Issuu on Google+

sun Hailey

Ketchum

Sun Valley

Bellevue

Carey

the weekly

s t a n l e y • F a i r f i e l d • S h o sh o n e • P i c a b o

Fools Announce Their Summer Production Page 3

Bryant Dunn to Speak on Fly-Fishing the Himalayas, Thursday

Szabo Reviews Medicine Mountaineering Book Page 6

Love: Do Something That Makes You Smile

read about it on PaGe 10

Page 11

A p r i l 3 , 2 0 1 3 • V o l . 6 • N o . 1 4 • w w w .T h e W e e k l y S u n . c o m

Defining

Kapala

SKI HALL OF FAMER

STORY & PHOTOS BY KAREN BOSSICK

Ian McFeron plays Saturday night in Hailey. COURTESY PHOTO

Brewery Concert to Feature Ian McFeron BY KAREN BOSSICK

I

an McFeron could easily have been teaching at an inner-city school this week. But, instead, the Seattle-based folk rocker will be in Hailey playing selections from his seventh studio recording, “Time Will Take You,” which he just released on Tuesday. McFeron will play songs from the album during a free concert at 7:30 p.m. Saturday at the Sun Valley Brewing Co. in Hailey. The album, which was produced by Doug Lancio—the Grammy-nominated producer for Patty Griffin—almost didn’t come to fruition. After a decade of touring nationally and internationally, McFeron was considering a career change. He was playing 200 shows a year but still living hand to mouth. Unable to make a decision whether to teach or continue being a musician, he penned “That’s the Truth,” a song about getting unstuck and searching for new bearings in confusing times. As he wrote the song, he realized he had love, he had music to write and he had enough money to get by. And, soon, he found himself in a recording studio with his fiddler Alisa Milner and bassist Norman Baker, as well as Brad Pemberton and pedal steel player Jon Graboff of Ryan Adams’ Cardinals and Nashville-based piano player Micah Hulscher. The album’s name, “Time Will Take You,” is a line from one of the songs. But it also offers a message of comfort, a reminder that hard times pass. “It’s a central theme—that time has a way of carrying you, even when you feel frozen in space,” said McFeron. “With enough time and enough hope, you get to where you are meant to be.” The album features fewer stories of heartbreak and more stories from the road, along with references to the things you don’t lose to foreclosure or a broken stock market ticker—things like friends and family. “It’s a brighter record than ‘Summer Nights,’ which I loved for its late-night introspective mood,” said McFeron. “The new songs are more upbeat and fun and more playful, although it still digs into some soul searching.” Then, on Sunday, April 7, local band Finn Riggins, who just finished a huge tour with Built to Spill, will take the Brewery stage at 9 p.m. Cover for that show is $3/person. tws

R

ick Kapala rubs his toe in the snow and scowls. Instinctively, he knows the young skiers on his ski team are going to have problems with snow building up under their skis given the spring snow conditions at the Lake Creek training area. He throws a bunch of no-wax skis in the tub behind his snowmobile and ferries them out to the ski tracks where he begins handing them out, along with some skiing advice. “Peter, we want your arms swinging full extension, not that short little swing,” he tells one young skier as he approaches the staging area. “Be sure your nose is over your knee—you’re maybe not as centered as you could be,” he tells another. “Go back down there when (Zachary) Lindahl comes around. Jump on behind him and mimic him as he goes around the track.” The young racers circling the trails hang on every word. After all, Kapala has been named the U.S. Coach of the Year several times and his program has twice been named the U.S. CrossCountry Club of the Year. What’s more, the man who was inducted into the Sun Valley Ski Hall of Fame earlier this year has coached internationally for the United States at world championships and world junior championships. “Rick has built an amazing program—he’s well known across the world for his coaching skills and what’s he’s done with these young athletes,” said Bob Rosso, who was involved with Sun Valley’s Nordic race program in its infancy. Kapala himself aspired to be an Olympic wrestler but an injury he sustained during a pick-up football game at Michigan Tech forced him to drop contact sports. He began cross-country skiing with his college buddies—his “tribe,” as he calls them—to stay fit and was smitten with the sport’s challenge and solitude. “Wrestling is a tough sport—you have to diet, you have to be one-on-one with another person, you’re pushed to a really high level of discomfort, which I liked,” said Kapala, who majored in biology. “In many ways, cross-country skiing is similar—you’re on a team but it’s an individual sport that requires a lot of individual sacrifice. What’s different is your gym is the great outdoors, whether you’re roller skiing or running through the woods.” Kapala admits that he was never the strongest guy on the team but he did well enough to earn a scholarship. “The coaches were accepting of me as not the best guy on the team but as an important component of the team—I was always made to feel wanted,” he added. Kapala says he’s tried to carry that philosophy over to his own program. “We want to win ski races, but that’s not the point. Most of the kids in our program will not go to the Olympics—maybe they will not ever race. But that doesn’t mean their participation is not important, that they can’t use their time with us as a vehicle for human growth. “We’re not fighting world hunger here. The kids know I’m competitive, but I never let that cloud our big mission, which is to

Rick Kapala says he strives to be a servant when coaching. His craziest dream, he said, is to host a World Cup Nordic race in Sun Valley.

get kids out of doors and have them learn to push themselves beyond their comfort level. At the end of the day, all we’re doing is skiing around in circles with funny little suits and sticks on our feet. But I watch them and I know they’re going to be successful human beings. I get to see them grow up, become confident, ready to take on the world.” However understated, Kapala and his coaches have had some notable successes at the highest levels of the sport, from Morgan Arritola and Simi Hamilton, who competed in the 2010 Winter Olympics in Vancouver, B.C., to more than three dozen kids who have become national champions and gotten invites to such notable events as the Scandinavian Cup and world junior teams. Kapala says he learned more from Arritola than, he’s sure, he ever taught her. Ditto for many of his other athletes. “You don’t make Olympians out of your athletes. They’re given

continued, page 13


COOKING SHOULD NEVER BE DULL Interdesign

.BSDI.BEOFTT

LOCAL’S RED TAG SPECIAL

Knife Clearance

Organizers

Popcorn Popper

Selected: Henckels, WĂźsthof, Shun, Viking and Global

- Cabinet, kitchen, fridge, pantry

UP TO 75% OFF

ALL STOCK 25% OFF

- #CPM-700 BK

SUGGESTED RETAIL

Spring Organizing

- Easy Clean-up

Wellness

Anti-Fatigue Mats - 2’ x 3’ - Made in the U.S.A.

SUPER SPECIAL $ 88

88

KK REG. $119.99

Check out the ‘New’ Antique Look!

59

KK REG. $72.00

Multi-Cookers and Slow Cookers

13-Cup Food Processor

FROM $79.99

- #KFP1333 CU/WH

- 4 and 6.5 qt

ALL STOCK 25% OFF One Time Local’s Special

SPECIAL 99

199

$

KK REG. $249.99

Bialetti

Mama Francesca

Pasta

SUPER SPECIAL:

- 1 lb. - Product of Italy - Choose from: Spaghetti, Fettuccine, Penne, Elicodali, Shells, Farfalle, Fusilli or Cappellini

9 for $ 99 9

3FSVOPGB4FMM0VU

Non-Stick Fry Pans - White Ceramic, non-stick - Safe for all cooktops - Oven safe to 400Âş

- Choose from: 8Ë?, 10Ë? and 12Ë? fry pans or 11Ë? deep sautĂŠ pan with lid

FROM $2999

Frank Granato Importing Co.

Mavea

Canned Organic Tomato Products

Water Filtration Pitchers German Technology

SPECIAL $ 99

- # KM1000 - Programmable

-JNJUFE2VBOUJUJFT

Spring Cleaning

- No pre-soaking of �ilters

Including FREE Wabash Farms Popcorn

10 Cup Coffee Maker

ALL STOCK 25% OFF

ONLY 99

49

$

- Pops up to 16 cups

Kitchen Brooms

- 5 or 9 glass

3*<

SPECIALS FROM $ 99

29

Frank Granato Importing Co.

Frank Granato Importing Co.

Extra Virgin Olive Oil - 33.8 oz

- 28 oz.

- First cold-pressed

- Choose from: Diced, Puree, Whole Peeled, or Crushed

SPECIAL $ 99

9

KK REG. $14.99

12 Qt.

Pasta Steamer Set Grated Romano or KK REG. $2.79 Parmesan 3FSVOPGB4FMMPVU SUPER BUY ONE Cheese SPECIAL SPECIAL $ 99 GET ONE FOR 1/2 PRICE $ 3 (OF EQUAL OR LESSER VALUE) 9999 KK REG. $4.99 KK REG. $150.00 Sugg. List $3.29

- # 77-412 - Stainless - Stock pot, pasta insert, and steamer insert

- 8 oz Sugg List. $6.39

SALE GOOD THRU TUESDAY, APRIL 9, 2013

9-6 MON-FRI â&#x20AC;˘ 10-6 SAT & SUN (208) 726-1989 GIACOBBI SQUARE, KETCHUM SERIOUS KITCHENWARE 

Th e W e e k l y S u n â&#x20AC;˘

Ap r i l 3 , 2 0 1 3


Rieko Aizawa to Headline Concert

jane’s artifacts arts / / crafts / / papers / / office / / party

BY KAREN BOSSICK

R

ieko Aizawa was just 13 when she was discovered by the late Alexander Schneider. She performed as a soloist with his Brandenburg Ensemble at concerts marking the debut of Tokyo’s Casals Hall. And at 14 she was booked into the Kennedy Center and Carnegie Hall performing Mozart’s “Concerto No. 12 in A Major” with Schneider’s New York String Orchestra. On Tuesday the now-38-yearold Japanese-born pianist will headline the final concert in the Sun Valley Artist Series 2012-13 season. She’ll perform music by Beethoven, Chopin, Ibert and Grieg at 7 p.m. at the Church of the Big Wood in Ketchum. The series’ artistic director, Susan Spelius Dunning Gannon, will offer an entertaining Meet the Artist question-and-answer session with Aizawa preceding the concert at 6:15 p.m. Tickets, which range from $10 to $24, are available at Ketchum bookstores. Aizawa also will present a special performance for the students and parents of the Community School, The Sage School and Pioneer Montessori School at 4 p.m. Sunday at the Community School Theater. Aizawa will present a master class featuring three or four local piano students performing on stage during the presentation. Aizawa, who has been praised by “The New York Times” for her “impressive musicality, crisp touch and expressive phrasing,” has performed throughout the world, including Boston’s Symphony Hall. The proud holder of a Master’s degree from the Juilliard School of Music, Aizawa became the artistic director of the Alpenglow Chamber Music Festival in Colorado in 2010. She is about to release her second solo CD. Aizawa comes to Sun Valley fresh off a tour of India. “Dealing with different pianos for every concert has certainly been a challenge. However, adjusting to the instrument, no matter what the conditions—and with limited time—is a part of a pianist’s responsibility,” said Aizawa, who typically has just a few hours before a concert to get used to her ivory-keyed partner. “I always try to have a positive attitude, to focus on making music with as much joy as possible.” (Aizawa will get to perform on Gannon’s 9-foot Steinway concert grand piano at both the Community School and the Presbyterian Church.) Though born in Japan, Aizawa moved to the United States when she was 15 and now lives in New York City. “Although I appreciate my home country, as a musician

I feel freer and more comfortable here. New York City is a wonderful cosmopolitan city, full of energy and excitement. And it allows me to explore many different things in the artistic realm,” Aizawa said. One of Aizawa’s recent explorations is the Prism series she did in Japan. She presented three recital programs, each highlighting the music of three different composers. And in each she performed a commissioned work written with the idea of paying homage to the featured composer. Japanese composer Akira Nishimura wrote a mysterious work, “Night Spell,” inspired by Ludwig Van Beethoven’s “Moonlight Sonata.” Japanese composer Toshiro Saruya wrote the fantasy-like “Illusion,” inspired by Johannes Brahms. And American composer Dan Coleman wrote the beautiful “Night Singing” in response to one of Franz Schumann’s songs. “Giving a world premiere of works by these composers, whom I respect greatly, was an honor for me. I was also very happy to learn that this homage concept let the audience feel closer to the contemporary music,” she said. Aizawa said she will perform a shorter and somewhat more accessible program for the kids on Sunday, talking about each piece as she goes. “However, I will still give them the same repertoire from my regular recital program. They deserve to taste the real thing—I prefer not to give them a typical ‘kid’s menu!’ ”

Spring Deals are Hatching! And, we have new product arriving daily! Come by and see! M-F 8–6:30 • Sat 8–6 • Sun 10–5 • 106 S. Main, Hailey • 208.788.0848

If you go… What: Pianist Rieko Aizawa in concert When: 7 p.m. Tuesday (question-and-answer session begins at 6:15 p.m.) Where: Presbyterian Church of the Big Wood, Warm Springs and Saddle roads in Ketchum Tickets: $24 available at Chapter One Bookstore and Iconoclast Books in Ketchum or online at www.svartistseries. org. Student tickets are $10 at the door. tws

Fools’ Summer Production BY KAREN BOSSICK

C

ompany of Fools, it appears, has suspended with the foolishness since merging with the Sun Valley Center for the Arts. The theater group did not hold its annual Fools Day event announcing its upcoming season in order to blend its programming announcement with The Center’s in August. That said, the Fools has announced its upcoming summer production, which will run July 2 through 27 at The Liberty Theatre. That would be John Robin Baitz’s “Other Desert Cities.” The play revolves around a woman who announces that she

is about to publish a memoir dredging up a pivotal and tragic event in her family’s history, even though it’s a wound her parents, her brother and aunt don’t want reopened. She draws a line in the sand and dares them to cross it. A “Vogue” critic called it a “scathingly funny, deeply felt family drama… with a wisdom and compassion and sureness of touch.” The cast will include Keith Moore, Denise Simone, Patsy Wygle and New York-based actor Hanna Cheek. Rusty Wilson, who co-founded Company of Fools, will direct it. Tickets go on sale May 20. tws

Th e W e e k l y S u n •

Ap r i l 3 , 2 0 1 3




what you’ll find in this issue

habitat for non-humanity

erc beat

Have a Mouse in the House?

D Plotts See Healing in Ethiopia Page 6

o you have a pest problem but want to reduce the use of chemicals in your home? One ERC member has a few suggestions to keep your home a healthy one. Is there a mouse in the house? Cats make great natural “mousetraps.” If a cat isn’t an option, live traps can be used and released away from the home. To prevent rodents from entering, seal up cracks and holes, trim plants, seal food, keep a tidy house, don’t let garbage accumulate, and clean up standing water. Ants stealing your picnic? Plant a natural barrier of spearmint and basil. Inside the home, discourage ants with a sprinkle of cayenne pepper, garlic, cinnamon, charcoal, bone meal, talcum powder or chalk. Flies and moths driving

5b recycles

Orage Masters To Turn Dollar Into Three-Ring Circus Page 7

Chamber Corner Features Clean Web Design Page 10

sun the weekly

phone / fax, mailing, physical

Phone: 208-928-7186 Fax: 208-788-4297 16 West Croy St. • P.O. Box 2711 Hailey, Idaho 83333 when you can find us here

Mon– Friday 8 a.m. - 5 p.m. the folks who work here

owner/Publisher: Steve Johnston • 208-309-1088 steve@theweeklysun.com Sales and Marketing: Steve Johnston • 208-309-1088 steve@theweeklysun.com Leslie Thompson • 208-309-1566 leslie@theweeklysun.com Editor: Leslie Thompson Staff Writer: Karen Bossick • 208-578-2111 kbossick@cox-internet.com Copy Editor: Patty Healey Production Manager: Leslie Thompson • 208-928-7186 leslie@theweeklysun.com Graphic Designer: Mandi Patterson accounting: Shirley Spinelli • 208-788-4200 accounting@theweeklysun.com

you crazy? Mothballs should never be used because of their toxicity; try glue traps near attics and basements or a squirt from a spray bottle filled with a solution of one-third cup of mild dishwashing liquid to one gallon of water. Vacuum up fallen insects. Mosquito season isn’t far off, so plant marigolds or catnip in your yard to repel them. Install bat and bird houses to encourage natural predators for mosquitoes. Ban the “bug zapper” because studies show that many bugs killed in electrocution traps are beneficial insects. Next week, more on pesticides. Have a question, or want to write your own ERCbeat? Contact the Environmental Resource Center at 208.726.4333 or tws reduce@ercsv.org.

A Little Change Adds Up

T

he changes in the county’s recycling program as of October 1, 2012, mean that mixed paper, plastics 1-5 and aluminum/steel/tin are accepted curbside and at drop-off locations. Aluminum/steel/tin is a big category—but what does it include? Acceptable aluminum/ steel/tin items include soda and juice cans, disposable food tins (tuna, soup and cat food cans), and clean or slightly used foil. Aluminum in particular is a great (and easy!) item to recycle, and it’s often called infinitely recyclable. About two thirds of the aluminum ever made is still in existence, and used aluminum cans are recycled and returned to a store shelf as a new can in as few as 60 days! Isn’t that incredible? An awesome 106,000 cans are recycled every minute, but if every American recycled

just one more can per week, we could boost recycling rates from 57 percent to 75 percent. How about we try that here in Blaine County. When recycling your aluminum/steel/tin, it’s very important to rinse the containers before putting them in your bins. The leftover food residue can mold, spill onto other recyclable items and contaminate them, and cause damage to recycling center machines. When recycling, it’s very important that only items that can be recycled are placed in recycling bins. Even a small amount of the wrong material can cause contamination, making it nonrecyclable and headed for the landfill. When it doubt, throw it out. For a list of all the acceptable items in Blaine County, visit 5brecycles.org tws

This Column is BroughT To You BY 5B reCYles 5b recycles is Blaine County’s recycling program.

Visit 5brecycles.org for updated information and resources.

Send your recipes! When we run yours, you get a $20 gift card to Albertsons! chef@theweeklysun.com

Harrison Hotel BEST BEDS IN BOISE

4QSJOHIBTTQSVOH BOEXFµSFDFMFCSBUJOHXJUI PVS#4QSJOH4BWJOHT 1st Night: $7000 • 2nd Night: $6500 (THROUGH JUNE 20, 2013)

We will indulge you with our oversized rooms, complimentary breakfast, down comforters and exemplary service!

deadlines • Get it in or wait

Display or Classified Ads Monday @ Noon Calendar or Press Releases Friday @ 5

our entire edition is online

www.TheWeeklySun.com or www.TheWeeklyPaper.biz

www.facebook.com/WeeklySun twitter.com/#!/TheWeeklySun



Dawn near the Al Aqsa Mosque, Jerusalem.

Jerusalem, a City For Everyone STORY & PHOTO BY BALI SZABO

P

rofessional photographers are like fishermen and farmers—they have to get out of bed. I was in Jerusalem, my first morning in this storied city, the Center of the World to some. The publisher of the book we were working on warned, “Don’t waste your time here. There’ll be an overload of pictures from Jerusalem, so it’s unlikely you’ll get published. The same for the Dead Sea.” He, his favorite photographer and I left the hotel at 5:30 a.m. and headed for the pink-and-white limestone ramparts of East Jerusalem. They dropped me off at the east-facing Lion’s Gate, and I began the slow walk along the cobbled Via Dolorosa toward the 1000-year-old Church of the Holy Sepulcher. It was overcast, and with no light, there’d be no pictures. Or so I thought. One step inside the gate, and immediately felt the old city’s gravity (the streets are too narrow for cars), the weight of history, its spiritual lore, its reality and reputation for being the most contested city in the world. A city known for its miracles had one for me. The rising sun broke through a gap in the clouds and flooded the old street with its magenta light. I was in the perfect spot for the perfect shot. I got it and I knew it. (In spite of the publisher’s skepticism, the picture became a full-page frontispiece for the Jerusalem chapter.) History is nothing if not tidal. Jerusalem, the ‘City of Peace’, has had little of it. This City on a Hill, 2500 feet above sea level, in spite of its walls and elevation, was never secure without a conqueror’s umbrella. It sits near the intersection of three continents—Africa, Asia and Europe. It’s also a home to the three great monotheistic religions of the world. It was never a

political, military or commercial center of power. That resided in Damascus, Beirut, Baghdad, Rome, Constantinople, Persia and Europe, and in time, they all came a’calling. Jerusalem (JebuSalem) documents the rising and waning of imperial fortunes. The area had been inhabited by Arab Jebusites, a moon-worshipping people, headquartered in Jericho, since 9000 BCE (Before Common Era). In 1000 BCE, King David and his son Solomon built a temple around the rock where Abraham was to sacrifice Isaac. It was called the Holy of the Holies, and housed the Ark of the Covenant. It stood until the Babylonians destroyed it in 597 BCE. When the Jewish residents refused to adopt their polytheistic religion, they were exiled to Babylon. Here they had a great epiphany—the city around their beloved Mount Zion became enshrined as the City of God. In 539 BCE, the Persian, Cyrus the Great, conquered Babylon and let the Jews, who by 515 BCE had rebuilt their temple, return home. In 100 BCE, the Syrians razed Jerusalem, and the Romans did the same in 137 A.D. The Islamic armies took over in 637 A.D. and promptly built the Dome of the Rock atop the Temple Mount that reputedly has Mohammed’s footprint as he ascended to heaven. As a token of respect paid to the other Abrahamic religion, Judaism, they built their own mosque, the Al Aqsa, a discreet distance from the Haram-al-Sharif (Noble Sanctuary). Both survived the Crusades and stand to this day. Today, the city is home to secular Jews, the Hasidim, secular Arabs, Muslims, Jewish Arabs, Christians, to 30 denominations, 15 language groups and seven different alphabets. This city does not belong to anyone, or any two groups. It never has, and I doubt it ever will. tws

correction 1.800.376.3608 • 409 S. Cole Road, Boise, ID www.HarrisonHotelBoise.com Th e W e e k l y S u n •

In last week’s story examining a freestyler who found healing by returning to skiing 28 years after suffering an accident, we identified Marc Mast as the founder of Sun Valley Adaptive Sports. But we neglected to note that he now works with Paralympians and others through the Wood River Ability Program (WRAP). The Weekly Sun

Ap r i l 3 , 2 0 1 3


student spotlight

briefs

Through the Looking Glass BY JONATHAN KANE

A

lison and Miranda Gasenica have a reputation for always being together. That makes sense because the two Wood River High School seniors are identical twins and have lovingly followed in each otherâ&#x20AC;&#x2122;s footsteps since birth. It also means that they have a lot of similarities besides looks that enter into every phase of their lives, including identical 4.2 grade point averages. For Miranda, she wouldnâ&#x20AC;&#x2122;t think of having it any other way. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s just really unique,â&#x20AC;? she said. â&#x20AC;&#x153;To have your best friend by your side every day is truly amazing. Not everyone experiences what we feel in the way that we always have that someone so close to us to go through life with.â&#x20AC;? For Alison itâ&#x20AC;&#x2122;s â&#x20AC;&#x153;the way that we always finish each otherâ&#x20AC;&#x2122;s sentences, no matter what. Itâ&#x20AC;&#x2122;s also true that you can both feel for the other emotionally in a pretty strong way. You can actually hurt when the other one cries.â&#x20AC;? The two girls lived in Indian Creek until seventh grade and then they moved to Hailey. Although they are now 18, they dressed in identical outfits until the fifth grade. â&#x20AC;&#x153;Our parents finally realized that we needed to break apart and be who we are. As babies we would each have a toenail painted a different color so that we wouldnâ&#x20AC;&#x2122;t be mixed up. That lasted until we were about three or four and our hair grew in. Iâ&#x20AC;&#x2122;m just really used to being called Miranda,â&#x20AC;? said Alison. â&#x20AC;&#x153;It happens about twice a day and Iâ&#x20AC;&#x2122;ll just turn and nicely explain that Iâ&#x20AC;&#x2122;m not her. Itâ&#x20AC;&#x2122;s not really weird. Our little trick is that I part my hair on the left and Mirandaâ&#x20AC;&#x2122;s on the right. Our faces have changed a lot since weâ&#x20AC;&#x2122;ve matured but we still get

The Gasenica twins at a younger age.

Alison and Miranda Gasenica

mixed up a lot. Weâ&#x20AC;&#x2122;ve always been in the same class since sophomore year and our teachers donâ&#x20AC;&#x2122;t always enjoy it.â&#x20AC;? They have both loved growing up here. For Miranda it â&#x20AC;&#x153;is such a beautiful place. I love the outdoors and you can just go outside and be in nature.â&#x20AC;? Alison remarks that her parents are avid skiers and that her grandmother is a ranger so there has always been a big appreciation of the outdoors. â&#x20AC;&#x153;We were just brought up in this amazing environment where we can do things like hike at any

time of the day. Of course, itâ&#x20AC;&#x2122;s small here, so everyone pretty much knows your business. You hear about twins pulling off pranks but everyone here knows us, so we have to plan stuff like that out in advance. Mirandaâ&#x20AC;&#x2122;s boyfriend once hugged me by mistake but weâ&#x20AC;&#x2122;ve never tried to fool people on purpose.â&#x20AC;? For the girls, their real passion in life revolves around academics and soccer. At Wood River they have tackled a number of Advanced Placement classes including U.S. history,

COURTESY PhotoS

language and composition, micro- and macroeconomics, government and statistics. For both girls economics and math are favorite subjects, with both leaning toward specific careers. Miranda wants to work in a city as part of a large marketing firm and will major in economics, and Alison wants to get into the nutrition field and hopefully travel and work in Third World countries. They both have high hopes for their separate futures, but could anything less be accepted from two very bright students? tws

This Student Spotlight brought to you by the Blaine County School District Our Mission: To be a worldclass, student focused, community of teaching and learning.

For the latest news and happenings at BCSD sign up to receive our BCSD Weekly Update on our website: www.blaineschools.org

â&#x20AC;&#x153;Likeâ&#x20AC;? us on Facebook and sign up for RSS Feeds from our home page and each schoolâ&#x20AC;&#x2122;s home page too. Go to â&#x20AC;&#x153;Newsâ&#x20AC;? at www.blaineschools.org

Zions Pays for Aâ&#x20AC;&#x2122;s

The average teenager now sends and receives about 60 text messages each day, and spends about nine hours a week on social networks. As researchers quantify modern teenage life, Zions Bank is rewarding teens who work hard for one timeless status update: â&#x20AC;&#x153;Got an â&#x20AC;&#x2DC;Aâ&#x20AC;&#x2122; today.â&#x20AC;? Grades still matter, and students like Wood River High School freshman Zuly Lapa know it. Lapa recently won a $100 scholarship savings account through the Zions Pays for Aâ&#x20AC;&#x2122;s program, which partners with parents and teachers to recognize academic achievement. Open to all Idaho and Utah students ages 13 through 18, the Zions Pays for Aâ&#x20AC;&#x2122;s program offers cash incentives for good grades. To participate, students bring their most recent termend report cards from the current academic year into any Zions Bank location. Theyâ&#x20AC;&#x2122;ll receive $1 per â&#x20AC;&#x153;Aâ&#x20AC;? deposited into their savings accounts, or .50 cents per â&#x20AC;&#x153;Aâ&#x20AC;? if they opt for cash. For each â&#x20AC;&#x153;Aâ&#x20AC;? on their report cards, students receive automatic entries to win one of 152 regional scholarship prizes worth $100 and one grand prize worth $1,000. Teens need not be customers of Zions to participate. Find more information and full contest details at www.zionsbank.com/pays4as

Autism Awareness

Higher Ground Sun Valley will hold an Autism Awareness Reception from 4 to 6 p.m. Saturday at the Starbucks Visitors Center in Ketchum. It was to have been held in the new Velocio (formerly Tullyâ&#x20AC;&#x2122;s), but the new coffee shop will not be ready in time to host the reception. Those who stop by will have a chance to view artwork from schoolaged kids between the ages of 6 and 12 who have been diagnosed with autism/autism spectrum disorder. The kids created bowls in a special afterschool get-together at The Bead Shop in Hailey. Refreshments will be served. For more information contact Higher Ground Sun Valley at 726-9298 or info@highergroundsv.org <mailto: info@highergroundsv.org>

TODAY! WeDnesDAY, Wednesday, April 3: April 3: Registration for All-Day Kindergarten, Dual Immersion Kindergarten, & Half-Day PRESCHOOL (5 days/week) Students entering Kindergarten and PRESCHOOL muStEHDJHĂ&#x20AC;YH . RUIRXU 3UH. RQRUEHIRUH School

Bellevue, Hailey, and Woodside Elementaries

Hemingway Elementary

Carey School

Times

11:30 AM - 7:00 PM The Community Campus (1050 Fox Acres Rd)

8:30 - Noon, 1:00 - 3:30 PM

1:00 - 3:00 PM

Hemingway Elementary

Carey School

Locations

Your checklist for registration: 92ULJLQDO67$7(&(57,),('%LUWK&HUWLĂ&#x20AC;FDWH - 1RWDKRVSLWDOFHUWLĂ&#x20AC;FDWH 9 . ,PPXQL]DWLRQ5HFRUG with: 5 DPT 4 Polio, 2 MMR, 3 HEP B, 2 Varicella, 2 HEP A  3UH. ,PPXQL]DWLRQ5HFRUG with: 4 DPT 3 Polio, 1 MMR, 3 HEP B, 1 Varicella, 1 HEP A* 9'RFXPHQWHG3URRIRI5HVLGHQF\ with a PHYSICAL address in Blaine County Â&#x2021; TWO (2) CURRENT UTILITY BILLS, written proof of utility service, or lease agreement indicating utilities paid with lease; any of which include name and physical address in Blaine County; AND one (1) of the following additional documents: Â&#x2021; VALID IDAHO DRIVERâ&#x20AC;&#x2122;S LICENSE OR STATE ISSUED I.D. CARD indicating physical address in Blaine County. Â&#x2021; A PROPERTY TAX BILL indicating physical address in Blaine County. Â&#x2021; A CURRENT LEASE AGREEMENT indicating physical address in Blaine County. Â&#x2021; A NOTARIZED AFFIDAVIT SIGNED AND SWORN FROM CURRENT LANDLORD OR HOMEOWNER of physical address in Blaine County. Â&#x2021; IDAHO TAX RETURN indicating physical address in Blaine County. 9&KLOG¡V'D\&DUHLQIRUPDWLRQ - ZLOOGHWHUPLQH\RXUFKLOG¡VVFKRRORIDWWHQGDQFHLI\RXUFKLOGZLOOEHULGLQJWKHEXV 9PRESCHOOL Only - ,QFRPHYHULĂ&#x20AC;FDWLRQ - copy of 2012 Federal Tax Return from both parents. $OOPRESCHOOLSURJUDPVDUHWXLWLRQEDVHGXVLQJDVOLGLQJIHHVFKHGXOH6SDFHIRUPRESCHOOLLVOLPLWHGDQGDYDLODEOHRQDĂ&#x20AC;UVWFRPHĂ&#x20AC;UVWVHUYHEDVLV $ZDLWLQJOLVW ZLOOEHPDLQWDLQHGLIVSDFHEHFRPHVDYDLODEOH * Idaho legislature requires proof of completion of immunization requirements at time of registration for Kindergarten. Contact South Central Public Health District at 788-4335 or childâ&#x20AC;&#x2122;s primary provider for YDFFLQDWLRQDSSRLQWPHQWV,GDKR,PPXQL]DWLRQ5HTXLUHPHQWVFDQEHIRXQGDWLULVLGDKRJRYRUFRQWDFW/LQGD/XEHFN513+1DW

Call the Blaine County School District for more information, 578-5000 or visit www.blaineschools.org Th e W e e k l y S u n â&#x20AC;˘

Ap r i l 3 , 2 0 1 3




did you know?! Don’t miss out on a thing this Summer! Obama Girls Ski Baldy 2013

5IF/FXFTU4VNNFS&EJUJPOPG5IF8FFLMZ 4VOµT"NB[JOH5IJOHTUP%P.BHB[JOF XJMMCFPOTIFMWFT.FNPSJBM%BZ8FFLFOE 4VCNJU$BMFOEBS*UFNT"E3FTFSWBUJPOT/08

101@theweeklysun.com

Please Join Chef Steve and The Connection for our First Bibs and Ribs Fundraising Feed

Support Meals on Wheels

Ribs and Bibs Feed

BY KAREN BOSSICK

Bring the Whole Family!

L

25/adults • $10/children 12 & under

721 3rd ave South, Hailey

RSVP Today: Barbara at 788-3468

The Connection

721 3rd Ave. S., Hailey • www.BlaineCountySeniors.org • (208) 788-3468

“Main Street Service” How much do you really know about insurance? You know that you have to have it, but there are lots of options. Lindy and Betty would like to remind you that they are here to help you navigate to find the best choice for you and your family. Bisnett Insurance are strong partners with Safeco, Travelers and Liberty Northwest, along with numerous other carriers.

We know you because we’re a lot like you. Take the time to Call us today and Get a Quote on…

Auto • WAtercrAft • Home • umbrellA • HeAltH • life • business • rentAl

We’ll make it easy for you! Lindy Uberuaga Sales Agent lindy@bisnett.com Betty Urbany, CIC Sales Agent burb@bisnett.com 631 E. 2nd St., Ketchum (208) 726-8866 • www.bisnett.com 

T

hey checked in under assumed names. And they listed their address as Hawaii. But those furtive stares of men with ear pieces gave away the fact that the Obama girls were in town. Twelve-year-old Sasha and 14-year-old Malia Obama spent a couple days skiing Baldy this past week just days after having spent part of their Spring Break in the Bahamas. They were accompanied by perhaps a dozen friends, a full slate of Secret Service men (who still can’t ski any better than they did when they were protecting presidential candidate John Kerry) and a few members of the Sun Valley Ski Patrol, for good measure. Other Secret Service men hung out in the parking lot

Th e W e e k l y S u n •

guarding hefty looking backpacks that observers speculated had heavy artillery in them. Their entourage hit several of Ketchum’s finest restaurants, including Sushi on Second and The Sawtooth Club. The two O girls had what appeared to be a brief sisterly spat on the slopes. And, with no Mom in sight, they couldn’t resist one of those warm gooey chocolate chip cookies that Sun Valley Resort owner Carol Holding fought so hard to save earlier this year at Warm Springs Lodge. Aw heck, Mom’s healthy eating kick can kick back in when the vacation is over! Meanwhile, the Secret Service left souvenirs with several Sun Valley employees—tiny little Secret Service pins so small you might need a magnifying glass to read ’em! Want to see one? Just ask tws Aaron Morgan.

Plotts See Healing

FRiday, aPRil 5 • 5 To 7 Pm $

BY KAREN BOSSICK

arry and Marilyn Plott have long read about how Jesus healed the blind and lame. The Bellevue couple saw such healing first-hand this past month while serving Larry Plott and his wife Marilyn stayed in a hotel overlooking a on a medical shantytown where residents used truck tires to hold down the corrugated roofs. COURTESY PHOTO mission in Ethiopia. “Put in genital cataracts, infected teeth, simple terms: Jesus still makes wounds that needed stitching. the blind to see and the lame to Larry had to figure out ways walk,” said Marilyn. “I saw this to hold back lines six deep—full not just once but in three or four of people who were used to cases. People would come in with surging to the front, given the crutches who could hardly walk chance. and they’d stand up and throw “We performed triage, banding their crutches away.” people according to what kind of The Plotts have long wanted to treatment they were seeking. We serve on a medical mission, but would only band 25 at a time—if most were open just to doctors, we banded everyone, they would nurses and dentists. That wasn’t crowd. They all wanted to touch the case with Jewish Voice Minus, to show us they wanted istries International. clothes, food, anything we had,” The messianic Jewish orgahe said. nization provides free medical “I got to thinking: There was clinics and humanitarian aid to a time (in Nazi Germany) that impoverished pockets of Jewthey banded the Jews’ arms for ish people scattered throughout destruction. Here we were bandAfrica and India with the hope ing the arms for good,” he added. of proclaiming the gospel of Marilyn was assigned to a Yeshua, or Jesus, in the process. prayer team that prayed for the Its focus is on Jews—especially people’s healing and salvation. those of the lost tribes of Israel. She saw one person delivered But no one is turned away. from demons after he started goThe Plotts joined 34 other ing into what appeared to be seiAmericans and Canadian zures. The man was identified as citizens who teamed up with 40 a witch by the necklace he wore Ethiopian doctors and another around his neck. As the team 120 Ethiopian lay people. Their prayed over him, he became very assignment: a five-day clinic in composed, she said. a four-story compound in the “I prayed, ‘Lord, don’t send me Ethiopian capitol of Addis Abada a blind man.’ So he sent me an 8,000 feet above sea level in the elderly deaf mute,” she added. “I foothills of the Entotto Moundidn’t know how to handle it so tains. I asked another man to help. He They worked 12-hour days bent down near his ear and said, tending to people who spoke Am‘Yeshua heal him. He reared haric, a language that features back—we knew he had heard more than 200 dialects. something. He looked as if he’d As the former director of been released from something. Idaho’s Police Academy, Larry He kissed my hand, and he had was put in charge of controlling the peace of God—he didn’t want the crowds who stood in line to leave.” for hours under a blazing sun Marilyn said the experience with scarcely any cedar trees for offered her a glimpse of what it shade. must have been like to be Jesus It was a daunting job, considwhen the crowds were pressing ering the clinic treated 8,708 in on him. people over a five-day period— “He had great compassion 1,900 in one day. for them, and I felt such a great The people hobbled in with compassion, as well,” she said. “I sticks for crutches. Some had felt weeping inside of me, even skin problems, such as ringthough I was not crying tears.” worm. Others had AIDS, contws

Ap r i l 3 , 2 0 1 3


Beyond Common Sense Medicine For Mountaineering and Other Wilderness Activities by James A. Wilkerson, ed.

7XH$SULOÂ&#x2021;

BY BALI SZABO

T

courtesy photo

Orage Masters to Sizzle on Dollar BY KAREN BOSSICK

G

et ready for high-flying choreographed acrobatics and theatrics when Orage Masters commandeers Dollar Mountain this weekend. The Anti-Comp, as itâ&#x20AC;&#x2122;s known, will provide a free spectator spectacular with break-all-rules, on-the-hill shenanigans Friday and Saturday. Billed as â&#x20AC;&#x153;the craziest scene skiing has ever seen,â&#x20AC;? the event is one-part slopestyle, one-part on-hill tailgate party and onepart costume party. Forty of the nationâ&#x20AC;&#x2122;s top ski athletes, including hometown boys Collin Collins and Karl Fostvedt, will compete on teams of four on Sun Valleyâ&#x20AC;&#x2122;s Olympic-sanctioned Superpipe, cross course and terrain park in events judged by the riders themselves. The riders represent the top film crews in skiing and snowboarding, including Level 1 and The Traveling Circus. Orage, a Montreal clothing manufacturer that makes geeked-out jackets and ski pants, launched the event a decade ago to add a little pizzazz to the event circuit, said Mike Nick, Orage marketing director. The first four were held at Mammoth, the next three at Whistler. The next three events are planned for Sun Valley, Nick said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a completely wild event with a long history,â&#x20AC;? he said. â&#x20AC;&#x153;Eight teams, four athletes on each team, hitting jumps, you name it. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a killer event at a killer resort, and weâ&#x20AC;&#x2122;ll roll out some of our cool clothing lines. It looks more like a party than a contest. With the Sochi Olympics on everyoneâ&#x20AC;&#x2122;s mind, thereâ&#x20AC;&#x2122;s no better time to lighten things up a bit.â&#x20AC;? Riders will get a chance to eye one another during a King Pin Challenge Bowling Party Thursday night. On Friday theyâ&#x20AC;&#x2122;ll train on Dollar Mountain. Say â&#x20AC;&#x153;pretty pleaseâ&#x20AC;? and you might get some of them to sign your helmet. On Saturday the riders battle it out head to head. The six noncompeting teams and guests will

judge the acrobatics, ice skating style, with scores ranging from zero to a best of 10. When the slush has settled, a team either rides into the next round or is banished to their crib. If thereâ&#x20AC;&#x2122;s a tie, each competing team will be asked to send their best athlete in a one-run tie-breaking ski-off. The teams are vying for $10,000 cold hard cash for first place, compliments of Go Pro. Second-place finishers can choose between a three-day trip for four to Retallack Lodge in British Columbia or a five-day summer getaway to Sun Valley, complete with golf and guns. The third-place finishers get whatever the second-place finishers donâ&#x20AC;&#x2122;t pick. Skiers will also have other opportunities to vie for such prizes as a thousand greenbacks and $5,000 cold hard cash at various events, including the Halftime Hoedown on Saturday.

FRIDAY

11 a.m.-3 p.m. Skiers train on Dollar Mountain. 4-6 p.m. Skiers will battle it out in an Orange Masters Cup Broom Hockey Tournament at the Sun Valley indoor ice rink in an event open to the public. (Disclaimer: We arenâ&#x20AC;&#x2122;t saying itâ&#x20AC;&#x2122;s gonna be pretty. More like ridiculousâ&#x20AC;Ś .)

SATURDAY

11 a.m.-4 p.m. Orage Masters 8 will take place on Dollar Mountain. Practice runs will be held from 9 to 11 a.m. Heat No. 1 takes place from 11:30 a.m. to 1:30 p.m. Each of the four teams that has been banished to their crib will send one athlete to compete in a winner-take-all mystery competition for $1,000 cash during the Halftime Hoedown from 1:30 to 1:45 p.m. The top four teams will face off in head-tohead action from 2 to 3 p.m. The finals will be held at 3:15 p.m. with an Award Ceremony at 4:15 p.m. 4:30-6 p.m. Old Death Whisper will provide live Americana folkabilly music on the patio of Carolâ&#x20AC;&#x2122;s Dollar Mountain Lodge. 8 p.m.-close. An after-party featuring live music from the Casey Donahew Band will be held at Whiskey Jacquesâ&#x20AC;&#x2122; in downtown Ketchum. The event is sponsored by â&#x20AC;&#x153;Freeskier Magazine,â&#x20AC;? Go Pro, Sun Valley and Retallack Lodge. tws

he Intralibrary Loan didnâ&#x20AC;&#x2122;t have this book, so at my behest, the Hailey Public Library kindly purchased a copy. The Community Library has two copies. First published in 1967, it is now in its sixth edition, and remains the gold standard for outdoor medical practice when weâ&#x20AC;&#x2122;re far from a care facility. Each edition has added chapters, and this 2010 version has eight new additions. This volume is an appropriate reference source for this all-season, physically active Valley full of older people who are still pushing it and are prone to â&#x20AC;&#x2DC;boomeritis.â&#x20AC;&#x2122; After reading a good part of this book, I may never venture outside again, as it deals with everything the natural world can and does throw at us. The book is a thorough, clear, technically uncompromised series of medical treatises, yet itâ&#x20AC;&#x2122;s accessible to trip leaders, outfitters and the layperson. It deals with extremes of heat, cold, altitude, allergies, drowning, parasitic disorders, strokes, surgical problems, pregnancies, animal attacks and evacuation protocols. The first half of the book, chapter by chapter, details the basics of human physiologyâ&#x20AC;&#x201D;cardiac, respiratory, neurological, circulatory, eye and ear, foot and ankle and other orthopedics. The bookâ&#x20AC;&#x2122;s readability is important because any one of us may have to step into the breach, not only to help ourselves, but others. This is particularly true at altitude, where more than one person should be able to recognize the symptoms of acute mountain sickness (AMS), and be able to make decisions. Thereâ&#x20AC;&#x2122;s even a chapter on human psychology. The book is as strong on prevention, whenever possible, as it is on treatment. One of my core beliefs is that the more you know, the better off you, and/or perhaps others, are. tws

briefs

Sun Valley Projects The Sun Valley Lodge will undergo scheduled infrastructure maintenance April 7-14. During this period, the Lodge, Gretchenâ&#x20AC;&#x2122;s Restaurant, the Duchin Lounge, the Gift Shop, Bowling Alley, Spa and pool will be unavailable for service. The Sun Valley Beauty Salon also will close April 7-14 and re-open April 15. Lodging accommodations will be available at the Sun Valley Inn where the Inn Lobby Lounge will remain open daily along with all other village restaurants, shops and services - Konditorei, 7 am - 5 pm, Bald Mountain Pizza, 5-9 pm daily, Deli 11 am - 5 pm daily and the Ram Restaurant, Thursday through Monday, until April 14. Additionally re-landscaping around the Indoor Ice Rink takes place April 8-12 and in the Village now through June. A temporary road closure will happen April 8-16 on West Lake Drive due to new water line installation.

Th e W e e k l y S u n â&#x20AC;˘

0DUFK0DUNGRZQ0DGQHVVFRQWLQXHVÂŤ :HG(QWLUH6WRUHLV2)) 7KX2))Â&#x2021;)UL2)) 6DW%$*'$< &ORVHGWKLV6XQ0RQSUHSDULQJIRU7XHVGD\ 3 52

0RQ)UL6DW6XQ 1:DOQXW$YHQXH.HWFKXP JROGPLQHWKULIWVWRUHRUJÂ&#x2021;

& ( ( ' 6  6 8 3 3 2 57

L

inda and I decided on making Sweetwater our second home (soon to be primary) just about a year ago. We have had so much fun exploring the area that we decided to open a satellite office in downtown Hailey just so we could extend our play time. We have enjoyed the workout facility and then really enjoyed the hot-tub. Have I mentioned that hot-tub enough? Even at 6 degrees outside the pool and the hot-tub were great! Throughout all of our experiences we have noticed that everything from the town home and the entire Sweetwater property has been built and maintained with quality that is truly designed to last a lifetime. We are not flying in to the airport on a Lear Jet, but when we walk around the grounds and lounge around the facilities we certainly feel like we did just that.â&#x20AC;? ~Thanks for all you do, Don and Linda Kenyon

Sweetwater Community Realty Karen Province | Sue Radford, Realtors (208) 788-2164 â&#x20AC;˘ www.SweetwaterHailey.com Hwy 75 to Countryside Blvd., follow signs to Sweetwater Clubhouse Model Homes Open 7 Days A Week Prices may change at sellers discretion

KAREN PROVINCE

SUE RADFORD

'VS4UPSBHF

G\YYdg_]b 

7cUh:UWhcfm



:IFG5@CB

NEW Leath

S ARRIVAo-LWear

er Jackets, Spr ing Ready-t

Other Services: Cleaning, Remodelling, Repairs )%%GibJU``YmFX" ?YhW\iap+&*"'),, kkk"g\YYdg_]bWcUh"WcapVfYbXU_bcfhcb4mU\cc"Wca

DONâ&#x20AC;&#x2122;T MISS THIS WEEKâ&#x20AC;&#x2122;S CALENDAR - PAGES 8 & 9

Ap r i l 3 , 2 0 1 3




sun

QSFWJFXT

Coming Soon in The Weekly Sun! April 17

Kids Camp and Summer Activities

Remember how much you looked forward to summer when you were a kid? Summer means fun and it’ll be here before we know it. Readers will use this section to plan their children’s summer activities and adventures. Whether it’s a daily activity, a weekend activity or time away at camp, people need choices and time to plan.

rsvp by: 4/4/13

copy & ad deadline: 4/11/13

MAy 24

third AnnuAl

101 Amazing Things to Do This Summer Magazine

Distributed just before Memorial day, this unique publication is dedicated to everything you can do in the Wood River Valley and outlying areas. Dedicated to visitors and locals alike with a comprehensive calendar that encompasses Memorial Day to mid-fall.

Early Booking disounts are Available - Call for details early deadline: 4/10/13 regular deadline: 4/17/13 materials due: 4/26/13

{ c a l e n da r }

send your entries to live@theweeklysun.com or ente

S- Live Music _- Benefit

ONGOING/MULTI-DAY CLASSES & WORKSHOPS ARE LISTED IN OUR

Theatre

this week wednesday, 4.3.13

Yoga and Breath with Victoria Roper - 8 to 9:15 a.m. at Pure Body Pilates, Alturas Plaza, Hailey Kindergarten, Dual Immersion and Preschool registration for Hemingway Elementary - 8:30 a.m. to 12 p.m. and 1 to 3:30 p.m. at Hemingway Elementary, Ketchum. Info: www.BlaineSchools.org or 578-5000 Books and Babies - 10 a.m. at the Bellevue Public Library. Story Mania - 10:30 to 11:30 a.m. at the Hailey Public Library. A book-lovin’ story hour featuring passionate parents and volunteers. All ages. Info: www.HaileyPublicLibrary.org or 788-2036. Fit and Fall Proof - 11 a.m. at the Senior Connection in Hailey. 788-3468. Kindergarten, Dual Immersion and Preschool registration for Bellevue, Woodside and Hailey Elementary- 11:30 a.m. to 7 p.m. at the Community Campus, 1050 Fox Acres Rd., Hailey. Info: www.BlaineSchools.org or 578-5000 Hailey Kiwanis Club meeting - 11:30 a.m. at the Senior Connection, 721 S. 3rd Ave, Hailey. New Moms Support Group - 12 to 1:30 p.m. in the River Run Rooms at St. Luke’s Hospital. Info: 208-727-8733 Gentle Yoga with Katherine Pleasants - 12 to 1 p.m. - YMCA in Ketchum. 727-9600. Free Brown Bag Health Talk: Access Your Medical Records - 12:15 to 1:15 p.m. at St. Luke’s Hailey Clinic, Carbonate Rooms. Learn about myChart, which St. Luke’s has recently initiated. Beginning bridge lessons - 12:30-2:30 p.m. at Our Lady of the Snows Catholic Church Community Room, Sun Valley. Reservations required, 720-1501 or jo@ jomurray.com. www.SunValleyBridge. com Kindergarten, Dual Immersion and Preschool registration for Carey School - 1 to 3 p.m. at Carey School. Info: www.BlaineSchools.org or 578-5000 Kundalini Yoga as taught by Yogi Bhajan  2 to 3:30 p.m. 416 Main Street, North entrance, Hailey. For questions: HansMukh 721-7478  Intermediate bridge lessons - 3-5:30 p.m. at Our Lady of the Snows Catholic Church Community Room, Sun Valley. Reservations required, 720-1501 or jo@jomurray. com. www.SunValleyBridge.com WRHS Chess Club - 3:30 to 5:30 p.m., Rm.

upcoMing

Here are some key dates for advertisers:

Earth Day Ads ...........April 17 (deadline, April 12) Mother’s Day Ads........May 8 (deadline, May 3) Graduation Ads .........May 22 (deadline, May 17) Sun Valley Wellness Fest Ads.....May 22 (deadline, May 17)

ongoing

Free 20-Word Classified Ads in Any Category

CK’s Real Food… LUNCH: M - F • 11 AM TO 2PM DINNER: 7 NIGHTS A WEEK 5-10 PM ~ outdoor dining available ~

Voted Best of the Valley for:

& Best Chef

contAct us Steve: 309.1088 Leslie: 309.1566 office: 928.7186 16 West Croy, Hailey

sun



Janss Pro-Am Classic, a benefit for the Sun Valley Ski Education Foundation. Info: kate@svsef.org or visit www.svsef. org Yoga Sauna - 8:10 to 9:40 a.m., Bellevue. Info: 720-6513. Yoga and the Breath w/Victoria Roper - 9 to 10:15 a.m. at the BCRD Fitworks Yoga Studio. Stella’s 30 minute meditation class (beginner level) - 11 to 11:30 a.m. at the YMCA in Ketchum. FREE. Info: 726-6274. Connection Club - 11 a.m. to 3 p.m. at the Senior Connection in Hailey. 788-3468. Movie and Popcorn for $1 - 1 p.m. at the Senior Connection in Hailey. Kundalini Yoga as taught by Yogi Bhajan  2 - 3:30 pm and 6:00 - 7:30 pm. 416 Main Street, North entrance, Hailey. For questions: HansMukh 721-7478 Duplicate Bridge for all skill levels - 3 p.m., in the basement of Our Lady of the Snows Catholic Church in Ketchum. Call 726-5997 for info. Hemingway Chapter, Trout Unlimited presents Fly Fishing the Himalayas with Bryant Dunn - 5 to 7 p.m. at Whiskey Jacques’ Restaurant, Ketchum. Free admission S Mic Terra - 5 to 7 p.m. at Silver Dol-

friday, 4.5.13

_

Janss Pro-Am Classic, a benefit for the Sun Valley Ski Education Foundation. Info: kate@svsef.org or visit www.svsef. org Fit and Fall Proof - 11 a.m. at the Senior Connection in Hailey. 788-3468. Therapeutic Yoga for the back with Katherine Pleasants - 12 to 1 p.m. - YMCA in Ketchum. 727-9622. Kundalini Yoga as taught by Yogi Bhajan  2 -3:30 pm 416 Main Street, North entrance, Hailey. For questions: HansMukh 721-7478 Duplicate bridge for players new to duplicate - 3-5:30 p.m. at Our Lady of the Snows Catholic Church Community Room, Sun Valley. Reservations required, 7201501 or jo@sunvalleybridge.com. www. SunValleyBridge.com. Orage Masters Cup Broom Hockey Tournament - 4 to 6 p.m. at the Sun Valley indoor ice rink. Open to the public

_

Bibs & Ribs Fundraiser for Meals on Wheels - 5 to 7 p.m. at the Senior Connection. $25/adults and $10/children 12 and under. Make your reservations: 208-7883468 S South of Bellevue, rock and southern rock - 9:30 p.m. at Silver Dollar Saloon, Bellevue. No cover and free shuttle rides available

saturday, 4.6.13

_

Janss Pro-Am Classic, a benefit for the Sun Valley Ski Education Foundation. Info: kate@svsef.org or visit www.svsef. org Painting Class - 10 a.m. to 1 p.m. at the Senior Connection, Hailey. 788-3468 Saturday Storytime - 10 a.m. at the Children’s Library in The Community Library, Ketchum. FREE. Info: 208-726-3493

Orage Masters 8 - 11 a.m. to 4 p.m. on Dollar Mountain (practice runs from 9 to 11 a.m.). Award ceremony at 4:15 p.m. Story Mania - 2 p.m. at the Hailey Publi Library. A book-lovin’ story hour featur ing passionate parents and volunteers. A ages. Info: www.HaileyPublicLibrary.or or 788-2036. Higher Ground Art Reception (to help raise awareness of Autism) - 4 to 6 p.m. a Starbucks Visitors Center, Ketchum. S Old Death Whisper, live American folkabilly - 4:30 to 6 p.m. on the patio a Carol’s Dollar Mountain Lodge. S Rock ‘n the Sun Concert Series pres ents free music by The Bernie Worrell Or chestra as well as bars and beer garden bbq and other picnic fare - 4:30 p.m. a River Run Restorative Yoga with Katherine Pleas ants - 4:30 to 5:45 p.m. - YMCA in Ket chum. 727-9600. S Ian McFeron & Alisa Milner of Seat tle, storytelling songwriting - 7:30 p.m. a the Sun Valley Brewery, Hailey. No Cover S Casey Donahew Band - 8 p.m. a Whiskey Jacques’, Ketchum.

sunday, 4.7.13

Ride, Stride and Glide Winter Triathlon - 9 a.m. at Galena Lodge. Multi-sport, relay style race (Bike, Run, Ski and costume are encouraged). $30 for three-person mixed teams and $15 for solo racers. Info 208-726-4010 S The Great Fifty Days Concert Serie presented by Caritas Chorale - Meredith Thompson, organ competition finalist - 4 p.m. at St. Thomas Episcopal Church, Ket chum. Kundalini Yoga as taught by Yogi Bhajan 5 - 6:30. 416 Main Street, North entrance Hailey. For questions: HansMukh 721 7478 S Finn Riggins - 9 p.m. at the Sun Val ley Brewery, Hailey. $3. S Leana Leach Trio (pop, jazz, rock - 8:30 to 12:30 in the Duchin Room, Sun Valley.

monday, 4.8.13

Toddler Story Time - 10:30 a.m. at the Bellevue Public Library. Fit and Fall Proof - 11 a.m. at the Senio Connection in Hailey. 788-3468. Gentle Yoga with Katherine Pleasants - 12 to 1 p.m. - YMCA in Ketchum. 727-9600. Laughter Yoga with Carrie Mellen - 12:15 to 1 p.m. at All Things Sacred (upstairs a the Galleria). Trip to the Hunger Coalition - meet at the Senior Connection, Hailey at 3 p.m.. 788 3468

Burt Not So Incredible BY JONATHAN KANE

M

agic and illusion are made to amaze and delight the mind. Unfortunately, they do not always achieve the same results when transferred to the big screen. Last week it was Oz The Great and Powerful and this week exhibit number one is The Incredible Burt Wonderstone. Perhaps if the producers had not gone so overboard in the proclamation of the film’s title it would not be so easy to mock the final outcome, because this movie is anything but incredible. Too bad for Steve Carell, whose talents certainly pass for incred-

ible—just not in this so-called comedy. Also too bad for the other three excellent leads, Steve Buscemi, Alan Arkin and Jim Carrey, who try their hardest to breath fire into the script. Carell and Buscemi play a magical act that has been together since puberty and now, after dominating the strip for a decade, has fallen on hard times. Unfortunately, the newcomer on the block is a total parody of magician Criss Angel, played to psycho perfection by Carrey. If you only see this movie for one reason make that reason be Carrey’s funniest work in a decade. Whether it’s roasting on hot coals or plunging a screw into

Jon rated this movie

his brain, Carrey gets the loudest laughs in the film and actually reminds you of what it was in the first place that made him so funny. Arkin is always good as the magician that inspired Carell’s dreams, and Buscemi gives comic support as the other half of the mismatched showbiz team. The real problems remain with the script, labored over by at least six writers without a lot to show for it. The film never really seems to know what it’s about, and for flaws, that one is pretty fatal. tws

For DAILY CALenDAr upDAtes, tune Into 95.3Fm Listen Monday-Friday MorNiNg 7:30 a.m.

www.TheWeeklySun.com the weekly

thursday, 4.4.13

_

lar Saloon, Bellevue. No cover FREE Souper Supper (meal to those in need) - 5:30 to 6:30 p.m. at the St. Charles Parish Hall in Hailey. Walker Center Early Recovery & Alumni Support Group - 5:30 to 6:45 p.m. at the Sun Club South in Hailey. Info: 208-7206872 or 208-539-3771 Free Panel Discussion with Navy SEAL Bert Gillette presented by Sun Valley Center for the Arts - 6:30 p.m. at The Center, Ketchum. Sun Valley Center for the Arts and Magic Lantern Cinemas present Movie Club featuring Alfred Hitchcock’s ‘Psycho - 7 p.m. at the Magic Lantern Cinemas, Ketchum. $5 . Info: KetchumCinimaClub@gmail. com

movie review

Join us at

Best Overall Restaurant

C214 at the Wood River High School. FREE for all ages. Info: 208-450-9048. Connie’s Core Class - 5:15 to 5:45 p.m. at the YMCA, Ketchum. FREE. Info: 7200504 Free Screening of Guilty Pleasures, Julie Moggan’s new documentary - 6 p.m. at The Community Library, Ketchum. For more info: www. TheCommunityLibrary.org West African Drumming - 6 to 7 p.m. in the backroom at Ikaunics Salon, Ketchum. Open to all ages and abilities. Bring a hand drum and join the fun. NAMI - National Alliance for the Mentally Ill support groups for friends and families of persons living with mental illness - 1st and 3rd Wednesday of each month - 6 to 7 p.m. at the NAMI-WRV office on the corner of Main and Maple - lower level under the Hailey Chamber Office, Hailey. Info at 309-1987. Free Playreading of The Seafarer - 6:30 p.m. at the nexStage Theatre, Ketchum. Info: 726-9124 Duplicate bridge game for all levels - 7-10 p.m. at Our Lady of the Snows Catholic Church Community Room, Sun Valley. Reservations required, 720-1501 or jo@ sunvalleybridge.com. www.SunValleyBridge.com

208-788-1223 Hailey, ID www.CKsRealFood.com

AFTerNooN 2:30 p.m. …and Send your calendar items or events to live@TheWeeklySUN.com Th e W e e k l y S u n •

Ap r i l 3 , 2 0 1 3


e r o n l i n e a t w w w.T h e w e e k l y s u n . c o m

R TAKE A CLASS SECTION IN OUR CLASSIFIEDS

n o

ic rAll g

p at

na at

srn, at

st-

tat r. at

9 yes n o:

es h 4 t-

n  e, 1-

l-

k) n

e

or

2

5 at

e 8-

credible

.

,

Duplicate Bridge for all skill levels - 3 p.m., in the basement of Our Lady of the Snows Catholic Church in Ketchum. Call 726-5997 for info. Intermediate Bridge Lessons - 3-5:30 p.m. at Our Lady of the Snows Catholic Church Community Room, Sun Valley. Reservations required, 720-1501 or jo@jomurray. com. www.SunValleyBridge.com Restorative Yoga with Katherine Pleasants - 5:30 to 6:30 p.m. - MOVE Studio, Ketchum. 727-9600. NAMI - National Alliance for the Mentally Ill “Connections” Recovery Support Group for persons living with mental illness - 5:30 to 7 p.m. at the NAMI-WRV office on the corner of Main and Maple - lower level under the Hailey Chamber Office, Hailey. Info: 309-1987 FREE Souper Supper (meal to those in need) - 5:30 to 6:30 p.m. at the St. Charles Parish Hall in Hailey.

Senior Connection, Hailey. Info: 7883468. FREE Hailey Community Meditation - 5:30 to 6:30 p.m. at Pure Body Pilates, across from Hailey Atkinsons’. All welcome, chairs and cushions available. Info: 7212583 Free acupuncture clinic for veterans, military and their families 6:30 to 8 p.m. at Cody Acupuncture Clinic, Hailey. 7207530. S Sun Valley Artist Series presents Rieko Aizawa, piano - 7 p.m. at the Presbyterian Church of the Big Wood, Ketchum. Meet the Artist Pre-Concert Talk at 6:125 p.m. $24 ($10/students). Info/tickets: 208725-5807

discover ID S

tuesday, 4.9.13

Yoga Sauna - 8:10 to 9:40 a.m., Bellevue. Info: 720-6513.

_

Spring Opening Time - 10 a.m. to 6 p.m. at the Gold Mine, Ketchum. Info: 208-726-3465. Connection Club - 11 a.m. to 3 p.m. at the Senior Connection in Hailey. 788-3468. Children’s Library Science time w/Ann Christensen, 11 a.m. at the Children’s Library of the Community Library in Ketchum YMCA Mommy Yoga - ages infant to walking. 11 a.m. to 12 p.m. Info: 727-9622. Rotary Club of Ketchum/Sun Valley meeting - 12 to 1:15 p.m. at Rico’s, Ketchum. Info: www.Rotary.org Guided Meditation - 12:15 to 1:15 p.m. at St. Luke’s Wood River, Chapel. Info: 7278733 Blood Pressure Check - 12:30 p.m. at the Senior Connection. 788-3468. BINGO after lunch, 1 to 2 p.m. at the Senior Connection. 788-3468. Sewcial Society open sew - 2 to 5 p.m. at the Fabric Granery in Hailey. Outdoor After School Program for 1st 3rd Graders - 2:30 to 5 p.m. at The Mountain School, Bellevue. Space is limited, call for details/register: 208-788-3170 Kundalini Yoga as taught by Yogi Bhajan  2 - 3:30 pm and 6:00 - 7:30 pm. 416 Main Street, North entrance, Hailey. For questions: HansMukh 721-7478 Duplicate bridge game for those new to duplicate - 3-5:30 p.m. at the Wood River YMCA, Ketchum. Reservations required, 720-1501 or jo@sunvalleybridge.com. www.SunValleyBridge.com Weight Watchers - 5 to 6:30 p.m. at the

thursday, 4.4.13

The Claire Lynch Band (bluegrass) 7:30 p.m. at the CSI Fine Arts Auditorium, Twin Falls. $22/adults or $16/children. Info: 208-732-6288

friday, 4.5.13

Special Evening of ASL Performers - 6 p.m. at the CSI Fine Arts Auditorium, Twin Falls. The event is conducted in American Sign Language, but interpreters will be provided. $15/advance or $18/door. Info: 208-732-6288

saturday, 4.6.13

Off Center Dance Project - 7 p.m. in the CSI Fine Arts Auditorium, Twin Falls. $10 at the door. Info: 208-732-6288

thursday, 4.11.13

Mrs. Idaho America Meet & Mingle - 7 to 8 p.m. at the Heritage Commons Clubhouse (3775 Hollymount( in Meridian. For info call Susan at 208-859-3809 or Sher at 208-870-3722 or e-mail mrsidahoteam@ yahoo.com

plan ahead Wednesday, 4.10.13

AARP Taxes - 11 a.m. to 4:30 p.m. at the Senior Connection, Hailey. 788-3468

thursday, 4.11.13

Film Screening of 56Up presented by Sun Valley Center for the Arts - 7 p.m. at Magic Lantern Cinema, Ketchum. $10/m, $12/ nm. Tickets available on Monday, April 8 at 4:30 p.m. at Magic Lantern. Info: film@ sunvalleycenter.org

briefs

tws

Wake Up Hailey Spotlights New Bike Program Please join the Hailey Chamber of Commerce for Wake Up Hailey from 9 to 10 a.m. on Tuesday, April 9 with Friends of the Library at the Hailey Public Library. 5B Bike Share program will be there to tell us more about the “smart bikes” that will

be around town. Come and enjoy a cup of coffee, a light treat and Chamber chatter. Find out what is going on in Hailey. For more information, please call the Hailey Chamber at 788-3484.

how do you reduce your carbon footprint?

The Punch line

{ c a l e n da r } read it

Dear Leader

We have our liquor license

The Orphan Master’s Son by Adam Johnson, 2012, hardback, 443 pages

come have a mixed drink and more! 103 South Main, Unit A, Hailey, Idaho

BY MARGOT VAN HORN

I

am sure that you are aware of the worries North Korea has presented our world. This book is a must read for anyone who is concerned or interested in North Korea, its people, and how the government and the “Dear Leader” thinks. It’s a must read in spite of the fact that this book is fiction because I have a feeling that what this book portrays can probably be a fairly accurate description of the North Korean spirit of today. In this beautifully told thriller, you’ll feel like you are getting a bird’s-eye view of a very secretive society and country. It is a real page-turner. It’s a tale that contains astute thinking on the nature of freedom, sacrifice, and glory surrounded by people who have nothing to live for. This story also contains one thing most good stories can’t do without: a love story. In this story, the “Dear Leader” is omnipresent in every conversation, thought and movement of all of the citizens of North Korea. “Dear Leader” becomes a 3-dimentional figure with hair that is heavily sprayed wearing a jumpsuit. He has traits of madness. He is a monomaniac and is a dude with whom I am sure we can relate to other dear leaders such as Stalin and Hitler. One reviewer calls the author Johnson “a lunatic storyteller.” He teaches creative writing at Stanford. Here are some Adam Johnson quotes that I find very interesting: “Where we are from... stories are factual. If a farmer is declared a music virtuoso by the state, everyone had better start calling him maestro. And secretly, he’d be wise to start practicing the piano. For us, the story is more important than the person. If a man and his story are in conflict, it is the man who must change. But people do things to survive, and then after they survive, they can’t live with what they’ve done.” I hope that these quotes will give you a hint of what this story is about. So, now’s a good time to pick up this book for a very intense and entertaining rollercoaster read. Give us your feedback at margot6@mindspring.com tws

The wife said I’d be happier if I put a little spring in my step. Personally, I don’t get it! PHOTO: SUSAN LITTLEFIELD

d

t

in ad this OFF g n Bri get $1 em! it and enu m y an

788.0960

This Weeks Lunch Special! Come try our

Adobo Chicken Tacos 210 Main Street, Ketchum • 726-0125

BE A WINNER! $POHSBUVMBUJPOTUPUIJTXFFLµT XJOOFS5JGOFZ4UFXBSU XIPXPOB(JGU$BSEUP 4VOWBMMFZµT,POEJUFSPJ ©BOEUPMBTUXFFLµTXJOOFS 1BU)BOH(* XIPXPOBHJGUDBSEGPSB GVMMBVUPEFUBJMBU4VO7BMMFZBVUPDMVC

enter to win this week’s prize!

a $25 Gift Card to Sun Valley’s Lodge Dining Room enteR by 12 p.m., monDay, apRIL 8, 2013 3 WayS to enteR:

text: ‘LDR’ and your name to 208-309-1566 email leslie@theweeklysun.com • or Call 208-928-7186 Must BE 18 YEAR sO AGE tO ENtER. ONE ENtRY PER GIVEAWAY, PER PERsON. tHOsE WHO HAVE WON sOMEtHING FROM tHE WEEKLY suN IN tHE LAst 90 DAYs ARE NOt ELIGIBLE.

sun the weekly

Avid weekly paper reader, Susan Littlefield, who has lived in the Valley for over 35 years, claims that laughter is the best medicine. She creates these scenarios in her husbands N-scale model railroad.

Th e W e e k l y S u n •

It’s Always More Fun in

Ap r i l 3 , 2 0 1 3




SERVICE SPECIALS THRU APRIL 12

24

$

lube, 95* Incl: oil, filter,

($3495 minus $10 mail-in rebate)

tire rotation and safety inspection

*dIesel or synthetIc oIls not Incl.

FREE WiNteR Safety iNSpectioN

27-point Safety check â&#x20AC;˘ Check all fluid levels â&#x20AC;˘ Tire pressure â&#x20AC;˘ Heater operation â&#x20AC;˘ Anti-freeze levels and protection

b y a p p o i N t M e N t o N Ly â&#x20AC;˘ M e N t i o N o R p R e S e N t t H i S a d t o R e c e i V e S p e c i a L

Wood River MOTORS

711 N. Main St. Hailey 208-788-2225

Looking for a vehicle? V i s i t u s o n l i n e a t w w w. Wo o d R i v e r M o t o r s . n e t

Big Savings + Long Soak = Feel Like a Kid Again!

Bryant Dunn to Speak on Fly-Fishing the Himalayas this Thursday Bryant Dunn, owner/operator Sun Valley Outfitters LLC, will talk about his Himalayan fly-fishing adventures at the next meeting of the Hemingway Chapter, Trout Unlimited. The meeting is from 5 to 7 p.m. this Thursday, April 4 at Whiskey Jacquesâ&#x20AC;&#x2122; in Ketchum, and admission is free. A 20-year resident of the Wood River Valley, Dunnâ&#x20AC;&#x2122;s passion for flyfishing and exploration began in the rainforests of the Olympic Peninsula and the massive drainages of British Columbia. Today, six continents and 50 countries later, in addition to casting flies throughout the Arctic, Africa, Europe, India, the South Pacific, Southeast Asia and Central America, Dunn has pioneered some the most remote fishing destinations in the Himalayan Range. He is currently planning an expedition into Burma for 2014 and later this year will lead an expedition into eastern Bhutan to make the first fishing descent of a major Himalayan river only first navigated in late 2011.

Golden Mahseer, landed in Bhutan. When not searching the Himalayas for undiscovered fishing opportunities, Dunn runs his stateside business, Sun Valley Outfitters, at his home in Ketchum. He also supervises the Sun

courtesy photo

Valley Ski Patrol and chases steelhead with his wife Debby and three children, Madeline, Amanda and Daker. For more information, call 6224613.

chamber corner

briefs

All Hot Tubs $500-$1,000 OFF ~ VISIT OUR SHOWROOM TODAY ~ Spa & Pool â&#x20AC;˘ Sales â&#x20AC;˘ Service â&#x20AC;˘ Supplies â&#x20AC;˘ Repair Professional, Insured Staff â&#x20AC;˘ Serving the Community for over 17 Years

www.FourSeasonsSpaAndPool.com

FOUR

SEASONS Spa & Pool, LLC

(208) 788-6300 519 S Main Hailey 10-5:30 Mon-Fri

Got news? Send it to editor@theweeklysun.com

$UH<28UHDG\WR

/26(:(,*+7" )RUDVOLWWOHDV







SHUZHHN\RXÂśOOJHW

',(7 (;(5&,6( 027,9$7,21

$6&,(17,),&$//<3529(1:(,*+7/2663/$1 7KHRQO\FRPSOHWHZHLJKWORVVSODQWKDWSURGXFHV UHDOUHVXOWVIRUUHDOZRPHQ

PICTURED: Aaron W. Johnson (Farm Loan Chief - Idaho) presented a Certificate of Appreciation to John Evans, Jr., (D.L. Evans Bank Chief Executive Officer).

D.L. Evans Lauded

D.L. Evans Bank has been presented with a Certificate of Appreciation for a successful partnership with Farm Service Agency. The certificate was granted in appreciation of D.L. Evans Banks professional dedication and diligent efforts in helping the farmers and ranchers of Idaho. D.L. Evans Bank has the highest number of FSA guaranteed loans to Idaho farmers and ranchers. D.L. Evans Bank has made the most guaranteed loans for the past three years.

RE/MAX Honored

RE/MAX River Run Realty of Sun Valley has been named the 2012 Outstanding Brokerage of the Year - Small Market for the RE/MAX Pacific Northwest Region. This prestigious award is presented annually to the brokerage that has not only performed at the highest level, demonstrating top-tier customer service, but has also shown a deep commitment to its community. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re honored that our office and agents are being recognized,â&#x20AC;? said Joanne Wetherell. â&#x20AC;&#x153;We are anticipating a strong real estate market this year. Second-home sales are on the rise and there is a pent-up demand from buyers for more inventory. We are excited about the future.â&#x20AC;? The success of RE/MAX River Run Realty of Sun Valley goes beyond the work ethic of the office; the company also gives back to the community. The office staff and agents raise money for Childrenâ&#x20AC;&#x2122;s Miracle Network Hospitals and Susan G. Komen for the Cure, as well as volunteering for a variety of local organizations. As part of the global RE/MAX network, RE/MAX River Run Realty of Sun Valley has access to an international database that reaches more than 90 countries. â&#x20AC;&#x153;Real estate goes beyond our local market,â&#x20AC;? said Cindy Kesting. â&#x20AC;&#x153;What we are experiencing is that buyers now come from all over the world. RE/MAX International puts us in a better position to market to buyers and sellers globally.â&#x20AC;? To contact an agent, or to see the latest listings, please visit: www.RemaxRiverRunRealty.com, or call: (208) 726-4901.

Got news? We want it! CALL 788.6066 FOR MORE INFORMATION! 10

Send it to Leslie Thompson at editor@theweeklySUN.com

Th e W e e k l y S u n â&#x20AC;˘

COURTESY Photo

Clean Web Design FOR THE WEEKLY SUN

L

isa Chambers got her degree in biology, with a minor in art. She figured people rarely could make a living in â&#x20AC;&#x153;art,â&#x20AC;? so she planned to become a teacher. But she found herself overwhelmed in the big, high-tech Bay Area of California. Her husband at the time was into computers and she started to learn from those around her. Her first project was creating a Website for her wedding. Twelve years later, Lisa is now located at 126 S. Main St., Ste. B6, in Hailey. With one employee, Julie Gates, and office mascot Benny, Chambers now runs Clean Web Design and gets to pursue her first love, art. Each Website is unique to the needs of the client, which means the job stays fresh and interesting and is always evolving. Chambersâ&#x20AC;&#x2122; goals for her clients are to first meet their needs. She then helps them create Websites that represent their work, which in turn makes it easier for them to

conduct business, whether that is through creating an online catalogue inventory, information or weekly e-mail updates. Chambers tries to create clean and functional Websites. She trains each client just how to maintain and edit their own site, and how to design, develop and market to each clientâ&#x20AC;&#x2122;s target audience. They also have a dedicated server, meaning that Clean Web Design holds all businesses, also known as â&#x20AC;&#x153;hosting,â&#x20AC;? and they put the information out into the attainable target markets. By hosting their clients, Clean Web Design provides a safe, fast backup for Websites, free from viruses and in case of permanent loss on the clientâ&#x20AC;&#x2122;s end. They always have the backup. A well-done Website can be easier than Facebook to operate and more cost effective than the Yellow Pages. For more information please contact Lisa Chambers, Clean Web Design, lisa@ cleanwebdesign.com, 208-9063203. tws

This Chamber Corner is brought to you by the Hailey Chamber of Commerce.

To find out about being featured here, or for info on Hailey Chamber of Commerce Membership, please contact Kristy at 788.3484 or kristy@haileyidaho.com

Ap r i l 3 , 2 0 1 3


from margot’s

table to your’s

Transform Those Hard-boiled Eggs BY MARGOT VAN HORN

T

his is a very delicious filling for leftover hardboiled eggs (Easter) or for St. Pat’s (think green) or really anytime. For fun I sometimes combine this recipe with some ham-filled eggs so as to duplicate the Green Eggs and Ham from that famed Dr. Seuss tale so many of us read to our wee ones. In conclusion, a little hardboiled egg safety knowledge according to the FDA’s Website is the following: “Cooked eggs, including hard-boiled eggs, and egg-containing foods, should not sit out for more than 2 hours. Within 2 hours either reheat or refrigerate. Use hard-cooked eggs (in the shell or peeled) within 1 week after cooking.” Spinach-Stuffed Eggs (I think for hors d’oeuvres, most people might eat two halves so this recipe might serve 4)

Ingredients: 4 hard-boiled eggs 2 Tbsp. cooked well-drained spinach (I use fresh) 2 oz. whipped cream cheese 2 Tbsp. grated Parmesan A dash of freshly grated nutmeg Salt and pepper to taste A dash of cream Sliced black olives and some slivered pimentos for topping or even some finely chopped ham

to your health

Directions:

Cut the eggs lengthwise. Scoop out the yolk and put into a food processor or blender along with the cream cheese, spinach, Parmesan cheese, salt and pepper, and nutmeg. I actually mashed everything with a fork so that it came out not quite so smooth and I thought more tasty and interesting looking. It’s up to you, and if your filling is not as smooth as you wish, add a bit of whole milk or cream. Fill egg whites with the spinach filling and top with a sliced black olive and a sliver of pimiento or chopped ham. Ham and gherkins egg filling for the Dr. Seuss effect: Mash 6 hard-boiled egg yolks with 4 Tbsp. finely chopped cold cooked ham, 1 Tbsp. finely chopped gherkins and enough mayonnaise or whipped cream cheese to make a firm paste. Fill the eggs with the ham mixture and garnish tops with more chopped ham and paprika. For easy access and printing of this and past recipes, visit Margot’s blog http://blog. tempinnkeeper.com Call Margot for personal cooking help or hosting at 721-3551. Margot is a self-taught, enthusiastic and passionate cook. Having been an innkeeper for five years at her own inn, she accumulated a lot of good recipes, which she loves to share. tws

Do Something That Makes You Smile BY CONNIE LOVE

A

re you mentally trying to shake the winter doldrums? Spring weather doesn’t always help. One day the air is sunny and crisp and clear; the next day we’re back to rain and snow. Nevertheless, it’s a good time to absorb the energy of the blossoming earth. Remember that just as the exterior world alternates between rain and sunshine, it’s okay if your mental state sometimes alternates. The important goal is to keep moving ahead. Think of spring as a great time to renew yourself physically and mentally. Remain open to new possibilities. Be willing to escape routines. Leave the doors of your mind open to discoveries that enable you to feel truly alive. Enjoy opportunities around you. Do the things that make time disappear. Find your passion. Passion is energy. It’s the power that comes from focusing on what really excites you. When you live with enthusiasm, you fully engage your brain and body. Your activities build new pathways that will foster heath and well-being. When you live your life with passion and purpose, you can serve yourself and your community in meaningful ways. Passion will keep your mind active and sharp and

strengthen your relationships with everyone you meet. You may have read the article in The New York Times last week entitled “Is Giving the Secret to Getting Ahead?” The author interviewed Adam Grant, adviser to Google on productivity and the youngest-tenured and highest-rated professor at the Wharton School of the University of Pennsylvania. He is convinced that helping others is the key to productivity and to personal and professional success. One can only do this, of course, by remaining open to the possibilities of helping others. So shed those winter clothes and ski boots. Shed the rainy state of mind. Find a way to help others as well as yourself. Then do something that makes you smile and that makes you feel good. Catch up with your neighbors, friends, pets, etc. Take it all in. Be the best you can be for yourself and others around you. Was there a time in your day that you thought about others as well as yourself? Was there laughter in your day? Be playful and learn to relax. Be open to new possibilities and go with the flow of the day. These are the moments of life. Connie Love, a certified life coach, is available at (208) 720-2216 or connie@lifecoachconnielove.com. Additional information is at www.lifecoachconnielove.com. tws

Got news? We want it!

anycategory 20words/less alwaysfree SUBMIT YOUR CLASSIFIED ADS BY 12 P.M., MONDAYS

FREE classified

• fax: (208) 788-4297

ads

• e-mail: classifieds@theweeklySUN.com

on sale • drop by/mail: 16 West Croy St. / PO Box 2711, Hailey, ID 83333

sun the weekly

every ink cartridge a l l

p r i n t

t o n e r

every major brand

are always E! N I L N O IVE NOW L

Just type www.copyandprint.biz into your browser address bar Create an account and we’ll get you on a great discount program!

208-788-4200 208-788-4297 Fax Corner of Croy & River Downtown Hailey

Put the value of your home to work for you! In Low te R REVOLVING at res es t HOME EQUITY !

LINE OF CREDIT* Be your own banker Paid down amount is available for you to use

Multiple purpose product such as: consolidate debt, finance home improvements, or any other personal expense Lock in low fixed interest rate at any time Work with experienced knowledgeable lenders Bank locally

Visit your local branch today.

www.dlevans.com ALBION BOISE BURLEY HAILEY IDAHO FALLS JEROME KETCHUM MERIDIAN NAMPA POCATELLO RUPERT TWIN FALLS *On Approved Credit

Send it to Leslie Thompson at editor@theweeklysun.com or call 928-7186.

Th e W e e k l y S u n •

Ap r i l 3 , 2 0 1 3

11


financial planning

Easter in Bellevue

The Impact of Long-Term Care Giving BY MICHELLE SANDOZ

T

he majority of long- term care services in this country are provided not by nursing homes—as many may incorrectly assume—but by women in the home. A study by the U.S Department of Health and Human Services, titled “Where is Long-Term Care Provided?” found these services were provided by women who are approaching their 50’s, are employed full-time and may be responsible for their own children as well as the care of a loved one. In fact, about three-fourths of family caregivers are women. Although men do provide some direct care, it is women who are likely to do most of the “hands-on” care, such as bathing and feeding the person in need. In a Genworth survey, “Beyond Dollars: The True Impact of Long-Term Caring,” over a third of surveyed caregivers reported direct negative consequences to their lives. According to a 2009 study by the National Alliance for Caregivers, there are approximately 66 million Americans serving as unpaid family caregivers, with the economic value of this care estimated at $350 billion. Caregiving is an extremely difficult

job and many caregivers show symptoms of decline in physical and mental health. It can have dramatic effects on caregivers’ lives: their marriages, family dynamics, and relationships with friends and financial security. It is not uncommon for caregivers to have serious health problems. Emotional stresses may include: concern over the recipient’s health and safety; loss of friends due to increased time spent caregiving; feelings of depression; and a sense of guilt over desiring personal time. If you or anyone you know has been a caregiver for just two weeks, most can agree to these feelings. U.S. Department of Health and Human Services reported elderly people who felt stressed while taking care of a disabled spouse were 63 percent more likely to die within four years than those caregivers who were not feeling stressed. The main reason for this is that caregivers get less sleep, do not exercise and eat properly, and do not keep up with their own medical care. As women age they may be likely to face major challenges as they seek to maintain independence and security. According to the National Center for Health Statistics in 2006, women have a longer life expectancy than men,

briefs

outliving them by an average of 20 or more years. Women who reach 65 can expect to live an average of 20 more years, and those who reach 75 can expect to live another 13 years. Upon visiting a nursing home, you will notice a large ratio of women to men. Many of us mistakenly believe that traditional health insurance pays for long-term care services. Health insurance pays for medical expenses, doctors’ services and hospital stays. Generally, it will not cover long-term care costs. Research shows that roughly 70 percent of those currently turning 65 will have longterm care needs at some point in their lives. Consider purchasing a longterm care insurance policy to plan for your long-term care needs and ensure protection from these consequences. Please contact me for a free publication by Genworth Financial: “A guide for women and their advisors in preparing for long-term care.”

ABOUT THE AUTHOR Michelle Sandoz works at Insurance Specialists in Hailey. She specializes in long-term care insurance, health, life and disability. She can be reached at 788-9209. tws

REMINDER: Free Reading of Seafarer at the nexStage Tonight

A chilling tale of deviltry and hellfire will unfold on Wednesday, April 3, when the nexStage Theatre presents a free play reading of Irish playwright Conor McPherson’s “Seafarer.” The play, which runs one hour and 45 minutes with an intermission, starts at 6:30 p.m. at the theater at 120 S. Main St., Ketchum. Refreshments will

be available. The play, which takes a page right out of Celtic folklore, revolves around an alcoholic named Sharky who is attempting to stay off the bottle, even as he contends with his hard-drinking brother and his own haunted conscience. Sharky agrees to a harmless game

of poker but soon finds himself playing for his very soul when a stranger from the distant past arrives, raising the stakes higher. The cast features Andrew Alburger, Scott Creighton, Steve d’Smith, Keith Moore and Richard Rush under Jon Kane’s direction.

ADVERTISING

GETS RESULTS! the more places you’re heard & seen, the more customers you reach…it’s that simple!

be heard on the radio + be seen in the paper

sun

O

ver 125 children showed up to Mike Rose’s place, in Bellevue, this Sunday to search for Easter eggs. Four years ago, Rose began this tradition for the Bellevue community. It first began as five or six kids and he estimates this year’s crowd to be the biggest turnout. Rose and about five of his friends started preparations last week with boiling and coloring over 1,000 eggs. They even stuffed 500 plastic eggs for the sawdust pile. COURTESY PhotoS: BARBARA PATTERSON

Living Well

UI-Blaine Extension Tips

Poisonous Plants, Livestock

P

oisonous plants are a major cause of economic loss to the livestock industry. Each year these plants adversely affect 3 to 5 percent of the cattle, sheep, goats, and horses that graze western ranges. All too often the losses to individual livestock operations are large enough to threaten the viability of that ranch. There are no known treatments for animals poisoned by most poisonous plants. Where a treatment is available, affected animals are usually in remote places and cannot be reached until it is too late to provide treatment. Many livestock-related deaths from grazing poisonous plants are due to management error. This includes failure to examine a pasture or range prior to use because the growth of some of these plants varies from year to year. Failure to know and understand plants in an area that are toxic to livestock can lead to catastrophic losses. Prevention and knowledge are essential in avoiding livestock loss.

For more information on Living Well visit your Blaine County Extension office at 302 First Avenue South in Hailey, phone: (208) 788-5585 or e-mail: blaine@ uidaho.edu website: http://www. uidaho.edu/extension

Does that favorite vehicle in the garage need some work?

the weekly

Then, let’s fix it up for next Season! We Specialize in Restoration of Vehicles Body Work • Paint • Rust Repair • Upholstery Mechanical • Electrical • Specialty Needs

Call today and find out how to maximize your advertising dollar by being in 2 places at once!

Making Your Vehicle a Desirable Classic!

(208) 788.7118

• 10 3.7 KSKI • 107.5 H C E K K YZ 3 . 5 K 9 12

Hundreds of plants are poisonous to livestock; many are toxic at all times, whereas others are toxic only under certain conditions. Livestock producers are urged to become familiar with the plants on their ranges and pastures that are potentially dangerous to their livestock. Help in identifying these plants can usually be obtained from the local county agricultural agent or by mailing a sample to the USDA-ARS Poisonous Plant Research Laboratory (PPRL). Help with poisonous plant problems can also be obtained from local veterinarians. To request a copy of the USDA Plants Poisonous to Livestock in the Western States book or the mailing address for PPRL, please contact your local Extension office. tws

Th e W e e k l y S u n •

www.ClassicDriversInc.com

928.7139

Ap r i l 3 , 2 0 1 3

117 B Honeysuckle St., Bellevue


DEFINING KAPALA — SKI HALL OF FAMER, from page 1 to you and your job is not to screw it up,” said Kapala. “They have a certain way, a certain level of relentless determination and they will not be pushed off their path. “They don’t define themselves by their results as much as the standard they’ve set for themselves. They may win by a minute and they say to themselves, ‘I can go faster.’ They just don’t define themselves the way others do.” Kapala never envisioned spending his life as a coach— he’d hoped to be a freshwater aquatic biologist. But a coaching stint at Michigan Tech led to another stint at Pacific Lutheran University. He coached the top two boys in the state in Alaska, plus a girls team that included Nina Kemppel, who competed in four Winter Olympics and claimed 18 national championships before becoming a consultant for Fortune 500 companies. In 1987 he received a letter from the Sun Valley Ski Education Foundation that started, “We know you’re happy up there, but if you know anyone who would be interested in an opening as our coach, spread the word…” “I didn’t tell anyone,” Kapala said, that wide craggy grin stretching from one end of his face to the other. Before long, Kapala was flyfishing at Silver Creek, biking Sun Valley’s mountain bike trails and running up Carbonate Ridge. He even had a new bride on his arm—a science and math teacher at Wood River Middle School named Bridget with whom he recently celebrated his 20th anniversary. “I really like the environment here. It’s small enough you know the people who go to the post office but large enough to sustain the infrastructure you need to run a top-notch program,” he said. “And this place has the economic advantages to attract quality coaches—people like Chris Grover, who now heads the U.S. cross-country ski team,

and Chris Hall, now the head of Fischer Racing…” The shelves in Kapala’s office at the Lake Creek training hut sag under the weight of heavy tomes like “Lactate Threshold Training,” “One Stride Ahead,” “Sports Periodization,” “Jumping into Plyometrics” and “Theory and Methodology of Training.” There’s even a Texting Dictionary defining such abbreviations as ADIP (another day in paradise), 2G2BT (too good to be true) and 511 (too much information) so he can keep up with the youngsters. “6 at Sochi” posters heralding the Sun Valley Ski Education Foundation’s hopes for the future are sprinkled in among pictures of the 150 youngsters who participate in the program each year and gobs of trophies and plaques. “You make goals in three- to five-year increments and next thing you know, 20 years has gone by,” Kapala said, glancing around. The Nordic program got a big bump with the excitement generated by the 20002 Winter Olympics in Salt Lake City. School

kids watched Olympic athletes racing around the old Sun Valley Gun Club and—bang--there were 40 new kids in the pipeline. The North Valley Trails, especially the development of trails in Hailey, has helped, as well. “Build it and they will come,” Kapala said, quoting from “Field of Dreams.” “We have an amazing trail system that’s affordable and accessible to our community. And we will always be beneficiaries of this great alpine ski community that has paved the way for a robust cross-country community. And, while we’ve had notable success, parents aren’t necessarily saying, ‘I want my kid to be an Olympic skier.’ They’re saying, ‘This is a good, healthy program for my child to be involved in.’ They’re looking for something that’s challenging and fun, with people who care, and we can provide that.” Kelley Sinnott, who now coaches with Kapala after starting out as a racer, recalls how Kapala turned what initially seemed like a “big intimidating program” into a fun thing, with impromptu wrestling matches.

“The whole point is to stand on one ski and make sure your nose is over your toe,” says Rick Kapala as he teaches his young charges about balance.

“It’s so fun when you’re beating the coach to a pulp,” she said. “He retains a youthful enthusiasm for a guy who’s been doing this for so long. He exudes excitement, energy, passion, always looking out for the best interests of every kid. The kids pick up on the fact that it’s not just a job for him. He loves every minute of it, from working with kids who are struggling to being out on those extra nasty days.” Racer Nate Thomas agreed: “He’s really nice to everyone and he’s got a great bunch of good stories like what it was like back in the old days when he was young and all they had was classic skiing. He’s also a really good motivational speaker. He makes you relaxed, ready for a race, but jazzed up at the same time. He tells us: ‘You have a chance of doing great tomorrow and, if you don’t, that’s okay, too.’ ” Kapala, of course, claims that any success he and the program has had is a product of a cooperative effort of all its coaches

FEEL GOOD KAPALA-ISMS

TOAST ‘EM AT JANSS

Rick Kapala and other Sun Valley Ski Education Foundation coaches will be toasted this weekend when a couple hundred people take part in the Bill Janss Pro Am Classic. Former Olympic, World Cup, pro and even amateur skiers and snowboarders will participate in a myriad of fun events, including Saturday morning’s races on Lower Warm Springs. This year’s Pro Am Classic has been themed “Let the Games Begin!” in honor of the upcoming 2014 Winter Olympics in Sochi, Russia, so you can expect to see racers sporting such costumes as Monopoly game pieces to the Greek gods.

and all its athletes. “It’s possible to have success when you have people like Kelley Sinnott who are invested in cross-country skiing and athletes who are killing themselves with their training—they make us coaches look great.” tws

Rick Kapala can’t carry on a conversation without issuing a bunch of time-honored Kapala-isms. Here are a few: You have to define yourself not by wins or losses but by your efforts. Big successes are built on little things repeated over time. Every day there are a bunch of little lessons and tasks you need to get good at, such as being on time, having your equipment organized… When you give your best as athletes and coaches, you elevate each other. You don’t need me every day to point the way. You need to take your own responsibility.

The worst thing that happens at a bad race is you get a workout. When we talk about someone having talent, what we mean is that they have the talent to learn a lot, the talent to push themselves. No one is born good at something. You apply yourself and you improve. There’s nothing you can’t accomplish in life if you decide you’re going to work at it and bring to it relentless determination in everything you do.

Who teaches you? You do. We provide the tips, but at the end of the day, it’s a process of discovery. You’ve got to be true to yourself in terms of what motivates you and your understanding of your psyche. There’s nothing wrong with your technique that another thousand kilometers won’t fix. It’s not what you do when people are watching that matters but what you do when people aren’t watching. That’s why you see people like Morgan Arritola and Pat Casey out there training alone day after day.

... River Valley! LIVeE Wood

from th

copyandprint.biz

Log on today and see how much you can save doing business with us!

#1...type www.copyandprint.biz into your browser address bar #2...you’ll land on our “britlink” site. Save in your favorites as Copy & Print #3...select “create an account” #4...we’ll get with you to set up your unique discount plan #5...if you need a hand, just call Greg at 721-7450

Online office supplies with all of the features the other guys. • No shipping • Free Next Day Delivery • Local Business & Employees “Your friends & neighbors!”

Print Copy and Of fice Supply!

Th e W e e k l y S u n •

Ap r i l 3 , 2 0 1 3

Come see us on the corner of Croy & River in beautiful downtown Hailey

208-788-4200 208-788-4297 fax

13


sunclassifieds T H E W E E K LY

Ask the Guys

Dear Classified Guys, My 15-year-old daughter has been reading the classifieds and circling employment ads of places she'd like to work. My husband and I are leery of letting her get a job. We think she is too young for a part-time job and fear that it will interfere with her schoolwork. She already gets $10/week allowance, but she says she wants to make more money to buy clothes and go to the movies with her friends. We sat her down for a family meeting the other night hoping to resolve our differences. We tried to keep it calm, but there was a lot of screaming and yelling. When she practically threatened to start shoplifting, we decided to take her concerns more seriously. We're wondering if a job is a good idea for such a young teenager. At what age is it okay to let her go to work?

• • • Cash: Many teenagers love the idea of getting their first job and feeling independent. Of course, as they grow into adults, they usually can't wait to retire either! Carry: Much like most parental decisions, there is no specific rule

Fast Facts Summer Smarts

Duane “Cash” Holze & Todd “Carry” Holze 03/31/13 ©The Classified Guys®

on what age is appropriate for a first job. It should depend on the child's emotional maturity and your best judgment. Cash: Obviously your family meeting didn't quite go as planned. Screaming and yelling never really help any situation. Carry: First, you should be proud that your daughter is asking to have a job and not just an increase in allowance. It does show she has initiative, especially since she's been reading the classified section. Cash: It's never too early for her to learn good working habits. Having a part-time job on the weekend has a lot of benefits such as teaching her to be on time, developing self-esteem and hav-

ing a sense of responsibility. Carry: Some adults have needed several jobs to figure all that out! Cash: If you don't believe she is emotionally ready for a weekend job, there are other options you can try to compromise with her. Consider offering her a paid job around the house or maybe she could work for a close neighbor. That way she gets to make some extra money, but you get to make sure her schedule doesn't interfere with her schoolwork. Carry: Negotiating a compromise with her on this situation will go a long way to developing your relationship. That will prove very helpful when she turns 16 and wants her first car!

A study by The American Sociological Review found that how children spend their summer break could have a big impact on their future. Over summer break, kids often forget much of what they learned in school. However, those who were engaged in organized sports, read newspapers, visited museums, and engaged in mental activities over the summer break had an increase in academic achievement. They were more likely to attend a four-year college and reduce their dropout rate.

Celebrity Style

Not many of us had glamorous first jobs. So it may be comforting to know that even the celebrities started out simple. Singer-songwriter Gwen Stefani wasn't always a pop star. She started working by scrubbing floors at a Dairy Queen. Actor Matthew McConaughey shoveled chicken manure for a while. Actress Kate Winslet once worked at a deli making sandwiches. Even actor Brad Pitt had many jobs that didn't make the "A list", including dressing up as a chicken mascot, moving refrigerators and being a limo driver. •

Reader Humor Retail Reality

As the HR Manager for a large retail store, I'm always looking for good honest workers. Luckily with the new school season, I get a few students looking for a job after school. As if on cue, I had a young high school girl stop in and fill out an application. She was very meticulous, taking the time to answer each question. When she handed it to me, I took a few minutes to look it over. Under the previous employment section she listed "babysitter" as her last job. Before I could ask her about it, I laughed at the next line. Next to reasons for leaving she wrote, "They came home." (Thanks to Dorothy C.)

Laughs For Sale

At that age, can they even see over the bar?

WANTED s for rtender Wedding ba Sundays. Saturdays & preferred. Experience t 8 years old. leas Must be at

Got a question or funny story? Email us at: comments@classifiedguys.com.

www.ClassifiedGuys.com

10 help wanted Systems Integration & IT Technician and Technician Level I or II needed to join Maestro team in audio/video, home theater, commercial and residential infrastructure, security integration, & network installation. Detail oriented, organized, and selfmotivated person with solid computer skills required. Go to www. Maestrots.com for job description and application instructions. RN, Health Services Administrator Needed NOW! “Immediate Hire! We’re looking for you!” Come join our healthcare team at the Blaine County Jail site in Hailey, ID! Full Time Position, 32hrs/wk + benefits! APPLY online TODAY at w w w. c o r re c t i o n c a re . c o m / why-chc/311-careers-about-us EOE Jane’s Artifacts is now hiring a sales associate - part to full-time available. Must be able to work weekends. Must have retail sales experience and have good math skills. Basic knowledge of 10-key, cash register and a knowledge of art and office a plus. Must be able to learn and run equipment in copy center. Send resume to janesartifacts@cox.net or fax to 788-0849.

11 business op Richer Every Morning - please visit www.ProfitableSunrise.com/ ?upline=xtremecash The Dream is Alive!

Established Sales Route For Sale

Deliver tortillas, chips, bread, misc. from Carey to Stanley & everything in between. $40,00. Or, with 2 trailers and a pick up: $58,000.

Call Tracy at 208-720-1679 or 208-578-1777. Leave a message, I will call you back

Choose Your Hours, Your Income and Your Rewards - I Do! Contact: Kim Coonis, Avon Independent Sales Representative. 208-720-3897 or youravon.com/kimberlycoonis

19 services HOUSEKEEPING SERVICES; Experience, Recommendations, Responsible, free estimates, call : 208720-5973 Dog Vacations: Never caged, hikes, stick chasing, 24-hour interaction and supervision. Three friendly resident dogs for playmates. Call 4812016. Twin Falls Train Shop & Hobbies trains and parts, lionel trains, repairs. Consignment, buy, sell, and trade. 144 Main Ave. S., Twin Falls, Idaho. Call Simon at 208-420-6878 for more info. Professional Window Washing and

14

maintenance. Affordable rates. 7209913. Books can change the life of another person, so if you have some that are taking up space, and would like to donate them, call Fabio at 788-3964 and we’ll pick them up for free. Two guys and a truck - Furniture moving & hauling. Dump runs. No job too small. 208-720-4821. MOVING MADE EASY - The little ladies will pack’em and stack’em and the mighty men will load’em and totem. We’ll even do the dreaded move out clean. Call 721-3543 for your moving needs. JACK OF ALL TRADES - One call does it all, whether your job be big or small. Drywall, paint, small remodels, maintenance, tiling, woodwork, electrical plumbing, framing, etc. Don’t stall, give a call, 720-6676.

20 appliances Thermador Professional 6 burner dual fuel stove and oven. Stainless. $1000 OBO 208-309-1130

21 lawn & garden Thanks for the great season!  See you next spring! Black Bear Ranch Aspen Tree Farm

22 art, antiques and collectibles

The Trader is now accepting consignments for furniture, home accessories and collectibles. Call Linda at 208.720.9206. Kitchen Pie Cupboard - wooden w/carving on the doors. Must see! Was $250, no just $175. Must See! Old Firestone Console Radio/phonagraph. Works sometimes, has tubes. $150 OBO. 788-2566 Blonde Oak Dresser with hand carving - (3 drawer) $250. 788-2566

25 household Professional fabric cutting machine - 7˝ throat. Self sharpening. Like new. $500. Call 720-5801 Nice, warm, low operating cost far infrared heaters for sale. Two sizes. Call 788-2012

26 office furniture 2 golden wood file cabinets. $75 each OBO 208-309-1130 IKEA computer desk. Silver and light wood with shelves, monitor space, etc. $100 OBO 208-3091130

37 electronics Samsung Galaxy 10.1 Tablet w/ leather case and charger. Clean. $375. 727-7159

40 musical

Antique oval dining table, 2 leaves, 6 chairs with hand crafted seats. $950. Pics avail. (406)671-1582 or getfit_12@yaho.com Hundreds of basketball cards for sale. 1980-2000. All cards in excellent to mint condition. $375 OBO for all. Call 208-309-1959. ORIGINAL AND UNUSUAL ARTWORKS. Three original Nancy Stonington watercolors, $500 to $1000. Unique Sunshine Mine 100th anniversary poster, very nicely framed, $150. Original dot matrix painting, 3’ wide by 4’ high, Jack Gunter, $1500. Call Ann (208) 726-9510.

24 furniture Antique oval dining table, 2 leaves, 6 chairs with hand crafted seats. $950. Pics avail. (406)671-1582 or getfit_12@yaho.com 2 wood video/CD/book/ tape shelves. $25 each OBO 208-3091130 Crib with mattress and bedding. Crib can convert into toddler bed. $50 obo. (406)671-1582 or getfit_12@yahoo.com King size water bed with all equipment: box springs, frame, heater, used but in good condition. Free, you haul. 788-2927. Dining or conference table with 6 chairs. Blond colored wood. $500 OBO 208-309-1130 Modern-style, glass-top tasking/ work table. Almost new. Retail $250, yours for $50 OBO. Call 208-3091088

Yamaha baby ebony grand piano in excellent condition. $8500 208-6227455. Upright William Knabe piano and bench. Light brown wood. Very pretty. Tuned. $300. Please call 208309-1130 Rehearsal Space for Bands Available - area has heat and restrooms. Call Scott at 727-1480. Voice lessons - classically trained, professionally unionized singer/actress. All ages and abilities encouraged and accepted. Vivian Lee Alperin. 727-9774. Guitar and drum lessons available for all levels of musicians. Our studio or yours. Call Scott at 727-1480.

Remington 760 Series, pump, 3006. $450 Firm. Call 320-3374 We pay cash for quality ski and snowboard gear - Ketchum Pawn. 208-726-0110.

56 other stuff for sale PRODUCTS AVON at www.youravon.com/beatriz5, Avon Independent Sales Representative. AVON puedes solicitar tus productos y ver los catalogos on line en www.youravon.com/beatriz5

60 homes for sale Northstar 4 Bd/2.5 BA home, recent upgrades, central air, $359,000. Call Sandra Caulkins, Sun Valley Real Estate, 208-720-3497. A realtor that makes your best interest a priority, 720-9609, kurt.selisch@ coldwellbanker.com. Coldwell Banker Distinctive Properties. 5 br/3 bath 2 story Farmhouse on 30 acres, in alfalfa. Domestic and irrigation wells. Four and 1/2 milesfSouth of Bellevue. Beautiful views, close to Silver Creek. $375,000. 208-7882566 SALMON RIVER: 2+2 Home, Apt., Barn, Garage, Bunkhouse, (1,500 sf improvements) on 3.14 level fenced riverfront acres between StanleyClayton, $239,000. 80-miles north of WRV. Adjacent 3.76 level riverfront acres also avail. for sale, $139,500. Betsy Barrymore-Stoll, Capik & Co. 208-726-4455. Beautiful 3 bed/2 bath mountain lodge-style home on nearly 2 acres 3.6 miles west of Stanley (Crooked Creek Sub.). Asking $495,000. Jason Roth, Broker, Legacy Group, LLC, 208-720-1256 Fairfield - 3bd/1ba, big fenced yard, fire pit, 2-car garage, outbuildings, chicken coop, woodstove. On 3 lots in town, walk to bars and restaurants. 1,792 sf, 2-story, propane, city water and sewer. Call 208-837-6145. Owner carry.

64 condos/townhouses for sale Sweetwater • Hailey, ID

48 skis/boards, equip. Volkl Wall 177cm - twin tip. Brand new, never been drilled. $275. Call 309-1088 SKIS FOR ME! Volkl Kendo 177cm w/Marker IPT wide-ring binding. Skied 10 times. $495. Call 309-1088

Th e W e e k l y S u n •

12 p.m. on Monday

Place your ad • Online: fill out an auto form on our submit classifieds tab at www.TheWeeklySun.com • E-mail: include all possible information and e-mail it to us at classifieds@theweeklysun.com • Fax: 208-788-4297, attn: The Weekly Sun • Mail: PO Box 2711, Hailey, ID 83333 • Drop By: we are located in the Croy St. Bldg. on the corner of Croy & River streets in Hailey. We are the first door on the right at the top of the stairs, and if we aren’t here, you can place it in the drop box on the door

cost All Line Ads 20 words or less are FREE in any category. After that, it is 17.5¢/per word. Add a photo, logo or border for $7.50/per week in b/w, or $45 for full color. Classified Display Ads are available at our open rate of $10.98/column inch SNOWCREEK SV condo. 2/2 with loft. Baldy views, walk to Pavilion. Pool, Dollar Mt. lifts, bike path. Penny Windermere 208-309-1130 Ketchum  TIMBERS 3/3 fully furnished turnkey! Baldy views, hardwood floors, private underground parking, hot tub - location! $695,000. Windermere Penny 208-309-1130 Ketchum PTARMIGAN immaculate 2/2.5 reverse floor plan, underground parking, storage lockers. Walk to River Run, bike path. $339,000 Windermere Penny 208-309-1130

70 vacation property Hey Golfers!! 16 rounds of golf & 2 massages included w/ luxury 2 BR/ 2 Bath unit on beach in Mexico. Choose between Cabo, Puerto Vallarta, Cancun on availability $2900/ week. 788-0752.

72 commercial land Hailey block (choose 3 lots, 7 lots, or full block 10 lots). Development opportunity, alley access. Zoned H/ B. Windermere Penny 208-309-1130

73 vacant land 19 acres, 2,000’ river front, 4 miles S. of Mackay. Fenced, fishing, wildlife, views, gorgeous!. $140,000. photos available jjgrif@gmail.com. 208-726-3656. 50% REDUCTION SALE by owner - 2.5 acre lots near Soldier Mountain Resort and Golf Course. Great skiing, underground power and telephone completed in scenic subdivision. $24,500. 720-7828. SALMON RIVER: 3.76 level riverfront fenced acres between Stanley and Clayton. Hunting, fishing, riding, views, 80-miles north of WRV, $139,500. Adjacent 3.14 level riverfront acres w/1,500 sf improvemtns also available for sale, $239,500. Betsy Barrymore-Stoll, Capik & Co. 208-726-4455. Hagerman. Vacant lot in North view mature sub-division with own well system. Poor health forces sell. Great neighborhood. Hot springs, Snake River and bird hunting near surrounding area. $29,000, owner consider carry paper. 208 788-2566

77 out of area rental

50 sporting goods Youth, Black Diamond “Wiz Kid” climbing harness. One size fits youth to 12 years old. Like New, used once. $30. Call 578-2230. Fox 32 suspension fork. 150mm w lockout. RLC/FIT. 8” Tapered steer tube. 15mm thru axle. Clean. $500. Call 208-727-7159 Adjustable Basketball Hoop Assembly.  $75.00 Call 788-1290 Masi Road Bike for sale - excellent condition. $1,000. Call for more info 208-720-5127

DEADLINE

39 Sold • 4 Under Contract Sweetwater Townhomes ONLY $168,000 BONUS!!! When you buy a Sweetwater home, you’ll receive FREE HOA dues thru 12/31/2013!! Green Neighborhood www.SweetwaterHailey.com Village open 7 days a week (208) 788-2164 Sales, Sue & Karen Sweetwater Community Realty

Ap r i l 3 , 2 0 1 3

2bd, 1ba home on Salmon River Furnished - $650 month plus utilities. No smoking. First, last and deposit, pets neg. References requested. Located across from Old Sawmill Station between Stanley and Challis with easy access to River. Call Denise at 7882648.

78 commercial rental Office space 2000 sq ft. $.50 sq ft - Seven offices, Kitchen, Two restrooms one with shower, Underground parking. 208-720-0691 Main Street Ketchum - Ketchum LI / Storage – .85 – 1.00 / sqft / mon. Bellevue Main Street – Office / Retail. Jeff Engelhardt 578-4412, Allstar-


c l a s s i f i e d ad pa g e s • d e ad l i n e : n o o n o n M o n day • c l a s s i f i e d s @ t h e w e e k ly s u n . c o m PropertiesOnline.com Great Shop/Storage/ Space - 1680 sf shop with 7’ bay door, 9’ ceilings with 2 offices at Cold Springs Business Park across from St. Luke’s Hospital with both Hwy 75 & Hospital Dr. access. We would consider splitting the shop space for a long term tenant or we will accept winter or year round car, boat, toy, or household storage. Contact Emil Capik emil@sunvalleyinvestments.com or 622-5474 PARKER GULCH COMMERCIAL RENTALS - Ketchum Office Club: Ground Flr #104, 106; 153 & 175 sf. Upstairs #216, Interior, 198 sf. Lower Level #2, 198sf. Also Leadville Building Complex: Upstairs, Unit #8, 8A 229-164sf; Upstairs Unit #2 & 3, 293166sf. Call Scott at 471-0065.

ANY

FREE

category

20 WORDS

s d a d e fi i s s cla

or fewer

ALWAYS FREE

in the Weekly Sun!

80 bellevue rentals Bellevue, for lease new unfurnished apartment over barn w/ fridge, stove, full bath, spacious living room, views, wonderful light, complete privacy. Good cell reception, wired for phone/internet,TV. $750 plus cleaning deposit, includes electricity, water, garbage,plowing. Horse arrangement possible. References required. 208-721-8898.

SUBMIT YOUR CLASSIFIED ADS BY 12 P.M., MONDAYS

82 ketchum rentals Studio plus loft, top floor furnished apartment. Baldy views, balcony, laundry, parking. Walk to River Run and town. $550/mth. 208-309-1130 Gorgeous 1-bedroom/ 1-bath available in downtown Ketchum. New building, high-quality features and neighbors. Covered parking + storage. $950. Call 415-652-7400

86 apt./studio rental Mid valley rental: Studio available now. Large bedroom, larger bathroom, and mini kitchen. Deck, views, sunny, and utilities included. Single, non smoker, dog considered. Cleaning/security deposit. $600/ month. (208) 788-4929 Tanglewood Apartments for rent - 3bd. $695/month. Unfurnished. Please call 720-7828 for more info.

87 condo/townhome rental Wake up to Incredible Views - condo conveniences, estate living, 1bd/1.5 ba, 900 sf., unfurnished apt. on 5 acres. Bike, ski and snowshoe from back door. 1.5 miles from Sun Valley and Ketchum. N/S. $895/month, incl. utilities and cable. Pets negotiable. Call 622-7555. Copper Ranch condo.  Beautiful, quiet and spacious.  2 bed, 2 bath, ground floor. Garage and nice patio. Residence faces the mountains; must see to appreciate.  New appliances, washer/dryer, gas fireplace.  Available April 1.  Small pet negotiable.  $900 per month, long term preferred.  Call 309-0615 or 720-2579.  

89 roommate wanted Roommate wanted. Mature, moderate drinking, no drugs. 2bd available for 1 person. North Woodside home. $350 + utilities. Wi-fi available. Dog possible, fenced yard. 720-9368.

the weekly

• e-mail: classifieds@theweeklySUN.com • drop by/mail: 16 West Croy St. /

81 hailey rentals 2BD, 1BA house in south Woodside. One car garage, sprinkler system, fenced back yard. Pets negotiable. $850/mo plus utilities. Available May 1. Please call 208-450-9729 or 208450-9082. 3 BD/2 BA duplex, Just remodeled! No smoking, pet possible, avail early April. $1100/month + utils. Brian at 208-720-4235 or check out www. svmlps.com Nightly/weekly/monthly! 2 BD/1 BA condo, fully furnished/outfitted. Prices vary depending on length of stay. 208-720-4235 or check out www.svmlps.com

sun

• fax: (208) 788-4297

PO Box 2711, Hailey, ID 83333

Looking for someone to share the cost of living these days? Say it here in 20 words or less for free! e-mail classifieds@theweeklysun.com or fax to 788-4297

90 want to rent/buy Long term unfurnished rental needed starting May or June, K/SV/WS area, 3-4 Bd. Call 208-720-3497. Local single retired lady seeking long-term rental. Exceptional references. Call 720-1792

100 garage & yard sales Simplifying! Mega garage sale, all new items out, and discounted prices: Furniture, children and adult sporting goods, toys, antiques, building materials, garden supplies, Children’s clothes—toddler through teen $1/bag. Saturday only, 4/6. 0900 till? Early birds pay double. 201 Apache Lane (Indian Creek), or call 578-2230 if lost. It’ll be worth the trip! Simplificar! Mega venta de garaje, todos los elementos nuevos hacia fuera, y con precios reducidos: Muebles, niños y adultos, artículos deportivos, juguetes, antigüedades, materiales de construcción, artículos de jardinería, ropa de niños y niños pequeños a través adolescente $ 1/bolsa. Sólo el sábado, 4/6. 0900 hasta? Los madrugadores pagar el doble. 201 Apache Lane (Indian Creek), o llame al 578-2230 si se pierden. Valdrá la pena el viaje! Saturday 4/6, 8am-1pm Garage Sale. Furniture, clothing, yard tools, etc. 518 N 3rd, Bellevue List Your Yard Sale (20 words or less is always free) ad and get a Yard Sale Kit for only $9.99. Your kit includes 6 bright 11 x 17 signs, 6 bright letter-size signs, 100 price stickers, 10 balloons, free tip book. What are you waiting for? Get more bang for your buck when you list your ad in The Weekly Sun!

201 horse boarding Barn for Rent - 2 stalls w/ 12’ x 36’ runs. Small pasture area, large round pen, hay shed, storage area, heated water. North Hailey near bike path. $200 a month per horse. Call 7882648 Horse Boarding available just south of Bellevue; experienced horse per-

son on premises; riding adjacent to property. Shelter and Pasture available. Reasonably priced. Call 7883251.

302 kittens & cats Big Fluffy Female Kitty needs home; indoor/outdoor. Great w/kids; potty trained (will go outside too). Great mouser. Move forces finding a new home. Free to a good home. 208721-0447.

303 equestrian Farrier Service: just trim, no shoeing. Call 435-994-2127 For sale or trade, 1981 Miley bumper pull two horse trailer w/tack room, decent condition, $1,000 firm or trade for hay trailer, located Bellevue, 208-721-8898 River Sage Stables offers first class horse boarding at an active kid and adult friendly environment, lessons available with ranch horses. Heated indoor arena and many other amenities included. Please contact Katie (208) 788-4844.

400 share the ride Need a Ride? www.rideshareonline. com is Idaho’s source for catching or sharing a ride! For more information or help with the system, visit www. mountainrides.org or call Mountain Rides 788.RIDE.

5013c charitable exchange Do something good for your community Volunteer to drive for Meals on Wheels today, flexible schedule. We need you. For more information call Nicole @ 788-3468. For Rent: 6’ and 8 ‘ tables $8.00 each/ 8 round tables $5.00 each. Chairs $1.00 each. Contact Nancy Kennette 788-4347 Does your non-profit have a service, product or item that you need or could share with another organization who needs it? List it here for free! Say it in 20 words or less and it’s free! We want to help you spread the word. Just e-mail classifieds@ theweeklysun.com

502 take a class Sun Valley Center for the Arts presents an adult workshop: Sipping and Sketching w/Bob Dix - 5:30 to 7:30 p.m., Thursdays, April 4/4, 4/11, 4/18

and 4/25 at The Center, Hailey. Info/ Reg.: 208-726-9491 Sun Valley Center for the Arts presents a Teen Workshop: Drawing Fundamentals w/Danica Mattias - 10 a.m. to 4 p.m. this Saturday and Sunday, April 6 and 7 at The Center, Hailey. $10 pre-registration fee required. Info/Reg.: 208-726-9491 Wilderness First Aid Class - May 18 and 19 near at Camp Perkins, in the Sawtooth Valley. Fast-paced, handson training for people who travel in the outdoors. $200. Meals and lodging at Camp Perkinds available for add’l $95, but not required. Info/register: Paul Holle at 208-720-8437 or holle.paul@gmail.com Weeding, Watering and Fertilizing - 6 to 8 p.m. on Tuesday, April 16 at the Sawtooth Botanical Garden. $30. Sign up/Info: 208-720-2867 Building a Root Cellar and Your Own Chicken Coop - 6 to 8 p.m. on Tuesday, May 7 at the Sawtooth Botanical Garden. $30. Sign up/Info: 208-720-2867 Direct Seeding and Transplanting - No-Till Garden - 6 to 8 p.m. on Tuesday, May 21 at the Sawtooth Botanical Garden. $30. Sign up/Info: 208-720-2867 Writing Retreats - Wyoming Writing Retreat! - Triple Peak Lodge (June 19-23); Women’s Writing Retreat Sicily (September 15-22). Kate Riley, Story Consultant - www.kateriley.org Ongoing Weekly Writing groups with Kate Riley. Begin or complete your project! 2013 Writing Retreats and more! Visit www.kateriley.org Metal Clay classes at The Bead Shop in Hailey. Monthly Beginner’s “mini-teazer”, Intermediate Skills Classes and Open Studio with skills demo. www.LisaHortonJewelry for details or call 788-6770 to register. $25 deposit and registration required. KIDS CLAY - 3:30 to 5:30 p.m. every Friday, Bella Cosa Studio at the Bead Shop Plus, Hailey. Info: 721-8045 Hot Yoga in the South Valley - 8:10 to 9:40 a.m. on Tuesdays and Thursdays. $10/donation. Call for location/ Info: 720-6513. Tennis 101. Fun, family, fitness, a tennis program designed to teach the basics to all ages. 9-10:30 a.m.

SCATTERED SHOWERS

high 65º

high 65º

high 57º

high 54º

high 49º

high 51º

high 55º

WEDNESDAY

THURSDAY

FRIDAY

SATURDAY

SUNDAY

MONDAY

TUESDAY

low 40º

low 44º

low 40º

low 37º

low 33º

low 34º

low 35º

THE WOOD RIVER VALLEY 7-DAY WEATHER FORECAST IS BROUGHT TO YOU BY: Th e W e e k l y S u n •

Ap r i l 3 , 2 0 1 3

at WR High School, 1250 Fox Acres Road. Register at idtennis.com, (208) 322-5150, Ext. 207.

506 i need this Do something good for your community Volunteer to drive for Meals on Wheels today, flexible schedule. We need you. For more information call Nicole @ 788-3468. ERC needs Trex in good condition, any color, for sustainable yard redesign project at our office. Call 208726-4333. NEEDED: Please support the Hailey Memorial Day Ceremony. Make checks payable to: H.C.M.D.C.F. (Hailey Cemetery Memorial Day Ceremony Fund). Mail to: Hailey Memorial Day Committee, 211 W. Elm St., Hailey, ID 83333. For details call Maggie Springer at 208-309-1959. DONATE your books, shelves or unwanted cars that you don’t need any more or are taken up space in your house. Free pick up. 788-3964 NEEDED - Aluminum cans - your donation will support public art in Hailey. Drop donations off at 4051 Glenbrook Dr., Woodside Industrial Park or call Bob 788-0018 for pickup.

509 announcements From Margot’s Table to Yours offering small B&B style breakfasts, lunches, dinners, après ski menus in the privacy of your or Margot’s own space. $15/hour (does not include menu ingredients) Call 208-7213551 or email margot6@mindspring. com We pay cash for quality ski and snowboard gear - Ketchum Pawn. 208-726-0110. Are you struggling to make ends meet? Not always enough to pay the bills and buy groceries? The Hunger Coalition is here to help. Hundreds of local families individuals have food on their table and some relief from the daily struggle. Confidential. Welcoming. Supportive. There is no reason to face hunger alone. Call 788-0121 Monday - Thursday or find out more at www.thehungercoalition. org. Have an announcement you’d like to share? Send someone wishes for their special occasion, or list events for your businesses, etc. Say it here in 20 words or less for FREE! E-mail classifieds@theweeklysun.com or fax 788-4297.

510 thank you notes Show your appreciation! Say thanks with a FREE 20-word thank you note, right here. e-mail your ad to classifieds@theweeklysun.com.

512 tickets & travel Frequent trips to Boise. Need something hauled to or from? Call 208-320-3374

514 free stuff (really!) FREE BOXES - moving, packing or storage. Lots of sizes. Come and get ‘em or we’ll recycle them. Copy & Print, 16 W. Croy St., Hailey.

518 raves Sorry to hear that your Top Shelf Consignment Shop (above Cari’s Hair Care) is no longer — but thanks so much for all your REALLY GREAT customer service there during its operation. Snagged several shirts there that I have gotten heaps of compliments on (wish now that I had bought a couple more of them!!) :) Like something? Don’t keep it to yourself! Say it here in 20 words or less for free. e-mail your ad to classifieds@theweeklysun.com or fax it over to 788-4297 by Noon on Mondays.

[208.788.7446]

Custom Signs & Graphics CUSTOM SIGNS 15


c l a s s i f i e d ad pa g e s • d e ad l i n e : n o o n o n M o n day • c l a s s i f i e d s @ t h e w e e k ly s u n . c o m 602 autos under $5,000 1999 Pontiac Bonneville - $2,700 OBO. Brand new tires. Call 413-2659561 ‘98 Chevy Cavalier - black. Cracked head gasket. Once fixed, it should run good. Almost new car stereo and speakers. $500. 541-517-6530

606 autos $10,000+ PROGRESSIVE INSURANCE - For all of your automotive needs. Call 208-788-3255

610 4wd/suv 1999 GMC Suburban SLT 4x4, loaded, runs great, some minor details need TLC. 175,500 miles. $2,800. 471-0147 2004 GMC Yukon XL SLT 4WD. 145,000 miles, fully loaded. New tires, Leather, DVD, Sunroof. $10,000. Call 788-1290 1977 G10 Jeep pickup - $1,500 OBO. Call 413-265-9561 1989 Ford F150, 4WD. 6cyl, 4 speed manual, long bed w/shell. Good tires. Motor replaced in ‘05. Differential rebuilt in ‘08. $1,500. Call Carol at 208886-2105.

1982 Ford Bronco - 4x4, white, standard 351. New battery, runs good, good tires. 73,000 orig. miles. $2,500 OBO. 208-837-6145.

zakk hill comic strip

611 trailers For sale or trade, 1981 Miley bumper pull two horse trailer w/tack room, decent condition, $1,000 firm or trade for hay trailer, located Bellevue, 208-721-8898

620 snowmobiles etc. 1997 700 RMK - custom paint, skis. Always garaged. $1,500 OBO. Call 208-721-1103.

621 r.v.’s 1986 Southwiind 27 foot motorhome, sleeps 5 easily with separate bedroom and bath. Excellent condition with new refrigerator and awning. Includes self contained generator. Only about 55000 miles – runs great. $7200. 788-0752 Motorhome, 1977, 22ft., mechanically excellent, needs roof repair. Call 435-994-2127 Drift Boat - Fish/Rite, 15 ft., oars and anchor system. $3,000. Call 208-720-1579. tws

They’re talking about us, but we’re not worried. Here’s what they’re saying: _I[ XWV[M \PM ZM[ TQMV\[ IVL  V ] < MMSTa NQZ[\\QUM K WN \PM V a =PM @ QVO QV Ia ]X 6IV PM XZWL]K\QW [ \Q Z M ^ _ = IL \  Z V M M M ^ N\ _ M\Q\Q ~* [ /QTTM[ a [ITM[ a KWUX UM[ 5M P]OM 6I\M[ IZM ^MZ MZ ,WU V _ Z W  Z \PM IL XPMVWUMVIT ,TI]LQI 0ZMM  IL _I[

sun the weekly

It’s Always More Fun in

You Can Find it in Blaine! b l o o m!

Advertise on this page for ONLY $35/week! (includes full color & free ad design)! Space is limited, call today!

Steve: 309-1088 Leslie: 309-1566

8,)86%()6 'SRWMKRQIRXJSVXLILSQI

Wednesday through Saturday 11:00 to 5:00 Always available by appointment and if we’re here.

720-9206 or 788-0216 509 S. Main Street • Bellevue, Idaho

come have a sip of tea and a little luxury…

WEARETHE8OOD 3IVER7ALLEYeS /&84ERTAI$OMFORT MATTRESSSTORE 726.2622 • 491 E. 10th St., Ketchum • www.fisherappliance.com

From Your Roof to Your Rain Gutter, We’ve Got You Covered!

208.788.5362 fully insured & guaranteed

Airport West | Hailey, Idaho 83333

-BHP"[VM

Food is the Essence of Spring—Let Margot do the Cooking

Salvadorian & Mexican Cuisine

to your’s

Offering Small B&B-styled Menus

Th e W e e k l y S u n •

We Offer Catering

15/hour (does not incl. cost of ingredients)

$

Contact Margot, today, for your special occassion or party! 208-721-3551 margot6@mindspring.com blog.tempinnkeeper.com

There’s No Place Like Home! 16

tues-sat 11-5:30

table

from margot’s

SCott Miley Roofing

bellevue square • 788-9879

Ap r i l 3 , 2 0 1 3

Open 11am-10pm

578-1700 14 W. Croy

Hailey (next to Hailey Hotel)


April 3, 2013