rapiah, tapi lebih kuat dan sering ditaburi pasir yang mirip pasir pantai. Agar tidak licin, dasarnya pun diberi karet.

menghadirkan Rumput sintesis lapangan futsal lebih diminati dengan rumput karena berasa sintetis yang bermain di berkualitas. Di rumput, seperti Balikpapan, di luar negeri. Planet Futsal Tidak seperti menyediakan tiga lapangan lapangan. Untuk sepakbola di kenyamanan dan Indonesia. keasyikan Sedangkan untuk berolahraga, lapangan futsal TRIBUN KALTIM/M WIKAN penerangan dan internasional Hartono Gunawan pengaturan biasanya udara juga sangat menggunakan karpet khusus. diperhatikan. Demi keperluan Sampai saat ini Planet penerangan, Hartono Futsal telah memiliki belasan menggunakan lampu dari cabang di seluruh Indonesia. Jerman yang per bijinya Hartono Gunawan, pemilik berharga Rp 300.000. “Karena Planet Futsal Balikpapan bermain di sini kan juga perlu mengatakan, dirinya sengaja ada penerangan yang cukup memilih bergabung dengan supaya permainan juga lebih waralaba penyewaan futsal asyik,” katanya. Hartono juga untuk mendapatkan maintetidak melupakan pengaturan nance yang lebih bagus. udara, AC atau air condition“Memang konsekuensi ing juga disesuaikan sebagai franchise, setiap jumlahnya untuk menjaga tahun harus membayar. Tapi, ruangan tetap sejuk. maintenance-nya lebih Demam futsal tampaknya bagus. Mulai dari jala, hingga memang menjanjikan rumput. Kualitasnya juga keuntungan. Menurut terjaga. Karena mulai dari awal pendiriannya, kita sudah Hartono, bisnis ini masih dapat bertahan meski dunia benar-benar dikontrol dari saat ini tengah diterpa krisis pusat jadi standarisasinya finansial global. “Memang sesuai. Bukan asal-asalan sampai sekarang dampak bikin,” kata pria yang akrab krisis finansial global belum disapa Hartono ini. terasa di Kalimantan Timur. Planet Futsal Tapi, tampaknya sampai tahun depan, bisnis ini masih

Gelar Event Tahunan Berskala Nasional KESEMPATAN untuk meraih prestasi di bidang olahraga juga terbuka di Planet Futsal. Olahraga ini juga telah mendapat pengakuan di dunia. Jadi, urusan mencetak prestasi juga tidak tertutup kemungkinan bahkan untuk pemula sekalipun. Sementara itu, keuntungan Planet Futsal sebagai franchise nasional yang selalu online satu sama lain, perkembangan futsal di setiap cabang juga terus dipantau. Salah satunya juga melalui pertandingan futsal antar cabang yang digelar setiap

tahun. “Masing-masing cabang menggelar pertandingan di daerahnya. Satu tim yang menjadi juara di daerah akan bertemu dalam turnamen tingkat nasional. Sayangnya, tahun ini tim dari Balikpapan dan Samarinda masih belum mendapatkan hasil yang maksimal,” katanya. Tak perlu merasa minder, karena pertandingan futsal ini justru tertutup untuk pemain liga. “Kami memang sengaja ingin mencari bibit baru. Kesempatannya terbuka melalui pertandingan ini,” katanya. (cpk)

menjanjikan mengingat penggemar olahraga futsal ini berasal dari semua kalangan. Mulai dari pelajar sampai para eksekutif,” katanya. Perbedaan generasi ini membuat persewaan lapangan futsal laris. “Biasanya untuk pagi hari, penggunanya lebih banyak dari kalangan kaum muda. Sementara pada sore hingga malam hari dan pada akhir pekan penggunanya kebanyakan dari para pekerja dan eksekutif,” kata Hartono. Tingginya minat penyuka olahraga futsal ini membuat Hartono optimis peluang bisnis ini masih sangat menjanjikan. Tapi, Planet Futsal tidak sekadar mengembangkan bisnis belaka. Meraup keuntungan juga dibarengi tekad untuk memberikan pendidikan kepada kaum muda dan masyrakat umumnya. Olahraga tanpa asap rokok, komitmen inilah yang dikembangkan Planet Futsal. “Di sini tidak boleh merokok di dalam lapangan. Sebenarnya, banyak juga yang mempertanyakannya, tapi ini sudah jadi komitmen kami. Bahkan untuk event yang digelar di Planet Futsal, kami juga tidak menerima sponsor dari perusahaan rokok,” katanya. (cpk)

Sewa lapangan Planet Futsal Balikpapan Senin - Jumat Lapangan I Lapangan II dan III 08.00 - 14.00 Rp 175.000 Rp 125.000 14.00 - 17.00 Rp 275.000 Rp 175.000 17.00 - 24.00 Rp 350.000 Rp 250.000 Hari Sabtu, Minggu, dan Libur Nasional 08.00 - 24.00 Rp 350.000 Rp 250.000

Planet Futsal Balikpapan Jl Syarifudin Yoes RT 094, Kelurahan Gunung Bahagia (0542) 5622269, 8879269

Planet Futsal Samarinda ● Jl Muso Salim No 10 0819 5023 500 0819 5080 800 ● GOR Latihan 1 Kompleks Stadion Madya Sempaja (0541) 7101177, 7096677, 7101717 (cpk)

Fasilitas Planet Futsal ● Bola ● Kafetaria ● Shower ● Big screen projector ● Ruang ganti dan loker yang aman ● Parkir luas ● Menyediakan staf dan wasit-wasit yang berpengalaman ● Rumput sintetis (cpk)

Event yang dapat digelar ● Turnamen antarperusahaan ● Futsal coaching clinic ● Family and company gathering ● Perayaan ulang tahun ● Penggalangan dana ● Nonton bareng acara sepak bola (cpk)


14

MINGGU 14 Desember 2008

Si Manis untuk Akhir

Jalan-jalan Kuliner

Pekan

TRIBUN/FAHMI RAHMAN

Makanan manis memang tak ada habisnya. Nikmat disantap kapan saja. Dapur Tribun kali ini menyajikan tiga resep istimewa, lapis tiramisu, cokelat mouse, puding khatulistiwa. Masih ada satu resep istimewa lainnya. Bila masih ingin makan daging usai Idul Adha, daging sapi masak barbeque bisa menjadi pilihan Anda dan keluarga di akhir pekan ini. (*)

Lapis Tiramisu BAHAN I 5 butir telur 75 gram gula putih 75 gram tepung terigu 75 gram mentega 1 sdt SP ½ sdt baking powder CARA MEMBUAT ■ Campurkan telur, gula, SP jadi satu kemudian mixer hingga lembut ■ Masukkan terigu dan baking powder sambil terus dimixer ■ Tambahkan mentega yang telah dicairkan, aduk rata. Tuang dalam loyang ukuran 36x28 cm yang telah dilapisi kertas ■ Bakar dengan suhu 200 derajat celcius BAHAN II 15 gram kopi instan 10 gram mocca pasta 100 gram gula putih 300 cc air panas 100 cc kahluwa/rum CARA MEMBUAT ■ Campur semua bahan jadi

Legitn isang GGor or eng egitnyya PPisang oreng DI Indonesia, pisang goreng adalah penganan yang sangat dikenal masyarakat. Buah pisang menghadirkan sensasi yang berbeda dengan digoreng dengan tepung, ataupun tanpa tepung. Dari beberapa variasi hidangan pisang goreng, Jalan-jalan Kuliner mencoba pisang godeng ala sche zuan yang ditawarkan di Depot Mr Koki. Embel-embel sche zuan yang melekat membuat penasaran. Sepiring pisang goreng rasanya nikmat disantap pada sore hari bersama keluarga di rumah. Satu porsi pisang goreng sche zuan rasanya juga cukup untuk dinikmati bersama keluarga. Porsinya pas untuk keluarga kecil. Pisang yang tersaji dipotong-potong berukuran sedang sehingga membuatnya mudah disantap. Pisang digoreng tanpa tepung hingga kecokelatan. Untuk mempercantik, digunakan taburan wijen. Rasa pisang goreng menjadi manis dan gurih dengan perpaduan pisang, dan wijennya. Nikmat Jl Jend Sudirman (Markoni) No 7 untuk disantap diTelp (0542) 7168057 dan 5621427 temani dengan sePisang goreng ala Sche Zuan Rp 10.000 cangkir teh hangat. (cpk) (cpk)

D epot Mr oki Mr.. KKoki

TRIBUN/FAHMI RAHMAN

TRIBUN/FAHMI RAHMAN

satu kecuali kahluwa/rhum. ■ Aduk rata dan sisihkan BAHAN III 250 gram seezan tiramisu powder 125 cc air hangat kuku 1 ltr whipping cream CARA MEMBUAT ■ Mixer whipping cream sampai kaku, sisihkan ■ Seduh seezan tiramisu pow-

Puding Khatulistiwa BAHAN CAKE 5 butir kuning telur 2 butir putih telur 50 gram gula pasir 30 gram tepung segitiga 15 gram susu bubuk 15 gram tepung maizena ½ sdt tepung maizena 75 gram mentega cair ½ sdt essens vanili

TRIBUN/AMALIA HUSNUL A

CARA MEMBUAT ■ Semua bahan jadi satu, kemudian mixer hingga mengembang ■ Tuang ke dalam loyang ■ Bakar hingga matang BAHAN PUDING 400 ml susu cair 1 bungkus agar-agar bubuk 100 gram sirup melon TRIBUN/FAHMI RAHMAN

der dengan air hangat, aduk rata, lalu tambahkan whipping cream BAHAN IV 15 gram coklat Bourdoux 10 gram kopi instan CARA MEMBUAT Adonan bahan III dibagi menjadi tiga bagian, lalu masingmasing diberi kopi instan (cpk) 1/8 sdt pewarna hijau muda 1 butir kuning telur 3 butir putih telur 1/8 sdt garam 50 gram gula pasir 100 gram buah naga, haluskan CARA MEMBUAT ■ Rebus susu cair dan agaragar, sambil diaduk sampai mendidih. Tambahkan sirup melon dan pewarna hijau muda, aduk rata ■ Ambil sedikit adonan. Tambahkan kuning telur. Aduk rata, tuang lagi ke rebusan susu sambil diaduk sampai mendidih. Sisihkan ■ Kocok putih telur dan garam sampai setengah mengembang, tambahkan gula pasir sedikit-sedikit sambil dikocok hingga mengembang ■ Tuang rebusan agar-agar sambil dikocok dengan kecepatan rendah ■ Tuang diatas cake lalu tambahkan bauah naga (cpk)

Cokelat Mouse BAHAN 250 gram dark chocolate 3 butir kuning telur 3 butir putih telur 60 gram gula pasir 2 sdm rhum 250 ml whipping cream, kocok CARA MEMBUAT ■ Panaskan dark chocolate hingga meleleh, sisihkan

■ Kocok putih telur dan gula hingga kaku ■ Kocok kuning hingga mengembang ■ Tambahkan dark chocolate, aduk perlahan ■ Tambahkan rhum, putih telur, aduk rata ■ Tambahkan whipping cream yang sudah dikocok ■ Tuang dalam cetakan atau gelas. Diamkan selama lebih kurang dua jam dalam lemari es (cpk)

TRIBUN/FAHMI RAHMAN

Daging Sapi Masak Barbeque BAHAN 1 kg daging sapi 5 siung bawang putih 1 buah bawang bombay 2 sdm margarine 2 sdm saus tiram 100 ml saus barbeque 1 buah paprika hijau 1 buah paprika merah

CARA MEMBUAT ■ Tumis bawang putih dan bawang bombay hingga harum ■ Tambahkan saus tiram dan aduk rata ■ Masukkan daging sapi dan semua bumbu, aduk rata ■ Masak dengan menekan tombol ‘tenden bean’ ■ Setelah matang tambahkan bahan pelengkap Catatan: Gunakan Epresto untuk hasil maksimal. (cpk)

Pojok Kuliner

Pisang untuk Atasi Kecanduan Rokok PISANG bukan hanya enak dikonsumsi tapi juga memiliki segudang manfaat, dari kesehatan hingga kecantikan. Pisang adalah tanaman buah berupa herbal yang berasal dari kawasan Asia Tenggara (termasuk Indonesia), Afrika (Madagaskar), Amerika Selatan, dan Tengah. Beragam jenis pisang yang ada di pasaran, ada pisang ambon, raja, kepok, pisang susu, dan lainlain. Buah berwarna kuning ini termasuk multimanfaat. Dari buah, daun, kulit, dan batangnya pun dapat digunakan. Misalnya, batang pisang dapat diolah menjadi serat untuk pakaian, kertas, dan sebagainya. Sedangkan batang pisang yang telah dipotong kecil dan daun pisang dapat dijadikan makanan ternak ruminansia (domba, kambing) pada saat musim kemarau di mana rumput tidak/kurang tersedia. Kulit pisang pun dapat dimanfaatkan untuk membuat cuka melalui proses fermentasi alkohol dan asam cuka. Sedangkan daun pisang dipakai sebagai pembungkus berbagai macam makanan tradisional Indonesia. Menurut para ahli gizi, pisang mengandung banyak gizi, antar lain kalsium, lemak, kalium mineral, vitamin, karbohidrat, protein. Dari kandungan inilah maka pisang dapat memberikan manfaat bagi kesehatan dan kecantikan. Dalam Medicinal Uses of Bananas menyebutkan pisang dapat menyembuhkan anemia, menurunkan tekanan darah, menambah tenaga untuk berpikir, kaya serat untuk membantu sistem saraf, dapat membantu perokok untuk menghilangkan pengaruh nikotin, stres, mencegah stroke, mengontrol temperatur badan terutama bagi ibu hamil, menetralkan keasaman lambung, dan sebagainya. Untuk Anda yang sering menguap, padahal tidak mengantuk berarti oksigen di dalam otak agak terganggu. Untuk mengatasinya sebaiknya Anda sering mengonsumsi pisang. Karena pisang mengandung banyak kalium, maka dapat mengembalikan kadar kalium dalam tubuh dan melancarkan pengiriman oksigen ke otak. Selain itu, pisang juga sangat baik bagi ibu yang mengandung. Kandungan asam folat di dalamnya mudah diserap oleh janin, juga baik bagi perkembangan sistem saraf janin. Selain itu, pisang juga dapat dijadikan sumber kekuatan tenaga karena mengandung gula yang dapat diubah sumber tenaga dan dapat menghilangkan rasa lelah. (dariberbagisumber/cpk)


MINGGU 14 DESEMBER 2008

KONTAK JODOH JEJAKA, Jawa, 28, 170/60, Islam, swasta, baik, pendiam, pemalu, jujur, sederhana, selalu serius, dan dapat dipercaya, Penajam Pasir Utara. Menghendaki wanita soleh, baik, jujur, setia, cantik, sederhana, dewasa, dapat dipercaya dan mau menerima apa adanya. K-001/04/08 JEJAKA, Bugis, 28, 175/70, Islam, SLTA, karyawan swasta, sederhana, hobi membaca dan olahraga, Balikpapan. Mendambakan gadis tinggi, langsing, rambut panjang, cantik dan murah senyum ke semua orang, bisa membaca Al Quran, siap untuk menikah dan berumah tangga, pendidikan sekurang-kurangnya SMA atau MAN. K-006/05/08 GADIS, Bugis (Enrekang), 26, 150/47, Islam, D3, PNS, pendiam, penyayang, sabar, taat beragama, sederhana, dan agak sedikit ceroboh, hobi membaca, dengar musik, nonton, dll. Menghendaki pria seiman (Islam), baik agama, iman, akhlak, dan budi pekerti, bertanggungjawab, sabar, jujur, apa adanya, pengertian dan penyayang, swasta/PNS, pendidikan minimal D3, usia 26-32 tahun, suku Bugis (tidak mutlak), 160 cm atau lebih dengan berat badan seimbang. K-007/05/08 JANDA cerai beranak satu, Bugis, 34, 165/45, wiraswasta, jujur, beriman, penyayang, penolong, setia, sederhana, suka bercanda, bertanggung jawab, agak sensitif. Mendambakan jejaka/duda yang tidak punya anak, 30-45 tahun, jujur, beriman, dapat membaca Al quran, bertanggung jawab, punya pekerjaan tetap, penyayang, baik hati, humoris, tidak suka judi/mabuk, berjiwa penolong. K-008/06/08 JANDA, 46 tahun, anak 3, 155/60, Islam, PNS, berkerudung, sawo matang, mandiri, ramah, sayang keluarga, hobi traveling. Samarinda. Mendambakan duda usia di atas 50 tahun, S1, Islam dan menjalankan syariat Islam, tidak merokok, mapan, dan punya penghasilan tetap, sabar dan sayang keluarga, suku apa saja. K-010/08/08 GADIS, 26 tahun,155/43, Islam, pegawai, kulit kuning langsat, rambut panjang, wajah tirus, alis tebal, lesung pipi, humoris, supel, hobi membaca, nonton, makan, dan mendengarkan musik. Balikpapan Mendambakan perjaka atau duda tanpa anak, mapan, penyanyang, sabar, setia, santun, umur tak masalah, postur tubuh tak masalah, suku apapun, serius dan siap berumah tangga. K-011/09/08 GADIS, Jawa, 34 tahun, 150/47, Islam, S1, guru SLTA, pendiam, keibuan, sopan, agak pemalu, taat beragama, sederhana, penyabar, dan penyayang. Kutai Kartanegara. Mendambakan pria seiman, baik, soleh, tidak merokok, bertanggungjawab, sabar, jujur, pengertian dan penyayang, swasta sudah mapan/ PNS, pendidikan S1, usia 35-38 tahun, suku Jawa, tinggi 160 berat badan seimbang, domisili di Tenggarong atau Samarinda. K-012/09/08

15

KONTAK JODOH Mau cari pasangan? Tribun Kaltim membuka rubrik KONTAK JODOH. Kirimkan berkas dan data diri Anda. Kirimkan ke Redaksi Desk Minggu, Jl Indrakila No 1 Gunung Samarinda, Balikpapan 76125

1

3

2

8

7

6

5

4

PERSYARATAN

10

☛ Fotokopi KTP, alamat jelas, tanda tangan (sesuai KTP), tak dipungut biaya ☛ Untuk duda/janda disertai fotokopi surat cerai/kematian ☛ Data diri, suku, agama, pendidikan, profesi, sifat pribadi, hobi, tinggi dan berat badan, nomor telepon yang bisa dihubungi. ☛ Data diri pasangan yang dikehendaki ☛ Ditulis di sehelai kertas ☛ Nama/ peserta di tangan redaksi ☛ Peminat dapat meminta foto dirinya dimuat di rubrik ini

✍ Surat perkenalan langsung ditujukan ke nomor peserta ✍ Semua surat pasti dikirimkan kepada ybs. Dibalas atau tidaknya tergantung ybs.

1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 Kepada Yth : Sdr/i : K.../.../08 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 Kontak Jodoh Tribun Kaltim 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 Jl Indrakila Strat III RT 52 Nomor 1 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 BALIKPAPAN 76125 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789 1234567890123456789012345678901212345678901234567890123456789012123456789

11 17

14 21 16

18 22

31

27

32

37 33

22 33

29

34 28

35 39

40

38

42

46

51

Sebaiknya jangan memberi/meminjamkan sesuatu/uang/barang kepada pasangan Anda

45 47

LAJANG, 28 tahun, 175 cm/75 kg, Islam, Kutai-Banjar, swasta, sawo matang, terkadang periang, terkadang pendiam kalau ada masalah, hobi bulutangkis, bola voli, dan tenis meja, Samarinda. Mendambakan wanita kaya (punya usaha atau lainnya), kulit sawo matang, janda tanpa anak atau pun punya anak, atau gadis, umur di bawah 50 tahun, pengertian, sederhana. K-014/09/08 LAJANG, 23, Katolik, 178 cm/85 kg, Dayak, karyawan rumah sakit, lulusan SMK, pemalu, sensitif, humoris, pemarah, hobi musik dan main game online, Balikpapan. Mendambakan perempuan sabar, pengertian, dan siap hidup menderita. K-015/10/08 DUDA, 27, anak satu, Islam, Kutai, 175 cm/65 kg, SMU, PNS, sedikit pemalu, sederhana, selalu serius, dapat dipercaya, dan selalu menghargai pendapat orang lain, Kukar. Mendambakan wanita dewasa, singel atau janda, pengertian, setia, jujur, seiman, sudah bekerja atau belu, dari suku apa saja. K-016/10/08

GADIS, 38, Islam, Banjar, 150 cm, 45 kg, SLTA, Swasta, kulit sawo matang, keibuan, sabar, jujur, setia, hobi memasak, menyanyi, travelling, Balikpapan. Mendambakan bujangan atau duda anak satu, Islam, PNS/ swasta/ berpenghasilan tetap, suku bebas, minimal SLTA, usia 30-45 tahun, tinggi dan berat badan seimbang, domisili di Balikpapan, dewasa, pengertian, baik, jujur setia, sabar, bertanggungjawab, dan siap menikah. K-020/12/08

GADIS, 39, Batak, Kristen, tinggi 165 cm, berat 60 kg, S1, Samarinda. Mendambakan bujangan/ duda tanpa anak atau duda anak satu, suku apa saja, kerja/wiraswasta, Kristen, umur 39 sampai dengan 50 tahun, hidup baru, serius K-017/11/08

TTS

GADIS, 31, Dayak, Katolik, 161 cm, 55 kg, SLTA, Pegawai swasta, sederhana, bertanggungjawab, penyabar, sedikit pendiam, suka membaca, menonton, suka bercanda, dan jalan-jalan,

Edisi 14 Desember

36

39

52

70 60

59 69 64

61

71

62

70

72 84

85

KETENTUAN

MENEBAK 1. Tulis jawaban di kertas, lampirkan fotokopi KTP/ Kartu Pelajar dan nomor telepon 2. Masukkan ke dalam amplop, tempel kupon di sampul luar 3. Surat ditujukan ke Redaksi Desk Minggu Tribun Kaltim, Jl Indrakila No. 1 (Straat 3) Kampung Timur, Kelurahan Gunung Samarinda, Balikpapan 76125 4. Jawaban sampai di Redaksi paling lambat tanggal 10 Maret 2009. 5. Pemenang diumumkan hari Minggu 15 Maret 2009. Dengan membawa fotokopi KTP. 6. Hadiah paket buku persembahan dari Toko Buku Gramedia untuk tiga orang pemenang

58 73

65 76

66

79

80

50

63 55

81 71

77 67

68

82

74

86 76

MENDATAR 1. Penyakit sesak napas 3. Liburan, plesiran 6. Metode pelatihan yang meragakan sesuatu dalam bentuk tiruan 10. Ujian nasional 11. Kue khas Sunda 13. Orang yang sangat kekurangan, orang miskin 14. Tidak lupa 16. ....Day, peringatan atas gugurnya 229 tentara Australia di Balikpapan 18. Lekas 19. Inti 20. Ukuran luas (Inggris) 22. Kemasan atau wadah untuk menyimpan dan membawa sesuatu 25. Pemimpin dalam shalat 26. Carik kertas 27. Perkakas 29. Lampai, langsing 34. Liberty Reserve 35. Kelak, kemudian hari 36. Sedih (Inggris) 37. Buah yang rasanya legit 39. Jarum emas atau intan yang dimasukkan ke kulit disertai mantra agar tampak cantik 40. Kasihan 41. Tunai 43. Alu, alat penumbuk padi 45. Luka bernanah 46. Tidak ingat 49. Universitas di Tarakan (singkat)

1. Cadas 3. Keramas 6. Kata 8. Koala 9. Tuan 10. Galon 12. Lauk 13. ASI 15. Plasa 18. Niat 19. Mual 21. Laut 22. Pra 23. Spin 24. Muak 25. Unta 26. Uap 27. Senam 28. Run 30. Akta 32. Pala 33. Tiki 35. Nya 36. Kain 38. Ning 39. Nias 40. Angin 42. RRC 44. Topan 45. Gulai 46. Gamis 47. Rusak 48. Angkasa 49. Ayaub 1. Cakap 2. Skala 4. Ragi 5. Santapan 7. ATK 11. Laptop 14. Santan 16. Lampau 17. Semampai 20. Laksa 21. Laun 23. Sarangan 25. Umpan 29. Nyanyi 31. Taksir 33. Tetangga 34. Kancil 37. Nastar 40. Angka 41. Nasib 43. Cara

PEMENANG

68

72 63

73 75

62 54

53

66

49

54

53

Jawaban TTS Edisi 5 Oktober MENDATAR

MENURUN

48 42

57 49

75 78 69

47

48 61

52 60

32

41

57

GADIS, 33, Jawa-Banjar, Islam, 150 cm. 45 kg, S1, wiraswasta, kulit putih, berjilbab, cantik, dan taat beragama, sifat pribadi baik, pendiam, pemalu, jujur, sederhana, penyayang, dan setia. Hobi membaca dan mendengarkan musik, Balikpapan. Mendambakan pria seiman, saleh, baik agama, iman, akhlak, budi pekerti, dan dapat membaca Alquran, bertanggung jawab, sabar, jujur, pengertian, penyayang dan setia, punya pekerjaan tetap, sudah mapan, dan siap untuk menikah, pendidikan min D3, usia 32 s/d 40 tahun, suku apa saja, tinggi dan berat badan seimbang, berdomisili di Balikpapan. K-019/11/08

31

41

44 51

50 55

74

35

29

28 25

40

Kupon Pertemuan : 036

Samarinda. Mendambakan pria seiman, suku apa saja, baik, bertanggungjawab, serius, dan paling penting jujur dan perhatian, punya kerjaan tetap, dari keluarga sederhana, umur 31 s/d 37 tahun, domisili di Samarinda atau Tenggarong. K-018/11/08

30

20

19 15 25 19

24

23

34 37

43

23

21

27 20 26

14

13 18

12

17

26

Bagi Peminat

JANDA beranak satu, 33 tahun, 150 cm/45 kg, Sarjana ekonomi, Islam, ibu rumah tangga/ wiraswasta, manis, penyabar, setia, taat beragam, hobi membaca. Mendambakan jejaka atau duda, 30 s/d 40 tahun, penyabar, sayang, jujur, setia, punya pekerjaan tetap, seiman, berat dan tinggi badan seimbang. K-013/09/08

9

51. Hari....Diperingati setiap 9 Desember 54. Rasa ingin digaruk 57. Kami (Inggris) 58. Hal gaib 60. Lahir (Inggris) 62. Orangtua menantu 64. Orang-orangan dsb yang dikendalikan oleh mesin 65. Rukun Tetangga 66. Sang....Kamahayanikan, sebuah karya sastra dalam bentuk prosa 71. Dana alokasi khusus 72. Singel, sendirian 73. Negara di Timur Tengah 74. Tak bergigi 75. Tanpa, cacat 76. Sombong

MENURUN 1. Menemani orang berjalan 2. Patung 4+17. Artis yang menjadi tersangka dalam kasus penculikan dan penyekapan 5. Ali...Mantan Menteri Luar Negeri yang meninggal Kamis lalu 6. Kusir 7. Banyak usia 8. Bunyi yang dikeluarkan dari mulut 9. Tindakan menakut-nakuti, gertakan, ancaman 12. Bicara, katakan 13. Lemak (Inggris) 15. Kemeja Arab

1. Muamar Khadafi, Jl Banjar No.12 RT 006, Kelurahan Gunung Sari Ilir, Balikpapan 2. Buadi Selamet, Jl Abdul Azis Samad 50/G RT 036, Samarinda 3. N Urwatil Wutsqo (urwah), Jl Angkasa Gang Tiung R 28/ No.3-F, Nunukan CATT: Hadiah sudah bisa diambil mulai Rabu 17 Desember di Toko Buku Gramedia Balikpapan dengan menunjukkan fotokopi KTP dan bukti koran. 21. Gelar kebangsawanan di Jawa 23. Penghitungan jumlah penduduk, ekonomi, dll 24. Bank daerah di Kaltim 28. Makna 30. Ingin, kehendak 31. Gelar Pascasarjana 32. Seseorang atau firma yang melakukan transaksi di instrumen finansial 33. Penyangga tubuh 38. Pergantian musim 39. Tahan menghadapi cobaan 42. Ilmu tentang kelautan atau pembuatan kapal 44+69 (mendatar). Tokoh dalam Kisah Seribu Satu Malam 47. Lembar kertas yang berjilid (Dibalik) 48. Tulis: Posesi 50. Tempat penampung air 52. Prajurit 53. Hal atau perbuatan yang terlarang menurut adat atau kepercayaan 55. Di, pada (Inggris) 59. Jenis tari berpasangan 60. Berat 61. Partner Batman 63. Seni (Inggris) 67. Tugu batu, prasasti 68. Bagian tubuh yang berfungsi untuk mengunyah makanan 70. Bawah Kendali Operasi, istilah dalam militer dan kepolisian 71. Daerah Operasi Hulu


G always sucking up to you B only makes me look like a fool F theres so sweet my mind C G you got the devil in you

Endang Sari (perkusi)

Yogiyansyah (gitar)

TRIBUN KALTIM/M WIKAN H

G longer i hang out with you B the moment has been round and round F .... ... on the ground C G you got the devil in you

TRIBUN KALTIM/M WIKAN H

Song by Slank

TRIBUN KALTIM/M WIKAN H

Devilinu (Devil in you)

TRIBUN KALTIM/M WIKAN H

16

MINGGU 14 Desember 2008

Rizal Abdillah (keyboard)

Purwanto (vokal)

[chorus] C there different you and I G can‘t stay together for ever C there just so un-alike D so just don\’t fool arround again, okey? G being mixed up with you B has make my whole world go crazy F drise up all my thought C G you got the devil in you C G you all trouble thats you C G you got the devil in you [interlude] G B F C G

New

Release

KLa Returns by Kla Project MESKI telah eksis sejak tahun 1988, tapi menghadapi persaingan dunia musik, Kla Project juga harus membuat sentuhan baru. Akhir tahun 2008 ini, Kla Project merilis mini album yang bertajuk Kla Returns dengan formasi trio original dari Kla Project. Di blantika musik Indonesia, Kla adalah salah satu ikon band Indonesia yang beraliran pop kontemporer dengan lagu-lagu yang romatis, berlirik puitis, dengan bungkusan aransemen msuik yang selalu mengutamakan kualitas dan inovatif. Sebagai mini album, Kla Returns hanya berisikan empat lagu saja. Dua lagu lama yang telah didaur ulang dan dua lagu baru. Kla Project pernah meraih penghargaan sebagai grup rekaman terinovatif dari PWI Pusat bagian musik.

Track ✘ Someday ✘ Tak Ingin Ku Beralih ✘ Yogyakarta ✘ Semoga

Masih muda tapi ketinggalan jaman, waduh jangan sampai deh...Tapi, enam anak muda yang tergabung dalam grup band Assoi Geboi justru asyik mengusung irama dan penampilan yang terbilang jadul alias jaman dulu. DENGAN celana press body, kacamata besar yang menutupi sebagian besar wajah, busana bermotif vintage kemudian bergaya di atas vespa yang jadul, membuat penampilan anak-anak Assoi Geboi memang lebih mirip generasi muda jaman bapak dan ibu dulu ketimbang generasi muda abad milenium yang serba gemerlap. Tapi, begitulah Assoi Geboi menempatkan dirinya di jalur musik. Mantap memilih tema jadul sebagai jalur mereka bermusik. Gapur, Rizal,

Hendra, Endang, Yogi, dan Yadi tak takut dibilang jadul. “Kami ini anak muda yang cinta jaman dulu,” kata Gapur mewakili kelima rekannya. Kecintaan keenam anak muda ini terhadap gaya tempo dulu berawal dari foto-foto orangtua mereka. “Waktu melihat foto-foto orangtua jaman dulu, kok kayaknya asyik juga. Karena itulah kami memilih untuk tampil dengan gaya begini,” katanya. Meski memilih berpenampilan jadul, tapi keenam anak muda ini tetap menyuguhkan lagu-lagu yang tentu diminati publik. Irama tempo dulu tak jadi masalah, yang penting lagu-lagunya tetap asyik didengarkan. “Tujuan kami kan tetap menghibur,” katanya. Aliran ini sengaja dipilih Assoi Geboi karena masih jarang di Balikpapan. “Di sini kan grup musik itu banyak. Tapi

hampir sama semuanya. Kami mau mengambil yang berbeda,” kata Gapur. Assoi Geboi berusaha menampilkan ciri khas mereka yang tidak dimiliki grup band lainnya. Assoi Geboi awalnya bukan berasal dari kumpulan anak-anak muda yang nongkrong di studio musik atau dipertemukan karena musik. Personel Assoi Geboi dipertemukan dari sebuah komunitas otomotif yang juga unik menilik dari kuda besi tunggangannya. Skuter bermerk Vespa. Sebuah kendaraan bermotor yang memiliki keistimewaan tersendiri. Ya, awalnya personel Assoi Geboi adalah anggota komunitas Vespa. Dari sekadar mencoba-coba untuk bermusik, akhirnya Assoi Geboi mantap melakoni dunia musik yang masih mengusung keunikan seperti halnya Vespa. “Dari vespa juga

sangat mendukung,” katanya. Sebenarnya Assoi Geboi juga ingin menjadikan Vespa sebagai kendaraan wajib saat mereka manggung. “Maunya sih begitu. Kami tetap pakai Vespa. Sekalian untuk promosi. Tapi, kadang susah untuk melakukannya. Apalagi kalau kita harus berusaha sendiri. Wah, alatnya kan banyak dan berat. Jadi, susah kalau naik Vespa. Jadi ya hanya kadang-kadang saja,” katanya. Soal kendaraan memang masih bisa ditolerir. Tapi, yang wajib dikenakan saat manggung adalah busana yang tentu harus bertema jadul. “Kalau kostum itu ya tanggung jawab masing-masing. Nggak harus seragam sih, tapi yang pasti sesuai dengan tema saja,” katanya. (cpk)

Antara Hobi dan Cari Uang MEMUTUSKAN menekuni musik yang berbeda dari kebanyakan grup musik lainnya memacu Assoi Geboi untuk menghibur publik dengan musiknya. Bukan asal-asalan meski di Balikpapan dan Kalimantan Timur, tidak banyak grup musik yang mengusung irama musik serupa. Saat ini, bagi Assoi Geboi, musik adalah hobi tapi juga ladang mencari uang. Untuk terus mempopulerkan musik mereka, Assoi Geoi juga memanfaatkan jaringan dari temanteman komunitas Vespa. “Bukan hanya mendukung tapi jaringan dari komunitas ini juga sangat membantu,” kata Gapur, vokalis Assoi Geboi. Pada beberapa event yang digelar komunitas Vespa, Assoi Geboi juga ikut tampil. Tapi, meski mendapat kemudahan dari komunitasnya, Assoi Geboi tetap mengasah kemampuan mereka dalam

bermusik. Latihan wajib dilakukan. “Apalagi kami mendapat dukungan penuh dari orangtua, terutama orangtua Hendra yang membuat sebuah studio sehingga memudahkan kami untuk latihan,” katanya. Bagaimana dengan rekaman? “Ya, kalau ditanya soal itu ya pasti kepingin. Tapi jalannya mungkin yang belum,” katanya. Assoi Geboi sementara ini telah menyelesaikan recording tiga buah lagu. Tema cinta masih jadi pilihan mengingat tema ini juga masih banyak diminati penikmat musik Nusantara. “Bukan sekadar tema cinta biasa. Kepinginnya kami dapat menciptakan lagu yang bisa bercerita,” kata Gapur lagi. (cpk)

A

S ss W tud oi N o io A o n o J Ge b bo B a 28 k l C al n 8 ro i p e o n i k p g Ta m o na G rs ta a p 08 a p o c t a h n 13 u r n : 47 42 28 94 TRIBUN KALTIM/M WIKAN H


Super Ball Minggu, 14 Desember 2008

Diva Sepakbola LEBIH dari sekadar cantik, Heather Mitts kerap disebut sebagai “Anna Kournikova-nya” sepakbola. Julukan yang membuat bek timnas putri Amerika Serikat (AS) ini merengut. Pasalnya, kata Mitts, Kournikova hanya bermodalkan paras cantik, dan tak punya prestasi dan teknik mentereng. Sedang dirinya memiliki itu semua. halaman

19

Halaman 17

AP PHOTO

JUVENTUS

kondisi tim JUVENTUS Daftar pemain cedera Bianconeri masih panjang, mulai dari Zebina, Trezeguet, Buffon, Tiago Mendes, Salihamidzic, Knezevic, Poulsen, dan Camoranesi. Namun kondisi Camoranesi mulai bugar dan telah ikut berlatih. AC MILAN Rossoneri mendapat kabar buruk dengan kemungkinan absennya Kaka. Milan pun dipastikan tidak diperkuat Nesta, Borriello, dan Gattuso karena cedera, sementara Bonera menjalani operasi hernia. Tapi Seedorf, Pirlo, dan Ambrosini sudah fit.

player to watch AMAURI (JUVENTUS) Striker berdarah Brasil ini terus menunjukkan sinar kemilaunya. Pekan lalu ia menjadi kunci kemenangan atas Lecce. Ia bisa menjadi momok bagi gawang Milan, selain tentunya Del Piero. ZAMBR O TT A (MILAN) ZAMBRO TTA Gianluca Zambrotta meninggalkan Juventus saat degradasi ke Serie B dua musim lalu. Kini ia kembali lagi ke bersama Milan. Ia bakal menjadi sorotan karena melawan mantan timnya yang telah dikhianati.

prediksi Apapun hasilnya, pertandingan ini akan menyuguhkan tensi tinggi-rendah dan naikturun. Milan tentu akan menyerang dengan karakternya, karena jika mereka menunggu di belakang, maka Juventus yang akan mengambil posisi itu. Juve bisa memanfaatkan kelemahan lini belakang Milan. JUVENTUS 2-1 MILAN

PAPAN atas Serie A pekan ke-16 kembali panas. Grande Partita Juventus versus AC LIVE ON Milan akan tersaji, Senin (15/12) dini hari. Senin Kedua tim (15/12) pengoleksi titel scudetto pukul 03.30 Wita terbanyak Italia ini mengklaim pertarungan yang akan digelar di Stadion Olimpico, Turin, ini sebagai final kecil. Kenapa disebut final kecil? Kapten Juventus Alesandro Del Piero mengartikan perjalanan timnya untuk mengejar Inter yang berlari sendirian di puncak klasemen ditentukan di laga melawan Rossoneri. Il Pinturicchio mengatakan timnya masih tertinggal enam poin dari Inter. Karena itu timnya harus bisa menaklukkan Milan. Jika jelang libur musim kompetisi putaran pertama Juve kalah dan tertinggal sembilan angka dari Inter, maka peluang timnya kian kecil. “Kami tertinggal enam angka, jika perbedaan itu semakin melebar maka posisi kami semakin berat untuk mengejar gelar musim ini. Tertinggal sembilan angka sama halnya membiarkan pesaing kami yang menjadi juara,” kata Del Piero “Karena itu, laga melawan Milan tak ubahnya seperti final kecil. Apalagi kedua tim saat ini mengoleksi angka sama 30 poin,” lanjutnya seperti dikutip dari Channel4.

Menentukan Posisi TAK bisa dipungkiri, ini akan menjadi duel spektakuler antara dua klub hebat yang selama beberapa tahun terakhir ini telah memberikan kontribusi besar terhadap sepakbola Italia. Laga ini pastinya menjamin Anda bakal mendapat tontonan luar biasa. Kehadiran pemain sekelas Ronaldinho dan Alessandro Del Piero selalu memberikan sesuatu yang unik. Saya sangat beruntung, karena saya akan mendapat kursi terbaik di bench dan tak perlu bersusah payah membeli tiket untuk menyaksikan duel akbar ini. Duel ini juga menentukan posisi kami meski ini masih jauh bicara perebutan gelar scudetto. Namun, yang jelas kami tidak akan melepasnya (rif) poin lagi seperti ketika melawan Inter Milan.(rif) *) Claudio Ranieri, Pelatih Juventus, dilansir AP

Flamini Bisa CEDERA membuat hidup kami semakin sulit. Tapi tanpa Gattuso atau Boriello dan pemain lainnya kami masih punya pemain lain yang siap tampil. Saya pikir Flamini bisa bermain bagus meski mungkin ia masih tak sebanding dengan Gattuso, tapi ia berusaha menyatu dengan tim. Pirlo juga akan membuat pekerjaan hebat bersama kami. Ia adalah nyawa tim ini. Soal kondisi Kaka, kami belum mendapatkan pernyataan resmi dari pihak medis. Tapi sejauh ini ia memang hanya bermasalah dengan kebugarannya. Penuh harap (rif) ia tampil.(rif) *) Carlo Ancelotti, Pelatih AC Milan, dilansir goal

Alessandro Del Piero

AC MILAN

Untuk itu, tidak ada pilihan yang lebih baik bagi Del Piero dkk selain memenangi partai ini guna memelihara jarak poin mereka dengan Inter Milan. Namun demikian, suami Sonia Amoroso itu juga sadar, memetik tiga angka dari Milan bukan hal gampang. Mereka harus memeras keringat hingga tetesan terakhir dalam pertandingan 90 menit. “Milan kini menjadi tim yang kuat dan kedatangan sejumlah pemain baru seperti Ronaldinho telah meningkatkan permainan. Mereka mampu tampil baik setelah di awal musim sangat buruk,” tambah Del Piero. Hanya saja, keuntungan meraih poin penuh dimiliki si Kuda Zebra. Selain tampil di kandang, pasukan Claudio Ranieri memiliki penampilan yang stabil. Sejak 25 Oktober mereka meraup sembilan kemenangan dan hanya kalah dari Inter Milan tiga pekan lalu. Materi Ranieri saat ini juga lebih solid. Mereka mampu mengatasi problem banyaknya pemain inti yang sedang cedera. Tim yang akan tampil Minggu nanti adalah skuad yang membawa Juventus naik ke peringkat kedua. Del Piero menjadi sosok yang membawa Juve berada di grafik puncak. Bersama striker baru asal Brasil, Amauri, keduanya terus menunjukkan sinar kemilau.

„ ulasan ranieri

„ ulasan ancelotti

VS

Keduanya silih berganti menjadi kunci kemenangan tim. Kaka Meragukan Juve juga mendapat kabar baik dari kubu Milan. Superstar Milan, Ricardo Kaka, meragukan tampil. Kaka diisukan cedera karena tidak berlatih bersama rekan setimnya dalam latihan terakhir, Jumat (12/ 12) waktu setempat. Dugaan itu makin diperkuat dengan laporan yang menyebutkan bahwa Pelatih Carlo Ancelotti menurunkan trisula Ronaldinho, Alexandre Pato, dan Clarence Seedorf untuk mengisi lini depan pada sesi latihan pemantapan tim tersebut. Namun belum ada kepastian apakah absennya Kaka pada latihan itu semata-mata dilakukan untuk berjaga-jaga, atau gelandang 26 tahun itu memang dibekap cedera. “Ia memang berlatih di ruang kebugaran dan tidak ikut bermain bersama rekan-rekannya. Tapi semuanya belum ditentukan oleh pelatih. Saya pikir ia memang tengah memulihkan kondisinya,” jawab Pato, yang disiapkan sebagai target man. Jika Kaka tidak bisa main, hal tersebut tentu menambah derita Il Diavolo Rosso yang sebelumnya kehilangan gelandang tangguh Gennaro Gattuso. Pemain berjuluk si Badak itu cedera ketika menghadapi Catania, akhir pekan lalu. Tapi kabar baik datang dari kapten Paolo Maldini. Ia menyatakan siap tampil dan sudah

Live on TV GAMBA OSAKA VS ADELAIDE Minggu (14/12) pukul 18.30 Wita INTER VS CHIEVO Minggu (14/12) pukul 22.00 Wita ROMA VS CAGLIARI (T) Senin (15/12) pukul 00.00 Wita JUVENTUS VS AC MILAN Senin (15/12) pukul 03.30 Wita SEVILLA VS VILLARREAL Senin (15/12) pukul 02.00 Wita ATLETICO VS BETIS Senin (15/12) pukul 04.00 Wita KLITSCHKO VS RAHMAN (T) Minggu (14/12) pukul 11.00 Wita

menunjuk Del Piero sebagai target yang harus dijaga dengan ketat. “Jika saya main, saya harus menjaga Del Piero. Saya sangat senang dengan performanya saat ini. Dengan talentanya yang luar biasa ia adalah pemimpin yang layak dicintai dan senang hati mengawalnya,” ujar Maldini. (Persda Network/rif)

Ranieri vs Ancelotti LAGA ini akan mempertemukan eks pelatih Parma; Claudio Ranieri (Juventus) dan Carlo Ancelotti (AC Milan). Tapi secara prestasi Ancelotti lebih bagus dari Ranieri. Bersama Milan, ia telah merasakan beragam gelar. Ancelotti juga pernah melatih Juventus selama dua musim (1999-2001), tapi tak mampu memberi gelar apapun. Musim lalu, ia mendapat ejekan sepanjang pertandingan dari suporter Juventus saat tampil di Stadion Olimpico, Turin. Tugas berat kini berada di pundak Carletto -panggilan Ancelotti. Ia harus menang di Turin untuk melempangkan jalan menjadi scudetto. Jika gagal membawa Milan scudetto, bisa jadi ia akan dilengserkan. Sedangkan Ranieri masih banyak pihak meragukannya bakal membawa sukses bagi klub besar seperti Juventus. Mantan pelatih Chelsea ini harus membuktikan diri bahwa semua hal itu keliru dengan mengalahkan Milan. Jika Ranieri mampu melakukanya, maka si Nyonya Tua akan menjadi rival terkuat Inter Milan mempertahankan scudetto. (rif)

Alexandre Pato


18 z MINGGU MINGGU,, 14 DESEMBER 2008

ulasan mourinho

kondisi tim INTER MILAN

INTER MILAN Nelson Rivas, Patrick Vieira, Julio Cruz, dan Marco Materazzi tak akan tampil karena masih dibekap cedera. Namun begitu, Rivas telah tampil dalam latihan setelah menjalani operasi lutut pada awal Oktober lalu. CHIEVO VERONA

player to watch

LIVE ON

SULLEY MUNT ARI (INTER) MUNTARI

Minggu (14/12) pukul 22.00 Wita

DUEL tim paling puncak Serie A, Inter Milan, melawan juru kunci klasemen, Chievo Verona, Minggu (14/12) malam, sepertinya membuat peluang tim asuhan Jose Mourinho untuk terus memimpin race menuju scudetto makin

Milan dan Juventus. Dan lebih menyenangkan bagi kubu Nerrazurri, dua pesaingnya itu harus saling sikut saat bertemu di Turin. Striker Inter Milan Zlatan Ibrahimovic pun menyatakan timnya harus memanfaatkan sebaik mungkin situasi yang terjadi di pekan ini. Apalagi jika laga antara Juve dan Milan berakhir imbang, Ibra menyebut timnya wajib menang. “Saya memang berharap dua pesaing kami meraih hasil imbang. Dengan itu kami bisa menjauhkan diri dari kejaran dua tim tersebut.

AP PHOTO

terbuka lebar. Inter mengantongi selisih enam poin dengan dua rival terdekat AC AP PHOTO

CHIEVO

Ibra Manfaatkan Situasi

Masih kehilangan gelandang andalan Erjon Bogdani yang cedera. Sedangkan defender Cesar, Mauro Esposito, dan Iunco kondisinya sangat merugikan. Giampiero Pinzi dan Davide Mandelli tak bisa main karena menjalani hukuman.

Didatangkan untuk menjadi pemain pelapis, Sulley Muntari justru tampil gemilang bersama Inter. Tangguh, mobile dan rajin mencetak gol membuat namanya kini selalu menjadi pilihan utama Mourinho. LUCIANO (CHIEVO)

VS

AP PHOTO

Winger berusia 33 tahun ini telah merasakan sekilas level sepakbola papan atas ketika bergabung bersama Inter dari Chievo pada musim panas 2003. Tapi ia hanya sebulan dan gagal menjadi skuad utama Nerazzurri. Ia balik ke Chievo pada bursa transfer Januari. Tetap bertahan meski klubnya didegradasi dan kini menjadi pemain paling terkenal di Chievo.

Kalaupun tidak terjadi, minimal kami diuntungkan dengan tertinggalnya satu pesaing,” sebutnya dikutip dari Football Italia, Sabtu (13/12). “Tapi, sebaiknya kami tak berharap dari tim lain, kami sebaiknya memang menang dan fokus pada permainan kami sendiri saat ini,” lanjutnya. Statement Ibra masuk akal. Nerazzurri sekarang ini memang seperti kehilangan tenaga. Setelah menang dengan meyakinkan saat membantai tuan rumah Lazio 3-0 pekan lalu, di laga midweek mereka justru kalah dari Werder Bremen. Pelatih Jose Mourinho pun menganggap timnya sebagai sekelompok pemain yang moody --kadang fokus main, kadang kala terlalu kompromi dengan lawannya. Karena itu The Special One paling malas menyatakan timya layak meraih Scudetto. Ia pun berulang kali menyatakan kalau memun-

prediksi Cukup membuat banyak pihak ingin tahu kenapa Inter tak mampu menang lebih dari satu gol di kandang musim ini, padahal mereka mampu menang 4-0 dan 3-0 saat bertemu Roma dan Lazio di Stadion Olmpico. Kmeudian mengalahkan Torino dan Palermo saat jauh dari kandang dengan skor mencolok. Inilah saatnya melihat Inter berjuang di depan fansnya untuk meraih banyak gol. Inter 2-0 Chievo (rif)

Zlatan Ibrahimovic

caki kompetisi putaran pertama atau menjadi campione de inverno (juara paruh musim) bukan jaminan timnya bakal juara. Sebut Mourinho, gelar baru datang di bulan Mei tahun depan. “Apa yang dikatakan pelatih memang benar. Kami harus memperbaiki penampilan kami dari pekan ke pekan. Hasil melawan Bermen menjadi contoh kalau kami memang masih jauh dari memuaskan,” pungkas Ibra. Zona Degradasi Peluang Inter terbuka lebar mengingat Chievo masih mencari bentuk permainan. Tim promosi ini juga masih berada dalam tekanan karena tak kunjung memetik kemenangan dan semakin terpuruk di zona degrdasi. The Flying Donkeys masih harus belajar bagaimana bisa memenangi pertandingan saat peluang tersebut ada di depan mata. Pekan lalu ia kurang beruntung saat kalah 1-0 dari Roma setelah sebelumnya mengalahkan Udinese. Pekerjaan yang bisa dilakukan pelatih Domenico Di Carlo saat ini adalah membuat timnya bermain lepas dan tidak membebani pemainnya dengan target mulukmuluk. Di Carlo sukses memotivasikan hal itu ketika menang dari Udinese. Namun demikian, bermain di Giuseppe Meazza sepertinya Chievo harus siap-siap meraih malu lagi. Dalam jejak rekam laga kedua tim beberapa musim terakhir, Inter memang terlalu dominan. Inter mengalahkan Chievo 2-0 di pertemuan terakhir. Sebelumnya, La Beneamata juga meraih skor 4-3 pada September 2006. Kekalahan terakhir Inter terjadi pada 15 Februari 2003 dengan skor akhir 2-1 dan pada musim itu membuat Nerrazurri gagal Scudetto pada tahun tersebut.(Persda Network/rif)

AP PHOTO

Fokus Striker SEMUA orang selalu berbicara tentang pemain saya. Soal Adriano, semua menyorot mereka dan seperti ingin menghakiminya terus menerus. Tapi saya tak ingin berkomentar. Saya ingin fokus ke permainan kami yang kini tengah menurun. Kami akan fokus memperbaiki lini depan kami yang kerap membuang peluang saat berhadap-hadapan dengan kiper. Ballotelli, Adriano, atau Ibrahimovic layak belajar untuk mengatasi kebiasaan mereka (rif) membuang peluang.(rif) *) Jose Mourinho, Manajer Inter Milan, dikutip Channel4

ulasan di carlo

AP PHOTO

Saling Komunikasi LIMA kekalahan sejak saya menangani tim ini menjadi hal yang memalukan bagi saya. Tapi di beberapa kesempatan, kami memang kurang beruntung. Menghadapi Inter, kami ingin para pemain saling berkomunikasi satu sama lain. Saya juga berharap penyerang kami bisa membantu lini tengah saat kehilangan bola. Tim ini juga terlalu banyak kebobolan. Kami benar-benar harus membuat perbedaan jika kami tak ingin terus menerus (rif) menelan kekalahan.(rif) *) Domenico Di Carlo, Pelatih Chievo, dikutip Goal

Mabuk Lagi, Adriano Diusir Sebelum Latihan ADRIANO memang sosok fenomenal bagi Inter. Striker asal Brasil itu kembali berulah dan datang ke tempat latihan dengan kondisi awut-awutan. Sepertinya ia belum bisa meninggalkan kebiasaan lamanya; dugem dan mabuk. Ia pun dikabarkan diusir sebelum ikut latihan. Seperti ditulis La Gazzetta dello Sport, Adriano datang cukup awal ke tempat latihan tapi ia dalam kondisi mabuk.

Melihat kondisi tersebut, Pelatih Jose Mourinho langsung memulangkan striker gempal tersebut. Kondisi serupa juga menimpa Maicon. Peristiwa itu terjadi pada Kamis (11/12) sekitar pukul 10.30 pagi. Untuk kali pertama para pemain Inter berlatih setelah menelan kekalahan dalam laga tandang ke Werder Bremen di ajang Liga Champions, Selasa (9/12) malam. Namun kabar itu dibantah pihak Nerazzurri. Kubu Inter

menyebutkan bahwa tak benar Adriano absen latihan karena mabuk, tapi karena ia menjalani pemeriksaan dokter. Sedangkan Maicon berada di pusat kebugaran. “Sehubungan dengan artikel di sejumlah surat kabar pada Jumat pagi, Inter ingin memperjelas bahwa Adriano sedang dalam tes oleh staf medis pada Kamis sehubungan dengan kejang otot yang dia dapat saat melawan Werder Bremen,” demikian

pernyataan Inter. “Adapun untuk Maicon, dia berlatih dalam sesi tersendiri seperti yang dijadwalkan untuk pemain-pemain yang berlaga di partai penting pada Selasa.” Jika Adriano benar-benar mabuk, maka ini menjadi sinyal buruk bagi pemain Brasil tersebut. Sebab ia sebelumnya sudah diperingati Mourinho untuk tidak mengulang hal yang pernah dilakukannya itu.(Persda Network/ rif)

AP PHOTO/ALBERTO PELLASCHIAR

PELUK MAICON Striker Inter Milan, Adriano (kanan), memeluk Maicon usai mencetak gol melawan Anorthosis di Stadion Giuseppe Meazza, Rabu (22/10). Adriano diisukan kembali mabuk sehingga diusir jelang latihan.


Jagal dari Andes SAA T Claudio Pizarro kembali ke SAAT Werder Bremen dan diperkenalkan ke publik Weserstadion pada 15 Agustus 2008, ada satu spanduk yang membuat semangat sang pemain terlecut. Kalimat “Ritter wird zurückgekommen” terpampang jelas. Kalimat yang berarti “Ksatria itu Datang Kembali” menunjukkan kehadiran Pizarro dianggap makin memperkokoh skuad Werder Bremen. halaman

19

22

MINGGU MINGGU,, 14 DESEMBER 2008 HEATHER MITTS .COM

Heather Mitts

Diva Sepakbola LEBIH dari sekadar cantik, Heather Mitts kerap disebut sebagai “Anna Kournikovanya” sepakbola. Julukan yang membuat bek timnas putri Amerika Serikat (AS) ini merengut. Pasalnya, kata Mitts, Kournikova hanya bermodalkan paras cantik, dan tak punya prestasi dan teknik mentereng. Sedang dirinya memiliki itu semua. Tak berlebihan memang jika perempuan kelahiran Cincinnati 9 Juni 1978 ini mengklaim sebagai atlet berprestasi —yang cantik. Dua medali emas Olimpiade, masing-masing di Athena pada 2004, dan di Beijing pada 2008, menjadi bukti dari kehebatannya. Tiap kali pemain Boston Breakers ini berlaga di liga sepakbola putri AS, dipastikan penonton akan datang berduyun-duyun. Mereka tak hanya ingin menyimak aksi rapih dan cerdiknya menjaga benteng pertahanan. Yang terutama, pastinya, mencuci mata dengan melihat betapa memesonanya senyum dari bek cantik ini. Ya, patut dicatat, Mitts ibaratnya seperti Ronaldinho, yang tak pernah lepas dari senyuman setiap berlaga. Bedanya barangkali, senyuman Mitts

menjadi puncak dari kecantikannya yang begitu menyihir kaum Adam. Entah bagaimana penilaian kaum hawa terhadap senyuman Ronaldinho. “Tak ada hari bagiku tanpa senyuman saat sedang bermain bola. Aku mencintai olahraga ini, dan karenanya aku selalu tersenyum lantaran begitu menikmatinya,” ujarnya dalam sebuah wawancara di soccerdigest. Itu kesadaran yang murni datang dari dalam hatinya. Terlepas dari itu ia pun mengakui bahwa sepakbola juga adalah sebuah hiburan. Sebuah industri yang bisa menggerakkan orang untuk mengeluarkan uang dari dompet demi mendapatkan hiburan dari atraksinya di lapangan. Maka, ia pun membalasnya dengan permainan menawan dan senyuman yang menghanyutkan. “Aku tahu, orang-orang datang ke stadion untuk mendapatkan hiburan. Dan kewajiban kita untuk memberikan yang terbaik agar mereka terhibur. Sepakbola bukan sekadar pertarungan antara dua tim, tapi juga melibatkan para penonton

sebagai spektator,” ujarnya, serius. Mitts mulai berkenalan dengan sepakbola pada usia enam tahun. Tapi, kala itu perhatiannya melebar ke berbagai cabang olahraga lainnya. Energinya yang tak pernah habis mengantarkan bocah nakal ini untuk juga menggeluti beragam olahraga mulai dari softball, berenang, voli, sampai berkuda. Faktor orang tua yang juga sama-sama mantan atlet amatiran, sangat berperan hingga Mitts kecil tumbuh jadi penggila olahraga. “Saya pikir, orangtuaku memang sengaja menggiring aku untuk menggemari olahraga, agar aku tak jadi anak nakal di jalanan,” kenangnya. Ia mulai serius melakoni sepakbola saat masuk sMA St Ursula di Cincinnati, Ohio. Bakatnya semakin nyata terlihat, ketika Mitts sukses mengantarkan sekolahnya menjuarai liga sepakbola putri SMA nasional. Berkat keahliannya mengolah bola, aa pun ditarik ke Universitas Florida. Dari sana, karirnya terus melesat. Pada 1998, ia ditarik ke tim nasional AS yunior, dan juga berlaga di kancah profesional bersama tim Philadelphia Charge. Dua medali emas Olimpiade menjadi bukti suksesnya. Lantas, apa lagi yang sekarang dicari perempuan cantik ini? “Aku sekarang ingin mengembangkan karir di bidang yang sejak lama aku impikan, menjadi reporter olahraga,” tekadnya. (Persda Network/den)

biofile Nama Lengkap: Heather Blaine Mitts Tanggal lahir: 9 Juni 1978 Tempat lahir: Cincinnati, Ohio, AS Tinggi: 1,65m Berat: 55kg Posisi: bek Karir 1993-1996 St. Ursula Academy 1996-1999 University of Florida 70 (5) 2001-2008 Philadelphia Charge 95 (0) 2008- Boston Breakers 51 (0) Timnas 1999Amerika Serikat 63 (2) Olimpiade 2004 Emas 2004 Athena 2008 Emas 2008 Beijing

Atlet Terseksi Sejagat EMP AT tahun lalu, Heather Mitts EMPA terpilih sebagai atlet putri terseksi sejagat versi ESPN. Keseksian, dan keindahannya masih tetap terpancar sekarang. Bahkan semakin gemerlap lantaran dipadukan dengan kematangan usia. Saat itu, dia mengalahkan petenis Anna Kournikova, dan pemain softball AS, Jennie Finch dengan selisih angka sangat menyolok. Hampir 30% dari 250 ribu responden sedunia sepakat menunjuk Mitts sebagai atlet terseksi.

Mengulas kembali anugerah tersebut, Heather Mitts tampak malu-malu. Dan ia mengaku masih tak percaya bahwa dirinya pernah terpilih sebagai atlet putri terseksi sejagat. “Anda tahu, pertama-kali saya mendapat kabar itu saya hanya tertawa lebar. Awalnya saya tak percaya sama-sekali. Namun, kabar itu ternyata benar, dan yang saya katakan waktu itu hanyalah ‘Astaga!’,” kenangnya sambil tersenyum lebar seperti dikutip dari ESPN.

Lucunya, ia secara terus terang mengatakan bahwa suksesnya menjadi atlet terseksi itu tak lepas dari bantuan pacar, rekan, serta keluarganya. “Ini sebuah poling. Siapa yang paling banyak mendapat suara yang menang. Dan saya merancang strategi untuk meraup suara terbanyak,” ujarnya membocorkan rahasia. Bagaimana caranya? Ini dia, dengan santainya, Heather mengungkapkan bahwa pacar, dan keluarganya terus mengirimkan suaranya ke poling lewat internet

tersebut. “Terutama pacar saya, ia mengirimkan sampai lebih dari dua ribu suara untukku,” ujarnya sambil tertawa. Lepas dari faktor rekayasa tersebut, tak bisa dipungkiri empat tahun lalu, Mitts adalah atlet fresh yang fenomenal. Namanya kerap jadi headline lantaran sukses membantu tim AS meraih medali emas di Olimpiade Athena. Tak heran, ia pun mampu mengalahkan Anna Kournikova dengan selisih hampir 28 ribu (Persda Network/den) suara.(Persda

c

m

y

k


20 z MINGGU MINGGU,, 14 DESEMBER 2008

Avram Grant

Pemain Chelsea seperti Anak TK

AP PHOTO

LAMA tak terdengar kabarnya sejak didepak dari kursi manajer Chelsea, Avram Grant kembali muncul di media. Pria asal Israel itu berbicara panjang lebar soal pengalamannya ketika duduk di kursi panas klub asal London tersebut. Seperti dikutip Reuters, Jumat (12/12), Grant menyebut, skuad Chelsea memiliki gaya kekanak-kanakan khas anak TK. Itu tercermin dari sikap di lapangan dan gaya hidup di luar lapangan. Ia mencibir perilaku Frank Lampard, Ashley Cole sampai Salomon Kalou yang dianggapnya memiliki “kelainan”. “Level performa di Chelsea sangat tinggi,. Begitu juga gaji pemainnya. Tapi, ada masalah yang terjadi pada sebagian pemain. Mereka seringkali berulah seperti anak-anak, dan mereka tak pernah menyadari itu,” sindir Grant. Bahkan Grant pernah mendapati beberapa pemain asal Chelsea berebut kaset video porno yang dikirim seorang teman Michael Ballack dari Jerman. Kala itu, Grant tak

bisa berbuat banyak karena Frank Lampard dkk seperti menemukan mainan baru. “Mereka berkata kalau model asal Jerman memiliki fantasi sendiri, tapi seperti kawasan Eropa lainnya, aku tak habis pikir ternyata mereka masih anak-anak,” ucap Grant. Di sisi lain, Grant juga meng-klaim dirinya-lah yang berjasa mengatrol performa Nicolas Anelka. “Aku ingin dia memperbaiki dirinya. Dia adalah pemain yang bagus, tetapi dia masih butuh ambisi yang lebih besar,”imbuh pia bernama asli Avraham Grant ini. Ia pun mengaku memiliki metode unik untuk membuat Anelka terus berkembang seperti sekarang. Ternyata keduanya sering berbicara dari hati ke hati di sebuah restoran yang menyajikan menu istimewa, yakni sate rusa. “Saat itulah aku mengungkapkan apa yang harus diperbuat Anelka, aku tahu dia suka makanan itu, karena itulah ia berubah musim ini,” imbuh pria 53 tahun ini.(Persda Network/ bud)

Balas Dendam di Spa

Rencana Nikah USAI mengikuti acara I Am Celebrity, get Me Out of Here, pekerjaan dan jadwal padat sudah menunggu dua model cantik ini. Carly Zucker sudah ditunggu “pasukannya” untuk berlatih, sedang Nicola McLean juga sudah dihadapkan pada rencana sesi pemotretan. Di luar itu, mereka berdua juga tengah menghadapi pekerjaan yang tak kalah pentingnya, merencanakan hari pernikahan!. “Seperti sudah pernah kubilang, aku terus menyiapkan pernikahan kami, Joe secara intens terus mengerjakannya sendiri selama kutinggal, kini saatnya aku mengambil alih semuanya, karena kami sudah siap dengan hal itu, “ungkap Zucker, yang mengaku sudah fitting gaun pengantin. Sementara Nicola McLean juga sudah bersiap untuk lebih serius berhubungan dengan Tom Williams. Pasangan ini memang sudah dikaruniai anak sematawayang, Rocky, dan tinggal serumah di kawasan Wexham, Buckinghamshire, meski belum terikat pernikahan resmi. Sayang, ia belum menyebutkan kepastian tanggal pernikahan mereka. (Persda Netwok/bud)

AP PHOTO

Joe Cole dan Carly Zucker

NET

KEGEMBIRAAN tengah melanda kekasih penyerang Chelsea, Joe Cole, Carly Zucker. Bagaimana tidak, ia merasa lega setelah menyelesaikan “kewajiban” menjalani ujian hidup di tengah hutan Australia saat mengikuti program reality show “I Am Celebrity”. Kini, ia pun bersiap untuk balas dendam. Bersama rekannya, Nicola McLean, Zucker memang akhirnya menyerah kalah di pertengahan acara. Ganasnya hutan dengan kehidupan alami yang bagi mereka terasa menjijikkan, membuatnya keduanya akhirnya angkat tangan. Alhasil, terlihatlah perbedaan pada kondisi fisik keduanya saat kembali ke Inggris, Jumat (12/12). Hidup prihatin tanpa make up dan perawatan tubuh di tengah hutan tidak hanya membuat keduanya tampak lebih kurus, tapi juga kulit mereka yang tadinya mulus menjadi bercak dan tampak seperti belang. Tak heran kalau hal pertama kali yang mereka lakukan adalah ke salon guna merawat ‘harta’ mereka selama ini. “Aku sudah memastikan diri bakal berendam seharian di spa, kemudia ke salon, menata rambut dan mengembalikan kulitku seperti semula. Berada di luar peradaban membuatku seperti orang linglung dan aneh, apalagi seluruh badanku sudah berubah, semoga saja Joe masih mengenaliku,” papar Carly Zucker. Kondisi kekasih Joe Cole ini masih sedikit lebih bagus. Berkat kebiasaannya berolahraga dan menjaga stamina, nyaris tak ada rona

lelah terpancar di mata cewek yang sudah dilamar Cole setahun yang lalu ini. Karena itulah, ia bisa langsung tersenyum dan masih sempat bergerak ke sana kemari. Di sisi lain, Zucker mengaku mandapat pelajaran berharga bagaimana hidup dengan segala keterbatasan. Paling tidak, acara kemarin membuatnya merengkuh ilmu berharga bagaimana menghormati dan merawat alam, karena sebenarnya dari sanalah semuanya berasal. “Aku begitu takjub merasakan air yang sangat segar, lebih segar dari air paling jernih sekalipun di hotel atau di rumah. Aku juga masih teringat betap segarnya buah-buahan yang ada di dalam hutan sana, lebih ‘menggigit’ rasanya ketimbang apa yang tersedia di kulkas atau supermarket,” ucap Zucker. Hal serupa juga menimpa Nicola McLean. Kekasih pemain Peterborough United, Tom Williams ini merasa meski badannya tampak belang dan bobot badannya turun lebih dari tujuh kilogram, ia mendapat sisi lain yang tak pernah dirasakan kala berada di kota metropolis seperti London. “Yang aku ingat, di sana serba alami, bertemu penduduk di sana, mereka nyaris tak pernah merasakan sakit parah, berbeda dengan di sini yang seringkali harus mengidap penyakit jantung, paru-paru atau bahkan kulit, mereka di hutan sana paling hanya flu, itupun mereka cukup meramu dedaunan,”ungkap Nicola McLean. Di luar itu, kini mereka sudah kembali ke gaya hidup semula yang penuh dengan modernitas. Pengalaman di reality show I Am Celebrity, Get Me Out of Here menjadi pelajaran berharga untuk lebih berpikir tentang alam tentunya.(Persda Network/bud)

Claudia Galanti

Incar Fabio Galante

NET

PESONA pesepakbola tak pernah lepas dari mata seorang cewek. Entah itu di Premiership, La Liga maupun di Serie A, para pria yang merumput menjadi target tersendiri. Itulah yang kini bergelayut di dada Claudia Galanti. Presenter cantik sebuah televisi Italia ini baru saja membuat kejutan. Pasalnya, ia mendadak terlihat berjalan mesra dengan bek Livorno, Fabio Galante.

Kontan semua pihak tak menyangka hal itu bisa terjadi, mengingat Galante selama ini dekat dengan model cantik Samantha De Grenet. Seperti dirilis Sportmediaset, Sabtu (13/12), pasangan itu terlihat menuju pusat perbelanjaan dan tak lama kemudian masuk ke sebuah restoran cepat saji. Wajah keduanya tampak sumringah menandakan hubungan mereka terlihat sangat

intim. Cewek berdarah Paraguay itupun mengaku kalau dirinya memang tengah mengincar Fabio Galante untuk menjadi kekasih. Di sisi lain, gosip yang beredar, Claudia hanya mencari pelarian saja karena baru saja bercerai dari Stefano Ricucci, yang ironisnya sudah menggandeng wanita lain. “Claudia tidak hanya sedang

dekat dengan Galante saja. Beberapa waktu lalu dia mengatakan baru saja bertemu dengan Fillipo Inzaghi di sebuah ruangan di Milan. Kelihatannya, Claudia juga telah mencoba peruntungannya untuk menggoda Inzaghi, tapi aku tahu dia hanya ingin Galante ada di dekatnya,” ungkap seorang teman Claudia Galanti. Sementara Claudia menyebut,

sosok Galante memang menjadi tipikal pria yang diincarnya. Mantan bek Internazionale Milano itu memiliki kharisma yang menurut Claudia bisa menggetarkan setiap hati wanita, siapapun dia. “Dia sangat romantis, baik dan sangat perhatian, setiap wanita pasti senang berada di dekatnya, tapi kali ini aku akan memilikinya,”tegas Claudia.(Persda Network/bud)


MINGGU MINGGU,, 14 DESEMBER 2008 z

Ingin Lebih Bergaul

ISTIMEWA

Takuma Sato

Takuma Sato

Yakin Dipilih STR MANTAN pembalap Super Aguri, Takuma Sato yakin akan menjadi bagian tim Scuderia Toro Rosso musim depan. Ia beranggapan, apa yang dilakukannya sepanjang melakukan uji coba bersama tim asal Italia itu akan menjadi pertimbangan penting. Usai melakukan uji coba di Barcelona, bulan lalu, Sato (31) juga turut melakukan uji coba di Jerez, Spanyol. Hasilnya, ia tak melakukan kesalahan dan selalu finis di posisi kedua di bawah Sebastien Buemi. Buemi adalah pembalap Swiss yang kemungkinan besar mendapat satu kursi STR. Pembalap 20 tahun ini selalu menjadi yang tercepat dalam tiga hari uji coba di Jerez. Namun STR belum mematok tanggal dalam mengumumkan skuadnya. Yang pasti, uji coba Barcelona dan Jerez menjadi evaluasi penting untuk menentukan pembalap yang dibawa. Kalau Buemi sudah mendapat lampu hijau, Sato memiliki saingan, pembalap incumbent STR, Sebastien Bourdais. “Saya merasa puas dengan seluruh proses kerja dengan engineer, mekanik dan orang-orang di cockpit sepanjang uji coba, setelah absen panjang dari F1,” ucap Sato dilansir ITV. “So, saya harap itu cukup meyakinkan manajemen untuk membuat keputusan.” Ia mengaku menikmati hari-hari bersama Toro Rosso. Pembalap Jepang ini pun mengucapkan terima kasih atas seluruh pengalaman dan kerja sama selama ini. Sato memang sangat merindukan arena balap setelah timnya Super Aguri Honda tim gulung tikar, tengah musim ini. Praktis, Sato sangat berharap STR menuliskan namanya di daftar barisan pembalap. Pembalap veteran ini memulai debutnya pada 2002 silam bersama tim Jordan sebelum pindah ke BAR Honda pada 2004. Pada saat itu, Sato berhasil mengamankan podiumnya di Grand Prix Amerika Serikat.(Persda Network/rie)

SELAIN memilih istirahat lebih lama, ada hal berbeda yang juga akan ditunjukkan Lewis Hamilton pada musim depan. Ia bertekad akan menjadi manusia yang lebih banyak bergaul, dan tak melulu mengurus balapan mobil. Lho? Hal itu diutarakannya dalam wawancara dikutip dari F1SA. “Tahun depan saya akan lebih banyak menikmati waktu untuk diri saya sendiri. Saya akan lebih menghargai diri saya,” ujarnya serius. Caranya? “Saya akan lebih banyak menghabiskan waktu dengan keluarga, dan dengan teman-teman. Saya ingin lebih banyak bergaul. Tapi, tentu saja saya tak akan berpesta setiap waktu,” paparnya. Musim lalu, katanya, ia sangat menderita lantaran hanya terkonsentrasi pada balapan. “Saya memang bepergian ke banyak tempat. Tapi, saya tak melihat atau menikmati apapun karena saya terus berdiam di hotel sepanjang waktu. Itu sangat menyiksa,” tandasnya. Karena itulah, kata Hamilton, tahun depan ia akan mengisi hari-harinya dengan cara berbeda. “Saya ingin sukses di balapan, dan juga sukses di pergaulan,” harap kekasih penyanyi Pussycat Dolls, Nicole Scherzinger ini. (Persda Network/den)

ISTIMEWA

21

Pilih Bersantai Dulu JUARA dunia Formula One (F1), Lewis Hamilton (McLaren) masih berada dalam persembunyiannya. Saat pembalap lain sudah melakukan serangkaian persiapan menghadapi musim 2009, ia masih belum nongol di sirkuit. Begitu juga dalam uji coba di Jerez, Spanyol, lalu. Hanya Heikki Kovalainen dan test driver Pedro de la Rosa yang beraksi. Menurut jadwal, Hamilton akan menguji mobil MP4-24 pada Januari mendatang. Hamilton memang tak mau terburu-buru melakukan uji coba menjelang musim baru. Ia menahan diri karena berkaca dari pengalaman musim lalu. Kalah satu poin di musim pertamanya (2007) atas Kimi Raikkonen (Ferrari), Hamilton lantas ngebet melakukan persiapan sejak awal untuk menghadapi balapan 2008. Hasilnya memang gemilang. Ia menang setelah balapan seri terakhir yang berlangsung di Interlagos, Brasil, unggul satu poin atas Felipe Massa dan mencatatkan diri sebagai pembalap termuda yang menjuarai balapan jet darat. Tapi itu diperoleh dengan sangat susah-payah. Jelang putaran akhir tenaganya memang terkuras habis, dan ia hampir tersalip oleh rivalnya. Dari perjalanan melelahkan di musim 2008 itulah, pembalap 23 tahun ini memetik satu pelajaran. Kini, Hamilton lebih senang melakukan istirahat lebih panjang karena itu juga bagian dari persiapan. Ia tak mau cepatcepat kembali ke kokpit dan membiasakan diri dengan mobil barunya, karena itu akan cepat menghabiskan tenaga. “Saya sudah belajar dari musim lalu bahwa saya sudah melakukan banyak hal di awal dan di akhir musim saya benar-benar kehabisan energi. Saya bahkan terkejut bisa siap untuk balapan pertama (di 2008),” ucap Hamilton dilansir autosport. Karena itulah, kali ini Hamilton enggan memaksakan diri. Dia memanfaatkan benar waktu istirahatnya agar bisa bugar memulai musim. “So, saya mengatur waktu lebih baik tahun ini dan memastikan cukup istirahat. Saya baru saja mulai berlatih lagi dan saya tak melakukan pengujian apapun tahun ini. Saya akan mulai pengujian tahun depan dengan mobil baru dan sata tak sabar untuk itu,” jelasnya. Hamilton, yang meraih penghargaan International Racing Driver of the Year di Autosport Awards akhir pekan lalu, akan tetap menunggu waktu yang tepat untuk memulai latihan dengan mobil. Mengenai pertarungan musim depan dengan banyak regulasi baru, pembalap Inggris ini sangat antusias. “Itu akan menjadi pertarungan baru untuk semua orang dan untuk melakukan pekerjaan terbaik. Saya memiliki kepercayaan diri dalam tim saya,” tegasnya.(Persda Network/rie)

PENGAP PHOTO/VALERY HACHE, POOL

LAMBAIKAN TANGAN - Lewis Hamilton mendapat penghargaan sebagai juara dunia termuda F1 dalam acara 2008 FIA Prize Giving di Monako (13/12)

Jelena Habiskan Waktu di Gym

Jelena Jankovic

ISTIMEWA

JELENA Jankovic terus melakukan latihan keras jelang pertarungan di musim baru, 2009. Selain agar tetap menjadi petenis terbaik dunia, ia juga memiliki target lain yang tak kalah penting:: meraih gelar Grand Slam pertama! Petenis Serbia ini memang belum pernah menjuarai ajang Grand Slam. Dari empat turnamen Grand Slam --Australia Terbuka, Prancis Terbuka, Wimbledon, dan Amerika Terbuka-- Australia Terbuka yang paling dekat. Ajang tersebut akan dilaksanakan bulan Januari mendatang. Jankovic memenangi empat gelar tahun ini dan mengakhiri musim 2008 sebagai petenis terbaik

setelah bersaing ketat dengan petenis papan atas lainnya memperebutkan posisi puncak. Petenis 23 tahun itu mampu menjadi yang terbaik mengalahkan Serena Williams, Dinara Safina, Elena Dementieva dan kompatriotnya, Ana Ivanovic setelah pemegang peringkat satu sebelumnya, Justine Henin mengundurkan diri. “Saya benar-benar bekerja keras dan melakukan yang terbaik agar bisa fit secepat mungkin. Saya berharap siap dan berada dalam kondisi terbaik di Australia Open karena target saya adalah memenanginya,” tekad Jankovic dilansir AFP. Jankovic memulai latihan di lapangan dan gym

sejak dua pekan lalu setelah liburan ke Hawaii. Ia menghabiskan banyak waktu di gym untuk meningkatkan tenaga dan kecepatannya secara utuh. “Saya mencoba agar sangat kuat dan fit untuk tahun depan dan meminimalisir cedera sebanyak saya bisa mengontrolnya,” jelas Jankovic. Agar tak kaget saat turun di Australia Terbuka yang dimulai tanggal 19 Januari mendatang, ia akan turun di World Team Challenge di Hong Kong, 7-10 Januari. Even ini juga akan diikuti Maria Sharapova dan Venus Williams. Kejuaraan tersebut akan diikuti empat tim yang mewakili Eropa, Rusia, Amerika dan Asia-Pacific.(Persda Network/rie)


22z

MINGGU MINGGU,, 14 DESEMBER 2008

Claudio Pizarro Fact Nama : Claudio Pizarro Bossio Lahir : Callao, 3 Oktober 1978 Postur : 186 cm/76 kg Tahun Klub T am pil/gol ampil/gol 1996-1997 Deportivo Pesquero 42/11 1997-1999 Alianza Lima 44/22 1999-2001 Werder Bremen 56/29 2001-2007 Bayern Munich 174/71 2007Chelsea 21/2 2008Werder Bremen 13/10 1999Timnas Peru 56/13

Claudio Pizarro

Jagal dari Andes

Prestasi dan penghargaan: ◗ Olahragawan Terbaik Peru (1999) ◗ Pemain Paling Memberi Inspirasi Bundesliga 1999-2000 ◗ Runner up Top Skor Pra Olimpiade Zona Amerika Selatan dengan 5 gol (2000) ◗ Striker Bundesliga All Star Musim 2001 ◗ Juara Bundesliga musiim 2002/2003, 2004/ 2005, 2005/2006 ◗ Juara Piala Jerman 2003, 2005, 2006 ◗ Juara FIFA Intercontinental Cup tahun 2001

Kata Mereka Thomas Schaaf, Pelatih Werder Bremen

Saat Tepat DIA hadir pada saat yang tepat, kecepatannya mungkin menurun sedikit, tapi pengalaman dan keeping ball-nya masih sangat bagus. Satu golnya malam ini (melawan Inter Milan di liga Champions, RED), membuat kami setuju, kembalinya Pizarro membuat suasana kembali membaik. (bud) Diego, Gelandang Werder Bremen

Bikin Bergairah

BERMAIN bersamanya selalu menggairahkan, dia besar tapi lincah. Aku tinggal menyorongkan bola daerah, atau cukup melempar bola ke depan gawang, sudah pasti dia akan mengejarnya sekuat tenaga. Daya juangnya luar biasa, dan tak heran kalau banyak gol musim ini akan lahir dari kaki dan kepalanya. (bud) Dusko Tosic, Bek Werder Bremen

Striker Lengkap

DIA sangat liat, mau bergumul, menendang dan memanfaatkan bodinya yang besar dan kokoh, dijamin bek lawan bakal terpental kalau tak siap-siap untuk bertabrakan, dia sosok yang lengkap sebagai striker khas Eropa. Sangat beruntung kami mendapatkannya. (bud)

FOTO-FOTO: ISTIMEWA

SAAT Claudio Pizarro kembali ke Werder Bremen dan diperkenalkan ke publik Weserstadion pada 15 Agustus 2008, ada satu spanduk yang membuat semangat sang pemain terlecut. Kalimat “Ritter wird zurückgekommen” terpampang jelas. Kalimat yang berarti “Ksatria itu Datang Kembali” menunjukkan kehadiran Pizarro dianggap makin memperkokoh skuad Werder Bremen. Dukungan besar pun langsung dirasakan Pizarro, kala kostum bernomor punggung 24 langsung terjual lebih dari 20 ribu sehari sesudah namanya resmi menajdi skuad baru besutan Thomas Schaaf. Seolah tak ingin menyia-nyiakan dukungan dan kesempatan, striker asal Peru ini langsung tancap gas. Performa menawan ditunjukkan kala Claudio Pizarro menjadi pahlawan kemenangan Werder Bremen atas Eintrach Frankfurt pada Senin (1/12) dinihari WIB. Tidak tanggung-tanggung, striker berusia 30 tahun itu melakukan machen Sie drei Absichten alias mencetak tiga gol. Tak hanya itu, Pizarro pun membantu Die Grün-Weißen (hijau-putih) meraih impian mereka di Liga Champions musim 2008 ini. Diego dkk mampu lolos ke fase knock out dengan status meyakinkan, juara grup!. Langkah sensasional ini diperoleh setelah mengangkangi klub favorit Internazionale Milan dengan skor 2-1 di partai terakhir, Rabu (10/12) dinihari WIB. Aktornya? Siapa lagi kalau bukan pria kelahiran 3 Oktober tersebut. Satu gol pembuka di menit ke-63 menjadi penyembur semangat sekaligus asa seluruh tim. Tak heran, selepas itu anak asuh Jose Mourinho dibuat merana dan hanya

Kemampuannya menjebol jala lawan memang sudah terlihat sejak ia memulai berkarir di klub lokal Deportivo Perquero dan Alianza Lima. Di dua klub tersebut, total ia sukses merengkuh 33 gol resmi dari 86 partai, statistik yang membuat Weder Bremen kepincut. mampu membalas satu gol penghibur via Zlatan Ibrahimovic. Bersinar di Liga Champions, Claudio Pizarro pun membuktikan kapasitasnya di level Bundesliga musim ini. Paling tidak, raihan sepuluh gol sampai pekan ke-16 menjadi bukti nyata ia kembali tajam seperti tatkala pertama kali menginjakkan kaki di Wesserstadion tahun 1999 lalu. Sosok kelahiran kota Callao ini memang tak asing lagi bagi publik Bremen, Ia pernah menjadi legenda di sana kala mencatat 29 gol dari 56 partai bareng Bremen alias 0,51 gol per partai!. Predikat “Jagal dari Andes” pun melekat sebagai sanjungan untuknya. Kemampuannya menjebol jala lawan memang sudah terlihat sejak ia memulai berkarir di klub lokal Deportivo Perquero dan Alianza Lima. Di dua klub tersebut, total ia sukses merengkuh 33 gol resmi dari 86 partai, statistik yang membuat Weder Bremen kepincut. Sukses di Bremen, membuatnya jadi magnet luar biasa tim-tim Bundesliga, dan Bayern Muenchen menjadi tim yang dipilih pria penyuka rambut gondrong ini. Selepas bermain apik di FC Hollywood dengan 71 gol dari 174 partai, ia lantas pindah ke Chelsea. Sayang, di The Blues ia selalu menderita cedera yang membuatnya kalah bersaing dengan bomber lainnya. Alhasil ia kembali klub Eropa pertamanya, Werder Bremen. Kini Pizarro tengah menikmati bulan madu keduanya di ranah Jerman. Tapi itu belum memuaskan hatinya, karena dia ingin membawa Bremen ke level tertinggi Bundesliga dan meraih hasil maksimal di Liga Champions. “Juara Eropa mungkin masih belum, maksimal kami berada di semifinal, baru 2 tahun lagi dengan skuad seperti ini Bremen bisa melaju ke final Eropa, tapi kalau di Bundesliga, aku yakin kami bisa meraih hasil terbaik di akhir musim,”tegas Pizarro. (persda network/bud)

c m y k


MINGGU MINGGU,, 14 DESEMBER 2008 z

23

Adelaide United VS Gamba Osaka

AP PHOTO/ITSUO INOUYE

GOL GIMENEZ - Pemain Pachuca, Christian Gimenez, mencetak gol kedua ke gawang Al Ahly pada partai perempatfinal Piala Dunia Antarklub di Tokyo, Jepang, Sabtu (13/12). Gimenez menjadi bintang dengan menyumbang dua gol.

Pachuca 4 VS 2 Al Ahly

Buah Kecerdikan Pelatih Pachuca PACHUCA, klub jawara Liga Champions Amerika Utara (Concacaf), mengawali debutnya di Piala Dunia Antarklub 2008 dengan penampilan mengesankan. Tertinggal dua gol terlebih dahulu di babak pertama, klub dari Meksiko itu berhasil menyamakan kedudukan dan balik menghajar Al Ahly di babak perpanjangan waktu dengan kedudukan akhir 4-2. Gelandang asal Argentina, Christian Gimenez, menjadi bintang Pachuca. Ia melesakkan dua gol ke Al Ahly, yang menjadi wakil Afrika, Sabtu (13/12), di Tokyo, Jepang. Kemenangan tersebut membuat Pachuca melangkah ke babak semifinal untuk bertemu dengan jawara Copa Libertadores, LDU Quito, yang akan dimainkan pada Rabu, 17 Desember. Bagi Al Ahly hasil tersebut membuat mereka gagal mengikuti jejak kampiun Afrika tahun lalu, Etoile du Sahel, yang melaju ke semifinal di perhelatan sebelumnya. Al Ahly yang diasuh pelatih asal Portugal, Manuel Jose, bermain disiplin di babak pertama. Pertahanan dibangun rapi, dan serangan mereka begitu efektif. Alhasil di menit ke-28 tekanan tim Mesir itu membuahkan keunggulan. Pachuca yang mengusai bola lebih lama kembali kebobolan untuk kali kedua menjelang babak pertama usai. Berawal dari serangan balik, striker asal Angola Flavio Amado berhasil menjaringkan bola ke gawang yang dijaga kiper Miguel Calero. Kecerdikan Pelatih Pachuca, Enrique Meza,

mengubah taktik di babak kedua, dengan dua pergantian pemain, membawa angin segar. Baru dua menit bergulir usai istirahat, gawang Al Ahly jebol. Pachuca memperkecil ketinggalan melalui Luis Montes yang masuk sebagai pemain pengganti. Gol yang begitu cepat itu membuat Pachuca tampil lebih berani dalam menyerang. Al Ahly yang berupaya mempertahankan keunggulan akhirnya kendor juga. Gimenez menjadi penolong bagi Pachuca yang membuat skor imbang 2-2 di menit ke-72. Kedudukan tersebut bertahan sampai waktu normal berakhir walau Pachuca aktif dalam menyerang. Di babak perpanjangan waktu, Damian Alvarez membuat Pachuca balik memimpin melalui cocoran memanfaatkan bola liar di menit ke-98. Kemenangan Pachuca ditentukan oleh Gimenez yang di menit ke-110 melepaskan tendangan menyilang yang tidak bisa dijangkau penjaga gawang Al Ahly, Amir Abdelhamid. (Persda Network/rie) SUSUNAN PEMAIN: Al Alhy Alhy: Amir Abdelhamid; Ahmed El Sayed (kk), Shady Mohamed, Hassan Ahmed (Sedik Ahmed 76), Wael Gomaa; Mohamed Barakat, Gilberto, Ahmed Fathi, Ashour; Aboutrika, Flavio. Pachuca Pachuca: Miguel Calero; Leobardo López, Julio Manzur, Jaime Correa (Luis Montes 45), Fausto Pinto (Juan Rojas Guerra 45), Paul Aguilar; Damián Alvarez, Carlos Rodríguez, José Francisco Torres (José Cárdenas 69), Christian Giménez; Bruno Marioni. Wasit Wasit: Ravshan Irmatov (Uzbekistan).

Penantang Setan “LUPAKAN Manchester United!” Itulah kalimat pertama yang diluncurkan Pelatih Gamba Osaka, Akiro Nishino, usai kepastian lawan mereka di babak perempatfinal Piala Dunia Antarklub 2008 adalah Adelaide United. Bukan apa-apa, Nishino hanya ingin seluruh skuadnya fokus pada klub asal Australia tersebut sebelum mewujudkan impian bertemu Manchester

United di semifinal. Pemenang duel ini akan menjadi penantang Setan Merah yang langsung lolos ke semifinal sebagai juara Liga Champions Eropa sekaligus unggulan utama. Bulan lalu sukses menumpas pasukan Aurelio Vidmar tersebut dengan agregat skor telak 5-0 dalam partai final Liga Champions Asia. Tapi Nishino yakin kini kondisinya jelas berbeda. Paling tidak, Adelaide sudah melakukan ‘pemanasan’ kala

Live on Minggu (14/12) ul 1 7. 1 5 WIB pukul 17 puk

menang tipis 2-1 atas tetangga mereka Waitakere United. “Kami hanya fokus pada Adelaide, tak ada yang lain. Manchester United? Itu masalah lain. Kami semua tak boleh memikirkan MU. Adelaide sudah pemanasan kami belum, itulah masalah kami,” ucap Nishino. Hambatan bagi Yasuhito Endo dkk makin kentara takala Adelaide hampir dipastikan akan diperkuat pemain andalan mereka, Diego, Cassio dan Sasa Ognenovski, meski ketiganya hanya datang dari bangku cadangan. Tekanan lain datang dari masyarakat sepakbola yang menginginkan Gamba Osaka minimal harus mengulangi prestasi rival mereka Urawa Reds Diamond tahun lalu kala finis di posisi ketiga. Bahkan sebagian dari mereka menyebut, seharusnya tahun ini ada wakil tuan rumah yang berada di jalur terakhir Head to Head 05/11/2008 Final LCA 12/11/2008 Final LCA

AP PHOTO/ SHIZUO KAMBAYASHI

LEPASKAN TENDANGAN Pemain Adelaide, Angelo Costanzo, melepaskan tendangan dengan dibayangi pemain Waitakere di Tokyo, Kamis (11/12). Adelaide siap balas dendam pada Gamba Osaka.

perburuan juara alias final. “Tekanan memang kami rasakan, tapi kami tak ingin memikirkan hal itu, yang ada hanya bermain dan mengalahkan Adelaide terlebih dulu. Mereka tim yang kuat meski terlihat kami mampu menumbangkan mereka dengan telak,” ucap the rising star Gamba, Michihiro Yasuda. Sayap kiri Gamba Osaka ini tak asal ucap. Pelatih tim tamu, Aurelia Vidmar menegaskan timnya sudah banyak belajar dari dua kekalahan di final Liga Champions Asia lalu. “Sebenarnya kami seimbang, hanya kesabaran yang membedakan. Kini kami lebih siap menghadapai mereka,” ucap Vidmar, yang gembira Diego dan Cassio bisa kembali merumput. Adelaide tetap akan mengandalkan kombinasi kapten Travis Dodd, Cristiano, Daniel Mullen, dan Kristian Sarkies. “Kami akan revans, meski bermain di kandang lawan. Kami sudah tahu celah mereka. Dua pertemuan sebelumnya memberi banyak pelajaran tentang kelemahan kami, juga mereka,” ancam kapten Travis Dodd. (Persda Network/bud)

Gamba Osaka 3-0 Adelaide Adelaide 0-2 Gamba Osaka

Prakiraan Pemain: Gamba Osak a (4-4-2): 22 Fujigaya, 2 Nakazawa, 5 Yamaguchi, Osaka 21 Kaji, 7 Endo, 10 Futagawa, 13 Yasuda, 16 Sasaki, 17 Myojin, 27 Hashimoto, 9 Lucas Cadangan Cadangan: 1 Matsuyo, 6 Fukumoto, 8 Terada, 11 Bando, 14 Hirai, 18 Roni, 19 Shimohira, 20 Kurata, 23 Takei Pelatih Pelatih: Akira NISHINO Adelaide United (4-4-2): 20 Galekovic, 2 Cornthwaite, 4 Cosranzo, 8 Sarkies, 10 Cristiano, 13 Dodd, 14 Jamieson, 16 Mullen, 18 Barbiero, 21 Spagnuolo, 24 Reid Cadangan Cadangan: 1 Birighitti, 40 Lucas, 3 Alemao, 5 Valkanis, 15 Salley, 23 Marrone, 25 Younis, 6 Cassio, 19 Ognenovski, 22 Diego Pelatih Pelatih: Aurelio Vidmar

soccer short BABEL - Manajer Liverpool, Rafael Benitez, melarang Ryan Babel bergabung dengan status pinjaman ke Ajax Amsterdam. “Dia akan tetap bersama kami,” kata Benitez. VALENCIA - Wakil Presiden Valencia Fernando Gomez menegaskan tidak akan melepas winger David Silva meski Los Che tengah dibelit masalah keuangan. Sebaliknya kontrak Ivan Helguera diputus atas kesepakatan bersama. MILAN - AC Milan dilaporkan mendapatkan bek muda asal klub

Fluminense, Brasil, Thiago Silva. Namun ia baru bisa turun Juni mendatang karena kuota pemain non Uni Eropa di Milan sudah habis. Sementara itu, pemain pinjaman David Beckham dikabarkan akan bergabung pada 29 Desember nanti. MADRID - Real Madrid mendekati bintang Portsmouth Lassana Diarra untuk menggantikan posisi gelandang bertahan Mahamadou Diarra yang dipastikan absen hingga akhir musim akibat cedera lutut. VAN DER SAR - Manchester United memutuskan untuk meneruskan

kontrak kiper veteran Edwin van der Sar. Kiper berusia 38 tahun ini bergabung hingga 2010. ANELKA - Striker Chelsea, Nicolas Anelka, dinobatkan Barclays sebagai Pemain Terbaik Premier League untuk bulan November. Penghargaan ini adalah yang pertama kali diterima mantan bintang Arsenal itu sejak Februari 1999 silam. BUFFON - Agen Gianluigi Buffon menampik berita yang menyebutkan adanya kemungkinan bagi kliennya untuk bergabung dengan klub Premier League Manchester City.


28 24

z MINGGU MINGGU,, 14 DESEMBER 2008

lima kandidat pemain terbaik dunia

CR7 Kandidat Terdepan

■ Lima Besar Pemain Terbaik Dunia 2008

1. Cristiano Ronaldo

2. Lionel Messi

3. Fernando To r r e s

4. Xavi

5. Kaka

SETELAH mengawinkan gelar Liga Inggris dan Liga Champions bersama Manchester United musim lalu, Cristiano Ronaldo kini berpeluang mengawinkan dua gelar individu; Pemain Terbaik Eropa dan Pemain Terbaik Dunia 2008! Gelar Pemain Terbaik Eropa (Ballon d’Or) sudah menjadi milik megabintang MU ini. Dan gelar Pemain Terbaik Dunia versi FIFA sudah berada di depan mata.

Fabiano Tak Dilepas ke City PENYERANG Sevilla asal Brasil, Luis Fabiano, menjadi salah satu pemain yang diburu tim Inggris, Manchester City. Seperti dilansir daily star, City bahkan sudah melakukan penawaran terhadap pemain yang 23 kali membela tim nasional tersebut dengan harga 28 juta euro atau sekitar Rp 425 miliar. Manajer Mark Hughes berniat menggabungkan Fabiano dengan kompatriotnya yang lebih dulu bergabung dari Real Madrid, Robinho. Sayang, keinginan Hughes sepertinya terhambat. Sevilla tak akan melepas pemain yang pernah bergabung dengan AP PHOTO Luis Fabiano Sao Paulo antara 2001-2004, dan mencetak 62 gol dalam 87 pertandingan tersebut. Fabiano bergabung dengan Sevilla sejak tahun 2005 dan hingga kini sudah bertanding di 86 partai serta mencetak 42 gol. Hal itu langsung diungkapkan sang Presiden Klub, Jose Maria del Nido. Menurutnya, ia tak akan melepas Fabiano karena akan memperburuk kondisi tim. Ia beranggapan penyerang 1,83 meter itu merupakan penyerang mematikan di Liga Spanyol. “Kami terlibat di banyak kompetisi dan kami tak ingin kehilangan pemain penting. Kami tak tertarik dengan uang,” ucapnya dilansir goal. “Saya tak akan mengubah pikiran saya. Ide memenangkan (Persda pertandingan lebih penting untuk kami dibandingkan uang.”(Persda Network/rie)

Peluang winger asal Portugal ini terbuka setelah tercantum dalam daftar lima kandidat terdepan peraih penghargaan Pemain Terbaik Dunia versi FIFA atau FIFA World Player of the Year. Ronaldo tercantun dalam daftar nominasi bersama dengan duo Barcelona: Lionel Messi dan Xavi Hernandez. Di samping itu terdapat juga peraih penghargaan tahun kemarin, playmaker AC

Milan, Kaka, dan tukang gedor Liverpool, Fernando Torres. Kelima nama nominasi tersebut dipilih oleh para pelatih dan kapten tim nasional dari seluruh negara anggota FIFA. CR7 --julukan Ronaldo-- yang tahun lalu berada di belakang Kaka dan Messi, untuk tahun ini berpeluang besar meraihnya yang pengumumannya dilakukan di Zurich, 12 Januari. (Persda Network/ka)

Sevilla VS Villareal

Gairah Sevillistas Live on Senin (15/12) ul 02.00 WIT A pukul WITA puk

SUNDUL BOLA - Gelandang Sevilla, Renato (kiri), menyundul bola dengan dibayangi pemain Real Madrid, Fernando Gago, pada partai La Liga di Santiago Bernabeu, Minggu (7/ 12). Sevilla percaya diri mengalahkan Villarreal, Senin (15/ 12) dini hari.

AP PHOTO/DANIEL OCHOA DE OLZA

SEMUA mata tertuju di Stadion Camp Nou, milik Barcelona pada pekan 15 La Liga. Di sana ada pertandingan terakbar antara tuan rumah dan Real

Madrid. Tapi di tempat lain, juga ada pertarungan seru yang mempertemukan dua tim yang juga bercokol di papan atas. Tuan rumah Sevilla kedatangan tamu Villarreal di Stadion Ramon Sanchez Pizjuan, Senin (15/12). Sevilla dan Villarreal berada di posisi empat dan dua. Selisih poin keduanya hanya dua angka, Villarreal 29 dan Sevilla 27. Kemenangan bagi Sevillistas --julukan Sevilla-- akan mengantar mereka ke posisi runner up menggeser Villarreal. Namun Villarreal bertekad mempertahankan posisinya dan terus menempel Barca. Jelang laga panas ini, Sevilla memiliki kepercayaan diri tinggi. Usai kalah 0-3 dari Barcelona di kandang sendiri, mereka menang 4-3 di Stadion Bernabeu, kandang Madrid. Berkat kemenangan tersebut, Sevilla masuk empat besar klasemen sementara. Bahkan hasil pertandingan tersebut turut mengantar Bernd Schuster meletakkan jabatannya dan diganti Juande Ramos. “Ini merupakan satu tempat yang sangat sulit didatangi dan memenangkan pertandingan. Tapi performa ini memberikan keyakinan kalau kami memiliki kemampuan bermain

di mana saja dan memenangkannya,” ucap Pelatih Manolo Jimenez usai kemenangan melawan Madrid, seperti dilansir goal. Kubu Sevillistas makin bergairah karena striker andalannya, Luis Fabiano, bisa kembali turun. Sebelumnya bomber Brasil ini absen melawan Madrid karena hukuman kartu merah yang didapat kala kalah dari Barca. Selain barisan depan yang kembali menggigit dengan hadirnya Fabiano, Sevilla juga memiliki barisan pertahanan yang mumpuni. Dari 14 laga yang telah dijalani, mereka hanya kebobolan 14 gol. Catatan ini sama yang dilakukan Deportivo La Coruna dan di bawahnya hanya ada Barca, yang baru kebobolan sembilan gol. Bagaimana dengan Villarreal? Di saat Sevilla kembali ke jalur kemenangan, performa tim tamu malah menurun. Pekan lalu mereka bermain imbang 3-3 melawan Getafe di kandang sendiri. Berikutnya Joan Capdevilla dkk mengalami kekalahan 0-2 di Liga Champions melawan Celtic, Kamis (11/12), walau tetap lolos ke 16 besar mendampingi Manchester United. Melawan Sevilla, Joseba Llorente sudah kembali berlatih setelah mulai sembuh dari cedera. Namun kemungkinan ia tak akan bermain sejak menit pertama. Sementara penyerang Nihat Kahveci yang sudah kembali fit mungkin akan menggantikan Jozy Altidore. Nihat yang cedera sejak Euro 2008, sebelumnya sudah tampil sebagai pemain pengganti melawan Getafe dan Celtic. Musim lalu, Villarreal menyerah dua gol tanpa balas dari Sevilla di Ramon Sanchez Pizjuan. Tetapi musim sebelumnya si Kapal Selam Kuning menenggelamkan tuan rumah dengan skor 1-0. Siapakah kali ini yang akan tenggelam? (Persda Network/rie)

cmy k


TRIBUN KALTIM 14-12-2008