Page 1


re-SHAPE your thinking ;YP[HU)7(MYLLJVWVS`LZ[LY^PSSZ\YWYPZL`V\0[»ZHZPNUPÄJHU[HUK^LSJVTLIYLHR[OYV\NO that helps you differentiate your products through design and performance.

Markets include: Houseware / Small Appliances / Medical packaging / Infant care / Sports bottles / Bulk water bottles

TRITAN™ is a registered Eastman Chemical Company product.

Tritan™ retains the versatility of copolyesters. But it also can offer unexpected advantages, including higher temperature resistance, easier processing and higher impact resistance. Tritan™ reshapes your expectations of polymers. The unique properties of Tritan™ deliver performance that is often superior to other clear thermoplastics, such as polycarbonate (PC). Areas of potential advantage include ease of processing and lower levels of residual stress, as well as clarity, toughness and JOLTPJHSYLZPZ[HUJLVM[OLÄUPZOLKWYVK\J[Z For more info call 0800 006 772 or go to www.plastichem.co.za


&ƌĞĞĐŽŶƐƵůƚĂƟŽŶƐ for new projects

We supply & maintain moulding machinery ĂŶĚĐĂƉŝƚĂůĞƋƵŝƉŵĞŶƚĨŽƌƚŚĞƉůĂƐƟĐ and metals industry

^ƚĂīƚƌĂŝŶŝŶŐĨŽƌ ŵĂĐŚŝŶĞƐĞƫ ŶŐ Machine maintenance contracts Free manuals for old ŽƌĞdžŝƐƟŶŐŵĂĐŚŝŶĞƐ

Technical Machine Suppliers is at the forefront ŽĨůĞĂĚŝŶŐŝŶŶŽǀĂƟŽŶƐŝŶŽƵƌŝŶĚƵƐƚƌLJ Kai Mei – 40yrs of excellence </D/WůĂƐƟĐDĂĐŚŝŶĞƌLJŽŚĂƐďĞĞŶďƵŝůĚŝŶŐďůŽǁŵŽƵůĚŝŶŐ ŵĂĐŚŝŶĞƐŝŶdĂŝǁĂŶƐŝŶĐĞϭϵϳϳ͘dŚĞĐŽŵƉĂŶLJ͛ƐŚŝŐŚůLJĞĸĐŝĞŶƚ ƐLJƐƚĞŵƐŚĂǀĞďĞĞŶƵƐĞĚŝŶ^ŽƵƚŚĨƌŝĐĂƐŝŶĐĞƚŚĞůĂƚĞϭϵϴϬƐ͘ zd^;zŽƵƌdĞĐŚŶŝĐĂů^ŽůƵƟŽŶƐͿŶŽǁƌĞƉƌĞƐĞŶƚƐ<ĂŝDĞŝŝŶ Southern Africa and ǁĞƐƵƉƉŽƌƚĂůůƵƐĞƌƐŽĨƚŚĞƐĞƚŽƉͲŇŝŐŚƚ machines͕ĞǀĞŶƐLJƐƚĞŵƐƚŚĂƚŚĂǀĞďĞĞŶŝŶƵƐĞƐŝŶĐĞƚŚĞ ϭϵϴϬƐ͙ƐĞǀĞƌĂůŽĨǁŚŝĐŚĂƌĞƐƟůůŝŶĚĂŝůLJŽƉĞƌĂƟŽŶ͘ Kai Mei’s machines are used for a complete range of containers, from as small as 5ml up to as large as 1500 litres and across the ƌĂŶŐĞŽĨƉŽůLJŵĞƌƐ;W͕W͕Wd'͕WW͕WsĂŶĚŵŽƌĞͿ͘

The R+D department at the Taichung City company is devoted ƚŽƚŚĞĚĞǀĞůŽƉŵĞŶƚŽĨŶĞǁŵĂĐŚŝŶĞƌLJĐŽŶƟŶƵŽƵƐůLJ͕ŝŶĐůƵĚŝŶŐ ƐŝŶŐůĞ͕ĚŽƵďůĞ͕ƚƌŝƉůĞ͕ƋƵĂĚƌƵƉůĞƚŽŽĐƚŽŶĂƌLJĚŝĞͲŚĞĂĚďůŽǁ ŵŽƵůĚŝŶŐƐLJƐƚĞŵƐ͕/D>ƐLJƐƚĞŵƐ͕ĂŶĚĞǀĞŶŝŶũĞĐƟŽŶͲƐƚƌĞƚĐŚ ŵĂĐŚŝŶĞƐ;ĨŽƌWdĐŽŶƚĂŝŶĞƌƐͿ͘ Kei Mai has sold over 5000 machines to customers in an ĞƐƟŵĂƚĞĚϴϱĐŽƵŶƚƌŝĞƐŽǀĞƌƚŚĞƉĂƐƚϯϬLJĞĂƌƐ͘/ƚŚĂƐĂůƐŽ ďĞĞŶŵĂŶƵĨĂĐƚƵƌŝŶŐŵĂĐŚŝŶĞƐŝŶŽŶŐŐƵĂŶ͕ŚŝŶĂ͕ƐŝŶĐĞ 1998, where it operates a 15,000m² factory.

Examples of Kai Mei technology

PBS 1005͕ƉŽǁĞƌĨƵů͕ĐƌĂŶŬͲƚLJƉĞ mould clamp system with linear ŵŽƟŽŶŐƵŝĚĞƐƚŽŵĞĞƚŚŝŐŚ ƉƌŽĚƵĐƟŽŶƌĞƋƵŝƌĞŵĞŶƚƐ͖ĂƵƚŽͲ ĚĞŇĂƐŚŝŶŐĂŶĚƚĂŬĞͲŽƵƚƌŽďŽƚ ĨŽƌĨƵůůLJͲĂƵƚŽŵĂƟĐƉƌŽĚƵĐƟŽŶ

HEAD OFFICE 031 701 0422 DĂƌŬsĂƌƌŝĞ͗ϬϴϯϮϵϬϵϮϲϭ mark@ytsm.co.za

TMS '08'17-full page ad-bleed.indd 1

PBS 905 ĂůƐŽŚĂƐĐƌĂŶŬƚLJƉĞŵŽƵůĚĐůĂŵƉŝŶŐƐLJƐƚĞŵ͖ ŵƵůƟƉůĞĚŝĞͲŚĞĂĚĐŽŶĮŐƵƌĂƟŽŶƐƵŝƚƐƚŚŝƐŵĂĐŚŝŶĞĨŽƌ ŚŝŐŚƉƌŽĚƵĐƟŽŶƐƉĞĞĚƐĨŽƌŵĞĚŝƵŵĂŶĚůĂƌŐĞĐŽŶƚĂŝŶĞƌƐ͖ ǀĂƌŝĂƟŽŶƐĨŽƌǀŝƐŝͲƐƚƌŝƉĞ͕ϮͲĐŽůŽƵƌĂŶĚϮͲůĂLJĞƌƉƌŽĚƵĐƟŽŶ ĂǀĂŝůĂďůĞ

REGIONAL SALES REPS Johannesburg Clive Gooding sales@ytsm.co.za 083 310 3967

Cape Town Sean Herholdt info@ytsm.co.za 071 155 0981

Eastern Cape DĂƌŬΘŶŶĞƩĞsĂƌƌŝĞ ĂŶŶĞƩĞΛLJƚƐŵ͘ĐŽ͘njĂ 083 788 1565

PBS-405DǁŝƚŚƚĂŬĞͲŽƵƚ ƌŽďŽƚ͖ĐƵƐƚŽŵĚĞƐŝŐŶĂǀĂŝůĂďůĞ ĨŽƌĚŝīĞƌĞŶƚŵĂƚĞƌŝĂůƐ͖ suited for small to medium containers for automated long ƉƌŽĚƵĐƟŽŶƌƵŶƐ

Zimbabwe & Africa Raymond Marowa info@ytsm.co.za +263 7734 77740

2017/08/03 12:31


By the way Publisher & Managing Editor: Martin Wells (martin@summitpub.co.za) Editor: Tessa Oâ&#x20AC;&#x2122;Hara (tessa@summitpub.co.za) Editorial assistant: Heather Peplow (heather@summitpub.co.za) Financial manager: Lisa Mulligan (lisa@summitpub.co.za) 'HVLJQHUV Jeanette Erasmus *UDSKLF'HVLJQ MHDQHWWHHUDVPXV#ODWHUDOG\QDPLFVFR]D

Bronwen Moys %OLQF'HVLJQ (bronwen.clarke@gmail.com)

Summit Publishing cc t:    f: c:   e: saplastics@iafrica.com 3RVWQHW6XLWH3ULYDWH%DJ; &RQVWDQWLD&DSH7RZQ6RXWK$IULFD Unit 8, Bergvliet Village Centre, Cnr Hiddingh & &KLOGUHQ¶V:D\5RDGV%HUJYOLHW

www.saplastics.co.za GAUTENG Lowrie Sharp t:   f:   c: e: lowrieplasticsmedia@absamail.co.za KZN Lynne Askew t:   f:   e: lynne@summitpub.co.za Printed by: Tandym Print, Maitland, Cape Town SA Plastics Composites + Rubber Technology is published six times a year and focuses on these industries in South and southern Africa. We welcome news, articles, technical reports, information in general and photographs about events and developments related to the plastics industry. The views expressed in the magazine are not necessarily those of the publisher. Views expressed are not necessarily those of the Plastics Converters Association, Institute of Materials or Association of Rotational Moulders either. Copyright: All rights reserved. ISSN number: ,6'6&HQWUH3DULV

Summit Publishing:&. VAT reg:

Plastics Institute of Southern Africa

Matter of fact: EPS not to blame IN THE last issue we published a book review by market research company Ceresana which implied that expanded polystyrene was LQYROYHGLQWKHWUDJLF¿UHDWWKH*UHQIHOO7RZHUEXLOGLQJLQ/RQGRQ The report implied that EPS was the most problematic insulation PDWHULDOIURPD¿UHSHUVSHFWLYH Mike Myers of the Expanded Polystyrene Association of 6RXWKHUQ$IULFD (36$6$ KDVREMHFWHGWRWKLVLPSOLFDWLRQ EPSASA represents EPS manufacturers, raw material suppliers and equipment suppliers in the region. ³$Q\UHVHDUFKRUJDQLVDWLRQVKRXOGKDYHFRQ¿UPHGWKDW(36 IRDPZDV127DSURGXFWXVHGLQWKH*UHQIHOO¿UHGLVDVWHU7KH FDXVHRIWKH¿UHZDVDUHVXOWRIWKHFRPELQDWLRQRIWKHFKRLFH of products used as a system, the design and application. Unfortunately, irresponsible comments in the media, driven by YHVWHGLQWHUHVWVZLOORQO\IXHOWKHÃ&#x20AC;DPHVRIXQLQIRUPHGGLVFXVVLRQ 7KHSUHYHQWLRQRI¿UHVWRVDYHOLYHVDQGSURSHUW\VKRXOGEHOHIW to engineering experts who will take into proper consideration a system of products, competent design and installation in DFFRUGDQFHZLWKWKHVSHFL¿FUHTXLUHPHQWVRIHDFKDQGHYHU\ SURMHFW´VDLG0\HUV

Early Polyoak directors slept alongside machines JOHN Nield of MyPlas ferreted out an historic volume recently, a 1981 copy of PLASTICS SOUTHERN AFRICA, which threw some light on the early days of the company he co-founded, Polyoak, now one of the most successful businesses in the LQGXVWU\3RO\RDNZDVVWDUWHGDPHUH¿YH\HDUVHDUOLHUDVD â&#x20AC;&#x2DC;bucket and brushâ&#x20AC;&#x2122; operation in the garage of its founder, Mr Peter G Nield, who had â&#x20AC;&#x2DC;perfected a method of simulating wood using polyurethane in silicone rubber mouldsâ&#x20AC;&#x2122;. The article continued: â&#x20AC;&#x2DC;Mr Nield easily sold his entire production LQWKH¿UVW\HDU+HZDVWKHQMRLQHGE\KLVEURWKHU0U-0 1LHOGDQGLWZDVGHFLGHGWRJRLQWRLQMHFWLRQPRXOGLQJWRPDNH WKHFRPS¶VRSHUDWLRQVOHVVODERXULQWHQVLYH$KLJKO\TXDOL¿HG WHFKQLFDOSDUWQHU0U%ULDQ:DOWHUVZDVEURXJKWLQDQGWKH¿UVW LQMHFWLRQPRXOGLQJPDFKLQHSXUFKDVHG(DFKRIWKHWKUHHGLUHFWRUV worked an 8-hour shift with the one on night shift sleeping next WRWKHPDFKLQHRQDVWUHWFKHU%\WKHHQGRIWKH¿UVWPRQWKV RILQMHFWLRQPRXOGLQJWKHFRPSDQ\KDG¿YHPDFKLQHV«¶LW concluded. Makes one think about what lays the foundation for success.

Association of Rotational Moulders of South Africa

Plastics Converters Association

PET Plastic Recycling South Africa

Greenlite Insulated Concrete won gold at the recent SAPRO Recycled Product of the Year Awards, in the category for products made from mixed materials. Its Jumbo Building Blocks are made from concrete and recycled expanded polystyrene, a useful application for ubiquitous and versatile EPS. Make no mistake, the blocks are light â&#x20AC;¦ but not that light, and can potentially consume large quantities of rEPS â&#x20AC;&#x201C; see page 19

Institute of Materials

METHING HAVE SO â&#x20AC;¦ IF YOU TO SAY de: if you e bright si Look at th isdom to w of m e ge have som e to us at rit w se ea impart, pl com s@iafrica. saplastic


Volume 15 No 5

REGLOPLAS

OCTOBER â&#x20AC;&#x201C; NOVEMBER 2017

Contents )LQGRXWPRUHDWZZZVDSODVWLFVFR]D

High-performance temperature control units â&#x20AC;¦ for large injection moulds, extruders, rollers, autoclaves and other processing equipment

New, more efficient Type 90 Smart INDUSTRY NEWS $IULFD7DQNV blow moulds big tanks &RQYHU7HNbuilds new plant



5RWR7DQN builds biggest tank in Africa



SAPRO Recycled Product of the Year

18

SAPPMA Pipes XI conference



3ODVWL7HFK supply Mozambican graphite mine



SOUND a â&#x20AC;&#x2DC;no-brainerâ&#x20AC;&#x2122; for Charles Rust!

32

AKWA 3URGXFWV excels with Chen Hsong systems



,SH[unveils its Innovation Centre

36

$UJHQWR commissions new Haixings



3ULQFLSOH¶Von the Wintec path



6HULRSODVWdoubles the size of its Boksburg plant



)G% Consulting Engineering Design forges ahead



0$7(5,$/6 (48,30(17 /DWHVWupdates on new materials & equipment

Temperature control units for water up to 90°C

6

44

â&#x20AC;¢ RT 70 control system â&#x20AC;¢ Solid-state relay (SSR)instead of heating contactor â&#x20AC;¢ Automatic phasechanger for pump direction (clockwise)

66

70

Temperature control units for oil up to 150°C

56

â&#x20AC;¢ Controller RT61 PID â&#x20AC;¢ Outlet temperature

72

72

82

Automotive Lightweighting

max 150°C â&#x20AC;¢ Heating capacity at 400V 6 kW â&#x20AC;¢ Cooling capacity 28kW @ 140°C â&#x20AC;¢ Pump capacity 60 litres/min, 3.8 bar

SPORT (UJRQ%$6) revolutionise bicycle saddle

NEW

Type 150 Smart

:25/'1(:6 WK$OWDLUEnlighten Awards for Innovation in

â&#x20AC;¢ Heating capacity 9 kW â&#x20AC;¢ Cooling capacity 24-90 kW â&#x20AC;¢ Pump capacity 60 litres/min, 3.8 bar

DESIGN ([FHOOHQFH in plastic design

â&#x20AC;¢ Alarm buzzer

96

82

â&#x20AC;¢ Simultaneous readout of temperature set-point and actual value â&#x20AC;¢ Clear arrangement of operating and indicating elements â&#x20AC;¢ Solid state relay (SSR) instead of heating contactor

ON THE COVER 7(3(;'\QDOLWHFRQWLQXRXV¿EUHUHLQIRUFHGVHPL¿QLVKHG WKHUPRSODVWLFFRPSRVLWHVIURP/DQ[HVVDUHQRZ¿QGLQJ QHZDSSOLFDWLRQVLQYHKLFOHLQWHULRUV2QHH[DPSOHLVWKH EDFNVHDWV\VWHPRIDQRIIURDGYHKLFOHLQZKLFKWKHFHQWUH EDFNVHDWLVHTXLSSHGZLWKDORDGWKURXJKWKDWHQDEOHV WKHEDFNUHVWRIHDFKVHDWWREHIROGHGGRZQLQGLYLGXDOO\ 7KLVORDGWKURXJKFRPSRQHQWLVSURGXFHGE\VKDSLQJ DQGEDFNLQMHFWLQJ7HSH['\QDOLWH7KHQHZFRPSRQHQW LVPRUHWKDQOLJKWHUWKDQLWVVWHHOFRXQWHUSDUW7HSH[ LVPDQXIDFWXUHGE\/DQ[HVVVXEVLGLDU\%RQG/DPLQDWHV *PE+ZKLFKLVEDVHGLQ%ULORQ*HUPDQ\

ZZZODQ[HVVFRP

â&#x20AC;¢ All components exposed to water are made of non-rusting materials, hence long service-life â&#x20AC;¢ Achieves estimated 24% reduction in rejects and 20% increase in productivity

JENOWILL SERVICES Contact â&#x20AC;&#x201C; Willy Tschopp Tel: 021 551 7241 Fax: 021 551 7243 28C Lilly Park, Railway Rd Montague Gardens, Cape Town jenowill@iafrica.com www.regloplas.com


Comment Dela Plast of Pretoria has set up its plant for the production of food packaging containers and components and gained ISO and other food grade compatibility accreditation. The initiative also required the installation of automation systems, such as the conveyor here, to achieve less handling of mouldings as well as, and possibly most importantly, the appointment of a QA/food safety manager, which role Cornelia Kerkhoff is now thriving in – see page 29

Little consensus, or appreciation, among public of industry’s products Brand companies should change to plastic because it’s a better solution

T

4 OCTOBER / NOVEMBER 2017

HERE has been a rush of sector conferences recently and we’ve been fortunate to host quite a large number of international delegates, some of who have made interesting observations.

One of the most relevant was that by Zoran Davidovski of the Plastic Pipe Conference Association (PPCA), who was at SAPPMA’s Pipes XI conference at Emperors in September. According to Davidovski, who is based in Austria, many people do not understand plastic materials and often are unaware of the many advantages that the materials offer. He gave a presentation at the conference in which the acceptance of plastic pipe was compared between various European countries. There was little conformity, whereas from an African perspective, we might have anticipated that, with Europe being such a highly civilized area, there would have been more agreement. Perhaps you have faced similar unfamiliarity? Many people I talk to express complete surprise that there is even such a thing as a plastics industry, let alone of the advantages of the product solutions produced. The average citizen seems to regard plastics as either a bottle or a bag, and has little awareness of what the huge range of plastic components used in the automotive, medical, household, electric/electronic and numerous other applications actually are. But apparently suppliers of products made from other materials are similarly unaware that their customers don’t really understand much about the products they supply. It might be useful to bear this in mind: at the moment most of the material substitution taking place is because plastics are seen as a cheaper, and not as a better solution – which is what they actually are. Perils of recycling ventures The fact that the Appeals Court did not support

THIS ISSUE

tyre recycling venture REDISA’s appeal against the liquidation order issued against it earlier this year has created a major crisis in the tyre sector. Getting an industry recycling venture up and running is no mean feat, with the path literally littered with obstacles, often from businesses and people who derive their living from these sectors. REDISA had a comprehensive business plan, Getting an but it appears there may have been industry some personality clashes or other agendas. Some individuals in the tyre recycling manufacturing sector have been quoted venture as saying they would rather see the up and tyre levy going to the government than running to REDISA. Do these people have any idea that this will be the last they will is no ever see of the levy funds? mean feat It may have been helpful for the anti-venture lobby to have chatted with people in the local bag manufacturing sector, who have seen absolutely no result from their levy payments for over a decade. This also goes to show how tricky the future may SURYHWREHWKHQRQSUR¿WVHFWRUVXVWDLQDELOLW\ associations in the plastics industry have got off to a good start, and have been helping create recycling businesses and jobs (which are vital to the future of the industry), but it can all come unstuck very quickly. New manufacturing ventures We report on several new manufacturing ventures in this issue and it has to be said that you have to have big thingies to start projects now, but that is the nature of entrepreneurship – situations where most people would decline … except you. Plus we report about an empowerment venture where the person involved really has the potential and the attitude to succeed, and we hope he does. We need more young black individuals to get involved in business ventures – the door is wide open for you!

Martin Wells , Publisher


75875/B

THE MORE WE

THE LESS WE’LL HAVE TO

At SAFRIPOL, we never leave things to chance. We walk our business journey with care; which is why we are doing all we can to preserve the environment in which we operate. By working closely with a plastic recycling company since 2012, we’ve replaced the previously used wooden pallets – many of which need to be thrown out after one delivery – with pallets made from the tons of scrap and waste plastic destined for landfills. This is just one of our many innovations developed to create a more rewarding future. CAIA Responsible Care Initiative of the Year Award (Received in 2016).

75875B-307821 Safripol_Ad_Plastic Pallets.indd 1

A Division of KAP Diversified Industrial (Pty) Ltd.

2017/08/01 4:07 PM


News

Africa Tanks blow moulds big tanks … opens up water tank market in SA

Big blow job – A 2500-litre tank leaves the mould at the Africa Tanks plant in Cullinan, to the east of Pretoria. The new company is able to produce tanks at far greater speed than by the roto process, with the cycle time for this size being just over 7min, only about 15% of the time required for roto moulding; the design of the container and quality of the surface ¿QLVKUHVXOWLQDQDWWUDFWLYHSURGXFW


â&#x20AC;&#x2DC;It is the first large HDPE tank with greater density than linear LLDPE, and is less porous, hence inhibits growth of any bacteria.â&#x20AC;&#x2122; IN ONE of the boldest steps in the local converting industry for quite some time, Africa Tanks has commenced with the blow moulding of plastic tanks up to 5000 litres at Cullinan near Pretoria.

OCT / NOV 2017 7

With an estimated capex of R26-million, this is a major venture into a market which has not been tested in South Africa before. The production of large plastic tanks in Southern Africa, mainly for water storage, has up to now been the territory of rotational moulding, and many in the roto industry were fearing the arrival of blow moulding technology. But conditions in the region have FKDQJHGRYHUWKHSDVWGHFDGHÂąVSHFLÂżFDOO\ due to the perceived unpredictability of water supply, drought in several areas as well as the increased need for drinking water â&#x20AC;&#x201C; and it appears that the roto sector, ZKLFKLQFOXGHVVHYHUDOYHU\HIÂżFLHQWWDQN manufacturing operations, were unable to supply orders from some of the building/ construction supply chains. That was in fact the origin of the Africa Tanks project: Hannes Geldenhuys, cofounder of the new company, had been involved at Build-it hardware group since 1997 and, while managing orders for the

chain, noticed that it could not procure a VXIÂżFLHQWVXSSO\RIZDWHUWDQNVIURPWKHORFDO roto manufacturers. Build-it operates over 350 outlets around the region (in SA as well as in Lesotho, Namibia, Mozambique and Swaziland), so demand was substantial. Geldenhuys, along with business partner and Africa Tanks co-founder Frik Mulder, assessed the situation and considered the possibility of blow moulding. Others in the sector had previously looked at the potential to blow mould tanks and the topic had been discussed at several roto trade conferences, but no-one had as yet been prepared to take the leap. The partners researched the options and then, with virtually complete secrecy, embarked on an extensive tour to China, visiting manufacturers of large blow moulding machines. The technology to blow mould large tanks is readily available in China and it likewise became clear that blow moulding tanks up to 5000-litres has become relatively common in developed countries. They chose a system from Yankang Plastic Machinery of Qingdao, equipped to manufacture three-layer containers up WROLWUHVHQDEOLQJLWWRPDNHWKHÂżUVW 3-layer tank in South Africa. Geldenhuys and Mulder (who now resides in Perth,


News Controls of the Yankang machine make it relatively easy to observe and adjust wall thickness, which is a big advantage in large container production

namely Build-it group. Technicians Australia) were impressed by the Yankang from Yankang assisted during the technology and also ordered the moulds commissioning of the machine, and the from the company. Africa Tanks now has moulds for 5000, 4000 and 2500-litre tanks Africa Tanks production team have been on a steep learning curve since. The as well as for a 1500-litre ‘slimline’ tank tanks’ three-layer HD structure comprises for domestic installation. With some of the a coloured outer layer (for the colour of more popular sizes, it also has duplicate choice); a mid-layer of black, to reduce moulds. It also manufactures a ‘nestable’ light ingress; and an tank. inner-layer of white, HDPE is used in the ‘Produces to allow for easier blow moulding operation, 2500-litre tank inspection of the tanks. as opposed to linear in 14 min; “The inner layer white for roto, with another 5000 in just 10.’ layer of food grade advantage for the blown PDWHULDOLVEHQH¿FLDOWR option being that colour users in more than one way: it is suitable masterbatch, or other additives, can for use for human consumption of potable be dosed and blended at the machine, water, and allows for better visibility inside compared to roto where material needs to the tank, to spot any foreign objects,” said be milled to powder and colour and other Mulder. additives/stabilizers need to be blended in ³,WLVDOVRWKH¿UVWODUJH+'3(WDQNZLWK a prior compounding step. greater density than linear LLDPE, and is Although blow moulding technology is less porous and hence inhibits growth of all new to Geldenhuys, the company’s any bacteria,” he added. focus is simply on supplying its customer,

The system can produce a 2500-litre tank in a little over seven minutes, approximately 15% of the cycle time of a similar sized roto moulded tank. Production of the 5000-litre tanks takes about 10 minutes, once again considerably quicker than by roto moulding. A further plus is that the tanks, on exiting the mould, are already cooled to room temperature – which allows for easier handling and is a further almost unexpected advantage. But the far faster production has presented another challenge: that of transporting the tanks to market. At optimum output, running 2500-litre tanks, the Yankang would produce about 160 tanks a day; for the 5000-litre option, it would produce 144 tanks over 24 hours, ZKLFKZRXOGSUHVHQWDVLJQL¿FDQWORJLVWLFV challenge. As a result, the machine is not yet running at full output, and the affable Geldenhuys is if anything trying to rein the wild horse in.

8

OCT / NOV 2017

Hannes Geldenhuys, co-founder of Africa Tanks, was involved in the hardware trade for 20 years before starting the company

Africa Tanks’ trademark rain drop motif is likely to become far more visible in the water tanks market

The name of the merchant supplier can be set in relief

The inner layer of the tanks are white, allowing for easier inspection


News Hurricane stops Texas ethylene plants

JUST BRIEFLY

THE hurricane which hit Texas in late August had a major impact on polymer production in the USA state, illustrating both what effect natural phenomenon can have on supply as well as the important role of the Texas petrochemical industry worldwide: on 1 September, 13 Texas ethylene plants were down (compare that to southern Africa, where Sasolâ&#x20AC;&#x2122;s ethylene plant is the sole supplier); four other ethylene plants in Texas were operating at reduced rates. The result of Hurricane Harveyâ&#x20AC;&#x2122;s activities was, obviously, an increase in polyethylene prices. Large amounts of feedstock and polymer production remained down by mid-September. &RQVXOWLQJÂżUP3HWUR&KHP:LUH estimated that at peak storm impact, about 60 percent of US ethylene production was out of commission. Several of the manufacturers declared force majeure, including Chevron Phillips Chemical (three PE production sites in Texas); LyondellBasell (four PE sites); Formosa (PP and PVC plants); Oxy Vinyls (two PVC sites); Ineos (two PP sites) and Total Petrochemicals (PP unit). The effect of the interruption, however, appears to have been less than expected as PE prices were not majorly altered.

10 OCT / NOV 2017

Strike not actually at Mpact KZN THE industrial action which was reported to have hit Mpact KZN in mid-September, where fulltime employees were said to have gone on strike in support of contract workers, did not actually take place. Instead, an independent service provider to Mpact Plastics, providing packing services to the companyâ&#x20AC;&#x2122;s operation in Pinetown, was involved in wage negotiations with NUMSA. A company statement said Mpact Plastics had successfully concluded wage negotiations through the appropriate structures, namely the Plastics Negotiations Forum (PNF), falling within the scope of registration of MEIBC. Paul Visagie, GM of Mpact Plastics: FMCG said: â&#x20AC;&#x153;We are hoping for a speedy resolution between the service provider and their protesting employees, whom we consider to be our partners. At this point, Mpact has VXIÂżFLHQWVWRFNOHYHOVWRFRQWLQXHWR service our customers as usual.â&#x20AC;?

In very tough economic times, Conver-Tek has recently built a new R20-million factory facility to be able to expand and develop its vision and to remain competitive in the local and international market

Conver-Tek put years of experience EXPLODING populations and competitive plastic related markets around the world rely on smart development and manufacturing WRPHHWKLJKYROXPHDQGTXDOLW\ÂżWIRUXVH products. In South Africa it is no different: here we have companies like Conver-Tek which design, develop and manufacture world-class tools, dies and injection moulds to rigorous demands of convertors in selected precise industries. According to Bevan Davis, MD of ConverTek, the quality of the design, cooling, steels used and manufacture of moulds has an enormous bearing on the output and life of the mould as well as on the products made on the mould. â&#x20AC;&#x153;That is why it is critical to make use of only the best designs, computer software, tool steels, cutting tools and toolroom machinery in their manufacture,â&#x20AC;? says Bevan, who was a founder member and past chairman of TASA Gauteng and is a director of the NTI (National Tooling Initiative), organisations which are committed to uplift and develop the toolmaking and support engineering industries. Modern tool and die making is specialized and in many instances complex, with many interrelated requirements for specialized plastic engineered products. â&#x20AC;&#x153;For example, a tool may be required for quality high-speed injection moulding of components using engineering polymers that must last through the entire life cycle of a product (sometimes for 10 years and even longer), while maximizing speed, quality, critical sizing, no runner wastage and minimizing costs, machine downtime, repairs to tools and production scrap.

â&#x20AC;&#x153;In order to achieve this one needs to unGHUVWDQGWKHSURGXFWUHTXLUHPHQWVÂżWIRUXVH plastic materials needed, production, manufacturing process and engineer tools in such a way that they deliver beyond the expectations of the client. We have tools that have delivered Âą120 million units that can still produce to the original tight spec and quality. The long-term cost of the tooling into the product is a fraction of a cent versus the ongoing hidden added production costs of non-performing ÂľFKHDSÂśWRROVVFUDSUDWHVWULPPLQJÂżWPHQW problems etc,â&#x20AC;? added Bevan. Best-of-breed Conver-Tek upholds the motto â&#x20AC;&#x2DC;what you put in is what you get out,â&#x20AC;&#x2122; and there is no such phenomena as a cheap quality tool, DQG%HYDQLVDÂżUPEHOLHYHULQWKLVSULQFLSOH The company makes use of only the highest quality tool steel from its long-time supplier, BĂźhler Uddeholm. â&#x20AC;&#x153;Depending on production requirements and expected tool life we use some tough high spec steels to build our tools. These VWHHOVDUHGLIÂżFXOW to machine to precise detail with standard cutting tools. Here we make use of CNC Chamille spark erosion technology with delicate electrodes for precision detail. This of course increases the costs of the tools. â&#x20AC;&#x153;We invest in recognized machine tools that are up to the precision toolmaking task and make use of the highest quality cutting tools and spark eroding equipment to build our tools. â&#x20AC;&#x153;There is a good reason why we use the machines we do. They have been found to deliver the best performance for this type

â&#x20AC;&#x2DC;Mould maker is in fact its own best client as its other core business is plastic injection moulding.â&#x20AC;&#x2122;


of work internationally and are up to the rigours of working the kind of materials that we do,â&#x20AC;? Bevan says. The companyâ&#x20AC;&#x2122;s machine shop makes use of Haas and Deckel CNC milling machines, Victor CNC lathes and CNC Chamille spark erosion equipment. Most of the cutting tools, on the other hand, are provided by Sandvik. Concept to completion Gone are the days of creating tools, dies and moulds over an extended period of

â&#x20AC;&#x153;Every aspect of tool, die and mould making requires expertise and it all begins ZLWKDÂżWIRUXVHSUHFLVHGHVLJQ7KLVLV achieved with the assistance of 3D modelling and CAD/CAM software. All parameters need to be taken into consideration DQGZKHQWKHÂżQDOGUDZLQJVDUHSUHVHQW ed, will be taken to rapid prototype level. The exact dimensions and functions of the product can be provided using rapid prototyping. We have our own rapid prototyping machine, and where necessary we use bureaus for larger parts that have these larger growing machines. We prove the concept and design where possible as a working sample.â&#x20AC;? From there it goes into the manufacturing process using the capture-approved CAD design data and LWLVPDFKLQHGWRVSHFLÂżFDWLRQLQWKHWRRO room. After vigorous quality checks, the tool or mould will be delivered after it has been jointly trialed and commissioned by ConverTekâ&#x20AC;&#x2122;s staff and the customer to ensure it performs to the designed spec. â&#x20AC;&#x153;We will supply all the production parameters to the client or produce for the client, to ensure that the tool is properly utilized to ensure it performs optimally,â&#x20AC;? Bevan adds. Conver-Tekâ&#x20AC;&#x2122;s efforts have not gone unnoticed. A few years ago it was recognised

builds new plant, to good use

Buzz Trading â&#x20AC;&#x201C; ready for contract work Capacity available: ready for contract moulding work Servicing the domestic appliance market in Southern Africa since 2003 â&#x20AC;˘ Injection moulding capability from 60 to 1300 tons clamp force â&#x20AC;˘ Own toolroom: we offer development from concept to finished product â&#x20AC;˘ We operate our own transport fleet: delivery to anywhere in SA within 48hrs

Buzz Trading 104 (Pty) Ltd t/a Master Products 16 Moller Street, Germiston Tel: 011 873 8050 | Email: orders@buzztrading104.co.za www.buzztrading104.co.za

OCT / NOV 2017 11

Conver-Tek MD Bevan Davis and production manager Barry Winter at the companyâ&#x20AC;&#x2122;s new and far more spacious plant in Brakpan. The design and construction of the plant, part of an estimated R20-million project, is a major achievement by the Conver-Tek team. The companyâ&#x20AC;&#x2122;s toolroom is however still operating from its premises in Elsburg and will only move over once a number of important tool building jobs have been completed

time. Modern TDM is in itself becoming a highly technical production process nowadays. Customer demand calls for ergonomic design, rapid product development from concept, to prototype and end-product to compete with Chinese and Eastern opposition toolmaking companies. â&#x20AC;&#x153;We prefer to compete in high-end, quality tools and production rather than compete in the low and cheap tools. We cooperate and make use of likeminded toolrooms who can support our business to reduce lead times and deliver quality tooling.


News Maiden results from Master

JUST BRIEFLY

THERE are very few, if any, companies in the industry who would list on the JSE in the current economic climate, but that hasnâ&#x20AC;&#x2122;t fazed Master Plastics CEO Manley Diedloff. Master listed earlier this year after it separated from Astrapak when the latter joined with RPC, the giant British-global converting operation. In its maiden results released in mid-September, Master Plastics achieved EBITDA (earnings before interest, tax, depreciation and amortization) of R27,8-million for the six-month period to end-August, marginally ahead RILWVSURMHFWHGÂżJXUHVIRUWKHIXOO\HDU due to end-February 2018. Besides VWDQGDUGSODVWLFÂżOPVDQGEDJV0DVWHU Plastics also manufactures undercover farming nets and geotextiles, areas where there is expected to be growth. The group includes Barrier Film Converters, Peninsula Plastics and Plusnet-Geotex.

IMCD opens -)NZQKIWNĂ&#x2026;KM

,0&'WKHGLYHUVLÂżHGVSHFLDOW\ chemicals business which has its South $IULFDQKHDGRIÂżFHLQ-RKDQQHVEXUJ KDVRSHQHGDQRIÂżFHLQ1DLURELWRVXS ply the East African market. IMCD is a global supplier of chemicals, detergents, coatings, lubricants and other materials. It took over Chemimpo in SA some years ago, which ironically supplied a very similar range of products, giving access to markets similar to which it trades in internationally. IMCD is apparently also planning to open an RIÂżFHLQ*KDQDWRVXSSO\LQWKH:HVW Africa market.

12 OCT / NOV 2017

Natural energy at SAPY SAPY, the PP yarn manufacturer, and its subsidiary SAPY Colours are making use of naturally sourced energy at the companyâ&#x20AC;&#x2122;s plant in Hammarsdale, .=16$3<ÂśVSLORWSURMHFWIRUK\EULG renewable energy uses photovoltaic panels that generate enough current WRSRZHUDOOWKHOLJKWVLQWKHRIÂżFH and factory for about 8hrs overnight, depending on conditions. The PV panel is the main source of energy, but the wind turbine is also used. The PV panel moves with the sun through the use of a sophisticated software programme (using GPS coordinates), to capture the maximum amount of energy possible.

Ndileni Mikosi in the Conver-Tek assembly department with a batch of water meters ready for shipment. The company designs, builds the tools and manufactures all the plastic components used in these projects

by the University of Aachen of Germany, in conjunction with the University of Stellenbosch, who undertook benchmarking studies of South African tool, die and mould makers, comparing them with their European compatriots. The project was FRQGXFWHGRQEHKDOIRIWKH1DWLRQDO7RRO LQJ,QLWLDWLYH 17, UHFHQWO\ Âł:HOLNHWRROPDNHUVDQGFRQYHUWRUV in Europe, have to compete against the Chinese and need to adjust performance to compete for the same slice of cake. Our design ability, quality and performance is our selling edge.â&#x20AC;? More to Conver-Tek There is more to Conver-Tek than manufacturing and supplying tools, die and moulds. The company is, in fact, its own best client, as its other core business is plastic injection moulding of components for the water and specialised engineering sectors. Besides fully assembled water meters, it produces parts for the armaments, medical, motor, electronics, pump and pool industries. Although the divisions were started simultaneously and complement each other, they maintain a high degree of independence. Experience gained in the injection moulding production lines often transpires to improvement and optimization of services to customers on the tool, die and injection moulding side of things. Conver-Tek is seen by many as an innovation house. Many of the products produced on the plastic and tooling side have stood the test of time and some have even changed our lives. Âł:HZHUHRQHRIWKHLQYHQWRUVRI the original micro irrigation system and produced both the tooling for their manufacture and the end products ourselves. Although it has been widely copied and produced elsewhere in the world, it still makes use of our original concepts and materials used.

Âł:HIXUWKHUGHYHORSHGWKHÂżUVWSODVWLF water meters for Meinecke in Germany that withstand 80-Bar burst pressure. This was considered impossible by their design engineers at the time. Âł:HDOVRGHYHORSHGDQGSURGXFHGWKH tooling, chose the materials and produced the legendary Kreepy Krauly pool cleaner for over 20 years. That revolutionized the way pools are cleaned around the world,â&#x20AC;? says Bevan proudly. Whatâ&#x20AC;&#x2122;s next And the innovation doesnâ&#x20AC;&#x2122;t stop there. The company has produced many other ÂľZRUOGÂżUVWÂśSODVWLFGHYHORSPHQWLQQRYD tions. It designed and produced tamperproof-all polymer water meters in housings for metropolitan municipalities in South Africa. The above-ground meter boxes DQGÂżWWLQJVDUHSDWHQWHGLQQRYDWLRQVRI Conver-Tek and large volumes have been installed and used by the major metros. Export of these products is also a major focus. A unique, internationally patented plastic solar geyser with PV power and combined water heating are in the pipeline and are being shown to interested concerns globally. A few new technologies in the challenging water industry to resolve ongoing problems are in an advanced stage of development. A new high-tech patented electronic fully automatic hunting bow sight has already been highly praised and tested by the current world champion. Production and tooling will begin in the next few months, mainly for export purposes. â&#x20AC;&#x153;In order to compete in a global competitive marketplace dominated by countries with huge manufacturing infrastructures and budgets, we have had to keep innovating and producing new and better quality products locally than can be found anywhere else in the world in order to stay ahead of the pack,â&#x20AC;? concludes Bevan.

www.convertek.co.za


40,000-litres in Africa from

The big one – Terry Stanley and Spike Lemmer dwarfed by one of the 40,000-litre vertical tanks moulded at RotoTank™ in Brits. The roto moulding of these large tanks, reputed to be the largest plastic tanks manufactured in Africa, has been a major project over the past three years for RotoTank™. About 850kg (water) and up to 1 000kg (chemical) LLDPE polymer is used in each tank and its dimensions – 3,3m diameter by 4,85m height – are formidable to say the least

14

OCT / NOV 2017

NEWS-ROTOTANK.indd 14

2017/09/27 10:14


News

Biggest tank RotoTank

Being dwarfed by your products can be a good feeling

Solution lies in no single participant, but through collaboration ROTO TANK has put some space between itself and rivals in the South African tank market by producing the ¿UVW5RWDWLRQDO0RXOGHGOLWUH LLDPE plastic water tank in Africa. 0LQG\RXLWKDVEHHQPDNLQJ these large tanks for almost three \HDUVEXWVXFKZDVWKHVHFUHF\ that it has only now unveiled its breakthrough achievement.

SURFHVVLQJHTXLSPHQWVLPSO\GRHVQ¶W H[LVW0DQXIDFWXUHUVRIODUJHWDQNVWR date have done it themselves and the nature of this undertaking is that few of the successful developers have been keen WRDVVLVWRWKHUV±LQRWKHUZRUGV6WDQOH\ and Lemmer literally had to develop the production plant themselves â&#x20AC;&#x201C; and WKH\¶UHQRWWHOOLQJKRZWKH\DFKLHYHGLW The birth of RotoTankâ&#x201E;¢ developed over a cold beer in a local Fourways pub LQZKHQWKH\DJUHHGWREXLOGWKHLU ¿UVWURWRPRXOGLQJRYHQ7KHUHH[LVWHGD synergy in that Stanley had the technical expertise and Lemmer had the ready availability of the polymer resin. It all VWDUWHGRXWZLWKDIDLUO\JUDGXDOWUDMHFWRU\ with Lemmer supplying the LLDPE PRXOGLQJSRZGHUZKLOVW6WDQOH\JRWWR grips with the aspects of developing the new roto moulding plant. The principle >>

OCT / NOV 2017 15

The problem with the production of such large capacity containers (and roto moulding is itself a challenging process) LVWKDWWKHVKHHU¿JXUHVDUHLQWLPLGDWLQJ ¿UVWRIDOOWKHPDVVLYHRYHQDQGPRXOG¶V PñGLPHQVLRQVDUHMXVWSODLQVFDU\ if not outright frightening during the SURFHVVLQJVWDJHWRQVRI//'3( powder is used to produce a heavy duty FKHPLFDOWDQNDOWHUQDWLYHO\WRQV

IRUDVWDQGDUGZDWHUWDQN UHMHFWVKRWV DUHQRWDWDOOZHOFRPH DQGWKHQWKHUH¶V still the substantial amount of total cycle WLPHLQYROYHGLQHDFKF\FOHRIKRXUV and 3 hours respectively. It all adds up to a daunting undertaking. All their roto moulded tanks are seamless. Larger plastic composite polymer tanks have been produced around the ZRUOGEXWXVLQJWKHFRPSRVLWHVSURFHVV ZLWKSRO\HVWHUUHVLQVDQGJODVV¿EUHRU other reinforcement. Larger roto moulded tanks have been PDGHHOVHZKHUHKRZHYHULQ$XVWUDOLD ,UHODQG ZKHUHDQGOLWUHWDQNV are produced) and possibly the USA for sure. So Terry Stanley and Spike Lemmer of RotoTank in Brits knew that it was possible. And there were further challenges WRREHFDXVHVRIHZURWRPRXOGHUVDUH SURGXFLQJWDQNVDVODUJHDVWKLVWKH

Experts in fine powder milling of plastic resins PowderPlast milling operations around South Africa can accommodate our customersâ&#x20AC;&#x2122; exact powder needs and specifications â&#x20AC;&#x201C; from particle size and melt flow rate, to pigment choice and other additives We regularly process resins such as LDPE, LLDPE, HDPE, EVA, PP. We also offer a one-time foaming additive in compound form for rotational moulding. â&#x20AC;¢ Uncompromising powder processing quality â&#x20AC;¢ Fast turnaround times â&#x20AC;¢ Proactive communication â&#x20AC;¢ Knowledge and experience â&#x20AC;¢ Multi-step approaches to solving customer needs Contact us: Plot 198 Zilkaatsnek, R511 (Brits) 0250, PO Box 1210, Ifafi, 0260 Tel: 011 393 5062 Fax: 011 393 5647 E-mail: sales@powderplast.co.za GPS: S 25°41.268â&#x20AC;&#x2122; E25°52.442â&#x20AC;&#x2122;

NEWS-ROTOTANK.indd 15

Web: www.powderplast.co.za

2017/09/27 10:15


16

OCT / NOV 2017

News << was established that RotoTankâ&#x201E;˘ would specialise mainly in producing large tanks. The synergies appear to have worked, with Lemmer continuing to supply the pulverized LLDPE moulding powder (mainly serviced by Sasol Base Chemicals â&#x20AC;&#x201C; Polymers) through the RotoTank subsidiary, PowderPlast and Stanley hands-on at the roto moulding plant. But the project to manufacture Africaâ&#x20AC;&#x2122;s biggest plastic tank gathered momentum and Stanley steadily cobbled the solution together, with Lemmer being the technology bouncing board. The construction of the mould for the large tank was in itself a EUHDNWKURXJKZLWKPRGLÂżFDWLRQVWRWKH ribbing being necessary. And the scale of the project meant that trial-and-error was not a sustainable option. RotoTankâ&#x201E;˘ also have another two roto moulding plants strategically positioned around South Africa so it is able to competitively offer its services nationally, and possibly, even internationally. RotoTank Cape is in Moorreesburg on the Cape West Coast near Saldanah Bay, run by business partner, Hendrik Helberg who also heads up PowderPlast Cape, another strategically positioned powder pulverizing facility. This roto moulding plant was set up in 2008 and the powder plant soon thereafter. RotoTank KZN, in Marburg is run by another partner, Hendrik Janse van Rensburg. This roto moulding factory also boasts its own pulverizing powder machine. Hendrik is further occupied in making high quality roto moulds for the 3 plants. This option can be offered to customers with new projects in mind. The 40,000-litre tanks are now being supplied mainly into the chemicals sector, but with the advent of a national water supply challenge arising, this large tank now offers a fantastic alternative for heavy industry. There also exists the obvious The process developed at RotoTank is being kept secret by Lemmer and 6WDQOH\VXIÂżFHWRVD\WKDW the rotational frame design and gear arrangement is vital. The oven below is 8 metres high

NEWS-ROTOTANK.indd 16

issue surrounding the delivery of such an over-sized hollow container, where the provincial road ordinance limitations must be considered. Nevertheless, all RotoTankâ&#x201E;˘ product deliveries are made countrywide, free of charge. RotoTankâ&#x201E;˘ claim and boast to make the largest, plastic , vertical tank (40,000-litres), largest horizontal or transport tank (8,000-litres), largest

septic tank (12,500-litres) and largest silo (27,000-litres). This claim is unsurpassed in the South African market place. Other noteworthy developments have been achieved, including Decant-a-Tankâ&#x201E;˘, a solution to completely drain a large vessel and Decant-a-Binâ&#x201E;˘, an industrial solution to completely drain a 1,000-litre container. Apparently, there is more to come. So, watch this space.

RotoTank also had to redesign its trailers to transport the big tanks, which at just over 40mÂł are the size of a not-so-small swimming pool

Besides the big tank project, Lemmer and Stanley have been working on several other technical and design advances at Brits

The moulded tanks could weigh up to 1,1 tons and require a special jig to be lifted out of the mould (which has a similar extreme weight). The big tanks take up to 3hrs to cool, which is vital in order to retain structural integrity

RotoTank uses Mold On GraphicsÂŽ to label its tanks, achieving long-lasting branding â&#x20AC;Ś and is seeing its tanks becoming increasingly popular. Brighton Molele, part of the companyâ&#x20AC;&#x2122;s assembly team, also handles the tank decoration

Dissected section of one of the tanks shows an almost remarkably FRQVLVWHQWZDOOWKLFNQHVVGLIÂżFXOW to achieve in roto moulding

The quality of milled material from the RotoTankâ&#x20AC;&#x2122;s subsidiary Powderplast, with consistent formulation DQGĂ&#x20AC;RZLQJKDVPDGHWKH production of the large containers much easier

2017/09/27 10:15


CHEN HSONG MITSUBISHI A WORLDWIDE STRATEGIC PARTNER OF

SHOWCASES ITS ADVANCED TWO-PLATEN MACHINES WITH STATE-OF-THE-ART TECHNOLOGIES. Chen Hsong’s revolutionary two-platen advanced series Supermaster machines are built in collaboration with leading European and Japanese industry experts delivering unparalleled performance that’s underpinned by the latest global technological advancements. Chen Hsong also boasts patented design aspects including high speed automatic mould height adjustment coupled with the acclaimed Second Generation Servo-Drive System that saves up to 80% electricity compared to VTCFKVKQPCNƒZGFRWORU[UVGOU

Additional features include 14 clamping units and 14 injection units to choose from offering uncompromising flexibility . With the largest opening stroke and a small footprint Chen *UQPI OCEJKPGU CTG GHƒEKGPV CPF CFCRVCDNG to your factory environment whether your requirement is a 700 ton machine or a 6500 ton for larger outputs. With almost 60 years in the industry, Chen Hsong is one of the largest plastic injection moulding machine manufacturers in the world, producing around 15,000 machines annually.

Contact details: Tel: 011 466 1717 • Email: sales@maritimemarketing.co.za Website: www.maritimemarketing.co.za • Address: Unit 12A Kyalami Crescent, Kyalami Boulevard, Kyalami Business Park, Johannesburg, South Africa, 1685

@MaritimeMarketing1

Maritime Marketing

Maritime Marketing


News

Innovative new demonstrate PHOTOS: LOWRIE SHARP

Can-do attitude of recyclers at SAPRO best recycled product competition MAKING bed bases from old car bumpers turned out to be anything but a rubbish idea for Graham Coleman and Gianni Nosenzo of Cycliq, two veterans of the bedding industry whose innovative â&#x20AC;&#x2DC;Space Baseâ&#x20AC;&#x2122; bed base was awarded the SAPRO Trophy for the Best Recycled Product of the Year recently.

The SAPRO awards were presented at the organisationâ&#x20AC;&#x2122;s 6th biennial awards ceremony at Emperors Palace in Johannesburg on National Recycling Day, Friday 15 September. This yearâ&#x20AC;&#x2122;s lavish dinner was hosted in partnership with platinum sponsors Erema Plastic Recycling Systems and 3RO\FRWKH3RO\ROH¿Q3URGXFW5HFRYHU\ Organisation. According to Rudi Johannes, chairman of SAPRO (the South African Plastics Recycling Organisation), products entered for this yearâ&#x20AC;&#x2122;s competition showcased a tremendous amount of ingenuity and creativity, despite

7KH6SDFH%DVHEHGEDVHIURP&\FOLT ZRQWKH6$352µ5HF\FOHG3URGXFWRIWKH <HDU¶$ZDUG,WZHLJKVFRQVLGHUDEO\OHVV WKDQWKHZRRGHQRSWLRQDWNJVFDQIROG XSLQWRDERXWDTXDUWHURIWKHVL]HDQGQRW VXUSULVLQJO\LVSURYLQJSRSXODU

 U%HVW5HF\FOHG FHUWL¿FDWHIR Q OLTUHFHLYHGWKH \F PD I& DLU QR FK PD 52 $3 *UDKDP&ROH GL-RKDQQHV6 H<HDUIURP5X 3URGXFWRIWK

And the winners are â&#x20AC;¦ Innovation revealed at Recycled Product of the Year Awards INNOVATION and organisation were evident among the entries of the SAPRO â&#x20AC;&#x2DC;Designâ&#x20AC;&#x2122; Award winners. Besides extending the life of post-use plastic materials, the innovators also had to conceptualise and develop the new products with an eye to making the projects commercially viable and sustainable. 18 OCT / NOV 2017

Street Sleeper won the gold award in the category for Novel and Artistic Products

GOLD


recycled products

ingenuity

Usabco took gold for their Addis 10-litre watering can in the Percentage Post-consumer Recyclate category

is burgeoning. Locally, Cycliq produces about 3500 of the black bases per month at its plant in Wadevilleâ&#x20AC;&#x161; but has the capacity to double that. â&#x20AC;&#x153;After much trial and error and having to overcome numerous obstacles, Cycliq has managed to totally reinvent the household staple that was traditionally heavyâ&#x20AC;&#x161; cumbersome and usually made out of wood by using recycled polypropylene in the form of end-of-life automotive components, mainly car bumpers,â&#x20AC;? disclosed Colman. Other products that received awards Other winners in the various categories included: â&#x20AC;˘ Street Sleeper (gold award) in the category Novel and Artistic Products for a waterproof sleeping bags for the homeless made from recycled PVC banners; â&#x20AC;˘ Greenlite Concrete (gold award) for their Jumbo Building Blocks made from recycled expanded polystyrene in the category Products made from Mixed Materials; â&#x20AC;˘ Usabco (gold award) for their Addis 10-litre watering can in the category Products made from a percentage post-consumer recyclate; â&#x20AC;˘ Wreaths International (silver award) for their range of funeral wreaths and baskets made from recycled LDPE PRQRÂżODPHQW

OCT / NOV 2017 19

criteria included life expectancy of the the fact that plastics recycling in South product; sustainability or long-term Africa is under threat. demand and market acceptance of â&#x20AC;&#x153;The past few years have not been product; measures taken to ensure easy for our recyclers. Virgin polymer product consistency and customer prices are very low and operating costs satisfaction despite recycled material have increased as a result of higher fuel content; tonnage or potential tonnage prices, increased energy and labour of plastics that were converted and costs. To add insult to injury, we have WKHUHIRUHGLYHUWHGIURPODQGÂżOOWHFKQLFDO seen traditional markets for recyclate achievements in manufacturing to reach saturation. The public expects overcome recycled material challenges; recyclers to take any plastic product replacement of alternative materials; at no charge and turn it into a perfect originality of design and the care and raw material that will solve the worldâ&#x20AC;&#x2122;s pride with which the product was energy crisis and change litter habits,â&#x20AC;? manufactured. said Johannes. â&#x20AC;&#x153;The Space Base is a true example of 7KLV\HDUÂśVFRPSHWLWLRQKDGÂżYH a new product designed and marketed product categories, namely XVLQJWKHFRVWEHQHÂżWVRIUHF\FOHG â&#x20AC;˘ Products made from 100% postmaterial, while maintaining the productâ&#x20AC;&#x2122;s consumer recyclate; credibilityâ&#x20AC;&#x161;â&#x20AC;? Johannes â&#x20AC;˘ Products containing Technical says, adding that a percentage postthe judges were consumer recyclate; achievements in impressed by the â&#x20AC;˘ Products made from manufacturing to productâ&#x20AC;&#x2122;s consumer mixed materials; overcome recycled acceptance and the â&#x20AC;˘ Novel and Artistic extent to which it products made from material challenges reduces the amount discarded plastic of plastic ending up products; and LQODQGÂżOOV â&#x20AC;˘ )RUWKHÂżUVWWLPHDFDWHJRU\IRU Weighing just 19kgâ&#x20AC;&#x161; the double base concept ideas for new end markets. folds up into a quarter of the space of a traditional bed baseâ&#x20AC;&#x161; making it far easier Entries were received from around to move, store, re-assemble or export South Africa, but eventually the judges to countries such as Australia and the VHOHFWHGSURGXFWVDVÂżQDOLVWVWKDW Dominican Republic, where the market best met their criteria. The judging

GOLD

GOLD Ju

gory ld in the cate ncrete won go rials for its te Greenlite Co Ma d xe Mi e from d EPS Products mad e from recycle g Blocks mad mbo Buildin


News

And the winners are â&#x20AC;Ś

&ORFNZLVHIURPWRS1: 7DQLH(YLWDKDGVRPHLQWHUHVWLQJWKLQJVWRVD\RQ WKHQLJKWLQIDFWVKHKDGWKHDXGLHQFHLQVWLWFKHV+HUHZHVHH3LHWHU'LUN 8\VZLWK$QQDEp3UHWRULXVDQG5XGL-RKDQQHV2: 9HULJUHHQÂśVÂľ6XSD0DPDÂś SURJUDPPHVKDYHHQFRXUDJHGSHRSOHLQWKHFRPPXQLW\QHDUWKH'XUEDQ FRPSDQ\ÂśVSODQWWRLQYROYHWKHPVHOYHVLQUHXVHUHF\FOHSURMHFWVHPSRZHULQJ WKHPVHOYHVZKLOHÂąDWWKHSURPRWLRQHQGRIWKHSURFHVVÂąRQWKHQLJKWZHUH .HUU\DQGKHUPRP6XH:R\FLHK3: 5RJD3ODVWLFVKDVLQWURGXFHG-HPSODV XQGHUWLOHURRIPHPEUDQH-RKQVRQ1DJDVHURIWKH'XUEDQFRPSDQ\ZDV DWWKHVKRZWRWDONDERXWWKHPLFURQIDEULFZKLFKKHVD\VKDVDOLIH H[SHFWDQF\RI\HDUVÂąLIQRWDORWORQJHU4: 3RO\FRDQGSDUWQHUVÂą )UDQFRLVDQG&DWK0DUDLVRI32/<&2ZLWK0DUN6WU\GRPDQG'RXJODV*UHLJ RI7XII\%UDQGVDQG%HUWXVDQG0DUWL%HFNHURI%%3ODVWLFV6ROXWLRQVRI1LJHO UHF\FOHURI3(+'ERWWOHV 0\3ODVZDVZHOOSUHVHQWHGDW(PSHURUVÂśZLWK 6WHIDQ5RX[:DOWHU-RUGDDQDQG-RKDQQ&RQUDGLHWKHUH

SILVER â&#x20AC;˘ ,QÂżQLWH,QGXVWULHV (silver award) for their

â&#x20AC;˘

,QÂżQLWH,QGXVWULHV WRRNVLOYHUIRU LWV&DEOH7UHQFK &RYHUVPDGHIURP UHF\FOHGSODVWLF

â&#x20AC;˘

SILVER

VWLF WVVROLGSOD DZDUGIRUL JRWDVLOYHU RQVXPHU WF RV S 5LGJHGURS   DGHIURPD KHUH GURSSHUVP PHIHQFLQJ HGLQWKHJD XV V D 3( +'

7XII\JRWDVLOYHU DZDUGIRULWVFDUULHU EDJVPDGHIURP UHF\FOHGSODVWLF

SILVER

Bronze

0\:DVWH0RXOGLQJV WRRNEURQ]HIRULWV LQQRYDWLYHZDVWHELQ VHSDUDWRUPDGHIURP WUDGLWLRQDOO\GLIÂżFXOW WRUHF\FOHPDWHULDOV WKDWDVVLVWVHYHU\ KRXVHKROGWR VHSDUDWHDWVRXUFH

â&#x20AC;&#x153;We see more and more materials are becoming available for recycling as collectors and waste pickers recognize recycling as a major income generator. +RZHYHUIRUWKHÂżUVWWLPHLQWKHIRXU decades of successful recycling in South Africa, we are experiencing a bottleneck on the demand side. The Best Recycled Product of the Year Awards plays an important role in educating and encouraging brand owners and product designer to include recycled content in everyday plastics products and components in order to generate ongoing demand for recyclate and to reduce the pressure on non-renewable resources,â&#x20AC;? said Johannes. â&#x20AC;&#x153;It was hugely encouraging to see how plastics recyclers, convertors, product designers and innovators managed to come up with new and innovative solutions that use postconsumer, recycled plastic to provide a solution to everyday problems and we look forward to seeing even more entries in our next competition in 2019,â&#x20AC;? he concluded. â&#x20AC;˘ For more information, visit the SAPRO website on www.plasticrecyclingsa.co.za 20 OCT / NOV 2017

FCB CAPE TOWN 10014153CT/E

â&#x20AC;˘

LWVUDQJHRI JRWVLOYHUIRU P :UHDWKV,QWÂśO HWVPDGHIUR VN ED G DQ KV IXQHUDOZUHDW PHQW OD Âż R RQ P UHF\FOHG/'3(

Cable Trench Covers made from recycled plastic; 5LGJHGURS (silver award) for their solid Plastic Droppers made from a 100% post-consumer HDPE recyclate blend for game-fencing; 7XII\for their Refuse Bags (bronze award) which ensures that more than 4800 tons of recycled milk bottles, carrier EDJVDQGSULQWHGÂżOPVDUHNHSWIURP ODQGÂżOOHYHU\\HDUDQGIRUWKHLU&KHFNHUV carrier bags (silver award) made from 100 % recycled plastic; 0\:DVWH0RXOGLQJV (bronze award) for their innovative waste bin separator PDGHIURPWUDGLWLRQDOO\GLIÂżFXOWWRUHF\FOH materials that assists every household to separate at source.


1

2

3

4

5

Walter Jordaan of MyPlas chatted to Pauline Muvirimi and Patrick Rutaha of Safrique; the latter is one of the main export agencies for manufacturers of recycled materials wishing to sell outside of the country All the winners â&#x20AC;&#x201C; The winners of all the categories on stage prior to the countdown for the overall prize

FCB CAPE TOWN 10014153CT/E

OCT / NOV 2017 21

PROFESSIONAL PROFICIENT PROACTIVE PROGRESSIVE PROCESS OILS

Engen is a member of the PETRONAS Group

At Engen, we have reaffirmed our commitment to the Process Oils market. We supply high quality virgin Group I and II base oils and Naphthenic grades under the Parprol brand. These are available in a variety of packs, including true bulk and mini bulk. Our dynamic, new management team is ready to take your business into the future with a strong focus on supply assurance, and a reliable network that takes advantage of our distribution centres in all major cities and a number of outlying areas. We supply a wide range of industries, including: Adhesives, Pesticides, Cable Compounds, Ink Oils, Plasticisers, Rope Dressing, Rubber, Textiles, Coatings, Paints, Sealants, Detergents and Wood Oils. To find out more on how we can take your business forward, contact us at Engen.ProcessOils@engenoil.com


News

JUST BRIEFLY

Trucks go missing en route to Zambia, info sought TWO trucks carrying over 60 tons of LD and LLDPE from international manufacturers went missing en route to Zambia in mid-September. Both vehicles had Gauteng registrations. Besides the actual trucks and trailers, the value of the loads is considerable, estimated at R1,3-million. Haulers have long had to deal with the problem of disappearing trucks, but measures have for some time been in place to make it virtually impossible for nefarious individuals to engage in this activity, but seemingly not in this case. MBT, the South African supplier, has appealed to anyone with info to assist. The missing material includes 33mt SABIC LLDPE 118WJ; 7.5mt SABIC LLDPE 118WJ and 25.5mt of Muntajat LDPE FE3000. All the goods were in producer marked 25kg bags.

â&#x20AC;&#x2DC;Ransomwareâ&#x20AC;&#x2122; causes further problems THE crisis created by the â&#x20AC;&#x2DC;Ransomwareâ&#x20AC;&#x2122; internet hackers who hit international shipping line Maerskâ&#x20AC;&#x2122;s systems earlier this year were seemingly resolved by some undisclosed compromise between the Danish business and the shadowy cyberspace operators, but other problems KDYHVLQFHUHVXOWHGVSHFLÂżFDOO\ that the shipping line was in many cases unaware where cargos were left. We hear that numerous containers have still not reached their destined delivery points, and in some cases have been left abandoned at shipping yards in unexpected places. This may seem of passing relevance, since polymer materials should remain safely in containers for extended periods, but itâ&#x20AC;&#x2122;s no laughing matter for convertors who purchased the materials or the supply companies responsible. This has become a costly exercise for the agents, who in several cases had to emergency freight material to their customers.

RotoFlo group restructures Roto powder manufacturer improves material supply service ACD RotoFlo, the Roto Powder Compounder, has restructured operations LQRUGHUWRLPSURYHHIÂżFLHQFLHVDQG streamline service to customers around southern Africa. The restructuring process involves the establishment of a holding company, RotoFlo Holdings, with a B-BBEE level 4 rating, which will in turn house the groupâ&#x20AC;&#x2122;s main manufacturing operation, ACD RotoFlo, and the new company RotoFlo Marketing, which is being structured to meet with current B-BBEE compliancy plus their Property/ Investment activities. A number of internal promotions commensurate with the new strategy have been made too, including those of Michael BĂśltau, appointed Managing Director of RotoFlo Group; Andrew Robertson, appointed Operations and Purchasing Manager of RotoFlo Group; and Brian Robertson as General Manager of RotoFlo Group. Group founder Clive Robertson is to

play an â&#x20AC;&#x2DC;oversight roleâ&#x20AC;&#x2122; as group CEO with the management team taking care of the day-to-day operations of the companies. â&#x20AC;&#x153;We believe that the restructuring will strengthen the activities of the group and prepare us well into the future,â&#x20AC;? said Clive. To summarise, RotoFlo Holdings deals with property; investments and speciality trading. It is the holding business of:ACD RotoFlo ACD RotoFlo in Kya Sand, Johannesburg, continues as the main manufacturing facility with a roto powder capacity of RYHUPWPRQWKFRPSULVLQJRIÂżYH complete compounding and pulverising lines plus additional pulverising capacity IRUQDWXUDOSRZGHUV$&'5RWRĂ&#x20AC;R employs just over 60 personnel and operates 24/7, producing over 30 different standard colours. Roto Powders are supplied throughout SA and exported to all bordering countries up to Congo. The company has

RotoFlo CEO Clive Robertson with the groupâ&#x20AC;&#x2122;s new management team, all of which are internal promotions, Michael BĂśltau, new MD; Andrew Robertson, new ops/purchasing manager; and Brian Robertson, new GM

22 OCT / NOV 2017

RotoF


RotoFlo group has also been sponsoring community activities to enhance the lives and skills of young people and employees

had a rapid growth path over the past ¿YHSOXV\HDUVZLWKDGGLWLRQDOFDSDFLW\ DGGHGHYHU\\HDULQRUGHUWRPHHWPDUNHW GHPDQGDQGRUJDQLFJURZWKWRUHDFK FXUUHQWFDSDFLW\ ³)XUWKHUFDSDFLW\DGGLWLRQZLOOEHDGGHG ZKHQUHTXLUHGLQRUGHUWRNHHSXSZLWK PDUNHWJURZWKDQGWKHZHOOUHVSHFWHG µ5RWR)ORVHUYLFHOHYHO¶´VDLG&OLYH RotoFlo Marketing 5RWR)OR0DUNHWLQJKDVEHHQHVWDEOLVKHG LQDQHZIDFLOLW\DVKRUWGLVWDQFHIURPWKH PDLQSODQWLQ.\D6DQG,WKRXVHVWKH QHZO\LQVWDOOHGFDSDFLW\FRPPLVVLRQHG PLG\HDUDQGJLYHVWKHJURXSDGGLWLRQDO VWRUDJHFDSDFLW\RI¿FHVSDFHDQG ZLOOLQWKHIXWXUHKRXVHDQH[SDQGHG GHYHORSPHQWODERUDWRU\FRPSULVLQJ RIWKHH[LVWLQJµ5RWR5RFNHW¶. .3DTSRUWDEOHWHPSHUDWXUHPRQLWRULQJ

DSSDUDWXVDQGLQWKHQHDUIXWXUHWKH XQLTXH...UHDWRU5RWR0RXOGLQJ PDFKLQHWKDWZLOODOORZIRUPDQ\QHZ GHYHORSPHQWVWREHWHVWHGDQGKRSHIXOO\ ¿QDOLVHG Community development 2WKHUDFWLYLWLHVZKLFKWKHJURXSKDVEHHQ LQYROYHGLQRYHUWKHSDVW\HDULQFOXGH 5RWR)OR¶VSDUWLFLSDWLRQLQVXSSRUWRIWKH .Q\VQDFRPPXQLW\DIWHUWKHUHFHQW¿UHV 7KHJURXSVSRQVRUHGPDWHULDOXVHGIRU WKHSURGXFWLRQRIRYHU'X\VZDWHU WDQNVZKLFKZHUHGRQDWHGWRWKHUDYDJHG .Q\VQDGLVWULFWZKHUH&OLYH5REHUWVRQ JUHZXS 7KHJURXSKDVDOVRVSRQVRUHGWKH 5RWR)OR(TXHVWULDQ7HDPZKLFKWRGD\ LQYROYHVKRUVHVDQGVL[ULGHUVIURP WR\HDUVRIDJH7KHSURFHVV LQYROYHVDVVLVWLQJVHOHFWHGVWDEOHVZLWK

5RWR0RXOGHGSURGXFWVWKDWLPSURYHWKH IDFLOLWLHVDQGHQKDQFHWKHFRQGLWLRQRIWKH KRUVHVDQGWKHVSRUW 2SHUDWRUDVVLVWDQFHKDVLQYROYHGWKH VXSSO\RIDVXLWDEOHZDWHUKDUYHVWLQJ WDQNVWRWKHKRPHVRIDOORIWKHZRUNHUV HPSOR\HG ³%HVLGHVWKDWZHHTXLSSHGRXUIDFWRU\ ZLWKRYHUOLWUHVRIUDLQZDWHU VWRUDJHXVHGIRUFRROLQJZDWHULQWKH IDFWRU\DQGEDFNXSVXSSO\GXULQJ IUHTXHQWZDWHURXWDJHV3OXVZHKDYH VWDQGE\SRZHUJHQHUDWLRQFDSDFLW\WKDW FDQUXQRXUIDFWRU\GXULQJIUHTXHQWSRZHU RXWDJHV´VDLG&OLYH ³7KH5RWR)OR*URXSLVFRPPLWWHG WRFHUWDLQFRPPXQLW\GHYHORSPHQW SURMHFWVDQGVSRUWLQJDFWLYLWLHVWKDW HQKDQFHWKHOLYHVDQGVNLOOVRIRXU\RXWK DQGHPSOR\HHVWKURXJKRXULQKRXVH FDSDELOLWLHV´KHDGGHG OCT / NOV 2017 23

        

RotoFloYourHoldings Supplier of Choice Members of:

Largest Supplier of Colour Compounded LLDPE in Sub Saharan Africa Colour Compounding of Rotomoulding Speciality Polymers Pulverising of Rotomoulding and Speciality Powders Agents for PSD Rotoworx PP, LaPlastecnica Vents and MIGS® &RQWDFW   

&OLYH5REHUWVRQ 0LFKDHO%|OWDX $QGUHZ5REHUWVRQ &KDQGD0XNXND

Website: Address:

ZZZURWRÃ&#x20AC;RFR]D 28 Hilston Road Kya Sands Randburg, Johannesburg South Africa

RotoFlo Holdings advert-10'17.indd 78

FOLYH#URWRÃ&#x20AC;RFR]D WHFK#URWRÃ&#x20AC;RFR]D DQGUHZ#URWRÃ&#x20AC;RFR]D VDOHV#URWRÃ&#x20AC;RFR]D

    7HO

+27 11 708 1919 (Fax)

Agents for:

Mold In Graphic Systems® www.moldingraphics.com

LaPlastecnica

2017/09/19 11:02


News

PIPES X1:

conference sets bar high for local plastic pipe industry 300 delegates, two days, world-class presentations SAPPMAâ&#x20AC;&#x2122;S Pipes XI conference at Emperors Palace in September has set the bar high for the future of South Africaâ&#x20AC;&#x2122;s water infrastructure and engineering professionals. More than 300 delegates from around South Africa, southern Africa and the world were treated to two days of in-depth and world-class presentations delivered by 35 speakers â&#x20AC;&#x201C; including 18 international and 17 local experts â&#x20AC;&#x201C; on issues relating to plastic piping, water infrastructure and engineering courtesy of the international Plastic Pipe Conference Association (PPCA), which sponsored the best speakers at the Pipes XVIII conference in Berlin last year, to present in South Africa in a spin-off conference. According to the PPCAâ&#x20AC;&#x2122;s Zoran Davidovski, the global conference has had six

spin-off conferences around the world since WKHÂżUVWRQHZDVKRVWHGLQ%HLMLQJLQ â&#x20AC;&#x153;Just as connections are vital in the pipe industry, so too are the connections made between people and professionals in this ÂżHOGDQGIRUWKLVUHDVRQZHDUHSOHDVHG to see the South African industry so well represented as this yearâ&#x20AC;&#x2122;s conference,â&#x20AC;? said Davidovski, stressing the importance of attending and hosting international conferences. â&#x20AC;&#x153;Survival needs invention, and the best way to be inspired and to learn is by allowing yourself to be educated and your mind stretched by learning from your local and international peersâ&#x20AC;?. Highlights of the conference included a keynote address by guest speaker and well-known economist Dr Roelof Botha, who looked into his proverbial crystal ball

to predict whether or not the state capture issue will force the South African economy into a recession. Botha offered a closer look at the socio-political landscape of the country and how this would impact the local economy and the plastic pipe industry VSHFLÂżFDOO\ â&#x20AC;&#x153;The next 18 months will be turbulent, but this doesnâ&#x20AC;&#x2122;t mean there wonâ&#x20AC;&#x2122;t be oppor-

Roshinin Govender has recently joined Safripol, based in Durban. Safripol sales/ marketing manager Mark Berry welcomed her to the pipe scene

Terence Hobson of Sun Ace South Africa gave a presentation about â&#x20AC;&#x2DC;Africa challengesâ&#x20AC;&#x2122; and there is no doubt that ERWKWKHQHHGIRUDQGGLIÂżFXOWLHVRI trading in Africa are huge

24 OCTOBER / NOVEMBER 2017

SABIC exhibit â&#x20AC;&#x201C; Hans Pierik of SABIC in Holland, who is also current chairman of the PE100+ association, was on the SABIC stand during the intervals, along with Waseem Abdulla of SABIC SA. Hans also gave a presentation update of the PE100+â&#x20AC;&#x2122;s group activities


What is new in PVC-O? â&#x20AC;&#x201C; Molecor of Spain is introducing a range of PVC-O pipe EHQGVDQGÂżWWLQJVZKHUHLWV technology to overcome the inherent problems with PVC for pipe applications is yielding results. Ignacio Munoz of Spain-based Molecor, which is involved in a JV with Sizabantu in South Africa, outlined the ecoFITTOMÂŽ project, which includes 45° bends

Dr Roelof Botha, the economist, provided an entertaining analysis of the South African socio-economic situation, which gave rise to some optimism. No doom and gloom from the man, who highlighted several good signs in our economy while being unsparing in his comments about the SA government. He hastened to point out that he is self-employed

Other speakers who presented, to name but a few, included Tony Radoszewski (PPI in the USA) on â&#x20AC;&#x2DC;Manufacturing and Infrastructure in the Age of Trump,â&#x20AC;&#x2122; Bruce Hollands (PVC Pipe Association in the USA) on â&#x20AC;&#x2DC;Life cycle assessment of PVC water and sewer pipe and a comparative sustainability analysis of pipe materials,â&#x20AC;&#x2122; and Dr Andreas Frank (Polymer Competence

SAPPMA chief executive Jan Venter welcomed Zoran Davidovski, chairman of the Plastic Pipe Conference Association. According to the PPCA man, one of the problems for pipe manufacturers in all countries is that specifying personnel often donâ&#x20AC;&#x2122;t know much about the capabilities of plastic pipe, and hence select traditional materials. This is clearly a problem in Africa too â&#x20AC;&#x201C; so the onus is on us to better present WKHEHQHÂżWVRISODVWLFSLSHSHUIRUPDQFH

Maco â&#x20AC;&#x201C; Joachim Kahl and Trevor Hutcheon of Macotech showed some of their companyâ&#x20AC;&#x2122;s measuring and monitoring systems

Emeraude team grows â&#x20AC;&#x201C; Lance van der Merwe (right) has recently signed up at Emeraude International, where he joins the team led by Trevor Moroney. (PHUDXGHZLWKLWVKHDGRIÂżFHLQ3DULVDQGORFDORIÂżFH at Fourways, is a global commodities and logistics supply operation for chemicals and polymers which is well represented in Africa

In a presentation titled â&#x20AC;&#x2DC;Main Drivers and Barriers for Plastic Pipe in Europe,â&#x20AC;&#x2122; Zoran Davidovski of the PPCA produced some surprising info, including the fact that there are varying degrees of resistance to plastic pipe in the various countries, as there is probably to other materials too. For instance, in Germany, one of the biggest markets in Europe, extensive use of concrete is still made and plastic is in many cases not the preferred choice

OCT / NOV 2017 25

tunities for growth. What we are currently experiencing in our country is a deepening of a democracy. It is important for us to invest in skills transfer, public-private partnerships and to restore the functionality of our leadership. With effective leadership, smart policies and team work, there can still be a bright future for South Africa,â&#x20AC;? Botha encouraged.


News Pipe failures are obviously the least welcome topic in the sector but thereâ&#x20AC;&#x2122;s no avoiding it and Renier Snyman of DPI has compiled quite an extensive dossier on the subject, with the above photo being one of the least stressful. According to Renier, approximately 80% of complaints are invalid, and handling/transport and installation are the main causes

Centre in Austria) on â&#x20AC;&#x2DC;Lifetime prediction of PE100 pipes based on slow crack growth resistanceâ&#x20AC;&#x2122;. When asked what they thought of this yearâ&#x20AC;&#x2122;s Pipes XI conference and whether RUQRWLWKDGEHQH¿WWHGWKHPWRDWWHQGWKH delegates were very outspoken and full of praise for the level of expertise of the presenters. â&#x20AC;&#x153;This was a high quality conference ZLWKH[FHOOHQWQHWZRUNLQJRSSRUWXQLWLHV´ VDLG&KDUO)RXULHWHFKQLFDOPDQDJHUDW Chemsystems. â&#x20AC;&#x153;It was a great platform for learning and interacting with my South African and LQWHUQDWLRQDOSHHUV,ZDVYHU\LPSUHVVHG´ VDLG1HR0HNJRHPDUNHWLQJDVVLVWDQWDW Safripol. ³,ZLOOGH¿QLWHO\DWWHQG6$330$¶V3LSHV conferences in future. I highly recommend it to anyone! I really enjoyed the last WZRGD\VDQGOHDUQHGDORW´VDLG:HUQHU YDQ+X\VWHHQVDOHVPDQDJHUDW$OSUHQH Plastic Products. â&#x20AC;&#x153;It was amazing to have these world leaders who are considered to be gurus in WKH¿HOGRQ6RXWK$IULFDQWXUIDQGSUHVHQW ing to us. Attending their presentations at international conferences is almost an HFRQRPLFLPSRVVLELOLW\IRU6RXWK$IULFDQV but having these calibre of speakers here and at such an affordable rate was an opportunity that nobody should have PLVVHG´VDLG*HRUJH'LOOL\DQQLVWHFKQLFDO support engineer at Safripol. SAPPMA CEO Jan Venter said the conference once again highlighted the importance of pipes and pipelines in www.sappma.co.za

civilization and infrastructure: â&#x20AC;&#x153;Water GLVWULEXWLRQZDVWHGLVSRVDOLUULJDWLRQDQG telecommunications all rely on pipelines to function. An extensive network of reliable water and sewage pipelines are essential for establishment and growth of civilization. ³$OWKRXJKZH¿QGRXUVHOYHVRSHUDW ing in a tough business climate and the economic recovery has not been what we KRSHGLWZRXOGEHWKHLPSRUWDQFHRIZKDW we are do remains undiminished. We WDNHDORQJWHUPYLHZRQWKHVHWKLQJVDQG ZLOOFRQWLQXHWR¿JKWIRUPDLQWDLQLQJWKH standards and integrity of the plastic pipes EHLQJPDQXIDFWXUHGDQGLQVWDOOHGORFDOO\´ Venter said. 'DYLGRYVNLFRQFOXGHGWKHFRQIHUHQFH by saying that it is clear that South Africa faces many challenges and resistance to FKDQJH+RZHYHULWLVHQFRXUDJLQJWRVHH WKDWGHVSLWHWKLVWKHWHFKQRORJ\HPSOR\HG in the manufacturing of plastic pipes is increasing both the quality and the quantity of drinking water to the country and its people. â&#x20AC;&#x153;Many of the presentations delivered centred around sustainability and invention. It is important to remember that these are never cast in concrete. We look forward to seeing what will come out of SAPPMAâ&#x20AC;&#x2122;s Pipes XII conference QH[W\HDUDQGZLOOFRQWLQXHWRNHHSD watchful and expectant eye on the South African plastic pipe industry which has SURYHGLWVHOIWREHWHQDFLRXVFRPPLWWHGWR excellence and passionate about raising VWDQGDUGV´'DYLGRYVNLDGGHG

Mike Smart of Genesis Consulting, now wearing a new Krah cap, gave a presentation about the German companyâ&#x20AC;&#x2122;s structured wall pipes, VSHFL¿FDOO\DERXWWKHMRLQLQJ methods. Various technologies are used, including electrofusion welding

www.pipesxiconference.co.za

Turkey-Cyprus pipeline â&#x20AC;&#x201C; One of the presentations, by Dragisa Dubocanin of Reinert Ritz of Germany, looked at what has been one of the most unusual projects of late, the construction of DÃ&#x20AC;RDWLQJSLSHOLQHWRVXSSO\ water from Turkey to Cyprus, which was in a crisis due to ground water having been excessively exploited by drilling. The project involved PP+'SLSHÃ&#x20AC;RDWLQJ between 250-280m below the surface with 500m between anchor points â&#x20AC;&#x201C; in itself a challenge as the seaâ&#x20AC;&#x2122;s maximum depth was 1430m 26 OCTOBER / NOVEMBER 2017


erda.co.za Sun Ace June-July Ad FAp RV1.indd 1

2017/09/15 10:11 AM


CM

MY

CY

MY

News

Ilija Radeljic of Pipelife of Norway gave a presentation about the challenges of developing large-diameter PE pipes for marine applications. Much has been learned in this area, with one of the trickiest problems being that of laying the pipes, where kinks can become major setbacks

The use of recycled material in high pressure water conveyance was seen as a complete no no, but not so in non-pressure applications. Michael Pluimer of Crossroads Engineering Services of the USA ran a test in which corrugated pipe manufactured from recycled material was used in a railroad culvert, and came up with positive results (above) There are an estimated 240,000 pipe bursts in the USA annually, according to Tony Radoszewski of the Texasbased Plastic Pipe Institute, quite a VWDJJHULQJ¿JXUH,QDSUHVHQWDWLRQ titled ‘Manufacturing in the Trump Age,’ Radoszewski pointed out that FRQ¿GHQFHDPRQJWKHFRXQWU\¶V manufacturers was high and the majority of businesses appeared to be happy with the country’s new president, and that his infrastructure development proposals were very welcome (left)

28 OCTOBER / NOVEMBER 2017


Dela Plast moves into food packaging sector ZLWK)66&FHUWLĂ&#x20AC;FDWLRQ Uses skills built up during years of precision injection moulding 5-ton crane was installed to load and unload moulds. A proper material feed V\VWHPZDVLPSOHPHQWHGZLWKPL[LQJ units removed from the injection moulding machines. Last year Dela Plast appointed Cornelia Kerkhoff as QA/food safety manager. Since then sanitation and pest control systems have been implemented and the necessary hygiene, facility and other prerequisite programs followed. The HACCP (Hazard Analysis Critical Control Point) system was introduced to prevent risks. Dela Plast aims to continually improve its systems and procedures to work towards a risk-free environment to ensure safe and high-quality food contact packaging products by being FSSC (Food Safety System &HUWLÂżFDWLRQ DQG,62FHUWLÂżHG Âł7KHÂżUVWDXGLWZDVRQ$XJXVW where the focus was on the documenta-

I.P.P Inkulu Plastic Pipes

WLRQV\VWHP7KHVHFRQGDQGÂżQDODXGLW is scheduled for October this year and ZHDUHFRQÂżGHQWWKDWZHZLOODFKLHYHWKH FHUWLÂżFDWLRQ´VDLG3RXZHOV At the moment Dela Plast produces food packaging products for a leading Italian chocolate manufacturer besides a number of other products. The aim is however to increase the food packaging sector with the FSSC accreditation. â&#x20AC;&#x153;We believe this sector of manufacturing will grow due to the increasing demand from clients to have safe packaging material for the products they purchase for the safety of the end consumer,â&#x20AC;? added Harry.

www.delaplast.co.za

(Pty) Ltd

Quality Pipe Manufacturers of HDPE pipe Think big, â&#x20AC;&#x153;Inkuluâ&#x20AC;? is Gabriel Reddyâ&#x20AC;&#x2122;s motto, who started the new pipe manufacturing business Inkulu Plastic 3LSHVLQ+DPPDUVGDOH.=1$QGVHOOLQJLWPLQG\RX7KHÂżUVWSLSHVSURGXFHGDWKLVQHZFRPSDQ\ZHQW GLUHFWO\IURPPDFKLQHWRWKHEDFNRIWKHGHOLYHU\WUXFNÂąZLWKRXWHYHQWRXFKLQJWKHIDFWRU\Ă&#x20AC;RRU Inkulu Plastic Pipes leased a 3440m2 factory in Hammarsdale. Inkulu Plastic Pipes has not looked back since, and the machines DUHQRZUXQQLQJ7KHFRPSDQ\KDVDOVRDFTXLUHG6$%6FHUWLÂżFDWLRQ*DEULHOÂśVWKLUGPDFKLQHDUULYHGLQ$XJXVW*DEULHO believes in always making a plan and satisfying his clients and keeping them happy. His success is due to the support and the good wishes of his very loyal customers and suppliers. Products include: HDPE (High Density Polyethylene) Pipes, LDPE (Low Density Polyethylene) Pipes, PP (Polypropylene) Pipes and Fabricated Fittings

Contact us: Unit 6B Coveway Industrial Park, Hammersdale, 3700 | Tel: 031 736 1055/56 | Fax: 031 736 1054 Gabriel: 084 446 6384 | Nikieta: 083 229 7161 | Email: gabriel@inkuluplastics.co.za | www.inkuluplastics.co.za

OCT / NOV 2017 29

DELA PLAST, which took a major leap when it acquired far larger premises in early 2015, is consolidating operations by gaining ISO and other food grade compatibility accreditation. The Pretoria injection moulding company, run by Harry Pouwels and Arend de Lange, moved to the 3000m² premises in Koedoespoort where the production room of 1300m² (previously used for cleanroom production of wafer/semiconductor components) was suited to Dela Plastâ&#x20AC;&#x2122;s production of seed trays, storage solution systems and contract moulding as well as, now, food packaging containers and components. 'XHWRLWVGXVWSURRÂżQJDQGIXOO\LVRODWHG walls, Dela Plast wanted to make the best use of the properties of this buildLQJ7KHĂ&#x20AC;RRUZDVXSJUDGHGWRDQHSR[\ ÂżQLVKIRUK\JLHQLFSXUSRVHV$QRYHUKHDG

Dela Plastâ&#x20AC;&#x2122;s new QA/food safety manager Cornelia Kerkhoff is closely involved in all aspects of production at the Koedoespoort plant


News

15km HDPE water pipeline for Mozambican graphite mine Plasti-Tech Piping Systems supplies Hürner ECO CNC butt-weld machines Multiple projects at Balama in Mozambique are underway to leverage the largest graphite resource ever. One such project is the recent construction of a new graphite mine, which involves the installation and commission of a 15-kilometrelong 315mm HDPE pipeline for the supply of water. The project required a reliable water supply pipeline, for which Plasti-Tech Piping Systems, provider of world-class thermoplastic piping systems, was commissioned. The main stakeholders in the mine project are IEPS, Tayanna Mozambique and Australian industrial minerals and technology company, Syrah Resources, “The water supply pipeline project had a very strict deadline for completion, which I am pleased to say, was met by using the two Hürner ECO CNC (Computer Numerically Controlled) 2.0 355mm butt-weld machines day and night until completion,” said Bradley Chamont, Plasti-Tech managing member. “We had four teams of eight people each, including four butt-welders and four assistant welders working around the clock to complete our work on the project and have them and our top-quality equipment to thank for another job well done,” he added. The water supply pipeline project had a very strict deadline for completion, it was met by using the two Hürner ECO CNC (Computer Numerically Controlled) 2.0 355 mm butt-weld machines

Plasti-Tech have been involved with the sale of GermanPDGH+UQHUZHOGLQJHTXLSPHQWIRU¿YH\HDUVDQGZHUH appointed to this project based on their offering of the unique Hürner CNC model butt-weld machine at a competitive price.

The Hürner way The Hürner CNC ECO 2.0 is a next-generation plastic butt-welder that is both durable and manufactured in strict compliance with international standards. “The CNC ECO 2.0 comes in 12 basic machine chassis models, which can join pipes as wide as O.D. 1600mm in diameter. The unit is easy to transport and comes with a fully encased CNC hydraulic and control box of ingress protection (IP) of 54, handling pressures of up to 220 bar. The heating element of the CNC ECO 2.0 is covered with an anti-stick coating and, along with the facing tool, is connected to the chassis of the unit on the hydraulic and control box. During the welding process, the heating element temperature and pressure control are implemented in line with applicable standards; all parameters for a good quality, reproducible joint are carefully monitored throughout the welding process and the related information is saved to the unit’s memory, which handles up to 10 000 reports. The Hürner CNC ECO 2.0 also represents innovation LQXVHULGHQWL¿FDWLRQ and access control in butt-welding technology. “Data is made available to the hydraulic and control box by the error-proof and userfriendly RFID (radio IUHTXHQF\LGHQWL¿FDWLRQ  technology, which PlastiTech had four teams of eight people each makes it so unique,” including four butt-welders and four assistant Chamont explained. welders working around the clock to complete Hürner’s CNC ECO + work on the Mozambique project. The Hürner 2.0 model also features CNC ECO 2.0 is a next-generation plastic buttwelder that is both durable and manufactured in the HDC, or Hürner strict compliance with international standard Distance Control, which is a sensing system for DFFXUDWHYHUL¿FDWLRQRISURSHUZHOGLQJDQGZHOGLQJSURFHVV preparation. “As a company whose expertise and experience lie in bringing high-end thermoplastic piping system technologies to southern and sub-Saharan Africa with after-sales support to match, Plasti-Tech Piping systems was well positioned to serve this project best,” Chamont said. Construction of the new mine commenced in June 2017 with operations set to commence by September. www.plastitech.co.za 30

NEWS-PLASTI-TECH.indd 30

OCT / NOV 2017

2017/09/27 10:17


Plasti-Tech_Advertisement(High-Res).pdf

1

2016/09/02

10:40 AM

Importers and Distributors of HDPE piping systems of International quality and standards

Hurner Butt Welding Machines, Tools & Equipment

Banninger PE100 Moulded Spigot Fittings 20 - 500mm

C

M

Y

CM

MY

CY

CMY

Nupigeco Elopress Compression Fittings and Saddles 16 - 110mm

Hurner Electrofusion Welding Machines, Tools & Equipment

K

PE100 HDPE Piping SABS approved SAPPMA approved 20 - 1 000mm

Nupigeco Elofit Electrofusion Fittings 20 - 900mm

Plasti-Tech provides world class Thermoplastic piping systems and related products to the Building, Civil, Mining, Irrigation, Plumbing, Gas and Water-works industries of Southern and Sub-Saharan Africa. We specialise in HDPE (High Density Polyethylene) PE100, EF (Electrofusion), Compression fittings and welding products, but always focus on providing a comprehensive solution for all related pipe products.

For more information: www.plastitech.co.za

Ensuring quality of an international standard, we are the distributors of European-manufactured products for Hürner, Bänninger, Nupi and HSK.We understand our customer’s needs and seek to provide a one-stop solution for all piping products. The combination of our knowledge, skills and passion, coupled with the guarantee of quality products, has made Plasti-Tech a preferred supplier in the market.

+27 (011) 609 5511

brad@plasti.co.za


News

SOUND a â&#x20AC;&#x2DC;no-brainerâ&#x20AC;&#x2122;

for Charles Rust! Electricity saving of over 50%, minimal down time, faster cycle times CHARLES Rust Associates is reaping WKHEHQHÂżWVRIDGHFLVLRQWRUHSODFH their older injection moulding machines with Sound servo energy saving machines. CRA, which has been in operation for over 20 years, commissioned LWVÂżUVW6RXQGLQMHFWLRQPRXOGLQJ PDFKLQHVÂżYH\HDUVDJR:LWK generally escalating operational costs, it was a â&#x20AC;&#x2DC;no-brainerâ&#x20AC;&#x2122; to replace all the older machines with these servo operated machines, said Charles Rust. 7KHPDFKLQHVDUHLQYDOXDEOHEHQHÂżWV he added. â&#x20AC;&#x153;With an electricity saving of over 50%, minimal downtime, maintaining of setting parameters, faster cycle times DVZHOODVLQFUHDVHGHIÂżFLHQF\DQG quality of product, the Sound machines DUHKDUGWREHDW´KHH[SODLQHG Situated in Bredell, Kempton Park, Charles Rust Associates manufactures a wide range of security seals on 22 000m² premises. Apart from injection moulding, other seal manufacturing facilities include machining of steel components, insert moulding, assembly using advanced methodology and hot foil printing and stamping.

Charles Rust and Bob Austen with the Sound servo energy-saving injection moulding machines

The Sound machines are specâ&#x20AC;&#x2122;d for South Africa and use international brand main components for ease of maintenance. Sound machinery is part of the Shintec Group Corporation of Hangzhou, China, which has

manufactured injection moulding machines for over 60 years and is a PDMRUH[SRUWHUWRPDUNHWVDURXQGWKH world. www.soundsouthafrica.co.za www.shintec.cn

Pedal Pickers Vision to create 20 000 jobs by 2020 in waste management, recycling A NEW recycling initiative to assist with job creation and ZDVWHUHGXFWLRQ3HGDO3LFNHUVDQRQSURÂżWRUJDQLVDWLRQ â&#x20AC;&#x201C; has been launched to create micro-entrepreneurs in communities by providing waste pickers with the necessary skills and equipment to start their own small businesses. â&#x20AC;&#x153;By empowering waste pickers we stimulate the local HFRQRP\DQGODUJHO\UHGXFHZDVWHWRODQGÂżOO´H[SODLQHG Jana Dyason from the NPO. â&#x20AC;&#x153;To further assist with creating sustainable solutions ZHKDYHLGHQWLÂżHGRWKHUUHF\FOLQJRSSRUWXQLWLHVZLWKLQ the organic waste sector to help increase revenue for our pickers. One of them being the recycling of used coffee grounds. We have asked local coffee shops to allow us to place a bin in their coffee shop where they can store their XVHGFRIIHHJURXQGV´VKHDGGHG 32

OCT / NOV 2017

NEWS-CHARLES RUST.indd 32

The pedal pickers collect the used coffee grounds regularly and sell them to Pedal Pickers where it is turned into organic compost that is packaged and sold for further revenue. Based in Paarl, Pedal Pickers decided to launch the pilot project locally to make it easier to manage any teething problems that might occur. Thereafter they will move further into the Winelands, Cape Town and eventually nationwide. The organisation is now looking for sponsors who, in return for funding, will receive lifetime advertising on one of the Pedal Pickers trailers. Sponsorship recognition will also be offered on the organisationâ&#x20AC;&#x2122;s website, social media pages and printed marketing material. Contact Jana Dyason at +27 (0)63 588 7607

www.pedalpickers.org

2017/09/27 10:19


SE Series Servo Energy Saving Injection Moulding Machines Main components of Servo machines purposely spec’d for South Africa • PLC • Servo motor • Servo pump

Techmation (Taiwan) Phase (JV of Italy) Eckerle (Germany)

• Servo drive • Transducer • Hydraulic valves

• High performance closed loop servo control system • Shortens cycle times and increases production

Rexroth (Germany) Vashy (France) Rexroth ( Germany)

• Low power consumption saving 40-60% • Low noise

Auxiliary equipment ex stock: • • • • •

Hopper dryers Robots Hopper magnets Chillers Granulators

• • • • •

Mould clamps Auto loaders Colour dosers Glass tube water flow regulators Mould temperature controllers

Assorted heater bands, thermocouples, proximity switches, limit switches, bypass oil filters etc.

Contact: Gauteng Charles Rust 083 227 2593 011 396 1452 Durban - Peter Wessel 084 803 9260 031 702 3997/8

Sound represented in Southern Africa by: Bob Austen 083 679 1159 011 396 1452

Charles Rust Associates 20 Fifth Avenue, Bredell, Kempton Park P O Box 2380 Kempton Park 1620 Tel: 011 396 1452 Email: info@soundsouthafrica.co.za chasrust@acenet.co.za Website: www.soundsouthafrica.co.za


News

Pet project: AKWA Products excels with

3+2726/2:5,(6+$53

â&#x20AC;&#x2DC;Master machines help convertor keep up production pace WHAT began as a hobby due to a love of animals has resulted in a successful injection moulding venture for Cornelius Muller of Benoni-based AKWA Products. &RUQHOLXV¿UVWRSHQHGDSHWVKRSDQGWKHQDVHFRQGEXWD VHULRXVPRWRUDFFLGHQWLQSODFHGWKHYHQWXUHLQMHRSDUG\ DQGGXULQJDOHQJWK\UHFRYHU\WKHPDQVXUYLYHGE\PDQXIDFWXULQJ YDULRXVOLJKWLQJFRPSRQHQWVIRUKRPHDTXDULXPHQWKXVLDVWV'XULQJ WKDWFKDOOHQJLQJSHULRGRSHUDWLQJIURPDPðµ]R]R¶KXWLQKLV SDUHQWV¶EDFN\DUGZLWKMXVWDVLQJOHHPSOR\HHWKHSURGXFWLRQRI WKHVHSURGXFWVXQGHUWKHQDPHµ$TXD/LJKW¶OHGWRWKHQDPHRIWKH VRRQWREHVWDUWHGYHQWXUH$.:$3URGXFWV $.:$EHJDQWRVXSSO\DZLGHUUDQJHRISURGXFWVDQGLQ LQVWDOOHGLWV¿UVWLQMHFWLRQPRXOGLQJPDFKLQHD&KHQ+VRQJ -HWPDVWHUXQLWVXSSOLHGE\WKHODWH7RQ\9DUULHRI3ODVTXLS,WV VHFRQGPDFKLQHFRPPLVVLRQHGDIHZ\HDUVODWHUD6XSHUPDVWHU XQLWZDVDOVRVXSSOLHGE\3ODVTXLSIURPLWVSULQFLSDO&KHQ+VRQJ JURXSRI7DLZDQ+RQJ.RQJ7KHPDFKLQHZDVPRUHHFRQRPLFDO

DQGPDGH$.:$PRUHFRPSHWLWLYHWRR &RQWLQXLQJWKHWUDGLWLRQ&RUQHOLXVKDVLQYHVWHGLQPDFKLQHU\ RQDQRQJRLQJEDVLVZRUNLQJZLWK7RQ\¶VVRQ0DUN9DUULHRI<RXU 7HFKQLFDO6ROXWLRQVZKR³KDVSURYLGHGH[FHOOHQWEDFNXSDQG VHUYLFH´7KHEXVLQHVVKDVJURZQWRDSRLQWZKHUHRIWKH SURGXFWVPDQXIDFWXUHGDUHIRU$.:$¶VRZQSHWVKRSVZLWKWKH UHPDLQLQJEHLQJIRUWKHRSHQPDUNHW 7UDGLQJDV3ODVWLQMHFWDGLYLVLRQRI$.:$3URGXFWVWKH FRPSDQ\HPSOR\VVWDIIPHPEHUVDWLWV(DVW5DQGSUHPLVHV 3ODVWLQMHFWKDVDQLQMHFWLRQPRXOGLQJFDSDFLW\IURPWRQVWR WRQVZLWKVHYHQPDFKLQHVEHLQJXVHG3ODVWLQMHFWDOVRRIIHUV vacuum forming facilities. &RUQHOLXVGHVLJQVWKHWRROVDQGWKHPRXOGVDUHPDGHLQ&KLQD ZLWK&RUQHOLXVRYHUVHHLQJWKHSURFHVV3ODVWLQMHFWLVDOVRDEOH SDFNDJHLWVSURGXFWV $.:$KDVJURZQVWHDGLO\RYHUWKH\HDUVPRYLQJLQWRPð SUHPLVHVLQPðLQDQGWKHQLQLQWRLWVRZQ

Synchem Group â&#x20AC;&#x201C; a year on â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU%$6)

RQ738(ODVWROODQ®7KHUPRSODVWLF3RO\XUHWKDQH

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU(ODVWURQ RQ73(739(ODVWURQ®6(%6DQG(3'033

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU &*)6(RQ)6(® )OXRURHODVWRPHUVDQG 3HUÃ&#x20AC;XRURHODVWRPHUV

â&#x20AC;¢ 'LVWULEXWRUIRU:HLIDQJRQ:HLSUHQ &3( â&#x20AC;¢ 6XSSOLHUVRI(369DULRXV*UDGHV â&#x20AC;¢ (QJLQHHULQJ3RO\PHUV â&#x20AC;¢ 3RO\ROH¿QV â&#x20AC;¢ 5HZRUNHGDQG5HSDOHWLVHG0DWHULDOV ®

,7+$6EHHQMXVWRYHUPRQWKVVLQFH6\Q&KHPZDV IRUPHGLQ-XO\WRPHUJHDOOWKHFKHPLFDOUHODWHG DVVHWVFRQWUROOHGE\WKH,(3*URXSDQGLQGRLQJVR FHPHQWLQJLWVSRVLWLRQDVDOHDGHULQWKHFKHPLFDOKROGLQJV LQGXVWU\LQVXE6DKDUDQ$IULFDZLWKDVWURQJLQWHUQDWLRQDO SUHVHQFHLQ(XURSH$XVWUDODVLD%UD]LO&KLQDDQG,UDQ 6\Q&KHP&(2,DQ)RUEHVVDLGWKDWWKHUDWLRQDOH LQEULQJLQJWKHVHDVVHWVWRJHWKHULQRQHHQWLW\ZDVWR RSWLPLVHWKHV\QHUJLHVDQGPD[LPL]HWKHFRVWVDYLQJVDQG RWKHURSSRUWXQLWLHVWKDWDUHSRVVLEOHDVDXQL¿HGJURXS 7KHQDPHµ6\Q&KHP¶LVGHULYHGIURPWKHIXOOQDPHRI WKH*URXS6\QWKHVLV&KHPLFDO+ROGLQJV 3W\ /WG 7KHIROORZLQJFRPSDQLHVKDYHEHHQPHUJHGWRIRUP 6\Q&KHP)HUUR6RXWK$IULFD )HUUR%UDNSDQ1&6 5HVLQV)HUUR&RDWLQJ5HVLQVDQG)HUUR'LVSHUVLRQV  1&3&KORUFKHP$UNHP:DOYLV%D\6DOW+ROGLQJV &HUHERV%RWDVK&-3&KHPLFDOVDQG,GZDOD 6\Q&KHPKDVRYHUHPSOR\HHVDQGVDOHVRI DSSUR[LPDWHO\5ELOOLRQ www.synchem.co.za

34 OCT / NOV 2017

MBT


PHOTOS: LOWRIE SHARP

Chen Hsong systems Akwa manufactures a large range of products for the pet sector

Cornelius Muller of Akwa Products in the Plastinject production hall at the companyâ&#x20AC;&#x2122;s site in Benoni, with setter Thembisa Khumalo, some of the companyâ&#x20AC;&#x2122;s Chen Hsong injection machines and moulded product

1200m² factory. However, the company outgrew that site too and another factory of 3600m² was built and in full production by 2004. â&#x20AC;&#x153;The new building was a huge challenge. All systems had to be improved to accommodate the handling of products on a larger VFDOH,WWRRNWZR\HDUVWRÂżQDOO\UHDFKDOHYHORIVDWLVIDFWLRQWKDW, could live with,â&#x20AC;? said Cornelius. All the hard work and perseverance has paid off though, and today AKWA Products has established itself as a reliable supplier to wholesale and retail pet stores, pet grooming parlours, veterinary practices, nurseries and water gardening outlets. The business has its own sales representatives throughout Southern Africa and is also able to distribute throughout Southern Africa. www.akwa.co.za

www.ytsm.co.za OCT / NOV 2017 35

Putting Putting all all your your eggs eggs in in one one basket? basket?

Putting Puttingall allyour youreggs eggs ininone onebasket? basket? )RURYHU\HDUV0%7KDV EHHQ7+(UHOLDEOHVXSSOLHU RIFKRLFHIRU\RXULLDPE, LDPE, HDPE, PVC, PET, PS, ABS, PP and WaxUHTXLUHPHQWV

www.mbtsa.co.za

MBTSouth SouthAfrica Africa MBT Distributors of Plastic Raw Materials Unit 16 (DVWZRRG2IÂżFH3DUN Unit 16, Eastwood Office Park, 8QLW(DVWZRRG2IÂżFH3DUN E5LOH\5RDG%HGIRUGYLHZ 11b Riley Road, E5LOH\5RDG%HGIRUGYLHZ7HO Tel: +27-11-455 2889Bedfordview: Tel: 011 455 2889

Lance vd Merwe 3DXO*ULSSHU Paul Gripper 7LDJRGRV5DPRV Tiago dos Ramos

6WHYHQ&RDWHV

MBT ad '017 08 (half page)-bleed .indd 86

082 901 0477  082 456 6659  082 775 5344 

&DSH7RZQ2IÂżFH &ROOHJH+RXVH Cape Town Office, 4 College House, &DSH7RZQ2IÂżFH&ROOHJH+RXVH 9LOODJH:DON3DUNODQGV Village Walk, Parklands: Tel: 021 556 7787 9LOODJH:DON3DUNODQGV7HO Tel: +27-21-5567787

Carlotta Stafford 082 600 7403 &DUORWWD6WDIIRUG  Helga Ferreira 072 573 4221 +HOJD)HUUHLUD  Ivan Horowitz 072 896 6636 ,YDQ+RURZLW] 

2017/08/23 13:02


News

Ipex unveils its Innovation

Itâ&#x20AC;&#x2122;s a moulding experience with Wittmann Battenfeld systems

36 OCT / NOV 2017

IPEX Machinery has unveiled its new Innovation Centre, with just a single production cell on display â&#x20AC;&#x201C; but what an impressive sight it is. In full operation at the centre at the Ipex premises in Selby, Johannesburg, the demo production unit from WittmannBattenfeld included a SmartPower 110 injection moulding machine, the focus of the centre, along with a range of ancillary equipment from Wittmann. 7KHFHQWUHZDVRIÂżFLDOO\RSHQHGGXULQJ an â&#x20AC;&#x2DC;open houseâ&#x20AC;&#x2122; show in August when Ipex MD Bruce Allen and his team hosted their partners from Wittmann-Battenfeld (WIBA) of Austria and guests from the injection moulding sector around the country One of the oldest names in injection moulding worldwide, having been established in 1876 (when it was a metal smith), Battenfeld was for many years one of the leaders in injection technology worldwide. One of its feats was building what was then the largest ever injection machine, an 8,000-ton system, in 1991. But the trajectory changed and Battenfeld was eventually bought by the Wittmann group of Austria in 2008. Established in 1976 by Dr Werner Wittmann, who remains at the helm of the merged companies, Wittmann group was by then an established leader in the manufacture of auxiliary equipment and automation 'DYLG+DUOH\DQG$NL0RXWDÂżVRI3ODVWLF%XEEOHV LQFRQYHUVDWLRQZLWK6LHJLHRI:LWWPDQQ %DWWHQIHOG'DYLGKDVUHFHQWO\EHHQDSSRLQWHG IDFWRU\PDQDJHUDW3ODVWLF%XEEOHVLQ6SULQJV

systems. The merger appears to have EHQHÂżWWHGERWKSDUWLHVWKHGHVLJQHUV of the Wittmann auxiliaries got to work more closely with the developers of the Battenfeld injection technology. The results KDYHEHHQLPSUHVVLYH Battenfeld now produces mainly smaller machines (although it does make a number of Macropower systems up to 2000 tons) that are integrated with its automation equipment. Its machines are characterised by a short footprint and generous mould mounting areas. WIBA has gained traction through the merger and sales of its integrated injection systems, with the Wittmann DX[LOLDULHVDUHXSDFFRUGLQJWR:,%$ sales director Sigi KĂśhler, current sales in Europe are up as much as 30%. Thatâ&#x20AC;&#x2122;s

due to demand from the automotive sector, which is particularly strong in Germany, as well as the packaging market. WIBAâ&#x20AC;&#x2122;s machines are also popular in the micro injection sector. Sales of WIBA systems in South Africa are also up, going mainly into the packaging and thinwall sectors.

WIBA has gained traction through its integrated injection systems

MacroPower The MacroPower 110 machine is regarded as a versatile system, which is useful as the intention is for it to be used for customer mould trials. Its Unilog B8 control unit offers various possibilities for process control and documentation, which will be useful for users needing to train setters and technicians. â&#x20AC;&#x153;The MacroPower machines feature a very small footprint, thanks to their highly

7KHYLVLWRUVIURP:LWWPDQQ%DWWHQIHOGLQ$XVWULDZKRDVVLVWHGZLWKWKHPDFKLQHGHPR DQGSUHVHQWDWLRQVLQFOXGHG(GPXQG.LUVFK6LHJIULHG.|KOHUDQG0DQIUHG%OXPDXHU

IPEX


It’s open – The cutting of the ribbon at the opening of the new Innovation Centre in Selby, Johannesburg, was a happy moment for the Ipex and Wittmann-Battenfeld teams. Pictured here from left are John Davies (Ipex), Sean Kleingeld (Ipex), Rosina Bill (Ipex), Sigi Köhler (WIBA), Bruce Allen (Ipex), Jenna Bradley Saunders (Ipex), Manfred Blumauer (WIBA) and Edmund Kirsch (WIBA) (above) Innovative machine – The production cell includes the SmartPower 110 injection machine together with various ancillaries, including a dehumidifying drier, gravimetric blender and hopper and pick-and-place robot, all from Wittmann. Injection moulders in South Africa have been invited to run their moulds on the system and experience the WIBA technology. The centre is also available for the training of setters and technicians (left)

PHOTOS: LOWRIE SHARP

Centre

OCT / NOV 2017 37

IPEX.indd 70

2017/09/15 11:29


News

Sean Kleingeld of Ipex and Kevin Barnard of Kevmar Plastics

compact, extremely rigid 3-platen GHVLJQ7KH\DUHKLJKO\HQHUJ\HIÂżFLHQW due to a new space-saving and low-noise servomotor. A generously dimensioned mould mounting area and low-maintenance linear guides are further highlights of the new SmartPower,â&#x20AC;? a WIBA brochure outlined. â&#x20AC;&#x153;The machine was designed around the mould area for the best possible combination of space and Ă&#x20AC;H[LELOLW\VPDOOHVWIRRWSULQWGXHWRWKH incorporation of the hydraulic system, including the high-pressure cylinder and main distribution block into the rear Âż[HGSODWHQFRXSOHGZLWKWKHVHUYR hydraulic system,â&#x20AC;? said John Davies of Ipex. â&#x20AC;&#x153;With the use of steel pipe work, the oil is not over-processed, increasing the life span of the oil and reducing required cooling allowing for almost

Joe May of Visconti-Polyoak Packaging, Jacobus Maritz of Zanpak, Sean Kleingeld of Ipex and Toni Duss of Alplas

95%-plus of the supplied cooling water to be freed up or even turned off. â&#x20AC;&#x153;All major moving parts are supported and guided by linear bearings, increasing the accuracy of movements and reducing the energy required to do so. The Kinetic Energy Recovery System stores the lost energy from this process and is released back into the system via the heating system and in a UPS type system that allows the industrial PC to stay energised for over one second with a power dip/spike,â&#x20AC;? said Davies. The machine also achieves the largest tiebar clearance for easy mould handling, and injection unit can swivel to allow easy access to the screw for cleaning/servicing. â&#x20AC;&#x153;Wittmann 4.0 allows seamless control of all connected ancillaries and allows the operator to save the entire production data to one point of control.

The new B8 HMI touch panel allows customisation per user with a simple RFID tag, and the large screen allows for two process pages, allowing real time display of information while being able to adjust settings without having to return to pages for reference. Over 2000 options are available to meet all process requirements,â&#x20AC;? added Davies. Convertors from around the country attended the opening of the Innovation Centre, which took place over three days in August. â&#x20AC;˘ The mould, for the production of PP tumblers, was supplied by Stratopak, a division of Plastic Bubbles. Plastic Bubbles, of Springs, also supplied the material. â&#x20AC;˘ Compact Cool supplied the chiller. â&#x20AC;˘ Skyland Masterbatch supplied some of the masterbatch used. www.ipex.co.za

38 OCT / NOV 2017

A new take on bottle-to-bottle recycling 7+$1.6WRWKHSLRQHHULQJZRUNRI6WDUOLQJHUWKHÂżUVW+'3(GHWHUJHQWERWWOHPDGHIURP odourless regranulate has been taken to market. The call for sustainable packaging VROXWLRQVIRUSRO\ROHÂżQVÂąHVSHFLDOO\E\EUDQGPDQXIDFWXUHUVÂąSURPSWHG6WDUOLQJHUWR engage with this topic on a deeper level. The material came from detergent bottles from a postconsumer collection that had maintained a persistent odour of dishwashing or laundry detergent even after undergoing a shredding and washing process. The goal was to produce high-quality regranulate, and to aim for optimum removal of the strong smell. In addition, the regranulate should not entail qualitative losses compared to products made from virgin material. Taking these requirements into account, Starlinger started a test production during which more than 100 tons of HDPE post-consumer material were processed. The subsequent production of bottles from 100% rHDPE IXOÂżOOHGDOOH[SHFWDWLRQV6WDUOLQJHUÂśVRGRXUUHGXFWLRQSURFHVVSHUPDQHQWO\UHPRYHVWKH substances causing the unwanted smell. In part, this removal occurs during material preparation in the SMART feeder of the recycling line recoSTAR dynamic as well as GXULQJGHJDVVLQJZLWKWKHKLJKO\HIÂżFLHQW&9$&PRGXOH$VDÂżQDOVWHSWKHUHJUDQXODWH UHFHLYHVWKHÂżQLVKLQJWRXFKHVLQWKH6PHOO([WUDFWLRQ8QLWÂąLWVFRQÂżJXUDWLRQDQGSURFHVV SDUDPHWHUVPD\EHDGDSWHGLQGLYLGXDOO\WRWKHQHHGVRIWKHFXVWRPHUÂśVPDWHULDO www.starlinger.com


News Ashraf Mohammed, factory manager of the Argento plant at Queensburgh, with one of the impressive new Haixing machines installed recently

Argento commissions new Haixings

40 OCT / NOV 2017

MJHâ&#x20AC;&#x2122;s Ricky Lazenby and Argento owner Navesh Singh

ARGENTO Plastic Manufacturers of Durban recently celebrated the commissioning of three new Haixing injection moulding machines supplied by MJH Machine Tools. Based in the Queensmead Industrial area, Argento specialises in the manufacture of thin-wall, tamper-evident plastic containers in various sizes for the food and chemical industries; it manufacturers other products besides, including plastic spools for the clothing industry. Argentoâ&#x20AC;&#x2122;s young and dynamic management team is headed up by Navesh Singh and his wife Rachel. The company is ISO and HACCP compliant with ISO

9001:2015 quality management and ISO 22000:2005 food safety management FHUWLÂżFDWLRQLQSODFH Navesh says MJHâ&#x20AC;&#x2122;s advice, service and follow-through has been invaluable. â&#x20AC;&#x153;MJH were able to supply machines acFRUGLQJWRRXUVSHFLÂżFDWLRQVDQGSULFLQJ was in our favour too. The servo motors and pumps are German and Japanese, which is the core of the injection moulding machines,â&#x20AC;? he adds. What started out as a small injection moulding business in 2007 with just two Ferromatik machines manufacturing honey jar caps has grown rapidly: Argento now boasts 14 injection moulding machines, but for the time being will only use the three new Haixings. It is currently constructing a new factory, with a production area of 3000m² over three storeys, in Queensmead and the plan is for the older machines to be brought back into use once the move is complete. Navesh remembers how it all progressed after starting with the production of the the honey caps: â&#x20AC;&#x153;Rachel, my wife, was running the factory at the time and I had to learn quickly about injection moulding and began to help improve the EXVLQHVV0\ÂżUVWVWHSZDVWRLQWURGXFH

new moulds and, after some hard thinking, I decided disposable, tamper-evident thin-walled products were going to be my target. To accomplish this, I had no choice but to leave South Africa and source moulds overseas.â&#x20AC;? Argentoâ&#x20AC;&#x2122;s staff complement soon grew to 30 and the company opened two sales branches in Johannesburg and Cape Town. However, with the commissioning of the new Haixing machines, Argento now employs just six staff members, thanks to the automated systems that Navesh designed and implemented on the factory Ă&#x20AC;RRU:LWKKLVHOHFWURQLFHQJLQHHULQJ background, Navesh designed the system so that the robots and conveyor belts â&#x20AC;&#x153;talk to each other,â&#x20AC;? thereby alleviating the need for additional staff. The plan is to expand the companyâ&#x20AC;&#x2122;s range of machines and robots, with inmould labelling the next big investment, and Navesh is optimistic that Argento will be able to supply international markets in the near future. www.argentoplastics.co.za www.mjhmachinetools.com

Argentoâ&#x20AC;&#x2122;s young and dynamic management team â&#x20AC;&#x201C; (back) Prinesha, Navesh and Rachel Singh, Natalie and Ricky Lazenby of machine supplier MJH, Boykie, Andre and Ashraf. Front: Terence, Blessing and Mike Navesh and Rachel Singh

PHOTOS: LYNNE ASKEW

MJH able to supply machines according to Argento specs


Haixing new A4-BLEED.indd 86

2017/09/26 09:39


News Nico White with one of the new Wintec machines

Principle’s

on the Wintec path PRINCIPLE Plastics, the Port Elizabeth injection moulding company, has recently commissioned two of the Wintec machines from Engel SA. The Wintec units are ‘scaled down’ versions of Engel machines, built by the Engel subsidiary in China. The purchase may have resulted from Principle’s purchase last year of a number of second-hand Engel machines, which put the team in contact with the Austrian machine builder’s technology. One thing led to another, and Principle decided to buy two of the lower-priced Wintec systems – and relatively large machines at that, of 850 and 1350 tons clamp force. The project appears to have gotten off to a good start and the machines are pumping out automotive components at Principle’s site in Markman Township. The fact that the machines do not have

all the bells and whistles appears to suit Principle MD Nico White: “Why pay for features you don’t need,” asks Nico. Parts are interchangeable with those of the Engel machines, which

means virtually all parts are readily available in South Africa. So good has the kickoff at Principle been that the company has purchased another Wintec, an even bigger machine.

42 OCT / NOV 2017

China plastic demand to rise as foreign waste ban curbs recycling CHINA’S soaring plastic demand may rise even further as the government plans to ban waste plastic imports by the end of this year, which will curb domestic plastic recycling. The expected increase in plastic demand highlights the consequences RI&KLQD¶VSROOXWLRQ¿JKWDQGLWVHIIRUWV to modernise its industry. As part of this drive, the world’s top importer of rubbish said in July that it would stop importing garbage by the end of this year. To make up for the loss of recycled plastic, petrochemical producers and

exporters to China from the Middle East, South Korea, Thailand and Singapore are expected to receive more orders for products including polythene. China imported 7.3 million tons of waste plastics last year, taking in over half the world’s leftover plastic. Of this, polythene made up about 2.53 million tons in 2016 and this is expected to fall to between 1.7 million and 1.8 million tons this year, data from IHS Markit Chemical showed. IHS Markit expects China’s polythene

demand to grow by 6.6% from 2017 to 2018, outpacing Asia’s overall growth of 5.5%t. “The ban of scrap/waste plastics LVGH¿QLWHO\SRVLWLYHIRUSRO\WKHQH producers as there will be a shift of consumption from recycled polythene to prime virgins polythene,” said JP Nah, GLUHFWRURISRO\ROH¿QVDW,+60DUNLW Chemical. Nah said Asia’s 2017 total polythene demand would be about 41.5 million tons, with China accounting for some two-thirds of total demand.


News Cutting ribbon at the newly expanded Serioplast factory is Carlo Luigi Innocenti (global operations director) with Riccardo Bellini (operations manager for Egypt & South Africa and Claude Naidoo (the Boksburg plant manager)

Serioplast doubles the size of its Boksburg plant EXPANSION plans for Serioplast South Africa are well underway with customers invited to a special â&#x20AC;&#x2DC;cutting the ribbonâ&#x20AC;&#x2122; ceremony at the companyâ&#x20AC;&#x2122;s newly expanded factory in Boksburg in September. Serioplast began its activities in Boksburg in 2015, for the production of rigid packaging from PET, HDPE and PP. In relation to the continued growth of the business â&#x20AC;&#x201C; approximately 15% in two years â&#x20AC;&#x201C; Serioplast has made a major investment plan that led to the expansion of the Boksburg production plant from 6 000 to 13 000m2, introducing new multilayer extrusion technology, which will increase the

production capacity of the plant by 20% for HDPE and PP products, and double the production capacity for PET. â&#x20AC;&#x153;Serioplast believes in the South African market and wants to continue its expansion through investment and development of the local team,â&#x20AC;? said Riccardo Bellini, operations manager for Egypt and South Africa. Serioplast SA will also achieve ISO 9001 and EN FHUWLÂżFDWLRQWKLV\HDU Serioplast has been in operation since 1974, with 22 factories all over the world (of which eight are in Italy and 14 abroad). Its main customers are major corporations in the home care, personal care, food & beverage

FIT for a king!

and pharmaceutical sectors. Among its main commercial partners are Unilever, Procter&Gamble, Henkel, Lâ&#x20AC;&#x2122;OrĂŠal, Bolton Manitoba, and Reckitt Benckiser. The Bergamo-based company is one of the largest Italian suppliers and European player in the production of customised, rigid plastic bottle packaging for the largest multinational brands in the mass consumer goods markets. The company is part of the larger packaging group, Old Mill Holding that provides a fully integrated rigid plastic packaging service for our clients: plastic bottle production; research, design DQGLQQRYDWLRQDQGEXONÂżOOLQJFRQWUDFW services.

PHOTOS: LOWRIE SHARP

www.serioplast.com

Company grows 15% in just two years

6RPHRI),7ÂśVÂżQLVKHG products, colour coated spectrum and vacuum hydrographic FDUERQÂżEUHFRDWLQJV

44

OCT / NOV 2017

Furniture Installation Technologiesâ&#x20AC;&#x2122; new manufacturing division FIT Plastics invests in full turnkey plastic injection moulding facility FURNITURE Installation Technologies (FIT) has recently established a manufacturing division, Fit Plastics, with state-ofthe-art Haitian injection moulding machines with capacity from 60 to 220 tons as well as a PVD (vacuum metallizing) facility. FIT Plastics has also added a full hydrographic (water transfer printing) dipping plant, expanding Keeping FIT on the path to success are Warren Mellett and sample to moulding and then to its capability even further. Henning van Aswegen, who combined have over 50 yearsâ&#x20AC;&#x2122; WKHÂżQLVKHGPHWDOL]HGSURGXFW Metallic coatings on plastics and H[SHULHQFHLQLQMHFWLRQPRXOGLQJDQGVXUIDFHÂżQLVKLQJ FITâ&#x20AC;&#x2122;s technical representatives any non-porous surface are processed LQDIXOO\DXWRPDWHGSODQW7KHSODQWLVFRQWUROOHGE\TXDOLÂżHGDQG also offer expertise during the concept stage of a product and give reliable advice about the design of injection moulds, experienced PVD specialists who perform continuous on-site ensuring the most ideal moulding and metallic coating results. testing and statistical control of the coating operations to ensure Sectors in which FIT is involved include the automotive, reliable and consistent high-quality performance. FRVPHWLFIXUQLWXUHKDUGZDUHFRIÂżQFDVNHWVLJQDJH FIT has its own toolroom, moulding machines, vacuum metallizer, entertainment, sports, lighting and mining industries. spray painting facility and hydrographic dipping plant. These assets 7KHFRPSDQ\RSHUDWHVQLQHRIÂżFHVDURXQGWKHFRXQWU\ enable FIT Plastics to handle requirements for customers making ABS, PA 66, PC/ABS or PP parts, to mention a few, from initial â&#x20AC;˘ &RQWDFW:DUUHQ0HOOHWWZDUUHQ#ÂżWVDOHVFR]DRU concept using its research and development team to 3D printed +HQQLQJYDQ$VZHJHQKHQQLQJ#ÂżWVDOHVFR]D

NEWS-SERIOPLAST.indd 44

2017/09/27 14:56


INSTRUMENTAL IN SUPPLYING ALL YOUR BLACK, WHITE AND FILLER MASTERBATCH REQUIREMENTS HEAD OFFICE - GAUTENG Telephone: +27 (0) 11 746 4000 KWA-ZULU NATAL - New Germany Telephone: +27 (0) 31 713 0631 EASTERN CAPE - Port Elizabeth Telephone: +27 (0) 41 451 2571 WESTERN CAPE - CAPE TOWN Telephone: +27 (0) 21 935 1788

www.ferro-sa.co.za


News The Mpact Polymers plant in Wadeville

An

impactful solution

www.mpact.co.za

www.petco.co.za

Solution lies in no single participant, but through collaboration ,1129$7,21DQGYDOXHEDVHGSURGXFW GHYHORSPHQWLVWKHIRUHIURQWIRUPRVW FRPSDQLHVEXWIHZFRQVLGHUKRZ WKLVW\SHRIGHYHORSPHQWVKRXOGEH IRFXVHGRQDZLGHULQGXVWU\FKDOOHQJH WREHFRPHSDUWRIDQLQGXVWU\VROXWLRQ 7KHSODVWLFVFRQYHUWLQJVHFWRULVQR H[FHSWLRQWRWKLVFRQVLGHUDWLRQ)RU WKHSODVWLFVFRQYHUWLQJVHFWRUWKH VROXWLRQOLHVLQQRVLQJOHSDUWLFLSDQWEXW WKURXJKFROODERUDWLRQZLWKDQXPEHU RIVWDNHKROGHUVYL]WKHGHFLVLRQ PDNHUVW\SLFDOO\WKHEUDQGRZQHUVWKH LQÃ&#x20AC;XHQFHUVW\SLFDOO\WKHFRQVXPHUV DQGWKHIDFLOLWDWRUVW\SLFDOO\WKH FRQYHUWRUVVXFKDV0SDFW3ODVWLFV 'HVLJQLQJQHZSURGXFWVEDVHG RQUHF\FOLQJSULQFLSOHVOLHVZLWKLQWKH NQRZOHGJHEDVHRIVRPHFRQYHUWRUV VXFKDV0SDFW3ODVWLFVZKLFKKDVGLUHFW LQWHUDFWLRQZLWKWKHGHFLVLRQPDNHUV DOVRUHIHUUHGWRDVWKHEUDQGRZQHUV ³%HLQJWKHIDFLOLWDWRUVRIQHZ SDFNDJLQJGHYHORSPHQWVWKH UHVSRQVLELOLW\WRJXLGHUHF\FOLQJIULHQGO\ SDFNDJLQJLVODUJHO\LQWKHKDQGVRIWKH FRQYHUWRUVVXFKDVRXUVHOYHV´VD\V 1HHOLQ1DLGRR0'RI0SDFWSODVWLFV -DQLQH%DVVRQ6WDNHKROGHU5HODWLRQV 0DQDJHUIRU3(7&2WKHLQGXVWU\ERG\

UHVSRQVLEOHIRUIXO¿OOLQJWKH6RXWK$IULFDQ 3(7SODVWLFLQGXVWU\¶VUROHRI([WHQGHG 3URGXFHU5HVSRQVLELOLW\FRPPHQWHG ³3DFNDJLQJGHFLVLRQPDNHUVQHHGWR XQGHUVWDQGKRZSDFNDJLQJGHVLJQ GHFLVLRQVDIIHFWFRQWDLQHUUHF\FODELOLW\ DQGWKLVPXVWIXUWKHUEHUHFRJQL]HGDQG IDFLOLWDWHGE\FRQYHUWRUVLQRUGHUWREH FRPSDWLEOHZLWKWKHEURDGHVWUDQJHRI UHF\FOLQJWHFKQRORJLHV´ ,WLVKRZHYHUWKHEUDQGRZQHUV RUGHFLVLRQPDNHUVZKRKDYHWRWDNH WKHFRXUDJHRXVVWHSWREUHDNFHUWDLQ QRUPVDQGDJUHHWRPDNHVXVWDLQDELOLW\ DWRSSULRULW\HYHQZKHQFKDOOHQJHG ZLWKFRPPHUFLDOPDWWHUVVXFKDV LFRQLFVKDSHVSURGXFWUHFRJQLWLRQDQG FRVWV0SDFWEHOLHYHWKHUHLVDVXLWDEOH FRPSURPLVHWRHQVXUHWKDWLQGXVWU\DQG EUDQGQHHGVDUHPHW Think green, buy green 7KHWKLUGSDUW\WKHFRQVXPHUVRU LQÃ&#x20AC;XHQFHUVKDYHPLQLPDOLQGLYLGXDO LPSDFWEXWPD[LPXPFROOHFWLYHLPSDFW 7KURXJKHGXFDWLRQDQGE\HOLPLQDWLQJ LJQRUDQWSXUFKDVHGHFLVLRQVWKH\FDQ FKRRVHWRFRQVXPHSURGXFWVDQGVXSSRUW EUDQGVWKDWVXSSRUWRXUHQYLURQPHQW 7KLVW\SHRIHGXFDWLRQLVDQGVKRXOG

FRQWLQXHWREHGULYHQE\WKHLQGXVWU\ ERGLHVWKDWSURPRWHJRRGSUDFWLFHV ZLWKLQWKHSODVWLFVLQGXVWU\±WKH VDPHERGLHVWKDWVRPHFRQYHUWRUV RU IDFLOLWDWRUV VXFKDV0SDFW3ODVWLFV VXSSRUWWKURXJKPHPEHUVKLSDQGWKH FRQWULEXWLRQRIOHYLHV Making the Mpact in design 7KH0SDFW3ODVWLFV,QQRYDWLRQDQG 'HVLJQ&HQWUHLVDKXEIRUSURYLGLQJ FRQFHSWXDOL]DWLRQGHYHORSPHQWDQG GHVLJQVHUYLFHVIRUFXVWRPHUVDQG SURVSHFWV7KHFURVVIXQFWLRQDOWHDP has a thorough understanding of the ³GHVLJQIRUUHF\FOLQJ´SULQFLSOHVDQG IRFXVHVRQDOODVSHFWVVXFKDVWKH GHVLJQLWVHOISURGXFWZHLJKWPDWHULDO SURFHVVDQGWHFKQRORJ\ 7KHWHDPDWWKHFHQWHUGULYHV UHF\FODEOHLQQRYDWLRQXVLQJWKH ODWHVWFRPSXWHUDLGHGGHVLJQDQG PRGHOEXLOGLQJWHFKQRORJ\WRHQVXUH WKDWDOOSDUDPHWHUVDUHPHWEHIRUH SDFNDJLQJDUULYHVRQWKHUHWDLOVKHOI $OOGHVLJQVDUHDOVREDVHGRQ¿OOLQJ OLQHUHTXLUHPHQWVVKHOISUHVHQFH HQYLURQPHQWDOFRQVLGHUDWLRQVVXSSO\ FKDLQUHTXLUHPHQWVFRVWHIIHFWLYHQHVV SUHVHUYDWLRQDQGVKHOIOLIH

Borealis establishes direct sales presence in SA BOREALIS, a leading provider of innovative solutions in the ¿HOGVRISRO\ROH¿QVEDVHFKHPLFDOVDQGIHUWLOL]HUVKDVRSHQHG DQHZVDOHVRI¿FHLQ-RKDQQHVEXUJ7KHQHZRI¿FHZLOOHQDEOH %RUHDOLVWRSURYLGHLPSURYHGFXVWRPHUVHUYLFHWKDQNVWRD EDODQFHGPL[RIGLUHFWDQGLQGLUHFWVDOHVDFWLYLWLHV 6RXWK$IULFDLVDQH[SDQGLQJPDUNHWZLWKHVSHFLDOO\ LQWHUHVWLQJJURZWKRSSRUWXQLWLHVLQSODVWLFV%RUHDOLVDLPV WRFDSLWDOLVHRQWKLVSRWHQWLDOE\VWHSSLQJXSLWVGLUHFWVDOHV DFWLYLWLHVZLWKIRFXVRQWKHSLSHDQGFRQVXPHUSURGXFWV VHJPHQWV6RXUFLQJZLOOFRQWLQXHIURPERWK%RUHDOLVLQ (XURSHDQG%RURXJHLQ$EX'KDEL8$(7KHQHZOHJDOHQWLW\ UHJLVWHUHGDQGORFDWHGLQ-RKDQQHVEXUJZLOOEHKHDGHGE\ $QGUHZ3LHQDDUPRVWUHFHQWO\RI3RO\VDILQ6RXWK$IULFD %RUHDOLVKDVKDGDSUHVHQFHRQWKH6RXWK$IULFDQPDUNHW IRURYHUWZRGHFDGHVE\ZD\RILWVDJHQW&KHPLPSRZKLFK 46

NEWS-MPACT .indd 46

OCT / NOV 2017

EHFDPHSDUWRIWKH,0&'*URXSLQ7KLVPXWXDOO\ EHQH¿FLDOSDUWQHUVKLSZKLFKLVSDUWLFXODUO\VWURQJLQWKH(QHUJ\ VHJPHQWKDVQRZEHHQH[WHQGHGE\ZD\RIDQHZGLVWULEXWLRQ DJUHHPHQW%RUHDOLVDQG,0&'ZLOOZRUNFORVHO\ZLWKWKHLU H[LVWLQJFXVWRPHUVWRHVWDEOLVKWKHPRVWVXLWDEOHFXVWRPHU LQWHUIDFHVIRUHDFKSDUW\&XVWRPHUVLQWKHUHJLRQFDQFRQWLQXH WRUHO\RQWKHFXVWRPDULO\VKRUWOHDGWLPHVWKDQNVWRORFDOO\ VWRUHGSURGXFWV ³7KDQNVLQJUHDWPHDVXUHWRRXUORQJVWDQGLQJSDUWQHUVKLS ZLWK,0&'ZHKDYHDVROLGIRRWLQJDQGH[FHOOHQWLPDJH LQ6RXWK$IULFD´VDLG$OIUHG6WHUQ%RUHDOLVH[HFXWLYHYLFH SUHVLGHQWIRUSRO\ROH¿QVDQGLQQRYDWLRQ WHFKQRORJ\³%RUHDOLV¶ ORQJWHUPFRPPLWPHQWWRGHOLYHULQJYDOXHDGGHGSURGXFWVDV HI¿FLHQWO\DVSRVVLEOHLVEROVWHUHGE\WKHHVWDEOLVKPHQWRIWKLV QHZGLUHFWVDOHVHQWLW\´ www.borealisgroup.com

2017/09/27 10:34


Masterbatch SA ad '017 06 (Pantone)-BLEED.indd 94

2017/04/21 11:05


News

JUST BRIEFLY

/(66WKDQWZRZHHNVDIWHULWVIRUPDO launch, DowDuPont was changing the PDNHXSRIWKHWKUHHÂżUPVWKDWLWSODQVWR spin off. DowDuPont began operations on 31 August after the merger of plastics and chemicals giants Dow Chemical Co DQG'X3RQW&R7KHVHWZRÂżUPVKDG combined sales of $72 billion last year. 3ODQVIRUWKHPHUJHUZHUHÂżUVWDQ nounced in late 2015. That included splitting into three separate companies within the next 18 months. The largest of those three will be focused on materials, including plastic resins. It will retain the Dow name and be based in Midland, where Dow had been based. The other WZRVSLQRIIÂżUPV²RQHGHYRWHGWR agriculture and the other to specialty SURGXFWV²ZLOOEHEDVHGLQ:LOPLQJWRQ Delaware, where DuPont had been based. The main plastics-related businesses affected by these moves are DuPontâ&#x20AC;&#x2122;s performance polymers unit and plastics compounder, Multibase. Performance polymers include DuPontâ&#x20AC;&#x2122;s production of nylon, acetal, PBT, polysters, copolyesters and related materials. Multibase is a maker of thermoplastic vulcanizates (TPVs) and related products.

3+2726/2:5,(6+$53

DowDuPont plans for spinoff companies

Ralph Bhengu and John Jacobs at the Bottles Direct plant in Aeroton

Bhengu buys into Bottles Direct Blow moulder now has exactly the right BEE credentials RALPH Bhengu (ex-Engen) has recently purchased a stake in Bottles Direct, the Kempton Park blow moulding company, a majority stake in fact. He and John Jacobs, founder of Bottles Direct in 2015, have plans to expand the business and even enter new markets. Up till now Bottles Direct has manufactured mainly sport bottles, DQGLVUHSXWHGWREHWKHÂżUVWLQ6$WR manufacture sports bottles using PP preforms. It has to be said that opportunities will

likely open for the company with its new BEE credentials, which meet set criteria almost exactly. A man with considerable enthusiasm and energy, Ralph brings a lot of experience to the party: he has worked across the African continent, Middle East, Europe and Asia and completed his MBA in 2012. He has worked previously at Buckman Laboratories (specialty chemicals), Valspar (specialty chemicals SDLQW (QYLUR6HUY ZDVWHPDQDJHPHQW  and most recently at Engen.

48 OCT / NOV 2017

Dave Moore: 083 675 8325 %RHVI[7LSVX Email: dave@mouldbasesa.co.za

YIZUMI D1 TWO PLATEN MACHINES HAVE BEEN LAUNCHED WORLDWIDE These machines have a broad range of suitability. From Auto Parts, Deep Cavity Moulds, Crates, Chairs, Pallets and Appliance Parts, Yizumi D1 will mould it.

Contact us for a brochure pack to be sent to you â&#x20AC;˘ 55% faster open and close time compared to three platen machines â&#x20AC;˘ Smaller footprint Â&#x2C6;/)&%GSRXVSPPIVWTIGM½GXSX[S platen machines â&#x20AC;˘ IP 54 rated electrical cabinet â&#x20AC;˘ Oil cooled double head servo motor â&#x20AC;˘ Highly sensitive mould protection circuit

MOULD BASE SA

[[[QSYPHFEWIWEGS^E Injection Moulding Toolmaking Supplier


Rapid Granulator ad '017 10-BLEED.indd 86

2017/09/20 12:00


News -KWVWUQK[Q\]I\QWVIĐ&#x201E;MK\[ <ZIV[XIKWZM[]T\[

TRANSPACO recorded a drop in headline earnings per share for the year to end-June due to what the group described as the unfavourable economic climate. Transpaco operates a QXPEHURIÂżOPDQGEDJPDQXIDFWXULQJDQG recycling businesses. It said reduced customer spending during the period had a knock-on effect which resulted in reduced demand for recycled materials and lower selling prices. Headline earnings fell 20,4% to 262 cents per share; a dividend of 120c a share, down from 150 cents, was declared.

AROUND THE WORLD

3MVaIJIV[XTI[\QK[PWXXQVO JIO[ A BAN on plastic bags has come into force in Kenya and those found violating the new UHJXODWLRQFRXOGUHFHLYHPD[LPXPÂżQHV of $38,000 or a four-year jail term. The ban applies to the use, manufacture and importation of plastic shopping bags and JLYHVDPLQLPXPÂżQHRIDERXWRU up to a year imprisonment. Exemptions were made for manufacturers producing plastic bags for industrial use. Most supermarkets chains have been selling cloth bags instead since the legislation on 28 Aug. Similar bans have been implemented in other African countries such as Cameroon, Guinea-Bissau, Mali, Tanzania, Uganda, Ethiopia, Mauritania and Malawi.

1\Âź[\PMTI[\[\ZI_NZWU01+

WE regret to report that HIC Straws in Cape 7RZQKDVFORVHG(VWDEOLVKHGLQE\ Hans Kabutz, a German engineer, HIC traded well for many years and set up its own plant in Killarney Gardens, one of the foremost industrial zones in the Western Cape. Kabutz passed away in 2002 and his wife, Sigrun, continued to run the operation with GM Andy Pani. The core of the business was the supply of sealed straws to boxed container manufacturers. However, one of HICâ&#x20AC;&#x2122;s main clients recently opted to purchase straws from the Far East, achieving a cost advantage, and HIC simply wasnâ&#x20AC;&#x2122;t able to compete or continue.

1UXZM[[Q^MZM[]T\[NWZ3)8

KAP Industrial Holdings, the owner of Hosaf and Safripol, achieved impressive results for the year ended-June. The listed group raised revenue by 23% to over R20-billion and operating margins increased from 12,4 to 12,6 percent. The group operates three divisions, industrial, logistics and chemicals (into which the polymer manufacturing businesses fall), with the latter achieving the best performance relatively. Turnover of the KAP Chemicals business was up from R3,06-bn to R5,47billion, a substantial lift. The KAP results DOVRQRWHGWKHGLIÂżFXOWLHVHQFRXQWHUHGZLWK operating in a subdued economic market, which affected its logistics the most, although it remained solidly in the black. 50

VM Bottle Printers starts Victor Gomes and Hugo Alegre

VICTOR Gomez has started VM Bottle Printers & Fillers in Johannesburg, offering a virtual A-Z container development-to-market service. The Regents Park business blows the bottles, sources closures, prints on WKHFRQWDLQHUVRUDSSOLHVODEHOVÂżOOVDQGSDOOHWLVHVDQGVKULQNZUDSVWUD\V pallets. Victor, who was previously involved in a blow moulding business, has started the new company with Hugo Alegre, who is a partner in the operation. Victor doubles up as a soccer referee where, besides local PSL games, he also presides on African international matches, which can be challenging activity. He has in the process honed skills to position himself cleverly on WKHÂżHOGSRVLWLRQVZKLFKUHTXLUHJRRGYDQWDJHRIWKHVWDWHRISOD\EXWGRQÂśW interfere with the game, and he now appears to have taken those skills to the business operation level, applying services which small to medium beverage PDQXIDFWXUHUVVKRXOGÂżQGDWWUDFWLYH ZZZYPESULQWHUVFR]D

Others assisted Knysna too Itâ&#x20AC;&#x2122;s come to light that others were involved in the Knysna relief operation too: Duys Rotomoulders also supplied a number of water tanks, two truckloads in fact, using PDWHULDOWKDWZDVGRQDWHGE\$&'5RWRĂ&#x20AC;RWKHURWRSRZGHUFRPSRXQGLQJEXVLQHVV On 15 June, two trucks carrying 80 water tanks ranging in size from 500 to 10 000 litres left Krugersdorp to provide tanks to the Knysna region, which had been devastated by ÂżUHV%\SPWKHIROORZLQJGD\WKHWDQNVKDGEHHQRIĂ&#x20AC;RDGHGDQGZHUHEHLQJGLVWULEXWHG WRYDULRXVFHQWUHVWKDWZHUHLQQHHG

OCT / NOV 2017

NEWS-VM BOTTLES .indd 50

2017/09/27 14:57


- passionate about the plastic industry.

Tel: +27 11 824 3103 - Fax: +27 11 824 6018 email: sales@sescc.co.za - www.sescc.co.za Unit 1, 16 Davidson Place, Wadeville, 1428

Supplier of:

ty Got

Injection Moulding Machine

Servo Klockner

Rebuild

JIANGSU VICTOR MACHINERY


News â&#x20AC;&#x2DC;2K compoundingâ&#x20AC;&#x2122; â&#x20AC;&#x201C; Klaus DrĂślle senior and Klaus DrĂślle junior at KD Polymersâ&#x20AC;&#x2122; new, consolidated VLWHLQ1XIÂżHOG6SULQJV7KH FRPSDQ\VSHFLDOLVHVLQWKH FRPSRXQGLQJRISURGXFWLRQ VFUDSIURPDQXPEHURI *DXWHQJFRQYHUWRUVDVZHOO DVFRORXUFRPSRXQGLQJRI PDWHULDO.'FRPSRXQGV YLUJLQPDWHULDOIRUWKH HOHFWULFDOKRXVHKROGDQG DXWRPRWLYHLQGXVWULHV

Compounder KD Polymers consolidates at site on E Rand Toll processor of engineering materials happy to simplify matters OPERATING a manufacturing establishment from separate locations, which can happen for various reasons during a businessâ&#x20AC;&#x2122;s growth, presents obvious challenges â&#x20AC;Ś but thereâ&#x20AC;&#x2122;s massive relief when activities are consolidated under one roof again. Thatâ&#x20AC;&#x2122;s certainly the case for KD Polymers, a specialist compounder of engineering plastics which until recently had been operating from three different locations on the East Rand. The separation was partly a result of the companyâ&#x20AC;&#x2122;s success: when Klaus DrĂślle started the company in 2007 it was necessary to keep costs under control and the company operated from small premises in Selcourt. But as KD gathered momentum, more space was required and by early-2017 the company had become fairly fragmented, necessitating much â&#x20AC;&#x2DC;interplantâ&#x20AC;&#x2122; communication and travel. Then came the invitation to share SUHPLVHVLQQHDUE\1XIÂżHOGZLWKWKHELJ SOXVRIVXIÂżFLHQWLQVWDOOHGSRZHUVXSSO\ KDâ&#x20AC;&#x2122;s recycling machinery and extruders have recently been moved to the new 52

site and the team is busy with installation and optimization of systems. The move was gradual, to prevent interruption of supply of material to convertors. Klaus Jnr, who was involved in the material supply business prior to starting KD, where he gained considerable experience, has built the company up along with his father, Klaus DrĂślle senior. Klaus Snr, who was originally at CBI and then started a recycling business when KHÂľUHWLUHGÂśZDVDWÂżUVWLQYROYHGDW.'RQ a part-time basis. But as the years went by it became apparent that the fatherson team was a workable and reliable solution. Effective management with considerable attention to detail is very necessary in the material compounding sector, where there is competition (where isnâ&#x20AC;&#x2122;t there?) and the danger of supplying inferior quality material can drastically limit prospects for future orders. KD Polymers is a toll compounder focussed mainly on the compounding of production scrap from a number of well-established Gauteng convertors. It also colour compounds material,

mostly virgin, to customer specs. Its focus is on engineering grade materials, and KD prides itself in being able to effectively manage the collection, granulation/shredding, re-extrusion and return-to-client steps in a predictable manner. Some of the clients require only granulated material, eliminating the pelletisation step. KD compounds virgin materials for the electrical, household and automotive industry. Klaus Jnr, who heads up KD, has built up the company in stages. When ÂżUVWJLYHQWKHRSSRUWXQLW\WRFRPSRXQG production scrap from a few convertors in 2007, he realized that the quality of material supplied was a vital focus and failure to comply would have seen his business plan shredded. Now, ten years on, the KD team has steadily improved HIÂżFLHQFLHVDQGEXLOWXSFXVWRPHUOR\DOW\ The father-and-son team are hands-on involved in all aspects of the production and delivery in a process which now sees KD Polymers being UHFRJQLVHGDVRQHRIWKHPRVWHIÂżFLHQW compounders in Gauteng.  Contact KD Polymers at tel: 011 818 2953

OCT / NOV 2017

NEWS-KD POLYMERS.indd 52

2017/09/27 11:17


We don’t need to be crowned to know we can beat any quote BER M E REM CK BLA Y A FRIDth

24 BER M E V NO

SEND US A COMPETITOR’S OFFICIAL SHINI QUOTE NO OLDER THAN 2 WEEKS AND WE WILL BEAT IT

+27 11 704 0824 | info@cabletech.co.za | www.cabletech.co.za | Lanseria Corporate Estate


News Langa residents are rewarded with an amount of money determined by the current market price of each material type they hand in for recycling. The money is loaded onto their Kilorands Card™ (a special debit card) and can be spent at any shop that accepts MasterCard

Trash into cash

54 OCT / NOV 2017

*RDOLVWRGLYHUWWRQV¶SDFNDJLQJZDVWHIURPODQG¿OO IN JUST four days, residents of Langa in Cape Town brought 5,2 tons of glass,1,9 tons of paper,1 ton of plastic and 295kgs of cans to the PACKA-CHING mobile buy-back service in their area and, in exchange, received R5,403.32. Spearheaded by Polyco and funded by its members, the PACKA-CHING project is being piloted in Langa. Its goal is to divert at least 750 tons of packaging waste IURPODQG¿OOE\LQFUHDVLQJUHF\FOLQJZLWKLQ selected informal settlements and lowerincome areas around Cape Town and Johannesburg. The initiative’s intention is to uplift the lives of local residents by HQDEOLQJWKHPWREHQH¿W¿QDQFLDOO\7KH www.polyco.co.za

PACKA-CHING recycling trailer visits GHVLJQDWHGDUHDVRQVSHFL¿FGD\VRIWKH week to collect recyclable plastic, paper, metal cans and glass that has been collected and separated by community members. In exchange for these materials, they are rewarded with an amount of money determined by the current market price of each material type. The money is loaded onto their Kilorands Card™ (a special debit card) and can be spent at any shop that accepts MasterCard. Plans are in place to rollout the PACKACHING project in Kya Sands and the surrounding communities in Johannesburg early next year. www.packaching.co.za

Eddy Brembilla of Erex, based in Randburg

Erex appointed agent for Italy’s Negri Bossi EREX, the supplier of equipment to the packaging, plastics and textiles industry, has been appointed as the agent for Negri Bossi, the Italian manufacturer of injection machines. Erex was established in Cape Town in 1952, but now operates out of Johannesburg; Negri Bossi predated that, having been set up in Italy in 1947, meaning that it is presently celebrating the 70th year of its establishment. Erex originally supplied only textile machinery, but it has gradually shifted and is now well represented in the packaging/ plastics sectors, supplying processing and ancillary equipment. Gaining the Negri Bossi agency is an exciting new option for it. Having been founded by Messrs Negri and Bossi way back, Negri Bossi was RQHRIWKH¿UVWPDQXIDFWXUHUVRILQMHFWLRQ moulding machines in Europe. It remains a pioneer in the area, building machines from 70 up to 7000 tons. Its machines have been popular with many companies in South Africa over many years.


Speed, Precision, Cleanliness Negri Bossi is on the cutting edge of injection moulding process development, and is known globally as a leading supplier of premium injection moulding machines and special technologies to suit the needs of even the most ,.+#.!//%2!%*&!0%+*)+1( %*#+),*%!/Ä&#x2039;!+Ăť!.3% !..5+"/,!%(%05 and custom technological solutions in order to ensure that our customers are equipped with the most advanced injection moulding capabilities available to the market. These technologies ensure that resulting products feature excellent Ăź*%/$!/Ä&#x152;(%#$0!.3!%#$0/Ä&#x152;"/0!.5(!0%)!/Ä&#x152;%**+20%2!)0!.%(+)%*0%+*/*  more. The Negri Bossi technology portfolio includes:

EOS ST (70-180 tonnes)

JANUS ST (300-450 tonnes)

two-platen clamp, servo-pump, hydraulic powered machines with extremely compact footprint.

5-point double toggle clamp, the Janus ST hybrid machines allow simultaneous (overlapping) movement of functions achieving a high level of energy efficiency by utilizing hybrid technology, achieving a standard speed of 600mm/sec.

Features new TACTUSâ&#x201E;˘ controller

Features new TACTUSâ&#x201E;˘ controller

CANBIO ST (180-500 tonnes) 5-point double toggle clamp, servo-pump hydraulic powered machine. Features new TACTUSâ&#x201E;˘ controller

VECTOR (650-1300 tonnes) The Vector Evolution Series are 5-point doubletoggle clamp, hybrid machine. The injection unit features an electric motor driven screw rotation, with injection capacities from 1875 to 11000g. Equipped with fully digital CanBus control.

ELE All Electric (50-350 tonnes) 5-point double-toggle clamp, all-electric injection PRXOGLQJPDFKLQHVRÎ?HUHQHUJ\VDYLQJVRIXSWR ZKHQFRPSDUHGWRFRQYHQWLRQDOK\GUDXOLF GULYHVROXWLRQV

BI-POWER (1000-7000 tonnes) The BI-POWER series are two-platen clamp, hybrid power machines featuring a reciprocating screw with electric screw rotation, with injection capacities from 2950 to 74900g.

SOUTHERN AFRICA AGENT: Erex (Pty) Ltd T: +27 (0) 11 789 1014 | F: +27 (0) 11 787 0193 C: +27 (0) 82 877 6459 | E: eddyb@erex.co.za www.erex.co.za

NEGRIBOSSI_pagina_ELE_.indd 8

www.negribossi.com

31/07/17 09:43


Materials

Cot design provides clearer visual access for children Eastman Tritanâ&#x201E;˘ copolyester scratch and stain resistant THE day that Jed Aylmer saw children at the Rahima Moosa Mother and Child Hospital standing in steel cots that looked more like cages than comforting and comfortable places of recovery, he realised that the steel cots were inadequate. 7KHFKDOOHQJHRIUHGHÂżQLQJWKHFRWDQGLQWURGXFLQJQHZ DQGLQWHOOLJHQWIHDWXUHVWKDWZRXOGEHQHÂżWWKHFKLOGUHQDQG the health practitioners, spurred him on to creating the Symba Paediatric Hospital Bed. Jed is the MD of Praestet, a company that designs, assembles and distributes medical products, and he wanted to inject innovation into a product that is used every day by medical professionals, children and parents, but he also wanted to improve the space within which the primary user â&#x20AC;&#x201C; the child â&#x20AC;&#x201C; recovers. He wanted to make the cot look cheerful and provide children with clearer visual access to the world outside their space of recovery from where parents and medical practitioners interact with them, however, he also needed to address the needs of medical professionals such as patient safety, functionality, hygiene, accessibility and mobility, which is something standard that is required in such medical equipment. The rounded â&#x20AC;&#x2DC;softâ&#x20AC;&#x2122; plastic parts in assorted colours would bring the hospital ward to life, however, Jed also needed WRÂżQGWKHULJKWUDZPDWHULDOVLQWHUPVRISURFHVVDELOLW\ and performance. It was at this point that Jed approached Plastichem (Pty) Ltd, a Brenntag Group Company for advice. Tritanâ&#x201E;˘ Copolyester from Eastman was selected as the material of choice for the clear cot side panels, because it has the excellent glass-like clarity that Jed was looking for in the panels whilst being scratch and stain resistant, and yet it met all the other important requirements as well. The grade that was selected may be used in repeated use food FRQWDFWDUWLFOHVXQGHU86)'$UHJXODWLRQVLVFHUWLÂżHGWR NSF/ANSI Standard 51 for Food Equipment Materials and LVDOVRFHUWLÂżHGWR16)$16,6WDQGDUGÂą'ULQNLQJ:DWHU System Components-Health Effects. It also has excellent hydrolytic stability, good chemical resistance, good heat resistance and an outstanding impact resistance. The other consideration was that the panels were comparatively long and narrow by design, so it was necessary to consider ease of processing. Tritanâ&#x201E;˘ 56 OCT / NOV 2017

MATS-PLASTICHEM.indd 56

The rounded â&#x20AC;&#x2DC;softâ&#x20AC;&#x2122; plastic parts in assorted colours bring a childrens hospital ward to life. The Tritanâ&#x201E;˘ Copolyester from Eastman was selected as the material of choice for the clear cot side panels, because it has the excellent glass-like clarity

Copolyester from Eastman had just the ULJKWKLJKĂ&#x20AC;RZJUDGHIRUWKHDSSOLFDWLRQ that combined ease of processing with quick cycle and fast drying times. Praestet Healthcare Design opted to have a Krugersdorpbased provider of turnkey solutions manufacture his moulds DQGLQMHFWLRQPRXOGWKHSDQHOV:LOYLFRZQHGE\WKHZLIH DQGKXVEDQGWHDPRI:LOPDDQG%RJGDQ%RJGDQRYLFDQG managed by Stephan Jansen van Vuuren, provide their clients with a state of the art turnkey operation that begins when their designs and prototypes are born and comes to fruition at the WLPHWKHLUSURGXFWLVVKLSSHGWRLWVÂżQDOGHVWLQDWLRQ:LOYLF discovered that the Tritanâ&#x201E;˘ Copolyester was gentle on their machinery and it was easy to process. Plastichem (Pty) Ltd was on hand to offer them technical support. Today parents can rest assured that their children are receiving a new level of innovative care when tucked into a Symba bed, and this is not only thanks to Jed Aylmerâ&#x20AC;&#x2122;s innovative thinking, drive and passion, and to all the men and women who invested their time and energy into the project, but also to the advanced raw materials in the product, like Eastman Tritanâ&#x201E;˘ copolyester. â&#x20AC;˘ Plastichem represents Eastman in South Africa  'HDQ'HODSRUWH&HOO Email: Dean.Delaporte@brenntag.co.za www.plastichem.co.za

2017/09/28 09:34


News

Next generation 33-layer stretch film DĂ&#x20AC;UVWLQ6$ Load stability and safety

7$,*$106WUHWFKKDVODXQFKHGD¾¿UVW of its kindâ&#x20AC;&#x2122; in the South African plastics industry with their next generation OD\HUVWUHWFKÂżOPÂąWQDQR33. Peter McCullough, MD of Taigan 06WUHWFKVDLGWKDWWKHPDMRU DGYDQWDJHVRIWKHQHZÂżOPZDVWKDW ZKLOHEHLQJRQHRIWKHWKLQQHVWÂżOPVRQ WKHPDUNHWLWGRHVQRWFRPSURPLVHRQ strength and enhances the safety of goods being transported. Because of its thinner gauge, there are also better \LHOGVDQGVLJQLÂżFDQWFRVWVDYLQJVIRU WKHFXVWRPHU

Âł7KLVPHDQVWKDWZHFDQVXSSO\D SURGXFWWKDWZLOOUHTXLUHOHVVÂżOPWR wrap a pallet, resulting in cheaper costs but ensuring that loads are safer when EHLQJGHOLYHUHGWRWKHFXVWRPHU$OOLQ all a winning solution, donâ&#x20AC;&#x2122;t you think?â&#x20AC;? he explained. The t-nano33VWUHWFKÂżOPLVH[WUXGHGRQ WKHPRVWDGYDQFHGHTXLSPHQWDYDLODEOH XVLQJÂľKLJKWHFKÂśUDZPDWHULDOV Âł:HDUHQRWGRZQJDXJLQJPHUHO\ for the sake of down gauging, thus SURWHFWLQJWKHPDQXIDFWXUHUVPDUJLQ :HDUHRIIHULQJDQHZJHQHUDWLRQÂżOP

unlike any that has been used before. The product will show an increase in puncture and tear resistance when DSSOLHGSDUWLFXODUO\RQDXWRPDWLF high speed wrapping lines, it will stretch beyond 360% on the correct applications and offer retention forces around each side that will ensure QRORDGPRYHPHQWZKLOHVWDFNLQJRU transport,â&#x20AC;? McCullough added. Taigan M-Stretch are offering clients a free trial of the t-nano33ÂżOP Contact Peter McCullough on tel: 011 974 1811 or 083 645 8254. www.taigan.co.za

STRETCH FILM

Skin/cling layer

Bulk core layers

Functional nanolayers

Functional layer

Functional layer

How far can it stretch? Peter McCullough, MD of Taigan M-Stretch, demonstrating the DGYDQWDJHVRIRQHRIWKHÂżOPVKHVHOOV

A TAIGAN BRAND C â&#x20AC;&#x201C; Skin/Cling Layer A & B â&#x20AC;&#x201C; Bulk Core Layer D & E â&#x20AC;&#x201C; Functional Nano Layers A & B â&#x20AC;&#x201C; Bulk Core Layer F â&#x20AC;&#x201C; Functional Layer A & B â&#x20AC;&#x201C; Bulk Core Layer D & E â&#x20AC;&#x201C; Functional Nano Layers A & B â&#x20AC;&#x201C; Bulk Core Layer G â&#x20AC;&#x201C; Skin/Slip Layer

58

NEWS TAIGAN.indd 58

OCT / NOV 2017

2017/09/27 15:18


Equipment

Zerma & Crushmaster granulators and shredders adding value around the country ZERMA Africaâ&#x20AC;&#x2122;s Jeff Cawcutt has been kept busy recently installing new Zerma and Crushmaster equipment at plastic converting and recycling operations around the country,

among them Chemcraft and AMPA Group in Gauteng, and Iskra Dealers, a plastic recycler based in Blackheath, Cape Town.

Chemcraft crazy for Crushmaster â&#x20AC;&#x201C; Neil McAlpine of Chemcraft (right) with Zerma Africaâ&#x20AC;&#x2122;s Jeff Cawcutt, is delighted with his latest investment from Zerma Africa â&#x20AC;&#x201C; the Crushmaster H-100 granulator, enabling them to recycle their in-house waste almost immediately. Gauteng based Chemcraft, a leader in the manufacture of plastic chairs, tables, desks and other furniture, as well as corrugated polypropylene sheeting (Corex) had a VSHFL¿FUHTXLUHPHQWIRUDQHZJUDQXODWRUWRXJKHQRXJKWR handle large injection moulded parts, wide enough to accept Corex sheeting without folding or pre-cutting, and priced right. At 1000mm wide, the Crushmaster H-100 granulator with EODGH9FXWURWRUFRQ¿JXUDWLRQLVLGHDOO\VXLWHGDQGYHUVDWLOH HQRXJKWRGHOLYHURQ&KHPFUDIW¶VYDULHGUHTXLUHPHQWV7KH special hopper design, with rear-mounted letter-chute opening, DOORZVIRUWKH&RUH[ERDUGWREHIHGLQWRWKHPDFKLQHDWWKH¿UVW stator blade position on the rotor down-stroke, for easier and IDVWHUIHHGLQJDQGOHVVPDWHULDOÃ&#x20AC;\EDFN

60 OCT / NOV 2017

www.zerma.com

Iskra Dealersâ&#x20AC;&#x2122;s new Zerma shredder â&#x20AC;&#x201C; Riaan Buys of Iskra Dealers with Zerma $IULFD¶V-HII&DZFXWWDQG,VNUD¶VQHZ=HUPD=%6VKUHGGHU,VNUD'HDOHUV DSODVWLFUHF\FOHUEDVHGLQ%ODFNKHDWK&DSH7RZQIDFHGDQLVVXHWKDWPDQ\ UHF\FOHUVDQGFRQYHUWHUVFRPPRQO\GRZLWKUHF\FOLQJPDFKLQHU\JHDUHG SULPDULO\IRU¿OPDQGRWKHUOLJKWZHLJKWSODVWLFVWKH\ZHUHXQDEOHWRHI¿FLHQWO\ SURFHVVOXPSVDQGSXUJLQJV7KH=HUPD=%6VHULHVVKUHGGHULVSXUSRVHEXLOW for this application, virtually plug-and-play with a small footprint and low energy consumption, this entry-level shredder caters for a growing market among recyclers and indeed any plastics company performing regular material and/or colour changes AMPA Group installs a beaut! ±7KH&UXVKPDVWHU6VHULHVKHDY\GXW\JUDQXODWRUVKDYH been tried and trusted across the globe for over 10 years in some of the most demanding applications and recycling environments. With rotors up to 560mm diameter and 1000mm wide, DQGDUHVWULFWHGFXWWLQJFKDPEHUGHVLJQZLWKVWDWRUEODGHSRVLWLRQVWKH6VHULHVLVDLPHG DWKLJKRXWSXWDSSOLFDWLRQVRIWKLFNKHDY\SDUWVVXFKDSLSHVSUR¿OHVDQGVPDOOOXPSVEXWDW WKHVDPHWLPHSURYHVYHU\FDSDEOHLQWKHSRVWFRQVXPHU¿OPLQGXVWU\7KH&UXVKPDVWHU6 granulator, pictured here at the Ampa Group in Johannesburg, with the exceptionally beautiful EODGHURWRULVSHUIHFWO\HTXLSSHGWRGHDOZLWKWKHZLGHUDQJHRIVKHHWLQJSURGXFHGE\$PSD

EQUIP-ZERMA.indd 60

2017/09/28 09:13


Crushmaster.indd 86

2017/09/22 10:47


Equipment

Engel bringing

process monitoring to the next level Provide direct information on the component quality to be expected CYCLICALLY determined performance indicators are used to monitor and optimise injection moulding processes. In the past, the focus was on axle movements and the forces and times that these required. Today, iQ weight monitor goes one big step further. Engelâ&#x20AC;&#x2122;s monitoring software generates performance indicators that provide direct information on the component quality to be expected. From the end of the year, the iQ weight monitor will be one of the standard features on all Engel injection moulding machines. In the development of iQ weight monitor, Engelâ&#x20AC;&#x2122;s SDUWLFXODUIRFXVZDVRQWKH¿OOLQJRIFDYLWLHV)RU WKHVFUHZPRYHPHQWLQWKHVSHHGUHJXODWHG¿OOLQJ phase, the machine operator enters a starting SRVLWLRQDVSHHGSUR¿OHDQGDVZLWFKRYHUSRLQWDV target values. The machine control uses these to calculate DWDUJHWYDOXHVSHFL¿FDWLRQZKLFKWKHLQMHFWLRQUHJXODWRU WKHQIXO¿OVDVEHVWDVSRVVLEOH,QDGGLWLRQWRWKHVSHHGWKH resulting injection pressure curve depends on the amount of PHOWLQWKHVFUHZYHVWLEXOHWKHÃ&#x20AC;RZSURSHUWLHVRIWKHPDWHULDO DQGWKHÃ&#x20AC;RZUHVLVWDQFHDORQJWKHMHWKRWUXQQHUDQGFDYLW\ 'XHWRWKHPDQ\LQÃ&#x20AC;XHQFLQJIDFWRUVWKHLQMHFWLRQSUHVVXUH curve is characteristic to the respective application â&#x20AC;&#x201C; and WKHUHIRUHXQLTXH)OXFWXDWLRQVLQRQHRUVHYHUDOLQÃ&#x20AC;XHQFLQJ factors that occur in practice affect the part quality as well as the pressure curve. Therefore, the pressure-time curve is suitable as an indirect quality monitor. Meaningful performance indicators iQ weight monitor provides three performance indicators for each shot: the injection volume, the change in viscosity of the melt and the congruence between the pressure curve and the reference curve. Since it is directly connected to the actual shot weight, injection volume is the key performance indicator. It takes into account that differences in the closing behaviour of the nonreturn valve result in more or less material being conveyed into the cavity. Change in viscosity, the second performance indicator, is PHDQLQJIXOEHFDXVHWKHYLVFRVLW\GHWHUPLQHVWKHÃ&#x20AC;RZFDSDFLW\ of the melt, which in turn determines the injection volume. 9LVFRVLW\FKDQJHVFDQUHVXOWIURPIRUH[DPSOHÃ&#x20AC;XFWXDWLRQVLQ the batches of material, the percentage of recycled material content, the moisture content or changes in temperature. Thirdly, the congruence of the pressure curve provides valuable indications of the existence of other disrupting factors during injection moulding. For example, an extremely Ã&#x20AC;XFWXDWLQJYDOXHPD\LQGLFDWHWKDWWKHSURFHVVLVSRRUO\ adjusted or that a cold plug has formed in the nozzle. 62 OCT / NOV 2017

EQUIP-ENGEL IQ.indd 62

The respectively current performance indicators are clearly presented on the display of the CC300 control of the injection PRXOGLQJPDFKLQH7UDI¿FOLJKWFRORXUVLQGLFDWHZKLFKYDOXHV DUHZLWKLQDQGZKLFKDUHRXWVLGHRIWROHUDQFH

6PDOOHIIRUWKXJHEHQH¿W At Fakuma 2017, from 17-21 October in Friedrichshafen, Germany, Engel will demonstrate how easy it is to fully XVHWKHSRWHQWLDORIL4ZHLJKWPRQLWRU$W¿UVWWKHRSHUDWRU optimises the process to the desired component quality as usual, and then starts the reference measurement with the push of a button. During the running process, the continuously calculated performance indicators can be monitored directly on the display of the CC300 control of the injection moulding, or, independent of location, through an MES. As iQ weight monitor already calculates the performance indicators in the course of injection, in case of deviation from the target values the system provides the opportunity to make corrections within the same cycle, thus proactively preventing rejects. Engel has also developed a software for this in-line regulation. iQ weight control adjusts the switchover point and WKHKROGLQJSUHVVXUHSUR¿OHWRWKHUHVSHFWLYHVWDWHLQHDFK cycle, thus maintaining a consistent injection volume. How well iQ weight control can improve reproducibility depends on several factors. Naturally, processes that are already very stable in and of themselves can only be optimised to a lesser extent. In order to evaluate the additional effect that iQ weight control may have, iQ weight monitor provides the injection moulder with a very smart feature: it calculates the improvement potential achievable through iQ weight control. â&#x20AC;¢ ENGEL at Fakuma 2017 Hall A5, booth 5204 â&#x20AC;¢ Engel is represented in SA by GreenTech Machinery www.greentechmachinery.co.za ZZZHQJHOJOREDOFRP

2017/09/27 14:43


A new generation takes shape.

Take the proven and tested, make it even better and explore something new â&#x20AC;&#x201C; that is what makes ENGEL and their customers so successful. Following our claim be the first, we present a new generation of injection moulding machines setting new standards. For now, we will entice you with this: We do not compromise on energy efficiency, ergonomics or precision. Do you want to know more?

www.engelglobal.com www.greentechmachinery.co.za sales@greentechmachinery.co.za

4854.14 ENG ANZ ZA postK A4 en 170126.indd 1

26.01.2017 10:26:16


News

FdB Consulting Engineering Design forges ahead

64 OCT / NOV 2017

Sole representation for Rapid Granulator in sub Saharan Africa 2017 has been an excellent year so far for FdB Consulting Engineering Design, reports Frank Blues, who started the business in 2012 to assist plastics industry customers with projects and engineering design solutions and to provide expertise where required. Frank has worked with Danish company, Rapid Granulator, since 2012, and 2016 was awarded sole representation in sub Saharan Africa as distributor for the company. Âł,QWKHÂżUVWIXOO\HDU,ZDVGLUHFWO\ZLWK5DSLG â&#x201A;Ź470,000 sales were recorded,â&#x20AC;? he says. Part of the responsibility of being a distributor is that FdB Consulting Engineering Design carries stock of selected fast-moving spares for

Rapid Granulatorâ&#x20AC;&#x2122;s â&#x20AC;&#x2DC;open-heartedâ&#x20AC;&#x2122; machines. FdB has also picked up several other contracts, representing BM Silo Fabrik, also of Denmark and is expanding its range of FXVWRPHUVZKRVHHWKHEHQHÂżWRIWKLVPRGXODU system for storage of raw materials. Since December 2016, the company has also supplied machines and spares to businesses in Zimbabwe, Zambia, Ghana and Kenya. One of the highlights of the past year was the installation at Nampak Liquids Cape Town of a Rapid 300-45 KU with Venturi hopper, DS-50 dust separator, regrind material bin with high/low level rotary sensors controlling the blower on/off to the silo.

One of the highlights for FdB Consulting this year was the installation at Nampak Liquids Cape Town of a Rapid 300-45 KU with Venturi hopper, DS-50 dust separator, and regrind material bin with high/ low level rotary sensors controlling the blower on/off to the silo

Rapid Granulator Appoints New Distributor for South Africa Effective from December 15th 2016, Rapid Granulator AB, the Swedish-based world leader in plastics granulation technology, has signed up FdB Consulting, Johannesburg, as its sole distributors for the South Africa and Sub-Sahara Market

Regrind Material Bin Bulk Bag Discharge Station with 2 Ton Elec Hoist

Representative in Africa

CONSULTING High value processing of films fibers in-house production scarp and wasted post consumer waste. For materials: PE, PP, PS, PPS

Frank Blues Engineering Design

+27 (0)82-651 3315 frank@fdbconsulting.co.za


za

Virgin silos and regrind auger feed silos for intermediate storage

FdB Consulting Engineering Design is also involved in a buy-back agreement with Nampak to replace 10 old generation Rapid 20 series machines with new generation Rapid 200-36 KU machines over a certain period. The buy-back PDFKLQHVZLOOEHFRPSOHWHO\UHIXUELVKHGÂżWWHG

with spares and powder coated for resale. â&#x20AC;&#x153;The aim of this arrangement is to provide Nampak with a solution to current downtime on the old machines. The new generation is more accessible and has a higher throughput. This also provides Nampak with machines which will QRZFDUU\DÂżYH\HDUZDUUDQW\JRLQJIRUZDUG´ Frank explains. Frank can also offer customers two options of pelletising extruders â&#x20AC;&#x201C; KMB Extruders from India and Polystar form Taiwan. â&#x20AC;&#x153;We also offer SLAâ&#x20AC;&#x2122;s to our clients as we feel this is an ongoing method of conducting training and educating customers in the correct use and maintenance of the products. During our visits to carry out the SLA, we are also in a position to offer support on other brands at the request of WKHFXVWRPHU´KHDGGV

FdB Consulting manufacture their own range of material regrind bins in various capacities. The bins are suitable for placing directly beneath a cyclone or dust separation unit. They KDYHDKLQJHGOLGDQGDUHÂżWWHGZLWKD Ă&#x20AC;DQJHIRUTXLFNFRXSOLQJ7KHELQV DUHÂżWWHGZLWKEODQNLQJSODWHVZKLFK cover pre-drilled openings for rotary OHYHOVHQVRUV$VOLGHJDWHLVÂżWWHGRQ the underside of the cone of the bin for bin emptying and cleaning. The bin can be supplied with suction points DQGLVPRXQWHGRQORFNDEOHFDVWRUV There is also a viewing slot for visual FKHFNLQJRIWKHPDWHULDOOHYHOLQWKHELQ OCT / NOV 2017 65


Equipment

DME TruCool

â&#x201E;˘

conformal cooling

Reduced cycle time, increased throughput and improved quality

66 OCT / NOV 2017

COOLING is the mould manufacturerâ&#x20AC;&#x2122;s next big opportunity! Cooling is often the longest portion of the moulding process, opening the door for major improvements and savings.

TruCool conformal cooling provides superior heat transfer over conventional cooling technologies â&#x20AC;&#x201C; on the left, conventional machined cooling, and right, conformal cooling

EQUIP-MDS.indd 66

TruCoolâ&#x201E;˘ Conformal Cooling (by DME) uses the cutting edge Direct Metal Laser Melting (DMLM) 3D printing process to produce highly complex cavities, cores and components with conformal cooling channels. This technology revolutionises mould building, allowing the â&#x20AC;&#x2DC;un-machinableâ&#x20AC;&#x2122; to be built. Conformal cooling achieves shapes, paths and channel geometries impossible to obtain with conventional tooling. The proprietary 3D formulation technology for metal powder processing, enables the delivery of 3D printed metal without porosity, and that is superior to other standard off-the-shelf formulas. By controlling both the hot and now the cold halves, the mould manufacturer can now have full process parameter control. The design solution places cooling (or heating) channels at the optimal distance from the part surface, allowing the mould to maintain a targeted, consistent temperature for complete thermal control. 7KLVWHFKQRORJ\RIIHUVYDULRXVNH\EHQHÂżWVLQFOXGLQJ â&#x20AC;˘ Cycle time reductions up to 60% â&#x20AC;˘ 8QOLPLWHGGHVLJQĂ&#x20AC;H[LELOLW\ â&#x20AC;˘ Improved quality â&#x20AC;˘ Complete thermal control of mould surface â&#x20AC;˘ Optimized cooling eliminates hot spots â&#x20AC;˘ Improved dimensional stability

2017/09/27 14:46


Equipment

inserts â&#x20AC;¢ Minimizes thermal drift which causes warpage, sink and distortion

â&#x20AC;¢ Process control over cooling cycle â&#x20AC;¢ Increase production capacity â&#x20AC;¢ Decrease cavitation Full design services are offered which include FEA analysis of the conventional solution, design of the conformal channels, simulation and comparative analysis and addition of mill stock. After manufacture involving the 3D print of the insert, FRPSUHKHQVLYHWHVWVDUHFDUULHGRXWYHULI\LQJWKHÃ&#x20AC;RZDQG SUHVVXUHWHVWDIXOOGLPHQVLRQDOYHUL¿FDWLRQZKHUHXSRQWKH

Typical injection moulding cycle (% of processing time)

inserts are heat treated.

â&#x20AC;¢ For more information contact Richard Carter at Mould & Die Solutions on 010 410 5350, or 021 555 2701 www.m-d-s.co.za

OCT / NOV 2017 67

Custom designed cooling for your mould

$&&85$7(5(63216,9($1',178,7,9( 7(03(5$785(&21752//(56 0ROG0DVWHUV¶06HULHVFRQWUROOHUVGHOLYHU VWDWHRIWKHDUWWHFKQRORJ\ZLWKDXVHUIULHQGO\ LQWHUIDFHDWWKHORZHVWFRVWRIRZQHUVKLS &RPSDWLEOHZLWK$1<KRWUXQQHUV\VWHP

ZZZPGVFR]D

EQUIP-MDS.indd 67

&RQWDFWXV

&DOO (PDLO

&37  -+%  LQIR#PGVFR]D 2017/09/27 14:47


Equipment

Movacolor launches

new dosing concept Ultra-compact, accurate mixing, easy colour change MOVACOLOR have launched a new dosing concept with the release of the MCHybrid 30 and MCHybrid 200. The MCHybrid 30 is a cross-over between a batch blender and an inOLQHGRVLQJV\VWHPFRPELQLQJWKHEHQHÂżWV of both systems. Two main components are blended in an ultra-compact batch blender with a maximum capacity of 350 kg/h, allowing accurate mixing of two main materials or a main material and a regrind in any ratio. The colour or additives are ÂżQDOO\DGGHGLQOLQHWRDFKLHYHPD[LPXPDFFXUDF\ and easy colour change as we are used to with in-line dosing systems. Also liquids and (non-freeĂ&#x20AC;RZLQJ SRZGHUVFDQEHDGGHGLQWKLVZD\ The MCHybrid 30 handles up to four components, two in batch and two in-line and is a 100% gravimetric system. The control of the total system is via our 8â&#x20AC;? full colour touch screen with simple operating menu and full recipe functionality.

The MCHybrid 30 is a cross-over between a batch EOHQGHUDQGDQLQOLQHGRVLQJV\VWHPFRPELQLQJWKHEHQHÂżWVRI both systems 68 OCT / NOV 2017

EQUIP-BANBURY VISHA.indd 68

Key features include its up to 350kg/h capacity; ultra compact design; gravimetric control of all components; high accuracy of the additives, also at extreme low percentages; easy colour change and the fact that it works with granulates, regrinds, OLTXLGVDQG QRQ IUHHĂ&#x20AC;RZLQJSRZGHUV The MCHybrid 200 is a larger version than the MCHybrid 30, with capacities up to 1,000 kg/h and a maximum of eight component blending and up to 14 components in-line dosing. This unit also has the option of a weighing mixing chamber, allowing real time throughput measurement for extrusion applications. By blending only the main components and adding the small components in-line, the MCHybrid system can be far more accurate in the VPDOOFRPSRQHQWVDQGLVPRUHĂ&#x20AC;H[LEOHDVZHOO Apart from its capacity, other key features include the fact that it is fully gravimetric, extremely compact and able to handle powders and liquids in one system. It is also quick and easy to change additives and offers the option of a weighing mixing ELQ UHDOWLPHWKURXJKSXWPHDVXUHPHQW  â&#x20AC;˘ Banbury represent Movacolor in South Africa www.banbury.co.za

2017/09/28 09:25


bagmaker is ultra-versatile

Equipment

New version of Veloss 800S Workhorse â&#x20AC;&#x201C; The Veloss Amaze 810 multi-purpose side-seal bagmaking machine from Vishva Exim is a versatile system which can run a wide variety of bag designs with rapid job changeove

Keeping productivity up is the name of the game EHFDXVHRILWVYHUVDWLOLW\LWFDQ UXQPDQ\GLIIHUHQWMREVDQG materials and offers minimum FKDQJHRYHUWLPHV â&#x20AC;&#x153;One can run HDPE, LDPE, PP, CPP and BOPP RQWKHVDPHPDFKLQHMXVW E\FKDQJLQJWKHMDZRIWKH PDFKLQH´VDLG8GD\6KDK RI9LVKYDRI,QGLDZKRLVD regular visitor to Africa and who has seen his companyâ&#x20AC;&#x2122;s HTXLSPHQWEHFRPLQJVWHDGLO\ PRUHSRSXODULQ6RXWK$IULFD DVZHOODV(DVW$IULFD

â&#x20AC;&#x153;This is a real workhorse of DPDFKLQH´VDLG8GD\ It can produce patch handle EDJVGLHFXWKDQGOHSXQFK EDJVFRXULHUEDJVSRVWDO EDJVVLPSOHVLGHVHDOEDJV ORZPLFURQEDJVJUDSH QXUVHU\EDJVFKLFNHQDQG SHQEDJVDQGSRVVLEO\HYHQ RWKHUV 9LVKYDVWRFNVVSDUHVLQWKH country to give faster after VDOHVVHUYLFH www.vishvaexim.com

OCT / NOV 2017 69

Uday Shah of Vishva Exim

IN THE highly competitive market, most processers cannot afford to run dedicated PDFKLQHVIRUVSHFLÂżFMREV The choice is thus to select versatile equipment and, as far as the manufacture of EDJVJRHVWKH9HORVV6 IURP9LVKYD([LPLVDSHUIHFW FKRLFH The new version of the 9HORVV6PXOWLSXUSRVH VLGHVHDOPDFKLQHZKLFKFDQ UXQDWF\FOHVDPLQXWH is a huge hit in the market

Presents

RANGE OF BAG MAKERS

MORE THAN 50 INSTALLATIONS IN 3 YRS

In this competitive market processer cannot afford to run dedicated machines for speciďŹ c jobs. So the Veloss 800s is the perfect choice for customers. Their new Veloss 800s, multi-purpose, side seal machine â&#x20AC;&#x201C; 300 cycles/min â&#x20AC;&#x201C; is a huge hit in the market because of its varsitility with running many different jobs and materials with minimum change over time. One can run hdpe, ldpe, pp, cpp and bopp on the same machine just by changing the jaw of the machine. Talk to us about our work horse machine. They also stock spares in the country to give faster after sales services.

VELOSS 800S â&#x20AC;&#x201C; MULTI PURPOSE â&#x20AC;&#x201C; SIDE SEAL MACHINE â&#x20AC;&#x201C; SPEED: 300 BAGS/MIN Side sealing: www.youtube.com/watch?v=uSO9JxfHFa8

THE TYPE OF BAGS THAT CAN BE MADE: 1. Patch Handle Bags 2. Die Cut / Handle Punch Bags 3. Courier / Dhl Bags 4. Postal Bags

5. Simple Side Seal Bags 6. Low Microns Bags 7. Grape / Nursary Bags 8. Chicken Bags 9. Pen Bags

WWW. VISHVAEXIM. COM Contact us: Vishva Exim Pvt Ltd T: +91 98 797 97910 M: +91 909 991 6958 1225 E: info@vishvaexim.com

EQUIP-BANBURY VISHA.indd 69

2017/09/27 11:01


Middle East The polyethylene capacity in Saudi Arabia will increase by 1,5 million tons by the end of the year with the commissioning of Sadara, the world’s largest chemical complex (pictured above) and PetroRabigh

Future for Middle East polymer industry looks bright – or does it? USA has ethylene feedstock costs almost as low as Middle East BY NIALL MARSHALL

MORE than a third of all plastics produced are HDPE, MDPE, LLDPE or LDPE, that is polyethylene. Most of the 95 million tons of PE converted in 2016 was processed in China, Europe or North America – with almost 20% or 17 million tons of that PE produced in only four countries: Saudi Arabia, UAE, Qatar and Kuwait and a further 8 million tons produced in Iran and Egypt. The market for PE is expected to grow to more than 120 million tons per year by 2025 and China, the biggest export market for Middle East PE, converted 24 million tons of PE in 2016, a 7% growth over the previous year. So, with an additional 1.5 million tons of capacity coming on-line in Saudi Arabia by the end of the year at Sadara and PetroRabigh, increased volumes of ethylene in Qatar are being made available for another 1 million tons and a new 830 000 ton per year plant will be commissioned in Oman in 2019, the future for the Middle East polymer industry looks bright – or does it? North America produced more PE than the Middle East (excluding Iran) – approximately 20,5 million tons in 2016 but, with a large domestic market, only about 2 million tons was exported outside of the NAFTA countries, most of it to Latin America but also with some volumes heading to China and Europe. For many years this large market was quite stagnant – high feedstock costs meant there had been 70

no investment in PE production, but the “shale revolution” changed everything. Suddenly the USA has ethylene feedstock costs almost as low as the Middle East and there is a glut of new PE capacity due to come on-line in the next few years: about 3 million tons in 2017 and a further 2 million tons in 2018. All this additional polymer will QHHGWR¿QGDPDUNHW±WKHH[SHFWHG growth in the US domestic market ZLOOQRWEHVXI¿FLHQWWRDEVRUEDOOWKLV capacity. China, the biggest consumer of PE, imported about 9 million tons of PE in 2016, most of it from the Middle East. But China is also investing in PE capacity – 2 million tons in 2017 and another 1,5 million tons in 2018. So while China is expected to remain a net importer it is not expected to increase the volumes of PE that it needs to import. 7KLVPHDQVZHFDQH[SHFWDVLJQL¿FDQW overcapacity of PE developing in the next few years with the Middle East and North America competing for market in Europe, Asia and Africa. The Middle East polymer industry is very relieved that President Trump has pulled the USA out of the proposed 733 7UDQV3DFL¿F3DUWQHUVKLS WUDGH agreement with Asian and South American countries (excluding China) the Trans-Atlantic Trade and Investment Partnership (TTIP) with the EU - both of which potentially would have given 86SRO\HWK\OHQHDGXW\EHQH¿WRYHU polymer from the Middle East. As it

is, Middle East producers capped the volumes exported to Europe when the duty was increased from 3% to 6,5% by the EU in 2014, preferring to sell those volumes to Asia. So can we expect increased PE capacity to result in lower PE prices? It depends! Globally PE is a commodity, and so the price naturally moves depending on supply and demand. But the price LVDOVRLQÀXHQFHGE\FRVW6RWKH global spot price of the polymer will largely be determined by the most expensive production required to meet the demand. Will prices drop with increased PE capacity? It all depends on the demand, and it depends on costs. If demand is more than the low-ethylenecost capacity then prices will go up. What the shale revolution does is it makes North America the secondlowest cost PE production region after the Middle East and increases the volume of low-ethylene cost polymer produced, and so North American PE will be able to compete strongly in export markets. The new naphthaor coal-based ethylene PE plants in China have a higher feedstock cost. And so, even with the massive growth in PE capacity in the next few years the outlook for the Middle East PE producers still looks positive – otherwise Borouge wouldn’t have announced plans to expand its polymer capacity, mostly PE, from the present 4,5 million tons to 10 million tons per year in 2023.

OCT / NOV 2017

Middle East feature.indd 70

2017/09/27 11:02


We make things better

Speak to us.. We know hot runners!

TEL: 011 462 2990

info@demaplastech.co.za

www.demaplastech.co.za


Design

Recognising the most creative, innovative and best. A whole-body imaging system, a dual washer and dryer concept, an augmented reality viewer, a temperatureadjustable coffee mug and a multi-device wireless keyboard are among the 2017 International Design Excellence Awardsâ&#x20AC;&#x2122; WRSZLQQHUVZLWKVLJQL¿FDQWSODVWLFVFRQWHQW The Industrial Designers Society of America received more WKDQ,'($HQWULHVIURPFRXQWULHV-XGJHVVHOHFWHG 77 top winners â&#x20AC;&#x201C; those eligible for gold and silver recognitions ±DQGEURQ]HZLQQHUV

Plastics Innovation Award

Makeblock Neuron THE Plastics Innovation award, sponsored by the Plastics Industry Association went to the Makeblock Neuron, a building EORFNSODWIRUPIRU67(0HGXFDWLRQDQGSUDFWLFH'HVLJQHUVDW IU+Design and Makeblock, both of Shenzhen, China, also won DJROGDZDUGIRUWKH0DNHEORFN0DWHULDOVLQFOXGHSODVWLFVDQG VLOLFRQHUXEEHU $1HXURQHOHFWURQLFGHYLFHLQFRUSRUDWHVDQLQWXLWLYHÃ&#x20AC;RZ based Makeblock software application for programming at all educational levels of science, technology, engineering and PDWKHPDWLFVGLVFLSOLQHV0RUHWKDQNLQGVRIEORFNVFDQ IXO¿OOGLIIHUHQWIXQFWLRQV(DFKEORFNFDQELQGZLWKRWKHUVWR EHFRPHDPXOWLIXQFWLRQDOVPDUWHOHFWURQLFVVROXWLRQ Designed by: Jiye Shen, Shenghui Jia and Junyao Li of IU+ Design; and Yiyue Zheng and Pu Liu of Makeblock R&D Center for Makeblock Co., Ltd. Contact: jiashenghui@gmail.com www.makeblock.com/en

72 OCT / NOV 2017

Best in Show

The Hololens

THE device design team of Redmond, Washington-based Microsoft Corp won gold for the HoloLens augmented reality viewer, Surface Dial digital accessory and Surface Studio desktop personal FRPSXWHUOLQH In the Consumer Technology category, Microsoft says the HoloLens is the ¿UVWVHOIFRQWDLQHGIXOO\XQWHWKHUHG KRORJUDSKLFFRPSXWHU$QRXWVLGHULQJRI thick plastic contains the technology, and a slim cushioned adjustable inner ring FRQQHFWVZLWKWKHXVHU¶VKHDG$IDEULF DQGIRDPFRQVWUXFWLRQFRPSULVHVWKH¿W system for comfortable wearing, and a www.microsoft.com/en-us/hololens

Ã&#x20AC;H[LEOHQ\ORQDQGVLOLFRQHVKHOOKLGHVDQG protects a tightening slider mechanism DOORZLQJDFFXUDWHDOLJQPHQWWRWKHH\HV A hard-coated PC visor and additional coatings protect the machine-polished glass optics, which have nano-imprinted diffractive optical waveguides and can UHGXFHUHÃ&#x20AC;HFWLRQVDQG¿QJHUSULQWV 0LFURVRIWVSHFL¿HVVLOLFRQHRYHUPROGLQJ of the deviceâ&#x20AC;&#x2122;s shells that come in contact ZLWKWKHXVHU0RXOGHGPDJQHVLXP thermal channels provide rapid heat GLVVLSDWLRQDQGVWUXFWXUDOULJLGLW\$ computer-numerical-control machined bar of magnesium connects the sensors

DQGRSWLFV The immersive HoloLens puts holograms into a physical environment and gives a user a new way to see the ZRUOG Designed by: Microsoft Device Design Team Contact: nidenhez@ microsoft.com


The FlexWash and FlexDry DESIGNERS for Samsung Electronics won multiple top awards for these entries: the FlexWash + FlexDry washer and GU\HUGXRFRQFHSWWKH4Ã&#x20AC;RRU standing air conditioner and the Q9 QLED television set. FlexWash + FlexDry took home a gold medal. Its materials include ABS, PC, PP, glass and stainless steel. In the Home & Bath category, the duo concept facilitates customized clothes care through segregation during the washing process and separated drying and aims to optimize usability based

RQKXPDQEHKDYLRXU7KHVPDOOORDG washing machine within the larger washing machine reduces water and power consumption. A specialized drying method for delicate clothes adds a new value of fabric care to the existing tumble dryer. Segregated drying is possible. The manufacturer used a â&#x20AC;&#x2DC;Distinctness of Imageâ&#x20AC;&#x2122; concept in designing each productâ&#x20AC;&#x2122;s front frame. The DOI LQWHJUDWHVVHSDUDWHEUXVKSDWWHUQHGDQG HYDSRUDWLYHFRDWLQJSURFHVVHVWKDWZHUH required in existing Samsung productsâ&#x20AC;&#x2122; YLQ\OFRDWHGPHWDOVXUIDFH6DPVXQJVDLG the integrated DOI design may reduce cost by 20% and enhance productivity. Credits for the FlexWash + FlexDry design go to Sanghoon Yoon, Yuna Park, Myunggyu Kim, Ahjung Joo and Kyoungmin Lee.

Vectra whole body imaging system XVHGIRUSRGIDFHDOLJQPHQWZLWKFXVWRPFORVHG cell polyurethane foam gasket material for pod VHDOLQJDQGFXVWRPFORVHGFHOOSRO\WHWUDÃ&#x20AC;XRUR ethylene foam gaskets for shock absorbers and JDS¿OOHUV7KHGLIIXVHUPDWHULDOLVPDGHRIFDVW acrylic, and the levelling feet are rubber. To achieve the desired goal, designers and SURFHVVRUVSXVKHGVRPHRIWKHSRO\PHUPROG ing techniques to their design limits. Tolerance requirements and curved geometries were challenging. Each plastic component needed to be precise to allow for exact camera placement without compromising the design aesthetics. Credits go to HS Designâ&#x20AC;&#x2122;s Stephen Simantiras, Robert Boyer, Alex Gorschkov and others on the design and HQJLQHHULQJ¿UP¶V&DQ¿HOGVFLHQWL¿FWHDP

OCT / NOV 2017 73

AN HS Design team in Gladstone, New Jersey, won a gold award for the Vectra WB360 3D ZKROHERG\LPDJLQJV\VWHPIRUELRWHFKQRORJ\ ¿UP&DQ¿HOG6FLHQWL¿F,QF Designed primarily for dermatology, the system entered the commercial market in its ¿QDOIRUPLQ)HEUXDU\,QDVLQJOHFDSWXUHWKH WB360 can image a personâ&#x20AC;&#x2122;s entire skin surface LQPDFURTXDOLW\UHVROXWLRQ7\SLFDOWRWDOERG\ imaging requires about 25 photographs. 3ODVWLFVLQFOXGHSOXJDVVLVWHGYDFXXPDQG SUHVVXUHIRUPHGDFU\OLF39&.\GH[EUDQGVKHHW for external housings and an injection moulded blend of polycarbonate and ABS for both pod KRXVLQJVZLWKDOXPLQLXPEDVHSODWHVDQGHTXLS PHQWER[HVIRUZKLWHOLJKWÃ&#x20AC;DVKHV &XVWRPGXURPHWHUVLOLFRQHJDVNHWVDUH


Design

74 OCT / NOV 2017

The Google Home speaker IN the Consumer Technology category, designers for Google won gold for both the Google Home voice-activated speaker and the Daydream View headset and motion controller, and they shared credit for a silver for the Jamboard interactive whiteboard. Principal materials in the Google Home are PC and painted steel. The fabric contains 33% nylon and 67% polyester and has hydrophobic and antimicrobial coatings. A user can start by saying, “OK, Google,” and proceed to ask questions of the Google Assistant, request particular music or give instructions relating to everyday tasks and control of smart devices around a home. Credits for Google Home go to Jung Tak, Kristen Beck, Amy Martin, Michael Sundermeyer and others on the Google Design Team. Contact: ammartin@ google.com

QCollar

Daydream View THE Google-designed lightweight and durable Daydream View headset and motion controller provide an immersive virtual reality experience. Materials include multiple layers of soft, breathable fabric and foam. The outside of the device is a knitted SRO\HVWHUIDEULF7KHKHDGVHW¿WVRYHU most eyeglasses. Google began selling the Daydream View in November. Contact: ptdang@google.com www.vr.google.com/daydream/headset

INDIVIDUALS at Priority Designs of Columbus, Ohio, won gold for the brain-protecting Q-Collar device from Q30 Sports Science LLC doing business as Q30 Innovations LLC of Westport, Conn. Materials include silicone, PU, TPE and stainless steel. The Q-Collar is designed to mitigate the dangers of concussive blows for athletes, military personnel and industrial workers. Q30 began development work on the product in 2012 and is pursuing regulatory approvals. Q30 says the Q-Collar is the world’s ¿UVWWHFKQRORJ\WRXVHWKHERG\¶V natural physiology to protect against mild traumatic brain injury caused by concussive events. The Q-Collar applies slight pressure to the neck and mildly increases blood volume in the brain creating a bubble-wrap-type cushion that reduces slosh, which effectively is the twisting and slamming of the brain against the skull’s interior walls. Credits go to Jamison Float, James Lua, Kevin Vititoe, Sherry Jones and others on the Priority Designs team. Contact: vbreon@prioritydesigns.com

www.prioritydesigns.com

Poputar P1 DESIGNERS for the Shenzhen Shigan Culture Technology Co. Ltd. of Shenzhen, China, won gold for the Poputar P1 self-learning guitar. 0DWHULDOVLQFOXGH$%6IRUWKHJXLWDU¿QJHUERDUGDQGZRRGV including spruce, sapele and nato. A seamless combination meshes wood to the guitar neck. Poputar targets music beginners learning basic guitar skills. The guitar neck holds 120 light-emitting diodes. A user can visually locate the chord positions in the electronic mode. Poputar can provide a music rhythm game with real-time sound recognition. When not needing the lights, the instrument can function as a traditional folk guitar without any electronic components. The Poputar P1 model began entering the commercial market in June 2016. Credits go to JunDa Ye, QiRan Song, Yan Huang, FeiFei Li and YuJie Hao. Contact: 394180493@qq.com www.poputar.com


Design

Scooter for Life DESIGNERS at PriestmanGoode Ltd of London won a top award for the Scooter for Life, which The Design Museum in London commissioned. Materials include ABS for the EDJVKHOOSRO\PHUPDWUL[FRPSRVLWHVIRUWKHEDVHERDUG and aluminium for the frame. The scooter is intended as a safe and intuitive way to help seniors maintain independence through greater mobility. Two large wheels are mounted in the front and one small wheel in the back. The user must release the brakes before proceeding. A front basket is convenient for shopping. Electric power is an option. A function to return home helps those with mild forms of dementia. Designed by: Paul Priestman, Dan Window and Mike Lambourn of PriestmanGoode for The Design Museum in London Contact: anna@priestmangoode.com

Worx Switchdriver FIVE designers for Positec Group Ltd.â&#x20AC;&#x2122;s tool unit in Suzhou, China, won gold for the proprietary :RU[EUDQGYROW6ZLWFKGULYHUIRU GULOOLQJKROHVDQGGULYLQJVFUHZV*ODVVÂżOOHG nylon is used for the housing and TPE for the grips. The 3-pound unit has two quarter-inch chucks and a twoVSHHGJHDUER[ZLWKQRORDGVSHHGVRIÂąDQGÂą revolutions per minute. Switchdriver retails for $99 and entered the market in September 2015. Credits go to Fangyong Wang, Gang Xu, Haibo Zhou, Wenjin Huang and Qiaohua Tao. Contact: mkmcomm@gmail.com

www.priestmangoode.com

www.worx.com

76 OCT / NOV 2017

Logitech K780

Mugello R D-Air

FEIZ Design Studio of Amsterdam, the Netherlands, and the Logitech International SA design team won gold for the Logitech K780 multi-device ZLUHOHVVNH\ERDUG/RJLWHFKVD\VWKH.LVWKHÂżUVWIXOO\ equipped computer keyboard with a 10-key numerical pad IRUXVHZLWKVPDUWSKRQHVDQGWDEOHWV7KHGHVLJQVSHFLÂżHV injection moulded ABS for the top case and keys, Mylarbrand stretched PET for the bottom and rubber-overmoulded ABS for the main body and cradle. An integrated rubber slot can cradle a smartphone, tablet or other device at a user-desired reading angle. Injection moulding of the components occurs at contractor facilities in Belgium and China. The unique speckled rubber was developed in collaboration with compounder PolyOne Corp. of Avon Lake, Ohio. The K780 has a steel plate stabilizer and features scissor key construction. An Easy-Switch-brand button permits a user to transition quickly and seamlessly between devices. The K780 keyboard entered the U.S. commercial market in September 2016. Designed by: Feiz Design Studio and Logitech Design Contact: info@ feizdesign.com

VICENZA, Italy-based protective wear manufacturer Dainese SpA won gold for its Mugello R D-Air-brand motorcycling suit. Dainese developed the suit in collaboration with the MotoGP racing legend Valentino Rossi, incorporating 25 new WHFKQLFDOIHDWXUHVDQGÂżYHSDWHQWHGLQQRYDWLRQV7KH top-of-the-line suit is composed mostly of 0.9-millimeterthick kangaroo leather and sells for about $4,600. 'NQLWWHGQ\ORQDQG38ÂżEUHVDUHXVHGLQ elasticated inserts in the inner area of the limbsâ&#x20AC;&#x2122; SURWHFWLRQ7KHVDPHÂżEHUVDUHZRYHQWRVWUHWFK diagonally in the elasticated inserts around the crotch. The bag component of the airbag is made of PUlaminated 3D-woven polyester fabric. The bagâ&#x20AC;&#x2122;s two SDUDOOHOVXUIDFHVDUHNHSWĂ&#x20AC;DWDQGWHQVHGE\KXQGUHGV of transverse wires that increase impact resistance and coverage. Several parts of the suit are built with Kevlar aramid ÂżEUHWH[WLOHEDFNLQJWRLQFUHDVHDEUDVLRQUHVLVWDQFH The titanium plates on the joints can protect a rider if sliding on the pavement. Production occurs in Tunisia. Investcorp Bank BSC of Manama, Bahrain, includes Dainese in its portfolio of investments. Dainese also makes protective wear for mountain biking and downhill skiing. Designed by: Dainese SpA Contact: marcello. bencini@dainese.coM www.dainese.com

www.feizdesign.com


PACKAGING THAT PROTECTS Packaging helps to preserve food and protects both consumers and goods. SABIC develops innovative polyethylene and polypropylene solutions with a higher performance and purity. That is how ‘Chemistry that Matters™’ really delivers for all of us.

© 2016 Copyright by SABIC. All rights reserved.


Design The rotationally moulded PP wheelbarrow can also be used as a vendor cart and a boat for VDIHWUDQVSRUWGXULQJĂ&#x20AC;RRGV

Multifunctional roto moulded wheelbarrow vies for major award

78 OCT / NOV 2017

Wheelbarrow designed to serve multiple uses in emergencies, daily life TWO enterprising university students in Melbourne, Australia, are vying for a major award with their design for a plastic wheelbarrow that doubles as a boat and a vendor cart. According to Plastics News, Lachlan Meadows and Hugh McKay, both aged 23, developed the utility barrow as part RIWKHLUÂżQDO\HDUVWXGLHVLQSURGXFW design engineering at Melbourneâ&#x20AC;&#x2122;s Swinburne University. They were given a brief to develop a SURGXFWWRKHOSSHRSOHOLYLQJLQĂ&#x20AC;RRG prone Kampung Melayu, a village on the edge of Ciliwung River, in Indonesia, ZKLFKĂ&#x20AC;RRGVWKUHHRUIRXUWLPHVD\HDU Meadows told Plastics News that the SDLUIULHQGVWKURXJKRXWWKHLUÂżYH\HDU university course, thought the rotationally molded polypropylene wheelbarrow would be useful for villagers to clean up

WKHLUPXGÂżOOHGKRPHVDIWHUĂ&#x20AC;RRGV They selected PP as the resin to give the product strength and because it could not be punctured easily. Meadows and McKay added rings to the side of the barrow so villagers can slip poles into them to use the barrows as vendor carts to sell produce, which is their major income source. They also ensured the EDUURZFDQĂ&#x20AC;RDWVRYLOODJHUVFDQXVHLW IRUVDIHWUDQVSRUWGXULQJĂ&#x20AC;RRGV The design, created using 3D modeling, has a heavy wheel at the front of the barrow to balance the weight of a person sitting on its rear seat. The pair designed the utility barrow to carry up to 300kg a boat. The barrow weighs 26kg and the wheel 12kg. â&#x20AC;&#x153;The idea was to have something they could use all year round so the barrowâ&#x20AC;&#x2122;s not wasting space in their small homes,â&#x20AC;?

Meadows said. The inventors now hope aid organizations might help them build a prototype and get the barrows manufactured and donated to the Indonesian villagers and other areas where the multipurpose design will be useful. Meadows and McKay have entered the utility barrow in the annual James Dyson award, an international award with a mission to get young people excited about design engineering. The DZDUGLVUXQE\WKH&KLFDJREDVHG James Dyson Foundation. James Dyson, who selects the international ZLQQHULVWKHLQYHQWRURI'\VRQEUDQG vacuum cleaners. If the team wins the Australian prize, they then go on to complete against international entries.

Design Faster, Smarter, and Lighter solidThinking Inspire shows the essential material that cannot be removed from a design. This helps you understand your design earlier and can be used as a common language between departments.â&#x20AC;? Senior Design Engineer

Design lightweight in, instead of engineering mass out. Inspire is easy to use structural optimization that works with all major CAD tools.

 Learn more at SolidThinking.com/SAP

An

Company


candice@relloy.co.za


Books & Web News

DPI FlowCalc app for free download LEADING PVC and HDPE water reticulation and drainage pipe and fitting system manufacturer DPI Plastics has launched its smartphone ‘DPI FlowCalc’ app, available for free download from the Google Play and Apple App stores. This represents a first for the South African industry, DPI Plastics Technical and Product Manager Renier Snyman highlights. The app includes a calculator that can be used to determine friction loss, flow resistance, pipe size, and water delivery for pipelines under pressure. “Results can be emailed directly to the end user via their smartphone. In addition, the user is able to email our technical department directly from the app itself in the event of any further queries,” Snyman explains. The DPI Plastics website at www.dpiplastics. co.za also features ‘hot’

buttons linking to the DPI FlowCalc app. This means users now have the added convenience of not having to search for the app itself, but can simply click on the link provided. The development of the DPI FlowCalc app reflects the growing importance of digital platforms such as smartphones versus the traditional way of conducting business, DPI Plastics marketing manager, Martine Goodchild said. “Africa, for example, has a very high smartphone penetration rate, together with a significant youth bulge, with 70% of the population under 25. When our website became mobi-responsive in November 2015, the number of new visitors quadrupled, testament to how business is being conducted more and more via smartphone,” Goodchild added. The new app will make it easier for customers to obtain critical information on their pipeline requirements and specifications, thereby enhancing DPI Plastics’ product and service offering to the water infrastructure sector. www.dpiplastics.co.za

80 OCT / NOV 2017

Proudly South African synthetic rubbers for every step of your journey www.karbochem.co.za SALES AND MARKETING

Eastgate Office Park, Ground Floor, Block A South Boulevard, Bruma 2026, South Africa

Books/WEB news.indd 80

T +27 (0)11 601 1660 F +27 (0)11 616 6651 E kbcinfo@karbochem.co.za

2017/09/27 11:03


Mark ylene Polyeth(4 ed.) HDPE

THE fourth study on the world market for HDPE was recently th published by Ceresana. The study expects the demand for HDPE to grow by an average of 2.7% a year until 2024. 7KH$VLD3DFLÂżFUHJLRQ is by far the largest consumer of HDPE with a global market share of about 45%. This region will experience the most dynamic growth in the coming eight years, however, not to the same extent as in the past. The development in Western Europe is reversed: While the HDPE market only registered marginal growth in the past, it will presumably increase at higher rates. Ceresana also forecasts growth rates of 3.3% per year in the upcoming eight years for the SURFHVVLQJRISLSHVDQGSURÂżOHVE\H[WUXVLRQ Almost 28% of global HDPE were processed into butter dishes, yogurt cups, trays, bottles, ER[HVDVZHOODVFDSV$QRWKHUVLJQLÂżFDQW application area is products for the construction industry, such as tubes and cables.

can help plastics processors save energy, optimise operation EXXONMOBIL has launched its â&#x20AC;&#x2DC;Energy Saving Guide for Injection Moulding Companiesâ&#x20AC;&#x2122;, in partnership with leading research consultancy, Applied Market Information. Developed by industry expert, Dr Robin Kent, the free handbook contains practical guidance and insights to help plastics processors cut their energy consumption. The guide offers best practise guidance on almost every aspect of an LQMHFWLRQPRXOGLQJSODQWIURPKRZWRFUHDWHDQÂľHQHUJ\ÂżQJHUSULQWÂśWR using high performance hydraulic oils. The guide also details the types of likely savings that are available, including: â&#x20AC;˘ Fitting insulation to barrel heaters, which account for up to 25% of the energy input of an injection moulding machine, can cut heating costs by 50%. â&#x20AC;˘ Reducing compressed air leaks, dropping pressures and improving pipework can cut compressor energy consumption by 50%. â&#x20AC;˘ Switching to Mobil DTE 10 Excelâ&#x201E;˘ hydraulic oil can help increase K\GUDXOLFHIÂżFLHQF\E\XSWR â&#x20AC;&#x153;Plastics processing is a highly competitive and energy intensive industry where every detail matters,â&#x20AC;? said Mohamed Mourad, industrial marketing advisor at ExxonMobil. â&#x20AC;&#x153;The â&#x20AC;&#x2DC;Energy Saving Guide for Injection Moulding Companiesâ&#x20AC;&#x2122; covers every important detail to help plastics processors optimise their operation and cut power consumption. The practical, hands-on guidance can help operators make a real impact on their bottom line and give them a competitive edge.â&#x20AC;? â&#x20AC;˘ Register on the site to access the guide

www.ceresana.com/en/marketstudies/plastics/polyethylene-hdpe

Books & Web News

Free guide

HDPE growth of 2.7% a y: year to 2024 et Stud

www.event.on24.com/eventRegistration OCT / NOV 2017 81

9LN5V

With 35 yearsâ&#x20AC;&#x2122; experience in supplying engineering polymers to the industry, our logistics & technical backup provide the highest level of service and support.

ABS â&#x20AC;&#x201C; Polylac MABS â&#x20AC;&#x201C; Polylac ASA â&#x20AC;&#x201C; Kibilac SAN â&#x20AC;&#x201C; Kibisan GPPS â&#x20AC;&#x201C; Taitarex / Denka / Polyrex / Supreme Q-RESIN â&#x20AC;&#x201C; Kibiton / Denka HIPS â&#x20AC;&#x201C; GPPC / Supreme EPS â&#x20AC;&#x201C; Taitacell / King Pearl  PMMA â&#x20AC;&#x201C; Acryrex SMMA â&#x20AC;&#x201C; Acrystex PC â&#x20AC;&#x201C; Wonderlite Johannesburg Jeremy Goosen (T) 011 626 1030 jeremy@rawmac.co.za

Cape Town Shanaaz Wardien (T) 021 933 331/2 shanaaz@rawmac.co.za

PC/ABS ALLOY â&#x20AC;&#x201C; Wonderloy PA 6 â&#x20AC;&#x201C; Zissloy PA 66 â&#x20AC;&#x201C; Gramid / Zissloy POM â&#x20AC;&#x201C; Kocetal PBT â&#x20AC;&#x201C; Spesin EVA â&#x20AC;&#x201C; APC SBS â&#x20AC;&#x201C; Kibiton 330,1(5$/),//Âą:RRUL&RĂ&#x20AC;HQ&DOSHW PP GLASS FILL â&#x20AC;&#x201C; Woori PE â&#x20AC;&#x201C; HDPE / LLDPE  UREA COMPOUND â&#x20AC;&#x201C; Sprea  Durban Muthu Sagree (T) 031 577 0505 sagree@rawmac.co.za

Port Elizabeth Delene Williams (T) 041 484 3390 glen@rawmac.co.za

www.rawmacplastics.co.za

Books/WEB news.indd 81

2017/09/27 11:03


-

World News Dow and DuPont set up new holding company 7+(&RPSHWLWLRQ7ULEXQDOKDVFRQGLWLRQDOO\ DSSURYHGWKHPHUJHUEHWZHHQ'RZDQG 'X3RQWDQGWKH'RZ&KHPLFDO&RPSDQ\ DQG(,'X3RQWGH1HPRXUVDQG &RPSDQ\ 'X3RQW  'RZ'X3RQWLVDQHZO\LQFRUSRUDWHG KROGLQJFRPSDQ\IRUWKHSXUSRVHVRIWKH WUDQVDFWLRQZKLFKLVFRQWUROOHGE\ERWK 'RZDQG'X3RQW 'RZ¶VDFWLYLWLHVLQ6RXWK$IULFDLQFOXGH WKHGLVWULEXWLRQRIVXQÃ&#x20AC;RZHUVHHGV DJURFKHPLFDOVPDWHULDOVFLHQFHSURGXFWV VXFKDVORZGHQVLW\SRO\HWK\OHQHDQGIRRG texturisers. 'RZGRHVQRWPDQXIDFWXUHWKHVHSURGXFWV LQ6RXWK$IULFDEXWLPSRUWVWKHPIURP PDQXIDFWXULQJRSHUDWLRQVDFURVVWKHZRUOG

AROUND THE WORLD

Huntsman, Clariant deal continues to move forward &/$5,$17$*LVSURJUHVVLQJWRZDUGV VDWLVI\LQJWKHUHJXODWRU\DSSURYDOFRQGLWLRQ to closing its merger of equals with +XQWVPDQ&RUSRUDWLRQ7KH8QLWHG6WDWHV )HGHUDO7UDGH&RPPLVVLRQZKLFKUHYLHZV WKHDQWLWUXVWLPSOLFDWLRQVRIFHUWDLQEXVLQHVV FRPELQDWLRQVKDVGHOLYHUHGDVHFRQG UHTXHVWIRULQIRUPDWLRQWRWKHSDUWLHVUHODWLQJ WRMXVWWZRSURGXFWVíVRGLXPLVHWKLRQDWH XVHGLQSHUVRQDOFDUHSURGXFWVOLNHVRDS DQGVKDPSRRVDQGDSRO\HWKHUDPLQH SURGXFWXVHGLQFHUWDLQFRQVWUXFWLRQDQG DGGLWLYHSDLQWDQGLQNDSSOLFDWLRQV7KHVH SURGXFWVDFFRXQWHGIRUOHVVWKDQ86 million in total revenues of each of the two FRPSDQLHVLQWKH8QLWHG6WDWHVLQ DQG&ODULDQWLVFRQ¿GHQWWKDWWKHSDUWLHVZLOO be able to satisfy any FTC concerns on a WLPHOLQHFRQVLVWHQWZLWKWKHPHUJHUZKLFKZH FRQWLQXHWRH[SHFWWRFORVHDURXQG\HDUHQG

Krones and Erema team up on PET recycling 7:2PDFKLQHU\FRPSDQLHVKDYHDJUHHG WRWHDPXSLQWKH3(7UHF\FOLQJ¿HOG Krones AG and Erema Engineering 5HF\FOLQJXQG$QODJHQ*PE+.URQHV EDVHGLQ1HXWUDXEOLQJ*HUPDQ\PDNHV 3(7EORZPRXOGLQJPDFKLQHVDQGWXUQNH\ ¿OOLQJDQGSDFNDJLQJOLQHV5HF\FOLQJ PDFKLQHU\SURGXFHU(UHPDLVEDVHGLQ $QVIHOGHQ$XVWULD The collaboration will focus on WHFKQRORJ\SOXVRQSODQQLQJHQWLUH IDFWRULHV.URQHVDQG(UHPDZLOOZRUN WRJHWKHUDVDWXUQNH\YHQGRU.URQHV DOUHDG\PDNHVOLQHVIRUWKHUHF\FOLQJ SURFHVV7KHFRPSDQ\¶VSURGXFWUDQJH LQFOXGHVWKH0HWD3XUH:KRWZDVK WHFKQRORJ\IRU3(7(UHPDGHYHORSHGLWV 9DFXUHPDUHF\FOLQJSURFHVVV\VWHPZKLFK allows recycled PET to be used in new IRRGFRQWDFWERWWOHV 82 OCT / NOV 2017

WORLD NEWS-1.indd 82

5

th Altair Enlighten

for Innovation in FCA, Toyota, Faurecia and AP&T win, Honda and Constellium were runners-up ALTAIR and the Centre for Automotive Research (CAR) have announced the winners of the 5th annual Altair Enlighten Award for innovation in automotive lightweighting. The winner of the Full Vehicle category was the 2017 Chrysler 3DFL¿FDZKLFKLVDQLPSUHVVLYHNJ OLJKWHUWKDQLWVSUHGHFHVVRU7R\RWD¶V FDUERQ¿EUHFORVXUHSDQHOVIRUWKH 3ULXV3ULPHDQG/H[XV/& DQG)DXUHFLD¶V$GDSWLYH9DOYH70IRU

H[KDXVWV\VWHPVHPSOR\HGRQWKH &KHYUROHW6LOYHUDGRWRRNWKHWRSKRQRXUV for the module category. Swedish metal IRUPLQJVSHFLDOLVW$3 7FODLPHGWKH Enabling Technology category for its innovative aluminium forming technology XVHGRQVHYHUDO(XURSHDQYHKLFOHV The FCA team built the 2017 Chrysler 3DFL¿FDIURPWKHJURXQGXSWRDFKLHYH DOLJKWHUYHKLFOHZLWKLPSURYHGVDIHW\ EHWWHU19+SHUIRUPDQFHDQGVXSHULRU

In the chemical industry, BASF has the broadest product portfolio of materials that can be developed for 3D printing. The photo shows two airless tyres that were created with 3D printing technologies using thermoplastic polyurethane from BASF

BASFâ&#x20AC;&#x2122;s new

company to pursue opportunities in 3D printing BASF SE has established a new *URXSFRPSDQ\%$6)'3ULQWLQJ 6ROXWLRQV*PE+DVRI6HSWHPEHU 7KLVZKROO\RZQHGVXEVLGLDU\RI%$6) New Business GmbH is headquartered LQ+HLGHOEHUJ*HUPDQ\DWWKHVLWH of InnovationLab GmbH. It will focus RQHVWDEOLVKLQJDQGH[SDQGLQJWKH EXVLQHVVZLWKPDWHULDOVV\VWHP VROXWLRQVFRPSRQHQWVDQGVHUYLFHVLQ WKH¿HOGRI'SULQWLQJ7KHFRPSDQ\ ZLOOZRUNFORVHO\ZLWKUHVHDUFKHUVDQG DSSOLFDWLRQHQJLQHHUVIURP%$6)DQG H[WHUQDOSDUWQHUVVXFKDVXQLYHUVLWLHV DQGSRWHQWLDOFXVWRPHUVLQRUGHUWR GHYHORSWKHULJKWVROXWLRQVIRUDZLGH array of requirements.

7KHQHZFRPSDQ\¶VFXVWRPHUV ZLOOPDLQO\EH¿UPVWKDWZDQWWRXVH 'SULQWLQJIRULQGXVWULDOSURGXFWLRQ 7\SLFDOLQGXVWULHVZLOOLQFOXGHIRU H[DPSOHDXWRPRWLYHDHURVSDFH and consumer goods. In order to be DEOHWRGHYHORSDQGWHVWDYDULHW\RI VROXWLRQV%$6)'3ULQWLQJ6ROXWLRQV *PE+ZLOOWDNHRYHUDQGH[SDQGWKH 'SULQWLQJDSSOLFDWLRQWHFKQRORJ\ center in Heidelberg belonging to 'HXWVFKH1DQRVFKLFKW*PE+D subsidiary of BASF New Business. 7KHQHZFRPSDQ\ZLOOLQLWLDOO\HPSOR\ DURXQGH[SHUWVPDQ\RIZKRP ZHUHDOUHDG\ZRUNLQJIRU%$6)LQWKH ¿HOGRI'SULQWLQJ www.basf.com

2017/09/27 14:57


World News

Awards

Automotive Lightweighting interior space and comfort. The body system, which shed 76kg, used high strength steels and large amounts of dual phase and hot stamped material grades for improved impact protection at reduced weight. Aluminium and cast magnesium were used for the rear sliding door, liftgate and the instrument panel beam, while the front-end module is a steel-plastic over mould to improve part integration and stiffness.

Simulation methodologies including topology optimization studies were used throughout the vehicleâ&#x20AC;&#x2122;s development to HQVXUHDPDWHULDOHIÂżFLHQWGHVLJQ The Altair Enlighten Award honours the greatest achievements in vehicle weight saving each year to inspire interest from policymakers, educators, students and the public, to create further competition for new ideas in the industry and to provide an incentive to share

7KH&KU\VOHU3DFLÂżFDZKLFKERG\V\VWHPVKHG NJZDVEXLOWIURPWKHJURXQGXSWRDFKLHYH DOLJKWHUYHKLFOHZLWKLPSURYHGVDIHW\EHWWHU 19+SHUIRUPDQFHDQGVXSHULRULQWHULRUVSDFH DQGFRPIRUW

technological advances. The award is judged by a combination of automotive experts from industry, academia and the engineering media from across the world who debated the merits of each of WKHÂżQDOLVWV ZZZDOWDLUFRP

China ban part of â&#x20AC;&#x2DC;tsunamiâ&#x20AC;&#x2122; of pressure for more recycledcontent plastic CHINAâ&#x20AC;&#x2122;S proposed ban on scrap plastic imports could be part of a â&#x20AC;&#x2DC;tsunamiâ&#x20AC;&#x2122; of increasing pressure on companies to use more recycled content in their products, according to the head of a U.S. plastics recycling association. Steve Alexander, president of the Washington-based Association of Plastic Recyclers, singled out California as a hot spot for more government pressure, and linked it to Chinaâ&#x20AC;&#x2122;s announcement during August to brief the industry on Chinaâ&#x20AC;&#x2122;s action. â&#x20AC;&#x153;My concern is that this activity by China and other market activity could lead to some, almost a tsunami if you will, of very stringent regulatory requirements,â&#x20AC;? Alexander said.

â&#x20AC;&#x153;We have to deal with this because the potential regulatory implication seems to be lining up in a perfect storm for California to implement some very draconian regulatory oversight of industry, in terms of certain requirements for packaging,â&#x20AC;? he said. While he said many details of the Chinese ban remain XQFOHDUPDNLQJSUHGLFWLRQVGLIÂżFXOWLQGXVWU\REVHUYHUVVDLG it could weaken traditional recycled plastic export markets, particularly on the West Coast. Alexander suggested industry, including consumer brand companies, step up recycled content ahead of potential government pressure. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re going to have to show, the brands are going to have to show, in my opinion, sustained commitment to incorporating recycled material in their marketplace, or I believe that theyâ&#x20AC;&#x2122;re going to be forced to do it,â&#x20AC;? Alexander said. In particular, he said Californiaâ&#x20AC;&#x2122;s government is looking at policy initiatives to meet its stated goal of a 75% recycling rate by 2020. Last year the stateâ&#x20AC;&#x2122;s recycling rate was 44%. Californiaâ&#x20AC;&#x2122;s Rigid Plastic Packaging Container law is one of only a limited number of legal requirements in the United States that companies use recycled content in plastic packaging, but Alexander suggested interest is growing. OCT / NOV 2017

WORLD NEWS-1.indd 83

83

2017/09/27 14:58


World News

AROUND THE WORLD

Processors take stock of damage from Harvey PROCESSORS are assessing damage from Hurricane Harvey and the more than one metre of rain that came with it in Texas. Berry Plastics Global Group Inc FORVHGWZRSODQWVLQGHÂżQLWHO\WRDVVHVV damage â&#x20AC;&#x201C; in Victoria and Beaumont â&#x20AC;&#x201C; while Inteplast Group said it expected to reopen its Lolita operations at the end of August. Inteplast manufactures PVC products, such as decking, moulding, siding and reusable shopping bags, at its 575-acre Lolita campus, which has numerous buildings. Some employees worked around the clock to minimize damage at the facility, despite outages and losses at home. Hurricane Harvey made landfall on 25 August as a Category 4 storm with 209km winds. Then, the weather system battered the Houston area for six days, dropping more than 1.3 metres of rain and setting a record for total rainfall from a single tropical storm, according to the National Weather Service. /RFDORIÂżFLDOVKDYHUHSRUWHGVWRUP related deaths in Texas and the Houston Police Department has rescued more WKDQSHRSOHIURPĂ&#x20AC;RRGLQJZKLOHWKH +DUULV&RXQW\6KHULIIÂśV2IÂżFHSHUIRUPHG more than 2,200 rescues. The Manufacturers Association for Plastics Processors (MAPP) contacted dozens of its members in Texas to see if any need help and to remind them about the special online forum created for these situations. The American Red Cross also is collecting plastic products to help with disaster relief, with the plastics industry association asking its members to help out.

New building for Movacolor in Sneek MOVACOLOR, developer and manufacturer of high quality dosing systems for the plastics industry, is to build a new building in its current location Sneek, The Netherlands. It is expected that the international company will move to the fully energy-neutral building in the third quarter of 2018. The 100% sustainable building will include solar panels, top cooling in the entire building, XQGHUĂ&#x20AC;RRUKHDWLQJDQGKHDWSXPSV2I course, charging stations for electric cars are provided. With a workforce of over 30 people, the company has outgrown its current location. The new location is therefore three times ELJJHUVXIÂżFLHQWIRUWKHKHDOWK\JURZWK and development that the company is experiencing. www.movacolor.com 84 OCT / NOV 2017

WORLD NEWS-1.indd 84

7KHZLQQLQJPROHFXOHLVDJDPHFKDQJLQJSODWIRUPWHFKQRORJ\WKDWZLOOHQDEOHFRVWHIÂżFLHQW production of a variety of renewable, high-performance chemicals and polymers with applications across a broad range of industries

DuPont, ADM Winners of 2017 Innovation in Bioplastics Award Technology developed results in higher yields, lower energy usage, lower capital expenditures, better performance DUPONT Industrial Biosciences (DuPont) and Archer Daniels Midland (ADM) are joint winners of the 2017 Innovation in Bioplastics Award. The Bioplastics Council â&#x20AC;&#x201C; a division of the Plastics Industry Association â&#x20AC;&#x201C; honoured the companies with the second annual award for their groundbreaking process to produce furan dicarboxylic methyl ester (FDME), a biobased monomer, from fructose. The technological development has the potential to expand the materials landscape in the 21st century with exciting and truly novel, highperformance renewable materials, with applications in packaging, textiles, engineering plastics and many other industries. FDME is a high-purity derivative of furandicarboxylic acid (FDCA), one of the 12 building blocks LGHQWLÂżHGE\WKH86'HSDUWPHQW of Energy, which can be converted into a number of high-value, biobased chemicals or materials that can deliver high performance in a number of applications. Bio-based FDME has long been sought-after and researched, but has not yet been available at commercial scale and at reasonable cost. The technology www.adm.com

developed by DuPont and ADM is a PRUHHIÂżFLHQWDQGVLPSOHSURFHVVWKDQ traditional conversion approaches and results in higher yields, lower energy usage, lower capital expenditures and better performance. â&#x20AC;&#x153;This molecule is a game-changing platform technology. It will enable FRVWHIÂżFLHQWSURGXFWLRQRIDYDULHW\ of renewable, high-performance chemicals and polymers with applications across a broad range of industries â&#x20AC;&#x201C; including textiles, auto parts, food packaging and more,â&#x20AC;? said Michael Saltzberg, global business director for biomaterials at DuPont. 2QHRIWKHÂżUVWSRO\PHUVXQGHU development that will use FDME is polytrimethylene furandicarboxylate (PTF), a novel polyester also made from DuPontâ&#x20AC;&#x2122;s proprietary Bio-PDOâ&#x201E;˘ (1,3-propanediol). PTF is a 100% renewable and recyclable polymer that, when used to make bottles and other beverage packages, substantially improves gas-barrier properties compared to other polyesters. This makes PTF a great choice for customers in the beverage packaging industry looking to improve the shelf life of their products.

www.biosciences.dupont.com

2017/09/27 14:58


PCS ad '017 04 (orig)-bleed.indd 94

2017/09/15 12:09


World News

NestlĂŠ puts a

â&#x20AC;&#x2DC;caps onâ&#x20AC;&#x2122;

recycling message on its bottles

7KH+RZ5HF\FOHODEHO LVDFRPSHOOLQJDQG VLPSOHZD\WRHGXFDWH DQGHQFRXUDJHUHF\FOLQJ

A clear and consistent recycling guide THE worldâ&#x20AC;&#x2122;s largest bottled water company has started using the How2Recycle label on all the companyâ&#x20AC;&#x2122;s half-litre bottles for major brands in the United States. NestlĂŠ Waters North America own several well-known US brands, including Poland Spring, Deer Park, Ice Mountain, Zephyrhills, Ozarka, Arrowhead and Nestle Pure Life. Use of the How2Recycle label has been growing substantially, and the adoption by NestlĂŠ Waters North America means millions and millions of additional water bottles will now support the information. Âł2XUJRDOKDVEHHQWRÂżQGD compelling and simple way to educate and encourage all Americans to recycle the bottle,â&#x20AC;? said Nelson Switzer, chief

VXVWDLQDELOLW\RIÂżFHUDW1HVWOp:DWHUV North America, in a statement. â&#x20AC;&#x153;By adopting the How2Recycle label, millions of consumers will now have a clear and consistent recycling guide on the side of the bottle â&#x20AC;&#x201C; driving recovery of the bottle and a reduction in environmental impact,â&#x20AC;? Switzer continued. The company also encouraged other packaged goods makers to adopt the labeling standard created by the Sustainable Packaging Coalition in 2012. The coalition reports the How2Recycle label is now being used by more than 65 brands and retailers that create thousands of products. â&#x20AC;&#x153;We cannot overstate the environmental importance of the â&#x20AC;&#x2DC;Empty & Replace Capâ&#x20AC;&#x2122; instruction on these bottles; it means fewer loose caps

will have the potential to get into our waterways and oceans,â&#x20AC;? says Kelly Cramer, leader of the How2Recycle effort at SPC, said in a statement. â&#x20AC;&#x153;It also helps ensure that the caps will be recycled. Thatâ&#x20AC;&#x2122;s because when caps are replaced on bottles that go through the recycling stream, itâ&#x20AC;&#x2122;s less likely that they will fall through recyclersâ&#x20AC;&#x2122; equipment and be discarded,â&#x20AC;? she continued. The recycling industry, for years now, has been promoting a â&#x20AC;&#x153;caps onâ&#x20AC;? message to consumers to overcome previous instructions that told consumers to remove closures before recycling. Modern recycling techniques typically now allow for those caps to remain. NestlĂŠ Waters expect the How2Recycle label will be on all major brands by September. www.How2Recycle.info

Processors work to resume production after Hurricane Harvey damage 209km winds, six days, 127cm rain AT plastics processing plants near Houston, USA, and other regions along the Gulf Coast, managers and employees at the end of August were taking note of damage and making plans to bring production fully back on line. Hurricane Harvey made landfall on 25 August as a Category 4 storm with 209km winds. Then, the weather system battered the Houston area for six days, dropping more than 127cm of rain and setting a record for total rainfall from a single tropical storm, according to the National Weather Service. /RFDORIÂżFLDOVKDYHUHSRUWHGPRUHWKDQVWRUPUHODWHG deaths in Texas before the storm moved east toward Louisiana. The Manufacturers Association for Plastics Processors (MAPP) contacted dozens of its members in Texas to see if any need help and to remind them about the special online forum created for these situations. Production at American Bag Manufacturing in Houston sustained a damaged roof that let in the pounding rains of Hurricane Harvey. 6DP7UHYLQRZKRZRUNVLQVDOHVZDVWKHÂżUVWHPSOR\HH to make it to the facility. â&#x20AC;&#x153;I live nearby and Iâ&#x20AC;&#x2122;m the only who FRXOGÂżQGURXWHVWRGULYHDURXQGWKHZDWHUDQGJHWKHUH´ 7UHYLQRVDLGRQ$XJXVWLQDSKRQHLQWHUYLHZÂł,ÂśPWHDULQJ out carpet, taking orders and answering some emails.â&#x20AC;? The operation closed on 24 August, he said, as Hurricane

$Ă&#x20AC;RRGHGKLJKZD\RXWVLGH+RXVWRQ

Harvey gained strength and took aim at the Texas coast. It made landfall a day later as a Category 4 storm. The business makes plastic bags for grocery store customers to package their inhouse baked goods and deli items like breads and seafood. Similar scenarios played out at many plastics processors coping with the aftermath of Harvey and its torrential rains. Nearly 700 businesses in the state sustained damage from Harvey, according to the Texas Department of Public Safety. Texas ranks third in the US for plastics employment and ÂżUVWLQSODVWLFVVKLSPHQWVDFFRUGLQJWRWKH3ODVWLFV,QGXVWU\ Association. The association has 49 members in Texas, including 16 in hard-hit Houston. Last year, Texas accounted for 16.8% of US shipments. The estimated value exceeded $68 billion, which is equivalent to ELOOLRQDZHHN%XVLQHVVHVDUHHDJHUWRUHVXPHVFKHGXOHV

86 OCT / NOV 2017

WORLD NEWS-1.indd 86

2017/09/27 14:58


MGMW Trading advert Edited-BLEED.indd 94

2016/04/07 1:17 PM


Diary

COMING UP

FINANCING INFRASTRUCTURE DEVELOPMENT IN AFRICA EASIER WITH PPPS THERE is enough private sector money to partner with governments and state institutions in Africa to speed up the roll-out of infrastructure and build programmes. That was the impression gained from the Infrastructure Africa Business Forum in Sandton in August, the sixth edition of this now popular conference/exhibition. There is greater scope for Africaâ&#x20AC;&#x2122;s private VHFWRUVRXUFHVRIÂżQDQFHWRFRPPLWWRÂżQDQFLQJ infrastructure projects through public-private partnerships (PPP). In previous years, Africaâ&#x20AC;&#x2122;s private sectors have lagged behind other emerging markets and developing economies where approximately 20 percent of infrastructure H[SHQGLWXUHLVÂżQDQFHGE\SULYDWHVRXUFHV Âł,QIUDVWUXFWXUH$IULFDLVDOODERXWÂżQGLQJDQG meeting the right people for the right projects. We specialize in bringing together African government leaders with private sector decision makers to unlock Africaâ&#x20AC;&#x2122;s next wave of economic growth,â&#x20AC;? said Liz Hart, MD of Infrastructure Africa. The event included dedicated workshops DQGVHVVLRQVRQÂżQDQFLQJRILQIUDVWUXFWXUH projects in Africa, with public-private partnerships being part of the debate. Roads, railways, airports, harbours and ports, renewable and base-load power plants, hospitals, schools, and ICT infrastructure â&#x20AC;&#x201C; these are all part of the vast network of $93-billion in infrastructure needed to unlock Africaâ&#x20AC;&#x2122;s economic growth, according to the World Bankâ&#x20AC;&#x2122;s estimates. â&#x20AC;&#x153;One of the most important aspects of $IULFDÂśVLQIUDVWUXFWXUHSURJUDPPHVLVÂżQGLQJ the right funding models. We explore all the ÂżQDQFLDOPRGHOVDQGDQJOHVIRUIXUWKHULQJ Africaâ&#x20AC;&#x2122;s infrastructure development,â&#x20AC;? said Hart. www.infrastructure-africa.com

Registration at the busy Propak West Africa show in Lagos in September

LARGEST YET PROPAK WEST AFRICA PROPAK West Africa, at the Landmark Centre in Lagos, Nigeria, from 19-21 September was the largest edition of the event yet. 1RZLQLWVÂżIWKHGLWLRQWKHVKRZ attracted 135 participating businesses and was effectively sold out. â&#x20AC;&#x153;Our key mission at Propak West Africa is to stimulate market growth and drive business within the industry, we do this through developing a carefully planned and trusted trade show that connects business leaders with key end users. After an immensely successful show in 2016, Propak West Africa has grown by 42% this year and we invested heavily in new market sectors and features for the show to add to visitor experienceâ&#x20AC;?, said George Pearson, regional director for West Africa at Afrocet Montgomery, the organiser.

Avery Dennison: Easier application of labels onto woven and non-woven textiles without sewing AVERY Dennison showcased a broad portfolio of innovative products to help convertors unlock new industry opportunities at Labelexpo Europe in Brussels in September. â&#x20AC;&#x153;Ever since inventing the self-adhesive label, Avery Dennison has been creating innovative product solutions,â&#x20AC;? said Georg MĂźller-Hof, vice president marketing Europe. â&#x20AC;&#x153;Our mission is to help label converters to source and use labels that look good, comply with regulations, excel in real-world performance, and convert successfully.â&#x20AC;? â&#x20AC;&#x153;Our unique combination of facestock and adhesive expertise has led us to develop labels that deliver both high performance and extended functionality,â&#x20AC;? adds MĂźller-Hof. The innovative patent-pending heatactivated adhesive technology allows manufacturers of automotive interior and safety components and OEMs (Original Equipment Manufacturers) to apply safety and warning labels onto woven and non-woven textiles without sewing. Many such OEMs need a solution for â&#x20AC;&#x2DC;permanentâ&#x20AC;&#x2122; marking/labelling of their products covering multiple substrates, multiple conditions and meeting automotive requirements. Today there is a limited

number of suitable technologies with narrow application windows, including ink transfer by heat, heat-seal label, and direct (silk screen) printing. Avery Dennisonâ&#x20AC;&#x2122;s heat-activated acrylic adhesive is changing the game in this VSDFHRIIHULQJFRVWHIÂżFLHQWDQGKLJKHU performance solutions. Meanwhile, digital printing continues to gain acceptance, and water-based inkjet and UV inkjet technologies are also growing in popularity. Avery Dennison has extended its offerings to address the growing demand of solutions that differentiate with innovative label designs and print in small production runs. These new offerings include an exclusive VLOYHUZDWHUEDVHGLQNMHWÂżOPDQG a premium range of textured UV inkjet materials â&#x20AC;&#x201C; all of which help to differentiate products on the shelf. The UV inkjet materials feature a new and unique topcoat, that â&#x20AC;&#x201C; unlike traditional UV inkjet top coatings â&#x20AC;&#x201C; retains both the look and the feel of the textured base paper. Avery Dennisonâ&#x20AC;&#x2122;s exclusive silver ZDWHUEDVHGLQNMHWÂżOPKHOSVWR GLIIHUHQWLDWHSURGXFWVRQWKHVKHOI

â&#x20AC;&#x2DC;Green is the New Goldâ&#x20AC;&#x2122; THE Institute of Waste Management (IWMSA) aims to change perceptions and encourage more people to consider waste as a valuable resource. The instituteâ&#x20AC;&#x2122;s Eastern Cape branch hosted its regional waste conference, titled â&#x20AC;&#x2DC;Green is the new Gold,â&#x20AC;&#x2122; at the Nelson Mandela Bay Stadium in Port Elizabeth in August. Rosa Blaauw of the Nelson Mandela Bay Municipality (NMBM) presented the NMB Stadiumâ&#x20AC;&#x2122;s environmental management system and elaborated on its various green initiatives. â&#x20AC;&#x153;The establishment of a recycling buy-back facility at the stadium is one of the NH\IRFXVDUHDVDQGZLOOEHQHÂżWWKH 88 OCT / NOV 2017

Diary new.indd 88

Avery Dennisonâ&#x20AC;&#x2122;s KHDWDFWLYDWHG DGKHVLYHWHFKQRORJ\ allows manufacturers of automotive interior and safety FRPSRQHQWVDQG 2(0VWRDSSO\VDIHW\ DQGZDUQLQJODEHOV onto woven and non-woven textiles ZLWKRXWVHZLQJ

immediate community by creating a value chain for recyclable material,â&#x20AC;? said Rosa. Vuyo Sikwebu of Clariter ZA elaborated on how his company converts plastic waste into high grade FKHPLFDOĂ&#x20AC;XLGXVLQJDXQLTXHSDWHQWHG process. â&#x20AC;&#x153;By investing in innovative WHFKQRORJ\ZHFDQÂżQGVROXWLRQVWR the worldâ&#x20AC;&#x2122;s plastic waste problems and create employment opportunities,â&#x20AC;? Sikwebu pointed out. Brian van Niekerk of Rhino Group discussed House Rhino, a building designed to be completely selfsustainable, incorporating energy, water-saving elements and various green building material and techniques. www.iwmsa.co.za

2017/09/27 15:17


Diary MORE VISITORS FROM ASIA AT EMO AFTER a record opening day attendance, EMO Hannover (18-23 September, in Germany) went on to achieve impressive results, with more than half of the showâ&#x20AC;&#x2122;s total of approximately 130,000 attendees coming from abroad (about 70% from European countries). Attendance from Asia was found to have risen sharply. EMO is focussed mainly on the machine tools and metal working sectors, but with digitalization, the focus is changing with delegates seeking to ÂżQGRXWPRUHDERXWWKHIXWXUHRIPDQXIDFWXULQJ â&#x20AC;&#x153;Foreign visitors were keenly interested in seeing how the market leaders are leveraging GLJLWL]DWLRQWREHQHÂżWWKHYDULRXVSURFHVV chains. They were also eager to see how new business models are growing up out of all the harvested data,â&#x20AC;? said Carl Martin Welcker, general commissioner for the show. Alongside digitization and connectivity, additive manufacturing was also very high on the agenda for EMO visitors. 3D printing of high-precision parts and additive manufacturing were also key areas of interest.

COMING UP

ICIS PETROCHEM, POLYMERS COURSES IN DUBAI ICIS is to present its Petrochemicals and Polymers training series in Dubai from 2-5 October. The course welcomes a mix of local and international delegates, ranging from new entrants to industry players who need a substantial refresher into the industry. The Fundamentals of Polymers, a two-day interactive course, is designed to give delegates a comprehensive understanding of both the commercial and technical aspects of polymers. As well as covering the basics, the course explores the impact of recent developments on the polymers industry, and how it affects your business. The multi-axis controller B maXX 5800 contains up to six scalable axes, which makes it a particularly compact solution for machines with several drives. It also uses the new DSH1 servo motors, GHYHORSHGVSHFLĂ&#x20AC;FDOO\ for smooth operation and unnoticeable detent torque

MODULAR AUTOMATION FOR NETWORKED SYSTEMS AND PLANTS AT MOTEK BAUMĂ&#x153;LLER is to present its solutions for production and assembly technology at Motek in Stuttgart from 9-12 October. By exhibiting its converters and motors, including its control technology, modular software and services, the automation and drive specialist will highlight both its broad product portfolio and the large number of variants that are possible using standard components, for example, for material handling systems. $VDV\VWHPVXSSOLHU%DXPÂ OOHUFRQÂżJXUHV both the hardware and software according to customer requirements to ensure a smooth integration process. In its hardware and software development, some of which feature web capability and a variety of interfaces.

PlastIndia

comes of age Will also host pioneering initiatives to offer maximum value propositions PLASTINDIA, the 10th edition of which takes place from 7-12 February 2018, has truly come of age: over 2000 exhibitors are expected, with more than 600 from abroad, which means the Indian event now rivals some of the top global polymer trade shows. This 10th edition will showcase two distinct and critical facets: The future of the plastics industry and the future of humankind itself. Growth segments, including automobiles, healthcare, packaging, infrastructure, agriculture, telecom, new & renewable energy and emerging segments like plastic composites, sports, 3-D printing, will also be showcased at the event. The week-long exhibition will be spread out across 125 000m2. PlastIndia will also host pioneering initiatives to offer maximum value propositions to all its exhibitors and participants. A unique business-2business networking opportunity called â&#x20AC;&#x2DC;Meet-2-Trade: The Reverse Buyer Seller Meetâ&#x20AC;&#x2122; (RBSM) is being organised by the PlastIndia Foundation in association with one of its founder member â&#x20AC;&#x2DC;Plexcouncilâ&#x20AC;&#x2122;. The objective of â&#x20AC;&#x2DC;Meet-2-Tradeâ&#x20AC;&#x2122; is to invite a select 600 international buyers to connect and transact with the exhibitors. This initiative will offer a win-win proposition to both and create

a strong platform for them to strike business alliances and create long-term associations for continued trade. The application procedure for this unique hosted buyer programme is detailed on the PlastIndia website. Concurrent events include Proplast, now in its 5th year, the â&#x20AC;&#x2DC;one of its kindâ&#x20AC;&#x2122; platform that showcases Indiaâ&#x20AC;&#x2122;s growing plastics processing capabilities to the entire world The Indian plastics industryâ&#x20AC;&#x2122;s capacity WRGHOLYHULQWHUQDWLRQDOTXDOLW\ÂżQLVKHG products, ability to produce large quantities with consistency and highly competitive pricing, is increasingly attracting multinational companies, international retail giants and manufacturers to either shift their base to India, or to source plastics processing DQGÂżQLVKHGJRRGVIURP,QGLD Integral to PlastIndia is the International Conference which will host some of the most renowned experts on plastics. The PlastIndia Foundation will also be hosting its 8th edition of the Plasticon Awards 2018 programme which recognise and honour iconic innovators, both individuals and organisations excelling in their performance and contributing to the growth of Industry. www.plastindia.org

Reifenhäuser â&#x20AC;&#x2DC;Ultra Flatâ&#x20AC;&#x2122; haul-off improves print, lamination capability ,17+(3$67EORZQÂżOPSURGXFHUV have struggled with â&#x20AC;&#x2DC;waveâ&#x20AC;&#x2122; phenomena and surfaces that are not perfectly SODQDU6WLIIHUÂżOPVFRQWDLQLQJ+'3( or PP are especially affected by these problems which frequently also occur LQWKHSURGXFWLRQRIEDUULHUÂżOPV1RZ Reifenhäuser Blown Film offers a solution with its Evolution Ultra Flat haul-off. This novel system allows for WKHSURGXFWLRQRIÂżOPVZLWKFRQVLGHUDEO\ LPSURYHGĂ&#x20AC;DWQHVVDQGHQVXUHVEHWWHU printability and lamination capability. But what makes EVO Ultra Flat

so special? The secret of the new RSWLPL]HGÂżOPĂ&#x20AC;DWWHQLQJV\VWHPLVPDLQO\ its position within the process. While LQWKHSDVWĂ&#x20AC;DWWHQLQJV\VWHPVZHUH arranged just in front of the winder, EVO Ultra Flat is installed exactly at the point where optimum processing conditions DUHDYDLODEOHIRUĂ&#x20AC;DWWHQLQJWKHZHEWKDW means upstream between the haul-off nip roll assembly and turner bar system.

Reifenhäuserâ&#x20AC;&#x2122;s EVO Ultra Flat haul-off is now optimally positioned in the machine, between the nip roll assembly and turner bar system; the system will be exhibited at Fakuma from 17-21 October 90 OCT / NOV 2017

Diary new.indd 90

2017/09/28 09:15


EQUIP-ZERMA.indd 70

2017/09/26 13:21


Diary

Improved hot runner

features from Mold-Masters MILACRON Holdings, a leading industrial technology company serving the plastics processing industry, will show the Fusion and Summit hot runner developments from its subsidiary MoldMasters at Fakuma (17-21 October), amongst other technologies, including Milacron injection moulding machines and DME mould solutions. New, enhanced features in the Fusion G2 Series hot runners for automotive and large-part moulding include an extended nozzle length range which SURYLGHVPRUHĂ&#x20AC;H[LELOLW\WKHFRPSRXQGQR]]OHFDQ be used to avoid interferences with cavity cooling

lines and position nozzles in very tight pockets. Fusion G2 is now available with valve pin open speed control and position monitoring that enables LPSURYHGVXUIDFHÂżQLVKHVDWWKHJDWHRIWKHSDUW Options for extra-extended gate seals are now also available on the entire Fusion G2 product line. Brand new additions to the Fusion G2 product line that will be on display will include high performance water-cooled gate inserts plus some additional new JDWLQJPHWKRGVGHVLJQHGVSHFLÂżFDOO\IRUFHUWDLQ resins.

92 AUG / SEPT 2017

Sumitomo (SHI) Demag at Fakuma 2017 SUMITOMO Demag will present a cross-section of its current portfolio of injection moulding machines at Fakuma (17-21 October) at Friedrichshafen in Germany. Highlights include the latest generation of the all-electric IntElect series, a high-speed El-Exis SP machine for injection compression moulding of decorated thin-walled packaging lids and a multi-component Systec Multi injection moulding machine with an Industry 4.0 application. In addition to the IntElect machine, the latest innovation on show is the servo-electric SDR 5P sprue picker. The IntElect 50/360-110 is the latest generation of its electric injection moulding machines at Fakuma. The injection mould

for polyamide bobbins is provided by Siemens, while material for the 500kN machine is supplied by Motan Colortronic. The new servo-electric SDR 5P sprue picker makes its dĂŠbut in the Sumitomo Sumitomo-Demag is extending its range of all-electric machines (SHI) Demag portfolio on this exhibit. with clamping forces up to 1300 kN and The IntElect is a complete series mid-sized IntElects available with forces with clamping forces of 500, 750, of 2,200 to 4,500 kN. Comprehensive 1000, 1300 and 1800 kN. The 1800 modularity and the introduction of kN machine expands the new IntElect intermediate sizes mean that moulders series, both in terms of clamping force can select their machine from an even DQGXSZDUGWLHEDUFOHDUDQFHDQGLWÂżOOV PRUHVSHFLDOLVHGUDQJHZLWKXSWRÂżYH the gap which existed between models screw diameters per injection unit.

YOUR LOCAL EREMA CONTACT RELLOY S.A. (Pty) Ltd P.O.Box 8190, ZA-1613 Edenglen www.relloy.co.za

HIGH THROUGHPUT. WE DRIVE THE DIAMEETS ECONOMY. QUALITY. CIRCULAR

Whether it is inhouse, postconsumer or bottle recycling: you can only close loops in a precise and profitable way if machines are perfectly tuned for the respective application. Count on the number 1 technology from EREMA when doing so: over 5000 of our machines and systems produce around 14 million tonnes of high-quality pellets like this every year â&#x20AC;&#x201C; in a highly efficient and energy-saving way. Thatâ&#x20AC;&#x2122;s Careformance!

CAREFORMANCE We care about your performance.

Diary new.indd 1708006ERE_SA 92 Plastics.indd 1

2017/09/27 15:00 09.08.17 13:15


ELASTOMERS

PLASTICS & COMPOSITES

ACM CR EPDM Epichlorohydrin FKM HNBR HTV Silicone IR NBR NR PVC/NBR Blends SBR & BR

ABS Acetal Additives Composites CPE CSM EVA HIPS & GPPS Nylon PC PVC TPE & TPV TPU

FILLERS & ADDITIVES

AUXILIARIES & SERVICES

Aluminas Antimony Products Blowings Agents Carbon Blacks Flame Retardents Hydrocarbon Resins Magnesium Oxide Masterbatches MC & PE Waxes Mineral Fillers Peroxides Process Aids Rubber Chemicals Silanes Silica Sulfur Zinc Oxide

Curing Bladder Machinery Other Services Release Agents Release liners Spares

ANCHOR CHEMICALS Batch Off Bonding Systems Coated Powders Factice Masterbatching Process Aids Toll Mixing


Diary

Propak Cape: Six industry

showcases within one venue Extends olive branch too

www.propakcape.co.za

3523$.&DSH 2FWREHU&7,&& &DSH7RZQ ZLOOEHEDFNLQ&DSH7RZQ WKUHH\HDUVDIWHUWKHODVWHGLWLRQRI WKHHYHQWLQ7KLV\HDU¶VVKRZ ZLOOIRFXVRQ¿YHSDFNDJLQJUHODWHG VKRZFDVHVSOXVDQHZ:LQH 2OLYH2LO 3URGXFWLRQ([SRDVDVL[WK 7KH:HVWHUQ&DSHLVDVXLWDEOH KRPHIRU3URSDN&DSHFRQVLGHULQJWKH DPRXQWRIDJULFXOWXUDOSURGXFHWKDWWKH &DSHSDFNDJHVDQGH[SRUWVDOORYHU WKHZRUOG 7KHPDLQFDWHJRULHVLQFOXGH SDFNDJLQJIRRGSURFHVVLQJSODVWLFV printing and labelling.

7KH:LQH 2OLYH2LO3URGXFWLRQ ([SRLQDLPHGDWEULQJLQJZLQHDQG ROLYHRLOSURGXFWLRQDQGVXSSO\LQWRWKH VSRWOLJKW,W¶VDSODWIRUPIRUJURZHUV DQGSURGXFHUVRIZLQHDQGROLYHRLODOO LQYROYHGLQWKHVHFWRUSOXVLQGXVWULDOLVWV ZKRDUHEXLOGLQJRQWKHUHJLRQ¶VQDWXUDO FOLPDWHWKDWPDNHVWKH&DSHDSHUIHFW wine and olive oil producing area. Mamata 0DPDWD0DFKLQHU\ZLOOVKRZRQHRI LWV9HJDVHULHVEDJPDNHUVDW3URSDN &DSH:LWKPRUHWKDQPDFKLQHV ZRUNLQJLQDERXWFRXQWULHVDURXQG

WKHZRUOG0DPDWDTXLWHOLWHUDOO\NQRZV LWVVWXII 7KHPDLQDUHDVZKLFK0DPDWD ZKLFKLVUHSUHVHQWHGE\$GH[KDV EHHQPDNLQJH[WHQVLYHXVHRIVHUYR WHFKQRORJ\DQGDSSO\LQJWKLVWRLQGH[LQJ SRVLWLRQFRQWURO OLQHVSHHG YHORFLW\ FRQWURO DQGSUHVVXUH WRUTXHFRQWURO  ,WV8QLYHUVDOEDJPDNHUVDUHQRZ NQRZQIRUWKHIDVWHVWFKDQJHRYHURI MREVIURPVLGHVHDOWRERWWRPVHDOWR PL[ZHOGVNLUWVLGHVHDOMREV • 5HJLVWUDWLRQIRU3URSDN&DSHLVIUHH online.

Hotter, lighter, faster 7KHKHDGOLJKWUHÀHFWRULQWKH+\XQGDLL[PDGHIURP8OWUDVRQ® E, SRO\HWKHUVXOIRQHIURP%$6)LVQRWRQO\KLJKO\IXQFWLRQDOEXWDOVRHOHJDQW LQGHVLJQ,QDGGLWLRQLWFDQFRQWLQXRXVO\ZLWKVWDQGKLJKWHPSHUDWXUHV 'HYHORSPHQWVLQWKLVDUHDZLOOEHH[KLELWHGE\%$6)DW)DNXPD

2017 Green Building Convention 9-11 October CTICC, Cape Town www.greenbuildingconvention.co.za 3RO\ROH¿Q$GGLWLYHV 2FWREHU 9LHQQD$XVWULDZZZDLPSODVWLFVFRPHYHQWV ,QW¶O(ODVWRPHU&RQIHUHQFH &OHYHODQG86$

2FWREHU ZZZUXEEHULHFRUJ

2((& $PVWHUGDP1HWKHUODQGV

2FWREHU ZZZRIIVKRUHHQHUJ\EL]

87(&+ 38&RQJUHVV  $PVWHUGDP1HWKHUODQGV

2FWREHU ZZZXWHFKFRQJUHVVFRP

)DNXPD )ULHGHULFKVKDIHQ*HUPDQ\ ZZZIDNXPDPHVVHGH

2FWREHU

(XURPROG ([KLELWLRQ&HQWHU0XQLFK*HUPDQ\ ZZZHXURPROGFRP

2FWREHU

3URSDN&DSH CTICC, Cape Town

94

Diary new.indd 94

2FWREHU

2FWREHU ZZZSSLDFKLQDFRP

$IULFD$6($1%XVLQHVV([SR 1RYHPEHU 6DQGWRQ&RQYHQWLRQ&HQWUH-RKDQQHVEXUJ ZZZ DDEH[SRFRP (XUDVLDQ&RPSRVLWHV6KRZ 1RYHPEHU ,VWDQEXO7XUNH\ZZZHXUDVLDQFRPSRVLWHVFRP &203$0(' 1RYHPEHU 'XVVHOGRUI*HUPDQ\ZZZFRPSDPHGWUDGHIDLUFRP &RVPHWLFV3DFNDJLQJ1RYHPEHU 0DULWLP+RWHO&RORJQH*HUPDQ\  ZZZDPLSODVWLFVFRPHYHQWV



,&,6$VLDQ3RO\PHUV %DQJNRN7KDLODQG



:DWHUSURRI0HPEUDQHV1RYHPEHU 0DULWLP+RWHO&RORJQH*HUPDQ\  ZZZDPLSODVWLFVFRPHYHQWV

1RYHPEHU ZZZLFLVFRQIHUHQFHFRP

0DQXIDFWXULQJ,QGDED:&DSH1RYHPEHU Century City ICC, Cape Town ZZZPDQXIDFWXULQJLQGDEDFR]DZF

2FWREHU www.propakcape.co.za

,0(6$FRQIHUHQFH (PSHURUV3DODFH-RKDQQHVEXUJ ZZZFRQIHUHQFHLPHVDRUJ]D

33&$FRQIHUHQFH +DQJ]KRX&KLQD



$JURIRRG 3ODVWSULQWSDFN:$IULFD 'HFHPEHU $FFUD,QW¶O&RQIHUHQFH&HQWUH*KDQD  ZZZSSSZHVWDIULFDFRP

3RO\PHUVLQ)RRWZHDU'HFHPEHU +RWHO1LNNR'XHVVHOGRUI*HUPDQ\  ZZZDPLSODVWLFVFRPHYHQWV :LQG7XUELQH%ODGH0QI'HFHPEHU 0DULWLP+RWHO'VVHOGRUI*HUPDQ\  ZZZDPLSODVWLFVFRPHYHQWV 2018 3ODVWLQGLD )HEUXDU\ *DQGKLQDJDU*XJDUDW,QGLDZZZSODVWLQGLDRUJ 3URSDN(DVW$IULFD )HE0DUFK .,&&1DLUREL.HQ\D ZZZSURSDNHDVWDIULFDFRP &KLQDSODV $SULO +RQJTLDR6KDQJKDL&KLQDZZZFKLQDSODVRQOLQHFRP 3/$67 0LODQ,WDO\

0D\-XQH ZZZSODVWRQOLQHRUJ

5RWRPRXOG -XQH )LML ZZZURWRPRXOGFRQIHUHQFHFRPDX &RPSRXQGLQJ:RUOG([SR -XQH 0HVVH(VVHQ*HUPDQ\   ZZZFRPSRXQGLQJZRUOGH[SRFRP 3ODVWLF3LSHV;,; /DV9HJDV86$

6HSWHPEHU ZZZSYFSLSHVFRP

OCT / NOV 2017

2017/09/27 15:00


CLASSIFIED ADVERTS )256$/(

Advertisers:â&#x20AC;&#x201C; Oct / Nov 2017 ACD RotoFlo Adex (Sysmetric) Altair Development Banbury Chemicals Buzz Trading Cabletech Marketing Carst & Walker Charles Rust Associates Chemfit COMPLAST DemaPlastech DH Polymers Engen Petroleum ExxonMobil Erex (Negri Bossi) FdB Consulting Ferro Industrial Products GreenTech Machinery Hestico Inkulu Plastic Pipes Ipex Machinery Jenowill Karbochem Maritime Marketing Masterbatch SA MBT Mould & Die Solutions MGMW Trading MJH Machine Tools Mould Base Nissei ASB Orion Engineered Carbons Performance Colour Systems Plastichem PlastIndia 2018 Plasti-Tech Plastomark Polyoak Packaging Powder Plast Protea Chemicals Rapid Granulator Rawmac Relloy SABIC Safripol SAPY Colours SES Skyland Masterbatch Sun Ace Ultra Polymers Vishva Exim W D Hearn Machine Tools Your Technical Solutions Zerma Africa

23 57 78 68 11 53 93 33 39 91 71 34 21 13 55 64 45 63 09 29 37 03 80 17 47 35 67 87 41 48 54 75 85 IFC 89 31 65,66 07 15 IBC 49 81 79,90 77 05 43 51 28 27 59 69 OBC 01 61

â&#x20AC;¢ Complete extrusion line in like new condition consisting of High Speed mixer â&#x20AC;¢ SJ45/90 Twin screw extruder and full downstream equipment and well automated â&#x20AC;¢ Includes compressor, Cooling Tower and all ancillary equipment such as in line punching facility to produce the following of which the tooling is included: â&#x20AC;¢ Complete range of YT Trunking â&#x20AC;¢ NBT4 and NBT4 Twin compartment trunking â&#x20AC;¢ Tile edging 9 + 12 mm â&#x20AC;¢ Complete 20 â&#x20AC;&#x201C; 25mm flexible conduit line â&#x20AC;¢ 65mm Single screw extruder (PVC Screw) All equipment in excellent condition and presently operating Contact: 011 680 0797

:H%X\DQG6HOO 3ODVWLF3DOOHWV 083 756 6897 ZZZSUHPLHUSDOOHWVFR]D

Recycle your plastic with us We buy most forms of clean factory waste

THERMOFORMING, SHEET EXTRUSION, AND MATERIALS THERMOFORMING TECHNOLOGY SAVE 90% of your electricity use with GN! â&#x20AC;¢ GN (Canada): machines for reduced waste and reduced energy â&#x20AC;¢ Thermoforming Moulds for GN and other thermoformers â&#x20AC;¢ ToolVu technology for productivity and NEW quality improvement on thermoforming machines â&#x20AC;¢ Complete lines for EPS foam trays and EPS cup moulding NEW

EXTRUSION TECHNOLOGY FROM AGRIPAK OF ITALY Mono & multi-layer extrusion lines for the production of: â&#x20AC;¢ â&#x20AC;&#x2DC;Cartonplastâ&#x20AC;&#x2122; (twinwall/hollow profile sheet) â&#x20AC;¢ Multilayer sheet for packaging â&#x20AC;¢ Semi-foamed sheet for thermoforming

MATERIALS FOR THERMOFORMED PACKAGING

â&#x20AC;¢ Sealing films for trays and top web for FFS machines â&#x20AC;¢ OPS, PP, PET sheet for general packaging â&#x20AC;¢ PP/EVOH/PP for high barrier containers

BRE INNOVATIONS Contact: Tim Forshaw (083 381 5253) or Phil Hopkinson (083 408 5253) or 021 671 5253 or mail to tim@bre.co.za

52%86,1'8675,$/

0$7(5,$/)256$/(

Redundant masterbatch colours:

FIRST GENERATION RECYCLED PE 100 PELLETISED MATERIAL Contact: WAYNE on 084 657 0596

â&#x20AC;¢ 4 tons LDPE based masterbatch predominantly reds, yellow, blue, purple and white. â&#x20AC;¢ 1 ton PS based masterbatch Defy white for HIPS or ABS and transparent blue Defy crisper door for PS or SAN. Price: R30/kg

0$/7$

Contact: Klaus 072 246 1840

5(&<&/,1*

High-quality recycled HDPE, LDPE, PP Contact: Desiré Preston for more info Tel: 011 894 3520 | Cell: 083 774 6038 | Email: desire@jcl.co.za www.jcl.co.za

KD Polymers (Compounder)

phone Danie WHO   GDQLH#PDOWDUHF\FOLQJFRP

7RSODFHDFODVVLÃ&#x20AC;HG DGYHUWSOHDVH Fax: 086 519 6089 or Tel: 021 712 1408 or E-mail: saplastics@iafrica.com ZZZVDSODVWLFVFR]D

OCT / NOV 2017

Classifieds Oct/Nov'17.indd 95

95

2017/09/29 10:45


World News ST Core made of BASFâ&#x20AC;&#x2122;s Infinergy® ensures direct response at low weight

Ergon, BASF revolutionize

bicycle saddle www.ergonbike.com

ZZZLQ¿QHUJ\EDVIFRP

Core Ultra: innovative design principle combines optimum pressure distribution and active motion support 7+(5(KDYHEHHQQRVLJQL¿FDQW FKDQJHVWRELF\FOHVDGGOHWHFKQRORJ\ VLQFHWKHVZLWKPRVWPRGHOV FRQIRUPLQJWRDVWDQGDUGL]HGSULQFLSOH UDLOV±VDGGOHVKHOO±SDGGLQJ±FRYHU 7KHGLVDGYDQWDJHRIWKLVFRQVWUXFWLRQ LVWKDWWKHVDGGOHVKHOOKDVDGXDO UROHLWEHDUVWKHORDGRIWKHF\FOLVW DQGLVVLPXOWDQHRXVO\WKHVHDWVKHOO EHLQJWKHVXEVWUXFWXUHIRUWKHSDGGLQJ 7KLVUHVXOWVLQDVWLIIVHDWVKHOOZKLFK UHVWULFWVVHDWLQJFRPIRUW 7KHUHVHDUFKWHDPDW(UJRQD OHDGLQJ*HUPDQPDQXIDFWXUHURIELNH VHDWVJULSVDQGRWKHUPDLQO\IRDPHG FRPSRQHQWVKDVEHHQIRFXVLQJRQ WKLVDVSHFWLQSDUWLFXODUIRUVRPHWLPH 7KLVOHGWRWKHGHYHORSPHQWRIWKH UHYROXWLRQDU\7ZLQ6KHOOWHFKQRORJ\ ZLWKDQHUJRQRPLFFRUH7ZRVKHOOV IXQFWLRQLQLVRODWLRQIURPHDFKRWKHULQD VDQGZLFKFRQVWUXFWLRQKHOGLQDÃ&#x20AC;RDWLQJ DUUDQJHPHQWE\DKLJKSHUIRUPDQFH HODVWRPHUGDPSHUPDGHRI,Q¿QHUJ\® DQH[SDQGHGWKHUPRSODVWLF SRO\XUHWKDQH (738 GHYHORSHGE\

%$6)7KHORZHUVXSSRUWLQJVKHOO SHUIRUPVDORDGEHDULQJIXQFWLRQZKLOH WKHXSSHUÃ&#x20AC;H[LEOHVHDWVKHOOVXSSRUWV WKHSDGGLQJ 7KLVGHVLJQSULQFLSOHQRWRQO\ LQFUHDVHVFRPIRUWEXWDOVRDOORZV IRUDQHQWLUHO\QHZIRUPRISHGDOLQJ HUJRQRPLFV$VDUHVXOWRILVRODWLQJ WKHVHDWVKHOOIURPWKHVXSSRUWLQJ VKHOOWKHVDGGOHIROORZVWKH QDWXUDOSHGDOLQJPRYHPHQWVLQDOO GLUHFWLRQV7KLVKDVWKHDGYDQWDJHRI V\VWHPDWLFDOO\FRPELQLQJRSWLPL]HG SUHVVXUHGLVWULEXWLRQDFURVVWKHVLW ERQHVHI¿FLHQWSHGDOLQJHUJRQRPLFV H[FHOOHQWYLEUDWLRQGDPSLQJDQGDFWLYH EDFNSURWHFWLRQIRUWKH¿UVWWLPH 7KH(UJRQFRUHLVPDGHRI,Q¿QHUJ\® 7KLVLQQRYDWLYHPDWHULDOLVVHWWLQJQHZ VWDQGDUGVLQUHODWLRQWRGDPSLQJDQG VXVSHQVLRQGXHWRWKRXVDQGVRIOLJKW DQGKLJKO\HODVWLFIRDPSDUWLFOHV7KH KLJKHODVWLFLW\RSWLPL]HVWKHGDPSLQJRI SUHVVXUHLQWKHVHDWDUHD$VVRRQDV WKHSUHVVXUHLPSXOVHKDVSDVVHGWKH IRDPVSULQJVEDFNLQWRLWVROGVKDSH

7KHPDWHULDOUHWDLQVWKLVSURSHUW\HYHQ XQGHUFRQWLQXRXVORDG7KH(UJRQ FRUHWKXVHQVXUHVDGLUHFWGDPSLQJ UHVSRQVHDQGWKHKLJKHVWSRVVLEOH UHVLOLHQFHDVZHOODVPD[LPXP GXUDELOLW\DWPLQLPDOPDWHULDOZHLJKW 7KLV(738IRDPKDVDOUHDG\EHHQ XVHGZLWKJUHDWVXFFHVVE\OHDGLQJ PDQXIDFWXUHUVLQWKHVDIHW\DQG UXQQLQJVKRHVHFWRUV )UDQF$UQROG(UJRQIRXQGHUDQG FKLHIH[HFXWLYHLVFRQYLQFHGWKDW WKH67&RUH8OWUDUHSUHVHQWVDKXJH WULXPSK³7KHLGHDRIDGHVLJQSULQFLSOH XVLQJ7ZLQ6KHOOWHFKQRORJ\DQGDQ HUJRQRPLFFRUHKDVEHHQDURXQGIRUD ZKLOHEXWZHZHUHQHYHUDEOHWR¿QG DVXLWDEOHPDWHULDORQWKHPDUNHWWR LPSOHPHQWWKLVSURMHFW1RZ,Q¿QHUJ\® IURP%$6)KDVH[FHHGHGRXU H[SHFWDWLRQV,DPDEVROXWHO\FHUWDLQ WKDW(UJRQZLOOFDXVHDVWLULQWKH ELF\FOHLQGXVWU\ZLWKLWV67&RUH8OWUD´ 7KH67&RUH8OWUDZLOOEHDYDLODEOH LQ(XURSHDQGWKH8QLWHG6WDWHVIURP )HEUXDU\

Basketball kit uses recycled fibres 0$.,1*SRO\HVWHU¿EUHIURPXVHG3(7ERWWOHVLVQRWKLQJQHZ%XWLW¶VQHZWR$PHULFD¶V1DWLRQDO%DVNHWEDOO $VVRFLDWLRQIRUWKLVXSFRPLQJVHDVRQ7KHOHDJXHZKLFKLVFKDQJLQJXQLIRUPVXSSOLHUVIURP$GLGDVWR1LNH VD\VHDFKXQLIRUPZLOOLQFOXGH¿EUHPDGHIURPUHF\FOHGERWWOHV³7KHXQLIRUPLVFRPSULVHGRIDFRPELQDWLRQ RI$OSKD<DUQVDQGUHF\FOHGSRO\HVWHU HDFKDWKOHWHXQLIRUPUHSUHVHQWVDSSUR[LPDWHO\UHF\FOHG3(7ERWWOHV  1RWRQO\GRHVWKLV\DUQEOHQGPDWFK1LNH¶VEURDGFRPPLWPHQWWRVXVWDLQDELOLW\LWDOVRUHPRYHVPRLVWXUHPRUH TXLFNO\WKDQSUHYLRXV1%$XQLIRUPVZLFNLQJVZHDWIDVWHUWKDQFXUUHQW1%$XQLIRUPV´1LNHUHSRUWHG 1LNHDOVRUHSRUWVWKDWSHUFHQWRILWVIRRWZHDUDQGDSSDUHOFRQWDLQVUHF\FOHGPDWHULDOV7KHFRPSDQ\KDV GLYHUWHGPRUHWKDQELOOLRQSODVWLFERWWOHVIURPODQG¿OOGLVSRVDOVLQFH 92 OCT / NOV 2017

Sports.indd 96

2017/09/27 11:08


The Protea Chemicals Team offers innovative solutions to industry with the backing of world class products, suppliers and industry professionals.

JOHANNESBURG 011 821 3300 jhbsales@ proteachemicals.co.za

CAPE TOWN 021 550 8100 capeorders@ proteachemicals.co.za

DURBAN 031 468 5424 orderskzn@ proteachemicals.co.za

www.proteachemicals.co.za

PORT ELIZABETH 041 403 1000 peorders@ proteachemicals.co.za


SA PLASTICS, Oct-Nov 2017  

SA Plastics, Composites & Rubber is published six times a year. The magazine includes news and information about issues, products and techno...

Advertisement