Page 1

www.saplastics.co.za

VOL 15 ISSUE 1 – FEBRUARY / MARCH 2017

RPC’s offer for Astrapak gets approval

New agency for Exxonmobil in South Africa

MILLIKEN – CLEARER BETTER AND FASTER

Alpla – plan & plant give advantages

N (PCA) &

‘Upcycling’ at MyPlas

OF T P

RN AF HE

RS

ASS O CI A S OU T

TIO

LICATION

OF TE A)

OF FI

PU B

ICS CONV A ST ER PL TE HE S INSTI STIC TU LA CA (PIS RI

C

L IA

Plastics|SA ‘greening’ partner for three major events

Designing with recycled materials

38

Trends from DuPont packaging awards

78

African Marine Waste event in PE

82


HIGH PERFORMANCE

;LYS\YHU®GP35`PLSKZZ\WLYPVYHLZ[OL[PJZ^P[OOPNONSVZZÄUPZOLZ IYPSSPHU[JVSV\Y and no visible weld lines.

Terluran® is a registered INEOS Styrolution product.

The superior properties of Terluran®GP35 stretches IL`VUKP[ZÅV^HIPSP[`. In addition to enabling the moulding of thin-walled articles and those with adverse ÅV^SLUN[O[V^HSS[OPJRULZZYH[PVZP[ZZLSSPUNWVPU[ZPUJS\KLNVVKK\J[PSP[` and a high NSVZZÄUPZO 6^PUN[VP[ZIYPNO[HUKJVUZPZ[LU[PU[YPUZPJJVSV\Y;LYS\YHU® GP35 ABS is ideally Z\P[LKMVYZLSMJVSV\YPUNWHY[PJ\SHYS`^OLU[OLYLPZHULLKMVYIYPSSPHU[JVSV\YZ  0TWYV]LKÅV^WYVWLY[PLZHSZVLUZ\YLLSPTPUH[PVUVM^LSKSPULZ which results in a product of Z\WLYPVYHLZ[OL[PJZ.  0[ZOPNOÅV^HIPSP[`HSZVLUZ\YLZZ[YLZZMYLLTV\SKPUN[OH[LUHISLZ;LYS\YHU®GP35 products to be electroplated. Get better value from INEOS Styrolutions high performance materials. For more info call 0800 006 772 or go to www.plastichem.co.za


A new generation takes shape.

Take the proven and tested, make it even better and explore something new – that is what makes ENGEL and their customers so successful. Following our claim be the first, we present a new generation of injection moulding machines setting new standards. For now, we will entice you with this: We do not compromise on energy efficiency, ergonomics or precision. Do you want to know more?

www.engelglobal.com www.greentechmachinery.co.za sales@greentechmachinery.co.za


BY THE WAY

Publisher: Martin Wells (martin@summitpub.co.za) Editor: Tessa O’Hara (tessa@summitpub.co.za)

Gone in close to record time – The attractively coloured polystyrene egg boxes, which are reusable and recyclable, were pulled off the shelves by Woolworths just a week after being introduced in December.

Editorial assistant: Heather Peplow (heather@summitpub.co.za) Financial manager: Lisa Mulligan (lisa@summitpub.co.za) Designer: Jeanette Erasmus Graphic Design (jeanette.erasmus@lateraldynamics.co.za) Bronwen Moys Blinc Design (bronwen.clarke@gmail.com) Summit Publishing cc t: +27 (21) 712 1408 f: 086 519 6089 c: +27 (82) 822 8115 e: saplastics@iafrica.com Postnet Suite 42, Private Bag X16, Constantia 7848, Cape Town, South Africa Unit 8, Bergvliet Village Centre, Cnr Hiddingh & Children’s Way Roads, Bergvliet 7945

www.saplastics.co.za GAUTENG Lowrie Sharp t: (011) 793 4691 f: (011) 791 0544 c: 082 344 7870 e: lowrieplasticsmedia@absamail.co.za KZN Lynne Askew t: (031) 764 2494 f: (031) 764 0676 e: lynne@summitpub.co.za Printed by: Tandym Print, Maitland, Cape Town SA Plastics Composites + Rubber Technology is published six times a year and focuses on these industries in South and southern Africa. We welcome news, articles, technical reports, information in general and photographs about events and developments related to the plastics industry. The views expressed in the magazine are not necessarily those of the publisher. Views expressed are not necessarily those of the Plastics Converters Association, Institute of Materials or Association of Rotational Moulders either. Copyright: All rights reserved. ISSN number: 1684-2855 (ISDS Centre, Paris) Summit Publishing: CK 9863581/23 VAT reg: 4600187902

Plastics Institute of Southern Africa

Association of Rotational Moulders of South Africa

Plastics Converters Association

PET Plastic Recycling

Plastics Federation

South Africa

of SA

Institute of Materials

The power of social media WOOLWORTHS has called off a trial that introduced colourful plastic egg boxes following a backlash from customers on social media platforms. The plastic egg boxes, on Woolies’ shelves for a short while during the festive season, were an attempt to make the containers more reusable in a ‘playful’ manner. The boxes had been launched in three brightly coloured plastic containers called ‘Eggplay’. But the backlash online was immediate, with thousands of individuals taking to Twitter and Facebook to complain about the product, which they said was an unnecessary and wasteful addition, considering the biodegradable nature of the recycled cartons the eggs are currently sold in. Writers criticised Woolworths for using plastic – even though the company pointed out that the boxes were designed to be re-used, could be recycled and returned to stores to be donated to other people. Woolworths responded: “It seems the power of social media should not be underestimated. During late January Woolworths responded, saying that the trial was called off and the product would be discontinued and pulled off shelves within a week. Your feedback is very important to Woolworths and we’ve listened to all comments received regarding the Eggyplay toy egg box. The Eggyplay toy egg box is a trial. Based on your feedback, we’ve decided to end the trial as soon as we can. The boxes should be out of stores in 5 to 7 days. Any remaining plastic egg boxes (you can return them to our stores) will be donated through our MySchool programme. Woolies remains committed to designing recyclable packaging and to continue to listen to you, our customers.”

National minimum wage by May 2018 IT APPEARS that the national minimum wage legislation will certainly be implemented before or by 1 May 2018, Deputy President Cyril Ramaphosa announced recently. In terms of the agreement, the national minimum wage (NMW) level will be R20 per hour which amounts to approximately R3 500 per month for employees who work 40 hours per week and approximately R3 900/month for employees who work 45 hrs/week. Initially domestic workers will be paid 75% of the NMW while agriculture workers will be paid 90% of the NMW. However, the proposal is that within two years of the introduction of the NMW, employees in these sectors will be paid 100% of the NMW. No business will be excluded from the NMW, but a business will have the option to apply for an exemption if it cannot afford to pay wages at the NMW level. Businesses that are exempt will have to pay a percentage of the NMW and the exemptions will only be provided for 12 months at a time. HAVE … IF YOU Employers should therefore prepare for the G TO SAY IN H ET M SO de: if you si implementation of the NMW. ht ig br at the to Look wisdom e gem of have som to us at te ri w se ea impart, pl com a. ic fr ia s@ saplastic


VOLUME 15 NR 1

REGLOPLAS

JANUARY / FEBRUARY 2017

Contents Find out more at www.saplastics.co.za

6 10 12 15

Design distinction in bioplastics EverBlock modular building blocks now in SA

24

26 18

34 36

38

SAPPMA: Pipes XI – A collaboration between SAPPMA and PPCA PISA annual conference will explore Industry 4.0 Plastics|SA encourages growth, innovative thinking POLYCO: Local plastics collectors, recyclers JHW¿QDQFLDOERRVW PSPC: Polystyrene recycling in SA exceeds expectations SAVA FRQ¿UPVH[FLWLQJVSHDNHUVIRU9LQ\OV SA 2017 Conference

62

• Alarm buzzer • Heating capacity 9 kW • Cooling capacity 24-90 kW

NEW

Type 150 Smart

50

Temperature control units for oil up to 150°C • Controller RT61 PID

63 64 66 68

• Outlet temperature max 150°C • Heating capacity

54

69

28kW @ 140°C • Pump capacity 60

• Simultaneous readout of temperature set-point and actual value

79 80

at 400V 6 kW • Cooling capacity

litres/min, 3.8 bar

WORLD NEWS Breathing Skins showroom wins EPSE innovation award ICEhouse – designing for durable carbon

• Solid-state relay (SSR)instead of

• Pump capacity 60 litres/min, 3.8 bar

44

ASSOCIATION NEWS

• RT 70 control system

changer for pump direction (clockwise)

PLASTICS IN AUTOMOTIVE SA automotive industry facing threat of impending skills shortage

Temperature control units for water up to 90°C

heating contactor • Automatic phase-

32

DESIGN

… for large injection moulds, extruders, rollers, autoclaves and other processing equipment

New, more efficient Type 90 Smart

INDUSTRY NEWS ‘Upcycling’ with customised recycled materials at MyPlas Proven plan, plant layout give Alpla advantages JCL celebrates 22 years in recycling Raw materials automation critical for advance of plastics processing in Africa Orchem Trading appointed SA agent for Cabot Global plastics industry effort to combat marine litter grows in 2016 Mellow motion

High-performance temperature control units

86

ON THE COVER Milliken focused on the advantages of using its WHFKQRORJ\OHDGLQJFODUL¿HUV and nucleators to improve PP resins, and demonstrate how its UV absorber can improve key properties in PET packaging, at Arabplast from 8-10 January at the Dubai World Trade Centre in the UAE. Read more on page 82 www.millikenchemical.com

• Clear arrangement of operating and indicating elements • Solid state relay (SSR) instead of heating contactor • All components exposed to water are made of non-rusting materials, hence long service-life • Achieves estimated 24% reduction in rejects and 20% increase in productivity

JENOWILL SERVICES Contact – Willy Tschopp Tel: 021 551 7241 Fax: 021 551 7243 28C Lilly Park, Railway Rd Montague Gardens, Cape Town jenowill@iafrica.com www.regloplas.com


COMMENT Mellow motion – The ‘Mellowcab’ short distance electric taxi for two is a development E\)UDQVFKKRHNHQWUHSUHQHXU1HLOGX3UHH]&XUUHQWO\LQWKHÂżQDOVWDJHVRISUH production, the vehicle uses a composite chassis and is intended to operate in a OLPLWHGXUEDQUDGLXVRINP,WLVQRWPHDQWWRFRPSHWHZLWKRWKHUWUDQVSRUWV\VWHPV VXFKDVWUDLQVRUEXVHVEXWUDWKHUIHHGLQWRDQGFRPSOHPHQWH[LVWLQJQHWZRUNV$ 0HOORZFDEFDQSURYLGHRYHUNPRIWUDQVSRUWDGD\6HHSDJH

Only realistic forecast is:

THIS ISSUE

expect it to be tough But it may be just tough elsewhere

W

EATHER forecasts have become far more accurate than ever before, but the same can’t be said for economic forecasting – your money is probably safer if you’re betting on the horses. A lot of people are obviously interested in where the South African economy is headed in 2017 and possibly the only relief is that the situation is not as bad as quite a lot of people were predicting. We frequently get questioned on the topic and it is true that, because of the nature of journalism, we speak to a lot of convertors around the country – so the interested parties are usually just as interested in how other convertors in their market sectors are doing, which is arguably also a barometer of the state of the industry. The only thing ,FDQFRQÂżUPLVWKDWPRVWRIWKHVXFFHVVIXOFRQYHUWRUVDUH WRREXV\WRZRUU\PXFKDERXWSROLWLFDOIDFWRUVDQGLQĂ€XHQFH although not ignoring the political scene altogether. %XW,FDQFRQÂżUPWKDWHYHQVRPHRIWKHWRSFRQYHUWRUVKDYH grudgingly conceded that “it’s toughâ€? at the moment. And it’s probably the same almost everywhere – just a glance at global headlines suggests there are problems all over the place. With over-capacity in most sectors of most economies, the competitive environment is brutal at times – if not most of the time. So probably the only thing to expect over the next year is that it is going to be challenging.

slightly different way of doing things, with methods that have been tried and tested in other countries. RPC is involved in 31 countries and employs over 20,000 people. Alpla had similar origins (it operates 159 plants in 42 countries, see page 10) but it has only a single plant in South Africa, whereas RPC will be using the 9 Astra plants as its springboard, so it is likely to provide serious FRPSHWLWLRQ$VWUDSDNœVÀH[LEOHVEXVLQHVVLVJRLQJWREHVSOLW off from the divisions bought by RPC, and the Astra-RPC business is to be delisted from the JSE. Besides that, it’s business as usual and expect to see continued growth in the plastic packaging sector this year. That is simply because it’s a global trend, which was noticeable at the K show in Germany towards the end of last year, with convertors from unheard of places arriving and a lot of growth expected in India particularly. What we need to hope for is that the technical moulding sector shows resilience and regains some of the market share it has lost of the past few years.

Our newest venture – Composites SA

Can you believe that we’ve been publishing SA Plastics, Composites & Rubber magazine for 15 years already! During this time we can say (modestly) that we have learned A LOT about the industry. We believe the time is right for another publication, but this one Another int’l entrant is unambiguously about composites, and In spite of the challenging scenario, Astrapak group PRUHVSHFL¿FDOO\WKHFRPSRVLWHVLQGXVWU\ has attracted an international buyer, which suggests in South Africa. that the view from outside of South Africa may be VXH LV With the industry’s interest, the slightly brighter than for many of those in the country. W V U ¿ I RIWKH UVLRQR digital Composites SA version will RPC of the United Kingdom has tabled an offer of H &RYHU Y O D GLJLW gain market traction and we may close to R1,4-billion for the nine operations in Astrapak’s RIWKH PDJ Z WKHQH even print an annual print issue. There is major moulding and forming divisions (see page 20). This brings scope for composites in transport, mining, to and end rumours which have been swirling around the construction and numerous other sectors, industry since March last year. If you are surprised that a and composites are seen as materials of the foreign convertor group should make so large an investment future, so we are looking forward to exciting in South Africa, you are probably not going to be surprised and interesting times. If you haven’t yet that RPC’s entry to the market is likely to shake things up seen the magazine, visit our website and a bit – just as the arrival of Alpla has done over the past click on the icon in the right-hand column. two years. These international convertors bring with them a Martin Wells,

4 FEBRUARY / MARCH 2017

Publisher


Top Employer Achievement Award 9 years in a row

džĐĞůůĞŶĐĞŝƐ͘͘͘/ŶŶŽǀĂƟŽŶŝŶ,ƵŵĂŶZĞƐŽƵƌĐĞƐ


NEWS The extrusion hall at the large MyPlas site in Bellville Industria

‘Upcycling’ with customised recycled materials at MyPlas New lab performs complete range of tests

6 FEB / MAR 2017

FIVE years since establishment, Cape recycler MyPlas is processing 700 tons a month of HDPE and PP – and is now also one of the largest post-consumer recyclers of polypropylene in South Africa. The company was started in 2012 by three partners – Johann Conradie, Walter Jordaan and Stephan Roux – with a team of very experienced recyclers. At that stage they were processing 180 tons a month at a plant in Stikland in Cape Town with funding from the Industrial

Development Corporation (IDC) and a private investor. The plant was later upgraded with funding from POLYCO in 2015. That year the Lomold group exited the scene, with its recycling business Proplas in Bellville being jettisoned in the aftermath. MyPlas subsequently purchased all the Proplas equipment from the bank and restarted the plant at the former Proplas site in nearby Bellville Industria, moving from its previous location. John Nield, the original founder of Proplas, remained with the company

Myplas Production team includes process engineer Pierre van Zyl, customer relationship manager John Nield, co-MD Walter Jordaan, chairman Stephan Roux (the Pretoria ice cream baron) and joint MD Johann Conradie

and is now key-customer relationship manager at the expanded MyPlas operation, an important advantage for the company as experience is vital in the still developing plastic recycling business – and John has over 30 years’ experience. “We are now slowly replacing the worn Chinese machinery with high-speed European equipment, including Weima, Erema, Untha and Tria,” said Johann. “We are very excited about the entry of POLYCO over the last few years as it has already contributed immensely

Lab manager Aubany Engelbrecht was formerly in the viticulture industry, and has taken to plastic recycling with ease; here she performs a test on the DSC (digital scanning calorimeter) unit used for, amongst other things, material composition analysis and oxidation induction times


Skilled and consistent collection and sorting of incoming materials is vital for a successful recycling operation

Careful and deliberate sorting of collected material before the shredding stage gets the process at MyPlas off to a good start

WHVWVLQFOXGLQJLPSDFWWHQVLOHPHOWĂ€RZ density, ash content, oxidation induction time, polymer compostion and more. Where required, Myplas provides &HUWLÂżFDWHVRI&RQIRUPDQFHZLWKPDWHULDO to ensure peace of mind for clients. MyPlas is also in the process of DWWDLQLQJ,62FHUWLÂżFDWLRQ

Mypolen ‘upcycling’ venture The latest venture to emerge from this forward-thinking recycler is the ‘upcycling’ of some of its materials with additives to improve characteristics such as MFI, impact resistance and thermal stability. “With our state-of-the art lab we are >

FEB / MAR 2017 7

in helping the recyclers and recycling industry in SA,�he added. Last year MyPlas installed a highly sophisticated R 2-million laboratory, with help again from the IDC and POLY CO. By far the most sophisticated of any recycler in South Africa, the MyPlas lab can perform a complete range of


NEWS Ampaglas liquidated AMPA Group (formerly known as Ampaglas), for long one of South Africa’s leading sheet extruders, has been liquidated. It appears the banks pulled the plug on the operation in November last year. Ampa has been ¿JKWLQJDWRXJKEDWWOHDJDLQVWLPSRUWHG sheet in recent years, with no duty protection being afforded to the local manufacturer. The PMMA (acrylic) sheet manufacturing line operating from the same premises at Elandsfontein in Johannesburg is operated by Evonik group of Germany and is not affected by the Ampa closure.

JUST BRIEFLY

Tin Can Man closes Cape plant TIN Can Man, which bought and took over the blow moulding business Winplas in late 2015, has shut the group’s plant in Beaconvale, Cape Town. According to a source at TCM, WKH&DSHSODQWÂłZDVQHYHUSURÂżWDEOH´ Tin Can Man now operates from its plant in Alrode, Johannesburg. Tin Can Man is part of Dursots group, a supplier of food and beverage products to supermarkets around the country; its business motto is ‘Class in a Can’.

SE-Asian countries’ trade mission in November Member countries of the Association of Southeast Asian Nations are set WREULQJWKHLUÂżUVWMRLQWWUDGHPLVVLRQ and business expo to South Africa later this year. Led by the Singapore Manufacturing Federation (SMF) and Conference & Exhibition Management Services (CEMS), the inaugural AfricaASEAN Business Expo (AABE) is aimed at introducing African businesses to the newly established ASEAN Economic Community (AEC), as the “two regions ramp up their bilateral trade and investment cooperation in the IDFHRIJOREDOHFRQRPLFXQFHUWDLQWLHV´ Formed in 1967, ASEAN represents the Southeast Asian countries of Indonesia, Malaysia, the Philippines, Singapore, Thailand, Brunei, Cambodia, Laos, Myanmar and Vietnam, with a total population of over 622 million people. AABE 2017 will be held at the Sandton Convention Centre from 6-8 November. www.cems.com.sg

8 FEB / MAR 2017

One of the company’s wash plants

able to develop custom materials for our clients. We achieve this by sorting deliberately according to requirements, pre-blending of raw materials and compounding our recycled materials ZLWKDGGLWLYHV´H[SODLQHG-RKDQQ “The end product, known as Mypolen, LVERWKDSURGXFWDQGDVHUYLFH´VDLG Johann. “Pellets are continuously tested and FODVVLÂżHGLQRXUODE7KHPHFKDQLFDO data is regularly monitored and quoted in our data sheets on the basis of these tests. “Feedback from clients so far has been positive with the newly developed Mypolen HD and Mypolen PP materials meeting with very favourable response from test customers. The base materials for the Mypolen materials are HDPE and PP plastic waste, which are obtained from, among other sources, post-consumer household and industrial waste collections. We process these materials at our plant in several stages, hand sorting according to colour and type of plastic, before it goes for extrusion. The end-result is a pelletised material suitable for the production of highquality products, also for the consumer segment. “We can always try to comply with FXVWRPHUUHTXHVWVIRUVSHFLÂżFFRORXUV and properties. These materials are aimed at replacing virgin plastics in

critical components. “We’ve also started to sell to qualitysensitive industries like the auto industry and we have started exporting into $IULFDDQG6RXWK$PHULFD´VDLG-RKDQQ Addition to the team A new addition to the 150-strong MyPlas staff is Pierre van Zyl, a process engineer with 30 years’ recycling and extrusion experience, including at Plastamid. “Pierre brings a critical, qualityÂżUVWDSSURDFKWR0\3ODVIURPKLV Plastamid days and has been tasked with achieving our ISO FHUWLÂżFDWLRQGXULQJ ´ Johann and Walter attended the K2016 show in Germany last year and observed that the European recycling industry appeared to be moving away from current high levels of incineration towards more mechanical recycling – something the South African recycling industry is already a world leader in. “However, to achieve higher recycling rates in SA we have to not only stimulate the supply of scrap, but also demand for the recyclate. We can’t depend on black bags, chairs and pipes as the main clients forever, but have to move into industries that historically XVHGYLUJLQRQO\´KHDGGHG

‘Mypolen’ is both a product and a service

www.myplas.co.za

For the production of high standard recycled materials, staff need to be both well trained and well informed; the ISO accreditation process underway at MyPlas is helping achieve this


GET

OUT OF SHREDDING New Rapid Shredders

The RAPTOR Series! • Recycling of all types o Heavy lumps or light weight 42 cubic foot IBC containers, all is possible in the Rapid Raptor series. • Open-Hearted technology First Open-Hearted shredder. Less than a minute! That’s all it takes to open up the complete machine for cleaning or maintenance. • Patented unique knife design Rapid’s new unique QuadCUT knives offer four true knife edges. Clamping is rock solid with impact absorber reducing the risk of damage. • Modular concept with 36 unique base configurations • Tilt back hopper • Patents pending • Can be operated from PC or pad offering unique logging possibilities

Rapid’s patented QuadCUT knife system with impact absorber.

Controlling the shredder from an iOS/Android pad.

FdB CONSULTING Engineering Design

www.rapidgranulator.com

Phone: +27 (0)82-651 3315 Email: frank@fdbconsulting.co.za


NEWS

159 plants – The South African plant commissioned in 2014 was the 144th to be developed by Alpla Werke, the Austrian converting group; it has since grown its global foothold with a further 15 plants, now operating 159 worldwide

Proven plan, plant layout give Alpla advantages Global blueprint: applying lessons from other markets where group is involved SOUTH Africa was number 144 on the list of Alpla’s global plants, coming after the Austrian group’s many investments around the world, so the shock it provided to the local market was something convertors across the globe had previously experienced, survived ‌ and possibly learned from. And there was nothing special about the fact that it was the global group’s 144th plant, just coincidence really, and since the setting up of the plant in Johannesburg in 2014 Alpla has put up 15 more plants – it now operates 159 plants in 42 countries. The arrival of Alpla as well as other international converting groups over WKHSDVWIHZ\HDUVUXIÀHGWKHIHDWKHUV of many in the industry and several allegations of unfair practice were made. Some of these allegations have been reported in this publication and

have been contested and refuted. SA PLASTICS consequently went to investigate, visiting the Alpla South Africa plant in Spartan, Johannesburg, and made some interesting observations. The background ALPLA Werke Alwin Lehner GmbH & Co KG was started in 1955 by the brothers Alwin and Helmuth Lehner in +DUG$XVWULDZLWKWKHÂżUVWSURGXFWLRQ site being their father’s laundry. Their start-up capital involved “inexpensive injection moulding machine as well as technical creativity and intelligenceâ€?. With such an inauspicious beginning, visualising that bigger things lay ahead would have been unlikely at that stage, but the Alpla team devised a model which found the favour of brand manufacturers which they were able to replicate and expand across borders. Besides Austria, the group has

since set up manufacturing plants in Argentina, Brazil, Colombia, Costa Rica, Panama; Mexico, Belgium, England, France, Germany, Holland, Spain, Poland, Portugal, Slovenia, Saudi Arabia, Uzbekistan, Vietnam, Turkey, Russia, China ‌ you name it. But how? Arguably the ¿UVWVWHSZDVWR fully cooperate with local legislation, which in the African case may have been more complex than in some other nations. According to Alpla SA manager Javier Delgado, the company has met all the set employment conditions. And it is the group’s policy to develop employees with its comprehensive

10 FEBRUARY / MARCH 2017

Among Alpla’s simple but effective solutions is a customised truck and trailer design, ideally suited for transport of lightweight but often bulky packaging containers

, Javier Delgado , who is Spanish r ge na ma the Alpla the responsible for of the development an plant in Spart since 2014

‘Our business here operates with locals deals’


in-house training programmes and to create a working environment where high levels of hygiene, individual development and production output are encouraged and achieved. Contrary to rumour, ALL production personnel at Alpla SA now are either South African or from neighbouring states. And it has achieved the required Level 6 empowerment rating. Although in South Africa employers often talk about trying to employ as few people as possible, most companies are probably employing more personnel relative to output than in the industry globally, certainly compared to convertors in the developed world. Alpla appears to know exactly how many people are required for its local output, which is increasing. Finding that formula may prove useful to many other convertors. Alpla has also streamlined its equipment procurement process by ZRUNLQJZLWKVSHFLÂżFVXSSOLHUVZKLFK has yielded long-term synergies, said Javier. The same applies to its mould requirements: it sources most of its moulds from toolrooms with which it has established relationships, but for the rest “it’s an open marketâ€? said Javier, adding that Alpla SA has

Visual inspection by Alpla production supervisors is customary, but probably unnecessary, as all QA systems at this global player’s plants are automated

started working with two South African toolrooms. But it’s possibly the layout of the plant, to a proven design – honed over the years by the teams at the tech centres in Austria as well as Brazil, Mexico, Thailand, USA, China and ,QGLD¹WKDWKDVSURYLGHGVLJQL¿FDQW SURGXFWLRQHI¿FLHQFLHVIRUWKH6$ venture. The exchange between the tech centres, applying lessons from other markets where cultures may be different but technical advantages yielded can be applied locally, may KDYHPRVWEHQH¿WHGWKHJURXS¹DQG put some daylight between the Alpla production units and their opposition The South African plant operates from premises in Spartan near OR Tambo

airport which are centrally situated for logistic purposes but which required DQH[WUHPHPDNHRYHUWRÂżW$OSODÂśV proven blueprint. Javier was tasked with applying this layout footprint in Spartan, which appears now to have been fully implemented. Javier has since been transferred and taken up a post with Alpla in the Middle East. At the end of the day, for convertors, is there a difference between local and international competition? For one thing, both beat the direct importation of manufactured goods, which probably remains the main enemy for local manufacturers.

www.alpla.com

FEBRUARY / MARCH 2017 11

9LN5V

With 35 years’ experience in supplying engineering polymers to the industry, our logistics & technical backup provide the highest level of service and support.

ABS – Polylac MABS – Polylac ASA – Kibilac SAN – Kibisan GPPS – Taitarex / Denka / Polyrex / Supreme Q-RESIN – Kibiton / Denka HIPS – GPPC / Supreme EPS – Taitacell / King Pearl  PMMA – Acryrex SMMA – Acrystex PC – Wonderlite Johannesburg Jeremy Goosen (T) 011 626 1030 jeremy@rawmac.co.za

Cape Town Shanaaz Wardien (T) 021 933 331/2 shanaaz@rawmac.co.za

PC/ABS ALLOY – Wonderloy PA 6 – Zissloy PA 66 – Gramid / Zissloy POM – Kocetal PBT – Spesin EVA – APC SBS – Kibiton 330,1(5$/),//¹:RRUL&RÀHQ&DOSHW PP GLASS FILL – Woori PE – HDPE / LLDPE  UREA COMPOUND – Sprea  Durban Muthu Sagree (T) 031 577 0505 sagree@rawmac.co.za

www.rawmacplastics.co.za

Port Elizabeth Delene Williams (T) 041 484 3390 glen@rawmac.co.za


NEWS

Operating from premises in Boksburg, JCL has 3500m² under roof and a 1000m² yard and today supplies many different plastic materials to companies throughout South Africa, South East Asia and Europe

JCL celebrates

22 years in recycling

Supplies companies throughout South Africa, South East Asia and Europe JCL Plastic Enterprises (JCL), one of South Africa’s leading plastic waste solutions companies, celebrates 22 years in business this year. The company started out as a closed corporation in 1995, founded by John Lovell, managing director, who has a mechanical engineering degree from Wits. Initially JCL provided recycled High Impact Polystyrene (HIPS) and Rigid Polyvinyl Chloride (PVC-U) to plastic companies in Gauteng. Operating from premises in Boksburg, JCL has 3500m² under roof and a 1000m² yard and today supplies many different plastic materials to companies throughout South Africa, South East Asia and Europe. JCL processes around 40 tons per month of rigid PVC into pipe and packaging strips. 420 tons per month of other materials are sourced, sorted,

baled and sold to specialist recycling companies. The majority is PET (570 tons a year), PC (300 tons a year), PS (650 tons a year), mixed PP and PET strapping (250 tons a year) and plastics from waste electrical and electronic equipment (250 tons a year). JCL provides recycling solutions to companies wanting to dispose of plastic waste. These activities range from plastic scrap trading on the one end to the production and selling of finished products manufactured from recycled plastic on the other. JCL operates in five broad categories Ÿ Sorting, compacting and preparing plastic waste for recycling Ÿ Providing the South African market with waste materials for recycling Ÿ Providing (mainly) unprocessed scrap to the European and Far East markets Ÿ Producing corner strip packaging for

the agricultural industry

Ÿ Producing RPVC Piping up to 160mm

diameter. Lovell said that the company has managed to show stellar growth despite the current economic downturn, and will remain a leader in the plastic trading and recycling industry. “JCL finds itself in a niche market and plans to expand its product offering to grow revenue and market share. Exports and product diversification will ensure that JCL achieves these objectives,” he added. Over the next few years Lovell intends to increase JCL’s sales by 10% pa, purchase company premises and modernize the company’s material handling facilities. www.jcl.co.za

52 FEBRUARY / MARCH 2017

JCL employs 34 staff members, averaging 6.2 years’ service with the company, who have all been trained in the handling, identification and processing of plastics

JCL was fo unded in 1995 by Jo hn Lovell


,W¶VWLPHWRJHWUHDO 021,725028/'6,15($/7,0( 3URJUHVVLYH¶V&9H0RQLWRUVDUHRQPRXOGVZRUOGZLGH1RZWKLVPRXOGPRQLWRULQJ SODWIRUPFRQWLQXHVWRDGYDQFHWRHQDEOHUHDOWLPHYLVLELOLW\RIFULWLFDOPRXOG SURGXFWLYLW\ „ „ „ „ „

7H[WDOHUWVZKHQDPRXOGVWRSVSHUIRUPLQJDVH[SHFWHG 5HMHFWDQGGRZQWLPHWUDFNLQJIRUFDOFXODWLQJRYHUDOOHTXLSPHQWHႇHFWLYHQHVV :RUNRUGHUDQGPRXOGPDFKLQHRSWLPLVDWLRQWUDFNLQJ 6WDWXVFDQEHYLHZHGRQPRELOHGHYLFHVDQG3&V $QXQEHOLHYDEO\D௺RUGDEOHVROXWLRQ

&9HOLYHGLVSOD\VGDWDLQDQHDV\WRXQGHUVWDQGIRUPDWWKDWDOORZVXVHUVWRLGHQWLI\ PRXOGLVVXHVWRGD\WKDWFRXOGLPSDFWWKHVXSSO\FKDLQWRPRUURZ&RQWDFWXVWR GLVFXVVUHDOYLVLELOLW\IRU\RXUPRXOGV :DWFKWKHYLGHR ZZZPGVFR]DFYHOLYHKWPO

ZZZPGVFR]D

&RQWDFWXV       

&DOO &37  -+% (PDLOLQIR#PGVFR]D 


NEWS

14 FEB / MAR 2017

From bottle to bag 7+(WUHQGWRZDUGVVXVWDLQDEOHSDFNDJLQJKDV EHHQJURZLQJVLJQL¿FDQWO\LQWKHSDVW\HDUV EULQJLQJLQWRIRFXVUHXVDELOLW\ELRGHJUDGDELOLW\ DQGUHF\FODELOLW\RIWKHSDFNDJLQJPDWHULDOV :LWKWKHGHYHORSPHQWRIWKHSURGXFWLRQ WHFKQRORJ\IRUZRYHQSODVWLFVDFNVPDGHIURP U3(76WDUOLQJHU &R*PE+QRZRIIHUVWKH RSSRUWXQLW\RIFORVHGORRSSURGXFWLRQIRUWKLV W\SHRISDFNDJLQJ ³6WDUOLQJHUEXLOGVRQGHFDGHVRIH[SHULHQFH LQZRYHQSRO\SURS\OHQHVDFNSURGXFWLRQ DW\SHRISDFNDJLQJWKDWLVUHXVDEOHDQG UHF\FODEOH´VDLG6WpSKDQH6RXGDLVKHDGRI 6WDUOLQJHU¶V&RQVXPHU%DJV'LYLVLRQ³6LQFH ZHFDQSURGXFH3(7WDSHIDEULFIURP YLUJLQ3(7DQGUHF\FOHG3(7SHOOHWVRQRXU PDFKLQHV1RZZHKDYHDFKLHYHGDQRWKHU EUHDNWKURXJKLQZRUNLQJZLWKUHF\FOHG3(7 ZHFDQSURGXFHU3(7WDSHVGLUHFWO\IURP3(7 ERWWOHÀDNHV´ )DEULFPDGHRI3(7WDSHVFDQEHFRQYHUWHG WRYDULRXVW\SHVRIZRYHQVDFNVRUXVHGIRU WHFKQLFDODSSOLFDWLRQVIRUH[DPSOHFDUSHW EDFNLQJRUJHRWH[WLOHV )RUFRQVXPHUDSSOLFDWLRQVDWWUDFWLYH SDFNDJHGHVLJQLVSRVVLEOHE\ODPLQDWLQJWKH U3(7IDEULFZLWKUHYHUVHSULQWHG%23(7¿OP $SHUIHFWH[DPSOHRIH\HFDWFKLQJGHVLJQ RQDVXVWDLQDEO\SURGXFHGEDJDUHU3(7 33 67$5EDJV±SLQFKERWWRPW\SHEDJV ZKLFKDUHSURGXFHGRQPDFKLQHU\GHYHORSHG E\6WDUOLQJHU0DGHRISRO\SURS\OHQHWKH\ DUHDOUHDG\DSRSXODUSDFNDJLQJIRUVHQVLWLYH SURGXFWVVXFKDVGU\SHWIRRG1RZWKH\FDQ EHSURGXFHGGLUHFWO\IURP3(7ERWWOHÀDNHV 33 67$5VDFNVPDGHRIU3(7ÀDNHVDUHQRW only eye-catchers on the shelves – they can be SURGXFHGLQDFORVHGORRSV\VWHP

ZZZVWDUOLQJHUFRP

0DJXLUHEOHQGHUVLQD6RXWK$IULFDQ¿OPSODQW

Raw materials advance of plastics Ensures product quality and consistency 7+(SUR¿WDELOLW\RIPDQ\SODVWLFV SURFHVVLQJFRPSDQLHVLQ$IULFDLVKHOG EDFNE\UHOLDQFHRQODERXULQWHQVLYHDQG LQDGHTXDWHO\FRQWUROOHGKDQGOLQJRIWKH YHU\WKLQJWKDWDFFRXQWVIRUXSWRRI SURGXFWLRQFRVWVUDZPDWHULDOV 7KLVZDVWKHPHVVDJHRI&KULV &ULWWHQGHQLQDSUHVHQWDWLRQDW$0,¶V 3ODVWLFVLQ$IULFDFRQIHUHQFHKHOG LQ'XEDLGXULQJHDUO\'HFHPEHU$WWKH FRQIHUHQFHKHFLWHGFDVHKLVWRULHVRI $IULFDQ¿UPVWKDWLQFUHDVHGSURGXFWLYLW\ DQGORZHUHGFRVWVZLWKXVHRIDXWRPDWHG PDWHULDOKDQGOLQJV\VWHPV &ULWWHQGHQLV0'RI0DJXLUH,0($ ZKLFKVHOOVDQGVXSSRUWV0DJXLUH SURGXFWVSODVWLFVDX[LOLDU\HTXLSPHQWLQ WKH0LGGOH(DVW,QGLDDQG$IULFD 'UDZLQJRQKLVH[SHULHQFHZLWK SURFHVVRUVLQ$IULFD&ULWWHQGHQVDLG

WKDWFRPPRQLVVXHVDWPDQ\RIWKHVH FRPSDQLHVDUHODERXULQWHQVLYH SURFHVVHVWKDWLQFUHDVHFRVWVDQGFDXVH HUURUVDQGZDVWHLQDGHTXDWHO\RUJDQL]HG V\VWHPVIRUPDQDJLQJPDWHULDOKDQGOLQJ DQGODFNRIDZDUHQHVVRIHTXLSPHQW DQGVRIWZDUHDGYDQFHVWKDWFDQDGGUHVV WKHVHLVVXHV ³,WLVWLPHWRHOLPLQDWHWKHKXPDQ HUURUWKDWDULVHVZLWKPDQXDOO\ZHLJKLQJ DQGPL[LQJPDWHULDOVDQGPRYHRQWR DXWRPDWHGV\VWHPV´&ULWWHQGHQVDLG³,I WKHPDWHULDOÀRZUDWHLVQRWPRQLWRUHG HDFKEDWFKPD\FRQWDLQLQFRUUHFW GLVSHQVHZHLJKWVZKHUHDVDXWRPDWHG FRQWUROGHOLYHUVH[DFWTXDQWLWLHVRIWKH PDWHULDOV\RXQHHGDWMXVWWKHULJKWWLPH (QVXULQJWKHFRUUHFWZHLJKWRIHDFK PDWHULDOSUHYHQWV\RXIURPXVLQJPRUH YLUJLQUHVLQUHJULQGRUDGGLWLYHWKDQLV

Want to boost recycling? Cut back on industry jargon 5(&<&/(56QHHGWRVWD\DZD\IURP LQGXVWU\MDUJRQWRKHOSERRVWUHF\FOLQJ RIIRRGVHUYLFHSDFNDJLQJDFFRUGLQJWR DUHFHQWVXUYH\ 7KH)RRGVHUYLFH3DFNDJLQJ ,QVWLWXWH¶VZHEEDVHGVXUYH\HQJDJHG KRPHRZQHUVLQWKH8QLWHG6WDWHV LQDQHIIRUWWRJHWDKDQGOHRQWKH µWKHLPSDFWRIODQJXDJHRQUHF\FOLQJ EHKDYLRXU¶WKHJURXSVDLG

7KHZHEEDVHGVXUYH\VKRZHGWKDW UHVSRQGHQWVW\SLFDOO\XVHFRPPRQ ODQJXDJHUDWKHUWKDQZKDWWKHWUDGH JURXSFDOOVµLQGXVWU\MDUJRQ¶WRGHVFULEH UHF\FODEOHPDWHULDOV &DVHLQSRLQWRIWKH UHVSRQGHQWVVLPSO\XVHGWKHZRUGV µSODVWLFFRQWDLQHU¶UDWKHUWKDQµFODPVKHOO FRQWDLQHU¶ZKHQVKRZQDSLFWXUHRIWKH ULJLGSODVWLFSDFNDJLQJ


Maguire blenders in an East African sheet plant

Chris Crittenden, MD of Maguire IMEA, with a Maguire vacuum dryer

automation critical for processing in Africa

He cited three case histories involving processors in Africa: y Accurate blending - A sheet manufacturer in East Africa was unable to achieve accurate dosing of regrind Ă&#x20AC;DNHZLWKDQH[LVWLQJEOHQGLQJV\VWHP The company then installed a Maguire WSB with four material receivers and an integrated vacuum loading

system. By weighing all materials, the blender immediately made it possible WRPD[LPL]HUHJULQGXVDJHDQGDGMXVW masterbatch dosing in accordance with accurate data on the weight of regrind and natural virgin resin. The system PD[LPL]HGRXWSXWUHGXFHGVFUDSDQG PLQLPL]HGODERXUDQGKDQGOLQJ y Automated conveying - Maguire helped a company in Kenya to improve control over raw materials and reduce labour, handling and weekend operation in a small production cell of 10 processing machines. The company had been moving 2000 25-kg bags of material around the plant each day or more than 1.5 million tons per year. With Maguireâ&#x20AC;&#x2122;s assistance, the company installed silos, debagging systems and automated systems for conveying materials to the processing machines. As a result, the company reduced wastage

and scrap, gained a better understanding and control of material usage, and streamlined its operation, providing greater versatility and facilitating planning. y Vacuum drying - A South African LQMHFWLRQPRXOGHUZDVKDYLQJSUREOHPV DFKLHYLQJVXIÂżFLHQWGU\LQJRIGLIIHUHQW coloured polyamide materials and was unable to meet the production timing requirements of customers. By switching from a conventional desiccant dryer to a Maguire vacuum dryer, the company GULHGPDWHULDOVVL[WLPHVPRUHUDSLGO\ ensuring product quality and consistency. It was now able to meet its deadlines, and the dryer made it possible to reduce HQHUJ\FRQVXPSWLRQVFUDSDQGĂ&#x20AC;RRU space. craig@precisionsa.co.za

Only 19% of people surveyed would call this a â&#x20AC;&#x2DC;clamshell containerâ&#x20AC;&#x2122;. Most people would more quickly recognize the words â&#x20AC;&#x2DC;plastic containerâ&#x20AC;&#x2122; and potentially be more likely to recycle it.

â&#x20AC;&#x153;The FPI survey aimed to re-create the moment a resident decides to recycle an item. We showed survey participants SKRWRVRIFXSVFRQWDLQHUVER[HVDQGEDJV WRÂżQGRXWKRZODQJXDJHRQIRRGVHUYLFH packaging material impacts peopleâ&#x20AC;&#x2122;s behaviour,â&#x20AC;? said FPI president, Lynn Dyer. While 19% of the people did call the packaging a â&#x20AC;&#x2DC;clamshell containerâ&#x20AC;&#x2122;, another 12% called it a â&#x20AC;&#x2DC;take-out containerâ&#x20AC;&#x2122;, and

4% each called it a â&#x20AC;&#x2DC;hinged containerâ&#x20AC;&#x2122; or a â&#x20AC;&#x2DC;produce container. The same was true for a polystyrene FODPVKHOOFRQWDLQHUZKHUHWKHPDMRULW\RI respondents called it a â&#x20AC;&#x2DC;foam containerâ&#x20AC;&#x2122;. The survey shows the importance of creating common language as 51% said they rely most on a city, county or recycling companyâ&#x20AC;&#x2122;s website for recycling information.

FEBRUARY / MARCH 2017 15

necessary, which not only ensures product quality and consistency but controls consumption of costly materials such as specialty polymers and additives.â&#x20AC;? A key component in automated systems is the Maguire Weigh Scale Blender (WSB), the worldâ&#x20AC;&#x2122;s most widely used gravimetric blender. Special software enables other components in a processing line to communicate with WSBs, creating a plant-wide system accessible on a company computer network.


NEWS

Orchem Trading appointed SA agent for Cabot Cabotâ&#x20AC;&#x2122;s specialty carbon black products a new addition to Orchemâ&#x20AC;&#x2122;s portfolio ORCHEM Trading has been appointed to represent Cabot Corporation in promoting and selling the global manufacturerâ&#x20AC;&#x2122;s specialty carbon blacks in the South African market. Cabotâ&#x20AC;&#x2122;s specialty carbon black products are a new addition to Orchemâ&#x20AC;&#x2122;s portfolio and will reinforce an existing trading relationship between  .HUU\.LUNKDP the two companies. Orchem RI2UFKHPZLOO and Cabot established their WKH EHPDQDJLQJ trading relationship through G DQ J WLQ PDUNH Orchemâ&#x20AC;&#x2122;s successful VDOHVRIWKH &DERWEODFNV

(and ongoing) representation of Cabotâ&#x20AC;&#x2122;s reinforcement materials. Cabot is currently the number one producer of carbon black, globally, and is proud of its history of carbon black as its core business. Cabot produces quality carbon blacks which meet the highest global standards. Its carbon blacks offer enhanced technical performance for a wide range of applications, which include rubbers, polymers, adhesives, inks and coatings and other specialised applications. With interests in each of these various ÂżHOGV2UFKHP7UDGLQJLVDVXSSO\

www.cabotcorp.com

partner between international and local intermediary chemical manufacturers and the users of the products in South Africa. Orchem Trading has experienced VLJQLÂżFDQWJURZWKLQWKH6RXWK$IULFDQ market since its establishment in 2008. As part of the Orchem Trading team, Kerry Kirkman will be working with Cabotâ&#x20AC;&#x2122;s range of carbon blacks. Port Elizabethbased Kerry recently joined Orchem. Her extensive knowledge and vast experience in sales and marketing will be invaluable in supporting Cabot and its customers, as Orchem Trading continues to grow its business dealings and relationships.

www.orchemtrading.com

16 FEB / MAR 2017

3RO\Ă RUVSHDUKHDGVLQGXVWU\¡VĂ&#x20AC;UVW YLQ\OĂ RRUVUHF\FOLQJGULYH POLYFLOR South Africa has launched WKHÂżUVWRIÂżFLDOUHF\FOLQJSURJUDPPH VSHFLÂżFDOO\DLPHGDWWKHORFDOYLQ\OĂ&#x20AC;RRULQJ industry. $FFRUGLQJWR3RO\Ă&#x20AC;RU6$FKLHIH[HFXWLYH RIÂżFHU7DQG\&ROHPDQWKHQHHGIRUDQ RIÂżFLDOUHF\FOLQJLQLWLDWLYHKDVEHHQDORQJ time coming and is in line with one of the key objectives of the South African Vinyls Associationâ&#x20AC;&#x2122;s (SAVA) Product Stewardship 3RO\YLQ\OUHF\FOLQJEDJ

3URJUDPPHÂąRIZKLFK3RO\Ă&#x20AC;RU6$LVD member. Âł7KHYLQ\OĂ&#x20AC;RRULQJPDUNHWKDVVHHQ a tremendous growth in recent years DQGWKHUHKDVQRW\HWEHHQDQRIÂżFLDO programme set in place for the recycling of off-cuts from installations,â&#x20AC;? Coleman said. 3RO\Ă&#x20AC;RU8.ZDVRQHRIWKHIRXQGLQJ PHPEHUVRI5HFRĂ&#x20AC;RRUÂąWKHYLQ\OWDNH back scheme that started in Europe in 2009 and collects SRVWFRQVXPHUYLQ\OĂ&#x20AC;RRULQJ for recycling into new Ă&#x20AC;RRULQJ This initiative recycled a record amount of 508 tons of post-consumer waste YLQ\OĂ&#x20AC;RRULQJODVW\HDU alone - enough to cover IRRWEDOOÂżHOGVÂąDQG continues to grow from strength to strength. According to Coleman, XVHGYLQ\OĂ&#x20AC;RRUVDUH currently not being recycled owing to the fact that glue and screed are also DWWDFKHGWRWKHĂ&#x20AC;RRUV

after they have been removed. â&#x20AC;&#x153;There is currently no technology available in South Africa that can separate glue residue from the vinyl for recycling, but in the meanwhile we believe it is important to make a difference where we can. Every piece of off-cut that we can recycle will help to DOOHYLDWHWKHVWUDLQRQWKHFRXQWU\ÂśVODQGÂżOOV and natural resources,â&#x20AC;? Coleman said. 3RO\Ă&#x20AC;RUFRQWUDFWRUVZLOOEHJLYHQ specially branded bags for them to place their off-cuts in and returned to the FRPSDQ\ÂśVKHDGRIÂżFHZKHUHLWZLOOEH weighed and recorded before it is collected by recyclers. â&#x20AC;&#x153;We have arranged with the major recyclers of vinyl around the country to collect the material from our premises for recycling into a wide variety of products, LQFOXGLQJWUDIÂżFPDQDJHPHQWSURGXFWVDQG gum boots,â&#x20AC;? she said. 6$9$ÂśV&KLHI([HFXWLYH2IÂżFHU'HODQLH Bezuidenhout said they welcomed any proactive steps taken by industry members to take responsibility for their own waste.

ZZZSRO\Ă&#x20AC;RUFR]D


ELASTOMERS

PLASTICS & COMPOSITES

ACM CR EPDM Epichlorohydrin FKM HNBR HTV Silicone IR NBR NR PVC/NBR Blends SBR & BR

ABS Acetal Additives Composites CPE CSM EVA HIPS & GPPS Nylon PC PVC TPE & TPV TPU

FILLERS & ADDITIVES

AUXILIARIES & SERVICES

Aluminas Antimony Products Blowings Agents Carbon Blacks Flame Retardents Hydrocarbon Resins Magnesium Oxide Masterbatches MC & PE Waxes Mineral Fillers Peroxides Process Aids Rubber Chemicals Silanes Silica Sulfur Zinc Oxide

Curing Bladder Machinery Other Services Release Agents Release liners Spares

ANCHOR CHEMICALS Batch Off Bonding Systems Coated Powders Factice Masterbatching Process Aids Toll Mixing


NEWS

Global plastics industry effort

to combat marine litter grows in 2016 Seven new industry associations join the joint declaration SEVEN new signatories were added to The Declaration of the Global Plastics Associations for Solutions on Marine Litter, also informally known as the â&#x20AC;&#x2DC;Joint Declarationâ&#x20AC;&#x2122; in 2016. New participants include the American Fibre Manufacturers Association (AFMA), the Bangladesh Plastic Goods Manufacturers & Exporters Association (BPGMEA), the Flexible Packaging Association (FPA), the Ghanaian Plastics Manufacturers Association (GPMA), the Myanmar Plastics Industries Association 03,$ WKH,QGRQHVLDQ2OHÂżQV$URPDWLFV and Plastics Association (INAPLA), and the Vietnam Plastics Association (VPA). â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re excited to welcome each of these new partners, who bring perspectives from countries in Asia and Africa, on types of plastic not previously represented in our Joint Declaration,â&#x20AC;? said Steve Russell, Vice President, Plastics, American Chemistry Council, at the 27th Global Meeting on Plastics and Sustainability in Hanoi, Vietnam. At the meeting, delegates also agreed that going forward the group will become the â&#x20AC;&#x153;Global Plastics Alliance.â&#x20AC;? Delegates from 17 countries and four continents participated in the Global Meeting â&#x20AC;&#x201C; making this the largest and best attended meeting to date. â&#x20AC;&#x153;Addressing marine litter issues effectively requires that we bring local, regional and global stakeholders together,â&#x20AC;? said Karl-H. Foerster, Executive Director of PlasticsEurope. Âł%URDGHQLQJRXUIROGKHOSVXVÂżQGQHZ partners and opportunities to tackle this very serious problem.â&#x20AC;? â&#x20AC;&#x153;Plastic producers from around the

world are coming together to keep used plastic out of the environment, and to further improve the sustainability of these HQHUJ\DQGUHVRXUFHHIÂżFLHQWPDWHULDOV The strong participation at this meeting demonstrates that this industry is committed to providing solutions to ensure a more sustainable future,â&#x20AC;? said Callum Chen, Secretary General of the Asia Plastics Forum. â&#x20AC;&#x153;Together, as a united, global industry, weâ&#x20AC;&#x2122;re involved in hundreds of marine litter prevention programs in all regions of the globe,â&#x20AC;? added Chen. â&#x20AC;&#x153;But there is still much to do. Growing our ranks helps further grow our work.â&#x20AC;? The Global Declaration was launched in March 2011 at the 5th International Marine Debris Conference. Today, the Declaration has been signed by 69 plastics associations from regions across the globe. 5HFRJQLVLQJWKHLULPSRUWDQWUROHLQÂżJKWLQJ marine litter, these plastics associations have launched and are supporting projects in six key areas aimed at contributing to sustainable solutions. The six focus areas of the Global Declaration are education, research, public policy, sharing best practices, plastics recycling/recovery, and plastic pellet containment. In May, leaders from plastics organizations across the globe announced that there were approximately 260 projects planned, underway or completed. Plastics|SA has been a signatory of the Joint Declaration since 2011 and Packaging SA signed the Declaration in 2015. Douw Steyn, Director Sustainability, repre-

Daniel Yaw Mensah Tornyigah of the Ghana Plastic Manufacturers Association, with Douw Steyn, director of sustainability with Plastics|SAâ&#x20AC;&#x2122;s

sents Plastics|SAâ&#x20AC;&#x2122;s Sustainability Council on various GPA task teams viz. advocacy, marketing and research, is the chairman of the subgroup: Stakeholder Engagement and attends GPA meetings on an annual basis. The Sustainability Councilâ&#x20AC;&#x2122;s marine activities are in line with the 6 focus areas of the Joint Declaration with a focus on providing strategic leadership to the industry on sustainability issues. Douw is also a member of the leading team on Plastics Waste Management, led by Dr Jurgen Bruder, IK Germany, as nominated in Hanoi in 2016.

18 FEB / MAR 2017

Among the delegates at the Summit were Crispian Lao (Three Coins Plastics Company, Philipines), Vijay Merchant (Polycraft, India), Leonor Garcia (PlasticsEurope), Margaret Wang (China Petroleum and Petrochemical Industry Federation), Yartseva Darya (Russian Chemist Union), Douw Steyn (Plastics|SA) and Dr Jurgen Bruder (Ik Industrievereinigung Kunstoffverpackungen)


- passionate about the plastic industry.

Tel: +27 11 824 3103 - Fax: +27 11 824 6018 email: sales@sescc.co.za - www.sescc.co.za Unit 1, 16 Davidson Place, Wadeville, 1428

Supplier of:

ty t o G

Injection Moulding Machine

Servo Klockner

Rebuild

JIANGSU VICTOR MACHINERY


NEWS

3ODVWLF%XEEOHVFXWVHQHUJ\

XSVHIĂ&#x20AC;FLHQF\ZLWK:,%$V\VWHPV New injection systems have small footprint, and even smaller energy need PLASTIC Bubbles, the East Rand manufacturer of housewares and packaging products, has installed three new Wittmann-Battenfeld injection moulding machines in a project which is enabling it to substantially increase output on a smaller â&#x20AC;&#x2DC;footprintâ&#x20AC;&#x2122; at its Springs factory. The WIBA machines also achieve SKHQRPHQDOHQHUJ\HIÂżFLHQF\ZKLFKLV obviously a big plus for the user.

Plastic Bubbles has grown its business for over four decades by using high-spec machinery and that hasnâ&#x20AC;&#x2122;t changed with the second generation of WKH0RXWDÂżVIDPLO\EURWKHUDQGVLVWHU Aki and iVrginia, now at the helm. The Bubbles team has been working with Ipex, the supplier of the Austrian-made Wittmann-Battenfeld (WIBA) machinery, for a number of years, being happy with the level of service provided. â&#x20AC;&#x153;We believe service is very important and need to have good back-up for our

PDFKLQHV´VDLG$NL0RXWDÂżV And Aki is impressed with the WIBA technology, as the small footprint and versatile yet high output injection systems are well suited to the factory space available. The three machines installed at Springs â&#x20AC;&#x201C; 120, 8 0 and 6 0-ton systems â&#x20AC;&#x201C; all offer exceptional energyperformance ratios, with per kg usage of power rates being far lower than what the Bubbles team was used to. WIBA has achieved this by using servo

RPCâ&#x20AC;&#x2122;s R1,37-bn offer for Astrapak gets approval

20 FEBRUARY / MARCH 2017

%ULWLVKJURXSWREX\IRUPLQJPRXOGLQJEXVLQHVVĂ&#x20AC;H[LEOHVWROLVWVHSDUDWHO\ AF TER close to a year of repeated cautionary announcements on the -6($VWUDSDNUHFHLYHGDÂżUPRIIHULQ December from RPC rGoup Plc of the n Uited Kingdom to buy the South African plastics packaging groupâ&#x20AC;&#x2122;s forming and moulding divisions. RPC has offered to acquire all of Astrapakâ&#x20AC;&#x2122;s ordinary shares in circulation through a Section 114 scheme for R1,37 0million on a cash-free, debt-free basis. The deal, which is still subject to shareholder and regulatory approvals, will see RPC take over the nine operations that represent the o Frming and Moulding Divisions of Astrapak and comprise its continuing operations. The businesses employ 1,100 people and had revenues of R1.4-billion for the year to end e Fbruary 2016 . $VWUDSDNÂśVWKUHHĂ&#x20AC;H[LEOHRSHUDWLRQV â&#x20AC;&#x201C; Penpak, Barrier iFlms and e GotexPlusnet â&#x20AC;&#x201C; are seen as non-core assets are are to be â&#x20AC;&#x2DC;unbundledâ&#x20AC;&#x2122; and listed on the Alternative Exchange of the JSE (AltX). Manley Diedloff, group executive director, ZLOOFRQWLQXHZLWKWKHĂ&#x20AC;H[LEOHVEXVLQHVV while Robin Moore will remain with the Astrapak-RPC business. RPC will be funding the consideration

through its existing debt facilities and has lodged the necessary guarantees. All processes are expected to be completed by end-March. Once the WUDQVDFWLRQLVÂżQDOLVHG$VWUDSDN/WGZLOO be delisted from the Johannesburg Stock Exchange. The offer to purchase comes four years LQWR$VWUDSDNÂśVÂżYH\HDUWXUQDURXQGSODQ The group said it had made good progress in rationalising and restructuring to be an HIÂżFLHQW0RXOGLQJDQG)RUPLQJEXVLQHVV with operations of scale that are focused RQFOHDUO\LGHQWLÂżHGFRUHPDUNHWVDQG customers. â&#x20AC;&#x153;The offer from RPC represents an exciting opportunity for all of our stakeholders,â&#x20AC;? said Astra CEO Moore. â&#x20AC;&#x153;I believe the proposed transaction enables us to release the underlying value of the rGoup to our shareholders. ,WDOVRDOORZVRXUĂ&#x20AC;H[LEOHEXVLQHVVHVWKH freedom to pursue their own strategy through their unbundling and listing. And most importantly, it provides really exciting opportunities for our staff and our customers. Our o Frming and Moulding operations are a scaled down version of RPC and a variety of synergies and opportunities will evolve in both the near

and long term,â&#x20AC;? added Moore. RPC was established in 1991 as 53&&RQWDLQHUVLQDQ0%2RIÂżYH manufacturing sites in the K U from SCA (Svenska Cellulosa Aktiebolaget) of Sweden. It has made quite dramatic progress since and is now involved in 31 countries across the northern hemisphere, including the S UA, Mexico and Canada, Russia, China and SE Asia. Its only other involvement in Africa up till now is in Algeria. RPC employs about 21,000 people internationally. Pim eVrvaat, chief executive of RPC, said the â&#x20AC;&#x153;acquisition of Astrapak represents an important step in realising RPCâ&#x20AC;&#x2122;s strategy to create a meaningful presence outside of Europeâ&#x20AC;?. â&#x20AC;&#x153;Astrapakâ&#x20AC;&#x2122;s strong market position in South Africa offers an exciting opportunity to develop a platform from which to serve the high growth Sub-Saharan African market. I look forward to working with Robin and the management team in taking Astrapak to the next stage of its strategic development,â&#x20AC;? added eVrvaat. RPC is listed on the London Stock Exchange and has a market capitalization of 3 ÂŁ.5 -billion and a turnover of 2 ÂŁ.5 -billion.


Heading for the Stratosphere â&#x20AC;&#x201C; 9LUJLQLD0LVVDLNRVDQG$NL0RXWDÂżVRI 3ODVWLF%XEEOHVPDQXIDFWXUHURIWKH Âľ6WUDWRSDNÂśUDQJHRIKRXVHZDUHVĂ&#x20AC;DQN 6HDQ.OHLQJHOGDQG-RKQ'DYLHVRI,SH[ ZLWKRQHRIWKHQHZ:LWWPDQQ%DWWHQIHOG LQMHFWLRQPRXOGLQJPDFKLQHVLQVWDOOHGDW WKH6SULQJVFRPSDQ\

motors as well as some simple design changes:for instance, the oil reservoir has been moved to below the injection cylinder, meaning that the cooling oil needs to circulate along shorter paths. This has had the result that maintenance is reduced and service intervals extended, a further plus for the machine user. The WIBA machines also use a kinetic energy recovery system which enables the systems to retain energy from retracing movements for use in other applications, which further reduces energy demand. The Ipex service engineers, Sean Kleingeld and John Davies, have been enjoying the process too. The Austrian company has continuously invested in its technology, which has had the result that its new machine editions come with added features and enhancements â&#x20AC;&#x201C;

which has interested and motivated both the service personnel and the machine setters at Plastics Bubbles. The WIBA machines are suited for SMME enterprises, with versatility being an important feature as relatively short production runs and hence regular mould changes are characteristic of this sector. WIBA also has the advantage that it has ready access to the robotics

and ancillary and IML systems made by partner company Wittmann, also based in Austria, which is potentially a further plus for plastic convertors who ZLVKWRFRQÂżGHQWO\VXSSRUWVXSSO\WR packaging customers while working with a dedicated machine supplier.

www.plasticbubbles.co.za FEB / MAR 2017 21

Putting all your eggs in one basket?

Putting all your eggs in one basket? Spread your risk and rely on us! For all your Polymer Raw Material Requirements: HDPE, LDPE, LLDPE, PVC, PET, PS, ABS, PP

www.mbtsa.co.za

MBT South Africa Distributors of Plastic Raw Materials Uit 16 n (DVWZRRG2IÂżFH3DUN Unit 16, Eastwood Office Park, E5LOH\5RDG%HGIRUGYLHZ 11b+27-11-455 Riley Road, Tel: 2889Bedfordview: Tel:

Lance vd Merwe Paul Gripper Tiago dos Ramos

011 455 2889

082 901 0477 082 456 6659 082 775 5344

&DSH7RZQ2IÂżFH &ROOHJH+RXVH Cape Town Office, 4 College House, 9LOODJH:DON3DUNODQGV Village Walk, Parklands: Tel: 021 556 Tel: +27-21-5567787

Carlotta Stafford Helga Ferreira Ivan Horowitz

082 600 7403 072 573 4221 072 896 6636

7787


NEWS

New agency for

'XQFDQ%URZQIRUPHUO\ RI:HVW$IULFD*URXS QRZUHVSRQVLEOHIRU FXVWRPHUFRPPXQLFDWLRQ DWHQ;3RO\PHUVZLWKHQ; EXVLQHVVPDQDJHU1DWDOLH &RQGHDQG%UHQW+HDQ

ExxonMobil in SA enX Polymers is the new agent for ExxonMobil Petroleum & Chemical BV BA in Southern Africa, servicing the local plastics converting market. enX Polymers, a subsidiary of enX G roup Ltd, took over from Polysaf Chemical as the agent from 1 January this year. The staff of enX Polymers will operate entirely independently and separately from West African G roup (WAG ), which will continue in its current role as

ExxonMobilâ&#x20AC;&#x2122;s distributor of polyethylene products in South Africa. WAG is also a subsidiary of the enX G roup, following the purchase of the former by the latter in 2016 . Duncan Brown, formerly of WAG , is the main point of contact at enX Polymers and will be responsible for customer communication. The support team at enX Polymers in Durban who work alongside Duncan are Natalie

Conde (business manager), Julie Ribeiro (customer services), and Jelinda Naidoo (account administrator). The Durban team is further supported by Andrea G oldsmith (customer services) based in Johannesburg. â&#x20AC;˘ enX Polymers,+27 (0) 31 202 3900 www.enxgroup.co.za

ExxonMobil expands new Exceed XP performance polymers portfolio

22 FEB / MAR 2017

3URYLGHVPRUHLQQRYDWLRQRSSRUWXQLWLHVIRUEUDQGRZQHUVDQGÂżOPFRQYHUWHUV EXXONMOBIL is expanding its Exceedâ&#x201E;˘ XP portfolio with the introduction of new grades. These new grades deliver exceptional performance advantages for resin converters and end-users in DSSOLFDWLRQVWKDWLQFOXGHÂżOPVIRUVRIW shrink and food lamination packaging and greenhouses. )OH[LEOHIRRGSDFNDJLQJXVLQJ([FHHGÂ&#x152;;3 SURGXFHVH[FHSWLRQDOO\VWURQJÂżOPVWKDW SUHYHQWSURGXFWOHDNDJHDQGFRQWDPLQDWLRQ

â&#x20AC;&#x153;We are excited to extend our recently launched Exceed XP portfolio with two new grades that provide our customers with additional options for applications that require extreme performance,â&#x20AC;? said Cindy Shulman, plastics and resins vice president, ExxonMobil Chemical. â&#x20AC;&#x153;Since its launch, Exceed XP has been exceptionally well received in the market with customers reporting an unprecedented level of mechanical and processing performance. These new grades will broaden this impact.â&#x20AC;? These grades, Exceed XP 0 626and Exceed XP 0 6,6 5provide outstanding processability with enhanced toughness, Ă&#x20AC;H[FUDFNUHVLVWDQFHVHDODELOLW\EDODQFHG shrink performance, and good optical properties. o Fr converters, the high melt strength of these polymers promotes greater bubble stability and improved output. Exceed XP allows converters to costHIIHFWLYHO\IDEULFDWHÂżOPVIRUH[WUHPH protection and preservation in a range of applications that include: y 6RIWVKULQNSDFNDJLQJÂżOP with the controlled holding force and toughness for high integrity wrap, overwrap

and bundle packaging solutions that help brand owners protect delicate and irregularly-shaped products from manufacturer to end-use. sUing Exceed XP, converters can use existing extrusion equipment, including monolayer lines, for a market which previously required investment in new machinery. y )RRGSDFNDJLQJÂżOPV, including pouches and bags with the extreme toughness and sealing performance that enable brand owners to protect frozen or dry foods, meat and cheese products from production to consumption. The melt strength and toughness of ([FHHG;3SURYLGHÂżOPGRZQJDXJLQJ opportunities while performance is maintained. y *UHHQKRXVHDQGODUJHWXQQHOÂżOPV - Exceed XP allows converters to HDVLO\IDEULFDWHÂżOPVZKLFKDUHW\SLFDOO\ 0 8-220 microns thick and up to 20m wide. Ethylene-vinyl acetate (EV A) and QRQ(9$ÂżOPIRUPXODWLRQVFDQEHHDVLO\ tailored for seasonal requirements and for special applications and climate conditions. www.exxonmobilchemical.com


Amcor unveils new PET stock bottle collection For dairy, aseptic, and high-pressure processed beverages AMCOR Rigid Plastics has launched a new collection of crystal clear PET stock bottles and preforms for dairy, aseptic, and high-pressure processed (HPP) liquid beverages. These premium bottles are aestheticallypleasing and easy to handle. They are spill-proof and offer higher quality and better sealing than competitive containers. The PET beverage collection is available in round, hourglass, and square shapes DQGFRPHVLQIRXUVL]HV7KUHHÂżOOLQJ W\SHVLQFOXGHFROGÂżOOIRUGDLU\DQGMXLFH DVHSWLFIRUGDLU\DQGMXLFHDQGKLJK SUHVVXUHSURFHVVLQJ +33 IRUMXLFH$ broad range of preforms enables stock and custom bottle designs ranging for singleserve and multiple-serve applications. Labeling alternatives include wrap, shrink, or pressure-sensitive labels (barring hourglass design).

The large, comprehensive product line enables multiple applications and onestop shopping for manufacturers thanks to the availability of three shapes, four ERWWOHFDSDFLWLHVWKUHHÂżQLVKHVDQGWKUHH ÂżOOLQJW\SHV7KHVWRFNERWWOHFROOHFWLRQ also offers compelling shapes and sleek premium designs which help brand owners achieve differentiation on the store shelf. The new dairy bottle portfolio delivers high performance and is designed to PD[LPL]HSURFHVVHIÂżFLHQFLHVZKLOH applying industry-leading technologies including the lightweight Bericap Aseptic ÂżQLVK6XSHULRUVHDOLQJLVDFKLHYHGGXH WRWKHWLJKWWROHUDQFHRIWKHÂżQLVKSURGXFW spoilage is virtually eliminated, and secondary packaging and distribution costs are reduced. Amcorâ&#x20AC;&#x2122;s superior vacuum absorbing technology provides bottle stability even during challenging altitudes

and temperatures encountered during transportation and distribution. Capital costs are reduced because fewer change parts are required to change from incumbent bottles as well as between the different shapes of a given size in the stock portfolio. This cost advantage applies to ERWKWKHÂżOOLQJHTXLSPHQWDQGWKHEORZ moulding machine. www.amcor.com FEBRUARY / MARCH 2017 23

BOPP â&#x20AC;˘ Desiccants â&#x20AC;˘ Air Bags


NEWS

Promoting SA composites industryâ&#x20AC;&#x2122;s ability globally Laying foundation for skills development to ensure workforce that produces high-value products SIX years on and the Cape-Town based Composites Training Academy (CTA) is achieving many of its founding objectives â&#x20AC;&#x201C; among them to convert the handson knowledge and expertise of skilled professionals in the African Composites Industry into economic value. Established in 2010, the CTA is raising the awareness of commercial opportunities in the rapidly expanding composites market and developing skills as an essential ingredient and building block for individuals and organizations to become both locally, and globally competitive in the polymeric composites sector. â&#x20AC;&#x153;Laying a foundation for skills development will ensure a workforce that produces high-value products at consistent standards,â&#x20AC;? said Oliver Dawson, founder and COO of the CTA. â&#x20AC;&#x153;We have developed key relationships within local and international manufacturing and material supply companies to further enhance our ability to deliver world-class training programmes, knowledge transfer projects, global secondment opportunities as well as technology development projects,â&#x20AC;? he added. Since beginning his career in 1994, Dawson has gained extensive experience in production as well as project management, along with moulding and technical experience across various application sectors. He is passionate about promoting SAâ&#x20AC;&#x2122;s composite manufacturing ability throughout the rest of Africa, and ultimately, globally. â&#x20AC;&#x153;The composites industry in South Africa has really been â&#x20AC;&#x2DC;up against itâ&#x20AC;&#x2122; IRUWKHODVW\HDUV*OREDOÂżQDQFLDO pressures along with the rand and RLOSULFHVKDYHVHHQVLJQLÂżFDQWSULFH 24 FEBRUARY / MARCH 2017

pressures across the sector. This in combination with a lack of focused skills interventions and industry cohesion has turned what should be a booming manufacturing sector, into one thatâ&#x20AC;&#x2122;s under severe pressure,â&#x20AC;? said Dawson â&#x20AC;&#x153;Our saving grace is that composites are still one of the fastest growing manufacturing sectors globally. We are mobilising behind some fantastic initiatives spearheaded by the Department of Science and Technology and the Department of Trade and Industry in close cooperation with the private sector. If we continue this way, the future looks good - hard, but good! We canâ&#x20AC;&#x2122;t sit by and watch the rest of the BRICS countries take advantage of the opportunities this sector offers and be left behind, it would be madness!â&#x20AC;? Dawson added.

â&#x20AC;&#x153;To have these kind of skills onboard a small business like ours if fantastic, we are looking forward to the value they will add in the short too medium-term. A key objective of the CTA is to â&#x20AC;&#x153;focus on developing a â&#x20AC;&#x2DC;recipeâ&#x20AC;&#x2122; for the sector, one that that takes into account current status as well as the gaps, whatâ&#x20AC;&#x2122;s required to stabilize and then ultimately grow individual businesses.â&#x20AC;? Dawson explained. â&#x20AC;&#x153;Key to creating this recipe is to go into industry, stabilizing current production lines from a Quality, Cost and Schedule perspective and then to assist in establishing new production lines and export opportunities,â&#x20AC;&#x2122; he added. At the Economic Policy Dialogue on The Role of Technology Commercialisation in Industrialisation, hosted earlier this year by the DTI in Pretoria, Dr van Rijswijk highlighted the importance of collaboration and synergy within government entities and among the public, academia, research institutions and business sectors. He added that R&D, skills development and industrialization efforts should be coordinated in order to activate a strengthen value chains, and that industrial clusters with representation of stakeholders along value chains is an internationally proven coordination mechanism.

â&#x20AC;&#x2DC;Have developed key relationships in local and international companies to enhance SAâ&#x20AC;&#x2122;s ability to deliver world-class training programmes, knowledge transfer projects, global secondment opportunities and technology development projectsâ&#x20AC;&#x2122;

CTA restructure and expansion Dawson said that earlier this year a restructuring of the CTA took place in which Maryam Kriel was appointed as National Training Manager. She brings with her a wealth of learning and development skills, as well as operations management experience which encompasses disability training. Janene Dawson, who recently left British American Tabaco after a 13-year FDUHHULQÂżQDQFHDQGPDUNHWLQJKDVDOVR joined the team to focus on the Strategic aspects going forward.

www.compositesafrica.co.za


NEWS

Plastics|SA greening partner

for three major events

26 FEBRUARY / MARCH 2017

Clean-up crews for Cape Town Cycle Tour, SA Navy Festival, Old Mutual Two Oceans Marathon THE Plastics|SA Clean-Up Crew has been tasked this year with the responsibility of ensuring that the routes and surrounding areas for three of Cape Townâ&#x20AC;&#x2122;s biggest spectator events are kept clean and litter-free. For the 10th consecutive year, Plastics|SAâ&#x20AC;&#x2122;s sustainability manager, John Kieser, will be coordinating three clean-up crews to quickly and effectively pick up all waste generated by athletes and spectators who will be attending the Cape Town Cycle Tour (CTCT) on 12 March, the SA Navy Festival from 17-19 March and the Old Mutual Two Oceans Marathon that will take place on 15 April. â&#x20AC;&#x153;These three events attract thousands of visitors from around the country and the rest of the world. It is no small task to ensure that all the water and energy drink sachets used by the athletes and the litter strewn by the spectators is picked up as quickly as possible and with as little disruption WRWKHHYHQWVRUWKHWUDIÂżF´.LHVHU explained. This year, Plastics|SA has been given the full responsibility of greening the events, and will be partnering with waste management company WastePlan to ensure that all recyclable material collected is sent for recycling. â&#x20AC;&#x153;Over the years, the active and visible involvement of the Plastics|SA cleanup team and the PETCO branded bins and truck at these events has helped

to create an awareness of the plastics industryâ&#x20AC;&#x2122;s dedication to ensuring that the waste footprint is kept as small DVSRVVLEOH´.LHVHUVDLG(DFK\HDU several truckloads of plastic waste are collected and sent to the Kraaifontein Material Recovering Facility (MRF) for recycling, whilst food waste is sent to Noordhoek for composting. The unsung heroes of event greening The majority of the waste collected during these events is plastic waste, which has a high recycling value. A crew of 205 cleaners employed from Masiphumelele, Ocean View and Athlone, are trained to quickly and effectively sweep the areas free of all litter. The City of Cape Town also plays a major role in boosting the clean-up efforts by ensuring that the routes for these annual events are cleaned prior to the race days. â&#x20AC;&#x153;Both the cycle race and the marathon have various refreshment stations where close to 20 000 bags each are handed out to the athletes. The SA Navy Festival sees up to 50 000 people visiting the harbour each day. On top of this, the weather at these events also plays a big role, as rainy and windy weather presents its own set RIFKDOOHQJHVIRUWKHZDVWHFROOHFWRUV´ Kieser said, explaining that makeshift raincoats are often made from refuse bags and the notorious Cape Doctor could blow the litter into the bushes.

Advertising campaign to support the clean-up efforts Whilst the clean-up crews will be playing their part on the roads, Plastics|SA will also be supporting their efforts with an extensive marketing campaign aimed at raising awareness of the important role the plastics industry plays in keeping our environment clean, and also spreading an anti-littering and recycling messages. â&#x20AC;&#x153;We will be supporting the cleanup efforts with a print ad campaign WKDWZLOODSSHDULQVHOHFWHGLQĂ&#x20AC;LJKW and trade magazines, as well as on the large billboard at the Cape Town International Airport. Our pay-off line for the campaign is: â&#x20AC;&#x153;When YOU UHF\FOHZHDOOZLQ´DQGZLOODSSHDOWR all cyclists and athletes visiting Cape Town during the next few months to KHOSXVNHHSWKH0RWKHU&LW\EHDXWLIXO´ explained Monya Vermaak, marketing and communications executive at Plastics|SA. Radio adverts and on-air interviews will also be heard on local Cape Town radio stations, including KFM, Smile FM, Heart FM, Radio Tygerberg and CCFM during the months of February, March and April, whilst Plastics|SA will also be exhibiting at the Cape Town International Convention Centre.

www.plasticsinfo.co.za

Some of the Plastics/SA clean-up crew at last yearâ&#x20AC;&#x2122;s Cape Town Cycle Tour and the Old Mutual Two Oceans Half and Ultra Marathons


NEWS

PMS Plastics taking on 2017 with a bang!

28 FEBRUARY / MARCH 2017

Moving, changing and evolving PMS Plastics, the Boksburg-based sales, service and repairs company for the plastics processing and converting industry, is determined to take on 2017 with determination, a positive attitude and true grit. Galvanising the action is a recent addition to the PMS staff, Paul ‘Mr SHINI’ Ferreira, who joins PMS Plastics together with the agency for SHINI. “Paul is well known in the Industry as the ‘SHINI guy’ and has ensured that SHINI is one of the top selling auxiliary equipment suppliers in the country. We are very proud to have him join our team,” said PMS Plastics’ Samantha Maye. Paul will also form part of the PMS Plastics marketing and sales team, joining Peter Wolber, Philip and Samantha Maye. “PMS Plastics is full of energy and we are positive that 2017 will see many changes and improvements for business in South Africa,” said Samantha. “The old saying, ‘when given lemons make lemonade’ has been so apt over the last couple of years as we have gone through huge uncertainty in our economy due to so many factors - politics, negativity with Investors due to corruption,

PMS Plastics’s Peter Wolber (left) with Samantha Maye, Paul Ferreira and PMS staff

companies buckling under the pressure and closing, massive unemployment and our cost of living sky-rocketing,’ she added. “We have now had all the lemons we need and we have learnt from this DQGPDGHVLJQL¿FDQWFKDQJHV«DQG now it is Lemonade time!” “Our motto ‘Moving, Changing and Evolving” means just that! We are up-todate with all the changes in the market and are on top of new technology as it

happens.” PMS Plastics are able to meet every requirement and to offer assistance and advice, from start-up companies to improvements and upgrading for existing customers with complete turn-key solutions.

www.pmsplastics.co.za

Dr Boy invites fair visitors to make their own torque wrench www.pmsplastics.co.za

DR BOY GmbH & Co KG will be offering visitors to an industry fair in Slovenia, from 4-7 April, a chance to get actively involved in producing injection moulded parts.

On a BOY 35 E, visitors can insert the blank of a hexagon socket wrench into the mould. By pushing the button the electrical driven guard plate closes and the injection moulding process starts. The insert component is overmoulded with the handle and the sleeve of a hexagon socket wrench with a torque indicator made of glass ¿EUHUHLQIRUFHG337KHPRXOGRSHQV and the very torque can be removed. The generously dimensioned distances of the tie bars and platens of the BOY 35 E (350 kN clamping force) offer easy accessibility for manual placement of the mould The BOY 35 E invites you to actively participate

www.dr-boy.de

with the insert components. The integration of automation systems – such as a removal picker perfectly adapted to the BOY 35 E – is also possible with the dual-platen clamping system of the BOY injection moulding machines. The BOY-developed Handling LR 5 is also available for the BOY 35 E. Dr Boy GmbH & Co KG is one of the leading worldwide manufacturers of injection moulding machines with clamping forces up to 1,000 kN. The very compact, durable machines work precise, energy-saving and therefore highly economical.


Golden Eagle Plastic Machinery

Flow Regulators JET Engine IML Robotics

MAKO MACHINE MOUNTS

With years of expertise in the Plastic Industry, we can help from start up to large installations. Our specialities are energy saving solutions and advice, assistance with production costing, forecasts and, most importantly, being there for our customers long after we have done our installations. 4 Newton Road, Hughes , Ext. 15 Boksburg P O Box 6250, Dunswart 1508 Tel: +27 11 823 5840/41 â&#x20AC;˘ Fax: +27 11 823 4969 Email: mail@pmsplastics.co.za â&#x20AC;˘ www.pmsplastics.co.za


NEWS

30 FEB / MAR 2017

Nitro base improves PET bottle PRODUCTION lines for still beverages using nitrogen dosing can now take advantage of the Sidel StarLite™ PET bottle base with the launch of the Sidel StarLite Nitro version. The new base ensures bottle resistance and stability, even under extremely high temperature conditions, while also SURYLGLQJEHQH¿WVLQWHUPVRIERWK lightweighting and energy saving. The new non-petaloid StarLite Nitro EDVHXVHVDXQLTXHVKDSHWKDWVLJQL¿ cantly increases base resistance and stability. This means the new base design can simultaneously increase PET bottle rigidity by enhancing resistance to the internal pressure created by nitrogen dosing, while lowering package weight and energy consumption.. The large and stable surface on which the bottle stands, combined with other structural elements within the bottle design, enables the formed PET bottle to better withstand the internal pressure caused by the addition of nitrogen and improves bottle stability during conveying, depending on the wall thickness of the base. The optimum strength-to-weight ratio is achieved by reducing the thickness of the bottle’s wall. For instance, a 0.5 litre PET bottle with a StarLite Nitro base weighing 1.8g can resist an internal pressure of up to 1 bar. www.sidel.com

Compounds for some of

Badamid PPA – Composite Plastics working with Bada to bring products to SA ENGINEERING Plastics with high stability and heat distortion temperatures form an integral part of material science. However, as the size of the local specialised compounds sector is not large enough to justify production in South Africa, demand for these materials is being supplied by just

a few specialist internationally competitive compounders. In South Africa, Composite Plastics in Midrand, has been working with one of these global standard compounders, Bada, a relatively young business established in Germany in 1997 and in 2007 in

Because of their high melting temperatures (>300°C), Badamid PPA-HT and Badamid PPA-HP types have ideal thermal properties


the most demanding applications -

more versatile than metal Spain. Composite Plastics and Bada have expanded supply to specialised technical component manufacturers in various sectors. Composite Plastics is supplying material from both Bada plants Bada Hispanaplast SA, the plant at Huesca, Spain and Bada AG in Baden, Southern Germany, Composite Plastics are able to supply Badaâ&#x20AC;&#x2122;s wide range of compounds based on polyphtalamide â&#x20AC;&#x201C; its Badamid PPA types. Because of their high melting temperatures (>300°C), Badamid PPA-HT and Badamid PPA-HP types have ideal thermal properties for many high heat applications. Due to its low glass transition temperature, Badamid PPA-GP is suitable for processing with mould temperatures less than 100 degrees Celcius, which offers considerable economic advantages.

www.bada.de

www.compositeplastics.co.za

FEBRUARY / MARCH 2017 31

%$'$0,'

ÂŽ

PA6, PA6.6, PA6.6/6

%$'$0,'

ÂŽ

PA12, PA6/6T, PPA, PA4.6, PA10T

%$'$7521

ÂŽ

PPS

%$'$)/(;

ÂŽ

TPE-S (SBS, SEBS)

%$'$)/(;

ÂŽ

TPE-E, TPU

%$'$35(1(

ÂŽ

TPV (EPDM/PP)

%$'$'85

ÂŽ

PBT, BLENDS

%$'$/$&

ÂŽ

ABS-SPEZIALITĂ&#x201E;TEN, BLENDS

%$'$)250

ÂŽ

POM

%$'$/21

ÂŽ

PC

New welding technology BASF has worked with a well-known machine manufacturer to develop a new technology for welding insulation boards. The contactless, thermal welding process makes it possible to combine a variety of insulation materials. For example, StyrodurÂŽ, the extruded rigid polystyrene foam from BASF, can be combined with polyurethane, inorganic insulation materials, or the melamine resin foam BasotectÂŽ to form completely new insulation material solutions.

An expert partner in future-focused compounds The only Spanish compounding specialist to comply with I62/TS FHUWLĂ&#x20AC;FDWLRQIRUWKHGHPDQGLQJDXWRPRWLYHPDUNHW 4XDOLW\FXVWRPLVHGVROXWLRQVXVLQJDGYDQFHGSURFHVVWHFKQRORJ\ LQQRYDWLRQ Ă H[LELOLW\ 2XULQQRYDWLYHSURGXFWVPHHW\RXUKLJKHVWVWDQGDUGV² 3$3$3$3%73$73(6739

www.styrodur.com Thermoplaste und Elastomere

ZZZEDGDGH

Composite Plastics cc S FUDLJ#FRPSRVLWHSODVWLFVFR]D &UDLJ DOODQ#FRPSRVLWHSODVWLFVFR]D $OODQ


NEWS

Neil du Preez, local entrepreneur, talks about his brainchildren â&#x20AC;&#x201C; the Mellowcabs

Mellow motion Short distance electric taxi for two set to revolutionise inner city transport transport solutions as a way to reduce the need for fossil-fuelled cars. Neil started Mellowcabs with Richard Bransonâ&#x20AC;&#x2122;s philosophy that â&#x20AC;&#x153;a business KDVWREHLQYROYLQJLWKDVWREHIXQDQGLW KDVWRH[HUFLVH\RXUFUHDWLYHLQVWLQFWV´ Mellowcabs will typically operate LQDOLPLWHGXUEDQUDGLXVRINP They are not meant to compete with other transport systems such as trains or buses, but rather feed into and complement existing networks. A single 0HOORZFDEFDQSURYLGHRYHUNPRI transport per day. Manufactured using composites Mellowcabsâ&#x20AC;&#x2122; large passenger cab is manufactured using composites. Cape 7RZQFRPSRVLWHVFRPSDQLHVLQYROYHG in manufacturing the cabs are Formo )LEUHJODVV$GYDQFHG)LEUHIRUPDQG Calculus products in Wellington. â&#x20AC;&#x153;The cabin itself is made from a GRP composite. We experimented with the idea of rotomoulding it, but we couldnâ&#x20AC;&#x2122;t get it right, plus the mould was super

32 FEBRUARY / MARCH 2017

ITâ&#x20AC;&#x2122;s not a Tuk-Tuk or a pedicab, itâ&#x20AC;&#x2122;s a Mellowcab â&#x20AC;&#x201C; a powerful and lightweight, fun, short distance electric taxi for two people and their hand luggage â&#x20AC;¦ and soon youâ&#x20AC;&#x2122;ll be seeing them on the streets of South Africaâ&#x20AC;&#x2122;s larger cities. The brainchildren of entrepreneur and Franschhoek resident Neil du Preez, the Mellowcabs are currently in the ¿QDOVWDJHVRISUHSURGXFWLRQZLWKIXOO production scheduled during the year ZLWKDÃ&#x20AC;HHWRIYHKLFOHVEHLQJEXLOW for Cape Town and Stellenbosch in the Western Cape, as well as at Gautrain stations, and other selected areas in Gauteng. â&#x20AC;&#x153;Although the South African market is important to us, the possibilities in the Indian sub-continent, Europe and further D¿HOGLVMXVWVWDJJHULQJ´VDLG1HLO Neil is an experienced entrepreneur, KDYLQJGHYHORSHGDQGOHGYDULRXV businesses including Riksha, a child mobility company. He is passionate about non-motorised transport and WKHGHYHORSPHQWRI¿UVWDQGODVWPLOH

www.mellowcabs.com

H[SHQVLYH:HHQGHGXSJRLQJIRUWKH GRP for now. The wheels and some RWKHUZHLJKWVHQVLWLYHFRPSRQHQWV DUHPDGHIURPFDUERQ¿EUH´1HLO explained. The entire cabin is set on an aluminium chassis and roll cage. Many design considerations were important to ensure the Mellowcabs were powerful, light-weight and safe. Joining forces with design experts Ideso, Neil and the team reimagined the short distance electric cab. They wanted WRFUHDWHDYHKLFOHWKDWLVDWRQFHFXWWLQJ edge in terms of technology, yet be DSSURDFKDEOHDQGHYHQIDPLOLDUWRWKH user. Drawing inspiration from the word â&#x20AC;&#x2DC;mellowâ&#x20AC;&#x2122;, the cab was designed to be modern, friendly and fun at the same time, to bring a smile to the face of all who see it. Mellowcabs are fully roadworthy, and comply with international road-worthy standards. They are installed with safety features such as an ultra-rigid roll cage, safety belts and proximity sensors.


DESIGN

Design distinction in bioplastics )LYHÂżQDOLVWVIRUWK*OREDO%LRSODVWLFV$ZDUGV processor Rodenburg and the US-based global food FRUSRUDWLRQ0DUVDVZHOODVWKHLQQRYDWLYHÂżOPSURGXFHU 7DJKOHHI,QGXVWULHV 7L ZRQWKH*OREDO%LRSODVWLFV $ZDUGIRUWKHLUHQFRXUDJLQJGHYHORSPHQWRIDQHZÂżOP SDFNDJLQJIRUFDQG\EDUV7KHLQWHUQDWLRQDOMXU\IRXQGLW DQRXWVWDQGLQJH[DPSOHRIUHVHDUFKWRGHYHORSDFRPSOH[ SDFNDJLQJIXOÂżOOLQJGHPDQGLQJUHTXLUHPHQWV

THE international trade publication bioplastics MAGAZINE VHOHFWHGÂżYHÂżQDOLVWVIRUWKHWK*OREDO%LRSODVWLFV$ZDUG Judges from the academic world, press and industry associations from America, Europe and Asia selected the most promising submissions based on innovation, success and achievements by manufacturers, processors, brand owners, or users of bioplastic materials. Two family-owned businesses â&#x20AC;&#x201C; the Dutch potatostarch

&DQG\EDUZUDSSHUPDGHIURP ZDVWHSRWDWR VWDUFKEDVHGĂ&#x20AC;OP Rodenburg and Mars (The Netherlands) 7KHSURMHFWFRYHUHGWKHZKROHYDOXHFKDLQRISDFNLQJPDWHULDO processing, ranging from the production of the bioplastic resin (waste starch based SolyanylÂŽ C, Rodenburg) through H[WUXVLRQDQGVWUHWFKLQJRIWKHSODVWLFÂżOPV 7L WRWKHDFWXDO SDFNDJLQJRIIRRGSURGXFWV 0DUVEDU  The development of a special Solanyl recipe consisting of waste starch from the potato processing industry and recycled 3/$ VKHHWH[WUXVLRQSURGXFWLRQZDVWH HQDEOHGWKHGHYHORSPHQW RIDSDFNDJLQJVWUXFWXUHZKLFKKDVSHUIRUPLQJZHOOLQDÂżHOGWHVW 7KHSDFNDJLQJZDVWHPSRUDULO\LQWURGXFHGLQWHVWPDUNHWVLQWKH 1HWKHUODQGV)UDQFHDQG*HUPDQ\GXULQJ%HIRUHKRZHYHU DFRPSUHKHQVLYHODXQFKPRUHZRUNQHHGVWREHGRQH 7DJKOHHI0DUVÂśSDFNDJLQJFRQYHUWHUPDQXIDFWXUHGWKHÂżOP RQD%233OLQHZKLOH0RQGLSULQWHGWKHSDFNDJLQJLWWRRN IRXUSURGXFWLRQWULDOVEHIRUHDQDFFHSWDEOHSDFNDJLQJÂżOP was manufactured. The development which started in LVDKLJKOLJKWRIZKDWFDQEHDFKLHYHGLIWKH right partners team up to develop a demanding

SDFNDJLQJ&KRFRODWHLVQRWRQHRI the easiest products in terms of smell and taste preservation and sensitivity ÂąWKLVQHZVWDUFKEDVHGSDFNDJLQJ PDWHULDOIXOÂżOVUHTXLUHPHQWVIRU barrier and protection. Âł:HKDYHDFRPSRXQGWKDWZRUNV and is recyclable at production ÂżOPH[WUXVLRQ ZKLFKKHOSVUHGXFH production waste and bring material cost down,â&#x20AC;? said Thijs Rodenburg, &(2RI5RGHQEXUJ%LRSRO\PHUVÂł7KHIRFXVZDVRQXVLQJ DSDFNDJLQJPDWHULDOWKDWLVVXVWDLQDEOHDQGXVHVVHFRQG JHQHUDWLRQIHHGVWRFN´KHDGGHG Not only does the material require about 30% less energy to SURGXFHLWDOVRKDVDFDUERQIRRWSULQWWKDWLVRYHUORZHU WKDQWKDWRIWUDGLWLRQDOSDFNDJLQJ www.biopolymers.nl materials (PP). www.mars.com

World First 100% Bio-PET Polyester Shirts Far Eastern New Century (FENC)

34 FEB / MAR 2017

Far Eastern New Century (FENC) Corp in Taiwan demonstrated the ZRUOGÂśVÂżUVWELRSRO\HVWHU shirt made entirely from renewable raw materials. The innovative biopolyester T-shirts are estimated to reduce by more than 40% carbon

GLR[LGHHPLVVLRQV7KHELR polyester shirts also retain all the properties and features of polyester shirts. The state-of-the-art shirts were made entirely from plant-based material in a 9-step conversion. Starting from Virentâ&#x20AC;&#x2122;s BioFormPXÂŽ

3DUD[\OHQH)(1&FRQYHUWHGLWWR ELR37$FKHPLFDOWKHQ ELR3(7UHVLQV32<DQG'7< yarns, fabric weaving, dyeing and ÂżQDOVKLUWVGHVLJQDQGVHZLQJ www.fenc.com

Renewable and recyclable water bottle â&#x20AC;&#x201C; a holistic concept

New compostable particle foam

Treeson Spring Water (USA)

EcovioÂŽ EA foam product is predominantly bio-based (>70%). Made IURP%$6)ÂśVELRGHJUDGDEOHSRO\HVWHUHFRĂ&#x20AC;H[ÂŽDQG3/$LWLVWKHÂżUVW H[SDQGDEOHFORVHGFHOOSDUWLFOHIRDPGHYHORSHGDVDGURSLQVROXWLRQ IRU([SDQGDEOH3RO\VW\UHQH (36 DQG([SDQGHG3RO\SURS\OHQH (33 FXVWRPHUV%\XVLQJDQLQQRYDWLYHFRQWLQXRXVH[WUXVLRQ process, ecovio EA polymer is charged with the blowing agent SHQWDQHWRSURGXFHH[SDQGDEOHEHDGVWKDWKDYHDVKHOIOLIHRIPRUH WKDQRQH\HDUZLWKRXWDQ\TXDOLW\LPSDLUPHQW7KHPDMRUEHQHÂżWVIRU the converter include lower transportation cost, longer storage time, less necessary storage space and most importantly its processability RQH[LVWLQJVWDQGDUGPDFKLQHU\(FRYLR($DOVRRIIHUVIXOOĂ&#x20AC;H[LELOLW\ LQWHUPVRIGHQVLW\DQGFRPSOH[GLPHQVLRQRIVKDSHPRXOGHGSDUWV Ecovio EA is highly durable under normal environmental conditions EXWGHJUDGHVYHU\IDVWZLWKLQÂżYHZHHNVXQGHULQGXVWULDOFRPSRVWLQJ conditions. Prior to composting, the foamed material can also be recycled in customary recycling processes. Taghleef manufactured WKHÂżOPRQDQH[LVWLQJ%233ZKLOH0RQGLSULQWHGWKH SDFNDJLQJLWWRRNIRXUSURGXFWLRQWULDOVEHIRUHDQ DFFHSWDEOHSDFNDJLQJÂżOPZDVPDQXIDFWXUHG

Treeson Spring Water was created to offer a sustainable alternative to plastic water bottles. Treesonâ&#x20AC;&#x2122;s philosophy is WRWDNHWKHLUERWWOHVEDFNDIWHUÂżQLVKLQJWKHPDQGXVHWKRVH returned bottles to generate clean energy. The companyâ&#x20AC;&#x2122;s PDLOEDFNUHWXUQSURJUDPPHLVIUHHIRUFXVWRPHUVDQG supports the United States Postal Service. It may sound trivial LQWKHÂżUVWPRPHQWEXWHPSW\ERWWOHVKDYHWREH transported to a recycling facility anyway. And it PDNHVQRELJGLIIHUHQFHLIWKLVKDSSHQVLQDELJ GHGLFDWHGWUXFNRURQHERWWOHDWDWLPHLQD IUHHFRUQHURIDSRVWWUXFNWKDWLVGRLQJWKH trip anyway. The shape of the bottles allows LWWRQDWXUDOO\FROODSVHĂ&#x20AC;DWZKHQHPSW\IRU easy mailing. The bottles are made of a 3/$PL[WXUH,WLVWR[LQIUHHDQGLV FHUWLÂżHGIUHHRIDQ\*02V7KHODEHOVDUH PDGHIURPSRVWFRQVXPHUUHF\FOHG materials. www.treesonspringwater.com

BASF (Germany)

www.basf.com


DESIGN EverBlock Systems was formed to make it easy for companies and people everywhere to build large sized objects using a series of universal building blocks

EverBlock modular building blocks now in SA Modular building system of oversized PP blocks EVERBLOCK Systems, the popular DGXOWÂľ/HJRÂśOLNHEXLOGLQJEORFNVWKDW have been making waves internationally are now available in South Africa. @ EverBlocksa offers a modular building system of oversized polypropylene blocks that can be used to construct durable, fun loving furniture and structures â&#x20AC;&#x201C; just about anything your imagination can create modularly. ,WÂśVVLPSOHTXLFNDQGIXQWREXLOGE\ stacking and organising the universal blocks in nearly any shape, pattern, colour or size. EverBlock Systems was formed to make it easy for companies and people

everywhere to build large sized objects using a series of universal building blocks. Each EverBlock module is designed to connect easily with the parts above DQGEHORZXVLQJDSUHVVXUHÂżWZKLFK creates a strong link between blocks, exactly like Lego! Because of the HIÂżFLHQWOXJV\VWHP(YHU%ORFNVFDQ be staggered to create all types of patterns. The range includes different VL]HGEORFNVDQGÂżQLVKLQJFDSVLQ standard colours to create objects for all types of use, from leisure lounge, to kids play area, to corporate workspaces.

EverBlock furniture can be taken apart and re-assembled and the pieces re-used to build other objects, making EverBlock an affordable furniture solution with increased longevity, multiple designs using the same blocks as well as being an exceptional green building method. The South African exclusive agents offer rentals and sales of EverBlock, along with design advice and installation services with customized solutions. www.everblocksystems.co.za

Pretoria student wins top packaging redesign award PRETORIA North resident, Tashalie Vorster, was presented with a Student Gold Pack award in the category for improving/redesigning packaging of an existing brand. Vorster, a second year IIE BA Graphic Design student at The Design School Southern Africa, (an educational brand of The Independent Institute of Education), was also announced as the second overall winner in the awards. The Gold Pack Awards are issued by the Institute of Packaging South Africa (IPSA) and is the showcase for the South African packaging industry. Since its inception in 1973, the awards have grown into an event of considerable importance Pretoria design student, Tashalie Vorster, selected the Whole Earth Farms brand from the US to improve and redesign. Its grain-free product line includes six dry dog foods 36 FEBRUARY / MARCH 2017

and prestige. Vorster selected the Whole Earth Farms brand from the US to improve and redesign. Its grain-free product line includes six dry dog foods. Voster noticed a design Ă&#x20AC;DZLQWKHEUDQGÂśVQDPHDQGORJRZKLFK GLGQRWUHĂ&#x20AC;HFWWKDWLWFDWHUHGIRUGRJV She endeavoured to design a logo which ZRXOGEHWWHUUHĂ&#x20AC;HFWZKDWWKHFRPSDQ\ was about and who they catered for. An additional theme in the redesign was to make the packaging both reusable and recyclable. The packaging comes with a sticker explaining the new features. www.designschoolsa.co.za


TEL: +27 (0) 11 462 2990

SOLUTION

MACHINERY (PTY) LTD

FAX: +27 (0) 11 462 8229 e-mail: jacques@demaplastech.co.za

“One total solution for Injection Moulding”

Color and material combinations that make you say “Wow!”

Introducing the Objet500 Connex3 from Stratasys, the world’s only full-color and multi-material 3D printer. Select from incomparably brilliant and consistent colors, plus a full palette of transparent colors — the only 3D printer to offer such a wide array. And it’s the only 3D printer that prints ÀH[LEOHPDWHULDOVLQDEURDGUDQJHRIVKRUH YDOXHV$OOZLWKXOWUD¿QHGHWDLOFUHDWLQJWKH PRVWWUXHWROLIHPRGHOLQJSRVVLEOH6WUDWDsys is the proven leader in multi-material 'SULQWLQJ For whatever your mind can imagine, visit stratasys.com/Objet500 Connex3.

®

Turning design into Reality faster than you can imagine

Objet500 &RQQH[

TEL: +27 (0) 11 462 2990 FAX: +27 (0) 11 462 8229 e-mail: jacques@demaplastech.co.za


DESIGN

Designing with A prime driver is the cost savings over the use of virgin materials BY BERNARD REEKSTING THE â&#x20AC;&#x2DC;circular economyâ&#x20AC;&#x2122; use of plastics materials, from cradle to cradle, is attainable by considering two simple concepts: design for recyclability of products made from virgin materials, and design using recycled materials. A prime driver for the use of recycled materials is the cost savings over the use of virgin materials. Other incentives are the reduction of environmental impact, customer requirements, marketing, and in some countries, legislation.

38 FEBRUARY / MARCH 2017

Design outcome The general outcome for the use of recycled materials is to turn a low value material into a higher value product. But, what grade of recycled material? There are different types of recycled materials, each of these have different performance properties that need to be understood: y Pre-consumer waste, also named in-house scrap, which is used in-house or sold on to another processor. y Post-consumer waste, which may be either household packaging with a mix of multiple materials, or from an industrial source, then of mostly uniform type. Technical data sheet Materials are affected by exposure to degradation during prior use. The amount of degradation will be determined by, prior thermal exposure, environmental exposure such as sunlight and UV, and mechanical damage. Further exposure to contaminants and chemicals will challenge the retention of the materials properties. The recycling process adds to the sum of the materials degradation by shear during granulation, agglomeration, heating and drying. Many materials contain some pigments and ÂżOOHUVWKDWKDYHDQLQĂ&#x20AC;XHQFHRQWKHSHUIRU mance of the recycled material. A technical data sheet of the materials should report the density, tensile strength, elongaWLRQDW\LHOG(PRGXOXVPHOWĂ&#x20AC;RZUDWHLPSDFW strength and hardness. Design considerations The properties of the product to be made from UHF\FOHGPDWHULDOQHHGWRFOHDUO\VSHFLÂżHG$ material that matches these requirements is selected. Additionally, the material needs to be able to be processed and possibly recycled once more at some future time. Recycled materials, through their prior use

Examples of materials and their primary and recycled use Material

Original use

Recycled

TPO

Automotive bumper

Automotive wheel liner, spoilers, mud guards

PP

Packaging, automotive, furniture

Crates, automotive air ducts, battery housings, garden furniture

PEHD

Bottles, food packaging, crates, pipes

Crates, waste bins, pots, pipes, bags, wood simulants

PET

Soft drinks bottles, SDFNDJLQJÂżOPIRRGWXEHV

Soft drink bottles, fabrics, Ă&#x20AC;HHFHVWUDSSLQJ

LDPE

%ORZQÂżOPVKULQNZUDS DJULFXOWXUDOÂżOPWR\V

Bags, pipe, wood simulants

PS/XPS

Disposable cups, cutlery, packaging

Rigid mouldings, insulation PDWHULDOVÂżOOHUVLQFHPHQW aggregates

PVC

Pipes, packaging, Ă&#x20AC;H[LEOHYLQ\O

7XEHVĂ&#x20AC;RRUWLOHV

Recycled materials are often not glossy; they may have spots, localised discolouration and only be available in a dark colour. To overcome these GHÂżFLHQFLHVDIHZVWUDWHJLHV are used, including a frame and FRYHUGHVLJQZKHUHDIUDPH forms the inside of the product and virgin material covers are used. For example, the Phillips Senseo Up coffee maker


recycled materials and processing may have reduced elasticity and become more brittle. Properties related to long-term loads and strains are usually reduced. Thermal and UV exposure have more marked effects on the performance of recycled materials. Recycled materials often have an associated odour, either from degradation or from the previous use. It is possible to reduce this by masking, sequestering, neutralizing or stripping the odour. $GGLWLYHVDQGÂżOOHUVPD\EHFRPSRXQGHG into the recycled material to improve selected properties. This requires some expertise in selection to retain an economic motivation for using a recycled material. For some required properties it may be required to make a blend using virgin material. The fundamental principles for injection moulding design still apply to recycled materials. However, because of the possible decrease of elastic properties and an increased sensitivity to sharp radii, these are made more generous for recycled product design. Mould shrinkage and post moulding shrinkage may also increase for the UHF\FOHGPDWHULDO,QFRUSRUDWLRQRIÂżOOHURU

adjustments of the processing parameters (cooling time and temperature) are required to retain the dimensions. Many products made by extrusion processes require long-term load characteristics. These need to be assessed in the application with constructed measurement of the time dependency property. Product design Recycled materials are often not glossy; they may have spots, localized discoloration and only be available in a dark colour. 7RRYHUFRPHWKHVHGHÂżFLHQFLHVDIHZ strategies are used: Frame and cover design, a frame forms the inside of the product and virgin material covers are used. For example, Phillips Senseo Up coffee maker. Strong colour contrasts for different parts of a product are employed to distract from surface imperfection Non visible parts for automobiles, for example, wheel housing liners and air ducts. Lighter colours can only be achieved from lighter colour materials, they still do tend to ODFNGHSWKDQGLQWHQVLW\8VHRIDÂżOOHUVXFK

as talc, may improve the appearance. The surface gloss is low when a recycled material is used. Textured surfaces are used disguise the lack of gloss. Labels and in-mould labelling may be XVHGWRGLVJXLVHVXUIDFHGHÂżFLHQFLHV Techniques that â&#x20AC;&#x2DC;sandwichâ&#x20AC;&#x2122; the recycled materials between thin layers of virgin materials are used for both injection moulding and extrusion processes. Review the design considerations Evaluate if the performance properties adequately cover the intended application and GRWKH\DFFXUDWHO\UHĂ&#x20AC;HFWWKHLQWHQGHGXVH Regulations governing food contact use of materials Recycled plastic materials and articles intended to come into contact with foods: Regulation EC No 282/2008 Requirements for plastics materials and articles intended to come into contact with food: Regulation EU No 10/2011 Good manufacturing practice for materials and articles intended to come into contact with food: EU No 2023/2006

FEBRUARY / MARCH 2017 39

I.P.P Inkulu Plastic Pipes

(Pty) Ltd

Quality Pipe Manufacturers of HDPE pipe Think big, â&#x20AC;&#x153;Inkuluâ&#x20AC;? is Gabriel Reddyâ&#x20AC;&#x2122;s motto, who started the new pipe manufacturing business Inkulu Plastic 3LSHVLQ+DPPDUVGDOH.=1$QGVHOOLQJLWPLQG\RX7KHÂżUVWSLSHVSURGXFHGDWKLVQHZFRPSDQ\ZHQW GLUHFWO\IURPPDFKLQHWRWKHEDFNRIWKHGHOLYHU\WUXFNÂąZLWKRXWHYHQWRXFKLQJWKHIDFWRU\Ă&#x20AC;RRU Inkulu Plastic Pipes leased a 3440m2 factory in Hammarsdale. Inkulu Plastic Pipes has not looked back since, and the machines DUHQRZUXQQLQJ7KHFRPSDQ\KDVDOVRDFTXLUHG6$%6FHUWLÂżFDWLRQ*DEULHOÂśVWKLUGPDFKLQHDUULYHGLQ$XJXVW*DEULHO believes in always making a plan and satisfying his clients and keeping them happy. His success is due to the support and the good wishes of his very loyal customers and suppliers. Products include: HDPE (High Density Polyethylene) Pipes, LDPE (Low Density Polyethylene) Pipes, PP (Polypropylene) Pipes and Fabricated Fittings

Contact us: Unit 6B Coveway Industrial Park, Hammersdale, 3700 | Tel: 031 736 1055/56 | Fax: 031 736 1054 Gabriel: 084 446 6384 | Nikieta: 083 229 7161 | Email: gabriel@inkuluplastics.co.za | www.inkuluplastics.co.za


FEATURE

Egyptian polymer industry struggling to achieve its full potential An already struggling economy facing further challenges

BY DR NIALL MARSHALL

THE story of the Egyptian polymer industry over the last few years is the story of Egypt: despite a large domestic market of 89 million people, a diverse petrochemical industry based on natural gas resources and market access to nearby North Africa and Europe it is struggling. And that is because of the economy. The Egyptian economy has long been dependent on agriculture, tourism and historically exporting natural gas IURPLWVH[WHQVLYHJDVÂżHOGV)ROORZLQJ the overthrow of Hosni Mubarak in 2010 and the subsequent overthrow of the elected Muhammad Morsi, an already struggling economy has faced further challenges. But it is important to note that, although struggling, the Egyptian economy overtook the South African economy in 2016 to become the second largest economy in Africa (behind Nigeria). Perhaps this is not DWUXHUHĂ&#x20AC;HFWLRQRIWKHUHODWLYHVL]HV of the economies as it was calculated XVLQJWKHRIÂżFLDO Âż[HG H[FKDQJHUDWH for the Egyptian pound compared to WKHĂ&#x20AC;RDWLQJ VSRW H[FKDQJHUDWHIRU the Rand, but certainly the Egyptian economy is not small. The Egyptian polymer market is also not small. Egypt produces more than 2 million tons of polymer per year â&#x20AC;&#x201C; or, more accurately, has more than 2 million tons of polymer capacity including HDPE, LLDPE, PP, PVC, PET and polystyrene, and it consumes more than 2.2 million tons of plastic per year. New polyethylene capacity came on-line last year and a new petrochemical complex, which will include an additional 1.4 million tons of polyethylene, is planned to be commissioned in 2019. Added to this is the recent discovery by ENI of the Zohr JDVÂżHOGDQGVHSDUDWHSODQVWRHYDOXDWH 40

FEBRUARY / MARCH 2017

DJDVWRROHÂżQVSURMHFWZKLFKFRXOG include an additional 1 million tons of polypropylene and a further 1 million tons of polyethylene, and the polymer industry would appear to be healthy. But this brings us again to the economic challenges faced by the polymer industry. Shortages of foreign currency has contributed to shortages of monomer (also, some monomer was piped in from Libya and the situation there has meant it is no longer available) and this means that actual production has been well under nameplate capacities. It has also meant that much polymer produced in Egypt is exported where it can be sold for hard currency. The overthrow of Mubarak in 2011 during the Arab Spring was as much about economic conditions and lack of opportunities as it was about democracy. And for various reasons the economy has not really improved. Not all of these reasons are in the control of the government: wars and terrorism have kept tourists away and low oil prices have resulted in decreased remittances sent home by Egyptians working in the oil-producing countries and reduced output from the gas H[LVWLQJJDVÂżHOGVDVZHOODVLQFUHDVHG domestic demand, has made Egypt a net importer of oil and gas. But a ODFNRIFRQÂżGHQFHLQWKHJRYHUQPHQW and its policies has also contributed by discouraging foreign investment in Egypt. Egypt has long relied on generous aid packages from the Gulf States and military aid from the USA, and this aid has become even more important in the last few years. Since 2013 it is estimated that Egypt has received more than $25 billion in aid, aid that has helped Egypt avoid an economic collapse, but it has not helped the economy recover. Egypt is in urgent

need of further aid and has recently been awarded a $12 billion loan by the ,0)ZLWKFHUWDLQFRQGLWLRQVLQFOXGLQJ allowing the Egyptian pound (EGP) to devalue. 7RNHHSLQĂ&#x20AC;DWLRQGRZQDQGDYRLG IRRGULRWVWKHJRYHUQPHQWKDGÂż[HGWKH RIÂżFLDOH[FKDQJHUDWHDW(*3 (which is why the economy, in Egyptian pounds, was calculated in US dollars to be larger than the South African HFRQRP\ 7KLVÂż[HGH[FKDQJHUDWH which was only relaxed in November 2016 (the exchange rate is now (*3 H[DFHUEDWHGWKHVKRUWDJH of hard currency available to businesses and contributed to the poor economic performance. Egypt has to import many staples and shortages of foreign currency resulted in the government setting capital controls and banning some â&#x20AC;&#x2DC;luxuryâ&#x20AC;&#x2122; imports to keep dollars in the country. Shortages of hard currency meant that many companies were forced to shut down due to foreign-exchange losses or because they were unable to buy vital imports. Even some polymer producers have only recently restarted production after a multi-year break and several polymer plants are producing almost exclusively for export markets where they have been able to earn foreign currency. Local converters then have a challenge getting dollars to pay for imported raw material, or shut down their businesses. The recent devaluation has pleased the business community, but higher food process, rising electricity costs and the introduction of VAT have not been popular. If these changes, as well as proposed changes to the complicated regulations which discourage businesses from existing in the formal sector, are successfully implemented the polymer industry could, like the Egyptian HFRQRP\ÂżQDOO\DFKLHYHLWVSRWHQWLDO


PACKAGING THAT PROTECTS Packaging helps to preserve food and protects both consumers and goods. SABIC develops innovative polyethylene and polypropylene solutions with a higher performance and purity. That is how ‘Chemistry that Matters™’ really delivers for all of us.

© 2016 Copyright by SABIC. All rights reserved.


What is the â&#x20AC;&#x2DC;gain-in-weightâ&#x20AC;&#x2122; method in the context of gravimetric asynchronous dosing? *UDYLPHWULFDV\QFKURQRXV GRVLQJVWDWLRQVPHWHUWKH FRPSRQHQWVRIDPL[WXUHLQWR DZHLJKLQJFKDPEHURQHDIWHU DQRWKHU$VHDFKLQJUHGLHQW LVDGGHGWKHV\VWHP PHDVXUHVWKHDJJUHJDWH PDVVRIDOOLQJUHGLHQWV±D PHWKRGGHVFULEHGDV³JDLQ LQZHLJKW´7KHPHWHUHG FRPSRQHQWVIRUPOD\HUVRQ WRSRIRQHDQRWKHUPHDQLQJ WKH\PXVWVXEVHTXHQWO\EH DFWLYHO\EOHQGHG

42 FEB / MARCH 2017

Gravimetric asynchronous dosing systems meter the individual components one after the other and the gain in weight is measured in the weighing chamber. After dosing, the ingredients form layers on top of each other and must then be transferred to a mixer.

GRAVIMETRIC asynchronous dosing is also known as discontinuous or batch dosing. As explained in an earlier article (part 2), gravimetric systems weigh the ingredients before dosing, i.e. mass is the GH¿QLQJSDUDPHWHU The mass of the ingredients can be measured in two ways: â&#x20AC;¢ Gain-in-weight systems measure the increase in aggregate mass in the weighing chamber as the material is being metered. â&#x20AC;¢ Loss-in-weight systems measure the decrease in mass of the ingredients remaining in the supply hoppers. Gravimetric asynchronous units meter ingredients to the weighing chamber one after the other, to form a batch. The total mass in the weighing chamber is measured as each new component is added, in line with the quantities and UDWLRVVSHFL¿HGLQWKHUHFLSH,QJUHGLHQWV are metered precisely using slide-gate valves, screws or disc dosing elements, for example. Because the metered components form layers on top of one another, a mixer is required to actively blend the ingredients. The contents of the weighing chamber are fed to a separate downstream mixing chamber. Depending on the system design, the material is then fed directly into the feed

www.motan-colortronic.com

www.marimark.co.za

IMAGES: MOTAN

In â&#x20AC;&#x2DC;Moâ&#x20AC;&#x2122;s Cornerâ&#x20AC;&#x2122; you will ¿QGH[SHUWDQVZHUVWR DOO\RXUTXHVWLRQVDERXW PDQXIDFWXULQJDQG SURFHVVLQJSODVWLFV,I\RX KDYHDSUREOHPMXVWDVN0R DVNPR#PRVFRUQHUFRP

throat of an injection moulding machine, or for example, into a day bin. Batch dosing stations are comparatively cost-effective gravimetric systems, as they only require a single weigh or load cell. However, in cases where volumes differ greatly from component to component, there are certain limits to the accuracy Gravicolor gravimetric of the weigh cell and dosing stations can the algorithms used to dose and mix up to six ingredients, depending measure the individual on the design. The ingredients. control unit compares 2QHEHQH¿WRI the mass that has already gravimetric dosing is been metered with the that, unlike in voluGH¿QHGWDUJHWPDVV metric systems, it is not necessary to calibrate the equipment. Because the system continues to dose material until the required target weight LVUHDFKHGÃ&#x20AC;XFWXDWLRQVLQGHQVLW\GRQRW affect the outcome. A further advantage is that you can say with certainty how much material â&#x20AC;&#x201C; by weight â&#x20AC;&#x201C; has been used in total. This is important for documentation purposes. In the next instalment, we will take a look at loss-in-weight systems. â&#x20AC;¢ MOTAN COLORTONIC IS REPRESENTED IN SOUTH AFRICA BY MARITIME MARKETING


SA automotive industry Plastics|SA providing hands-on training, upskilling car component manufacturers RITXDOLÂżHG Preparing the technicians automotive â&#x20AC;&#x153;Because of the automotive who can be industry for the industryâ&#x20AC;&#x2122;s growing dependency trained, as well next decadeâ&#x20AC;&#x2122;, as a shortage released by on plastic components, a huge of the kind of the Innovative demand is being placed on customer service G roup, the local skills (customer automotive training, upskilling and the focused industry is facing transfer of skills to employeesâ&#x20AC;? relationship the threat of an management impending skills across all aspects of the industry) that shortage. will become increasingly important. The â&#x20AC;&#x153;Our research suggests that there entrepreneurial mindset is not being is an impending shortage in the encouraged nor supported enough. As a automotive industry of the kind of skills result of this shortage, poaching of staff required to move it forward to the next is a real problemâ&#x20AC;?, the report suggests. level. It is less about new technology â&#x20AC;&#x201C; Locally, Plastics|SA has been playing employers can train in that regard â&#x20AC;&#x201C; and an instrumental role in providing onmuch of the new technology comes with site training to automotive parts and the equipment to maintain it. component manufacturers situated in â&#x20AC;&#x153;The problem lies in the shortage

SOUTH Africaâ&#x20AC;&#x2122;s automotive manufacturing standards compare favourably with the rest of the world â&#x20AC;&#x201C; evident in the close to two million bumpers produced annually for Mercedes Benz and other plastic components produced locally for the likes of Volkswagen India. However, DJURZLQJQHHGKDVEHHQLGHQWLÂżHG for training in machine processes, IRFXVVLQJVSHFLÂżFDOO\RQLQMHFWLRQ moulding, supervisory management and the basics of working with plastics. Because of the automotive industryâ&#x20AC;&#x2122;s growing dependency on plastic components, a huge demand is being placed on training, upskilling and the transfer of skills to employees. According to the recently published â&#x20AC;&#x2DC;Automotive Future Now Report 2016:

Tailored polyamides for charge-air ducts BASF Ultramid grades for demands on pressure and resistance up to 220°C THE reductions in fuel consumption and emissions which are prescribed by law in many countries are forcing the automotive industry to act. Besides developing alternative drives, the optimization of traditional combustion engines continues to play a key role. Downsizing results in higher pressures and temperatures, especially in components that carry air behind the turbocharger. BASF is responding to this development in engine designs with a consistent portfolio of PA6 and PA66 grades that meet the higher demands on the materials, their mechanical properties and temperature resistance. Depending on the base polymer and stabilization system, the materials are resistant to heat aging up to 220°C and show excellent burst pressure and Expansion of the polyamide portfolio for the charge-air duct in modern combustion engines 44

weld strength. This means the part developer can be provided with the optimum material for each of the different components in the charge-air duct that offers the best value for money. 6HOHFWHGJUDGHVDUHEDVHGRQJOREDOVSHFL¿FDWLRQV7KH\DUH supplied worldwide from local manufacturing facilities, with uniform material properties and a consistently high level of quality. For use in the charge-air duct BASF offers polyamides for the various temperature requirements of the charge-air duct. The range comprises PA6, PA66 and 3$JUDGHVZLWKJODVV¿EUHFRQWHQWEHWZHHQ UltramidŽ%:**3;D3$FRQWDLQLQJJODVV¿EUH has recently been added to the portfolio. It is resistant to temperatures up to 180°C and for a short time up to 200°C. Due to its excellent burst pressure and weld strength it is suitable for air intake manifolds made from several parts. The upper end of the temperature range is covered by UltramidŽ Endure, a specialty polyamide which can stand

FEBRUARY / MARCH 2017


AUTOMOTIVE & PLASTICS

South Africaâ&#x20AC;&#x2122;s automotive manufacturers have done well to develop their assembly lines to the point where they are almost on a par with lines in developed world countries, and the SA plastics convertors have likewise excelled at the JIT supply of the huge variety of plastic components used during the assembly of a wide range of vehicles at plants around the country

facing threat of impending skills shortage Port Elizabeth, Uitenhage, East London and Durban, including the likes of Mercedes Benz, Volkswagen, Toyota, Automould, Lumotech, Rehau Polymers, G eneral Motors SA, G rupo Antolin, Q -Plas, Principle Plastics and Faurecia Interior Systems. â&#x20AC;&#x153;For the past 38 years, providing hands-on training and upskilling car component manufacturers has been one of our key areas of focus for our training division,â&#x20AC;? says Anton Hanekom, executive director of Plastics|SA. Ensuring skills transfer, upskilling the local automotive industry During 2016 alone, the association successfully trained and graduated more than 90 students in the automotive LQGXVWU\LQYDULRXVLQGXVWU\VSHFLÂżF courses offered, ranging from Plastic

Transforming the automotive industry The use of plastics in the construction of automobiles gathered pace during the V7RGD\LWLVGLIÂżFXOWWRLPDJLQHD car without plastics. The average modern car weighs about 1 500 kg and >>

Innovative high heat-resistant polyamide RADICIG ROUP Performance Plastics has introduced a new blow-moulding-grade polyamide capable of standing up to continuous exposure to hot air at temperatures of up to 230°C. The material was developed for, and in collaboration with, RĂś chling Automotive. The new material belongs to RadiciG roupâ&#x20AC;&#x2122;s RadilonÂŽ range of polyamide engineering thermoplastics, products that have a wide variety of uses in the automotive, electrical/electronics, industrial goods and consumer goods sectors. The new product is a copolymer with a semi-aromatic component, which, in combination with other additives used to retard the thermal oxidation process, endows the material with very high heat resistance properties. The formulation also ensures high melt strength and good blow-mouldability. Trials and validation tests performed in the RĂś chling Automotive laboratories show some of the advantages of the new product: Weight reduction: 15% Reduced energy consumption in production: 5-7% (lower process and mould WHPSHUDWXUH

Less expensive moulds (moulds last longer thanks to the lower abrasion of PA FRPSDUHGWR336

Enhanced impact resistance compared to PPS (Charpy un-notched impact VWUHQJWKDWÂ&#x192;&&KDUS\QRWFKHGLPSDFWVWUHQJWKDWÂ&#x192;&

www.radicigroup.com

45

www.basf.com

replacing heavier, traditional materials with lightweight plastic materials. Through an increased use of plastics, automotive manufacturers can address growing environmental concerns, ever tougher legislative measures aimed at breaking the dependence on oil and reducing man-made emissions that threaten the environment. In addition, using more plastics helps the car makers to overcome the economic impact of the global crisis which led to profound changes in global manufacturing.

FEBRUARY / MARCH 2017

constant use temperatures of 220°C and peaks up to 240°C. The grades UltramidŽ Endure D3G 7 with 35% glass ¿EUHUHLQIRUFHPHQWDQG'*ZLWK JODVV¿EUHUHLQIRUFHPHQWDUHVXLWDEOH for injection moulding. They are proven to work well in air intake manifolds of turbocharged diesel engines as well as in resonators and sensors. Well-known OEMs use UltramidŽ Endure D5G 3 BM ZLWKJODVV¿EUH ZKLFKLVVXLWDEOH for blow moulding, in charge-air pipes. For temperatures between 180°C and 210°C, the portfolio contains PA66 plastics with enhanced heat stabilization. These include UltramidŽ A3W2G 6 to * ZLWKJODVV¿EUHUHLQIRUFHPHQWV IURPWR IRUWHPSHUDWXUHVXSWR 190°C, e.g. in charge air cooler endcaps, and the new UltramidŽ A3W3G 7 for temperatures up to 210°C.

Manufacturing and Assembly Operations Supervision Learnerships, Injection Moulding Construction, Supervisory Management and Skills Programmes. Effective Planning, Effective Communication, Effective Workplace Calculations, Effective Workplace Performance and Effective Industrial Relations also make up part of the curriculum, while students are given a detailed understanding of working with plastics during the manufacturing process which is covered in the Basic Raw Materials and Advanced Raw Materials, Plastics Manufacturing Learnerships â&#x20AC;&#x201C; NQ F Level 2, 3 and 4 and Injection Moulding Overview for Managers courses. 3ODVWLFVHQDEOHUHVRXUFHHIÂżFLHQW mobility and better functionality by


AUTOMOTIVE & PLASTICS >> contains between 12-15 % plastics. This equates to over 2 000 plastic parts of all shapes and sizes;from lights and bumpers, to engine components, dashboards, headrests, switches, clips, panoramic roofs, seats, airbags and seat belts. Itâ&#x20AC;&#x2122;s no surprise that plastics are now the second most commonly used material in automobile manufacture. Plastics have revolutionised the construction, performance, safety and functionality of cars. â&#x20AC;&#x153;Single mould components have helped manufacturers to decrease vehicle assembly time, quickly introduce design innovations and trim costs. Plastics help to make cars lighter, thus reducing fuel demand and greenhouse gas emissions,â&#x20AC;? says Hanekom. According to the research conducted by Plastics Europe (www. plasticseurope.org), reducing a modern carâ&#x20AC;&#x2122;s weight by 100kg cuts fuel consumption by approximately 0.4 litres per 100km and reduces CO2 emissions by around 10g/km. 6LPLODUO\GXUDEOHSRO\HVWHUÂżEUHV have made seat belts a reality whilst high-strength nylon has led to the introduction of airbags in cars. Versatility, safety and functionality The use of plastics in modern cars often goes unnoticed, but needs to be highlighted for its versatility, safety and functionality. For example, the air intake manifold located under the bonnet, is today made of glass ÂżEUHUHLQIRUFHGSODVWLFVDOORZLQJIRU RSWLPLVHGDLUĂ&#x20AC;RZGHVLJQIUHHGRP and general reductions in weight and cost. Similarly, plastics are used for producing head lamps that are virtually shatter proof and that can be moulded into any imaginable shape, allowing lamps to adapt to differing light conditions and increase visibility. Plastics are also used for vehiclesâ&#x20AC;&#x2122; active parts, for example, drive shafts. In the event of an accident, the shafts split lengthwise without bending. A conventional shaft would risk bending, thereby possibly puncturing the tank or the carâ&#x20AC;&#x2122;s interior,â&#x20AC;? Hanekom explains. Âł7KHUHLVGHÂżQLWHO\DJUHDWHU GHPDQGIRUWUDLQHGDQGTXDOLÂżHG injection moulders, as these plastic components are lighter than the traditional materials. They do not need to be painted and with the lighter weight, transportation costs are reduced. The manufacturing process is cheaper and the components are recyclable,â&#x20AC;? he adds. >> 46

FEBRUARY / MARCH 2017

1

2

1. Covestro has constructed a display and surface demonstrator for explaining the various DVSHFWVRILWVFXUUHQWÂżOPGHYHORSPHQWV 2. The current top issue is the process of seamlessly integrating displays into the large, threedimensional surfaces of instrument panels $QRWKHUDSSOLFDWLRQIRUSRO\FDUERQDWHÂżOPVLQWHJUDWHGLVVZLWFKHVZLWKÂľĂ&#x20AC;\LQJV\PEROVÂś 7KHVHDUHEDVHGRQDQLQQRYDWLYHFRPELQDWLRQRISULQWHGÂżOPVDQGFXWWLQJHGJHLQMHFWLRQ moulding techniques, creating switches with a kind of optical 3D effect 3

Display trends in car cockpits 6FUDWFKUHVLVWDQWJODUHIUHHÂżOPV &29(6752KDVGHYHORSHGDZLGHUDQJHRIÂżOPVIRUFDULQWHULRUV7KHIRFXV is on displays and operating panels that are protected by scratch-resistant, JODUHIUHHÂżOPV8VLQJWKHPHQDEOHVQHZOLJKWLQJHIIHFWVDQGWKHLQWHJUDWLRQRI functions into the instrument panel. They are part of a new concept for vehicle interiors that also takes account of trends such as increasing networking and customization, electric mobility and autonomous driving. 0DQ\RIWKHÂżOPVROXWLRQVZHUHFUHDWHGLQFORVHFROODERUDWLRQZLWKSDUWQHUV IURPYDULRXVVHFWLRQVRIWKHSURFHVVFKDLQ¹¿OPSURFHVVLQJE\SULQWLQJ shaping and back-injecting, surface galvanization, mould construction and integrating electronics. 7KHÂżOPVFDQEHPDWWHRUKLJKJORVVZLWKGHÂżQHGRSWLFDOSURSHUWLHV including anti-glare effect. The current top issue is the process of seamlessly integrating displays into the large, three-dimensional surfaces of instrument panels and central consoles. The MakrofolÂŽ HF polycarbonate products are available in various matte grades, are formable in three dimensions, and have a scratch-resistant coating. 7KDQNVWRDVSHFLDOOD\HURIFRDWLQJWKDWLVRQO\SUHFXUHGWKHÂżOPVFDQEH IRUPHGDQGEDFNLQMHFWHGXVLQJÂżOPLQVHUWPRXOGLQJ ),0 DIWHUSULQWLQJ %HWZHHQVKDSLQJDQGEDFNLQMHFWLQJWKHFRDWLQJLVIXOO\FXUHGXVLQJ89ODPSV â&#x20AC;&#x2DC;Flying symbolsâ&#x20AC;&#x2122; $QRWKHUDSSOLFDWLRQIRUSRO\FDUERQDWHÂżOPVLQWHJUDWHGLQWRWKHGHPRQVWUDWRU LVVZLWFKHVZLWKÂłĂ&#x20AC;\LQJV\PEROV´7KHVHFHQWHURQDQLQQRYDWLYHFRPELQDWLRQ RISULQWHGÂżOPVDQGFXWWLQJHGJHLQMHFWLRQPRXOGLQJWHFKQLTXHV7KLVFUHDWHV switches with a kind of optical 3D effect. 'XULQJSURGXFWLRQVHYHUDOOD\HUVRI0DNURIRO'(ÂżOPVDUHSULQWHGZLWK various symbols. Their bottom layer has a patterned reverse side. The top layer FRQVLVWVRIDSDUWLFXODUO\VFUDWFKUHVLVWDQWÂżOP:KHQDVZLWFKLVSULQWHGZLWK WKLVÂżOPVWUXFWXUHYDULRXVWKUHHGLPHQVLRQDOLPDJHVDSSHDURUWKHSDWWHUQRQ the reverse side, depending on whether the LED lighting comes from the side or from below. www.covestro.com


AUTOMOTIVE & PLASTICS

>> Todayâ&#x20AC;&#x2122;s lightweight, durable plastics give designers and engineers the freedom to create innovative design concepts on vehicles which enhance passenger comfort at a realistic cost. This extends to the dashboard, surfaces, textiles, lighting and sensors as well as the carâ&#x20AC;&#x2122;s shape and external accessories like door handles, mirror frames, wheel covers and rims and bumpers integrated with the front end. Tailor-made, ergonomic bumpers and dashboards can now be moulded as single parts instead of the multicomponents of yesterday, saving both time and money. This also means that new design innovations can quickly and cheaply be introduced to the production OLQH3ODVWLFERG\¿OOHUVZKLFK¿[VPDOO imperfections without the need for welding or grinding, keep small repair and maintenance costs to a minimum. Report highlights SA auto component manufacturersâ&#x20AC;&#x2122; progress 5HVHDUFKZKLFKVKRZVVLJQL¿FDQW performance improvements amongst South Africaâ&#x20AC;&#x2122;s automotive component manufacturers over the past decade, is enhancing the countryâ&#x20AC;&#x2122;s reputation as a competitive global automotive producer. Industry body, the National $VVRFLDWLRQRI$XWRPRWLYH&RPSRQHQW and Allied Manufacturers of South $IULFD 1$$&$0 VD\V¿JXUHV released by the South African $XWRPRWLYH%HQFKPDUNLQJ&OXE 6$$%& UHSRUWDUHQRWHZRUWK\ â&#x20AC;&#x153;We need to acknowledge what has been achieved, but most importantly WKHUHSRUWVXJJHVWVWKDWGLI¿FXOWWDUJHWV previously considered unattainable, can DQGPXVWEHUHDFKHG¶¶VDLG1$$&$0 SUHVLGHQW'DYH&RIIH\ â&#x20AC;&#x153;Many local component PDQXIDFWXULQJ¿UPVDUHWUXO\ZRUOG class, but we have the dual challenge of keeping up with rapidly progressing global best practice while also GHYHORSLQJWKHWDLORI¿UPV\HWWRIXOO\ adopt fundamental lean practices, which are essential to localisation FRQWUDFWV´&RIIH\VDLG $FFRUGLQJWRWKH6$$%& report, South Africaâ&#x20AC;&#x2122;s component manufacturers have made strong improvements over the past decade. Such an example is quality LPSURYHPHQWV,QFXVWRPHU UHWXUQUDWHVZHUHSDUWVSHU PLOOLRQLQWKLVZDVGRZQWR SSPDJDLQRI ³7KLVVWDWLVWLFLVWHOOLQJ´VD\V1$$&$0 executive director Renai Moothilal. â&#x20AC;&#x153;At a time where automotive quality and reliability issues have come to >> 48

FEBRUARY / MARCH 2017

New intake system from DuPont saves space, boosts performance THE BMW rGoupâ&#x20AC;&#x2122;s B58 3-litre straight-six petrol engines feature an integrated indirect charge air cooler from MAHLE. The system is made from DuPontâ&#x201E;¢ yZtel ® PLUS nylon which has particularly good resistance to heat and hot air ageing. 7KHDOXPLQLXPKHDWH[FKDQJHUWKURXJKZKLFKFRRODQWÃ&#x20AC;RZVLVLQVHUWHG lengthwise into the housing on guides which have sealing strips made from the same polymer. The innovative structural design of this charge air cooler means it can be arranged in the immediate vicinity of the engine, so minimising bulk and pressure drop and helping to optimise the balance of performance and fuel HI¿FLHQF\7KH%0:*URXSKDVEHHQXVLQJWKH%HQJLQHLQLWVLLDQG LPRGHOVVLQFHODWH This innovative application has been jointly developed by a team from Mahle, %0:DQG'X3RQW3HUIRUPDQFH0DWHULDOVZKRVHOHFWHGWKHJODVV¿EUHUHLQIRUFHG grade yZtel PLUS 95G 35. This choice arose from the productâ&#x20AC;&#x2122;s inherent outstanding UHVLVWDQFHWRFKHPLFDOVDQGWHPSHUDWXUHVRIXSWR&FRPELQHGZLWKDYHU\JRRG weldability. For this application, high weldability, using friction welding, is particularly important given the large size of the upper and lower parts of the housing which are PRXOGHGLQRQHVKRWLQDQLQMHFWLRQPRXOGLQJWRROZLWKDFDYLW\ Martin Valecka, development project manager at MAHLE, explains: â&#x20AC;&#x153;By deciding RQDJODVV¿EUHFRQWHQWRIE\ZHLJKWZHHQVXUHGDJRRGEDODQFHRIULJLGLW\ and impact strength. This combination of properties meant we were able to provide numerous thin-walled but nevertheless highly-effective supporting ribs. These ribs help to minimise deformation of the intake system even at high charge air pressures and temperatures and to ensure durability over the entire service life. Thanks to the YHU\JRRGÃ&#x20AC;RZDELOLW\RI=\WHO3/86ZHFDQDFKLHYHVKRUWLQMHFWLRQPRXOGLQJF\FOH WLPHVGHVSLWHVRPHWLPHVQDUURZÃ&#x20AC;RZSDWKVIRUWKHVHODUJHYROXPHFRPSRQHQWV *RRGÃ&#x20AC;RZDELOLW\DOVREHWWHUVXSSRUWVFRVWHIIHFWLYHPDQXIDFWXUH´ Saving space, boosting performance The charged air is cooled close to the engine by a coolant which is in turn cooled by outdoor air in a separate low-temperature circuit. This low-temperature cooler is very compact and so saves front-end space. The bulky charge air hoses used in direct charge air cooling are replaced by thin coolant lines. There is no requirement for ducts between the charged air cooler and intake manifold. Due to a smaller volume DQGVKRUWÃ&#x20AC;RZSDWKVWKH SUHVVXUHGURSLVXSWR lower than in conventional direct cooling. This translates into a higher YROXPHWULFHI¿FLHQF\LQWKH cylinder. In addition, cooler air remains available to the engine for longer time for example under hard acceleration. Both factors have a positive impact on engine performance and responsiveness. www.dupont.com


AUTOMOTIVE & PLASTICS >> the fore, evidence is being brought to bear that South African component producers are making huge strides in supplying products at the highest quality standards.” Other noteworthy gains include a 45% improvement in the time to do machine/tool changeovers whilst the supply chains’ reliability, measured relative to customer delivery expectations rose by 70.0%. Automotive Industry Conference in April Referring to the upcoming NAACAM show, Coffey said the Automotive Industry Conference would include DVHVVLRQSXUHO\UHÀHFWLQJRQ:RUOG Class Manufacturing and Best Practices. This would be led by international experts with a global view of manufacturing best practice and foresight of emerging trends. In addition to international experts, leading government and other automotive stakeholders, including OEM CEOs and tier-one executives would address participants on a range of topical issues. The NAACAM show is being held in conjunction with the National Localisation Indaba from 5-7 April in Durban, and aims to showcase the capabilities of South Africa’s diverse automotive components sector. Skills development in automotive industry must remain a major focus Despite all the great things the SA industry players have achieved, the future economic outlook and business climate is still uncertain for the local automotive industry. Most importers are concerned that the value of the Rand will impact negatively on the South African automotive market. With regards to the export market, globally, there is also some uncertainty: expectation of growth may have been over-estimated and the International Monetary Fund (IMF) has indicated that the world is not going to recover from the recession of 2008/9 as quickly as had been predicted. Despite this, skills and development in the automotive industry will remain a major focus area if local players wish to remain competitive and relevant. “Plastics|SA will continue to engage with government and industry to determine what skills are needed, and to ensure they are positioned to provide the best service to members and clients,” Hanekom concludes. www.naacamshow.co.za 50

FEBRUARY / MARCH 2017

Layer design of the MLT 4800 The new multilayer tubing system 4800 with an inner layer of low extractable VESTAMID® SRO\DPLGHRIIHUVVLJQL¿FDQWO\UHGXFHGOHYHOV of extractable substances

Low extractable fuel line 2IIHUVVLJQL¿FDQWO\UHGXFHGOHYHOV RIH[WUDFWDEOHVXEVWDQFHV WITH the multilayer tubing system (MLT) 4800, the world’s leading provider of polyamide 12 for multilayer plastic tubing systems, Evonik Industries, Essen, responds to new requirements in the automotive industry – low extractable fuel line systems. The new MLT 4800 system with an inner layer of low extractable VESTAMID®SRO\DPLGHRIIHUVVLJQL¿FDQWO\UHGXFHG levels of extractable substances. Alcohol containing fuels and lower fuel consumption The use of fuels that contain alcohol, for example biofuels containing ethanol, can lead to the extraction of substances from the inner walls of conventional gasoline lines. Under certain extreme conditions these substances can clog the nozzles in new, sensitive fuel systems, which use small-diameter nozzles to create an atomized spray of gasoline and air for fuel injection in order to decrease fuel consumption. To reliably counteract this, the automotive industry is looking for new fuel line materials with VLJQL¿FDQWO\UHGXFHGH[WUDFWLRQ Existing series expanded For many years, Evonik has been offering its MLT 7440, a conductive system that fully meets the requirements. The new MLT 4800 now supplements it with a non-conductive system. It is based on the MLT 4300, with an outer layer of VESTAMID® polyamide 12 and a barrier layer of ethylene vinyl alcohol (EVOH) to prevent fuel permeation. In the MLT 4800, however, the PA6 inner layer of the proven system 4300 is replaced by a newly developed, low extractable VESTAMID® polyamide 612, which meets the requirements of automobile manufacturers. The mechanical characteristics, chemical resistance, and permeation behavior are on the same level as the MLT 4300, which is the currently most used MLT in Europe. VESTAMID has been in use by prestigious automobile manufacturers for more than 50 years. In addition to molding compounds for monowall applications, Evonik has also developed various multilayer tubing systems with different barrier layers. VESTAMID polyamide 12 and polyamide 612 are the world’s most widely used polyamides for tubing systems in automobiles. www.evonik.de


AUTOMOTIVE & PLASTICS

An innovative material solution for particularly durable underbody panels is based on the composites of the Tepex brand. These enable the manufacture of virtually indestructible engine shields, fuel tank covers and centre tunnel covers that are already in use on several standard models such as the Bentley Bentayga

Thermoplastic composites for underbody area Dramatically increased strength and stiffness FREQ UENTLYused for off-road assignments or for driving on H[WUHPHO\SRRUURDGVMHHSVDQG689VQHHGWREHÂżWWHGZLWK particularly durable underbody panels. An innovative material VROXWLRQIRUVXFKFXVWRPSDUWVLVEDVHGRQWKHFRQWLQXRXV ÂżEUHUHLQIRUFHGWKHUPRSODVWLFFRPSRVLWHVRIWKH7HSH[EUDQG made by Lanxessâ&#x20AC;&#x2122;s subsidiary Bond-Laminates GmbH. 7KHVHHQDEOHWKHPDQXIDFWXUHRIYLUWXDOO\LQGHVWUXFWLEOH HQJLQHVKLHOGVIXHOWDQNFRYHUVDQGFHQWHUWXQQHOFRYHUVWKDW DUHDOUHDG\LQXVHRQVHYHUDOVWDQGDUGPRGHOVVXFKDVWKH Bentley Bentayga. Âł,QDWULDORQDURXJKDQGURFN\WHVWWUDFNWKHFRPSRQHQWV ZLWKVWRRGWKHH[WUHPHZHDUDQGWHDURIWKHXQGHUERG\KLWWLQJ WKHVXUIDFHDVZHOODVJUDYHOLPSDFWZLWKYLUWXDOO\QRGDPDJH at all,â&#x20AC;? said Harri Dittmar, Tepex applications developer. On WRSRIWKDWWKHFRPSRVLWHPDWHULDOVLPSOLÂżHVWKHSURGXFWLRQ SURFHVVÂł&XVWRPSDUWVFDQEHSURGXFHGLQWKHVDPH PRXOGDVWKHFRUUHVSRQGLQJVWDQGDUGYHKLFOHFRPSRQHQWV 3URFHVVRUVGRQÂśWQHHGWRWXUQRWKHUPDWHULDOVDQGFDQ HOLPLQDWHLQYHVWPHQWVLQDGGLWLRQDOPRXOGVDQGSUHVVHVZLWK KLJKHUFODPSLQJIRUFHV´KHDGGHG 7KHVKLHOGVDQGFRYHUVIRUWKHVWDQGDUGDQGFXVWRPPRGHOV DUHERWKIDEULFDWHGLQDFRPSUHVVLRQPRXOGLQJSURFHVVXVLQJ SRO\SURS\OHQHEDVHGORZZHLJKWUHLQIRUFHGWKHUPRSODVWLFV /:57 7KHODUJH/:57EODQNVDUHKHDWHGLQDFRQYHFWLRQRYHQ

DQGLQVHUWHGE\DURERWLQWRDFRPSUHVVLRQPRXOGWKDWFDQVKDSH up to four components simultaneously depending on part size. 7KHFRPSRQHQWVDUHWKHQSXQFKHGRXWRIWKH¿QLVK FRQWRXUHGEODQNVRUFXWRXWZLWKDZDWHUMHW7RIDEULFDWHWKH FRPSRQHQWVIRUWKHFXVWRPSDUWVDPLOOLPHWHUWKLFN7HSH[ LQVHUWLVDGGLWLRQDOO\SODFHGRQWRSRIWKH/:57EODQNVDQG PRXOGHGWRJHWKHUZLWKWKHPVRWKDWWKHUHVXOWLQJFRPSRQHQWV KDYHD7HSH[VXUIDFHRQWKHVLGHIDFLQJWKHURDG 7KHLQVHUWVIRUDOORIWKHFXVWRPSDUWVDUHPDGHRI7HSH[ G\QDOLWH5*FRPSULVLQJDSRO\SURS\OHQHPDWUL[ LQZKLFKE\YROXPHFRQWLQXRXVJODVV¿EUHURYLQJVDUH embedded as a single-layer fabric. 7KHWRSOD\HURI7HSH[VLJQL¿FDQWO\LQFUHDVHVWKHVWUHQJWK VWLIIQHVVDQGDERYHDOOWKHWRXJKQHVVRIWKH/:57FRPSRQHQWV ³%HFDXVHRILWVXQLTXHVWUXFWXUH/:57DGGLWLRQDOO\KDV DYHU\JRRGVRXQGDEVRUELQJHIIHFWZKLFKZRXOGQRWKDYH EHHQSRVVLEOHZLWKRWKHUFRPSUHVVLRQPRXOGLQJFRPSRXQGV DQGZRXOGKDYHPHDQWOHVVFRPIRUW´H[SODLQHG'LWWPDU7KH GXUDELOLW\RIWKHFRPSRVLWHVWUXFWXUHFDQEHLQFUHDVHGHYHQ PRUHLI7HSH[LVXVHGQRWRQO\RQWKHVLGHIDFLQJWKHURDG EXWDOVRRQWKHLQVLGHDVDQRYHUOD\7KHUHVXOWLVDVDQGZLFK VWUXFWXUHZLWKDFRUHPDGHRI/:57WKDWLVHYHQVWLIIHUEXW QRQHWKHOHVVVWLOOOLJKWZHLJKW www.bond-laminates.com

Worldâ&#x20AC;&#x2122;s largest PC rear quarter window

52

FEBRUARY / MARCH 2017

SABIC resin debuts on Buickâ&#x20AC;&#x2122;s new-generation Gl8 MPVs 6$,&*HQHUDO0RWRUV 6*0 KDVODXQFKHG LWVQHZJHQHUDWLRQ%XLFN*/DQG*/ $YHQLUOX[XU\PXOWLSXUSRVHYHKLFOHV 039V LQ&KLQDDOOZKLFKVSRUWWKHZRUOGÂśV ODUJHVWSRO\FDUERQDWHUHDUTXDUWHUZLQGRZ moulded from SABICâ&#x20AC;&#x2122;s LEX AN â&#x201E;˘ resin. 7KHQHZUHDUTXDUWHUZLQGRZ PHDVXUHVDUHFRUGEUHDNLQJPP E\PP,WLVWZRVKRWLQMHFWLRQ FRPSUHVVLRQPRXOGHGDW6KHQWRQJÂśV facility, using SABICâ&#x20AC;&#x2122;s transparent

LEX AN PC resin and CY COLOY â&#x201E;˘ resin, a PC/acrylonitrile-butadieneVW\UHQH $%6 PDWHULDO XVHGIRUWKH EODFNRXWDUHD  7KLVUHVLQFRPELQDWLRQKHOSVPHHW WKHVSHFLÂżFQHHGVRIWKHSDUWÂśVGHVLJQ DQGWKHWLJKWGLPHQVLRQDOWROHUDQFH UHTXLUHPHQWVRIWKHODUJHUHDUTXDUWHU ZLQGRZ$VLOLFRQHKDUGFRDWSURWHFWVWKH SDUWDJDLQVWDEUDVLRQDQGZHDWKHULQJ 7KHQHZUHDUTXDUWHUZLQGRZLV NJ OLJKWHUDQGVLJQLÂżFDQWO\PRUH The new-generation Buick GL8 and GL8 Avenir luxury LPSDFWUHVLVWDQWWKDQDFRPSDUDEOH multi-purpose vehicle has a rear quarter window made from PC that measures JODVVZLQGRZ7KH3&ZLQGRZ a record-breaking also features design elements 1200mm by WKDWFDQQRWEHDFKLHYHGZLWK 450mm JODVVFRQWULEXWLQJWRWKH more innovative exterior of

WKHQHZJHQHUDWLRQ*/ 6*0FKRVH1LQJER6KHQWRQJ$XWR Decorations as its tier one supplier IRUWKLVNH\ZLQGRZSDUW6KHQWRQJD long-time manufacturer of automotive plastic applications, provided design DVVLVWDQFHDQGWHFKQLFDOVXSSRUWDFURVV WKHHQWLUHGHYHORSPHQWF\FOHIURP FRQFHSWWRYDOLGDWLRQ6KHQWRQJDOVR LQYHVWHGLQDQHZSURGXFWLRQIDFLOLW\ IRU3&JOD]LQJ7KLVIDFLOLW\LVORFDWHG LQ<X\DR&LW\&KLQDDQGLVWKHÂżUVW mass production PC glazing line in WKHFRXQWU\0DQXIDFWXULQJFDSDELOLWLHV LQFOXGHWKHODWHVW3&JOD]LQJ WHFKQRORJLHVLQFOXGLQJDGYDQFHG WZRFRPSRQHQWLQMHFWLRQFRPSUHVVLRQ PRXOGLQJDQGĂ&#x20AC;RZFRDWLQJSURFHVVHV www.naacamshow.co.za


EQUIPMENT

Versatile, all electric auxiliary injection unit

54 FEBRUARY / MARCH 2017

Operates seamlessly with any IM machine on the market THE E-Multi, from Milacron’s hot runner brand, Mold-Masters, is an all-electric, servomotor driven, mould or platen mounted, fully mobile auxiliary injection unit for multimaterial or multi coloured applications. According to Richard Carter from Mould & Die Solutions (MDS), who represent Mold-Masters in SA, the E-Multi is brand independent and the ideal solution for moulders who are looking to economically optimize their existing injection moulding machine assets with an auxiliary injection unit solution that is highly mobile, compact and footprint neutral. It is servo driven, with high precision, fast, repeatable and reliable performance. Moulders are also able to use a single E-Multi or multiple IM machines for various programmes. It is also compact and operates horizontally mounted in as little area as 1.5 m2 – even less when vertically mounted directly to the mould. A big advantage is that it will operate seamlessly with any IM machine on the market. Using the E-Multi, moulders can simplify operations by centralising moulding functions and eliminating unnecessary equipment. It is also very simple to integrate additional functionality into the E-Multi controller.

The latest model enhancements The mould-mounted E-Multi EM1* model has a new carriage that provides enKDQFHGXWLOLW\DQGDFRPSDFW¿WRIWKHXQLW into the moulding area. Along with the new carriage, the EM1 has a relocated spring pack to provide increased tie-bar clearance and increased mechanical nozzle protrusion adjustment from +/- 5mm to +/- 15mm. The new E-Multi EM1** and EM2** mould mounted models with servo carriage are designed for applications requiring sprue-break (the ability to retract the nozzle each cycle away from the PHOWLQOHW 7KLVVLJQL¿FDQWDGYDQFHPHQW allows these new models to be used for applications where injection at the parting line is needed or in applications where the melt inlet moves relative to where the secondary injection unit is located. This is a breakthrough for customers looking to modernize their current injection moulding lines allowing for immediate part changes. The larger E-Multi EM3 and EM4 modHOVDUHQRZFDSDEOHRIEHLQJRXW¿WWHGZLWK the radial option. E-Multi radial mounts to the top of the stationary platen and allows the E-Multi unit to rotate to the ‘parked position’, providing unobstructed access to the mould mounting face for quick mould change. Servo sprue break motion is stan-

dard. The EM3 and EM4 units are capable of shots of 57cc to 499 cc. Software updates With the E-Multi software update comes the ability to integrate a Milacron Varian rotary table and have it controlled through the E-Multi control cabinet. The Milacron Varian turntables’ proven technology along with an E-Multi can be added to any machine to expand its capabilities. Milacron’s combined technologies and industry leading brands allow customers WKHÀH[LELOLW\WRSXUFKDVHDQ(0XOWLjOD carte or in a complete 2K package with a Milacron injection moulding machine, E-Multi and a Varian Turntable. * (EM1-15 and EM1-30: 14mm through to 22mm screw – standard and highspeed models) **(EM1-15SC and EM1-30SC: 14 though to 22mm screws standard and high-speed) **(EM2-50SC and EM2-80SC: 18 though to 25mm screws) • Mold-Masters is represented in South Africa by Mould & Die Solutions

www.m-d-s.co.za

The E-Multi auxiliary injection unit from Milacron

Compact horizontal mount stand

The E-Multi injection unit

Expandable multifunction controller


'HFLVLYHDGYDQWDJHVZLWKKLJKVKRWZHLJKWV Sewer manhole systems manufactured on large Ettlinger machines $1LQMHFWLRQPRXOGLQJPDFKLQHIRUODUJH mouldings was recently shipped by Ettlinger to a leading European plastics converter: an SRM 2500/120 with a clamping force of 25,000 kN and a maximum shot volume of 120 litres. The machine is used to manufacture components for accessible sewer manholes up to 1000mm in diameter from polypropylene. The manholes have a modular structure comprised of an entrance cone, shaft ring, and shaft bottom, frequently adding up to an overall height of several meters. The shaft bottom, which was moulded during

the machine acceptance test weighed 62kg by itself. The manholes enable reliable disposal of waste water in urban areas and are constructed in several different sizes. The newly commissioned SRM 2500 is WKHVHFRQGLQMHFWLRQPRXOGLQJPDFKLQH purchased by this client to expand the customerâ&#x20AC;&#x2122;s production capacity for sewer manholes. 7KHWZRVWDJHLQMHFWLRQXQLWLVFRPPRQ WRDOOLQMHFWLRQPRXOGLQJPDFKLQHVLQ the Ettlinger SRM series: the material is plasticized by an extrusion unit while DSOXQJHUXQLWLQMHFWVWKHPHOWLQWRWKH

This srm 2500/120 â&#x20AC;&#x201C; 16.4m long, 3.3m wide, and 4.9m high with a clamping force of 25,000 kN and a maximum shot volume of 120,000 cmÂł â&#x20AC;&#x201C; is designed to optimise the injection moulding process for PP sewer manhole systems.

mould. Both the plasticating extruder DQGWKHLQMHFWLRQXQLWRSHUDWHF\FOLFDOO\ The extruded melt is conveyed into a cylindrical accumulator, from where it is forced into the mould cavity by the LQMHFWLRQSOXQJHUZLWKDSUHVVXUHDQG velocity controlled forward movement. %HFDXVHRIWKLVSULQFLSOHWKHLQMHFWLRQ system is capable of processing large shot volumes with a high melt quality, yet the clamping system manages with less clamping force.

www.ettlinger.com

7KHIUDPHRQWKHÂż[HGSODWHQ SKRWROHIW DOORZVWKHFRUHSXOOHUVVSHFLÂżFWR HDFKPRXOGLQJWREHĂ&#x20AC;H[LEO\SRVLWLRQHG$OOZRUNĂ&#x20AC;RZVRQWKHVUPLQMHFWLRQ moulding machine are controlled and visualised on a powerful controller with LQWXLWLYHWRXFKVFUHHQRSHUDWLRQ SKRWRULJKW PHOTOS: ETTLINGER

7KHQH[WVWHSIRUZDUGIRUĂ H[LEOHEDUULHUSDFNDJLQJ 7RWDOUHVLQIRUPXODWLRQSURFHVVHGRQ+RVRNDZD$OSLQHOD\HUEDUULHUÂżOPOLQH TOTAL, Hosokawa Alpine, Coveris and Hayssen Flexible Systems have collaboratedto demonstrate a new 11-layer high performance barrier packaging solution. Using Total LumiceneÂŽ PE on WKHLUEORZQÂżOPOLQH+RVRNDZD Alpine manufactured an 11-layer high SHUIRUPDQFHEDUULHUÂżOPZLWKVXSHULRU toughness and ideal for food preservation applications. The extensive Total Lumicene range, containing both low and medium-tohigh density metallocene polyethylene, plays an important role in providing the best product for each layer of an OD\HUEDUULHUÂżOPWRSURYLGHRSWLPXP

packaging performance. The Total resin formulation boosts the water vapor barrier, which protects the gas barrier block and increases downgauging potential, providing excellent optics and fast sealing. Total, Hosokawa Alpine, Coveris and Hayssen represent leaders in their UHVSHFWLYHÂżHOGVSURYLGLQJWRJHWKHUWKH perfect solution with each collaborator dedicated to delivering their part: the right formula for boosting the water vapour barrier with Totalâ&#x20AC;&#x2122;s Lumicene resin; Hosokawa Alpineâ&#x20AC;&#x2122;s unique 11-layer blown ÂżOPOLQHDQGIRUWKLVSURMHFW&RYHULVÂś lamination and Hayssenâ&#x20AC;&#x2122;s packaging making expertise.

www.polymers.total.com

Total, Hosokawa Alpine and Coveris collaboration on barrier packaging using Total Lumicene

FEB / MARCH 2017 55


EQUIPMENT

Advancements for remote mould monitoring Production visibility in real time PROGRESSIVEâ&#x20AC;&#x2122;S CVe mould monitoring system, already used on thousands of tools worldwide since its initial release in 2011, now boasts new features allowing unprecedented visibility of tooling and production. With a CVe Monitor mounted in an injection mould and interfacing with wireless devices to relay data to the cloud based CVe LiveÂŽ website, timely production is ensured, whether the production is occurring across the plant or around the world. â&#x20AC;&#x153;The CVe platform serves up information in an easy to understand format, to enable users to identify poorly

56 FEBRUARY / MARCH 2017

Compact mould monitor

performing moulds before they impact the supply chainâ&#x20AC;?; explained Glenn Starkey, president of Progressive Components. â&#x20AC;&#x153;This new release further expands on an industry exclusive capability that allows users to access information online via a secured website using a PC, smartphone or tabletâ&#x20AC;? y Recent advancements of CVe Live v3 now feature: y Text alerts to designated recipients when a tool isnâ&#x20AC;&#x2122;t performing as expected y Mould downtime and reject tracking give visibility to common issues and trends y Work order tracking added to the existing preventive maintenance capability enables users to track and identify recurring issues in order to prevent future unscheduled maintenance; y Performance tracking and history aggregates data by both the mould and the moulding machine, allowing users to schedule tools for PIM machines they perform best in, thereby optimising production output.

PIM modules transmit via Gateway

Developed and supported by Progressiveâ&#x20AC;&#x2122;s subsidiary AST Technology, CVe Live is designed to integrate with a companyâ&#x20AC;&#x2122;s existing systems and can be FRQÂżJXUHGWRDXWRPDWLFDOO\H[SRUWDQ\RI the data collected or information that is entered by users. â&#x20AC;˘ Progressive Components are represented in South Africa by Mould & Die Solutions. www.m-d-s.co.za

Smell the difference! Permanent odour reduction WHAT do you do when you want to produce high-quality regranulate, but your input material is smelly, and consequently your regranulate, too? This is a problem that many plastics recyclers are facing, especially when UHSURFHVVLQJSRO\ROHÂżQSDFNDJLQJZDVWH Recyclers of post-consumer plastic waste often have to deal with materials containing migrated substances from food, cosmetics or detergents. But also residues of monomers, oxidation, hydrolysis and decomposition products (VOCs â&#x20AC;&#x201C; volatile contaminants) can cause unwanted smell in recycled pellets. Starlinger has developed a technology that reduces the smell during and after recycling VLJQLÂżFDQWO\DQGDOORZVUHF\FOHUVWRÂľXSF\FOHÂś

their end product. The method works without additives, achieving excellent resin quality with improved smell on a permanent basis. The odour reduction process consists of three steps: material preparation in the SMART feeder, where the material is heated and homogenised until the ideal operation point is reached; the C-VAC degassing module with 300% increased melt surface for highest possible degassing HIÂżFLHQF\DQGWKH6PHOO([WUDFWLRQ8QLW ZKLFKJLYHVWKHUHJUDQXODWHWKHÂżQDO touch. The result: upcycled, permanently smell-improved regranulate of highest quality that can be used in a wide range of applications. www.starlinger.com

Recycled granulate without the disturbing smell


LWK( 0

[ LDX XOW

LD RWHQW RXUS H \ QMH L LV OLDU\ L

:

0D [ L P

(0XOWLXWLOLVHV\RXUH[LVWLQJVLQJOH VKRWHTXLSPHQWDQGH[SDQGVLWV FDSDELOLWLHVE\HQDEOLQJPXOWLVKRW DQGPXOWLPDWHULDOPRXOGLQJ

5HSXUSRVLQJH[LVWLQJPDFKLQHU\ DOORZVIRUVPDOOHUFDSLWDOLQYHVWPHQWV DQGWDNHVXSOHVVÃ&#x20AC;RRUVSDFH (0XOWLLVIXOO\PRELOHVRWKDWLWFDQEH GHSOR\HGWKURXJKRXW\RXURSHUDWLRQ RQYDULRXVPDFKLQHVLPSURYLQJ52,

6HL]HWKHDGYDQWDJHZLWK0ROG0DVWHUV¶ (0XOWL

ZZZPGVFR]D

&RQWDFWXV

&DOO (PDLO

O

FW LRQ

&37  -+%  LQIR#PGVFR]D


EQUIPMENT

Unmatched hot runner warranty!

58 FEBRUARY / MARCH 2017

Mold-Masters offer 10-year warranty MOLD-MASTERS, part of the Milacron group that also owns brands such as DME, Ferromatic, Uniloy and Cimcool, believe their hot runner systems are so robust and reliable theyâ&#x20AC;&#x2122;re backed by a warranty that often exceeds the life of the mould! They are offering up to a 10-year warranty when purchased and used with an originally supplied Mold-Masters hot half DQGWHPSHUDWXUHFRQWUROOHU7KLVLVDÂżUVWLQ the industry! This commitment is impressive considering the cost of hot runner replacement parts. Mold-Mastersâ&#x20AC;&#x2122; power to engineer solutions is the result of combining individual, local expertise into a global team of the best the plastics industry has to offer. With their large network of global agents, they have the ability to support customers LQWKHÂżHOGQRPDWWHUZKHUHLQWKHZRUOG your mould is run. Hot runner technology can hold the key WRPRUHHIÂżFLHQWLQMHFWLRQPRXOGLQJDQG higher quality moulded components. High

volume plastics manufacturing covers a multitude of industries but all face the same demand â&#x20AC;&#x201C; produce more parts, more quickly, using less material and, ultimately, at a lower price. Melt delivery technology can help meet all those demands. As a consequence, hot runner system developers have been directing their attention to developing equipment that enables part weight savings and shorter moulding cycles, supports higher cavitation and closer pitch, and can handle ever more challenging materials. Whilst no-one disputes the obvious EHQHÂżWVRIWKLVVRUWRIWHFKQRORJ\D reputable hot runner manufacturer needs to put years of research and development behind the production of their hot runner V\VWHPV7KHLQLWLDOSURWRW\SHVDUHUHÂżQHG again and again, until they meet the GHPDQGLQJUHTXLUHPHQWVRIWKHLQMHFWLRQ mould manufacturer and moulder. This type of research and development

doesnâ&#x20AC;&#x2122;t come cheap. In addition, the exacting nature of hot runner requirements means that hot runner components are highly engineered and are manufactured from specialist raw materials. Your hot runner system can cost you many thousands of Rands. So how does a mould maker decide where to invest his hard earned buck when purchasing a new hot runner system? Can he really afford to run the risk of investing in the wrong product where breakdowns could erode his SRWHQWLDOSURÂżWPDUJLQ"'RHVKHEX\ cheap and hope for the best, or does he take a more considered approach, working with companies having a reputation for supplying reliable product. â&#x20AC;˘ Mold-Masters is represented in South Africa by Mould & Die Solutions www.m-d-s.co.za

Samchem Corporation delivering service excellence Samchem Corporation (Pty) Ltd was established in March 1998 to act as principal agent for Samsungâ&#x20AC;&#x2122;s plastics and chemicals business into both South Africa and sub-Saharan Africa. The company has since grown and diversified into a number of different markets, sustained by well-structured finance. Samchem Corporation (Pty) Ltd is a proactive company with a flat decision-making structure. This ensures that the dedicated staff is committed to adhere to the highest standards of personal service. The company prides itself on offering best quality, competitive prices delivering service excellence!

OUR PRODUCTS Samchem Corporation imports and distributes a wide range of virgin and high quality recycled plastic raw materials, plastic additives and chemical raw materials, mainly from South East Asia, North & South America, Middle East and Europe, including:

â&#x20AC;˘ LLDPE, LDPE, HDPE, EVA, GPPS, HIPS, ENGINEERING POLYMERS â&#x20AC;˘ â&#x20AC;˘ Chemicals: Organic, Inorganic, Cellulose

Plastic additives: Masterbatch, Titanium dioxide, Plasticisers

Durban

East London

Johannesburg

Vishnu Colan Mobile: 082 901 9267 vc@samchemcorp.co.za

Graham Randall Mobile: 078 229 7975 grandall@mweb.co.za

Hadley Lasarow Mobile: 082 255 8964 hadley@samchemcorp.co.za

www.samchemcorp.co.za


EQUIPMENT

ReFresher ensures odourless recyclate in post-consumer recycling The combination of ReFresher and the proven TVEplus technology now offers odourless UHF\FODWHVIRUWKHÂżUVWWLPHHYHQLQWKHFDVH of severely contaminated packaging waste

â&#x20AC;˘ 2IÂżFLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU%$6)

RQ738(ODVWROODQÂŽ7KHUPRSODVWLF3RO\XUHWKDQH

â&#x20AC;˘ 2IÂżFLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU(ODVWURQ RQ73(739(ODVWURQÂŽ6(%6DQG(3'033

â&#x20AC;˘ 2IÂżFLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU &*)6(RQ)6(ÂŽ )OXRURHODVWRPHUVDQG 3HUĂ&#x20AC;XRURHODVWRPHUV

â&#x20AC;˘ 'LVWULEXWRUIRU:HLIDQJRQ:HLSUHQ &3( â&#x20AC;˘ 6XSSOLHUVRI(369DULRXV*UDGHV â&#x20AC;˘ (QJLQHHULQJ3RO\PHUV â&#x20AC;˘ 3RO\ROHÂżQV â&#x20AC;˘ 5HZRUNHGDQG5HSDOHWLVHG0DWHULDOV

60 FEBRUARY / MARCH 2017

ÂŽ

WITH the presentation of ReFresher at the K 2016 trade fair EREMA achieved a breakthrough in the post-consumer sector - odourless recyclate opens up a multitude of new sales markets for recyclers and producers. Erema customers now have access to a mobile ReFresher for test purposes to enable them to carry out on-site trials and evaluate results. â&#x20AC;&#x153;We recognised the potential of continuously increasing SDFNDJLQJZDVWHHDUO\RQDQGZRUNHGLQWHQVLYHO\RQÂżQGLQJ a technical solution for the odour issue. With the ReFresher we offer recyclers and producers the edge in terms of quality to establish themselves in the marketplace with odourless recyclates from household waste,â&#x20AC;? says Manfred Hackl, Erema CEO. The ReFresher eliminates odours caused by migrated substances. The ReFresher is downstream of the extrusion process and keeps the recyclates at the required temperature at which volatile materials can be discharged. The ReFresher is available in various expansion stages depending on the end application. The Intarema TVEplus prevents unpleasant odours from developing in the course of the extrusion process. In conventional processes these develop for example through cellulose contamination such as wood or paper which burn during extrusion and transfer the smell to the plastic. The LQWHUSOD\RISUHFRQGLWLRQLQJXQLW$LUĂ&#x20AC;XVKWHFKQRORJ\ORZ PHOWWHPSHUDWXUHHIÂżFLHQWÂżOWUDWLRQDQGVHYHUDOGHJDVVLQJ steps ensures that the cellulose particles are separated from the plastic. â&#x20AC;&#x153;At the end of the extrusion process what we have in our hands is high-quality recyclate which is already suitable for many applications. And here I am referring to extrusion SURGXFWVVXFKDVSLSHVRUÂżOPLQWKHZDVWHPDQDJHPHQW or construction industry. The odour caused by migrated substances, however, is more stubborn. End products, such as plastic parts in cars or in the home, call for an additional recycling step to neutralise the odour. And this is exactly what we developed the ReFresher for,â&#x20AC;?explains Clemens Kitzberger, post-consumer business development manager at Erema.

â&#x20AC;˘ Relloy is the agent for Erema in South Africa

www.relloy.co.za

www.erema.at


First nasal-only oxygenation mask uses super-soft medical TPE Provides strong yet comfortable seal to the patient’s face RELYING on the sealing and cushioning capabilities of a super-soft thermoplastic elastomer (TPE), a small innovative company has addressed a longstanding problem in procedures involving sedation E\FUHDWLQJWKH¿UVWQDVDORQO\DOWHUQDWLYH to the standard full-face oxygenation and ventilation masks that medical practitioners have used for decades. Unlike full-face masks, the patentpending SuperNO2VA™ mask developed by Revolutionary Medical Devices (RMD) provides easy access to the oral cavity and is designed to GHOLYHUDJUHDWHUÀRZRIR[\JHQXQGHU positive pressure to the patient’s DLUZD\V7KHVLQJOHXVHPDVNFRQVLVWV of a transparent rigid polypropylene 33 FRPSRQHQWZLWKDFFHVVSRUWVIRU DQDQHVWKHVLDFLUFXLWRUK\SHULQÀDWLRQ bag, plus a TPE cushion that is overmoulded onto the PP structure. The TPE

cushion, moulded of Medalist® MD10105 medical elastomer from Teknor Apex Company, plays a critical role by providing a strong yet comfortable seal to the patient’s face. The Medalist TPE is a gel-like 5 Shore $FRPSRXQGZLWKVXI¿FLHQWµWDFN¶DQG is designed to form a tight seal on the patient’s face. The SuperNO2 VA mask LVDQHI¿FLHQWDQGYHUVDWLOHDOWHUQDWLYHWR full-face masks and nasal cannulas, and it is particularly advantageous for intraoral procedures. RMD uses the China-based contract moulding subsidiary of a US company to injection mould the components for the SuperNO2VA mask. The cushion part is produced in blue, green, pink, or \HOORZIRUSXUSRVHVRIFRORXUFRGLQJ Teknor Apex supplies the Medalist MD10105XRD1 in pre-coloured compounds from a US plant and a plant in Singapore.

SuperNO2VA mask with Medalist seal shown in blue

www.teknorapex.com www.RMDevices.com

FEBRUARY / MARCH 2017 61

WE CLOSE THE LOOP. (5(0$(ˈFLHQF\LQSODVWLFUHF\FOLQJ

Your local EREMA contact: Relloy S.A. (Pty) Ltd, 27 Mopedi Road, Sebenza Edenvale, 1609, Gauteng dean@relloy.co.za, www.relloy.co.za

CHOOSE THE NUMBER ONE.


ASSOCIATION NEWS

PIPES XI â&#x20AC;&#x201C; A collaboration between SAPPMA and PPCA Papers included from international Plastic Pipes Conference, Berlin during 2016

THIS yearâ&#x20AC;&#x2122;s Pipes X I conference, from 4-5 September at Emperors Place in Johannesburg, will be a close collaboration between the Southern African Plastic Pipe Manufacturers Association (SAPPMA) and the Plastic Pipes Conference Association (PPCA). Member associations of the PPCA are the PE 100+ Association, Plastics Pipe Institute, PVC4Pipes and The European Plastic Pipe and Fittings Association (TEPPFA) At Pipes X I, at least ten papers will be included from the international Plastic Pipes Conference held in Berlin during 2016. For this reason, the duration of Pipes X I has been extended to two days. Zoran Davidovski, spokesman for the event, forecasts a

large attendance. â&#x20AC;&#x153;Our industry is in a constant process of innovative change DVLWÂżQGVQHZVROXWLRQVIRUUHSODFLQJDJLQJVWHHODQGFRQFUHWH pipe systems. In the midst of these improvements, industry and government are faced with the need for new technical standards. â&#x20AC;&#x153;The conference will showcase new developments and enable stakeholders to consider the international work that KDVEHHQFDUULHGRXWLQWKHÂżHOGRIVWDQGDUGVVXVWDLQDELOLW\ and experience. This will be particularly interesting for the South Africa and China markets,â&#x20AC;? said Davidovski. The Baerlocher Group is one of the major sponsors of Pipes X I, as well as Molecor and Rollepaal. www.sappma.co.za

PISA annual conference will explore Industry 4.0 Current trend of automation and data exchange in manufacturing PISAâ&#x20AC;&#x2122;s annual international conference will be held at the Spier Wine Estate, outside Stellenbosch in the Western Cape from 9-10 November, preceded by monthly events at Tshwane University of Technologyâ&#x20AC;&#x2122;s Pretoria West campus. Industry 4.0, or the fourth industrial revolution, is the current trend of automation and data exchange in manufacturing technologies. It includes cyber-physical systems, the Iâ&#x20AC;&#x2DC; nternet of thingsâ&#x20AC;&#x2122; and cloud computing. Industry 4.0 creates what has been called a sâ&#x20AC;&#x2DC; mart factoryâ&#x20AC;&#x2122;. Within the modular structured smart factories, cyber-physical systems monitor physical processes, create a virtual copy of the physical world and make decentralized decisions. Over the Iâ&#x20AC;&#x2DC;nternet of thingsâ&#x20AC;&#x2122;, cyber-physical systems communicate and cooperate with each other and with humans in real time, and via the Internet of Services, both internal and cross-organizational services are offered and used by participants of the value chain. Tshwane University of Technology, University of Pretoria and Stellenbosch University, who offer polymer training programmes, will be participating. They will catalyse the events by involving academic staff and postgraduate students so that industry can provide guidance as to entry into this sector. Studentsâ&#x20AC;&#x2122; presentations will be peer reviewed to maintain high standards and the participation of international students will also be encouraged. As PISA is an institute representing members from the industrial sector, the events will be geared to providing a platform for industry captains and specialists to present about the latest technologies and trends, including new materials latest conversion technologies modern production technologies ancillary equipment product design and testing automotive www.pisa.org.za 62 FEBRUARY / MARCH 2017

sustainability training packaging medical consumer nanotechnology Industry 4.0 (Internet of things) TUT technical seminars and wine tastings During the course of 2017, Tshwane University of Technology will also host monthly events which will include wine tastings under the guidance of Cape Wine Master, Margaret Fry, who will share the magic of featured vineyards ahead of the conference at Spier Estate. The 2017 technical seminars and wine tastings, hosted by TUT on their Pretoria West Campus, will take place on Thursdays 16 February, 16 May, 27 July and 21 September from 14:00 to 19:00.


Plastic pipes in mining The hidden treasure PLASTIC pipe has been used extensively in mining in Southern Africa for more than 45 years. According to Jan Venter, CEO of the Plastic Pipe Manufacturerâ&#x20AC;&#x2122;s Association 6$330$ WKHXQLTXHEHQHÂżWVRI39&DQG+'3(SLSHVÂżW particularly well in a mining environment. ,WLVHVWLPDWHGWKDWPRUHWKDQRIDOO+'3(SLSHLQ 6RXWKHUQ$IULFDÂżQGVLWVZD\LQWRPLQLQJDSSOLFDWLRQV â&#x20AC;&#x153;It is a proven product in rugged terrains, extreme climates and changing site environments, and is without doubt one of the most popular materials, particularly in gold and platinum mines as well as in open-cast coal mines,â&#x20AC;? Venter said. Although they are used to a lesser extent, Venter said PVC SLSHVDUHSDUWLFXODUO\SRSXODUZKHQPRGLÂżHGIRUKLJKLPSDFW and for the use of compressed air. â&#x20AC;&#x153;Just as water distribution, waste disposal, irrigation and telecommunications all rely on pipelines to function, so too the mining industry relies heavily on its plastic pipe infrastructure for water distribution, dewatering and slurry disposal. It is therefore of vital importance to ensure the TXDOLW\RISLSHVÂżWWLQJVDQGWKHLQVWDOODWLRQVWKHPVHOYHVDUH of unquestionable quality in order to avoid pipeline failure and downtime,â&#x20AC;? Venter added. When it comes to selecting pipe materials for mining applications, Venter explained that the two most important

It is estimated that more than 30% of all HDPE pipe in Southern Africa ÂżQGVLWVZD\LQWRPLQLQJDSSOLFDWLRQV

factors are security and reliability. â&#x20AC;&#x153;The pipe must be rustproof, break-resistant and safeguard the environment. It is important that the pipe used has a proven track record and that it is respected by professional engineers and installers. +LJK'HQVLW\3RO\HWK\OHQH 3( SLSHVQRWRQO\PHHWEXW exceed these challenges.â&#x20AC;? 7KHĂ&#x20AC;H[LEOHQDWXUHRI+'3(SLSHVDOORZVWKHPWR expand with pressure surges, thereby increasing the life of the pipeline and reducing maintenance costs. Because WKHVHUYLFHOLIHIRU+'3(SLSHLVEHWZHHQ\HDUV VLJQLÂżFDQWVDYLQJVLQUHSODFHPHQWFRVWVDUHHQVXUHGIRU mines for generations to come. www.sappma.co.za FEBRUARY / MARCH 2017

63


ASSOCIATION NEWS

Plastics|SA encourages growth, 0XVWSXVKWRÂżQGLQQRYDWLYHVROXWLRQVIRUWKH$IULFDQHQYLURQPHQW PLASTICS|SA chairman Bernhard Mahl issued a challenge at the associationâ&#x20AC;&#x2122;s AGM in November to get out of a survival mindset and back into a growth mindset through a conscious commitment to innovation. Speaking to the various members, captains of industry, media and other interested parties who were in attendance, Mahl said: â&#x20AC;&#x153;Looking back at what we have achieved during 2016, we can be proud of the fact that we have had a very successful year and that we managed to reach many of the strategic objectives we have set out to achieve,â&#x20AC;? he said. â&#x20AC;&#x153;We have seen a growth of 6.4% in virgin material consumption to 1 490 000 tons per year, as well as a 3% increase in the amount of plastics being recycled, allowing the local plastics Industry to now divert approximately 310 600 tons of SODVWLFVSHU\HDUIURPODQGÂżOO´KHDGGHG However, he warned that the industry can ill afford to rest on its laurels. â&#x20AC;&#x153;If we look at the past 5 to 10 years, the South African plastics industry has not recorded any real growth. Whilst we managed to have stayed on par with the countryâ&#x20AC;&#x2122;s GDP growth, this is still far below the average plastics growth of 3% worldwide. We need to put on our innovatorsâ&#x20AC;&#x2122; caps. Think outside the box. What can we do differently? In South Africa we are unlikely to be able to FRPSHWHZLWKWKHÂżUVWZRUOGZKRRIIHUV technological advancement. We are also not able to compete with companies from the Far East on price. However, we are

Skills Development and Industry support in the unique position of understanding the challenges we face on the African through Public-Private Partnerships. continent, and as such we must push Guest speaker, Devan Valenti, an RXUVHOYHVWRÂżQGLQQRYDWLYHVROXWLRQVIRU Independent Authors Award Winning the African environment,â&#x20AC;? Mahl said. Writer, talked about considering design, In his overview of the past yearâ&#x20AC;&#x2122;s innovative technology and sound policy in activities, Plastics|SA executive director, a challenging environment. $QWRQ+DQHNRPFRQÂżUPHGWKDWWKHORFDO â&#x20AC;&#x153;Business conditions may not be plastics value chain is well developed entirely favourable at this time, but if and that it caters to both local demand your company is truly innovative, youâ&#x20AC;&#x2122;ll and export markets. The biggest markets be able to turn challenging conditions to this past year continued to be the your advantage,â&#x20AC;? Valenti encouraged. packaging, building and 2017 Board of Directors construction as well as The new Plastics|SA Board for automotive industries, Mahl warns 2017 includes Anton Hanekom whilst competition from (Plastics|SA), chairman that plastics advanced developing Bernhard Mahl (Safripol), vicecountries and cheap industry can ill chairman Douglas Greig (Tuffy imports of relatively low afford to rest Manufacturing, representing value-added products SAPRO), vice-chairman Jeremy on its laurels had a negative impact Mackintosh (Polyoak Packaging, on domestic demand representing PCA), Douw Steyn this past year. (Plastics|SA), Rudi Johannes (Polymark Âł'HVSLWHGLIÂżFXOWHFRQRPLFFRQGLWLRQV Recycling, representing SAPRO), Jan 3ODVWLFV_6$VWD\HGIRFXVHGRQIXOÂżOOLQJ Venter (SAPPMA), Tim Stewart (ITB our mandate of creating a vibrant and Manufacturing, representing PCA), Mxolisi sustainable plastics industry in South Khutama (Nampak Limited, representing Africa that is valued and respected by PCA), Bob Bond (PISA), David Mokomela local and international industry, customers, (Sasol Base Chemicals, representing suppliers, government, community and Sasol Polymers), Mike Myers (EPSASA), employeesâ&#x20AC;?, Hanekom said. Daniel Schoeman (HOSAF), Rowan le He highlighted four important strategic Roux (Polyoak, representing Sustainability initiatives that were developed and Council), Wayne Wiid (Pioneer Plastics, implemented during 2015 as part of representing ARMSA), Magda van Plastics|SAâ&#x20AC;&#x2122;s aim to stimulate growth in the plastics industry. These were Zero Plastics Zanten (Engen, representing importers) WR/DQGÂżOO*URZWKWKURXJK([SRUW and Helmut Oellermann (Plastichem, DQG,PSRUW5HSODFHPHQW,QQRYDWLRQDQG representing importers).

PE school wins recycling contest

Winners Kabega Primary â&#x20AC;&#x201C; Andrew Joanas (principal) and Corrie van Eck (vice-principal) with grade 1 pupils Natalie de Jager, Cloe Jantjies, Gareth van Heerden and Tanya de Kock 64

FEBRUARY / MARCH 2017

KABEGA Primary School in Port Elizabeth has proven their mettle as a group of learners committed to sustainability and cleaning up their environment by emerging victorious in Plastics|SAâ&#x20AC;&#x2122;s annual Clean-Up and Recycle Competition. According to Jacques Lightfoot, Sustainability Manager at Plastics|SA, the aim of this yearly competition is to encourage, schools, organisations and the public to involve their friends, family and communities in a clean-up or recycling activity. â&#x20AC;&#x153;We required the entrants to supply us with a short report and photographs of their initiatives as part of our Clean-Up and Recycle SA Week activities,â&#x20AC;? Lightfoot said. This event was sponsored by

Plastics|SAâ&#x20AC;&#x2122;s Sustainability Council, 3LRQHHU3ODVWLFVDQG7XIĂ&#x20AC;H[DQG offered exciting prizes that were up for grabs, including cash prizes, a 6-seater picnic table and a 3-seater bench made from recycled plastics and a four-in-one recycling station. The school received as its prize an DZDUGFHUWLÂżFDWHDQGDEHQFKPDGH of recycled plastic which was placed in the Grade 1 area of the school to make the little ones aware of the schoolâ&#x20AC;&#x2122;s green emphasis. Vaalpark Primary came second in the Primary School Category, and Louise Van Tonder was named the winner in the Organisation Category. www.plasticsinfo.co.za


innovative thinking â&#x20AC;&#x153;Our future growth relies on competitiveness and innovation. We look forward to the new challenges and opportunities the next year will present to us. We are working and living in a space that is as unpredictable as it is dynamic.

However, this presents us with exciting new opportunities and possibilities as we continue to develop and grow the industry and position ourselves in a way that is in-step with international developments without losing focus of our African roots

and reality. With the help and support of our members, Plastics|SA will continue to actively grow and develop our market through passionately promoting the use of plastics as the material of choice,â&#x20AC;? Hanekom concluded.

The Plastics|SA board for 2017: Anton Hanekom, Wayne Wiid, Bernhard Mahl, Jeremy Mackintosh, Bob Bond, Fernando Lopes, Mxolisi Khutama, Daniel Schoeman and Mike Meyers

FEBRUARY / MARCH 2017

65


ASSOCIATION NEWS

/RFDOSODVWLFVFROOHFWRUV  Five new project partners to receive total of R5.5 million in funding support

32/<&2WKH3RO\ROH¿Q5HF\FOLQJ &RPSDQ\ 13& ZLOODVVLVW¿YHVXFFHVVIXO DSSOLFDQWVZLWKDWRWDOLQYHVWPHQWRI 5PLOOLRQWRH[SDQGWKHLUH[LVWLQJ VHSDUDWLRQFROOHFWLRQVRUWLQJDQGRU PHFKDQLFDOUHF\FOLQJIDFLOLWLHV6LQFHLW VWDUWHGRSHUDWLRQVLQ32/<&2KDV LQYHVWHGPRUHWKDQ5PLOOLRQLQEXLOGLQJ DQGH[SDQGLQJWKHORFDOSRO\ROH¿Q SODVWLFVUHF\FOLQJLQGXVWU\ ³(DUOLHUODVW\HDUZHLVVXHGD&DOOIRU 3URSRVDOVIRUVXSSO\FKDLQHI¿FLHQF\ SURMHFWVVSHFL¿FDOO\DLPHGDWH[LVWLQJ EXVLQHVVHVZKRFRXOGFRQWULEXWHWRWKH VXVWDLQDEOHJURZWKRIWKHFROOHFWLRQVRUWLQJ DQGPHFKDQLFDOUHF\FOLQJRISRO\ROH¿Q SODVWLF´H[SODLQHG0DQG\1DXGp&(2RI 32/<&2³:HZHUHORRNLQJIRUFROOHFWRUV DQGUHF\FOHUVZKRQHHGHGIXQGLQJWR LQYHVWLQQHZHTXLSPHQWLQRUGHUWRWDNH WKHLUEXVLQHVVWRWKHQH[WOHYHORIJURZWK´ $SSOLFDWLRQVZHUHUHFHLYHGIURPDURXQG WKHFRXQWU\PDQ\RIZKLFKZDQWHG IXQGLQJWRLPSOHPHQWQHZVHSDUDWLRQ DWVRXUFHSURJUDPPHVSXUFKDVH PLQRUHTXLSPHQWWRRYHUFRPHFXUUHQW VXSSO\FKDLQFRQVWUDLQWVRUIXQGLQJWR VXSSRUWFRPPXQLW\EDVHGSURMHFWVWR JURZVHSDUDWHGFROOHFWLRQYROXPHV

$IWHUDULJRURXVHYDOXDWLRQSURFHVV 32/<&2¶V%RDUGRI'LUHFWRUVDSSURYHG WKHDSSOLFDWLRQVIURP¿YHFRPSDQLHVZKR ZHUHEHVWDEOHWRPHHWWKHLUFULWHULDIRU IXQGLQJVXSSRUW32/<&2¶VLQYHVWPHQW LQWRWKHVHRSHUDWLRQVLVHLWKHUDRQFHRII ¿QDQFLDOJUDQWRUDQLQWHUHVWIUHHORDQ ZKLFKKDVWREHSDLGEDFNRYHUWKUHH \HDUV7KHUHSDLGIXQGVDUHXVHGWR IXQGRWKHUUHF\FOLQJDFWLYLWLHV 7XIÃ&#x20AC;H[ 7KLV*HUPLVWRQEDVHGUHF\FOHULVDZHOO NQRZQDQGHVWDEOLVKHGEUDQGLQWKHORFDO UHF\FOLQJLQGXVWU\VSHFLDOLVLQJLQUHF\FOLQJ GRPHVWLFDQGLQGXVWULDOSRO\PHUVLQWR XVDEOHSURGXFWVVXFKDVUDLOVOHHSHUV IXUQLWXUH$UPFREDUULHUXSULJKWV GHFNLQJIRUZDONZD\VDQGSDOOHWV 8QGHUWKHJXLGDQFHRIQHZRZQHU 3HWHU:DOGEXUJHU7XIÃ&#x20AC;H[KDVEHHQJLYHQ DQHZOHDVHRQOLIHZLWKDORWRIWLPH PRQH\DQGHIIRUWVSHQWRQUHMXYHQDWLQJ LWVIDFLOLWLHV'HVSLWHLWVVXFFHVVHV :DOGEXUJHUZDVFRQFHUQHGDERXWWKH FRPSDQ\¶VVROHUHOLDQFHRQWKHLUVXSSO\ RIFOHDQSRVWLQGXVWULDOIHHGVWRFNWR NHHSWKHLURSHUDWLRQVJRLQJ6KRXOGWKH VLWXDWLRQRFFXUZKHUHWKLVVXSSO\UXQVGU\

WKHFRPSDQ\ZRXOGKDYHQRDOWHUQDWLYH VXSSO\RIPDWHULDODQGEHOHIWYXOQHUDEOH ³7KDQNVWR32/<&2¶VLQWHUHVWIUHH ORDQZHDUHQRZDEOHWRLQYHVWLQD PXFKQHHGHGZDVKSODQWDQGVKUHGGLQJ FDSDFLW\WKDWZRXOGHQDEOHXVWRDOVR DFFHSWSRVWFRQVXPHUPDWHULDO&RPLQJ IURPKRXVHKROGVRURIIODQG¿OOVLWHV WKHVHSODVWLFVDUHRIWHQYHU\KHDYLO\ VRLOHGDQGQHHGWREHZDVKHGEHIRUH SURFHVVLQJ´:DOGEXUJHUVDLG /DQVHULD3ODVWLFV 3W\ /WG %DVHGLQ.\D6DQGV*DXWHQJ/DQVHULD 3ODVWLFVVSHFLDOLVHVLQUHF\FOLQJERWK +'DQG/'SODVWLFV2ZQHU+DQQHV8\V DQGKLVWHDPLGHQWL¿HGQHZPDUNHWVIRU WKHLUJURZLQJEXVLQHVVEXWQHHGHGWR HQVXUHDFRQVLVWHQWTXDOLW\RIUHF\FODWH 7KH\ZHUHDZDUGHGDQLQWHUHVWIUHH ORDQWREHVSHQWRQLQYHVWLQJLQQHZWHVW HTXLSPHQWWRHQVXUHDTXDOLW\SURGXFW ³%HLQJDEOHWRSURGXFHUHF\FOHG SRO\PHURIFRQVLVWHQWTXDOLW\ZLOODOORZ XVDFFHVVLQWRQHZHQGXVHPDUNHWV´ 8\VVDLG %:HVW&OHDQLQJDQG5HF\FOLQJ 3URMHFW&RRSHUDWLYH/LPLWHG 32/<&2KDVDZDUGHGDJUDQWWRWKLV

6$352ZRUNVKRSORRNVDWVXVWDLQDEOHUHF\FOLQJ

66

FEBRUARY / MARCH 2017

Discussion format provides interest for even seasoned recyclers 6$352¶V¿UVWFRQIHUHQFHRQSODVWLFVUHF\FOLQJLQ0LGUDQG ODVW\HDUµ6XVWDLQDEOH3ODVWLF5HF\FOLQJ¶ZDVDKXJHVXFFHVV $QQDEp3UHWRULXVWKH6$352FRQYHQHUJRWWKHSURFHVV JRLQJDWWKH%\WHV&RQIHUHQFH&HQWUHZLWKDQRYHUYLHZRIWKH VHFWRUµ5HF\FOLQJLQ6$WKH+DUG)DFWV¶$QGWKHIDFWVDUH LQGHHGKDUGDWSUHVHQWDIWHUYHU\SRVLWLYHJURZWKRYHUWKH SDVWIHZ\HDUVJHQHUDWHGPXFKRSWLPLVPIRUJURZWKYROXPHV KDYHXQH[SHFWHGO\SODWHDXHGRYHUWKHSDVWPRQWKV $VOLJKWO\GLIIHUHQWZRUNVKRSIRUPDWZDVWHVWHGIRUWKH

¿UVWWLPHZKLFKDSSHDUHGWREHDFFHSWHGIDYRXUDEO\E\WKH GHOHJDWHVHDFKWRSLFLQYROYHGWZRSUHVHQWHUV±HLWKHURQWKH RQHKDQGDUHF\FOHURUFRQYHUWHUDORQJZLWKRQWKHRWKHU DQDFDGHPLFUHVHDUFKHURUVXSSOLHU(DFKSUHVHQWDWLRQZDV IROORZHGE\DPLQXWHGLVFXVVLRQSDQHO 3HWHU:DOGEXUJHUIURP7XIÃ&#x20AC;H[3ODVWLF0DWHULDOVFRPPHQWHG WKDWKHOHIWZLWKDQRWHERRNIXOORIDGYLFHDQGSUDFWLFDO KLQWV+LVRQO\UHJUHWZDVWKDWKHGLGQRWEULQJKLVZKROH PDQDJHPHQWWHDPDORQJ

6$352FKDLUPDQ-DFR%UH\WHQEDFKZLWKVRPHRIWKHVSHDNHUVDWWKHHYHQW LQ0LGUDQGLQFOXGLQJ,DQ%DUQDUGRI5HF\FOLQJ0DWWHUVDQG5LFKDUG%LQJKDP RI3UHVWLJH7KHUPDO(QHUJ\ZKRWDONHGDERXWS\URO\VLV-RYDQ-DFREVRI 7ULR3HOOHWV<RODQGH%RWKDDQG/RXLVHYDQ%LOMRQRI*.'0LQLQJ ,QGXVWULDO 6HUYLFHVDQG3ULVFLOODU0DWKHRIWKH'7,,QFXEDWLRQ6XSSRUW3URJUDPPH

'DULXV-DFREVRI7ULR3HOOHWVRI9DQGHUELMOSDUN)UDQFRLV 0DUDLV3RO\&R5RHOLHQGX3OHVVLVRI/LIH$OODQG%DUHQG 9LOMRHQRI&XVWRP3RO\PHUVRI&KORRUNRS5RHOLHQJDYHD SUHVHQWDWLRQRQZKDWUHF\FOHUVVKRXOGNHHSLQPLQGZKHQ DSSO\LQJIRUDZDVWHOLFHQVH


 UHF\FOHUVJHWÃ&#x20AC;QDQFLDOERRVW small collector on the outskirts of Soweto. As with many of the smaller collectors, %:HVWKDGWR¿QGDZD\RIJHWWLQJWKHLU PDWHULDOVWRWKHUHF\FOHUV,QYHVWLQJLQ a new baler and scale will allow them to ZHLJKWKHFROOHFWHGPDWHULDODQGFRPSDFW into bales for economical delivery. â&#x20AC;&#x153;Thanks to POLYCOâ&#x20AC;&#x2122;s investment, I can JURZWKHFRPSDQ\DQGEHDQHYHQPRUH SURIHVVLRQDOFROOHFWRUDQGJLYHDPRUH DFFXUDWHUHSRUWRQRXUJURZWKYROXPHV´ said Johannes Brocherds of B-West. BB Plastic Solutions This medium-sized recycler, based in 1LJHOVWDUWHGLWVRSHUDWLRQVLQ$VD Peter and Riaan Steyn of NC Cluster Recycling

VXSSOLHURISHOOHWL]HGPDWHULDOWRWKHSODVWLFV UHF\FOLQJLQGXVWU\RZQHU%HUWXV%HFNHU QHHGHGIXQGLQJVXSSRUWLQRUGHUWRJURZ WKHLURSHUDWLRQVRWKDWLWLVDEOHWRSURFHVV ODUJHUYROXPHVRISRO\ROH¿QSODVWLFV 5HFRJQLVLQJWKHSRWHQWLDORIWKLV business, POLYCO has awarded an interest-free loan to BB Plastic Solutions for LQVWDOOLQJDQHZH[WUXVLRQOLQHDEDOHUDQG WHVWLQJHTXLSPHQW NC Cluster Recycling 7KLVUHODWLYHO\QHZSOD\HULQWKHUHF\FOLQJ LQGXVWU\1&&OXVWHU5HF\FOLQJEDVHGLQ WKH1RUWKHUQ&DSHZDVDZDUGHGDJUDQW WRLPSURYHWKHLUFROOHFWLRQVRISRO\ROH¿Q

Johannes Borcherds of B-West Cleaning and Recycling

recyclables in many of the smaller towns in this area. Until recently, these towns had very little or nonH[LVWHQWVHUYLFHOHYHOV ³2XUELJJHVWFKDOOHQJHWKXVIDUKDV EHHQHQVXULQJWKDWWKHZDVWHIURP DOPRVWWRZQVZHDUHFXUUHQWO\ VHUYLFLQJJHWVWUDQVSRUWHGTXLFNO\DQG HIIHFWLYHO\WRWKHUHF\FOHUVLQWKHELJJHU WRZQV7RGRWKLVZHGHVSHUDWHO\ needed to invest in trailers that could be hooked onto our trucks to almost double WKHORDGIRUHDFKWULS´VDLGRZQHU5LDDQ Steyn. www.polyco.co.za

Bertus Becker of BB Plastic Solutions

3HWHU:DOGEXUJHURI7XIÃ&#x20AC;H[

FEBRUARY / MARCH 2017

Locally manufactured, globally sought after synthetic rubbers since 1964 www.karbochem.co.za SALES AND MARKETING

Eastgate Office Park, Ground Floor, Block A South Boulevard, Bruma 2026, South Africa

T +27 (0)11 601 1660 F +27 (0)11 616 6651 E kbcinfo@karbochem.co.za

67


ASSOCIATION NEWS

Polystyrene recycling in SA exceeds expectations 0RUHWKDQWRQQHVRISRO\VW\UHQHGLYHUWHGIURPODQGÂżOO POLYSTYRENE recycling in South Africa has continued to grow in 2016 , contrary to international reports that labelled this versatile product as â&#x20AC;&#x2DC;challenging to recycleâ&#x20AC;&#x2122; and sometimes even as being unrecyclable. According to Polystyrene Packaging Council (PSPC)director, Adri Spangenberg, the Polystyrene reprocessing of expanded Packaging and high impact Council director, Adri polystyrene has increased Spangenberg by 106 % between 2013 and 2015 in South Africa. She attributes this to the fact that more end-markets were developed and knowledge spread about the fact that the material can successfully be reused in various different applications. Âł:HDUHVWLOODZDLWLQJWKHRIÂżFLDO UHF\FOLQJÂżJXUHVIRUEXWHDUO\ indications show that approximately 3 0 60 tons of recycled polystyrene were added WRWKHWUDGLWLRQDOUHF\FOLQJÂżJXUHVÂąPDNLQJ this our best year to date,â&#x20AC;? Adri said. â&#x20AC;&#x153;We have managed to prove that polystyrene can successfully be recovered from households and industries by working closely with waste management companies and municipalities. Moreover, our recycling projects are undoubtedly successful and yet another proof that South Africa is a truly unique country. We may be small, but we have our own way of doing things DQGKDYHDQDELOLW\WRÂżQGVROXWLRQVWR problems that the rest of the world might www.polystyrenepackaging.co.za 68

FEBRUARY / MARCH 2017

ÂżQGLQVXUPRXQWDEOH´VKHDGGHG Polystyrene is widely being used by Spaza shops, take-away vendors, cafeterias and supermarkets around the country due to the fact that it insulates food and beverages, protects food and contents, is cost-effective, lightweight and convenient. Although it is a single-use plastic item, it gets recycled into items that continue to improve lives and create jobs in a variety of different industries, ranging from building and construction, to picture frames, cornices and home dĂŠ cor, clothing hangers and stationery. â&#x20AC;&#x153;Last year alone, 2 036tons of polystyrene were successfully recycled for use in lightweight concrete through our Project Build,â&#x20AC;? Adri said. ilton Cowie of Greenlite H Concrete in Cape Town and H ennie Snyman of the Get Connected Group in Gauteng, the two biggest projects the PSPC currently supports, use recycled, post-consumer polystyrene for large commercial and residential construction projects around the country. â&#x20AC;&#x153;We needed to have hammer mills installed at both these premises last year to assist with the processing of the large volumes of polystyrene that are required for their construction projects. These mills are capable www.greenliteconcrete.co.za

of pelletizing 150kg of expanded polystyrene per hour in order to keep up with the demand,â&#x20AC;? Adri explained. Another area that has seen impressive growth in the amount of recycled polystyrene used is the home dĂŠ cor market. More than 1 377 tons of expanded and high impact polystyrene were recycled last year for use in picture frames, cornices and curtain rods through the PSPCâ&#x20AC;&#x2122;s Project Dè cor. Looking ahead at 2017, the PSPC will continue to promote the use and the recycling of polystyrene to South Africans of all walks of life. Hilton Cowie of Greenlite Concrete with the hammer mill sponsored by the PSPC


6$9$FRQÃ&#x20AC;UPVH[FLWLQJVSHDNHUVIRU

9LQ\OV6$&RQIHUHQFH

Dave Moore: 083 675 8325 Email: mouldbasesa@gmail.com

STANDARD FEATURES â&#x20AC;¢ High speed injection without accumulator â&#x20AC;¢ High rigidity clamping unit â&#x20AC;¢ Low power consumption per Kg conversion rate â&#x20AC;¢ Yizumi offers professional in-house mould making for thin walled product and all standard PET preforms. â&#x20AC;¢ We can supply full electric, large two platen, high speed packing and preform machines. Contact Dave for a brochure pack to be sent to you. Click on the QR code on the right to watch a video of a PAC 300 operating.

MOULD BASE SA Dave Moore: 083 675 8325 | www.mouldbasesa.co.za

69

www.savinyls.co.za

FEBRUARY / MARCH 2017

,QVWLWXWHIRU6XVWDLQDELOLW\/HDGHUVKLS &,6/ ZKR TH E Southern African Vinyls Association (SAVA) KDVFRQ¿UPHGWKUHHRIWKHZRUOG¶VOHDGLQJ ZLOOEHGHOLYHULQJWKHNH\QRWHDGGUHVV H[SHUWVRQ39&DVVSHDNHUVDKHDGRILWV9LQ\O ,DQ/LOMD±9LQ\O&RXQFLORI$XVWUDOLD 9&$  SA 2017 Conference on 7 June at the H ilton  ZKRZLOOEHGHOLYHULQJDQXSGDWHRQWKH9&$ +RWHOLQ6DQGWRQ-RKDQQHVEXUJ  3URGXFW6WHZDUGVKLS3URJUDPPH $FFRUGLQJWR6$9$&(2'HODQLH 'U%ULJLWWH'HUR±JHQHUDOPDQDJHURIWKH %H]XLGHQKRXWWKLV\HDU¶VHYHQWZLOOEXLOGRQWKH European Council for Vinyl Manufacturers VXFFHVVRIWKH$VVRFLDWLRQ¶V¿UVW9LQ\O6$  DQG9LQ\OV3OXVZKRZLOOEHSURYLGLQJDQH[SHUW &RQIHUHQFHWKDWWRRNSODFHRQWKHEDFNRIWKH  RYHUYLHZRIWKH(XURSHDQ5HJXODWRU\DQG *OREDO9LQ\OV&RXQFLO¶V *9& ¿UVWELDQQXDO Policy Context PHHWLQJKRVWHGRQWKH$IULFDQFRQWLQHQW  *HUKDUG.XKQ±VHQLRUHFRQRPLVWDWWKH,'& Peter Willis ³2XU¿UVWFRQIHUHQFHDWWUDFWHGPRUHWKDQ  ZKRZLOOEHORRNLQJDWWKH6RXWK$IULFDQ GHOHJDWHVIURPDURXQGWKHFRXQWU\DQGDVIDUD¿HOG HFRQRP\DQGWKHYDULRXVRSSRUWXQLWLHVDQGFKDOOHQJHVLW DV$UJHQWLQD/LNHWKH¿UVWHYHQWGHOHJDWHVZKRZLOOEH SUHVHQWVIRUWKHORFDO39&LQGXVWU\ DWWHQGLQJWKLV\HDU¶VHYHQWFDQDJDLQORRNIRUZDUGWRDIXOO 5HQLHU6Q\PDQ±'3,3ODVWLFV6$%6"6$16"6$7$6" DQGYDULHGSURJUDPPHRIRULJLQDOSDSHUVDQGSUHVHQWDWLRQV 1DYLJDWLQJWKHZRUOGRIVWDQGDUGV E\YLVLWLQJLQWHUQDWLRQDODQGORFDOH[SHUWVZKRZLOOEHVKDULQJ $KLJKOLJKWRIWKHFRQIHUHQFHZLOOEHDQDZDUGVVHVVLRQ WKHVWDJHDQGWKHLUH[SHUWLVHRQYDULRXVPDWWHUVUHODWLQJWR ZKHUH6$9$ZLOOUHFRJQL]HWKHDFKLHYHPHQWVDQG PDQXIDFWXULQJXVHDQGUHF\FOLQJRI39&´'HODQLHVDLG FRQWULEXWLRQVPDGHE\LQGLYLGXDOVDQG6$9$PHPEHU FRPSDQLHVZLWKLQWKH39&LQGXVWU\ Local and international PVC experts share the stage 6$9$KDVLVVXHGDFDOOIRUSDSHUVWRWKH39&LQGXVWU\ ³7KLV\HDUVHYHUDORIWKHZRUOG¶VOHDGLQJH[SHUWVZLOOEH DQGFRQIHUHQFHRUJDQLVHUVDUHFXUUHQWO\ZRUNLQJWKURXJKWKH UHWXUQLQJWR6RXWK$IULFDWRSUHVHQWWKHLUODWHVW¿QGLQJVDQG VXEPLVVLRQV7KH¿QDOSURJUDPPHZLOOEHUHOHDVHGLQ$SULO UHVHDUFKDVLWUHODWHVWR39&´'HODQLHVDLG&RQ¿UPHG /DWHVXEPLVVLRQVZLOOEHDFFHSWHGLIWKHFRQWHQWLVWRSLFDO VSHDNHUVIRUWKH9LQ\OV6$FRQIHUHQFHLQFOXGH 3HWHU:LOOLV±VHQLRUDVVRFLDWH8QLYHUVLW\RI&DPEULGJH UHOHYDQWDQGSUHVHQWVDQGLQWHUHVWLQJSRLQWRIYLHZ


PEOPLE

New MD for BASF in South Africa BASF has appointed Benoit Fricard as Managing Director of BASF South Africa and Country Cluster Head for Southern Africa. Fricard, who holds a Betriebswirt (FH) Diploma and a Masterâ&#x20AC;&#x2122;s Degree in Economics as well as a MBA, joined the organization in 2002 and has demonstrated exemplary leadership skills in each position he has held â&#x20AC;&#x201C; most recently as Director of Performance Materials, BASF South America. In 2016 BASF has reorganized its market area focus on the African continent. African operations have been divided into four country clusters, Southern Africa; East Africa; West Africa and North-West Africa. As Country Cluster Head for Southern Africa, Fricard will lead the operations in the region focusing the strategic plan for

operational excellence, and local customer centricity He is based at the BASF RIÂżFHVLQ0LGUDQG6RXWK$IULFD BASF was established in South Africa, which is the hub into Sub-Saharan Africa, 50 years ago. Headquartered in Midrand, Johannesburg, the BASF Group in South $IULFDFRQVLVWVRIÂżYHFRPSDQLHVZLWK main locations in Johannesburg, Durban, Port Elizabeth and Cape Town. BASF KDVÂżYHSURGXFWLRQVVLWHVLQFOXGLQJD world-class automotive emissions catalysts production site in Port Elizabeth and a dispersions production plant located in Durban, which produces and exports acrylic dispersions. Other sites include a construction chemicals production site in Westonaria and an industrial coatings site in Vander-

Benoit Fricard, MD of BASF South Africa and Country Cluster Head for Southern Africa

bijlpark. Since 2013, BASF Agricultural Specialties (formerly Becker-Underwood) in Durban, also forms part of the South African EXVLQHVVSURÂżOH%$6)KDVDVWDIIFRPSOH ment of around 1000 people in South Africa. In 2015 BASF Zambia Ltd, a sales organization, with focus on the agriculture and mining business, was inaugurated in Lusaka, Zambia. www.basf.co.za

ROCCIâ&#x20AC;&#x2122;s the road to success for Buzz Top awards for Buzz Trading from Roodepoort Chamber of Commerce & Industry BUZZ Trading 104 was recently named the overall 2016 Business of the Year gold winner in the manufacturing category by the Roodepoort Chamber of Commerce & Industry (ROCCI). And the Germiston LQMHFWLRQPRXOGLQJEXVLQHVVÂśVÂżQDQFLDO manager Petro Nel walked away with the gold award for the 2016 Business Woman of the Year. Roodepoort Chamber of Commerce & Industry seeks to identify and

acknowledge businesses who have achieved success and who truly embody the spirit of enterprises. With 30 years of unsurpassed growth in the Business of the Year Awards, ROCCI honour businesses whose hard work and innovation have created successful business ventures, elevating them to be recognised for these achievements. Buzz Trading started just 13 years ago with a single machine and a single

Petro and Dewald Nel started Buzz Trading in 2004

The Buzz Trading team at the ROCCI awards ceremony

product. It has expanded to the point where it runs close to 30 injection moulding machines, including several large machines of over 1000 tons capacity, and operates from its own 8000m² premises in Germiston. When the owners, Dewald and Petro Nel, started the company in 2004 producing rake heads, they applied some simple strategies which have seen the company grow steadily. Buzz has expanded its product UDQJHVLJQLÂżFDQWO\LWQRZSURGXFHVYDULRXV housewares, furniture, basins/buckets, laundry baskets, hangers and even rice spoons. One of Buzzâ&#x20AC;&#x2122;s cornerstones is its guarantee to supply any customer in southern Africa within KRXUV2SHUDWLQJLWVRZQĂ&#x20AC;HHWKDVEHHQ a big factor in this respect, enabling Buzz to supply customers across southern Africa within two days of ordering. Buzz is processing over 600 tons a month, with the bulk of the material being recycled HD and PP. The factory runs at a production rate of 98% with a scrap rate of just 1.2%.

www.buzztrading104.co.za

70 FEB / MARCH 2017


Rapid Granulator appoints new distributor for SA RAPID Granulator AB, the Swedishbased world leader in plastics granulation technology, has signed up FdB Consulting, Johannesburg, as its sole distributors for the South Africa and Sub-Sahara Market, effective from 15 December 2016, “It’s great to see a new distributor in the South African market,” said Rapid Group CEO Bengt Rimark. “In spite of the current economic turmoil, the plastics industry in the region remains strong and innovative, and with this recent appointment we will be able to further expand our footprint in South Africa. FdB Consulting has, through Frank Blues, more than 20 years’ experience in the plastics processing industry and several years with Rapid’s products. This will guarantee the best possible service and support for the users and operators of our granulator and shredders.” FdB Consulting was formed in 2015 by Frank Blues to cater for certain elements in the plastics market. Frank has over \HDUV¶H[SHULHQFHLQWKHSODVWLFV¿HOG and has been involved in the plastics

manufacturing industry. $VDTXDOL¿HGWRROPDNHUDQGPHFKDQLFDO engineer his technical knowledge goes a long way toward providing customers with solutions to their manufacturing processes and a hands-on capability. Having been involved directly with Rapid Granulator for over the last four years he has assisted customers who have stressed their satisfaction about the reliability and design of Rapid Granulators. Service and support facilities are in place to help customers get the best out of their machinery, and certain clients have already been signed up on Service Level Agreements (SLA’s) FdB Consulting is in the process of signing additional partnership agreements with a number of ancillary equipment suppliers to complement their range of suppliers.

“Our customers have always stressed how happy they are with the reliability, superior design and build quality of their Rapid Granulators,” said Frank Blues, MD of FdB (on the right) together with Rapid Group CEO, Bengt Rimark PHOTO: RAPID GRANULATOR AB

• Frank Blues, tel +27 (0)82 651 3315, frank@fdbconsulting.co.za

www.rapidgranulator.com FEB / MARCH 2017 71


PEOPLE

People on the move

Grant Matthews has been appointed general manager of Alpla South Africa, running the Austrian groupâ&#x20AC;&#x2122;s blow moulding plant in Spartan, Johannesburg. One of only a few people who has worked at managerial sales level for most of South Africaâ&#x20AC;&#x2122;s top converting groups (including Nampak, MCG and Astrapak â&#x20AC;&#x201C; somehow missing out on Mpact), Grant brings considerable experience to the position, picked up over more than 20 years in the SA converting sector. He takes over from Javier Delgado, the Spaniard who managed the set-up of the Alpla plant over the past three years; Javier has recently taken up a post with Alpla in the Middle East. Clement Makhoro has joined Motherson South Africa, based at the companyâ&#x20AC;&#x2122;s injection and vacuum forming plant in Rosslyn, Pretoria. He was formerly one of the trainers at PlasticsSA in KZN, where he has instructed for the past eight years, and has now relocated to Gauteng. Clement has been appointed assistant manager: process engineering for the Indian-owned multinational automotive component manufacturing businessâ&#x20AC;&#x2122; Gauteng operation. Alan Wassung has joined West African Groupâ&#x20AC;&#x2122;s plastics team in the capacity of technical consultant. Alan has been involved in the polymer supply industry for many years, and the fact that he started in the converting sector has proved DQDGYDQWDJHKHÂżUVWZRUNHGDW'5* Plastics, where quite a number of todayâ&#x20AC;&#x2122;s company owners and managers cut their teeth, as well as in tyre manufacturing

at Dunlop Sydney Road as a mill room technician. He got into material supply at Esso Chemicals in 1982, working as solvents technical sales representative and then progressed to product manager, stewarding intermediates and phthalates into the PVC industry. Following Exxonâ&#x20AC;&#x2122;s divesture from SA in 1986, Aktol Chemicals continued the business representing Exxon Chemicals to industry. In 1992 Aktol was acquired by Engenâ&#x20AC;&#x2122;s Special Products division and Alan became polymer product manager, stewarding butyl rubber, EPDM and related HMA products into the adhesive industry. He â&#x20AC;&#x2DC;retiredâ&#x20AC;&#x2122; in 2010 but was semiobligated to continue when Polysaf, then DJHQWIRU([[RQ0RELOÂśVSRO\ROHÂżQSURGXFWV required his services to help establish Vistamaxx, within the compounding and converting industry. The unique qualities of Vistamaxx, a highly amorphous material, are used in a diverse variety of end applications. This Includes opportunities IRUFRQYHUWRUVWRDGYDQFHÂżOPVHDODELOLW\ impact strength improvement for injection moulding and exciting compounding opportunities. Alan, 69, now supports the WAG sales personnel with applications where the various Vistamaxx grades help improve both production and performance. Donnie Loubiere is the new MD of Orion Engineered Carbons in Port Elizabeth, as from September 2016. Donnie is originally from Louisiana, a chemical engineering graduate from the Louisiana State University. He has 37 yearsâ&#x20AC;&#x2122; experience in the carbon black industry. Also at Orion, Sipho Ngcobo joined in July last year DVWKHQHZÂżQDQFHPDQDJHUDWWKH3RUW

Grant Matthews has been appointed GM of Alpla South Africa

Clement Makhoro has joined Motherson in Rosslyn

Elizabeth plant. Sipho is a B.Com Honours Management Accounting, CIMA graduate, and his background includes experience DVDÂżQDQFLDO&RQWUROOHUZLWK$IUL6DP DVÂżQDQFLDOPDQDJHUJURXSZLWK$QJOR American and accountant at Amalgamated Beverage Industries. Another recent appointment at Orion is Roland Loganathan as operations manager who started with the Port Elizabeth plant in October 2016. Roland has a Masterâ&#x20AC;&#x2122;s degree in Technology. His background includes head of operations at African Pulp & Paper, operations manager at Air Liquide and senior production manager at Sappi. Sunneal Shah has been appointed as Technical Specialist in the Performance Materials Division of BASF, Country Cluster Southern Africa. His responsibility extends into the automotive, footwear & furniture sectors. Sunneal, has extensive experience in polymers ranging from rubber, plastics & polyurethane (both moulded & slabstock technologies). He was previously with the Feltex Automotive group for an extended period, during which time he had various roles in Wayne Rubber, Autoneum (Rieter), Feltex Fehrer and Feltex Foam. Prior to this Sunneal also worked at Dunlop Tyres (both Ladysmith and Durban factories) and Aberdare cables. His experience in the diverse technologies and industry sectors provides an ideal platform for the new venture with BASF. Sunneal can be contacted on +27 (0)79 880 0285. He takes over from Darran Berry, who has moved with BASF to Dubai. Darran, who was based in Durban, is now responsible for business development in the construction sector for the Middle

Varsity dedicated to plastics industry To offer B Tech, M Tech courses from 2018 A plastics research university, claiming to be completely paperless and eco-friendly, is slated to be built soon at Vapi in Gujarat, India, with support of the state government. The Plastindia International University, to be constructed on a 37-acre campus at Vapi, is expected to start from the 2018 academic year and have four-year B 72 FEB / MARCH 2017

Tech, two-year M Tech and doctorate programmes. According to the Indian Express newspaper, the university would also conduct several shortduration management development programmes. The varsity is sponsored by Plastindia Foundation, an apex body of the countryâ&#x20AC;&#x2122;s plastic industry.

It will be a completely paperless, ecofriendly, modern and research-driven university dedicated to one sector. It will feed talent to the Indian plastics sector, which has over 50,000 manufacturing units. The university would also create specialised managerial and technical talent for the sector.


Alan Wassung has joined West African Group

East/North Africa region (polyurethane applications in road, rail, wind and water). Also now in Dubai with BASF is Andrew Bailey, who has been transferred from Nigeria to the Gulf megapolis too.

New account manager for Dow Southern Africa

background â&#x20AC;&#x201C; combined with my sales DQGPDUNHWLQJH[SHULHQFHÂąZLOOEHQHÂżW ambitious companies in this really exciting region,â&#x20AC;? he said. Mudaly joins Dow â&#x20AC;&#x201C; which operates a portfolio of specialty chemical, advanced materials, agro-sciences and plastics businesses supporting customers in approximately 180 countries â&#x20AC;&#x201C; from Croda Chemicals, where he worked for the polymer additives and coatings business before progressing to sales manager of performance technologies and industrial chemicals. He has also held sales and product management roles at Metrohm, a Swiss laboratory instrumentation company, and began his career as a QC chemist in the nuclear industry. He is based in Dowâ&#x20AC;&#x2122;s Johannesburg RIÂżFH

Keith weighs Anchor Itâ&#x20AC;&#x2122;s farewell to Keith Marshall of Anchor Chemicals, who has decided to call it a day and set out on the next stage of his life, in retirement. Originally from 1HZFDVWOHLQ(QJODQG.HLWKTXDOLÂżHG at the National College of Rubber

Malan Mudaly is the new Southern Africa account manager for Dowâ&#x20AC;&#x2122;s packaging and specialty packaging business

Technology in Holloway, London, and came out to Africa â&#x20AC;&#x201C; like so many others â&#x20AC;&#x201C; for four years â&#x20AC;Ś and is still here 44 later. He started in the rubber industry, by accident, as a lab assistant at George Angus Oil Seal Division and never left the industry, also like so many others. His next appointment was as factory manager at Anchor Chemicals where, seven years later, he became something of an ISO implementation fundi, putting ISO 9001, ISO 14001 and OHSAS 18001 (now ISO 45 001) programmes in place. He was then given the opportunity to be group SHERQ manager for Hobart Enterprises (the group which owns Carst & Walker and Anchor Chemicals). Âł$WÂżUVW,ZDVUHOXFWDQWEXWDV,JRW into it I was privileged to work with some tremendous people around the world and as a team we put ISO 9001 into nine plants,â&#x20AC;? said Keith, adding the parting shot: â&#x20AC;&#x153;Companies must realize that their greatest asset is people, and treat them as such â&#x20AC;&#x201C; the new version of ISO 9001:2015 recognises this.â&#x20AC;? Keith and his wife are now enjoying a more relaxed lifestyle in KZN, well done!

SABIC donates container classroom SABIC South Africa sponsored a container classroom and presented it as a gift to the Willows Primary School in Heideveld in Cape Town in December. Part of SABIC groupâ&#x20AC;&#x2122;s community upliftment programme, the container is intended as a playroom for young pupils where they can get the opportunity to draw and enjoy the learning experience and environment. Desks and chairs were included in the donation

FEB / MARCH 2017 73

Dow Chemical Company has appointed Malan Mudaly as Southern Africa account manager for its packaging and specialty packaging business, supporting the companyâ&#x20AC;&#x2122;s plans for growth in this dynamic region. Mudaly has a Pure & Applied Chemistry degree from the University of KwaZulu-Natal as well as a degree in marketing management from the Johannesburg-based IMM Graduate School. â&#x20AC;&#x153;Dowâ&#x20AC;&#x2122;s packaging and specialty plastics business offers a vast array of technical innovations designed to improve consumer convenience, support groundbreaking design in multiple sectors, and of course drive sustainability in plastic SDFNDJLQJDQG,KRSHP\VFLHQWLÂżF

Sunneal Shah has joined BASF


PEOPLE

3RO\Ă RUSDUWQHUV with Carte Blanche 3RO\Ă&#x20AC;RU6$GRQDWHGDP2YLQ\OĂ&#x20AC;RRUIRUXVH in the creation of an Infant High Care Ward at the Sebokeng Hospital PHOTOS: MNET

Making a difference at Sebokeng Hospital POLYFLOR SA was once again in the privileged position to assist Carte Blanche with their â&#x20AC;&#x2DC;Making a Differenceâ&#x20AC;&#x2122; campaign by donating a 780m2YLQ\OĂ&#x20AC;RRUIRUXVHLQ the creation of an Infant High Care Ward at the Sebokeng Hospital. According to Tandy Coleman, CEO RI3RO\Ă&#x20AC;RU6$WKLVZDVWKHWK\HDU that the company has been involved in this campaign which aims to equip and renovate Paediatric Operating Theatres, ICUs and High Care Wards in selected state academic hospitals throughout South Africa. â&#x20AC;&#x153;Supplying hospitals and healthcare facilities with top quality and specialist vinyl Ă&#x20AC;RRULQJVROXWLRQVLVRQHRIRXUDUHDVRI expertise. For this reason we were very excited to partner with the Carte Blanche 0DNLQJD'LIIHUHQFH7UXVWWKHÂżUVWWLPHWKH\ approached us for a corporate sponsorship many years ago. We saw it as an ideal

opportunity to give something back to the community and to help make a lasting and tangible difference where it was most needed,â&#x20AC;? Tandy said. The Sebokeng hospital is an 800 bed, peri-urban, regional hospital situated in Sedibeng (south of Johannesburg) that historically served a population of well over 1 million inhabitants. With the only Neonatal Unit in the area, Sebokeng Hospital delivers vitally important service for the whole district. Rudolf Roos of the Hospital Design Group was the architect in charge of the UHQRYDWLRQSURMHFW+HVHOHFWHG3RO\Ă&#x20AC;RUÂśV Homogeneous Mystique sheeting for the XQLW$PRGHUQORRNLQJYLQ\OĂ&#x20AC;RRUWKDWZDV aesthetically pleasing was high on the project coordinatorâ&#x20AC;&#x2122;s wish list. â&#x20AC;&#x153;Modern healthcare design is about creating homely, relaxed environments for patients, staff and visitors. The choice

Change in management structure at Rawmac

RIĂ&#x20AC;RRUFRYHULQJFDQKDYHDPDMRULPSDFW RQWKHÂľIHHOÂśRIDKRVSLWDO9LQ\OĂ&#x20AC;RRULQJQRW only looks beautiful, but also offers one of the best environmentally sustainable RSWLRQVLQĂ&#x20AC;RRULQJ%HFDXVHLWFRPHV in a sheet form, it provides a hygienic, impervious surface which is critical in the healthcare environment,â&#x20AC;? Tandy explained. 7KHLQVWDOODWLRQRIWKHGRQDWHGĂ&#x20AC;RRUE\ 3RO\Ă&#x20AC;RUZDVIDFLOLWDWHGE\7XUQHU3LHUVRQDW a special rate. Âł/RRNLQJDWWKHÂżQLVKHGSURMHFWDQG seeing what a difference this project has made, we are immensely proud of being associated with a group of South Africaâ&#x20AC;&#x2122;s leading businesses who believe in the future of our country and donâ&#x20AC;&#x2122;t shy away from the opportunity to do good,â&#x20AC;? Tandy added. ZZZSRO\Ă&#x20AC;RUFR]D

Interest in Lindeâ&#x20AC;&#x2122;s basic injection system

74 FEB / MARCH 2017

WIM Goebel, founder and owner of Rawmac, has handed over the business management side of the company after 37 years. Taking over as managing director is Herman Botes who has been with Rawmac for the past 21 years. Wim will remain thoroughly involved with Rawmac as director and chairman. Anna Mohale and Gertie Scheepers are also directors at the company. Established in 1980, this Heriotdale-based plastic materials import and export distribution company has been servicing the entire country through their branches in Cape Town, Durban and Port Elizabeth. RAWMAC has for the past two years been registered as a B-BBEE empowerment company.

Wim Goebel with Herman Botes; Herman is now MD of Rawmac, with Wim as director and chairman

Lionel Linde of the Lindmann Engineering (right) showed his basic injection moulding system at a recent networking function presented by the Western Cape Tooling Initiative in Cape Town. Stellenbosch University engineering students Dewald Burger, Pieter de Wet and Francois Oberholzer received a quick training session on the machine. The system is very basic, functioning by compressing (twisting) and heating plastic bags, melting the material in a small barrel and then injection moulding items such as plugs. Upgrades could see the system become more effective and be used in the informal sector, which in fact is one of the objectives of the WCTI â&#x20AC;&#x201C; to help facilitate entrepreneurs in the informal sector who wish to manufacture goods â&#x20AC;Ś and hopefully to use this as the springboard for growth and development

www.lindmann.co.za


All the graduates - Lerato Loate Percy Mkhabele and Kelebogile Mkhabele

Kurt Schovell, Group HR Director at Boxmore

Boxmore invests in talent pipeline, addressing skills shortage Implemented an internship programme that aims to upskill graduates BOXMORE Packaging is committed to investing in youth and education as part of its strategic corporate investment in talent and skills development. Having partnered with The Experience Factory during 2016, the manufacturer has implemented an internship programme that aims to upskill graduates. Following a threeâ&#x20AC;&#x201C;week empowerment course to learn about soft skills, leadership skills, work and social etiquette, management skills, public speaking and presentation skills, three individuals joined Boxmore as paid interns in September 2016 to apply their knowledge in a real working environment within a six month programme. Kelebogile Mkhabele, Lerato Loate and Percy Mkhabele underwent an extensive LQWHUYLHZSURFHVVWRÂżQDOO\EHDSSRLQWHG by Boxmore. Kelebogile is currently ZRUNLQJLQVDOHV/HUDWRLQÂżQDQFHFRVW accounting and Percy in logistics. These graduates are monitored and mentored on the appropriate work related skills that will groom them as potential fulltime employees for the business at the end of the programme.

Commenting on the Boxmore partnership, Reinoud Willemsen, the founding partner of The Experience Factory said, â&#x20AC;&#x153;Boxmore is a brave and progressive business that truly wants to contribute to the industryâ&#x20AC;&#x2122;s talent pipeline. We started the discussions with Boxmoreâ&#x20AC;&#x2122;s Group HR Director, Kurt Schovell a year prior to the graduate appointments. The process was thorough and set the foundation to build a legacy of youth development at grassroots level.â&#x20AC;? In May 2016 this year, The World Economic Forum on Africa took place addressing South Africaâ&#x20AC;&#x2122;s skills shortage. The statistics revealed a 27% unemployment rate, â&#x20AC;&#x153;with even higher rates for youth, at more than 50%â&#x20AC;?. These staggering facts put the spotlight on skills development and while there are educated individuals in the market, they WHQGWRODFNÂłFRPSOH[SUREOHPVROYLQJ skills, critical thinking, good judgment DQGGHFLVLRQPDNLQJDVZHOODVFRJQLWLYH Ă&#x20AC;H[LELOLW\´7KLVSRLQWVWRWKHQHFHVVLW\IRU these individuals to have the opportunity to be mentored and gain real, practical experience.

â&#x20AC;&#x153;As part of the internship, the graduates participate in a Personal Development Programme, which is run by The Experience Factory and sponsored by Boxmore,â&#x20AC;? added Pumla Ncapai, MD of The Experience Factory. She continued, â&#x20AC;&#x153;This provides the individuals with a platform for continuous development, shared peer learning and access to external mentors.â&#x20AC;? â&#x20AC;&#x153;Working with The Experience Factory means we get to help close the gap between a trained graduate with sound technical skills and knowledge, and being ZRUNUHDG\IRUWKHMREPDUNHW,WÂśVZRQGHUIXO to be able to offer the platform for the graduates to unlock their full potential and gain experience beyond what is organically accessible to them. Boxmore has always EHHQVRFLDOO\FRQVFLRXVDQGUHVSRQVLEOH towards its surrounding communities. We aim to make a positive and sustainable difference and hopefully inspire the industry at large to collaborate and invest in talent, too,â&#x20AC;? Schovell added.

www.boxmore.co.za

Indiaâ&#x20AC;&#x2122;s government to print plastic currency note The Indian government informed Parliament in December that one billion plastic notes of 10-Rupee GHQRPLQDWLRQZRXOGEHLQWURGXFHGLQDÂżHOGWULDOLQÂżYHFLWLHVVHOHFWHGIRUWKHLUJHRJUDSKLFDO and climatic diversity. The selected cities were Kochi, Mysore, Jaipur, Shimla and Bhubaneswar. Procurement of material has started. â&#x20AC;&#x153;It has been decided to print banknotes based on plastic or polymer substrate. The process of procurement has been initiated,â&#x20AC;? Minister of State for Finance Arjun Ram Meghwal said in a written reply in Lok Sabha to a query whether RBI proposes to print plastic currency notes in place of paper ones. The Reserve Bank for long has been planning to ODXQFKSODVWLFFXUUHQF\QRWHDIWHUÂżHOGWULDOV FEB / MARCH 2017 75


BOOKS

Political instability, security concerns donâ&#x20AC;&#x2122;t prevent growth in GCC

United Arab Emirates 22%

www.amiplastics.com

KSA and UAE account for 83% of polymer demand in GCC COMPARED with other parts of the Middle East the Gulf Cooperation Council has not been as severely affected by the Syrian crisis, whilst free trade and investment incentives have seen infrastructure increasingly grow and a growing services sector contribute more to the economy, counteracting the impact of low oil prices. Saudi Arabia and the United Arab Emirates account for 83% of the plastics processed in the region with a high demand for commodity polymers whilst engineering polymers demand remains very low at less than 1% of total polymer demand in the region. Even the smaller countries of Bahrain, K uwait, Oman and Q atar exhibit growth and potential. In particular, the 2022 World Cup in Q atar has created major FRQVWUXFWLRQSURMHFWVEHQHÂżWWLQJWKH plastics industry. Combined with the World Expo in Dubai 2020 and ongoing residential construction across

the region, it is easy to see why the plastics processing industry in the GCC is Saudi Arabia Bahrain expected to be stronger than 61% 2% the rest of the tons for 2016 . Kuwait Further evidence for this 4% stable market is rising incomes Oman and reduced unemployment 8% Qatar that will continue to drive 3% demand for a large amount Š Applied Market Information Ltd., 2016 of consumer and household Saudi Arabia and the UAE (Dubai) comprise the major share goods and appliances. of Persian Gulf polymer demand, which is closing in on the The region is now moving 5 million tons p/a mark onto the next stage of its has recently released the latest version development programme, with a special of its database of P â&#x20AC;&#x2DC; lastic Processors in focus on downstream industries and the GCCâ&#x20AC;&#x2122;, the most comprehensive and plastics conversion. Leading the way reliable guide to over 470 production are Saudi Arabia and the UAE which sites across the region. The database have introduced a series of initiatives to provides contact information, processes boost growth of small and medium-sized operated, polymers used, polymer industries S ( MEs)for plastics processing. consumption, markets served and some Documenting the development of machinery information. plastics processing in the region, AMI

Market Plastic Study: Injectio n

Sparkling revenues Global demand for injection moulding plastics to increase by 3.7% per year until 2023

76 FEBRUARY / MARCH 2017

for the regions Western Europe, Eastern :25/':,'(DOPRVWPLOOLRQWRQVRISODVWLFVDUHOLTXHÂżHG (XURSH1RUWK$PHULFD6RXWK$PHULFD$VLD every year, and then injected into various moulds, and after 3DFLÂżFWKH0LGGOH(DVWDQG$IULFD FRROLQJUHPRYHGDVDÂżQLVKHGSURGXFW0DUNHWUHVHDUFK The study also provides market data for company, Ceresana, has published a study on the world the 16most important countries d ( emand market for plastics for injection moulding. and revenues). Demand is analysed in In 2015, about 54% of the plastics used for injection detail split by several application areas PRXOGLQJZHUHXVHGLQWKHUHJLRQ$VLD3DFLÂżF1RUWK$PHULFD and Western Europe followed with market shares of 15.4% and and product types. It also thoroughly examines the application areas for plastics for injection moulding: packaging, 14.3%. The most important sales market for injection moulded construction industry, transportation, electrical and electronics, products is the packaging industry which mainly protects food industrial products, other applications. These sales markets with these: containers, cans, mugs, bowls, boxes, and closures are split by both the world regions and the most important of any kind. The second largest - and fastest growing - sales countries. Furthermore, demand for the particular plastic types market is the transportation industry which for example uses VSOLWE\DSSOLFDWLRQDUHDVLVJLYHQ7KHÂżQDOFKDSWHUGHDOVZLWK injection moulding for dashboards, bumpers, and headlights. demand for the particular types of plastics: polypropylene Analysts of Ceresana expect global demand in this application P ( P), polyethylene L ( DPE, LLDPE, D HPE), polyamides area to increase by 3.7% per year until 2023. P ( A), acrylonitrile butadiene styrene A ( BS), polystyrene P ( S), The study provides a presentation and analysis of the global polycarbonate P ( C), other types of plastics. market for plastics for injection moulding - including forecasts up to 2023. Data on demand and revenues are analysed www.ceresana.com/en/market-studies/industry/plastic-injection/

White paper on global trends, investments in PE & PP 32/<(7+</(1(DQGSRO\SURS\OHQH continue to be the worldâ&#x20AC;&#x2122;s leading WKHUPRSODVWLFSRO\ROHÂżQVLQWHUPVRI market size. Despite ongoing volatility and uncertainty worldwide, there is clearly no debate over whether it pays WRLQYHVWLQSRO\ROHÂżQV In a whitepaper, Fabrizio Galiè , ICIS senior consultant and global lead for polymers insight, provides the critical factors to consider for your planning.

Referencing data from the ICIS Supply and Demand Database, the whitepaper covers regional highlights, an overview of recent trends in SRO\ROHÂżQV 33DQG3( VXSSO\DQG demand outlook, emerging challenges and investments affecting the markets. The paper enables subscribers to gain a long-term view of the rapidly changing petrochemicals markets, offering quick access to data on import

and export volumes, plant capacities, SURGXFWLRQDQGSURGXFWWUDGHĂ&#x20AC;RZV Download the whitepaper at www.icis.com/contact/global-trendsand-investment-opportunities-inpolyethylene-and-polypropylenemarkets/? cmpid= EMP|CE HM|CP HRI2016 -2911-GLOBAL-whitepaper-ppSHJHQ VÂżG Z.)


candice@relloy.co.za


AROUND THE WORLD Sonoco selling blow moulding operations to Amcor SONOCO Products Co is striking a $280 million deal to sell off its blow moulding operations to Amcor Ltd. The move includes seven manufacturing SODQWV²VL[LQWKH8QLWHG6WDWHVDQGRQHLQ Canada â&#x20AC;&#x201D; that have sales of $210 million annually, Amcor said. Sonoco said the sites produce containers for the personal care and food and beverage markets. )RU6RQRFRWKHPRYHDOORZVWKHÂżUP to focus on targeted growth businesses, LQFOXGLQJĂ&#x20AC;H[LEOHSDFNDJLQJWKHUPRIRUPLQJ rigid plastics and temperature-assurance packaging for transporting pharmaceuticals, biologics and vaccines. )RU$PFRUWKHPRYHDOORZVWKHÂżUPWR push further into specialty containers in North America. The Sonoco operations will become part of Amcor Rigid Plastics and help balance WKHÂżUPÂśVSURGXFWRIIHULQJVE\HQGPDUNHW That includes a big boost in the home and personal care segment, which accounts for more than two-thirds of the business coming from Sonoco.

Breakthrough technology could slash cost of manufacturing plastics 6&,(17,676IURP([[RQ0RELO&RUSDQG the Georgia Institute of Technology have developed a potential breakthrough to reducing the amount of energy and emissions associated with manufacturing plastics and cut costs by up to $2 billion annually. Results of the research were published in August in the peer-reviewed journal Science, DQG([[RQ0RELOVDLGWKDWLIEURXJKWWRDQ industrial scale, the new technology could VODVKLQGXVWU\ÂśVJOREDODQQXDOFDUERQGLR[LGH emissions by up to 45 million tons, or the equivalent of around 5 million households. The project focused on replacing the H[LVWLQJHQHUJ\DQGKHDWPHWKRGWRVHSDUDWH PROHFXOHVZLWKDPROHFXODUOHYHOÂżOWHUDQGD form of reverse osmosis to separate para[\OHQHDEXLOGLQJEORFNIRUSRO\HVWHUIURP FRPSOH[K\GURFDUERQPL[WXUHV

Chinaplas may outgrow its Shanghai site 648((=('E\OLPLWHGVSDFHDWLWVH[LVWLQJ 6KDQJKDLWUDGHIDLUFRPSOH[RUJDQL]HUVRI the Chinaplas show say they are open to PRYLQJWKHIDLUWRDQHZH[KLELWLRQJURXQGV WKHQHZ1DWLRQDO([KLELWLRQDQG&RQYHQWLRQ &HQWUHLQ6KDQJKDLÂśV+RQJTLDRDUHD Currently the show is held in the Shanghai 1HZ,QWHUQDWLRQDO([SR&HQWUHRQWKHRWKHU side of the city from o Hngqiao. Any change would happen in 2018 at the earliest. The QHZH[KLELWLRQFHQWUHLQWKH+RQJTLDRDUHDLV 400,000m2 indoors and 100,000 m2 outdoors. 78 FEBRUARY / MARCH 2017

Daisy Squeeze-Flexible pouch, is an inverted, wedge-shaped pouch ZLWKDQLQQRYDWLYHĂ&#x20AC;LS top dispensing closure

Trends emerge 'ULYHIRUJUHDWHUVXVWDLQDELOLW\DPDMRULQĂ&#x20AC;XHQFHRQSDFNDJLQJGHYHORSPHQW TH E 2016Awards for Packaging Innovation â&#x20AC;&#x201C;the 28th occasion that materials group DuPont Co has issued the awards â&#x20AC;&#x201C;revealed how manufacturers and brands are responding to pressures and trends currently bearing down on packaging. According to an article in PlasticsNews.com, the drive for greater sustainability has been a major LQĂ&#x20AC;XHQFHRQSDFNDJLQJGHYHORSPHQW for some years. Independent judges in the DuPont awards noted that entries UHĂ&#x20AC;HFWHGWKHSDFNDJLQJLQGXVWU\ÂśV continuing commitment to sustainability, with innovations around source reduction, lowering energy use during manufacturing, reusability and reducing food waste.

Âł$WKHPHWKDW,ÂśYHQRWLFHGLV that packaging sustainability and environmental impact is still alive and well,â&#x20AC;? said Jeff Schuetz, staff vice president for global technology consumer packaging at Sonoco 3URGXFWV&RÂł:HGRQÂśWWDONDERXWLW VRPXFKEXWLWÂśVEHFRPHPXFKPRUH mainstream in terms of how people are designing packaging with environmental impact in mind.â&#x20AC;? The connection between sustainability and packaging innovation is being seen as an opportunity. Ramon $JXVWLQHVJHQHUDOPDQDJHURIĂ&#x20AC;H[LEOH packaging division at Philippines-based Universal Robina, said: â&#x20AC;&#x153;The conception of the package is an opportunity for developers to say something about

Breathing Skins showroom wins Breathing facade skin of polycarbonate sheets COVESTRO recently won the innovation award of the European Polycarbonate 6KHHW([WUXGHUV2UJDQLVDWLRQ (36( IRU DÂľ%UHDWKLQJ6NLQVÂśVKRZURRP,WZDVWKH eighth time the organization had held the Best Polycarbonate Projects Competition to recognize outstanding applications with polycarbonate sheets. The idea behind the seminal Breathing Skins showroom is to use the outer envelope of buildings to variably adapt the indoor climate to the needs of the occupants. The project centres on a breathing facade skin using transparent solid sheets of the polycarbonate 0DNURORQÂŽ. This is modelled on a natural, organic skin. 7RELDV%HFNHUÂśVSURSULHWDU\GHYHORSPHQW PDNHVLWSRVVLEOHWRLQÂżQLWHO\YDU\WKH permeability of facades and thus adapt WKHLQGRRUFOLPDWHWRWKHXVHUÂśVVSHFLÂżF requirements.

The inspiration for developing a breathing facade skin comes from the idea of ventilating an interior via pore-like air ducts without creating a draft. These ducts can be sealed pneumatically so as to be airtight by applying a small overpressure to the facade element. A low-energy compressor controls around SQHXPDWLFÂľPXVFOHVÂśSHUVTXDUH metre without any visible technology. Applying a small under-pressure widens WKHUHYHUVLEOHDLUGXFWVÂżWWHGEHWZHHQ two perforated, transparent solid sheets RI0DNURORQ*3FOHDUSRO\FDUERQDWH from Covestro. The sandwich design weighs less than 11kg per square metre. The more the pneumatic muscles dilate, WKHPRUHWKHIDFDGHÂśVDSSHDUDQFH changes. Permeability for light and air as well as see-through visibility can be PRGLÂżHGORFDOO\DQGJUDGXDOO\7KHFRQFHSW is based on biomimetics, the basic idea of


WORLD NEWS Improving usability was clearly important for US-based Printpack Inc, which won a gold award for its packaging of Rust-Oleum SpraySmart marker paint, which replaces a conventional aerosol can with a technology enhanced barrier pouch

from DuPont packaging awards why the package is important and why it is created. They can communicate that thoughtfulness to the public so people can be more conscious about selecting the product, focusing on not just whatâ&#x20AC;&#x2122;s inside, but how the packaging was thought out and how it should be either used or discarded, and how it improves the functionality of the package.â&#x20AC;? /RRNLQJDWMXVWWKHĂ&#x20AC;H[LEOHSRXFKHVLQ the awards, there were a few companies gaining recognition this year. Aptar Food &Beverage partnered with Daisy Sour Cream in the US to create the 'DLV\6TXHH]H)OH[LEOHSRXFKZKLFKZDV UHFRJQL]HGDVDGLDPRQGÂżQDOLVWZLQQHULQ the 2016DuPont awards. This is an inverted, wedge-shaped pouch with an innovative Ă&#x20AC;LSWRSGLVSHQVLQJFORVXUHFUHDWLQJD stand-out design with shelf appeal.

The self-sealing valve-in technology FRXSOHGZLWKWKHULQJSXOOÂżWPHQWVHDOFXVWRP FORVXUHDQGÂżOPVWUXFWXUHZRUNHIIHFWLYHO\ together as a total packaging solution. The Daisy Squeeze package helps eliminate risks of contamination from dirty utensils minimizes wasted product and provides easy-to-control and drip free dispensing. Usability â&#x20AC;&#x153;What surprised me most about the entries is the continued focus on the consumer,â&#x20AC;? said lead judge David Luttenberger, global packaging director for the Mintel Group. â&#x20AC;&#x153;While graphics and shelf appeal are always important, weâ&#x20AC;&#x2122;re really seeing converters and brands come together to really focus on those solutions-based, functional, hardworking elements of packaging.â&#x20AC;? 7KHLQĂ&#x20AC;XHQFHRIWKHPLOOHQQLDOOLIHVW\OH

on design was apparent to Amazonâ&#x20AC;&#x2122;s senior manager of supply chain packaging Suzanne Fisher who said: â&#x20AC;&#x153;A few of the things that they love â&#x20AC;Ś is the ease of convenience. They want to make sure they can be on the go with their package.â&#x20AC;? Improving usability was clearly important for US-based Printpack Inc, which won a gold award for its packaging of Rust-Oleum SpraySmart marker paint, which replaces a conventional aerosol can with a technology enhanced barrier pouch. Recognized for râ&#x20AC;&#x2DC; esponsible packagingâ&#x20AC;&#x2122; and e â&#x20AC;&#x2DC; nhanced user H[SHULHQFHÂśWKHEDUULHUSRXFKLQFUHDVHV HIÂżFLHQF\DQGUHGXFHVZHLJKWIRUWKHXVHU and also replaces a potentially hazardous FDQ7KHSRXFKHVPL[DQGHYDFXDWHWKH paint more effectively, providing more paint coverage for the same package weight.

EPSE innovation award The Breathing Skins showroom shows how to control the permeability of facades and thus to adapt the indoor climate to the userâ&#x20AC;&#x2122;s VSHFLÂżFUHTXLUHPHQWV The project centres on a breathing facade skin using transparent solid polycarbonate sheets from Covestro

facade technology while he was studying architecture I(LEK , Institute for Lightweight Structures and Conceptual Design at the University of Stuttgart). Planning the showroom was the subject of his dissertation. The showroom was implemented independently in a project group with fellow student Simon u Hffer, who was responsible for planning the wooden structure.

www.covestro.com

www.breathingskins.com

79

recessed larch supports mounted outside the interior. The modular components are so small and light that each of them can be carried by two people. The laminated birch surfaces make you want to touch them, and create a warm effect that provides an H[FHOOHQWFRQWUDVWWRWKHSODVWLFIDFDGH Tobias Becker invented and obtained legal protection for the Breathing Skins

FEB / MAR 2017

which is to observe nature closely and turn WKHÂżQGLQJVLQWRWHFKQLFDODSSOLFDWLRQV The showroom is a prototype for testing breathing skins facade technology and H[SHULHQFLQJLWDWDQHPRWLRQDOOHYHO The organic-like facade skin and the soft, meandering form of the Breathing Skins showroom complement each other perfectly. Geometrically speaking, the IDFDGHLVPDGHXSRIVL[DUFVZLWKGLIIHUHQW radii. The solid sheetsâ&#x20AC;&#x2122; good thermoforming SURSHUWLHVSURGXFHGH[FHOOHQWUHVXOWV The facade is over 10m long, has an area of 25m2 and is split into several elements. To reinforce the image of a continuous facade, the load-bearing parts of the sandwich facade elements are all made of solid polycarbonate sheets. The interior has an area of 8m2 and a clear height of 2.4m. A wooden structure with edges 4.5m by 4.5m long marks the vertical limit of the interior. The ceiling panel rests on four round,


WORLD NEWS

The ICEhouseâ&#x201E;¢ was designed by William McDonough with advanced material technologies from SABIC

California recycling rate drops below 50% NEW data from California shows the stateâ&#x20AC;&#x2122;s recycling rate is actually declining as a monumental reuse goal looms in the not-todistant future. The state has a recycling goal of 75% by 2020, but saw its recycling rate drop to 47% last year, according to new data from the California Department of Resources 5HF\FOLQJDQG5HFRYHU\7KLVLVWKH¿UVWWLPH since 2010 that the stateâ&#x20AC;&#x2122;s recycling rate fell below 50%. The stateâ&#x20AC;&#x2122;s recycling rate is different from that of its diversion rate, which stood at 6 3% for 2015. While the recycling rate involves materials that are source-reduced, recycled or composted, a broader diversion rate also credits materials used for fuel, ODQG¿OOFRYHUDQGURDGVWREHFRXQWHGLQ that percentage. And while the recycling rate is a goal, California has a law requiring a 50% diversion rate.

AROUND THE WORLD

Plastics Industry Association drops SPI SPI: The Plastics Industry Trade Association in the USA has a new name, Plastics Industry Association, PLASTICS for short, and unveiled a new website, demonstrating that as the plastics industry grows and evolves, so does the association. PLASTICS, the associationâ&#x20AC;&#x2122;s new identity, builds upon nearly 80 years of a strong history of fostering collaboration among the entire plastics supply chain. PLASTICS unveiled a new logo, which represents the six facets of the plastics industry supply chain, including brand owners, equipment manufacturers, material suppliers, mouldmakers, processors and recyclers. Moving forward, the plastics industry is looking to grow and support VXVWDLQDELOLW\DQG¿QGZD\VWRPDNH recycling easier, hence the association also DGGHGLWVQHZDQG¿UVWHYHUWDJOLQH³%HWWHU ,QGXVWU\%HWWHU:RUOG´ To learn more about the plastics industryâ&#x20AC;&#x2122;s rebrand, please visit: PlasticsIndustry.org/ About-Us/Our-Rebrand.

Solvay wins Airbus Y]ITQÃ&#x2026;KI\QWV

62/9$<KDVREWDLQHGTXDOL¿FDWLRQIURP Airbus for its TegraCoreâ&#x201E;¢ PPSU foam, ZKLFKLVLPSOHPHQWHGRQLWVÃ&#x20AC;DJVKLS$ ;:%DVDKLJKSHUIRUPDQFHOLJKWZHLJKWLQJ material and paves the way for its use on other Airbus aircraft. Following rigorous testing by Airbus, TegraCoreâ&#x20AC;&#x2122;s applications on Airbus platforms can range from ducting to sandwich components which comply with the most GHPDQGLQJÃ&#x20AC;DPPDELOLW\VPRNHGHQVLW\DQG toxic gas emission F ( ST)requirements and are superior in impact strength compared with honeycomb cores. www.solvay.com 80 FEBRUARY / MARCH 2017

ICEhouse â&#x20AC;&#x201C;

designing for durable carbon Promotes concept of the importance of closed-loop, durable carbon systems ,1129$7,9(6$%,&FRPSRVLWHPDWHULDOV that have opened up a vast new array of possibilities for designers in diverse industries took centre stage at the World Economic Forum in January as part of an innovative structure, combining advanced technologies and design, known as the ICEhouseâ&#x201E;¢. The iconic structure â&#x20AC;&#x201C;constructed in Davos, Switzerland â&#x20AC;&#x201C;is spearheading 6$%,&¶VHIIRUWVWRGHOLYHUWKLV breakthrough technology to the world, and in doing so promote the architect William McDonoughâ&#x20AC;&#x2122;s concept of the importance of closed-loop, durable carbon systems. ICEhouse, where ICE stands for Innovation for the C * ircular Economy, was EXLOWXVLQJ6$%,&¶V/(;$1â&#x201E;¢ sheet and V\VWHPVIRUWKHZDOOVFHLOLQJURR¿QJDQG windows. 7KLV\HDU6$%,&¶VQHZ¿EUHUHLQIRUFHG thermoplastic composite technologies DUHXVHGIRUÃ&#x20AC;RRUSDQHOVDQGSUR¿OH structures instead of metal and wood, delivering superior durability, impact performance, and safety with less weight. The cladding is LEXAN multi-wall sheet ¿OOHGZLWKQDQRJHOIRURXWVWDQGLQJHQHUJ\ HI¿FLHQF\7KHUPRSODVWLFFRPSRVLWH VDQGZLFKÃ&#x20AC;RRUSDQHOVZLWKVNLQVPDGH

out of UDMAXâ&#x201E;¢ GPP 45-70 tape replace plywood being up to 50% lighter, with higher abrasion and impact resistance. 7KHWKHUPRSODVWLFFRPSRVLWHÃ&#x20AC;RRUSDQHOV do not absorb water and therefore do not decay, increasing safety in use and OLIHWLPHRIWKHÃ&#x20AC;RRULQJ$QRWKHUQRYHOW\ is the tubular composite structures made with UDMAX GPP 45-70 tape, a FRQWLQXRXV¿EUHUHLQIRUFHGSRO\SURS\OHQH which partially replaces aluminium /VKDSHGSUR¿OHVZLWKYHU\IDYRXUDEOH weight-to-performance ratio. William McDonough, author and sustainability pioneer, and his companies, William McDonough +Partners and WonderFrame LLC designed and built ICEhouse with collaboration and support IURP6$%,&RQHRIWKHZRUOG¶VSUHIHUUHG suppliers of chemicals. *The Circular Economy incorporates the Cradle to Cradle® design philosophy, developed by William McDonough, incorporating the principles of material health, material reutilization, renewable energy, clean water and social fairness. The Circular Economy utilizes this approach to product design to break the typical WDNHPDNHGLVSRVHÃ&#x20AC;RZRIPDWHULDOUHVRXUFHV today, replacing it with designs that make use of carbon through products that are inherently recoverable, reusable and recyclable.


Taiwan plastics lab is just what the doctor ordered

Thermoplastics for automotive, aerospace applications key areas of research CONSTRUCTION is forging ahead on $10 million medical polymer research centre thatâ&#x20AC;&#x2122;s the latest sign of Taiwanâ&#x20AC;&#x2122;s determination to target the upscale plastics market. According to PlasticsNews.com, while China and Southeast Asia will continue to churn out commodity products, Taiwanese processors can focus on high-end offerings like medical devices and lightweight car parts. â&#x20AC;&#x153;We donâ&#x20AC;&#x2122;t make regular plastic bags and water buckets, things like that. Theyâ&#x20AC;&#x2122;re too low value. So we go for high value-added items,â&#x20AC;? said Zen-Wen Chiou, vice president of the Plastics Industry Development Centre, which is building the new lab. When it opens in 2018, the lab, a half-block from the main PIDC building in Taichung, central Taiwan, will focus on device design.

â&#x20AC;&#x153;In Taiwan, we still donâ&#x20AC;&#x2122;t have the capability to design or develop the new polymer materials for medical use,â&#x20AC;? Chiou said. â&#x20AC;&#x153;Those materials need to pass regulations, and that will take a very long time.â&#x20AC;? The centre aims to bring together traditional polymer engineers with experts in human anatomy, hospitals and medical regulations from the Taichung areaâ&#x20AC;&#x2122;s hospitals and medical schools. Private industry will be able to access the centreâ&#x20AC;&#x2122;s pricey equipment, too. â&#x20AC;&#x153;It will be an open laboratory that industry researchers can come and use,â&#x20AC;? Chiou said. Currently, thermoplastics for automotive and aerospace applications are key areas of research. The centre works with injection moulding machine maker Victor Taichung Precision Machinery Works Co Ltd to

Kent Miller Zen-Wen Chiou, vice president of the Plastics Industry Development Centre

PDNHVFUHZVRSWLPL]HGIRUORQJÂżEUHÂą PRUHWKDQPPORQJÂąFRPSRVLWHV PIDC is also researching advanced ÂżOPV2QHKXPEOHEXWSUDFWLFDO innovation was a plastic bag that extends the shelf life of fruits like bananas that emit ethylene gas, Chiou said. From its inception in 1992, the PIDC has focused on serving the small- and medium-sized businesses that make up the vast majority of the islandâ&#x20AC;&#x2122;s plastics enterprises. The nation of 23 million has PRUHWKDQDPLOOLRQVPDOOEXVLQHVVHVÂąD tribute a strong entrepreneurial ethos, but a challenge when it comes to staying on top of cutting-edge technologies.

Helping Coca-Cola recycle 70 tons of pet waste annually AVERY Dennison has collaborated with partners WKURXJKRXWWKHVXSSO\FKDLQÂą9LULGRUDQG3(78. ÂąWRKHOS&RFD&ROD(XURSHDQ3DUWQHUV &&(3  reduce waste, costs, and the carbon footprint of 6PDUWZDWHUSURGXFWLRQLQWKH8QLWHG.LQJGRP â&#x20AC;&#x153;This example shows how we can turn the crisis of resources into a business opportunity through close collaboration across the value chain. Businesses which can be truly innovative with the products and services they provide, optimising the resources they use and encouraging consumers to do the same, have the potential to transform our economy,â&#x20AC;? said Joe Franses, director of corporate responsibility and sustainability at Coca-Cola European Partners: Xander van der Vlies, sustainability director for Avery Dennison Materials Group Europe, said that CCEP wanted to further improve Smartwater Avery Dennison helps Coca-Cola European partners to recycle 70 tons of pet waste annually

production in line with its focus on recycling, sustainability and creating a circular economy. More than 50 million bottles of Smartwater were SURGXFHGLQ7KH3(7OLQHUVXVHG FDUU\LQJWKH VHOIDGKHVLYHODEHOVEHIRUHGLVSHQVLQJ JHQHUDWHG more than 40 tons of waste in that year, costing around ÂŁ8,500 in disposal/handling costs. Under the QHZUHF\FOLQJVFKHPH3(78.VKUHGVDQGH[WUXGHV the waste PET liner and then produces a material suitable for making new items such as PET staple ÂżEUHVWUDSSLQJRUWKHUPRIRUPDEOHVKHHWV Van der Vlies noted that creating awareness on PET recycling will continue: â&#x20AC;&#x153;Since we launched this LQLWLDWLYHZLWK3(78.LQZHKDYHVLJQHGXS many wine, spirits, beer, and beverage brands. Avery Dennison has set an ambitious sustainability goal for 2025 of eliminating 70% of liner waste from the industry value chain.â&#x20AC;? www.averydennison.com FEBRUARY / MARCH 2017

81


DIARY

uly at 9-13 J er ath the Fe tre in et Cen Mark izabeth. l Port E

TH SAVE

E DAT

E

African Marine Waste conference in Port Elizabeth THE African Marine Waste conference will be taking place between 9-13 July at the Feather Market Centre in Port Elizabeth. The conference aims to bring together and grow a network of researchers, educators, other practitioners, industry, media and governments to meet the pollution challenges facing Africa. Delegates will be able to network with world class speakers, including renowned marine biologist, explorer, author, and conservationist, Sylvia Earle â&#x20AC;&#x201C; a National Geographic explorer-in-residence and founder of Mission Blue. Conference topics include: y Research y Policies and practices y Education and awareness

y Conservation y Data, GIS and mapping y Plastics and litter y Oil, aerial and chemical pollution y Socioeconomic impacts y Circular economy and blue economy y Role of businesses y Special challenges of municipalities y Recycling and upcycling y Exciting innovations The African Marine Waste Conference is hosted by the African Marine Waste Network (AWMN), which was launched in July 2016 by the Sustainable Seas Trust (SST), Plastics/SA and other partners in Port Elizabeth, South Africa. The network is the ÂżUVWGHGLFDWHGDSSURDFKWRDGGUHVVPDULQH waste at a pan-African level. This conference

provides the next major step forward. AMWC 2017 will provide a global interdisciplinary platform for stakeholders to present and discuss the most recent innovations, trends, and concerns, as well as practical challenges encountered and VROXWLRQVDGRSWHGLQWKHÂżHOGRIGHEULVDQG marine waste. Over the course of the four days, conference delegates will experience unparalleled opportunities for extensive networking, inspiring keynotes, and a FRPSUHKHQVLYHH[KLELWLRQĂ&#x20AC;RRUÂżOOHGZLWK new and innovative approaches to plastics, ZLWKVSHFLÂżFUHOHYDQFHWRPHHWLQJWKH challenges of waste in African waters.

www.sstconference.org.za

Clearer, better, faster

82 FEB / MARCH 2017

MILLIKEN focussed on the advantages RIXVLQJLWVWHFKQRORJ\OHDGLQJFODULÂżHUV and nucleators to improve PP resins, and demonstrate how its UV absorber can improve key properties in PET packaging, at Arabplast from 8-10 January at the Dubai World Trade Centre in the UAE. At Arabplast, Milliken discussed how itâ&#x20AC;&#x2122;s ClearShieldÂŽ UV absorber can improve key properties in PET packaging. At the same time as makers of homeand personal-care products increasingly are using more natural ingredients, theyâ&#x20AC;&#x2122;re embracing memorable colours, Milliken ClearShield UV absorbers help deliver better, brighter, more stable and more sustainable PET packaging

active ingredients and special additives. But UV light can negatively impact some of these QHZLQJUHGLHQWVDQGFXUUHQW89ÂżOWHUVFRPH with their own challenges. So Milliken has developed a better alternative -- ClearShield UV absorber. This crystal-clear additive offers a wider range of UV protection than other products (up to QP KDVSURYHQHIÂżFDF\LQSURWHFWLQJ sensitive ingredients such as vitamins and dyes, and retains the high transparency of PET without unwanted shading. Use of Millikenâ&#x20AC;&#x2122;s ClearShield UV absorber in the packaging offers an alternative,

simpler way to provide UV protection to formulations without reworking the composition, thereby avoiding regulatory uncertainty and the complexity of an extra formulation step. It also provides more freedom in formulation design and FRQÂżGHQFHLQWKHHQGSURGXFWTXDOLW\DV it is possible to extend the formulation shelf-life and avoid colour fading while keeping the visual appeal of a product in transparent packaging.

www.millikenchemical.com


COM I UP NG

Agrofood & Plastplack in Nigeria

in Munich, October 7+(QG(XUR0ROGWREHKHOG from 24-26 October at the Munich ([KLELWLRQ&HQWUHLQ*HUPDQ\±LVWKH ¿UVW(XUR0ROGWREHKHOGLQ0XQLFK *HUPDQ\RQHRIWKHPDMRUKLJKWHFK UHJLRQVLQ*HUPDQ\DQGLQ(XURSH +HOGODVW\HDUDWWKHVDPHWLPH DVWKHVXFFHVVIXODHURVSDFHVXSSO\ FKDLQVKRZ$,57(&XQGHUWKHPRWR µDXWRPRWLYHPHHWVDHURVSDFH¶WKHWZR shows had excellent results. Almost 500 exhibitors from 34 nations were represented, with around 12 000 YLVLWRUVIURPQDWLRQV (XUR0ROGZLOOGH¿QLWHO\JURZWKLV \HDUDQGZLOOGHYHORSLQWRRQHRIWKH PDMRUSURGXFWGHYHORSPHQWVKRZV RIWKHZRUOG8SWRH[KLELWRUV WRJHWKHUZLWK$,57(&DUH expected. ([KLELWRUVLQFOXGHHQJLQHHULQJ PDWHULDOVFRDWLQJ&$'&$0&$( standard components, hot runner, PRXOGSDWWHUQDQGWRROPDNLQJ machine tools, manufacturing, ODVHUPHDVXUHPHQWTXDOLW\FRQWURO and of course all the different sectors of modern production and SURFHVVLQJWHFKQRORJLHVLQDGGLWLYH PDQXIDFWXULQJ'SULQWLQJFRPELQHG with an international conference on 'SULQWLQJLQWKHH[KLELWLRQDUHD Special exhibit areas on materials, &$(DGGLWLYHPDQXIDFWXULQJVPDUW IDFWRU\DUHSODQQHG www.euromold.com/en/

FOLLOWING the success of the second edition of Agrofood & Plastplack Nigeria 2016, the third edition of the show will run from 28-30 March at the Landmark Centre in Lagos. )RUWKH¿UVWWLPH*HUPDQ\ZLOO KRVWDQRI¿FLDO*HUPDQ3DYLOLRQ at the show, featuring more than *HUPDQWHFKQRORJ\OHDGHUV SUHVHQWLQJWKHLULQQRYDWLRQVRQD 500m2 exhibition. The German 3DYLOLRQLVSUHVHQWHGE\WKH )HGHUDO0LQLVWU\IRU(FRQRPLF Affairs and the Association of the *HUPDQ7UDGH)DLU,QGXVWU\$80$ 6XSSRUWHGE\9'0$*HUPDQ (QJLQHHULQJ)HGHUDWLRQ*HUPDQ H[KLELWRUVLQFOXGH$'0¶V:LOG AWILA, BBM, Bosch Packaging, ',261$'|KOHU)ULWVFK*($ Güntner, Ingredion, Inoex, IPT, Kautex, KHS, Kuhne, Leistritz, 0DOO+HUODQ0RWDQ&RORUWURQLF 6\PULVH9LEURÃ&#x20AC;RRUV:HUQHU 3Ã&#x20AC;HLGHUHUDQG:LQGP|OOHU  +|OVFKHU Nigeria is the second largest importer of food processing and SDFNDJLQJWHFKQRORJ\LQ$IULFD PDNLQJXSIRU¼PLOOLRQLQ ,PSRUWVRISODVWLFVLQSULPDU\IRUPV DPRXQWHGWR86ELOOLRQLQ (WTO) and imports of plastics PDFKLQHU\VWRRGDW¼PLOOLRQ ZZZIDLUWUDGHPHVVHGH

Polymer testing & analysis event $0,¶VVHFRQG3RO\PHU7HVWLQJ  $QDO\VLVFRQIHUHQFHZLOOWDNHSODFH on 4-5 AprilLQ&RORJQH*HUPDQ\ 7KHHYHQWLVDQLPSRUWDQW meeting place for scientists, ODERUDWRU\VWDIIUHVHDUFKHUVDQG 5 'SURIHVVLRQDOVZKRGHYHORS WHVWDQGDQDO\VHQHZSRO\PHU materials, formulations and SURGXFWV,WSURYLGHVDYDOXDEOH RSSRUWXQLW\WRGLVFRYHUDQGGHEDWH WKHODWHVWLQQRYDWLRQVDQGEHVW SUDFWLFHVLQSRO\PHUWHVWLQJ FKDUDFWHULVDWLRQDQGDQDO\VLV 7KLV\HDU¶VSURJUDPPHIHDWXUHV DQLPSUHVVLYHLQWHUQDWLRQDOOLQH up of expert speakers who will FRYHUDEURDGUDQJHRISRO\PHU WHVWLQJDQGDQDO\VLVWRSLFV These will include: tensile testing; IDLOXUHDQDO\VLVÃ&#x20AC;DPPDELOLW\ DVVHVVPHQWQRQGHVWUXFWLYH

WHVWLQJFKHPLFDODQDO\VLVFRORXU control; creep testing; odour LGHQWL¿FDWLRQDGKHVLRQWHVWLQJ UHF\FOHGSODVWLFVDQDO\VLVÃ&#x20AC;RZ properties measurement; surface characterisation; and new materials testing standards. www.amiconferences.com

Plastic pipes in infrastructure 7+(WKHGLWLRQRI$0,¶V3ODVWLF Pipes in Infrastructure Conference will take place at the Hilton .HQVLQJWRQLQ/RQGRQ8QLWHG Kingdom on 25-26 April. 3ODVWLFSLSHV\VWHPVDUH easier to transport and install, HQYLURQPHQWDOO\IULHQGO\DQG SURYLGHLPSURYHGUHOLDELOLW\E\ eliminating the risk of corrosion. 'HVSLWHWKHVHLPSRUWDQWEHQH¿WV KRZHYHUµWUDGLWLRQDO¶V\VWHPV continue to be used in certain DSSOLFDWLRQV7RJHQHUDWHSUR¿WDEOH JURZWKWKHSODVWLFSLSHVLQGXVWU\ QHHGVWRFRQWLQXHWRLQQRYDWH FRQVWDQWO\LPSURYLQJLWVYDOXH SURSRVLWLRQ,QQRYDWLRQLVLQGHHG WDNLQJSODFHDWDOOOHYHOVDQG$0,¶V Plastic Pipes in Infrastructure FRQIHUHQFHZLOOSURYLGHDQ LQYDOXDEOHRSSRUWXQLW\WRKLJKOLJKW UHFHQWGHYHORSPHQWVDQGGLVFXVV current and future challenges faced E\WKHLQGXVWU\ ZZZELWO\3LSHV

Agricultural plastics â&#x20AC;&#x201C; potential for recycling 7+(VHFRQG,QWHUQDWLRQDOUHF\FOLQJ IRUXPRQµ$JULFXOWXUDO3ODVWLFV± 3RWHQWLDOIRU5HF\FOLQJ¶KHOGIRUWKH ¿UVWWLPHLQZLOOWDNHSODFH from 26-28 AprilDWWKH+RWHO'RULQW Pallas in Wiesbaden. The organiser is again RIGK GmbH in cooperation with WKH(XURSHDQ$VVRFLDWLRQRI 3ODVWLFV5HF\FOLQJ 5HFRYHU\ 2UJDQLVDWLRQV (352 7KH IRFXVZLOOEHRQUHF\FOLQJSODVWLFV in agriculture. Current political SODVWLFVUHF\FOLQJLVVXHVZLOO also be addressed in general. $QDFFRPSDQ\LQJH[KLELWLRQZLOO SURYLGHIXUWKHULQIRUPDWLRQDERXW the sector. ZZZULJNGHQFHQIRUXP UHJLVWUDWLRQUHJLVWUDWLRQIRUPKWPO

FEB / MARCH 2017 83


DIARY

Be part of the manufacturing solution at KITE 2017 Durban Exhibition Centre, from 26-28 July THE South African manufacturing sector has faced a number of challenges in recent years. Amongst these are â&#x20AC;&#x153;productivity, costs, labour issues, skills shortages, HIÂżFLHQF\DQGQHZWHFKQRORJ\´DFFRUGLQJ to Modise Makhene, principal at Odgers Berndtson Sub-Saharan Africa. â&#x20AC;&#x153;The biggest shift that leaders in the manufacturing sector are dealing with is the move globally from traditional manufacturing practices (which were labour intensive and required low technology) to models embracing the latest technological ÂąHVSHFLDOO\GLJLWDOÂąDGYDQFHV´ said Makhene. While some analysts have belaboured the decline in the manufacturing sector, there is no doubt that selected sub-sectors in manufacturing, including communication and professional equipment (11% growth in 2016); petroleum, chemical, rubber and plastics; and food & beverage, have experienced a solid growth path. A number of other sectors are steadily recovering and there are opportunities for South Africa to operate as the manufacturing hub of Africa (StatsSA). SAnews.gov.za says that improvements have been made in the sector that include

the South African governmentâ&#x20AC;&#x2122;s plan to spend R5.8-billion between 2015 and 2018, to help manufacturers affected by the global economic downturn to upgrade their factories, improve products and train workers. Amongst the manufacturing fraternityâ&#x20AC;&#x2122;s greatest obstacles to growth are supply FKDLQLQVWDELOLW\ÂżQGLQJFUHDWLYHPHWKRGV WRUHGXFHDQGHOLPLQDWHFRVWVDQGÂżQGLQJ new methods to increase productivity while reducing overheads (Casemore & Co). â&#x20AC;&#x153;Manufacturers and suppliers of industrial technology equipment are in a strong position to alleviate and eliminate these obstacles. We recognise that time is a precious resource for KwaZulu-Natal industry professionals, so the ability to source a multitude of leading products and services under one roof is a major drawcard. The KwaZulu-Natal Industrial Technology Exhibition (KITE) provides manufacturers with the unrivalled opportunity to interact with a wide variety of industrial technology providers in their quest for high-quality VROXWLRQV´VDLG-RVKXD/RZ3RUWIROLR Director at Specialised Exhibitions. Held once again at the Durban Exhibi-

tion Centre, from 26-28 July, KITE has repeatedly attracted visitors with the common goal of sourcing and buying industrial technology equipment and related services. The exhibition includes displays and information on construction equipment and material; electronic components, energy solutions; environmental solutions; heavy machinery; hygiene products and services; industrial equipment and components; IT and telecommunications manufacturing equipment; materials handling; monitoring, process control and sensors; security equipment; workwear and protective equipment; plant and facility equipment; safety equipment and machinery; tools; and industrial services.

â&#x20AC;˘ To book a stand or discuss a sponsorship package at KITE, contact Loftie Eaton or Mark Anderson on +27 41 585 8274 or +27 10 003 3063 or email loftiee@specialised.com or marka@specialised.com.

www.kznindustrial.co.za

EVENTS COMING UP ...

COMING UP

Interpack 2017 in May INTERPACK will be held in DĂźsseldorf from 4-10 May. The widespread global relevance of the areas covered by Interpack and the high calibre of both exhibitors and visitors make Interpack in DĂźsseldorf every three years the go-to international event for a highly knowledgeable specialist audience. Interpack is the essential event for the food, beverage, confectionery, bakery, pharmaceutical, cosmetics, non-food and industrial goods sectors. No other trade fair in the world represents the entire supply chain. And at no other trade fair does the packaging industry provide all industry sectors with tailored solutions and innovative designs based on such a variety of materials. www.interpack.com 84 FEB / MARCH 2017

Africaâ&#x20AC;&#x2122;s biggest machine tools expo AFRICAâ&#x20AC;&#x2122;S biggest machine tools exhibition will take place from 9-12 May at the Nasrec Expo Centre in Johannesburg. Visitors to Machine Tools Africa 2017 will be able to source products and services in one place at one time, gain knowledge about the latest in supplies, machinery and equipment; learn about the latest technologies, industry trends and innovations and participate in daily live demonstrations and interactive displays. A series of free-to-attend seminars co-located with Machine Tools Africa 2017 will enhance the visitor experience and add value to the programme. www.machinetoolsafrica.co.za

Chinaplas in May ASIAâ&#x20AC;&#x2122;S number one and the worldâ&#x20AC;&#x2122;s number two plastics and rubber trade fair, Chinaplas, will be held in Guangzhou, PR China from 1629 May. Chinaplas 2017 is expected to set a record in terms of its scale, with a 250 000m² exhibition area. The show will welcome more than 3300 exhibitors from 40 countries and regions. The fairground will be divided into 16 theme zones. Focusing on the theme of â&#x20AC;&#x2DC;Intelligent Manufacturing, High-tech Materials, Green Solutionsâ&#x20AC;&#x2122;, three concurrent events will be hosted during the exhibition: the 2nd â&#x20AC;&#x2DC;Industry 4.0 Conferenceâ&#x20AC;&#x2122;, â&#x20AC;&#x2DC;Design x Innovationâ&#x20AC;&#x2122;, and the third â&#x20AC;&#x2DC;Medical Plastics Conferenceâ&#x20AC;&#x2122;. Visitors can expect to grasp the cutting-edge technologies and inspiring case studies in these events, allowing them to hop on the bandwagon and understand market dynamics from multiple dimensions, explore more valuable


Propak Cape alongside wine and olive expo in October Aligns synergy of both exhibitions BRINGING wine and olive oil production and supply into the spotlight is the newlylaunched Wine and Olive Oil Suppliers Expo, taking place in Cape Town from 24-26 October, co-located with the acclaimed Propak Cape exhibition at the Cape Town International Conference Centre (CTICC). Showcasing a wide range of the latest equipment, machinery, products and services from leading local and international manufacturers and suppliers to wine farms and olive oil producers, the Wine and Olive Oil Suppliers Expo will offer an ideal marketing platform for exhibitors. A series of free-to-attend seminars will add further value to the expo with discussion topics such as sustainability, lightweight packaging options for wine and olive oil, recycling, mechanisation and the use of technology in the wine making SURFHVVLQJUHGLHQWVZDWHUSXULÂżFDWLRQDQG many others. South Africa is the eighth largest producer of wine in the world with export volumes having doubled in the past ten years. According to a study commissioned by the

opportunities for collaborations and expand networks to facilitate development. www.chinaplasonline.com

20th PPPexpo Kenya THE 20th edition of the PPPEXPO 2017 will be staged at The Dome, Nairobi, Kenya from 16-18 June. The past 18 years has seen the PPP trade events attracting prospective trade visitors from over East & central Africa. The events have also proven to be an ideal sourcing platform of enhanced printing and packaging solutions for industry buyers. With high degree of freedom of the press, IUHHLQIRUPDWLRQĂ&#x20AC;RZDQGVWULQJHQWLQWHOOHF tual property protection, East Africa is one of the major printing centres in the East Africa, opening up the African market for exhibitors to capture the aforementioned market opportunities and to promote company image abroad. Its geographical location and

SA Wine Industry Information & Systems (SAWIS), published in January 2015, of the R36.1 billion gross domestic product (GDP) contributed by the wine industry to the regional economy, about R19.3 billion eventually would remain in the Western &DSHWRWKHEHQHÂżWRILWVUHVLGHQWV*URZWK in contribution to GDP has been in excess of 10% per annum since 2003. Exports to Europe and the USA remain strong whilst export sales into Africa are also growing. 0DQ\ZLQHIDUPVKDYHDOVRGLYHUVLÂżHG into other products with olive oil being popular as some of the equipment and machinery used in the production of wine can also be used for producing olive oil. 7KLVEULQJVDGGLWLRQDOEHQHÂżWWRIDUPHUVDV olive trees require little water and need hot conditions to grow, which is ideal in the local climate conditions. â&#x20AC;&#x153;We have been in discussion with many wine farmers and industry suppliers in the Western Cape and they agree that a show of this nature can bring valuable EHQHÂżWWRWKHVHPDUNHWV´VDLG-RVKXD/RZ portfolio director, Specialised Exhibitions

superb supporting facilities and services create a major trading hub. The mega-platform has made this a record-breaking event. Combining forward and backward industry linkages under one roof, the scale of this joint event is unprecedented. Itâ&#x20AC;&#x2122;s the most-anticipated and the largest trade fair in Kenya, introducing the state-of-the-art equipment and technologies. www.expogr.com/kenyappp/media.php

First recycling technology conference in Europe LEADING experts and professionals from DFURVV(XURSHDQGIXUWKHUDÂżHOGDUHWR JDWKHULQ&RORJQHIRUWKHÂżUVW3ODVWLFV Recycling Technology conference. The conference, organised by specialist plastics industry consultancy AMI, takes place on 20-21 June.

Montgomery. â&#x20AC;&#x153;Bringing the new Wine and Olive Oil Suppliers Expo alongside Propak Cape aligns the synergy of both exhibitions. Propak Cape will be showcasing the full industry lifecycle from raw materials and processing to packaging, plastics, printing, labelling, logistics, and warehousing, recycling and waste management. The Wine and Olive Oil Suppliers Expo will cover the full supply chain up to the point of packaging including, but not limited to, suppliers of fertilisers, chemicals, vines, and all the machinery used for separation, ÂżOWUDWLRQDQGDJHLQJRIZLQH´KHDGGHG The Wine and Olive Oil Suppliers Expo and Propak Cape 2017 will be taking place at the Cape Town International Conference Centre (CTICC) from 24-26 October 2017. â&#x20AC;˘ To book a stand, contact Sven Riddle at email: svenr@specialised.com or for international sales contact Dawn Niemack at email: dniemack@specialised.com. For further information, contact Keraysha Pillay at email: kerayshap@specialised.com

In addition to a unique networking opportunity, the event provides expert analysis and discussion in advances to plastics recycling systems, from sorting and cleaning through to compounding and pelletization. Speakers will examine developments in additives for boosting the properties, appearance, compatibility and processability of recycled materials and explore ways to improve the quality of reclaimed materials so that they can be used in higher value applications. Presenters include Stena Recycling Intâ&#x20AC;&#x2122;l, Erema, Toyota Motor Europe, Wipag and Galloo Plastics. The conference closes with a session focusing on getting the most from your plastics recycling lines including papers from Nextek, Starlinger Recycling, B LER and Vecoplan AG. www.amiplastics.com FEB / MARCH 2017 85


DIARY

100% QA focus at

86 FEB / MARCH 2017

EMO Hannover QUALITY assurance will be one of the focus areas at EMO Hannover (18-23 September), the machine tools show in Germany â&#x20AC;&#x201C; to the point where technology is now available that guarantees 100% QA compliance. According to Prof Gisela Lanza of the Karlsruhe Institute of Technology (KIT), metrology for quality assurance from the viewpoint of Industry 4.0 and the Industrial Internet of Things (IIoT) now plays a major role in global production systems. â&#x20AC;&#x153;Thanks to the increasingly important LQĂ&#x20AC;XHQFHRIVHQVRUWHFKQRORJ\ZHZLOO GHÂżQLWHO\EHDEOHWRFROOHFWYHU\PDQ\ more measured data, and thus improve our detection of causal connections. I would even venture the hypothesis that in future we will be recording 100% of all

important measured values. 100% testing means: quality data (meaning all critical parameters) will no longer be acquired by random sampling, but with 100% FRYHUDJH7KLVVLJQLÂżHVDUDGLFDOFKDQJH in quality control, because now we can get a whole lot closer to the tolerance limits,â&#x20AC;? said Prof Lanza. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m predicting intelligent, adaptive QC strategies. One example here might be a revival of pairing strategies, which production people often hate because of the complicated mathematical approach and the logistical outlay involved. Here, components with different quality features are used in pairs, so as jointly to provide the functions of an assembly with very high tolerance requirements. â&#x20AC;&#x153;Pairing strategies are an obvious

option if not every component produced LVDQ\ORQJHUDEOHWRPHHWWKHVSHFLÂżHG tolerances. One example here is the injectors used in engines, which have to work with an operating pressure that in future may reach 3,000 bar. Rigorous deployment of inline metrology will here enable even more intelligent, componentVSHFLÂżFSDLULQJVWREHXVHGLQFRQMXQFWLRQ ZLWKG\QDPLFPRGLÂżFDWLRQRISURGXFWLRQ parameters, which open up multifarious new options,â&#x20AC;? she added.

Industry 4.0 for Plastics Processors: 7 March Maritim Hotel, Cologne, Germany www.amiplastics.com/events

Utech Las Americas: 4-6 April Mexico City: www.utechlasamericas.com

Vinyl SA 2017: 7 June: Hilton Hotel, Sandton www.savinyls.co.za

NAACAM: 5-7 April: ICC Durban www.naacam.co.za

Plastic Closure Innovations: 6-8 June 6RÂżWHO.XUIÂ UVWHQGDPP%HUOLQ*HUPDQ\ www.amiplastics.com/events

ARMSA Rotation: 8-9 March Kloofzicht Lodge Muldersdrift: www.armsa.co.za IOM National Rubber Conference 9-12 March: Khaya iBhubesi Lodge, Parys www.iom3.co.za

EVENTS

From machine tools to precision tools, automation components to customized systems - EMO Hannover 2017, from 16 to 21 of September, is held at one of the largest fairgrounds in the world

Waste Management Indaba: 20-21 April Emperorsâ&#x20AC;&#x2DC; Palace, Johannesburg www.vukani.comms.co.za

MyBusiness Expo: 15-16 March: Gallagher Estate, Midrand: www.mybizexpo.co.za

Plastic Pipes in Infrastructure Conf 25-26 April: Hilton Kensington, London, UK www.amiconferences.com

Specialty Packaging Films Asia: 23-24 March Grand Copthorne Waterfront Hotel, Singapore www.amiplastics.com/events

International Recycling Forum: 26-28 April Hotel Dorint Pallas, Wiesbaden, Germany www.rigk.de/nc/en/forum

BOPP Film: 27-29 March Coral Springs Golf Resort, Florida, USA www.amiplastics.com/events

Interpack 2017: 4-10 May Dusseldorf, Germany: www.interpack.com

Agrofood + Plastpack Nigeria: 28-30 March Landmark Centre, Lagos www.fairtrade-messe.de Feiplastic: 3-7 April: SĂŁo Paulo, Brazil www.feiplastic.com.br North American Pultrusion Conf: 4-5 April Atlanta Marriott Marquis, Atlanta, USA www.pultruders.org Polymer Testing & Analysis: 4-5 April Maritim Hotel, Cologne, Germany www.amiplastics.com/events Food & Drink East Africa: 4-6 April Nairobi, Kenya: www.foodanddrink.co.ke

Machine Tools Africa: 9-12 May Expo Centre, Nasrec,Johannesburg www.machinetoolsafrica.co.za PPP Expo Ethiopia: 12-14 May Millennium Hall, Addis Ababa: www.expogr.com Chinaplas: 16-19 May Pazhou, Guangzhou, China www.ChinaplasOnline.com PVP: 17-19 May Gallagher Conference Centre, Johannesburg www.dmgeventsme.com PPP Expo Kenya: 2-4 June Millennium Hall, Addis Ababa www.expogr.com

www.vdw.de www.emo-hannover.de

Plastics Recycling Technology: 20-21 June Maritim Hotel, Cologne, Germany www.amiplastics.com Intâ&#x20AC;&#x2122;l Thermprocess Summit: 27-28 June ,QWHU&RQWLQHQWDO+RWHO'Â VVHOGRUI  www.itps-online.com



Refocus: 27-29 June: Orlando, Florida, USA www.refocussummit.org African Marine Waste Conference: 9-13 July The Feather Market Centre, Port Elizabeth www.sstconference.org.za KZN Industrial Technology Expo: 26-28 July Durban Exhibition Centre, KZN www.kznindustrial.co.za PPP Expo Tanzania: 22-24 August Dar-es-Salaam: www.expogr.com PIPES XI & PPCA conference: 4-5 September Emperors Palace, Johannesburg www.sappma.co.za Petnology Europe: 11-12 September Munich, Germany: www.petnology.com Drinktec : 11-15 September Munich, Germany www.drinktec.com


CLASSIFIED ADVERTS Advertisers: – Feb / Mar 2017 ARMSA Carst & Walker Composite Plastics DemaPlastech DH Polymers FdB Consulting Green Tech Machinery

65 17 31 37 60 09 01

iCHILL Industrial Chillers Inkulu Plastic Pipes IOM Jenowill Karbochem Masterbatch SA MBT Mould & Die Solutions MGMW Trading Mould Base

25 39 65 03 67 35 21 13,57 33 69

BLOW MOULDERS AND MOULDS Krupp KautexTwin Station Up to 500 ml

Krupp Kautex Single Station Up to 1 Ltr

Myplas Nissei ASB Orion Engineered Carbons Performance Colour Systems Plastichem PlasticsSA Plastomark Protea Chemicals Rawmac Relloy

07 71 49 59 IFC 27 OBC IBC 11 61,77

SABIC

41

Safripol

05

SAPPMA

63

SAPY Colours

43

SES

19

Sun Ace

53

Ultra Polymers

51

W D Hearn Machine Tools

47

West African Group

23

THERMOFORMING, SHEET EXTRUSION, AND MATERIALS THERMOFORMING TECHNOLOGY SAVE 90% of your electricity use with GN! • GN (Canada): machines for reduced waste and reduced energy • Thermoforming Moulds for GN and other thermoformers • ToolVu technology for productivity and NEW quality improvement on thermoforming machines • Complete lines for EPS foam trays and EPS cup moulding NEW

EXTRUSION TECHNOLOGY FROM AGRIPAK OF ITALY Mono & multi-layer extrusion lines for the production of: • ‘Cartonplast’ (twinwall/hollow profile sheet) • Multilayer sheet for packaging • Semi-foamed sheet for thermoforming

MATERIALS FOR THERMOFORMED PACKAGING

R485 000.00 Negotiable In daily production PVC screw and Barrel + HDPE Excellent condition Free Moulds to the value of +/- R200 000.00 Please contact Tel: 033-394 5685 | 083 6299 739 | 082 5610 800

7HFKQLFDO6DOHVSRVLWLRQ ²3ODVWLFFRQYHUWLQJ PDFKLQHU\

• Sealing films for trays and top web for FFS machines • OPS, PP, PET sheet for general packaging • PP/EVOH/PP for high barrier containers

BRE INNOVATIONS Contact: Tim Forshaw (083 381 5253) or Phil Hopkinson (083 408 5253) or 021 671 5253 or mail to tim@bre.co.za

We recycle strapping. Whether heat-sealed or clip fastened. We can take baled or bagged loads. Contact: Melanie on 011 8943520 or email melanie@jcl.co.za

An exciting position has become available at Maritime Marketing for a Technical Sales Representative. This is your opportunity to sell part of our plastic converting machinery range within Southern Africa. Package: Basic salary, commission, petrol card. Dependant on experience. For more information please contact Gwen Pugh on 011-466 1717

(1*(/63$5(3$576

Recycle your plastic with us We buy most forms of clean factory waste

STOCK CLEARANCE OF ENGEL INJECTION MACHINE SPARES. VALVES, PUMPS, MOTORS, CARDS ETC. CONTACT GODFREY / GWEN 011 466 1717

Contact: Desiré Preston for more info Tel: 011 894 3520 | Cell: 083 774 6038 | Email: desire@jcl.co.za www.jcl.co.za

:H%X\DQG6HOO 3ODVWLF3DOOHWV 083 756 6897 ZZZSUHPLHUSDOOHWVFR]D

7RSODFHDFODVVLÀHG DGYHUWSOHDVH Fax: 086 519 6089 or Tel: 021 712 1408 or E-mail: saplastics@iafrica.com ZZZVDSODVWLFVFR]D FEBRUARY / MARCH 2017

87


SPORT

6SRUW,QÃ&#x20AC;QLW\² GHÃ&#x20AC;QLQJWKHIXWXUHRI PDWHULDOUHF\FOLQJ

The research programme focuses on football sporting goods, in particular shoes. In a design-driven approach, the automation potential of various moulding processes will be exploited, potentially enabling the production of a shoe in one step

88 FEBRUARY / MARCH 2017

BASF helps make sporting goods more sustainable BASF is one of ten members of industry and science working together on the SURMHFWµ6SRUW,Q¿QLW\¶6SHDUKHDGHGE\ adidas and funded by the European Commission, the three-year project aims at identifying and developing recyclable, SDUWO\ZDVWHEDVHGWH[WLOH¿EUHUHLQIRUFHG FRPSRVLWHV7KHVHPDWHULDOVHQDEOHWKH fast production of easily customizable VSRUWLQJJRRGV 7KHUHVHDUFKSURJUDPPHIRFXVHV on football sporting goods, in particular VKRHV,QDGHVLJQGULYHQDSSURDFKWKH automation potential of various moulding processes will be exploited, potentially enabling the production of a shoe in one VWHS7KHJRDOLVDQHZEUHHGRIVSRUW

ing goods that will not be discarded, but UHXVHG$XVHGIRRWEDOOVKRHIRULQVWDQFH could be collected and shredded into tiny pieces, of which every gram is reproFHVVHG&RPELQHGZLWKYLUJLQPDWHULDODQG UHLQIRUFHGZLWKVHOHFWHG¿EUHIURPVLPLODU or alternative waste sources, a new shoe FDQEHPDQXIDFWXUHG 7KHFKDOOHQJHOLHVLQDFKLHYLQJWKH desired product performance level in a UHSHDWHGPDWHULDOUHF\FOLQJORRS%$6)¶V extensive polymer know-how will play an integral part in developing new materials and tailoring them to the manufacturing SURFHVV5HF\FODELOLW\LVDGHWHUPLQLQJSD UDPHWHULQWKHPDWHULDOVHOHFWLRQSURFHVV Polymers, either from industrial or

sportswear waste sources, will be reengineered to the key manufacturing SURFHVVHVIRU6SRUW,Q¿QLW\7KHVHSUR cesses use almost every gram of mateULDODQGGRQRWSURGXFHZDVWH0RUHRYHU they enable consumers to customize their football shoes in shape, colour, and GHVLJQ&RQVXPHUVFDQWKXVEHFRPH creators without having to worry about ZDVWH8OWLPDWHO\WKHJRDOLVWRRSWLPL]H the process to a degree that enables the highly automated production of shoes in DVLQJOHSURFHVVVWHS

www.performance-materials.basf.com


The Protea Chemicals Team offers innovative solutions to industry with the backing of world class products, suppliers and industry professionals.

JOHANNESBURG 011 821 3300 jhbsales@ proteachemicals.co.za

CAPE TOWN 021 550 8100 capeorders@ proteachemicals.co.za

DURBAN 031 468 5424 orderskzn@ proteachemicals.co.za

www.proteachemicals.co.za

PORT ELIZABETH 041 403 1000 peorders@ proteachemicals.co.za


Sa plastics feb mar 2017 for web  

SA Plastics, Composites & Rubber magazine was launched in 2002 by Summit Publishing, based in Cape Town and owned by publisher/editor Martin...

Read more
Read more
Similar to
Popular now
Just for you