Issuu on Google+





Can Starbucks save the economy?

Rick Scott’s education plan


Basketball kicks off 2011-12 season









More than 200 students travel 1,000 miles for pipeline protest

!"#$%&"'()*+,( -%./"-(.$01'*+2( 3*,,1""%%



INDEX: News 2 ! 8

Viewpoints 9 ! 12


Ğ ĊėĆđĞēĆėđĎēČ /+(01.+'#"%&-+#.)

!"#$#%0#1)$/2'%#3%4+,+%(5%4#,/2 7)8+$$+$$+//+)"+9#"):'"4#).+;#),%+$)0(#)<01.2)%01$#)1/),0)=>)$,12#(,$6



Entertainment 13 ! 18 The Quickie 19 ! 20

Sports 21! 24


! !+,-

the current


!"#$%#&' 93":43


E742F-%-+67+0%2163+47%<7"?748%7+6+/#+>%4/>%=7"8%E20+7G 240/"243%6"8812/0A

D+<1:3/642%<7+-/>+20/43%7/#43-%>+:40+%="7+/?2%<"3/6A ,-$#$%&




;661<A%B433%C07++0%<7"0+-0+7-%-5/=0/2?%0"%6"33+?+% 648<1-+-






H/>24<<+>% 64065+7% D48"-% 7+-61+>% /2% .+2+I1+34 341#-./0$*01*2



;:484%<1-5+-%="7%7+2+,+>%+2?4?+8+20%,/05%@-/4% !""#$%&











the current


!+,- "

(( &&$)* !"#!$%&&$)*














!+,% C047:16K-% /2/0/40/#+% 4/8-% 0"% -0/81340+% @8+7/642%+6"2"8A(%L":%847K+0


ĞĆėěĊėđđĎĔęĊĊ 3//)08%-.9*%#)/&'(%)*+






! !+,-

the current


94705% <20+72-5/:%6"17-+%433",-%7+43% 1:;40+ ,"73;%+=:+7/+26+%>"7%-01;+20ĞĆėĞǦĆęĊĈĊēēĆ !"#$%&'($&#)*+%&$,%



?!9@AB%C7420-%D43+-0/2+%>133%8+8E+7-5/: ĞĊĆēĆĜđĔė –ƒơ”‹–‡”

1"(%$,/8*"9*+&=&.,7&3*!".."#/ ƒŽ‡•–‹‹ƒƪƒ‰•™ƒ˜‡™‹–Š˜‹…–‘”›Ǥ







the current






!+,- !










! 2*,#

the current


=,"$$*0>#%:':&)+0"$<%#'+0#% Ä&#x17E; Ä&#x2014;Ä&#x160;Ä&#x152;Ä&#x160;Ä&#x17D;Ä&#x2018;Ä&#x2018;Ä&#x17E; !"#$%&'($&#)*+%&$,%

!"#$#%&'%()**+,%-."#) !"#$%&&#"'()*++%"',*&-.&&%&'/"01#")'23'!"#$%&&#"'4/+&#56

9/?*0@% /*)*A0+$*#% $.*%+0$# Ä&#x17E;Ä&#x2020;Ä&#x2C6;Ä?Ä&#x160;Ä&#x2018;Ä&#x160;Ä&#x2C6;Ä?Ć­ Ä&#x17D;Ä&#x161;Ä&#x2018;Ä&#x17D;Ä&#x2020;Ä&#x201C;Ä&#x2020; Ä&#x2014;Ä&#x201D;Ä&#x2DC;Ä&#x2DC;Ä&#x17D; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;ÇĄÂ&#x2018;Â?Â&#x2013;Â&#x201D;Â&#x2039;Â&#x201E;Â&#x2014;Â&#x2013;Â&#x2039;Â?Â&#x2030;Â&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;


You know what they say, Facebook is for the people you know and Twitter is for the people you want to know. 7KH RQOLQH VRFLDOÄĽQHWZRUNLQJ DQG PLFUREORJJLQJVLWH7ZLWWHUDQQRXQFHGLQ 6HSWHPEHU WKDW LW KDV PRUH  PLOOLRQ DFWLYH XVHUV DQG VHYHUDO RI WKHP DUH FRPLQJIURP(FNHUG&ROOHJH Twitter, created in 2006 by Jack Dorsey, allows users to post up to 140 characters DWDWLPHDOVRNQRZQDVDÂłWZHHWV´DQG WKDW SRVW LV LPPHGLDWHO\ DYDLODEOH WR DOO RIWKHLUÂłIROORZHUV´Âł7ZHHSV´DOVRNQRZ DVSHRSOHZKRXVHWZLWWHUPD\FKRRVHWR follow other tweeps so that they can see their tweets on their news feed. While WKHOLQJRPD\VHHPFRQIXVLQJDWÂżUVWLWLV UHDOO\MXVWDVLPSOHUYHUVLRQRI)DFHERRN -HQHH 9DQGHUVW\QH D VRSKRPRUH DW (FNHUG IURP 9LFWRU 1< ÂżUVW VWDUWHG using Twitter a year ago to keep in touch ZLWK KHU FRXVLQ ZKR PRYHG WR 8WDK WR WUDLQIRUWKH2O\PSLFVÂł1RZDORWRIP\ friends are using Twitter, itâ&#x20AC;&#x2122;s a great way WRNHHSLQWRXFKZLWKWKHPDQGVHHZKDW WKH\DUHXSWR,XVH7ZLWWHUPRUHVRWKDQ )DFHERRNQRZ´9DQGHUVW\QHDGGHG &DUROLQH %RQG D MXQLRU IURP +XQWLQJWRQ 1< XVHV 7ZLWWHU IRU D YDULHW\RISXUSRVHVÂł,WZHHWPD\EHRQFH RUWZLFHDGD\´VKHVDLGÂł,ÂśOOXVXDOO\VKDUH SLFWXUHV WZHHW DW P\ IULHQGV WR PDNH WKHPODXJKVD\VRPHWKLQJDERXWP\GD\ RU SXW XS D PRWLYDWLRQDO TXRWH ,WÂśV DOVR PRUHSULYDWHWKDQ)DFHERRNEHFDXVH\RX can restrict who follows you so I donâ&#x20AC;&#x2122;t IHHOOLNH,ÂśPEHLQJVWDONHG´ Twitterâ&#x20AC;&#x2122;s popularity is growing rapidly. This can be largely attributed to celebrities creating accounts so they can interact with their fans as well as other celebrities. Twitter also allows you to view conversations between celebrities, creating an authentic feel for the



few weeks ago. Another facet of Twitter is using a hash tag to denote trending topics. The hash tags can be clicked on, linking tweeps WRDOORIWKHUHFHQWWZHHWVZLWKWKHVDPH KDVKWDJ5HFHQWWUHQGLQJWRSLFVLQFOXGH &RQUDG0XUUD\3HQQ6WDQG-RH)UD]LHU all who have been in the news. Despite Eckerd Collegeâ&#x20AC;&#x2122;s adaptation to 7ZLWWHUWKHVWXGHQWERG\VHHPVWRKDYH yet to follow, as none of the three Eckerd DɡOLDWHG DFFRXQWV KDYH PRUH WKDQ  IROORZHUV Âł, IHHO OLNH , FDQÂśW JHW HQRXJK DFURVV LQ  FKDUDFWHUV DQG LWÂśV MXVW DQRWKHU WKLQJ WR NHHS XS ZLWK´ &DOHE 'RZG\DMXQLRUIURP6W3HWHUVEXUJVDLG Although Twitter is still not on )DFHERRNÂśV SRSXODULW\ OHYHO RQ FDPSXV (YDQLHU EHOLHYHV LW LV RQO\ D PDWWHU RI WLPHÂł,NQRZVRPHSHRSOHDUHVNHSWLFDO DERXWLWDQGWKLQNLWÂśVZHLUG´KHVDLGÂł%XW once you give it a shot it gets addicting. You can see what youâ&#x20AC;&#x2122;re friends are up to, what youâ&#x20AC;&#x2122;re idols are up to, and whatâ&#x20AC;&#x2122;s JRLQJ RQ LQ WKH ZRUOG DOO RQ WKH VDPH SDJH<RXFDQÂśWEHDWWKDW´


9&0':*%/'($"(&*#%#$0&;;)*%$'%+//*:$%+&#$*0"$< Ä&#x17E;Ä&#x2122;Ä?Ä&#x2020;Ä&#x201C;Ä&#x2020;Ä&#x2C6;Ä?Ä&#x160;Ä&#x17E; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; Everyone knows about the European sovereign debt crisis WKDW KDV EHHQ KDPSHULQJ JOREDO HFRQRPLF SURVSHFWV VLQFH LWV inception in May 2010 with *UHHFHÂśVÂżUVWLQWHUQDWLRQDOEDLORXW Since then, Ireland and Portugal have both sought bailouts due to WKHLULQDELOLW\WRJHWGHEWÂżQDQFLQJ RQ WKH SULYDWH PDUNHW 6LQFH 0D\  *UHHFH KDV DSSOLHG IRU D second bailout. With Spain enacting VLJQLÂżFDQW UHIRUPV LQ  ,WDO\ and Spain have been under sharp scrutiny. 8QIRUWXQDWHO\WKHUHDUHRQJRLQJ SUREOHPVZLWKWKHLPSOHPHQWDWLRQ RI DXVWHULW\ PHDVXUHV LQ *UHHFH and Italy that continue to cause


&.)"+)/(.0".)%&'()*+ 34)$5%'67*)$$ #+,,)&-)&-),-"8&9)&-/)#0),12)1+ ,$$)-%&.)"+)/(.0".)%&'()*+ :"$)&"';",7$$7 1/234)5%,'6($"+ <,"#%';,7* 7(+"2)*+%*8%1(./.2"$ =)-4'>758&.7&

LV ,WDO\ KDV IJ WULOOLRQ LQ GHEW that will be due between now and WKHHQGRI7KLVDPRXQWHYHQ dwarfs the newly expanded EFSF, ZKLFK KDV UHVRXUFHV DPRXQWLQJ WR IJWULOOLRQ The passing of the austerity package by Italyâ&#x20AC;&#x2122;s legislature EULQJV KRSH $VVXPLQJ WKDW ,WDO\ÂśV HFRQRP\GRHVQRWWDNHDVLJQLÂżFDQW plunge into recession, the package would balance Italyâ&#x20AC;&#x2122;s budget by 2013 ZKLOH UHVWRULQJ FRQÂżGHQFH LQ WKH ERQG PDUNHW WKDW ,WDO\ ZLOO PDNH JRRGRQLWVFRPLQJGHEWSD\PHQWV 7KHSDFNDJHÂśVSDVVDJHDOVRUHTXLUHV ,WDOLDQ3ULPH Minister Berlusconiâ&#x20AC;&#x2122;s UHVLJQDWLRQ DQG UHSODFHPHQW ZLWK Mario Monti who will head an LQWHULPXQLW\JRYHUQPHQW There is still serious concern WKDWWKHVHGHYHORSPHQWVZLOOQRWEH

enough to arrest the ongoing debt crisis. Borrowing costs for Ireland DQG 3RUWXJDO UHPDLQ VWXEERUQO\ KLJK DQG WKH\ PD\ FRPH EDFN IRU second bailouts of their own. Spain LV VWLOO H[SHULHQFLQJ WXUPRLO LQ LWV ÂżQDQFLDO LQGXVWU\ WKDW PD\ OHDG WR a bailout there, too. 1RQH RI WKHVH UHSRUWV HYHQ WRXFK RQ WKH XQGHUO\LQJ SUREOHPV LQ WKH HFRQRPLF IXQGDPHQWDOV RI all 5 countries presently involved in the crisis: Portugal, Ireland, ,WDO\ *UHHFH DQG 6SDLQ 7KHUH LV VWLOO VLJQLÂżFDQW FRQFHUQ LQ ERWK DFDGHPLD DQG WKH SROLWLFDO VSKHUH that the crisis will continue and the newly expanded EFSF will still not have enough resources to contain all the unresolved issues within Europe.

7KH&XUUHQWLVDIUHHELZHHNO\VWXGHQWQHZVSDSHUDW(FNHUG&ROOHJH2ɡFHV are located upstairs in Cobb at 4200 54th Ave S, St. Petersburg, FL, 33711. Opinions expressed in this publication are those of the writers and do not QHFHVVDULO\ UHĂ&#x20AC;HFW WKRVH RI (& VWXGHQWV VWDÉą IDFXOW\ DQG DGPLQLVWUDWLRQ

&'()*+A(.AB:("8 C.4$)%'@"&8)$. -4)#+,,)&-/)#0),12)1+

!"#$%&'()*+ !"#$%&'()* #+,,)&-&)*./)#0),12)1+ ,$$)-%!"#$%&'()*+ Â&#x192;Â&#x2039;Â&#x2013;Â&#x2014;ĆĄÂ&#x203A;


=/./@(.@%&'()*+ :"E':",-8&)F C("#D*(.)$%&'()*+ !),"$%&'@",$8&D #+,,)&-A8)*./)#0),12)1+ ,$$)-%C("#D*(.)$%&'()*+ ;",A),'G)) ED*+)$%&'()*+ G8&#7$&'C&1,).H=)#0 #+,,)&-.I7,-./)#0),12)1+ ,$$)-%ED*+)$%&'()*+ 3)-4'>"A81 F:"%G3(2H("%&'()*+ C$8';$8&). F:"%G3(2H("%&'()*+ !7.4'J))$),

9:*)*%&'()*+ ;"..8)'?#47" ;"<%&'()*+ !74&&%'!7&). ;"<%=/$)"+ 34"*&';,"8&) 7(+"2)*+%*8%9>?,'6"+)($(.@ @)A7&'B8$$8"9. #+,,)&-"1./)#0),12)1+ ,$$)-%7(+"2)*+%*8%9>?,'6"+)($(.@ C,8)$$)'=+,D),




the current


C"$@%/'&(/")%<"3*#%."#$'0@%+%B)+/*%$'%#$+@ Ä&#x17E;Ä&#x17D;Ä&#x2020;Ä?Ä&#x17E;Ä&#x2018;Ä&#x2018;Ä&#x17E; !"#$%&'($&#)*+%&$,r The St. Petersburg city council recently agreed to XSJUDGHDQÄĽ\HDUÄĽROGKLVWRULFDO waterfront property in the downtown area. The Lantern Lane $SDUWPHQWV ZKLFK LV QRZ *UD\OÂśV +RWHO ORFDWHG DW  %HDFKZRRG'ULYH1(RSHQHG -DQ  DQG VL[ PHPEHUV RI WKH FLW\ÂśV &RPPXQLW\ 3UHVHUYDWLRQ &RPPLVVLRQ with a full crowd of onlookers, listened to a case on behalf of the owner Chuck Prather, a local real estate developer. This hotel is waterfront, facing Beach Drive and there are only a few buildings left like this in downtown. %DUEDUD 5DFH SUHVHQWHG IRU WKH 3ODQQLQJ DQG (FRQRPLF 'HYHORSPHQW 6WDÉą RQ EHKDOI of preserving the historical value of the property. The building was originally owned by Mrs. Purnell and the Evening Independent wrote DERXW KHU Âł7KH /DQWHUQ /DQH $SDUWPHQWV DUH VLJQLÂżFDQW QRWRQO\WRWKHFRPPXQLW\EXW DV D FRPPHUFLDO UHVLGHQWLDO and architectural building. It !"#$%&'()*#+,&"+)*#+&)-.,&%)(/,()/+)0.1+,.1+)2,3)4&,&"(56"73 was one of the last buildings desLJQHG E\ DUFKLWHFW *HRUJH and interior by the addition of a 4th Ă&#x20AC;RRU D 3HOWKDPLQ´ rooftop bar on the 5thDUHVWDXUDQWRQWKHÂżUVW The new owners wish to keep the Historical Ă&#x20AC;RRUDVWDLUHOHYDWRUWRWKHWRZHUDQG)RUHYHU integrity of the building, but added an extra French doors to the 2nd and 3rdĂ&#x20AC;RRU,QDGGLWLRQ Ă&#x20AC;RRURSHQLQJLWIRUKRWHOSXUSRVHVDUHVWDXUDQW to these changes, they plan to bring the entire DQGPHHWLQJSODFH EXLOGLQJXSWRWKHÂżUHVDIHW\FRGHV Beth Connor a spectator, thanked the 7R HQVXUH IURP WKH KLVWRULFDO DVSHFWV RI FRPPLVVLRQIRULPSURYLQJWKHhistoric treasures WKH EXLOGLQJ UHPDLQ WKH QHZ DGGLWLRQV ZLOO EH RI6W3HWHUVEXUJ0RWLRQZDVPRYHGE\5REHUW VHW VOLJKWO\ EDFN IURP WKH RULJLQDO IDoDGH7KH &DUWHU DQG VHFRQGHG E\ $UQHWW 6PLWK DQG DOO VHYHULW\RIWKHGHFD\ZLOOGHWHUPLQHWKHDPRXQW PRYHGIRULW RIUHPRYDOWKDWZLOOQHHGWREHGRQH,WZLOOEH The second part of the agenda was on a replaced by new construction but historically &HUWLÂżFDWHRI$SSURSULDWHQHVVIRUWKHEXLOGLQJ correct as was illustrated by pictorial evidence 7KH QHZ RZQHUV ZLVK WR LPSURYH WKH H[WHULRU displayed clearly for everyone inside city









90+:%;*+<&*% /'(=*1(#% +/$"'(#% '>%?@0"+(% <'3*0(1*($ Ä&#x17E;Ä&#x2122;Ä?Ä&#x2020;Ä&#x201C;Ä&#x2020;Ä&#x2C6;Ä?Ä&#x160;Ä&#x17E; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;

A+)1*$$'%A0'=&/$"'(#%B0*B+0*#%>'0%#B0"(< Ä&#x17E;Ä&#x160;Ä&#x2018;Ä&#x2018;Ä&#x17E;Ä&#x201D;Ä&#x2DC;Ä&#x2122;Ä&#x201D;Ä&#x201C; !"#$%&'($&#)*+%&$,%

2*,# !

The Arab League is one of WKH PRVW SRZHUIXO PXOWLÄĽVWDWH RUJDQL]DWLRQV LQ WKH 0LGGOH (DVW DQG FHUWDLQO\ WKH PRVW SRZHUIXO SROLWLFDO RUJDQL]DWLRQ ,W ZDV WKHLU FRQGHPQDWLRQRI*DGKD¿œVFLYLOZDU in Libya that set the stage for the 81 6HFXULW\ &RXQFLO 5HVROXWLRQ SHUPLWWLQJ WKH 1$72ÄĽHQIRUFHG QRÄĽĂ&#x20AC;\ ]RQH 7KH $UDE /HDJXH DFWHG DJDLQ 1RY  WR FRQGHPQ the ongoing violence in Syria by VXVSHQGLQJ 6\ULDÂśV PHPEHUVKLS LPSRVLQJ HFRQRPLF VDQFWLRQV DQG UHFRPPHQGLQJ WKDW DOO $UDE FRXQWULHV UHFDOO WKHLU DPEDVVDGRUV to Syria. 7KH PHDVXUHV SDVVHG ZLWK eighteen votes in favor, two votes DJDLQVWDQGRQHDEVWHQWLRQ<HPHQ DQG/HEDQRQRSSRVHGWKHPHDVXUH ZKLOH ,UDT DEVWDLQHG :KLOH WKRVH GLVVHQWHUV KDYH LPSRUWDQW LPSOLFDWLRQVWRDQHVFDODWLRQRIWKH FRQĂ&#x20AC;LFWLQ6\ULDLWLVVWLOOUHPDUNDEOH that there was consensus regarding WKH FRQGHPQDWLRQ RI 6\ULD ,W is a state considered one of the pillars of the Arab League, unlike *DGKD¿œV/LE\DZKLFKZDVDSDULDK even in the Arab League. There are larger geopolitical LPSOLFDWLRQV WR WKLV PRYH 7KH $UDE /HDJXHÂśV FRQGHPQDWLRQ RI /LE\D KHOSHG WKH 86 ZKLS UHFDOFLWUDQW 81 6HFXULW\ &RXQFLO PHPEHUV OLNH 5XVVLD DQG &KLQD LQWR VXSSRUWLQJ WKH QRÄĽĂ&#x20AC;\ ]RQH 6\ULDLVDOVRZLWKLQUDQJHRI1$72 ÂżJKWHUV DQG LW LV HQWLUHO\ SRVVLEOH WKDW WKH $UDE /HDJXHÂśV PRYH ZLOO FDXVH7XUNH\ 5XVVLD DQG &KLQD WR reconsider their positions. Despite the corresponding situation, the Arab League has expressed hope that their sanctions will bring President Assad to the table for negotiations with the protesters on ways to stop the violence. It is notable that the Arab Leagueâ&#x20AC;&#x2122;s FRQGHPQDWLRQ GLG QRW FDOO IRU LQWHUQDWLRQDOPLOLWDU\LQWHUYHQWLRQ ZKHUHDV WKHLU FRQGHPQDWLRQ RI Libya did. To an extent, the desire for a GLSORPDWLF UHVROXWLRQ LV D VPDUW PRYH RQ WKH SDUW RI WKH $UDE /HDJXH'HVSLWHWKHRYHUZKHOPLQJ FRQGHPQDWLRQ LW UHFHLYHG IURP its Arab neighbors, Syria can VWLOO FRPPDQG VRPH PHDVXUH RI LQĂ&#x20AC;XHQFH LQ WKH UHJLRQ LQĂ&#x20AC;XHQFH that could turn a Western intervention into a regional war. Lebanon is presently ruled by a FRDOLWLRQ JRYHUQPHQW GRPLQDWHG E\+H]EROODKDQGLWVV\PSDWKL]HUV ,UDQDOVRUHPDLQVDVWURQJVWUDWHJLF ally of Syria. If that were not HQRXJK ,UDTÂśV UXOLQJ FRDOLWLRQ who abstained on the Arab League YRWH H[LVWV EHFDXVH RI D PLOLWDQW SURÄĽ,UDQ SDUW\ RI 6KLLWHV 7KDW coalition could collapse, leading to civil unrest or it could intervene on 6\ULDÂśVVLGHRIDQ\FRQĂ&#x20AC;LFW The Middle East is a powder keg, and it always has been. World leaders need to be especially careful on how they decide to proceed now that the Arab League RɡFLDOO\ FRQGHPQHG WKH DFWLRQV RI WKH 6\ULDQ JRYHUQPHQW $Q\ LQDSSURSULDWH PRYHV FRXOG WULJJHU a wider regional war with global GHYDVWDWLQJFRQVHTXHQFHV

! 2*,#

the current


B l a s t f r o m t h e pa s t Welcome back to the â&#x20AC;&#x153;blast from the past,â&#x20AC;? a feature showcasing articles from our archives. This fourth piece, from March 9, 1979, showcases the artwork of an incredibly talented Eckerd alum. The rest, as they say, is history!

How talented can an EC graduate be? Very! Former â&#x20AC;&#x153;Eckâ&#x20AC;? Greg Lawson, who graduated with the class of â&#x20AC;&#x2DC;78, has done some excellent work in portraying the typical Eckerd student doing some typical and not so typical things. Lawson invented the â&#x20AC;&#x153;Eckâ&#x20AC;? and even though he has secured a copyright for the unusual creature, many EC departments have used it quite freely. Thimblerig is more than happy to present you with some of Lawsonâ&#x20AC;&#x2122;s latest creations. By the way, if you see yourself in one of these examples of life on campus, donâ&#x20AC;&#x2122;t be disgruntled; itâ&#x20AC;&#x2122;s like being on Candid Camera.


9/:*0;%/'11&("$<%.'('0#%+0$"#$"/%+/."*3*1*($#% Ransom performed in a trio with Jennifer Medina and Darryl QueÄĽ senberry, both of whom have worked with Ransom for many years. Medina played a baritone ceÄĽ ramic guitar and described the muÄĽ sic as â&#x20AC;&#x153;jungly.â&#x20AC;? Medina generally plays bass guiÄĽ tar but learned how to play the ceÄĽ ramic guitar and has worked with Ransom for three years. QuesenÄĽ berry, who played the drums, has worked with Ransom for over 10 years. Ransom played wind and string instruments, switching beÄĽ tween the two during songs. The trio performed a total of ÂżYH VRQJV LQFOXGLQJ Âł5LYHU 6XLWH´ ZKLFKPL[HGPDQ\GLÉąHUHQWVRXQGV including drums, pipes and reÄĽ corded bird noises. The songs were

inspired by Ransomâ&#x20AC;&#x2122;s encounters with the women in Peru who sang about their homeland. He used their melodies and his own style to create his unique art. Following Ransomâ&#x20AC;&#x2122;s perforÄĽ mance, a reading of poetry and exÄĽ cerpts from novels was held in the Roberts Music Center. 3URIHVVRU6WHUOLQJ:DWVRQEHJDQ the event with an excerpt from KLV ERRN Âł)LJKWLQJ LQ WKH 6KDGH´ a story about football and loss set LQ D ÂżFWLRQDO WRZQ LQ )ORULGD LQ 1960. His tale follows protagonist Billy who accidentally injures a felÄĽ low football player, resulting in the ER\ÂśVGHDWK7KHVFHQH:DWVRQUHDG came from Billyâ&#x20AC;&#x2122;s attempt to apoloÄĽ gize to the injured boyâ&#x20AC;&#x2122;s family, an emotional and riveting passage.

The next reading came from SRHW 'U +HOHQ:DOODFH ZKR UHDG a selection of her poems includÄĽ ing â&#x20AC;&#x153;Upstartsâ&#x20AC;? and â&#x20AC;&#x153;Cardinal at the %HGURRP:LQGRZ´+HUSRHPVH[ÄĽ plored the themes of political activÄĽ ism, death and human nature. Daniel Vilmure, assistant profesÄĽ VRURI&UHDWLYH:ULWLQJUHDGIURP KLVZRUNÂł/DZUHQFHRI6XEXUELD´,W detailed travels in the Middle East and experiences with Arabic culÄĽ ture and religion. The excerpt was OLJKWÄĽKHDUWHGDQGHQWHUWDLQLQJ The last two readings were from creative writing professor Tracy Crow and the chair of the creative DUWV FROOHJLXP 6FRWW :DUG &URZ read from her memoir of service as a woman Marine in the 1980s, an interesting account called â&#x20AC;&#x153;Eyes

Right.â&#x20AC;? The book will be released $SULO   :DUG UHDG IURP KLV ZRUNÄĽLQÄĽSURJUHVV Âł5HEHO´ D SRHP about a southern solider in the Civil :DU7KHWKHPHRIZDUDQGWKHOLIH of a solider appeared throughout his work. The last event for the day was a Cabaret performed in Roberts MuÄĽ sic Center by alumna Becca McCoy DFFRPSDQLHGE\-DPHV:HDYHU7KH title of their performance was â&#x20AC;&#x153;The Pearl in the Hogwaller.â&#x20AC;? A lot of the music was inspired by McCoyâ&#x20AC;&#x2122;s PRYHIURP&KLFDJR,OOWR3DODWND Fla., and the way she adjusted to all of the small town surprises she encountered in Palatka. One of the surprises she sings about is the â&#x20AC;&#x153;lime Jello marshmallow cottage FKHHVH VXUSULVH´ VKH ÂżQGV DW KHU

church potluck. The songs were hysterically IXQQ\ EXW DOVR KHDUWIHOW ,Q Âł-XVW D Housewife,â&#x20AC;? McCoy expressed soÄĽ cietyâ&#x20AC;&#x2122;s views on a housewife while acting drunk to demonstrate methÄĽ ods of coping. This had the audiÄĽ ence roaring with laughter. Between songs, she quoted a seÄĽ lection of her Facebook statuses, including, â&#x20AC;&#x153;Becca McCoy is having a great mommy day, but a bad hyÄĽ giene day. They usually coincide.â&#x20AC;? Her wonderful voice and charisÄĽ matic attitude entranced the audiÄĽ ence as she showed that she truly is the â&#x20AC;&#x153;Pearl in the Hogwaller.â&#x20AC;? The Creative Arts Collegium plans to continue this annual event in the coming years.



the current





Lobster claw game animal cruelty Â&#x2019;Â&#x192;Â&#x2030;Â&#x2021;Í?Í&#x153;

Friendly Fire

Sean and Ethan discuss same sex marriage Â&#x2019;Â&#x192;Â&#x2030;Â&#x2021;Í?Í?

EC to D.C.: Fighting oil with oil !"#$%&'()$*+$,-.-$/0$0"#$1#230'+#$45$6*7#8*+#$7&'0#30-$$$




Ä&#x17E;Ä&#x2020;Ä&#x2014;Ä&#x203A;Ä&#x160;Ä&#x2014;Ä&#x2018;Ä&#x2018;Ä&#x17D;Ä&#x201D;Ä&#x2122;Ä&#x160;Ä&#x160; Â&#x2022;Â&#x2022;Â&#x2013;ǤÂ&#x2039;Â&#x2021;Â&#x2122;Â&#x2019;Â&#x2018;Â&#x2039;Â?Â&#x2013;Â&#x2022;Â&#x2020;Â&#x2039;Â&#x2013;Â&#x2018;Â&#x201D; :KHQ,ÂżUVWKHDUGDERXWWKH(&WULSXSWR'&WRSURWHVWWKH.H\VWRQH XL Pipeline, I was just as excited as the other 200 students who signed up WRPDNHWKHPLOHWUHN,ZDVH[FLWHGULJKWXSWRWKHGD\RIGHSDUWXUH WU\LQJWRÂżWP\FDPHUDOHQVHVDQGFORWKHVLQRQHWLQ\EDFNSDFN /DVW PLQXWH SHUVRQDO FRQĂ&#x20AC;LFWV SXW D GDPSHU RQ P\ H[FLWHPHQW VR , GHFLGHGWRVWD\RQFDPSXVIRUWKHZHHNHQG%XW,ZLVKHGWKHGHSDUWLQJ (FNHUG VWXGHQWV JRRG OXFN DQG VXONHG DURXQG IRU D IHZ KRXUV IHHOLQJ






regret about not showing enough support for the movement. :LWKLQ MXVW D IHZ KRXUV RI WKH YDQV SXOOLQJ RXW RI (FNHUG , KHDUG something that made me feel better about my decision to not join the FDUDYDQXSWR'&6RPHRQHVDLGÂł,VQÂśWLWLURQLFWKDWLQRUGHUWRSURWHVW our dependency on oil, we have to use a large amount of it.â&#x20AC;? The irony of the situation hadnâ&#x20AC;&#x2122;t been completely lost on me before, EXW,KDGQÂśWJLYHQLWDQ\UHDOVFLHQWLÂżFWKRXJKW $FFRUGLQJWRWKH(3$SRXQGVRI&22, carbon dioxide, are released into the atmosphere for every gallon of gasoline burned. Though miles per JDOORQ YDULHV EHWZHHQ PDNHV DQG PRGHOV WKH (3$ HVWLPDWHV WKDW PRVW

Perspectives Find out what your classmates think about the idea of having a barge of dorms Â&#x2019;Â&#x192;Â&#x2030;Â&#x2021;Í?Í&#x153;


:"89-8%501,;-0#,8"09-0154,21%7650<-2%.5=2%5>1-8%?$@$% Ä&#x17E;Ä?Ä&#x2020;Ä&#x201C;Ä&#x201C;Ä&#x201D;Ä&#x201C;Ä&#x17D;Ä&#x;Ä&#x160; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; Throughout my life, I havenâ&#x20AC;&#x2122;t spent much time appreciating mother earth. I was forced into environmental classes in high school and now college, but I never intended to change my mindset that protecting earth wasnâ&#x20AC;&#x2122;t at the top of my priorities. I have spent numerous heated debates declaring that the world has much more important issues, such DVVWDUYDWLRQZDUKXPDQWUDɡFNLQJPXUGHU and poverty, that people should focus their time, money and energy on. My counterparts often responded with evidence of global warming caused by humans, which I usually GLVUHJDUGHG DV Ă&#x20AC;LPV\ DQG WKH GHYDVWDWLRQ of land for development and technology, ZKLFK,VDZDVDVDFULÂżFHQHHGHGIRUKXPDQ expansion and development. ,HYHQDVNHGP\(FNHUGWRXUJXLGHGXULQJ (FNHUGÂśVSURVSHFWLYHVWXGHQWVZHHNHQGZKDW ZRXOG KDSSHQ LI D VWXGHQW DW (FNHUG ZDVQÂśW necessarily concerned with the environment. Her reaction was confusion and she UHVSRQGHGE\DVNLQJZKDW,PHDQWZLWKDIDFH ÂżOOHGZLWKFRQWHPSW6LQFHWKHQ,ÂśYHOHDUQHG

WR NHHS P\ DSDWK\ IRU WKH GHVWUXFWLRQ RI HDUWK WR P\VHOI HVSHFLDOO\ KHUH DW (FNHUG VLQFH VHYHUDO RI P\ FORVH IULHQGV GHÂżQH themselves as environmentalists. However, my EHOLHIV DQG ODFN of support for environmental issues and movements were called into question after I attended WKH &36 HYHQW titled â&#x20AC;&#x153;Resisting Climate Changeâ&#x20AC;? by Bill 0F.LEEHQ,HQMR\H[SDQGLQJP\NQRZOHGJH on issues I disagree with and needed DQRWKHU&36HYHQWFUHGLWVR,IRXQGP\VHOI in the midst of dedicated and passionate HQYLURQPHQWDOLVWV ZKR ÂżOOHG WKH URRP LQ support of the cause. I listened with an open PLQGDQGZDVWDNHQDEDFNE\WKHOHFWXUH Bill McKibben explained his goal for reducing carbon in the air clearly and supported it with unbiased evidence proving human involvement in global warming. He focused on preventing the Keystone XL

pipeline from being constructed, which would cross through the heart of America. +LVRUJDQL]DWLRQZRUNVJOREDOO\ZLWKPLOOLRQV of volunteers to lower the carbon in the air to 350 parts per PLOOLRQ ÄŞVHH PRUH DW RUJÄŤ , KDG always disregarded the environmental issue due to faulty research ! SHANNON VIZE I had reviewed, uneducated environmentalists who forced their beliefs on me and the hippie stereotype I associated with the PRYHPHQW/LVWHQLQJWR0F.LEEHQ,ÂżQDOO\ witnessed something I could believe in. An environmentalist I felt I could trust and rely on who was educated and unbiased in his display of facts, but was also clearly passionate. I left Fox Hall feeling passionate DERXW VDYLQJ WKH HDUWK IRU WKH ÂżUVW WLPH LQ my life. I wanted to get involved in the protest of the pipeline and do my best to prevent further destruction of the place WKDWKDVQXUWXUHGPHP\HQWLUHOLIH,VSRNH

â&#x20AC;&#x153;I take more of an initiative to recycle, save energy and get involved.â&#x20AC;?

Â&#x2019;Â&#x160;Â&#x2018;Â&#x2013;Â&#x2018;Â&#x2026;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2013;Â&#x2021;Â&#x2022;Â&#x203A;Â&#x2018;Â&#x2C6;Â&#x161;Â&#x2021;Â&#x2026;Â&#x2014;Â&#x2013;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x2018;ĆĽÂ&#x2026;Â&#x2021;Â&#x2018;Â&#x2C6;Â&#x2013;Â&#x160;Â&#x2021; Â&#x2018;Â&#x2DC;Â&#x2021;Â&#x201D;Â?Â&#x2018;Â&#x201D;

A6-%9-50,0<%">%/-57Ä&#x17E;Ä&#x2018;Ä&#x17D;Ä&#x2DC;Ä&#x2020;Ä&#x2030;Ä&#x160;Ä&#x2018;Ä&#x2DC;Ä&#x2122;Ä&#x160;Ä&#x17D;Ä&#x201C; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;

B"#$%C,7D%E7"11%.8,1-2%5F"31%-G3751,"0 H7D-8GI2%J8-2,G-01%H521950%50G 7"4390,21%E-50%K5.4"8%8-2/"0G


ZLWK0DU\ÄĽ.DWH0F.HQQDRQHRIP\IULHQGV DQG D VWXGHQW KHUH DW (FNHUG ZKR FODVVLÂżHV herself as an environmentalist, about my past EHOLHIV DQG P\ QHZIRXQG SDVVLRQ 6KH VDLG â&#x20AC;&#x153;Most people tend to believe there are two RQO\ H[WUHPHV (LWKHU \RX DUH GHGLFDWHG WR saving the earth and hate people because they cause the destruction, or you donâ&#x20AC;&#x2122;t care at all about global warming and climate change and WKLQNLWÂśVMXVWDEXQFKRIKLSSLHVSURWHVWLQJ What people donâ&#x20AC;&#x2122;t see is that there is a middle ground. Only a few small changes can do a lot.â&#x20AC;? ,WKLQN,QRZIDOOXQGHUWKDWPLGGOHJURXQG Iâ&#x20AC;&#x2122;m not going to run out and try to save HYHU\ WUHH EXW , WDNH PRUH RI DQ LQLWLDWLYH to recycle, save energy and get involved. I went to the pipeline protest in D.C., and IRU WKH ÂżUVW WLPH , IHOW OLNH , EHORQJHG LQ D group of environmentalists. But it was more than that,.I felt connected to a group of people I had never seen eye to eye with, and was moved by their unwavering passion and commitment. Now, I am proud to be an environmentalist, and I will stand up to protect the earth.



It can be seen everywhere nowadays, on peopleâ&#x20AC;&#x2122;s clothing, accessories and jewelry. We see it decorating their cars, their homes and even permanently on their VNLQ6RZKDWLVLWDERXWWKHSHDFH sign that is so enticing it has made virtually every human being in the past few years want to decorate everything they own with this symbol? What does the symbol actually represent, and what has it turned into? 7KHSHDFHVLJQRULJLQDWHGLQ and itâ&#x20AC;&#x2122;s original symbolic meaning ZDV QRW WKDW RI XQLÂżFDWLRQ QRW RI IDFLQJ LQGLÉąHUHQFH DQG QRW HYHQ as loving each as their own. The original meaning behind the peace VLJQZDVVWDUWHGIRUWKHDQWLÄĽQXFOHDU ZDU SHDFH ZDON LQ (QJODQG E\ RQH

of the committee members, Gerald Herbert Holtom. The bottom triangle represents the letter N and the line represents the letter D in the naval code of semaphore. These letters stand for Nuclear Disarmament, and the circle symbolizes wholeness and the idea of completely banning nuclear weapons. The symbol was brought to the 8QLWHG6WDWHVLQWKHHDUO\ÂľVZKHQ University of Chicago student Philip Altbach convinced the 6WXGHQW 3HDFH 8QLRQ WR DGRSW WKH CND symbol as its logo. 6LQFHWKHQWKHSHDFHV\PEROKDV evolved to represent peace, unity, love and togetherness, but the people who adorn their bodies with this symbol donâ&#x20AC;&#x2122;t always practice what they preach. I canâ&#x20AC;&#x2122;t count how Â&#x2021;Â&#x2021;ÇĄÂ&#x2019;Â&#x192;Â&#x2030;Â&#x2021;Í?Í?

the current



*+!!,-./+01$2+,)(02 Leo developed into one of the biggest names in Hollywood, and I Ä&#x17E;Ä&#x2020;Ä? continued spending way too much Ä&#x2020;Ä&#x2014;Ä&#x2122;Ä&#x17D;Ä&#x201C;Ä&#x160;Ä&#x; !"#$%&'()*#*+$#+( WLPH VWDULQJ DW KLP ÄŞÂł,QFHSWLRQ´ ZDV RQ QHDUÄĽFRQVWDQW UHSHDW RQ ,-$.%&

As a lifelong vegetarian, Thanksgiving has never meant much to me. Instead of a turkey dinner with all the trimmings, Iâ&#x20AC;&#x2122;ve traditionally spent the afternoon preparing a large plate of nachos with all the necessary dips and toppings. Aside from sophomore year, I havenâ&#x20AC;&#x2122;t gone home for the holiday either. But not until today did I realize that, while I wonâ&#x20AC;&#x2122;t be at home with my family for Thanksgiving, something else will be: The Current, and therefore, this column. And, without fail, I guarantee this column will be passed around the dinner table for the entire Martinez/Dâ&#x20AC;&#x2122;Onofrio family to read. Interestingly enough, I have no idea to what extent my family knows Iâ&#x20AC;&#x2122;m gay, soâ&#x20AC;Śhey, guys. Hope dinner is going well. In keeping with the holiday spirit, Iâ&#x20AC;&#x2122;ve taken stock of a few of the things, big, fat, gay, or none of the above, that Iâ&#x20AC;&#x2122;m thankful for. Poppy At the risk of sounding clichĂŠ ÄŞDQG SLVVLQJ RÉą WKH UHVW RI P\ IDPLO\ IRU QRW LQFOXGLQJ WKHPÄŤ my grandfather, who I have called poppy for as long as I can remember, has been one of the PRVW LQĂ&#x20AC;XHQWLDO PHQ LQ P\ OLIH He had me playing poker by age  SRRO E\  DQG UXPP\ E\  +LV undying love for the Phillies fueled my interest in baseball. Heâ&#x20AC;&#x2122;s also a devout Catholic, but hey, nobody is perfect. Still, he is without a doubt the biggest embodiment of masculinity I had the pleasure of JURZLQJXSZLWKÄŞVRUU\'DG,ORYH you, but listening to Bjork is in no ZD\PDVFXOLQHÄŤ Leonardo DiCaprio I didnâ&#x20AC;&#x2122;t realize it then, but I spent way too much time staring at Leo when my dad took me to see â&#x20AC;&#x153;Titanicâ&#x20AC;? at age 9. After that,

HBO this summer, much to my GHOLJKWÄŤ Iâ&#x20AC;&#x2122;m especially thankful for Leoâ&#x20AC;&#x2122;s remarkable performance in the QHZ ÂżOP Âł- (GJDU´ ,Q WHUPV RI acting, itâ&#x20AC;&#x2122;s not Leoâ&#x20AC;&#x2122;s best. But the ZD\KHDQGFRÄĽVWDU$UPLH+DPPHU SRUWUD\HG WKH URPDQFH EHWZHHQ - Edgar Hoover and his FBI partner Clyde Tolson was quite memorable. 2KDQGVHHLQJ/HRLQDPDQÄĽRQÄĽ man kiss is always worth the price of admission. December Diamonds Christmas Ornaments ,ÂżUVWFDPHDFURVVWKLVFROOHFWLRQ of glittery merman ornaments ÂżYH \HDUV DJR ZKHQ Âł%OD]H´ D VKLUWOHVV ÂżUHÂżJKWHU PHUPDQ ZRQ our familyâ&#x20AC;&#x2122;s â&#x20AC;&#x153;gag giftâ&#x20AC;? competition, where we trade intentionally bad presents. Last month I found the entire collection in a gift shop in 1HZ 2UOHDQV )RU ÂżIWHHQ PLQXWHV I stood in awe in front of a wall of WRSOHVVJOLWWHUÄĽWDLOHGPHUPHQHDFK SRUWUD\LQJDGLÉąHUHQWSURIHVVLRQ 7KHUHÂśV 2ɡFHU 5LSSHG D WRUQÄĽ VKLUW SROLFH RɡFHU &DQG\ &DQH D VHGXFWLYH &KULVWPDVÄĽWKHPHG RQH DQG 'RFWRU 7XUQHQFRÉą , ERXJKW -RKQVRQWKHFXWHEORQGZLWKDQÂł, just got luckyâ&#x20AC;? face. He now hangs DERYHP\EHGZDUGLQJRÉąEDGMXMX and the like. Astroglide Appropriate subject for an article destined to be passed around the dinner table? No. Useful? Yes. Enough said. Straight Men My knack for being primarily attracted to straight guys has been frustrating at times. But my heterosexual male friends have shown me on countless occasions what I like in a guy, and for that, I am thankful. Above all else, I am blessed to have a particular few of these friends that continue to stand by my side despite my obvious feelings for them. If you canâ&#x20AC;&#x2122;t beat â&#x20AC;&#x2DC;em, join em, and if you canâ&#x20AC;&#x2122;t date â&#x20AC;&#x2DC;em, stay close. Thanks, guys.

!"#$!%&'()"$ â&#x20AC;&#x153;It sounds like a really cool idea because we always need more housing, but I never thought about the bad things, and I feel like bad things could happen. There could be safety hazards, just because itâ&#x20AC;&#x2122;s kind of secluded. Even though itâ&#x20AC;&#x2122;s a lot of singles, I think it would be really awesome if this happened. I think itâ&#x20AC;&#x2122;s a good idea.â&#x20AC;?

ÄĽAna Cunningham, Sophomore

Letter to the Editor: Response to â&#x20AC;&#x153;Transfer students left out of the loopâ&#x20AC;?

! "# $ % & '( )#$%&'$

Regarding the Nov. 4 9LHZSRLQWV column entitled â&#x20AC;&#x153;Transfer students OHIWRXWRIWKHORRS´ZHUHFRJQL]HWKDWWUDQVIHUVWXGHQWVħSDUWLFXODUO\ WKRVHZKRFRPPXWHħIDFHVSHFLÂżFFKDOOHQJHVDQGZHDUHFRPPLWWHG to addressing those challenges. It is important, however, for readers to be aware of certain relevant facts. In response to past transfer student VXJJHVWLRQVDQGDVVHVVPHQWVWKH2ɡFHVRIWKH'HDQRI)DFXOW\'HDQ of Students, and Dean of Admission created special Autumn Term and :LQWHU7HUPFRXUVHVWRPRUHHÉąHFWLYHO\RULHQWWKHW\SLFDO$XWXPQ )DOO DQG :LQWHU6SULQJ WUDQVIHU VWXGHQWV7KHVH FRXUVHV DOWKRXJK academic in nature, include extensive orientation information and community building programming. The special Winter Term course LV UHTXLUHG RI DOO PLGÄĽ\HDU WUDQVIHU VWXGHQWV )DOO WUDQVIHU VWXGHQWV who choose not to enroll in the special transfer Autumn Term course SDUWLFLSDWH LQ D WKUHHÄĽGD\ RULHQWDWLRQ SURJUDP WKDW WRJHWKHU ZLWK D detailed welcome and information packet, covers the informational issues raised by the author of the Viewpoints article.

â&#x20AC;&#x153;Like all things that hurt, they are good for you! Thatâ&#x20AC;&#x2122;s what I tell my freshies...this is building character.â&#x20AC;? ÄŚ$SV\FKRORJ\SURIHVVRURQWKLQJVWKDWDUH

Â&#x201D;Â&#x2021;Â&#x2020;Â&#x192;Â&#x201E;Â&#x2018;Â&#x2013;Â&#x192;ÇĄÂ&#x2022;Â&#x2022;Â&#x2039;Â&#x2022;Â&#x2013;Â&#x192;Â?Â&#x2013;Â&#x2021;Â&#x192;Â?Â&#x2018;Â&#x2C6;Â&#x2013;Â&#x2014;Â&#x2020;Â&#x2021;Â?Â&#x2013;Â&#x2022;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x192;Â?Â&#x2019;Â&#x2014;Â&#x2022;Â&#x2026;Â&#x2013;Â&#x2039;Â&#x2DC;Â&#x2039;Â&#x2013;Â&#x2039;Â&#x2021;Â&#x2022; Â?Â?Â&#x2021;ǤÂ&#x2021;Â&#x2013;Â?Â&#x2018;Â&#x201D;Â&#x2021;ÇĄÂ&#x2022;Â&#x2022;Â&#x2039;Â&#x2022;Â&#x2013;Â&#x192;Â?Â&#x2013;Â&#x2021;Â&#x192;Â?Â&#x2018;Â&#x2C6;Â&#x2013;Â&#x2014;Â&#x2020;Â&#x2021;Â?Â&#x2013;Â&#x2022;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2020;Â?Â&#x2039;Â?Â&#x2039;Â&#x2022;Â&#x2013;Â&#x201D;Â&#x192;Â&#x2013;Â&#x2039;Â&#x2DC;Â&#x2021; Â&#x2021;Â&#x201D;Â&#x2DC;Â&#x2039;Â&#x2026;Â&#x2021;Â&#x2022;Â&#x192;Â?Â&#x2020; Â&#x192;Â?Â&#x2039;Â&#x17D;Â&#x203A;Â&#x2021;Â&#x17D;Â&#x192;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x2022;


Check online for the full New Student Arrival Schedule and send suggestions to


â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s gonna be things that you know that people who didnâ&#x20AC;&#x2122;t go to college donâ&#x20AC;&#x2122;t. This can be one of those things.â&#x20AC;? ÄĽ$SK\VLFVSURIHVVRUH[SODLQLQJWKHGLɲHUÄŚ HQFHEHWZHHQFHQWULIXJDODQGFHQWULSLWDO IRUFHV

â&#x20AC;&#x153;Biology is too squishy. I donâ&#x20AC;&#x2122;t like VTXLVK\VWXÉą´

â&#x20AC;&#x153;I know they spit, but theyâ&#x20AC;&#x2122;re so darn cute.â&#x20AC;? ÄĽ$FUHDWLYHZULWLQJSURIHVVRURQKHUGUHDP MRERIRZQLQJDQDOSDFDIDUP

C)/2'04#D)-0#')4'+402#%0313022#;4+2'&;0&-2 Ä&#x17E;Ä&#x2018;Ä&#x17D;Ä&#x2DC;Ä&#x2020;Ä&#x2030;Ä&#x160;Ä&#x2018;Ä&#x2DC;Ä&#x2122;Ä&#x160;Ä&#x17D;Ä&#x201C; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; In Floridaâ&#x20AC;&#x2122;s very own city of Apopka, something very controversial was born in 1997, The Lobster Zone. The Lobster Zone is a game that allows customers to put two dollars in a machine, much like a claw game that allows one to ZLQDVWXÉąHGDQLPDOSUL]HDQGLQ seconds they have the chance to use the crane to catch a lobster. Yes, a live lobster, from a dozen or so that DUHNHSWLQDWDQNWKDWLVLQFKHV LQZLGWKLQFKHVLQGHSWKDQG inches in height. :KHQ,ÂżUVWIRXQGP\VHOIJD]LQJ upon a Lobster Zone machine, it was during a concert at a local bar in St. Paul, Minn., a place where this game is truly out of the ordinary. The point of the entire game is to pay your two dollars, catch a lobster ÄŞRU QRWÄŤ ZLWK WKH FUDQH DQG LI WKH

claw does catch a lobster, it slides it down the chute and the owner of the machine will prepare it for you on the spot or give you a coupon for later redemption. This lobster is living its entire life only to be put into a small tank, be chased with a claw, passed down a chute, put in a boiling pot and be consumed. What has entertainment come to? According to the lobster zone website, the claw machine doesnâ&#x20AC;&#x2122;t apply enough pressure to physically hurt the lobster and the animal is carefully whisked down the chute and placed close to the bottom so it has a â&#x20AC;&#x153;safe landing.â&#x20AC;? Regardless of whether or not the lobster feels pain, youâ&#x20AC;&#x2122;re playing with your food before you eat it. Itâ&#x20AC;&#x2122;s like chasing a chicken around the coop, then giving it a few solid kicks before killing it for dinner. According to Lobster Zone Inc.â&#x20AC;&#x2122;s ZHEVLWH RQO\ WZR RXW RI 

costumers have a complaint about the inhumanity of this game, but these numbers may have spiked VLQFH3(7$ÄŞ3HRSOHIRUWKH(WKLFDO 7UHDWPHQW RI $QLPDOVÄŤ PDGH WKH game into a real inhumanity issue. PETA has been boycotting the Lobster Zone game and is making the public aware of its â&#x20AC;&#x153;cruelty.â&#x20AC;? According to Lobster Zoneâ&#x20AC;&#x2122;s website, 85 percent of online bloggers tend to favor the game and would like to play it, but he didnâ&#x20AC;&#x2122;t specify what information was included in the poll. My issue is not so much that the game itself is the cruelest contraption I have seen but that these lobsters live their lives for pure entertainment to the human race. We may use other species on WKLV SODQHW DV VXVWHQDQFH ħ LWÂśV D SDUW RI WKH KXPDQ H[SHULHQFH ħ but being human doesnâ&#x20AC;&#x2122;t give us the right to torture other species for our pleasure.


â&#x20AC;&#x153;It sounds kind of interesting, but I donâ&#x20AC;&#x2122;t know how itâ&#x20AC;&#x2122;s going to work. Itâ&#x20AC;&#x2122;s worth a try I guess, students will go there. Weâ&#x20AC;&#x2122;ll see. Iâ&#x20AC;&#x2122;ll have graduated by then, but I think itâ&#x20AC;&#x2122;ll be really cool for freshmen. I think itâ&#x20AC;&#x2122;s probably worth pursuing. â&#x20AC;?

!Vincent Van Der Weerden, Senior

â&#x20AC;&#x153;I think itâ&#x20AC;&#x2122;s a neat idea and a great alternative to building new dorms and a much cheaper option, but I donâ&#x20AC;&#x2122;t know if putting it near South Beach is the best idea. Plus, the dredging is going to have a huge impact on the ecosystems out there. I think that itâ&#x20AC;&#x2122;s a cool idea, but it needs to be implemented in the right ZD\IRULWWREHHÉąHFWLYHIRUHYHU\RQHÂł

!"Meg Fitzpatrick, Senior

â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t want to live on the water, but I see how itâ&#x20AC;&#x2122;s a good place to go when theyâ&#x20AC;&#x2122;re redoing the traditional dorms. I donâ&#x20AC;&#x2122;t mind the water for a short period of time, but to live on the water where itâ&#x20AC;&#x2122;s over the cold, it doesnâ&#x20AC;&#x2122;t appeal to me, but I can see how people would enjoy it. All dorms have their ups and downs.â&#x20AC;?

! Mitchell Dobro, Junior


!" ##8,091),-'2



the current





Itâ&#x20AC;&#x2122;s comical that the loudest supporters of the 1996 Defense of Marriage Act are the same people who demand that the federal government get out of their hair. If there is anything that proves mainstream Republicans are not for small government, itâ&#x20AC;&#x2122;s this. If itâ&#x20AC;&#x2122;s not the governmentâ&#x20AC;&#x2122;s place to require healthcare, impose taxation or ensure environmental regulations, then why is it acceptable for the government to intervene in the bedroom and tell you what marriage is? If you support statesâ&#x20AC;&#x2122; rights, then the issue is equally relevant. According to Sec. 1 Article 4 of the Constitution, â&#x20AC;&#x153;Full Faith and Credit shall be given in each State to the public Acts, Records, and judicial Proceedings of every other State.â&#x20AC;? DOMA prevents Massachusetts, Vermont, Iowa, New Hampshire, Connecticut and most recently New York from attaining this right since it allows other states to deem same sex marriage licenses made in these VWDWHVDVQXOODQGYRLG&DQVXFKK\SRFULV\EHMXVWLÂżHG"

Ä&#x2122;Ä?Ä&#x2020;Ä&#x201C;Ä&#x2020;Ä&#x2C6;Ä?Ä&#x160;Ä&#x17E; !"#$%&

Ä&#x160;Ä&#x2020;Ä&#x201C;Ä&#x2020;Ä&#x153;Ä&#x2018;Ä&#x201D;Ä&#x2014; '(#$%&

6XFKK\SRFULV\LVQÂśWMXVWLÂżDEOHRUHYHQFRQVWLWXWLRQDO The Defense of Marriage Act as written and passed in LVXQFRQVWLWXWLRQDORQPDQ\JURXQGVWKHÂżUVWRI which you already mentioned, where it contravenes Section 1 of Article 4 of the United States Constitution. 0RUH VSHFLÂżFDOO\ LW YLRODWHV WKH VW $PHQGPHQWÂśV protection of religious institutions from government interference and the 14th Amendmentâ&#x20AC;&#x2122;s guarantee of equality before the law for all persons. Considering the legal precedence of these sections of the Constitution, it is my position that the current Defense of Marriage Act should be repealed and replaced with a new law WKDWÄŤGHÂżQHVPDUULDJHDVDSXUHO\UHOLJLRXVLQVWLWXWLRQ IUHHIURPLQWHUIHUHQFHE\JRYHUQPHQWDWDQ\OHYHOÄŤ UHTXHVWVWKDWVWDWHVÂżQGDQRWKHUPHDQVRIJXDUDQWHHLQJ HTXDOLW\IRUDOOFRXSOHVXQGHUWKHODZDQGÄŤUHDɡUPV the text of Article 4, Section 1 of the United States &RQVWLWXWLRQ WKHUHIRUH HQVXULQJ WKH UHVSHFW RI WKH laws of every state.

Iâ&#x20AC;&#x2122;m glad to see that all conservatives are not uniform on this issue. The sad irony is that Republicans are violating their greatest constitutional achievement, the 14th Amendment. I agree that the 14th Amendment must be imposed on all levels of government. This is why WKHVWDWHRI)ORULGDVKRXOGUHSHDO$PHQGPHQWSDVVHG LQ  ZKLFK EDQQHG DQ\ IRUP RI FLYLO XQLRQ RWKHU than traditional marriage. This measure not only hurt VDPHVH[FRXSOHVEXWDOVRVHQLRUFLWL]HQVZKREHQHÂżWHG from various union titles without being â&#x20AC;&#x153;married.â&#x20AC;? 'HVSLWHP\DJQRVWLFDɡOLDWLRQ,DJUHHWKDWPDUULDJH is a religious institution. This is precisely why the government should not remain in the position of an objective intermediary in this issue. Instead, these matters should be left in the hands of individual churches, temples and mosques. Same sex couples could WKHQ ÂżQG JD\ IULHQGO\ UHOLJLRXV LQVWLWXWLRQV LQ QHDUO\ every locale. If a same sex couple desires to bond their union in a church hostile toward homosexuality, such as the Mormon or Roman Catholic Church, then the attainment of that right should be fought in the pew, not the courthouse. It should be the governmentâ&#x20AC;&#x2122;s job to KDQGRYHUWKHQHFHVVDU\SDSHUZRUNQRWGHÂżQHPDUULDJH

Speaking of courthouses, I will state here my opposition to this issue being resolved by courts. -XGLFLDODFWLYLVPKDVQRFRQVWLWXWLRQDOEDVLV,QP\ opinion, it is drastically unconstitutional that in VL[RIWKHHOHYHQVWDWHVZKLFKKDYHOHJDOL]HGVDPHÄĽ sex unions, the decision came from a courthouse and not the legislature. Courts exist to arbitrate disputes between individuals and to interpret the constitutionality of current laws. I do not know of any state constitution that formally recognizes the SRZHURIWKHFRXUWV\VWHPWROHJLVODWHWKHSRZHUWR use a constitutional ruling as a means of enumerating a new right and declaring recognition of that right as binding law. Per the 9th Amendment to the United 6WDWHV &RQVWLWXWLRQ DOO ULJKWV QRW VSHFLÂżFDOO\ ODLG forth or denied by the Constitution are held by the citizenry. Logically that makes referendums and legislation by elected representatives the only constitutional avenues for the enumeration of the VSHFLÂżFULJKWVRIFRXSOHVDVQRWKLQJLVVDLGRQWKLV topic within the United States Constitution.



+,-./",012 !!


EC to D.C: Fighting oil with oil pounds of CO into the atmosphere. Thatâ&#x20AC;&#x2122;s not including the emissions of the two charter buses, or the amount of other greenhouse gasses emitted from gasoline. Service Learning Director Brian McHarg pointed out that traveling by van and bus ZDV WKH PRVW HɡFLHQW DQG FRVW HÉąHFWLYH FKRLFH WUDYHOOLQJ E\ SODQH ZRXOG EH PXFK more expensive and have a greater carbon footprint, and travelling by train would be just as expensive and a logistical nightmare. If going up to D.C. was the right thing to do, then I agree that travelling by van was the best decision, but Iâ&#x20AC;&#x2122;m not sure if I agree that going was the right thing to do. I do believe that the trip was a unique experience that could arguably be just as important to an individual as the cause. I know I was excited mostly for the idea of being with a group of friends and peers and rallying together behind a cause, not QHFHVVDULO\IRUSURWHVWLQJWKHVSHFLÂżFLVVXH

of the Keystone Pipeline. However, I think we could have had that experience without actions that completely oppose the issue weâ&#x20AC;&#x2122;re protesting. :HFRXOGKDYHJRWWHQWKRVHVWXGHQWV to go out into the community and educate people and the project, collecting signatures on letters to send to representatives. I know that groups on campus have attempted this before for a variety of issues and never get D WXUQRXW RI PRUH WKDQ  SHRSOH EXW shouldnâ&#x20AC;&#x2122;t that be what we try for? The EC to DC trip was planned and executed perfectly, and I greatly admire the group of students that took on the planning responsibilities. I believe that it was their enthusiasm for the cause and event that resulted in so much student participation. I fully believe that if that same group of people had organized a local event to support the same cause, the turnout would have been equally impressive.


Original meaning of peace sign many times I have seen people wearing SHDFH VLJQV SDUWLFLSDWLQJ LQ ÂżJKWV XVLQJ hateful language, discriminating against others and putting others down. This type of behavior, and every other type of behavior that contradicts the peace signâ&#x20AC;&#x2122;s new and old meaning, has turned the symbol of something beautiful into nothing but a mere fashion statement. It is almost sickening to see how such a delicate DQG ZRQGHUIXO V\PERO KDV EHFRPH VR LOOÄĽ represented. I know that those who use a peace symbol as a symbol for the way they live their life, including, but not limited to those who practice Eastern Philosophy, â&#x20AC;&#x153;hippiesâ&#x20AC;? and even those who just believe in Namaste ÄŞZKLFK LV 6DQVNULW IRU VHHLQJ DOO EHLQJV LQ WK\VHOIÄŤ DUH XQVHWWOHG E\ WKH K\SRFULWLFDO XVH RI WKLV V\PERO , MXVW FDQÂśW ÂżQG WKH connection where the peace sign became a symbol so full of virtuous meaning, into

something so irrefutably contradictive. This symbol, along with many others has been taken out of its original standing and has been turned into a popularity contest. And to tell the truth, it is pretty obnoxious for those who see the peace sign for what it truly is and work very hard to make peace to see people blatantly disregarding the meaning behind the symbol. Donâ&#x20AC;&#x2122;t get me wrong, there are still a large handful who rock the peace sign, that truly push for peace and could probably tell you what it stands for originally, but the whole assortment of people who choose to adorn themselves with it for the wrong reasons today give a bad name to the people who want to wear it for the right reasons. So we should do all the people who use it in the right mindset a favor and either conform to ways of peace, or we should put our peace signs down and let the loving vibes take a hold before we choose to wear them.

!" %%!"*,9'"($#

the current




Â&#x2019;Â&#x160;Â&#x2018;Â&#x2013;Â&#x2018;Â&#x2026;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2013;Â&#x2021;Â&#x2022;Â&#x203A;Â&#x2018;Â&#x2C6;Â&#x2013;Â&#x160;Â&#x2021;Â&#x161;Â&#x2021;Â&#x2026;Â&#x2014;Â&#x2013;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x2018;ĆĽÂ&#x2026;Â&#x2021;Â&#x2018;Â&#x2C6;Â&#x2013;Â&#x160;Â&#x2021; Â&#x2018;Â&#x2DC;Â&#x2021;Â&#x201D;Â?Â&#x2018;Â&#x201D;




---+(=%>/;*0=%0*#9'(=# On the Marc Bernier Radio Talk Show in Daytona Beach, Fla., on Oct. 10, Florida Governor Rick Scott spoke about his plans to reform the Florida education system. He claimed that Florida doesnâ&#x20AC;&#x2122;t need to provide students with degrees, such as anthropology, that wonâ&#x20AC;&#x2122;t assist them in obtaining jobs.








the current

!"#$%&'(%)*&&% +,-./-01,2.,-




Hell on Wheels


Sex on the Beach


Creative Arts at EC


+:%;/0<50-.%;".4%=/"2%/5;>?%-"%-.0 Ä&#x17E; Ä&#x2020;Ä&#x201C;Ä&#x17D;Ä&#x201C;Ä&#x2030;Ä&#x2DC;Ä&#x2020;Ä&#x17E; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; Raymond Ritola graduated Eckerd in the summer of 09â&#x20AC;&#x2122; and began his career as owner of the local Hooker Tea Company on Beach Drive in downtown St. Pete. During his time spent at Eckerd, Ray studied environmental VWXGLHV ÂżQLVKLQJ ZLWK WKLV DV D PDMRU and a minor in coastal management with concentrations in chemistry and international business. 5LWROD WRRN RÉą ZLWK WKH EXVLQHVV DVSHFW of his studies. Months after graduating, he found himself with the opportunity to take over ownership and management of Hooker Tea Co. Ritola purchased the rights to the VWRUHÂł+HKDVGRQHDZRQGHUIXOMREDVRZQHU´ 6KDZQ+RRNHUSUHÄĽRZQHUVDLGÂł7KHGHJUHH he has earned at Eckerd has been brought to WKHVWRUHDQGLWKDVEHHQDKHDOWK\LQĂ&#x20AC;X[RI NQRZOHGJHWREHWWHUWKHVWRUHDVDZKROH´ The Hooker Tea Co. is a retail teashop that VHOOV ORRVHÄĽOHDI WHD DQG WHD DFFHVVRULHV 7KH shop also sells cups of tea, as well as small food items like quiche and pastries. The loose leaf tea menu gives descriptions of the over 100 loose leaf teas ranging from the smoked, Âł/DSVDQJ6RXFKRQJ´WRWKHVSLF\KHUEDOÂł'U )HHO *RRG´  Âł7KH LFHG 0DVDOD &KDL ODWWH ZLWK$JDYH1HFWDULQLWLVP\IDYRULWH´VD\V Jennifer Gillis a regular patron at the tea

shop. Ritola states that Eckerd taught him a lot of leadership. Ritola played on Eckerdâ&#x20AC;&#x2122;s rugby team all four years and became the teamâ&#x20AC;&#x2122;s president. â&#x20AC;&#x153;Basically, I was president, captain, coach DQGWUDLQHUP\VHQLRU\HDU´KHVDLG 5LWROD GLG VXFK D JUHDW MRE SOD\LQJ FRDFK his senior year Eckerd approached him with an opportunity to coach. â&#x20AC;&#x153;There were discussions if I would be interested in coaching the team, but I had to turn it down due to obligations at the shop, he said. â&#x20AC;&#x153;I do miss the sport but if I ever have time I would OLNHWRJHWEDFNZLWKLW´ All this responsibility Ritola learned managing the rugby team translated into his skills at the teashop. 7KH HPSOR\HHV ORYH KLP Âł5D\ JHWV VWXÉą done and I love working with someone who JHWVVWXÉąGRQH´6LHUUD:HOGHQZKRKDVEHHQ working at the Hooker Tea Co. for three years, said. â&#x20AC;&#x153;He really pours his heart and his VRXOLQWRKLVZRUN´ Not only do employees like him but regular FXVWRPHUV KDYH DSSUHFLDWHG KLV HÉąRUWV DV the new owner. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s been busier in here and HYHU\WKLQJ VHHPV D WDG PRUH SURIHVVLRQDO´ Gillis said. Ritola not only learned life skills on the UXJE\ ÂżHOG EXW DOVR LQ WKH FODVVURRP $V DQ HQYLURQPHQWDO VWXGLHV PDMRU 5LWROD KDV


become a true environmentalist and does everything in his power to make the tea shop PRUHHFRÄĽIULHQGO\ â&#x20AC;&#x153;I reduced utilities here by 45 percent, I introduced environmentally friendly SDFNDJLQJ ÄŹRXUÄ­ SODVWLFV DUH FRPSRVWDEOH I try to reduce the carbon footprint of the


@A.0#14%0,<%A5--8.0<B% >09C%0=-./%.D-.,<.<%810-54

12#%34"#5"36"7# 6WDɲ:ULWHU More than 18 years since its GHEXWRQ079DQGDIWHUDÄĽ\HDU hiatus, Mike Judgeâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Beavis and %XWWKHDG´ UHWXUQV WR WHOHYLVLRQ screens for a new generation. Many Eckerd students may be too young to fully appreciate the show, having barely been in elementary school the last time new episodes were aired. Now that the controversial cartoon has made its triumphant return to MTV, kids who were not allowed to watch the show during its original run will have the chance to witness the origin of characters from Daria and King of the Hill, two more Mike Judge creations. Âł%HDYLV DQG %XWWKHDG´ IROORZV WZR WHHQV DV WKH\ MRXUQH\ WKURXJK high school, complete with skipping class, stealing beer and general teenage shenanigans. The creators break up the cartoon action by depicting the two adolescents watching and critiquing music videos. Apart from a strong dislike for any band from England, the duo VHHPVWRVKDUHDVSHFLDODɡnity for Metallica and GWAR. Other music video reviews seem to fall into WKH FDWHJRU\ RI ÂłFRRO´ RU ÂłVXFNV´ For two teens who are portrayed as below average students, their critiques of the music videos are often shown as one area in which WKH ER\V DUH H[WUHPHO\ SURÂżFLHQW Their knowledge of music is shown to be quite extensive, save for a few funny moments when the duo confuses Marilyn Manson and Dave Grohl with Cher and ÂłWKDW GXGH IURP 1LUYDQD´ )RU WKH new season, the teens have also begun to criticize clips from MTV



progrDPPLQJ OLNH Âł-HUVH\ 6KRUH´ DQGÂł7UXH/LIH´ The undereducated metal heads coast through life with seemingly no adult supervision, causing trouble for teachers, other students and their neighbor Tom Anderson, who is the basic mold for the King of the Hill lead character of Hank Hill. Controversy arose from the original seasons when critics and parents decried that the antics of the two teens was causing real teenagers to act out in similar ways in real life. The cartoonâ&#x20AC;&#x2122;s creators responded to these criticisms by adding the famous disclaimer:  Âł%HDYLV DQG %XWWÄĽKHDG DUH QRW role models. Theyâ&#x20AC;&#x2122;re not even human; theyâ&#x20AC;&#x2122;re cartoons. Some of the things they do could cause a person to get hurt, expelled, arrested, possibly deported. To put it another way: Donâ&#x20AC;&#x2122;t try this at KRPH´ (YHQ EHIRUH Âł6RXWK 3DUN´ Âł%HDYLV DQG %XWWKHDG´ ZHUH WKH undisputed champions of crude KXPRU 7KH VH[ÄĽFUD]HG FODVVÄĽ VNLSSLQJ FLJDUHWWHÄĽVPRNLQJ WHHQV RIWHQ ÂżQG VH[XDO LQQXHQGR LQ WKH most innocent of statements.


A popular recurring theme of episodes, and one of the main WKHPHV RI WKH IXOOÄĽOHQJWK PRYLH Âł%HDYLVDQG%XWWKHDG'R$PHULFD´ is that of the quest to have sex. The boys often go to great lengths in D PLVJXLGHG DWWHPSW WR ÂżQG D JLUO who will have sex with either one of them, which inevitably leads to trouble. Originally airing in a time when controversial cartoons were few and IDUEHWZHHQÂł%HDYLVDQG%XWWKHDG´ was a show that became an icon of WKH JHQUH  Âł6RXWK 3DUN´ FUHDWRUV Trey Parker and Matt Stone, FLWH Âł%HDYLV DQG %XWWKHDG´ DV DQ LQĂ&#x20AC;XHQFH RQ WKHLU RZQ EUDQG RI comedy. Now, after 14 years of being RÉą WKH DLU Âł%HDYLV DQG %XWWKHDG´ returns to a time when rude, childish humor is prevalent and WKULYLQJ DQG MXPSV ULJKW EDFN LQWR ZKHUHLWOHIWRÉą7KHVKRZIHHOVWKH same as the original episodes, with a few obvious updates in the music videos and pop culture references. For those who were too young to HQMR\ WKH ÂżUVW IHZ VHDVRQV RI WKH VKRZÂł%HDYLVDQG%XWWKHDG´PDNHV a hilariously vulgar return that is certainly worth a watch. The show airs 10 p.m. Thursdays.


shop while at the same time increasing the HɡFLHQF\´ Ritola wants EC to know about the loyalty reward programs that are in works at the shop including student discounts, he said. â&#x20AC;&#x153;We have quite a few Eckerd patrons I would OLNHWRVWUHQJWKHQWKDWERQGZLWK(FNHUG´


â&#x20AC;&#x153;Immortalsâ&#x20AC;? wonâ&#x20AC;&#x2122;t stand up to test of time Ä&#x17E;Ä&#x2020;Ä&#x17D;Ä&#x2122;Ä&#x161;Ä&#x2039;Ä&#x2039;Ä&#x17E; Â&#x2022;Â&#x2022;Â&#x2013;ǤÂ&#x2021;Â&#x2122;Â&#x2022;Â&#x2020;Â&#x2039;Â&#x2013;Â&#x2018;Â&#x201D; The entire future of Greek society has come under attack LQ Âł,PPRUWDOV´ .LQJ +\SHULRQ ÄŞ0LFNH\ 5RXUNHÄŤ KDV HQOLVWHG DQ army of followers on his bloodthirsty quest for the fabled Epirus bow, a weapon created by the Olympian gods thatâ&#x20AC;&#x2122;s capable of releasing the fallen Titans upon the earth and destroying known civilization. A young and seductively rugged peasant by the name of Theseus ÄŞ+HQU\ &DYLOOÄŤ LV WKH RQO\ RQH capable of stopping the vehement king. His vendetta against the cruel ruler comes after heâ&#x20AC;&#x2122;s forced to witness Hyperionâ&#x20AC;&#x2122;s personal, brutal slaying of his mother, yet the power to defend mankind can only come from within him. Produced by Gianni Nunnari ÄŞÄŤ 5\DQ .DYDQDXJK ÄŞ7KH )LJKWHUÄŤ DQG 0DUN &DQWRQ ÄŞÄŤ Âł,PPRUWDOV´ KDV WKH IHHO RI EHLQJ the next in the series of Greek ZDUULRU PRYLHV OLNH Âł´ H[FHSW with more scenes depicting extravagant, violent deaths. From VORZÄĽPRWLRQ KHDG VPDVKLQJ ZLWK hammers to large, virulent battle scenes, you canâ&#x20AC;&#x2122;t seem to watch PRUH WKDQ ÂżYH WR WHQ PLQXWHV RI ÂżOP ZLWKRXW VRPHERG\ G\LQJ DQ incredibly bloody death. Cavill brings the character of Theseus to life against a group of incredibly Americanized Greeks. While the set and costume allows the viewers to know they are watching an attempt at bringing a Greek epic to the silver screen, the roles and characters could have been ripped straight from an old Western. Theseus assembles a small band of followers to help KLP LQ KLV ÂżJKW DJDLQVW +\SHULRQ including the rough and tough WKLHI RI D VODYH 6WDYURV ÄŞ6WHSKHQ


'RUɹč ZLWK D:HVWHUQ DFFHQW DQG manifest destiny outlook on life to boot. Theseusâ&#x20AC;&#x2122; love interest, the virgin Sybelline Oracle Phaedra ÄŞ)UHLGD3LQWRÄŤGHSLFWVDQLQFUHGLEO\ powerful and empowered woman; perhaps too empowered for her to believably be portraying a woman of ancient Greece. +RZHYHU WKH ÂżOPÂśV LQDELOLW\ to accurately relay the stories of Greek mythology is frightening. The beJLQQLQJRIWKHÂżOPWHOOVWKH tale of the Epirus bow and how it came to exist during the battle between the gods and the titans before the beginning of mankind. The bow itself does not actually appear in Greek mythology, and Hyperion himself was not a king, but instead one of the original twelve titans. The tale of the battle depicts the titans as falling from the graces of the Olympian gods and thus being banished to eternal entrapment within Mount Tartarus, DVWRU\OLQHQRWLQFUHGLEO\GLÉąHUHQW IURP D ODUJHÄĽVFDOH YHUVLRQ RI WKH banishment of Lucifer. In actual !""#$%%&'()*!+#,-."#/0

!" 9($*0$+"(1*($

the current



Skyrim proves incredible RPG for loyal fans and newbies alike Ä&#x17E;Ä&#x2018;Ä&#x160;Ä&#x2C6;Ä&#x160;Ä&#x160;Ä&#x2018;Ä&#x160;Ä&#x2014; !"#$%&'($&#)*+%&$,% My journey through Skyrim begins at midnight November 10, waiting patiently in line for a game Iâ&#x20AC;&#x2122;ve been anticipating for years. I was there early, so I was in my car and headed home barely ten minutes after the release began. 7KHÂżUVWWKLQJWKDWVWUXFNPHDV,LQVWDOOHG Skyrim was that it required an Internet connection and Steam account to install. I personally detest being required to have an Internet cRQQHFWLRQ WR SOD\ D SXUHO\ VLQJOHÄĽ player game. I had hoped that since Oblivion had not required Internet, Bethesda would not alter their policy on the issue, but it was in vain. That said, the game installed in an extraordinarily fast twenty minutes. For anyone unfamiliar with The Elder Scrolls franchise of games, fear not. Bethesda, the gameâ&#x20AC;&#x2122;s developing company, has made a habit with The Elder Scrolls to make each new game accessible to new players unfamiliar with the story. No background knowledge is required to play this game. But if youâ&#x20AC;&#x2122;re an avid fan, the developers threw in plenty of treats for our amusement. As amazing as the story is so far, I feel that where Bethesda truly outdid themselves is with the mechanics of the game. Fans will be intricately familiar with the leveling system IURP0RUURZLQGDQG2EOLYLRQÄŞ(OGHU6FUROOV ,,, DQG ,9ÄŤ DQG Zith the general gameplay and feel of moving around in the game. Gone are the times when we must choose our Class and Birth Sign. Well, ladies and gentlemen, Bethesda has delivered unto us,

the most demanding VLQJOHÄĽSOD\HU 53* IDQÄĽEDVH RI DOO WLPH perhaps my favorite new development in the genre, ever. Like blowing things up with magic? Nothing stopping you. Want to do both? Sure. Do them both at the same time. Not only has Bethesda answered our FULHV IRU GXDOÄĽZLHOGLQJ LQ The Elder Scrolls universe, theyâ&#x20AC;&#x2122;ve even attached the same idea to spells. Yes, you can dual wield spells. There is no restriction on which skills you can get better at, or at what pace, as there were in previous Elder Scrolls titles. Furthermore, every tiPH \RX OHYHO XS ÄŞE\ the way, gone is the â&#x20AC;&#x153;ten skill increases equals one level!â&#x20AC;? system; the higher your skill that you increase, the more impact it has on how fast \RX OHYHO XSÄŤ \RX JHW WR FKRRVH D single â&#x20AC;&#x153;perk.â&#x20AC;? Each skill has a perk tree with between eight and twelve or so perks a piece. As far as the keyboard goes, many things are the same. Movement hasnâ&#x20AC;&#x2122;t changed. A strange choice by Bethesda, however, was to switch the â&#x20AC;&#x153;activateâ&#x20AC;? and â&#x20AC;&#x153;jumpâ&#x20AC;? keys. That one took a little bit of getting used to. Each race of, course, begins the game with a unique Power that can be used once per day, many of which have changed from what they were in Oblivion.



My personal favorite of the new gameplay mechanics is the â&#x20AC;&#x153;Favoritesâ&#x20AC;? option. Hitting â&#x20AC;&#x153;4´ SDXVHV WKH JDPH DQG EULQJV XS D TXLFN list of any equipable item, potion or spell you have tagged as a â&#x20AC;&#x153;Favoriteâ&#x20AC;? in your inventory, eliminating the need to scroll through all your belongings to switch rings, or spells, weapons, RUÂżQd that potion you need. Overall, Skyrim is a game that will be, at once, comfortably familiar and breathtakingly new for long time Elder Scrolls fans, and RÉąHUDQXQSDUDOOHOHGH[FLWLQJDQGLPPHUVLYH JDPH IRU QHZÄĽFRPHUV WR WKH VHULHV 7KHUH is so much to discover in this game, fans and noobies alike are set back to page one of this epic tale to discover a brand new ZRUOG RI PDJLF GUDJRQV LQWULJXH DQG LQWHUÄĽ connectivity never before seen in any video game. For the full version of this article, visit Nov. 18.



to be, or not to be Ä&#x17E; Ä&#x17D;Ä&#x161;Ä&#x2018;Ä&#x17D;Ä&#x2020;Ä&#x201C;Ä&#x2020; Ä&#x2014;Ä&#x201D;Ä&#x2DC;Ä&#x2DC;Ä&#x17D; !"#$%&'($&#)*+%&$,% â&#x20AC;&#x153;The voices, I canâ&#x20AC;&#x2122;t stop them. They come to meâ&#x20AC;ŚI would go mad if I didnâ&#x20AC;&#x2122;t write down the voices.â&#x20AC;? Imagine if the act of writing was looked upon as a sin and was, therefore, forbidden. Imagine that your passion, your hold on sanity was illegal. Edward De Vere ÄŞ5K\V,IDQVÄŤGHIHQGVKLVFODLPWRZULWHDJDLQVW the Puritan principle in the new movie, â&#x20AC;&#x153;Anonymous.â&#x20AC;? Compelled to write, yet prohibited from doing so, De Vere decides it best to have someone else publish and perform his plays and poetry under their own name to spare his UHSXWDWLRQ:LOOLDP6KDNHVSHDUHÄŞ5DIH6SDOOÄŤ WKH DWWHQWLRQÄĽVWDUYHG DFWRU LV PRUH WKDQ happy to be that fraud. After generations of critics debating whether Shakespeare is who he said he was, 5RODQG(PPHULFKGLUHFWVÂł$QRQ\PRXV´ZLWK WKH KHOS RI -RKQ 2UORÉą WKH VFUHHQZULWHU illustrating the theory that Shakespeare was not, in fact, the author many believed him to be. Emmerich directed movies such as â&#x20AC;&#x153;The Noahâ&#x20AC;&#x2122;s Ark Principle,â&#x20AC;? â&#x20AC;&#x153;Independence Day,â&#x20AC;? â&#x20AC;&#x153;The Patriot,â&#x20AC;? â&#x20AC;&#x153;2012â&#x20AC;? and others. 7KLVKLVWRULFDOÂżOPRÉąHUVDVPXFKVXVSHQVH as a successful thriller should. The setting and costumes are outstanding, as well as the layered plot. Identity seems to be an enduring WKHPH WKURXJKRXW WKLV ÂżOP SV\FKRORJLFDOO\ engaging the audience. Emmerichâ&#x20AC;&#x2122;s true artistic ability is shown in the sequence of 6KDNHSHDUH SOD\V ZLWK ÂżWWLQJ LQVWUXPHQWDO music carrying them along. He also foreshadows the climax with a thunderstorm, appropriate weather for such an event and follows afterward with quite a bizarre twist. Ifans has previously rolled in movies such as â&#x20AC;&#x153;Notting Hill,â&#x20AC;? â&#x20AC;&#x153;The Peth,â&#x20AC;? â&#x20AC;&#x153;Harry Potter and the Deathly Hollowsâ&#x20AC;? among others. +H ZDV SKHQRPHQDO LQ WKLV ÂżOP ZLWK WKH same seemingly intense connection to his character as he displayed in â&#x20AC;&#x153;Harry Potter and the Deathly Hollows.â&#x20AC;? I have to say the same about British DFWUHVV9DQHVVD5HGJUDYHZKRSOD\HG4XHHQ Elizabeth. In the past, sheâ&#x20AC;&#x2122;s been awarded an Oscar along with many other awards for her astounding acting in â&#x20AC;&#x153;As You Like It,â&#x20AC;? â&#x20AC;&#x153;Mary, 4XHHQ RI 6FRWV´ Âł0LVVLRQ ,PSRVVLEOH´ â&#x20AC;&#x153;Atonementâ&#x20AC;? DQG DW OHDVW  RWKHU ÂżOPV These two actors have an exceptional dynamic going, carrying out the double plot with energy and intricacy. 7KH TXDOLW\ RI WKLV ÂżOP LV LPSODXVLEOH WKH YLVXDO IDFHWV WKH HYHUÄĽPRYLQJ SORW WKH impeccable acting and the ability it has to stimulate the audienceâ&#x20AC;&#x2122;s minds. I am not SDUWLFXODUO\ ZHOOÄĽHGXFDWHG LQ KLVWRU\ EXW with enough attention, I was able to follow DQG VLQFHUHO\ HQMR\ WKLV ÂżOPÂśV SROLWLFV â&#x20AC;&#x153;Anonymousâ&#x20AC;? LVGHÂżQLWHO\ZRUWKDWULSWRWKH theater.



+,-./-01,2.,- !"

the current



A Greek tragLK`VMĂ&#x201E;ST

â&#x20AC;&#x153;In Timeâ&#x20AC;? puts real life social commentary on the silver screen Ä&#x17E;Ä&#x2018;Ä&#x17E; Ä&#x2014;Ä&#x17D;Ä&#x201C;Ä&#x2039;Ä&#x160;Ä&#x2018;Ä&#x2030; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; ,I \RX ÂżQG \RXUVHOI ZLWK HQRXJK WLPH RQ your hands, think about spending it watching â&#x20AC;&#x153;In Time.â&#x20AC;? From writer and producer of hits like â&#x20AC;&#x153;The Terminalâ&#x20AC;? and â&#x20AC;&#x153;Gattaca,â&#x20AC;? Andrew Niccol, dabbles in more alternate reality cinematic experiments where ordinary people and circumstances are thrust into D GLÉąHUHQW ZRUOG :LWK Âł,Q 7LPH´ ZH ÂżQG our protagonist Will Salas, played by Justin Timberlake, who stars in the recent â&#x20AC;&#x153;Friends ZLWK%HQHÂżWV´KXQWLQJIRUDQ\ZD\WRDGGDQ\ more time to his â&#x20AC;&#x2DC;clock.â&#x20AC;&#x2122; With an impressive supporting cast and a gripping plot, watching WKLVG\VWRSLDQWKULOOHULVWLPHZHOOÄĽVSHQW In this depressing alternate universe that mirrors our own, time replaces money as the form of currency. Everyone stops aging and time is â&#x20AC;&#x153;spentâ&#x20AC;? to sustain oneâ&#x20AC;&#x2122;s life. 7KHUH LV D FDWFK \RX GLH DW WKH DJH RI  XQOHVV\RXÂżQGVRPHZD\WRDGGWLPHWR\RXU clock. The rich seem to live forever while early death plagues the ghettos where we meet our hero. Salas, out of personal vengeance, vows to take down the hierarchical â&#x20AC;&#x2DC;timeâ&#x20AC;&#x2122; system that after obtaining a century from a precarious wealthy man who yearns for death. In his mission, he gets unlikely help from 6\OYLD:HLVÄŞ$PDQGD6H\IULHGÄŤWKHGDXJKWHU of a major timeshare CEO, and runs from a ÂľWLPHFRSÂś 5D\PRQG /HRQ ÄŞ&LOOLDQ 0XUSK\ÄŤ who mysteriously knows Salasâ&#x20AC;&#x2122;s father. )URP WKH LPSUHVVLYH $ÄĽOLVW FDVW GLVPDO VHWWLQJDQGQHZÄĽDJHHOHFWURQLFVRXQGWUDFN â&#x20AC;&#x153;In Timeâ&#x20AC;? has the elements to be a homerun thriller. Unfortunately, idiosyncrasies in the plot precede the overall experience, making LWKDUGIRUWKHDXGLHQFHWRDSSUHFLDWHWKHÂżOP in a philosophical and aesthetical manner.

â&#x20AC;&#x153;In Timeâ&#x20AC;? presents us with layers of political commentary on how our own society is painfully separated in terms of the rich and the poor, much like in the movie. The wealthy FDQÂľOLYHORQJHUÂśDVWKH\FDQDÉąRUGPRUHÂľWLPHÂś while the poor live each day as if it is their last. Plot loopholes arise throughout the movie. How did this system come about? If time is the currency, how did the rich get to be, well you know, rich? Luckily, huge leaps in tension help us forget these gaps in the narrative as ZH ÂżQG WKH FRQĂ&#x20AC;LFW ULVHV ZLWK HDFK PLQXWH 7KH EDVVÄĽKHDY\ HOHFWURQLF WXQHV MX[WDSRVHG with tender orchestration, work together fabulously as we feel further pulled by our heartstrings into Willâ&#x20AC;&#x2122;s world. The acting chops in this movie are enough reason to check out â&#x20AC;&#x153;In Time.â&#x20AC;? The tenacious DQG VO\ :LOO SOD\LQJ WKH 5RELQ +RRG ZKR wants to give time back to everyone, abducts Sylvia as a means to a ransom to extend his own time. As Salas seductively puts it, Sylvia is â&#x20AC;&#x153;keeping him alive.â&#x20AC;? Murphy, the Inception star, plays the badass cop/time keeper, 5D\PRQG/HRQ$FRQVWDQWWKUHDW/HRQSXOOV out every stop to maintain the status quo and prevent Willâ&#x20AC;&#x2122;s ambitious sense of justice from ruining the system. The supporting cast in this movie is also pretty stellar, with Olivia Wilde playing Timberlakeâ&#x20AC;&#x2122;s sympathetic mother who is caught in unfortunate circumstances as she tries to stay alive. A viewer will begin to doubt the credibility of key plot moments as the cast seems detached from one another. While the acting in the movie is good, the actors fail to reach out to each other and the bonds that develop seem to be too forced. Will, who seems to be a normal guy, is incredibly heroic for a man of his circumstances and too daring to believe. The romance between Will and Sylvia develops incredibly spontaneously. Instead of


sweet and inspiring, the love is bland and reeks of Stockholm syndrome creepiness. Other elements, such as Fortis, the timekeeper thug who steals time, and Willâ&#x20AC;&#x2122;s father, further dilute the plot in political commentary and take away from the viewing pleasure. Niccol, with â&#x20AC;&#x153;In Timeâ&#x20AC;? goes too far in creating a metaphysical message and loses the audience with overzealous preaching. Despite the frigid cast interactions, there is seductive warmth. You wonâ&#x20AC;&#x2122;t be won over by any hint of originality, since there is none, QRU ZLOO \RX ÂżQG D SHUIHFWO\ VHDPOHVV SORW +RZHYHU \RX ZLOO ÂżQG \RXUVHOI VWD\LQJ IRU WKHDGUHQDOLQHÄĽSXPSLQJDFWLRQEUHDWKWDNLQJ setting, soundtrack and relatable political message. If I were you, Iâ&#x20AC;&#x2122;d give â&#x20AC;&#x153;In Timeâ&#x20AC;? some of your precious time.


â&#x20AC;&#x153;Hannaâ&#x20AC;? doesnâ&#x20AC;&#x2122;t quite hit the mark Ä&#x17E;Ä&#x2019;Ä&#x17E;Ä&#x160;Ä&#x160;Ä&#x203A;Ä&#x201D;Ä&#x17D;Ä&#x2DC;Ä&#x160; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; A caribou bounds through snowy forest, SXUVXHG E\ D ÂżJXUH FODG LQ IXUV $Q DUURZ whizzes through the air. The caribou FUXPSOHVWR WKHJURXQG7KH ÂżJXUHSXOOVLWV VFDUI GRZQ UHYHDOLQJ WKH ZLGHÄĽH\HG IDFH RI a young girl. â&#x20AC;&#x153;I just missed your heart,â&#x20AC;? she murmurs, and pulls out her gun. Meet Hanna, the heroine and namesake of GLUHFWRU-RH:ULJKWÂśVODWHVWÂżOPDQGEROGÂżUVW foray into the action genre. At once a thriller, D P\VWHU\ DQG D XQLTXH FRPLQJÄĽRIÄĽDJH WDOH Âł+DQQD´ IROORZV WKH MRXUQH\ RI D ÄĽ\HDUÄĽ old assassin on her perilous mission across Europe. :HÂżUVWPHHW+DQQDÄŞ6DLRUVH5RQDQÄŤDQG KHU IDWKHU H[ÄĽ&,$ PDQ (ULN ÄŞ(ULF %DQDÄŤ LQ the wild tundra of Finland. It becomes clear that Hanna is no ordinary teenager. Here, Erik schools his daughter with encyclopedias and trains her in the art of combat. He grooms her into the perfect assassin. Once released into the world, Hanna soon discovers the secrets of her past and questions the nature of her humanity. â&#x20AC;&#x153;Hannaâ&#x20AC;? shines in its direction and cinematography. Joe Wright ÄŞÂł3ULGH  3UHMXGLFH´Âł$WRQHPHQW´čOHQGVDQDUWIXOĂ&#x20AC;DUH to his directing. Many shots evoke striking images, often heavy with symbolism and WKHPDWLF VLJQLÂżFDQFH +DQQD VSUDZOHG RXW on the snow beside a disemboweled caribou, or the villain emerging from the gaping maw RIDÂżEHUJODVVZROI Often the charactersâ&#x20AC;&#x2122; simplest actions speak louder than words. Much is said about the father/daughter relationship in an


embrace; we better understand intelligence oSHUDWLYH0DULVVDÄŞ&DWH%ODQFKHWWÄŤZKHQVKH brushes her gums until they bleed. 6DLRUVH 5RQDQ ÄŞÂł$WRQHPHQW´ Âł7KH LoYHO\ %RQHV´č JLYHV D VWXQQLQJ QXDQFHG performance as a young assassin experiencing WKH ZRUOG IRU WKH ÂżUVW WLPH 6KH FRQYH\V the perfect mixture of innocence and â&#x20AC;&#x153;wildnessâ&#x20AC;? required for her character. Cate %ODQFKHWW ÄŞÂł7KH &XULRXV &DVH RI %HQMDPLQ %XWWRQ´ Âł5RELQ +RRG´č LV IHDUVRPH DQG unforgettable in the role of the ruthless Marissa. As the father, Erik,portrayed by (ULF%DQDÄŞÂł6WDU7UHN´Âł7KH7LPH7UDYHOHUÂśV :LIH´č LV OHVV VDWLVIDFWRU\ /DFN RI HPRWLRQ leaves his potentially complex character stoic and inaccessible. Not to be ignored are the splendid performances of Tom Hollander as the creepy CIA operative Isaacs, and Jessica 9DUGHQDV6RSKLH+DQQDÂśVÂżUVWUHDOIULHQG Hannaâ&#x20AC;&#x2122;s story is a story of the hunt. Throughout her journey, the line between hunter and hunted blurs. Despite its unique aspects, â&#x20AC;&#x153;Hannaâ&#x20AC;? is still very much a chase ÂżOP$WWLPHVLWWDNHVRQWKHVWDQGDUGWURSHV of the genre. Chases are set to a mesmeric but repetitive score of electronic beats by The Chemical Brothers. Some chase scenes seem too drawn out, and a few action scenes resort to the typical device of slow motion. These scenes come across as gratuitous and somewhat cheap when set against the few SRLJQDQWPRPHQWVRIWKHÂżOP:ULWHUV6HWK /RFKKHDGDQG'DYLG)DUUÂśVEHVWHÉąRUWVVKRZ less in the thrills and more in the scenes that are beautifully, painfully human. Cinematographer Alwin H. Kuchler elevates â&#x20AC;&#x153;Hannaâ&#x20AC;? to the level of true art.


Â&#x201D;Â&#x2018;Â? ÇĄÂ&#x2019;Â&#x192;Â&#x2030;Â&#x2021;Í?Í&#x;

Greek mythology, the Titans were the original rulers of the Earth and Universe until Zeus and his siblings, the gods of Olympus and children of Titan king Cronus, overthrew them. The costuming department, headed by Eiko Ishioka, was another division that could have used a brush up in Greek history. The JRRGORJLFDO.LQJ'DUHLRVÄŞ$ODQ9DQ6SUDQJÄŤ is depicted as wearing a toga when he steps in IRUKLVÂżUVWVFHQH\HWWRJDVZHUHDQLQYHQWRI WKH5RPDQVQRWWRPHQWLRQWKHIDFWWKDWWKH Kingâ&#x20AC;&#x2122;s toga looks just as well put together as those found at Kappaâ&#x20AC;&#x2122;s toga party each fall. Ishioka must also have a thing for sequins; the sparkly craft aids were smattered and plastered all over the epirus bow once it was found, the weapons of the Olympians used in battle, the mask of King Hyperion and multiple other costume accessories that cloaked an important character. Elton John couldnâ&#x20AC;&#x2122;t have done a better job bedazzling the costumes himself. The artistic genius of director Tarsem 6LQJK ÄŞ7KH &HOO 7KH )DOOÄŤ LV QRW WR EH overlooked. The transitions and cutaways between scenes were impressively beautiful and seamlessly done, with one scene of a fallen manâ&#x20AC;&#x2122;s bleeding head transforming into a night scene of a Hyperionâ&#x20AC;&#x2122;s vessel on the water, his blood becoming the waves, his fallen face the ship, his hair the oars propelling the boat forward. The traditionally symbolic scenes of a character washing their hands in a water bowl were made use of, although perhaps a few too many times. Combine the butchered interpretation of Greek mythology with excessive violence and a costume department which must have come straight from the showroom of Caesarâ&#x20AC;&#x2122;s Palace in Las Vegas, and you have an expected, unimpressive American attempt at a Greek LQVSLUHG ÂżOP:KLOH D EDVLFDOO\ HQWHUWDLQLQJ piece of work, the movie left me walking away with a feeling of disappointment. My eye was constantly entertained throughout the ÂżOP \HW WKH GLDORJXH VWRU\ OLQH DQG RYHUDOO plot development were severely lacking. â&#x20AC;&#x153;Immortalsâ&#x20AC;? presents itself as not much more than a good watch for mind numbing gore DQGDFWLRQÂżOOHGSHUIRUPDQFHV

Free mixtapes Ä&#x17E;Ä&#x17D;Ä?Ä&#x160; Ä&#x160;Ä&#x17D;Ä&#x2021;Ä&#x160;Ä&#x2018; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;


He introduces us to settings ranging from the stark white plains of Finland to the vast rocky deserts of Morocco to a dilapidated Berlin amusement park. Sterile environments are painted with splashes of bright color. 7KH ÂżOPÂśV EUHDWKWDNLQJ DQG YLYLG VFHQHU\ adds a bleak air of enchantment to Hannaâ&#x20AC;&#x2122;s harrowing journey. Fraught with gripping action, vibrant settings, and tender pathos, â&#x20AC;&#x153;Hannaâ&#x20AC;? makes for an overall worthwhile viewing experience. It is a grim fairy tale that just barely misses its heart. â&#x20AC;&#x153;Hannaâ&#x20AC;? is now available for purchase on '9'DQG%OXÄĽUD\

0DVKÄĽXSV DUH RIWHQ KLW RU PLVV ZKHQ bringing together rappers and singers, but the recent mixtape from Miami DJ duo 8UEDQ 1RL]H VHDPOHVVO\ DQG HÉąRUWOHVVO\ brings together three of the biggest names in entertainment today. (OHPHQWV IURP -D\ÄĽ= DQG .DQ\H :HVWÂśV catalog of rhymes blended with Adeleâ&#x20AC;&#x2122;s soulful choruses come together to create an album of incredible artistry and weight that is so good that it is almost hard to believe that it is merely a DJâ&#x20AC;&#x2122;s conglomeration of recycled parts. The simple yet catchy beats behind the songs give the album a slightly retro feel KDUNHQLQJWR-D\ÄĽ=DOEXPVRIWKHODWHQLQHWLHV 2IWHQ RQO\ DQ H[FHUSW RI D -D\ÄĽ= RU .DQ\H verse is used and Adele songs are often sped up slightly to match the tempo that Urban Noize hopes to achieve, but neither of these changes takes anything away from the quality of the music. â&#x20AC;&#x153;Hometown Glory,â&#x20AC;? in particular, combines DZHOOÄĽVXQJKRRNE\$GHOHDQG8UEDQ1RL]H DGGVO\ULFVIURP.DQ\HDQG-D\ÄĽ=ZLWKDEHDW that sounds so natural it sounds more like a UDGLRKLWWKDQDPDVKÄĽXSUHPL[8UEDQ1RL]H certainly has created something that warrants D ÂżUVW OLVWHQ DQG RQFH PXVLF ORYHUV JHW DQ earful of the smooth blend of three great artists, this album will surely become one of WKHPRVWSRSXODUPDVKÄĽXSPL[WDSHVLQUHFHQW years. â&#x20AC;&#x153;Brooklyn. Chicago. London.â&#x20AC;? is available for free download at

!" 9($*0$+"(1*($

the current




â&#x20AC;&#x153;Hell on Wheelsâ&#x20AC;?: gritty and realistic Ä&#x17E;Ä&#x17D;Ä?Ä&#x160; Ä&#x160;Ä&#x17D;Ä&#x2021;Ä&#x160;Ä&#x2018; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; Any show that features an opening scene of a man being shot in a confessional booth is bound to grab attention. This holds true for â&#x20AC;&#x153;Hell on Wheels,â&#x20AC;? AMCâ&#x20AC;&#x2122;s newest addition of original programming. 7KH RSHQLQJ VFHQH VHW LQ SRVW &LYLO:DU America, shows a soldier walk into a church and attempt to confess for the atrocities he helped cause during the war, only to be gunned down from the other side of the confessional VFUHHQ E\ VORZÄĽWDONLQJ VRXWKHUQHU &XOOHQ %RKDQQRQ SOD\HG E\ $QVRQ 0RXQW %RKDQQRQLVGHWHUPLQHGWRH[DFWUHYHQJHRQ those soldiers who murdered his wife during the war. %RKDQQRQ KRSV D WUDLQ ZHVW WR ZRUN RQ the transcontinental railroad and seek his UHYHQJH$ORQJWKHZD\KHPHHWVWZR\RXQJ Irish men also chasing their fortunes along WKH UDLOURDG %RKDQQRQÂśV ÂżUVW FRQWDFW LV the foreman of the railroad project, Daniel -RKQVRQSOD\HGE\7HG/HYLQH-RKQVRQSXWV

%RKDQQRQ RQ WKH KDUGļZRUNLQJ ³FXW FUHZ´ which digs the trenches for the railroad tracks to pass through. Among the workers WKDW %RKDQQRQ LV VHW WR RYHUVHH LV UHFHQWO\ IUHHGVODYH(ODP)HUJXVRQSOD\HGE\UDSSHU Common. 7HQVLRQULVHVLQWKH¿UVWHSLVRGHEHWZHHQ WKH WZR PHQ DV )HUJXVRQ OHDUQV WKDW %RKDQQRQ LV IURP WKH VRXWK DQG KDV EHHQ tasked to be his boss. The two men seem to come to an understanding by the end of the pilot episode. Neither man wants any WURXEOH DQG %RKDQQRQ GRHVQRW DWWHPSWWR WDNH DGYDQWDJH RI )HUJXVRQ EHFDXVH RI WKH color of his skin. Another notable character is Thomas Durant, played by Colm Meaney, a EXVLQHVVPDQ DQG LQYHVWRU RQ WKH UDLOURDG project who is shown to be more focused RQ SUR¿W DQG QRWRULHW\ WKDQ WKH VDIHW\ RU HɹHFWLYHQHVV RI WKH SURMHFW  'XUDQW XVHV intimidation, bribery and suspicious business HWKLFV WR DFKLHYH KLV RZQ SHUVRQDO JRDOV often at the expense of other characters. Lily %HOO SOD\HG E\ 'RPLQLTXH 0F(OOLJRWW LV

introduced near the end of the episode after D&KH\HQQHWULEHDWWDFNVWKHVXUYH\RUVÂśFDPS DQG%HOOPXVWĂ&#x20AC;HHIRUKHURZQVDIHW\DIWHUWKH camp is destroyed and many of the men are killed. AMC original programming has a strong recent history of shows that are not only interesting and exciting, but also portray a JULWW\VHQVHRIUHDOLVPWKDWGUDZVYLHZHUVLQWR WKH VHULHV Âł+HOO RQ :KHHOV´ FUHDWHV D YHU\ accurate depiction of life in the late 1800s on the railroad project. The â&#x20AC;&#x153;tent townâ&#x20AC;? that the railroad workers LQKDELW LV VHHQ DV D YLROHQW ODZOHVV DQG dangerous place that is surely a fairly good representation of what the actual project was OLNH +LVWRU\ EXÉąV ZLOO UHFRJQL]H UHIHUHQFHV WR VHYHUDO HYHQWV GXULQJ WKH WLPH DQG IDQV of westerns will enjoy the dialogue between characters as well as the dirty, rough feel that WKHFDPHUDZRUNJLYHVWKHORRNRIWKHVKRZ â&#x20AC;&#x153;Hell on Wheelsâ&#x20AC;? is currently scheduled WR DLU VHYHQ HSLVRGHV DQG PD\ EH H[WHQGHG depending on the success of the series. The show airs at 10 p.m. Sundays.

3HUVRQDOWDVWHGHĂ°QHVWUXHVW\OHQRWWUHQGV Ä&#x17E;Ä&#x160;Ä&#x2014;Ä&#x2C6;Ä&#x160;Ä&#x2030;Ä&#x160;Ä&#x2DC;Ä&#x17D;Ä&#x2018;Ä&#x2018;Ä&#x17D;Ä&#x2020;Ä&#x2019;Ä&#x2DC; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D; Regardless of oneâ&#x20AC;&#x2122;s interest in fashion, most people are conscious to a small degree of the clothes they put on their body. We buy VKLUWVWKDWÂżWSDQWVWKDWÄŞJHQHUDOO\ÄŤFRYHURXU butts and comfortable shoes. Each of these choices is based on preference, whether it is IRUORRVHÂżWWLQJFORWKLQJRUKLSKXJJLQJPDÄĽ terials. Although many at Eckerd profess to not care about clothing, one must admit that HYHU\RQH WDNHV D VPDOO GHJUHH RI LQWHUHVW LQ what they wear. This concept may not be lauded in fashion magazines, whose primary JRDOLVWRFRQYLQFHWKHLUUHDGHUVRIWKHVXSHULÄĽ RULW\RIDFHUWDLQWUHQGEXWLWLVWKHYHU\EDVLV of personal style. In the winter months, personal style beÄĽ FRPHVHYHQPRUHDSSDUHQW)ORULGLDQVEHJLQ to pile layer upon layer of clothing, building XSRQ WKH VWDSOH RXWÂżW RI VKRUWV DQG D VLPÄĽ ple shirt. Although the process of getting dressed becomes more complex, it allows for a heightened sense of self expression. Say my roommate Kathrynâ&#x20AC;&#x2122;s grandmother knits her DQDOSDFDZRROKDWDQGVKHZHDUVLWHYHU\GD\ to protect her delicate ears from the frigid 60 degree wind. This tells us something about

,+#%#*-.*/0"10203*4&))&($3 Â&#x2021;Â&#x2030;Â&#x192;Â? Â&#x2039;Â&#x2013;Â&#x153;Â&#x2019;Â&#x192;Â&#x2013;Â&#x201D;Â&#x2039;Â&#x2026;Â?ÇĄÂ&#x2022;Â&#x2021;Â?Â&#x2039;Â&#x2018;Â&#x201D;ÇĄÂ&#x2022;Â&#x160;Â&#x2018;Â&#x2122;Â&#x2022;Â&#x2018;ĆĄÂ&#x160;Â&#x2021;Â&#x201D;Â&#x2C6;Â&#x192;Â&#x2022;Â&#x160;Â&#x2039;Â&#x2018;Â?Â&#x192;Â&#x2013;Â&#x192;Â&#x2022;Â&#x2022;Â?Â&#x2021;Â&#x2026;Â&#x2013;Â&#x192;Â&#x201D;Ǥ

ZKR VKH LV  6KH YDOXHV KHU IDPLO\ VKH OLNHV to stay warm and perhaps she has a soft spot for alpaca. Although mundane garments PD\VHHPLQVLJQLÂżFDQWWKH\FDQWHOOXVORDGV about their wearer. 6W\OHLVQRWDQLPSRVHGVHWRIYDOXHVUDWKHU LW LV D VHW RI SHUVRQDO YDOXHV FRQVWUXFWHG E\ HDFKLQGLYLGXDO,WLVOHVVDERXWWUHQGDQGODÄĽ bels, and more about the way a shirt hangs on a personâ&#x20AC;&#x2122;s body, or a a color that someone is particularly drawn to. The most mundane of

garments can tell a story about their owner. Itâ&#x20AC;&#x2122;s not wrong to appreciate clothing, or to acknowledge oneâ&#x20AC;&#x2122;s own sense of style. That DELOLW\ LV LQGLFDWLYH RI D SHUVRQ ZKR XQGHUÄĽ stands their own preferences. Although fashÄĽ LRQ PDJD]LQHV PD\ SURYLGH LQVSLUDWLRQ IRU interesting clothing combinations, or ideas for places to shop, they donâ&#x20AC;&#x2122;t dictate what we wear. If your clothes make you happy, and if you are comfortable wearing them, then you DUHZHOOÄĽGUHVVHG

Sex on the Beach: :"(;%<'&0%"((*0% 0'1+($"/ Ä&#x17E;Ä&#x160;Ä&#x2014;Ä&#x201D;Ä&#x17E; Ä&#x160;Ä&#x201C;Ä?Ä&#x160;Ä&#x201C;Ä&#x2DC; Â&#x2021;Â&#x161;Â&#x2018;Â&#x17D;Â&#x2014;Â?Â?Â&#x2039;Â&#x2022;Â&#x2013; When I look around at the world today, I cannot help but wonder what has happened to our society. I grew up EHOLHYLQJ LQ EHKDYLQJ FKLYDOURXVO\ VHHLQJ the examples of prince charming from Disney as well as the dashing male heroes of classic Hollywood musicals. I suppose this makes me a sappy, old IDVKLRQHG URPDQWLF , EHOLHYH LQ ORYH DW ÂżUVW VLJKW WUXH ORYH VRXO PDWHV DQG DQ\ other ideal of romantic relationships that DUH HDVLO\ GLVPLVVHG LQ YLHZ RI WKH KDUVK ZRUOG LW VRPHWLPHV DSSHDUV ZH OLYH LQ , think it is the duty of a man to make sure that his girlfriend knows how he feels in any and all ways he can, with as much FUHDWLYLW\DVSRVVLEOH It can be as simple as taking her to the PDOO DQG D PRYLH IRU D GD\ DV ZDNLQJ XS early and making her breakfast in bed, WDNLQJ KHU RXW WR VXVKL HYHU\ RQFH LQ D while. It can be hints left behind that tell her how you feel, messages left up on KHUFRPSXWHUDVFDYHQJHUKXQWIRUDJLIW VXUSULVHKHUDQ\ZD\\RXFDQDQGDERYHDOO tell her how you feel. The smallest things can make the biggest GLÉąHUHQFHLQVKRZLQJ\RXUDÉąHFWLRQ%ULQJ KHU FKRFRODWHV LI VKH LV KDYLQJ D EDG GD\ ask her how her day is going and actually listen. Rub her shoulders. The most important thing about URPDQFH LV WR PDNH VXUH \RX JLYH EHWWHU than you get. Make the focus be on making her happy. A relationship may be about getting something, but a romance is about VKDULQJDVPXFKORYHDQGDÉąHFWLRQDV\RX KDYHZLWK\RXUJLUOIULHQG Show you are willing to go as far as it takes, further than necessary, and you may ÂżQGWKDW\RXDUHQRORQJHULQDUHODWLRQVKLS RIJLYHDQGWDNHEXWDURPDQFHRIVKDULQJ DQGORYLQJWRJHWKHU Taking walks on the beach, watching a sunset from a bench or hammock, just sitting quietly on the couch can all be an DPD]LQJHYHQWLQDORYLQJURPDQFH Of course, there will be relationships that QHYHUJHWWKHUHDQGOXVWÂżOOHGHQFRXQWHUVLQ WKHZRUOGEXW,EHOLHYHWKDWHYHU\KXPDQ KDVDVRXOPDWHDWUXHORYHVRPHZKHUHLQ WKHZRUOG7KHRQO\TXHVWLRQLVLI\RXKDYH WKHSDWLHQFHWRZDLWXQWLO\RXÂżQGWKHRQH person meant for you and if you can be yourself and join a grand romance.

=>?%#*$%$'%@*0A'01%+$%A+"0B0'&(;%2'3-%4C Ä&#x17E;Ä&#x201D;Ä&#x2022;Ä?Ä&#x17D;Ä&#x2020; Ä&#x17D;Ä&#x2021;Ä&#x160;Ä&#x2014;Ä&#x2DC;Ä&#x201D;Ä&#x201C; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;

)RU WKRVH RI \RX KHDYLO\ LQWR WKH WUDQFH music scene, you canâ&#x20AC;&#x2122;t forget the song EcstaÄĽ V\UHOHDVHGLQE\DUWLVW$7% 3OD\HGDWYDULRXVFOXEVWKURXJKRXW(XURSH DQGWKH8QLWHG6WDWHV$7%ÂśVPXVLFFDUHHUVN\ rocketed as he began to tour internationally, DSSHDULQJDWYHQXHVDQGIHVWLYDOVWKURXJKRXW the world. )RUPHUO\ NQRZQ DV $QGUHZ 7DQQHEHUJHU this German DJ is widely known for his meÄĽ lodic electronica style and passionate lyrics about romance. $V D VRQJZULWHU DQG SURGXFHU $7%ÂśV Trance songs are complex and intriguing for his dance fan base, often taking your breath DZD\DQGPDNLQJLWLPSRVVLEOHWRVWRSPRYÄĽ

LQJ RQ WKH GDQFH Ă&#x20AC;RRU ,Q  '-0$* named him the 11th Dance DJ out of the Top 100 DJâ&#x20AC;&#x2122;s in the world. Producing his ninth record, Distant Earth Remixed, this year, $7% KDV KDG WUHPHQGRXV VXFFHVV RQ WKH dance music scene. 2Q 1RY  7DPSD %D\ÂśV GDQFH PXVLF VFHQHLVJHWWLQJDWDVWHRI$7%DVKHVFKHGÄĽ XOHGWRSHUIRUPDÂżYHKRXUVHWVWDUWLQJDW p.m. on his Distant Earth Tour. I personally had a satisfying night when I attended one of $7%ÂśV VHWV LQ P\ KRPHWRZQ RI:DVKLQJWRQ '&ODVW\HDUDW)851LJKW&OXE So if youâ&#x20AC;&#x2122;re into trance, dance, or electronÄĽ ica music, this is a show you do not want to miss! )RU WLFNHWLQJ LQIRUPDWLRQ JR WR KWWS H YHQWVWERH[WUDFRPWDPSDÄĽIOH YHQWV VKRZÄĽDWEÄĽWDPSD



the current


+,-./-01,2.,- !"



.,/0)+,!# SP Hellogoodbye *23DYLOOLRQ











11 a.m. %UHDVWVDQG%DJHOV )R[+DOO SP&36 Chamber Players of Sarasota Wireman Chapel

7 p.m. 3RLQW%ODQN Miller Aud.





!"#$%&'()($'*** +,-#%

SP(67 0RQGD\1LJKW)RRWEDOO Kansas City @ New England ESPN

1 p.m. EC Residential Visual Arts Exhibition Elliot Gallery



$OO'D\(YHQW Dollar Sushi +RRNÂśV6XVKL%DU

$# SP(67 0RQGD\1LJKW)RRWEDOO New York Giants at New Orleans ESPN



4 p.m. St. Petersburg College ÄĽ0HHWLQJ&RPPXQLW\ Needs Lewis House

! 8 p.m. CPS Proof %LQLQJHU7KHDWHU


To advertise your event with The Current, contact Current Entertainment at









!" 9($*0$+"(1*($

the current




A fairy tale for adults

!"#$%&'()$!*&$+,-./$0./1"2$3&,.2-4$5/1.26%&$#&,'",21$-/$7-,&2./$3*.#&%8$!"#$,-9*()$ :.4*.,;$<"*/1("/=$4%.11$"'$>?@@=$#%.;1$(*&$A%&/(,"#$",9./$-/$7-,&2./$3*.#&%8$+"(("2$,-9*()$ B,(*C,$DE-//&,=$4%.11$"'$@FG>=$9-H&1$.$(.%E$-/$5%%-"(($I.%%&,;8$+"(("2$%&'()$D(&,%-/9$7.(1"/$ ,&.J1$',"2$*-1$/"H&%$-/$7-,&2./$3*.#&%8$


Ä&#x17E;Ä&#x160;Ä&#x2018;Ä&#x2020;Ä&#x201C;Ä&#x160;Ä&#x17E;Ä&#x201D;Ä&#x2021;Ä&#x17D;Ä&#x201C;Ä&#x2DC;Ä&#x201D;Ä&#x201C; !"#$%&'($&#)*+%&$,%

? @ A " 5 # " $ ( / 0 ) ) ( C ( D " " E ( =

4"-"5#"$(//+( 1&2%&$'()*

1&2%&$'(/0+( !"#$%&$'()3

!"#$%&$'()*+( ,&$-.(/0

!"#$%&'("(#)*%'+,-.' /&&01'2*(%-3"%45' 2"))&*6#&.')""0'+"' 7"#'+"',&)('+,&8'.&&' (%"9&3+.'+,%"#6,1'/,-)&' "):';%-&4:.'*4:'4&/' :%"('<7';"%'*'=-.-+5

>4=-+&.'3"8&')&;+'*4:' %-6,+5'?++&4:'*.'8*47' *.'7"#'3*41'?@#*%-#.1' <#+':"4$+'"=&%&A+&4:' 7"#%.&);5'!"#',*=&' ."8&+,-46'-8("%+*4+' +"';-4-.,'*+',"8&5

?8*B-46'&=&4+.'"33#%' *+'&=&%7'+#%45'C49"71' D-.3&.5'?'8&8"')*7.' "#+'+,&'-+-4&%*%7';"%'*4' #(3"8-46'(%"9&3+1'*4:' 7"#'()*7'*4'-8("%+*4+' (*%+5

,&$-.(/)+( 67$89()*

67$89(/0+(( ,&'(/0

,&'(/)+((( 1%2"(/)

E,&'9"#%4&7'";'.&);F &A()"%*+-"4'<&6-4.';"%' *';%-&4:5'G-=&'+,&8' ."8&'.(*3&1'?%-&.5'?' 8"8&4+"#.'"33*.-"4' 3*)).';"%'*'8"8&4+"#.' =&4#&5'H+*%+'+,&'.&*%3,' 4"/5

E%7'*.'7"#'8-6,+1' E*#%#.1'7"#'3*44"+'6&+' *'7"#46';%-&4:'+"'"(&4' #(5'I*30'";;'*4:')&*=&' +,&8'<&5'E,&7'/-))' 3"4;-:&'-4'7"#'/,&4' +,&7'*%&'%&*:75

?%6#8&4+.'6&+'"#+'";' ,*4:'*+',"8&5'H+&('-4' *4:'()*7'(&*3&8*0&%1' G&8-4-5'?'%&=-&/'";' 7"#%';-4*43&.'%&=&*).' ."8&'&*.7'/*7.'+"'3#+' <*30'*4:'.*=&'8"%&5

1%2"(//+(((( 1%9'(//

1%9'(/=+( 6%:%;<(//

6%:%;<(/=+( >"7<"5#"$(//


I*:'-4=&.+8&4+.' ()*6#&'*'%&)*+-=&5'I&' +,&%&';"%'+,&81'2*43&%1' <#+':"4$+'7"#':*%&'<*-)' +,&8'"#+5'?',"<<7',*.' <&&4'4&6)&3+&:';"%';*%' +""')"465

J"4$+')""0'4"/1'K&"1' <#+'."8&"4&'3)".&'+"' 7"#'-.'=7-46';"%'7"#%' *++&4+-"45'?';-4:'*+'+,&' 6%"3&%7'.+"%&'+-30)&.' +,&'+*.+&'<#:.5'?' (*30*6&'*%%-=&.5

E,&'<-6':*7'-.'*)8".+' ,&%&1'L-%6"5'M&=-&/' 7"#%'-+-4&%*%7'*4:' 8*0&'.#%&'7"#'*%&' %&*:75'N4&'8-..+&(' 3"#):'+,%"/'&=&%7+,-46' ";;5'?4'&F8*-)'(-@#&.' 7"#%'3#%-".-+75

>"7<"5#"$(/=+( B-<@#"$(//

B-<@#"$(/=+( ?@A"5#"$(/)

K-0&'-+'"%'4"+1'K-<%*1' *'3"))&*6#&'-.',&%&' +"'.+*75'!"#'3"#):' 9#.+')&*%4'+"')-=&'/-+,' +,&81'<#+'/,7'4"+'6&+' +"'04"/'+,&8'-4.+&*:O' !"#'8-6,+')-0&'+,&85

G*8&'"41'H3"%(-"5'E,&' 3*+F*4:F8"#.&'3,*.&' <&6-4.'*+'/"%01'*4:' +,&'"4)7'/*7'7"#$%&' 6"-46'+"'/-4'-.'-;'7"#' ()*7'+"'/-45'?((%"*3,' -.'&=&%7+,-465

?'@#&.+-"4'*%-.&.5' K""0'/-+,-4';"%'+,&' *4./&%1'H*6-++*%-#.5' D%&(*%*+-"4'-.'0&7' +"'8*0-46'*'%&(*-%5' ?')*.+F:-+3,'&;;"%+'+"' 6&+'*'(%"9&3+'";;'+,&' ?@A"5#"$(//+( 6%"#4:'/"%0.5


One of the unfortunate parts of growing up is when we begin to realize that all the fairytales that we believed as children are not true at all. There isnâ&#x20AC;&#x2122;t going to be a prince waiting to sweep you away to a happily ever after, and there sure arenâ&#x20AC;&#x2122;t any mice that are willing to clean my dorm room. The upside, though, is that there are no evil witches or magical curses. As this reality sets in, although it may be upsetting, many of you will be pleased by ABCâ&#x20AC;&#x2122;s hit new TV series, â&#x20AC;&#x153;Once Upon A Time.â&#x20AC;? Although this series is brand new, with only four episodes aired, I am already hooked. Whether it is due to my childish obsession with fairy tales or its XQLTXH ZD\ RI PL[LQJ ÂżFWLRQ ZLWK reality, I think that this new show is going to be very popular. Starring Ginnifer Goodwin, Jennifer Morrison and Lana Parrilla, this drama centers on a woman QDPHG (PPD ÄŞ0RUULVRQÄŤ ZKR LV brought to a small town in Maine by her biological son. Her son, Henry, portrayed by Jared S. Gilmore is trying to convince her that everyone in the town is actually a fairy tale character frozen in time. Her job is to save the town from Henryâ&#x20AC;&#x2122;s adoptive mother, who is known in an alternate universe as the evil queen. The series follows Emma through the journey of trying to make sense of the curse the evil queen has placed on the town and the people within in. 7KH XQLTXH ZD\ RI Ă&#x20AC;DVKLQJ WR Snow Whiteâ&#x20AC;&#x2122;s magical fairy tale world and then back to the real world, with the same characters, is a fantastic way to keep the plot interesting. This new twist on classic fairytales is exciting and refreshing. According to, in the past three weeks, â&#x20AC;&#x153;Once Upon A Timeâ&#x20AC;? has marked ABCâ&#x20AC;&#x2122;s highest series rating in the slot in nearly three years. With Sunday Night Football and the World Series as competition, â&#x20AC;&#x153;Once Upon a Time â&#x20AC;&#x153; shines through as Sunday QLJKWV QXPEHU RQH QRQÄĽVSRUWV program. Tune in Sundays at 8 p.m. on ABC to get lost in magical world of fairy tales.



the current


! &"#$!%&'()'$

+,-%./0120- !"

Thereâ&#x20AC;&#x2122;s always enough time for a quickie ACROSS 1 Edwin or Ringo 6 Beginning of Scrooge catchphrase 9 Floor cleaner 12 Peninsula divided at the 38th parallel 13 Pooh or Baloo, to RaĂşl 14 Exist 15 â&#x20AC;&#x153;Frankly, my dear, I donâ&#x20AC;&#x2122;t give ______.â&#x20AC;? 16 Hem and ___ :LUHÄĽWDSSLQJRUJ 18 Georgia, Belarus, et al., formerly 20 Brando or Olivier, for example 22 Professor of Literature and CreÄĽ ative Writing 25 Professor of Religious Studies 26 MMC divided by DCC 27 Not bicycles, but not quite motorÄĽ cycles either :LWKÄĽDFURVVÂł+DUU\3RWWHU´ star +LWVRQJE\(GZLQRIÄĽDFURVV 32 â&#x20AC;&#x153;VoilĂ !â&#x20AC;? 36 Beamed 39 Daily weather prediction 40 Professor of Theatre 43 Professor of Political Science 45 Jetsonâ&#x20AC;&#x2122;s boy 46 â&#x20AC;&#x153;There will be an answer, let _____.â&#x20AC;? 47 2016 Olympics site, for short 48 Boy 50 Unexpected defeat 54 David Freese, in the 2011 World Series 55 Chat room question? 56 Clarinets and oboes 57 Glimpse 58 Formerly, as a name 59 Expunge

DOWN 1 Music you can skank to 2 Tampa Bay Lightning CEO LeiÄĽ weke, or original â&#x20AC;&#x153;Draculaâ&#x20AC;? director Browning 3 ___ Pacis: monument honoring the ÂżUVWHPSHURURI5RPH 4 With his brother, fabled founder of Rome 5 Professor of Visual Arts 6 Quantum theorist Niels 7 Simile words 8 Professor of Psychology 9 Largest ray 10 â&#x20AC;&#x153;Citizen Kaneâ&#x20AC;? director Welles 11 Rush drummer Neil 19 Prevent from moving, usually in the winter )OXLGÄĽÂżOOHGVDF 22 Golfer Michelle 23 Goal 24 â&#x20AC;&#x153;Rocky Horror Picture Showâ&#x20AC;? star Curry 25 Utterly lacking 28 Friend 30 Regarding 33 â&#x20AC;&#x153;Thrilla in Manilaâ&#x20AC;? competitor 34 Elmer, to Bugs 35 Admiration 37 Professor of Biology 38 Professor of Computer Science 40 Autumn and winter, at Eckerd 41 Martini garnish 42 Figure of speech 44 Pariah 46 Lazy (Q]\PHVXɡ[ 51 Housing locale next year? 52 Max Martinez and Ashley Daniels, e.g. 53 â&#x20AC;&#x153;The Waste Landâ&#x20AC;? poetâ&#x20AC;&#x2122;s initials


Scan this QR code with your smartphone to get the solution to this weekâ&#x20AC;&#x2122;s puzzle, or visit

<7/=%4>"570?,5 @"06%5,-%9:05-:4%"A%B12-:C%<"77-?Ä&#x17E;Ä&#x160;Ä&#x2DC;Ä&#x2018;Ä&#x17D;Ä&#x160;Ä&#x2020;Ä&#x17E;Ä&#x2018;Ä&#x201D;Ä&#x2014; !"#$%&'($&#)*+%&$,% The Creative Writing Club is focused on developing a community of writers within and without the creative writÄĽ ing and literature majors. Irregular meetings are held where discussions on writÄĽ ing and literature take place. Club members share original writing for workshop sessions. The club is also holding various events throughout the year to appeal to fans of writing and literature. Poetry with Professors, held every spring semesÄĽ ter, is one of the main club events. This event encourÄĽ ages professors of all disÄĽ ciplines to participate and read their creative writing work to the Eckerd comÄĽ munity. There is also going to be a big event next semester WKDWLVVWLOOLQLWVWRSÄĽVHFUHW planning stages. The creative writing club

also hosts poets who read and discuss their work. This alÄĽ lows students to interact with people who make a living with their craft. Join the Creative Writing Club even if you just appreciÄĽ ate writing but donâ&#x20AC;&#x2122;t necessarily write yourself. Contact Leslie Taylor at and join the email list for the Creative Writing Club to get the latÄĽ est news about fun writing and literature sessions.




!" 9.*%:&"/;"*


the current

<=>'#"(?%3"$+)% '")%@+/$#

Donâ&#x20AC;&#x2122;t worry, the sky isnâ&#x20AC;&#x2122;t falling. The world as we know it is not going to disappear over night.




the current


! &"#$%&"

+,"-./ !"

Inside Rugby


Wayne Sears

Back Cover

;"5%<6%/69=5>(%<+?%/.2>53./%-569. Ä&#x17E;Ä&#x17D;Ä?Ä&#x160; Ä&#x160;Ä&#x17D;Ä&#x2021;Ä&#x160;Ä&#x2018; Â&#x2013;Â&#x192;ĆĄÂ&#x201D;Â&#x2039;Â&#x2013;Â&#x2021;Â&#x201D;

So yes, people may argue that Joe 3DWHUQR GLG ZKDW KH ZDV UHTXLUHG WR GR DQG ZDV ZLWKLQ WKH FRQÂżQHV RI WKH ODZ EXW WKDW LV QRW HQRXJK Pennsylvania State University was 5HIXVLQJ WR ÂłVQLWFK´ RQ D FRZRUNHU a mess Wednesday night as students for stealing company pencils is one and local supporters of Joe Paterno thing, failing to report the continuÄĽ Ă&#x20AC;RFNHG WR WKH VWUHHWV  5HSRUWV RI ous, repeated, and horrifying sexual riotous behavior began streaming in abuse of elementary school children shortly after the sun went down and LVDQRWKHUVWRU\HQWLUHO\$SHUVRQLQ included an instance of a news van a position of authority over a college EHLQJĂ&#x20AC;LSSHGDQGDOORIWKHZLQGRZV football team, which regularly deals EURNHQ RXW  :KDW WKHVH VWXGHQWV with high school recruits, should donâ&#x20AC;&#x2122;t understand is that the punishÄĽ have the wherewithal to understand ment handed down to Joe Paterno, ZKDWQHHGVWREHGRQH in the form of his immediate disÄĽ Paterno has been shaping lives for missal as the head coach of the Penn more than half a century and should State football team, was completely have had enough conviction to proÄĽ MXVWLÂżHGDQGPXFKOHVVVHYHUHWKDQLW tect the future generations to stand FRXOGKDYHEHHQ up and put a stop to these atrociÄĽ Donâ&#x20AC;&#x2122;t get me wrong, it is a terrible WLHV,QKLVVWDWHPHQWUHJDUGLQJKLV tragedy to lose a coach with such a HQGÄĽRIÄĽ\HDU UHVLJQDWLRQ ÄŞPHUH KRXUV storied history as Joe Pa, but it is exÄĽ before trustees voted unanimously pected in this type of tragedy that WR LPPHGLDWHO\ GLVPLVV KLPÄŤ -RH some people who were only on the Pa stated that he should have done RXWVNLUWVRIWKHVFDQGDOVWLOOVWDQGWR PRUHWRKHOSWKHFKLOGUHQ7KHUHLV ORVHWKHLUMREV:KDWPDQ\SHRSOH no excuse for not doing everything with ties to Penn State donâ&#x20AC;&#x2122;t underÄĽ LQKLVSRZHUWRUHSRUWWKHFULPHV stand is that it wasnâ&#x20AC;&#x2122;t the fault of ,W VKRXOG EH QRWHG , LQ QR ZD\ the trustees; the blame falls on Joe blame Joe Paterno solely for what 3DWHUQRKLPVHOI Â&#x2026;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2013;Â&#x2021;Â&#x2022;Â&#x203A;Â&#x2018;Â&#x2C6;Â&#x2039;Â?Â&#x2021;Â&#x2021;Â&#x2013;Â&#x2013;Â&#x2039;Â&#x2030;Â&#x192;Â?Â&#x2018;Č&#x20AC;ĆŞÂ&#x2039;Â&#x2026;Â?Â&#x201D;ǤÂ&#x2026;Â&#x2018;Â? KDSSHQHG-HUU\6DQGXVN\LVFOHDUO\ According to the Pennsylvania !"#$%#&'%((&)*+*%&,"+,-&."%&'+*%#("/ DVLFNLQGLYLGXDODQGWKHFULPHVFRPÄĽ grand jury report, Joe Paterno was informed of the child abuse and moÄĽ PLWWHGIDOORQKLPFRPSOHWHO\What E\ODZWKDWDQ\RQHZLWKNQRZOHGJHRIFKLOGDEXVHPXVWUHSRUW lestation in 2002, four years after the investigation that later LWWRODZHQIRUFHPHQWRUDFKLOGÄĽDEXVHKRWOLQHDQGIDLOXUHWR , GR EODPH RQ -RH 3DWHUQR DQG WKH HQWLUH 3HQQ 6WDWH DWKÄĽ VKRZHGWKHFRQWDFWEHWZHHQ6DQGXVN\DQGWKHYLFWLPVEHJDQ GRVRRSHQVWKHULVNRIIDFLQJPLVGHPHDQRUFKDUJHVDQGIXOO OHWLFGHSDUWPHQWDVDZKROHLVWKDWLWWRRNVRORQJIRUWKHVH To his credit, Joe Pa immediately reported what he was told to OLDELOLW\LQFLYLOFRXUW,QIDFWLQPDQ\VWDWHVWKHODZVSHFL¿ļ FUXHODQGGLVJXVWLQJDFWVWREHVWRSSHG-RH3DWHUQRVKRXOGHUV WKHDWKOHWLFGLUHFWRURI3HQQ6WDWH7LP&XUOH\7KHUHVSRQÄĽ FDOO\ ZDUQV WKDW VKLUNLQJ UHVSRQVLELOLW\ WR D VXSHUYLVRU GRHV much of the scrutiny because of his notoriety, but from the sibility then fell into Curleyâ&#x20AC;&#x2122;s hands and Paterno seemingly not pardon the witness from reporting the abuse to an outside ÂżUVWUHSRUWVRIDEXVHLQHYHU\RQHZKRNQHZDERXWWKH GLG QRWKLQJ PRUH DERXW WKH LQFLGHQW $QG WKDWÂśV ZKHUH KH DXWKRULW\While Joe Pa managed to cover his own a**, and accusations should have done more to alert authorities and ZHQWZURQJ was completely within the child abuse reporting laws of PennÄĽ SXW D VWRS WR 6DQGXVN\ÂśV DFWLYLWLHV 8QIRUWXQDWHO\ IRU 3HQQ Pennsylvania is one of only about a half dozen states in the 6WDWHIDQV-RH3DWHUQRZDVLQWKHPLGGOHRIDWRSÄĽWRÄĽERWWRP FRXQWU\ZKHUHNQRZOHGJHRIFKLOGDEXVHRQO\QHHGVWREHUHÄĽ sylvania, in a situation where children as young as eight years SRUWHGWRDVXSHULRU,QWKHUHVWRIWKHFRXQWU\LWLVUHTXLUHG ROGDUHEHLQJVH[XDOO\DEXVHGMXVWHQRXJKLVQÂśWJRRGHQRXJK IDLOXUHE\WKHHQWLUHRUJDQL]DWLRQDQGLWFRVWKLPKLVMRE !"#$"%&'()*+,*-./'01)2'34(5'

!@A%"735-/(%,46B5-/%/.19=%."%.851-%C23/% often that once their playerâ&#x20AC;&#x2122;s initial contract expires, the player will go elsewhere. Enter Dan Gilbert, owner of the Cleveland Cavaliers. Gilbert has beÄĽ come a noted owner in the current labor negotiations. But Gilbert has proven to be the wrong choice by the owners due to his history with the players. Gilbert has held a hard line on player contracts and a salary cap since his Cavaliers lost Lebron James in the infamous Decision. In the weeks following â&#x20AC;&#x153;The Decisionâ&#x20AC;?, Gilbert went on tirades through letters to Cleveland fans saying that he will rebuild the team, guaranteeing winning a title within a decade, and even going so far as to declare the acquisition of James by Miami to be illegal by league by laws to demand an investigation of the move. Gilbert had a right to be upset; the loss of Lebron James meant that the Cavaliers went from a successful organization to a team that lost both money and games. In fact, The Atlantic estimated that losing Lebron meant that the city of Cleveland was losing up to two million dollars per home game. Gilbert invested in the Cavaliers at the crescendo of the Lebron era. The team was successful, the arena was packed with fans every night, and the money never seemed to VWRS Ă&#x20AC;RZLQJ QDWLRQZLGH WKDQNV WR the James brand. Now, the cruel truths of a small market team come to light. Due to these occurrences, the NBA owners have advocated for a stricter salary cap, a luxury tax for teams that surpass the cap,


DQGDSURSRVHGÄĽVSOLWZLWKWKH players for league revenue sharing. Looking at the deal from the ownÄĽ ersâ&#x20AC;&#x2122; standpoint, the deal looks like a positive for both sides. However, the players have their own arguÄĽ ments for their ideas. The Players Association seeks to maintain the balance of power that the players have carved out for the last decade. The players have been a mixed bag of emotions reÄĽ garding the lockout. Regardless of team, they seem to stand together in solidarity. Many look at each other as their brothers instead of just friends. Many have known each other since their days in college, while some only know people when they enter the league. Regardless of where they came from, the players have their own issues with treatÄĽ ment and money. Over the last ten years, NBA players have become some of the highest paid players in all of AmeriÄĽ can sport. In fact, the average salary RIDQRÉąWKHEHQFKSOD\HULVDURXQG two million dollars. With salaries like that it is not that hard to imagÄĽ ine why NBA payrolls run so high. A typical roster consists of 12 to 14 SOD\HUVÂżJXUHWKDWWKHVWDUWHUVZLOO be paid more money than the bench and the payroll will only grow. The ÂżYH PDMRU WHDPV WKH /RV $QJHOHV Lakers, Boston Celtics, Chicago Bulls, New York Knicks, and the 0LDPL +HDW WDNH XS ÂżYH RI WKH seven largest payrolls in the league. Not surprisingly, these major marÄĽ NHWWHDPVFDQRÉąHUPRUHPRQH\WR a player, so naturally many try to


reach these cities. Adding to the complications are rookies. These rookies receive addÄĽ ed bonuses for being an early pick, IRU H[DPSOH WKH  ÂżUVW RYHUDOO SLFN-RKQ:DOOUHFHLYHGDWZRÄĽ\HDU FRQWUDFW YDOXHG DW PRUH WKDQ IJ million with a two year player opÄĽ WLRQ ZRUWK PRUH WKDQ IJ PLOOLRQ So for a four year deal, Wallâ&#x20AC;&#x2122;s team KDVDWRWDORIPRUHWKDQIJPLOOLRQ invested in him. Now if every rookÄĽ ie could be as productive for their team as Wall was in his rookie year for the Wizards there would not be an issue. However some players drafted in the top ten picks turn out to be nothing more than bench players. Now their teams have milÄĽ lions of dollars invested in a player that barely plays. The players wish to do away with the current salary cap. This would open up more possibilities for star contracts. One such idea proposed was that teams should be allotted two roster spots for high salary players that would not count against a cap if there was one. 6KRXOG WKLV SODQ WDNH HÉąHFW 1%$ IDQV FRXOG VHH PXOWLÄĽPLOOLRQ GROODU deals that would rival salaries only seen in European soccer. Also the players wish to expand free agency, claiming that every summer should be like the summer of 2010. Also, the players wish to gain a 52 percent piece of total league revÄĽ HQXHDVRSSRVHGWRWKHSHUFHQW split that they had in the previous agreement. But what about the people who give the money, do they have a say in any of this?

As a truly nationwide campus, Eckerd is home to many NBA fans RIPDQ\GLÉąHUHQWWHDPV2QHVXFK fan is Jake Allgeier, a fan of the Denver Nuggets. This past season Jake watched the Nuggets trade Carmelo Anthony to New York with the promise of making more money. The Nuggets have one of the lowest payrolls in the league; Anthony was their highest paid player and was set to be a free agent at seasonâ&#x20AC;&#x2122;s end. On the proposal of a salary cap for the league, Jake was supportive saying that â&#x20AC;&#x153;if teams could spend only a certain amount, it would really allow smaller teams to compete.â&#x20AC;? He continued by sayÄĽ ing that the â&#x20AC;&#x153;game never changes as long as people can be paid as much as possible.â&#x20AC;? Eckerd sophomore and Lakers fan, Walker Banks agrees with Jake. When asked about the lockout, Walker described that the whole scenario was a result of poor deciÄĽ sion making by both parties. When asked if he was in favor of a salary cap, Banks responded that â&#x20AC;&#x153;yesâ&#x20AC;Ś even though I know it may hurt the Lakers, but if you look around the league thereâ&#x20AC;&#x2122;re good teams that MXVWFDQÂśWDÉąRUGWREHFRPSHWLWLYH´ Walker describes himself as a fan of the sport above all else and when told that in the last twenty years only eight teams had won a chamÄĽ pionship he said that if a cap were to be in place, basketball would be much more fun to watch for the fans. And in the end, the fans are the only ones who really are hurt by the lockout.

Â&#x2026;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2013;Â&#x2021;Â&#x2022;Â&#x203A;Â&#x2018;Â&#x2C6;Â&#x192;Â&#x17D;Â&#x153;Â&#x192;Â&#x2021;Â&#x2021;Â?Í&#x2122;Í&#x153;Í&#x2122;Í&#x;Č&#x20AC;ĆŞÂ&#x2039;Â&#x2026;Â?Â&#x201D;ǤÂ&#x2026;Â&#x2018;Â? 012&,"$$3443"(%#&5+637&)*%#(/

Monday afternoon the playÄĽ ers association rejected the ownÄĽ ersâ&#x20AC;&#x2122; proposal. With this rejection WKH XQLRQ KDV YRZHG WR GHÄĽFHUWLI\ meaning that they plan on suing the NBA on antitrust grounds. The playerâ&#x20AC;&#x2122;s claim that the league, and the owners, act as one single conÄĽ glomerate who do not allow other competitors onto the market, this means that the league operates to PD[LPL]H LWV RZQ SURÂżWV DW WKH expense of its workers. On top of EHJLQQLQJ WKH URDG WR GHFHUWLÂżFDÄĽ tion, the NBPA has taken steps to declare all current player contracts null and void. These latest â&#x20AC;&#x153;negotiaÄĽ tion ploysâ&#x20AC;? as NBA Commissioner David Stern called them have come far too late to have an impact on restarting the league. The rejected RÉąHULQFOXGHGDÄĽUHYHQXHVKDUÄĽ ing split between owners and playÄĽ HUV D ÂżYH \HDU PD[LPXP FRQWUDFW duration clause, a rookie contract limit, and a salary cap.

!! 9:'0$#

the current






Intrumural gridiron champion crowned

Luck runs out for Stanford Cardinal


Preseason Heisman favorite Andrew Luckâ&#x20AC;&#x2122;s camÄĽ paign to be named college footballâ&#x20AC;&#x2122;s best player hit a speed bump Nov. 12 as his Stanford Cardinal fell to WKH'XFNVRI2UHJRQÄĽ7KHSUHYLRXVO\XQGHIHDWHG Stanford was ranked number 4 in the nation before Saturday nightâ&#x20AC;&#x2122;s game. Oregon, whose only loss of the season thus far was to number 1 LSU, sustained a steady ground attack with a healthy Lamichael James racking up 146 rushing yards and three touchdowns. Stanford fell to ninth in the BCS polls, while Oregon rose to fourth.


Volleyball mounts charge for National Title Are you tired of hearing about your amazing volÄĽ leyball team yet? Hopefully not, because the girls will be taking on Christian Brothers University at 2:30 SPRQ1RYRQ87ÂśVKRPHFRXUWLQ7DPSD7KH /DG\7ULWRQVGHIHDWHGWKHWKÄĽVHHGHG/DG\%XFVÄŞÄĽ ÄŤE\WKHVFRUHRIVHWVWRDWWKH8:)5HJLRQDO Crossover on Oct. 15. Another win over CBU would earn the team a date with either the University of 1RUWK $ODEDPD RU 5ROOLQV FROOHJH LQ WKH UHJLRQDO VHPLÂżQDOV)URPWKHUHWKHJLUOVZRXOGKDYHWRÂżJKW WKHLUZD\WKURXJKWKHFUHDPRIWKHÄĽWHDP'LYLVLRQ ,,ÂżHOG

And then there were two 7KH&KDVHIRUWKH1$6&$56SULQW&XSFRQFOXGHV 1RY  DW +RPHVWHDGÄĽ0LDPL 6SHHGZD\ LQ ZKDW SURPLVHVWREHWKHFORVHVWÂżQLVKLQWKHVSRUWÂśVLOOXVWULÄĽ ous history. Current points leader Carl Edwards holds DVOLPSRLQWOHDGRYHUVHFRQGSODFH7RQ\6WHZDUWIRU WKH FKDPSLRQVKLS HQWHULQJ WKH ÂżQDO ZHHNHQG RI WKH season. Stewart, who has won four of the last nine racÄĽ es is sttampting to win his third title. Edwards looks WRZLQKLVÂżUVWWLWOHRQ6XQGD\%RWKGULYHUVKDYHKDG great careers at the South Florida track, setting up a VKRZGRZQ RI HSLF SURSRUWLRQV RQ 6XQGD\ 7KH UDFH will be televised by ESPN at 3 p.m. Sunday afternoon.

Big 10 makes Stagg-ering change to trophy In yet another blow for embattled Penn State footÄĽ EDOO FRDFK -RH 3DWHUQR RQ 0RQGD\ 1RY  WKH %LJ 7HQ &RQIHUHQFH DQQRXQFHG LWV GHFLVLRQ WR UHPRYH -RH3DÂśVQDPHIURPLWVQHZFKDPSLRQVKLSWURSK\7KH WURSK\ ZLOO EH DZDUGHG DW WKH FRQIHUHQFHÂśV ÂżUVW HYHU championship game on Dec. 3 in Indianapolis, and was WREHFDOOHGWKH6WDJJÄĽ3DWHUQR&KDPSLRQVKLS7URSK\ in honor of Paterno and fellow legend Amos Alonzo Stagg, best known for coaching football at the UniverÄĽ sity of Chicago from 1892 to 1932. Instead, it will simÄĽ SO\ EH FDOOHG WKH 6WDJJ &KDPSLRQVKLS 7URSK\ Âł7KH trophy and its namesake are intended to be celebraÄĽ tory and aspirational, not controversial, said CommisÄĽ VLRQHU-LP'HODQ\RIWKH%LJ7HQ3HQQ6WDWHUHIXVHG to comment.

11/1 v. St. Leo W 3-0 (25-13, 25-16, 25-16) (EC) Burr 17 Assists (EC) Smith 16 Assists

11/1 @ Rollins College L 2-1 (EC) Arico Goal (RC) Sowers Goal, Assist

11/4 v. North Alabama W 3-2 (22-25, 25-19, 23-25, 25-17, 15-11)

Womenâ&#x20AC;&#x2122;s Volleyball




7KH (FNHUG 0HQÂśV 5XJE\ &OXE recently avenged a heartbreaking three point loss to Florida Gulf Coast University. Four weeks earÄĽ OLHUWKHPHQWUDYHOHGWR)W0\HUV to take on the Eagles of FGCU in ZKDWZRXOGWXUQLQWRDKDUGÄĽIRXJKW loss in a heavy downpour that VRDNHGWKHÂżHOGDQGOHGWRDGHIHQÄĽ VLYH VWUXJJOH  (FNHUG ZDV DQ[LRXV coming into the rematch at home and ready to erase all memory of ZKDW ZDV WKH )*&8 FOXEÂľV ÂżUVW ever victory. In the highly advertised home match, Eckerd put on a great show for the fans in attendance and came away with a big victory, ultimately scoring 5 tries to the Eaglesâ&#x20AC;&#x2122; 1. Buck added 4 out of 5 conversions, some DWYHU\GLɡFXOWDQJOHVWREULQJWKH ÂżQDOVFRUHWRÄĽ Eckerd held FGCU scoreless for much of the game, with the EaÄĽ glesâ&#x20AC;&#x2122; only try of the match coming shortly after halftime as they were awarded a penalty and before EckÄĽ erd could get organized to mount a defense, dove for the line and snuck WKHEDOOXQGHUDIHZ7ULWRQVIRUWKH score. Eckerd held possession of the ball for a lot of the remainder of the game and were rewarded at the ÂżQDOZKLVWOHZLWKDELJZLQDWKRPH against a team that is sure to beÄĽ come a rival in upcoming seasons.

7KH (FNHUG 6LUHQV WRRN FHQWHU stage recently against Florida InterÄĽ QDWLRQDO 8QLYHUVLW\ LQ WKHLU7DFNOH +XQJHU:RPHQÂśV5XJE\PDWFK In front of a good home crowd RQ .DSSD )LHOG WKH 6LUHQV EHDW ),8ÄĽ$IWHUGHOD\LQJWKHJDPH nearly an hour for a late FIU team, WKHZRPHQJRWRÉąWRDVKDN\VWDUW but after settling down, played a very good game on both sides of the EDOO 7KH 6LUHQVÂś IRUZDUGV ZRUNHG well in the scrum and the backs ran well and had good kicking. Defensive play was strong for the Sirens, allowing very few long runs. Eckerd played with several starters missing due to injuries but those who were active in the game stepped up nicely for the Sirens secÄĽ ond home win in as many weeks. Impressive performances by the 6LUHQV LQFOXGHG H[FHOOHQW WDFNOLQJ from Briana Ballard, solid play from Zoe Oâ&#x20AC;&#x2122;Donoghue stepping into the #8 position for the match, and 0D[LQH 7DQ VFRULQJ KHU ÂżUVW HYHU try for the team. Along with the victory, the women were able to collect a large amount of canned goods and toiletÄĽ ries to donate to the St. Petersburg Free Clinic, which provides food, shelter, and health care for those in need in the area.

(EC) Laton 18 Kills (EC) Smith 40 Assists

(EC) Biggs 13 Kills, 10 Digs (EC) Smith 24 Assists

11/5 v. Florida Southern L 3-1 (25-16, 15-25, 23-25, 20-25) (EC) Smith 29 Assists (EC) Biggs 9 Kills, 13 Digs 11/11 @ Lynn W 3-1 (25-20, 25-19, 21-25, 25-17)

11/12 @ Barry W 3-1 (25-23, 25-16, 18-25, 25-23) (EC) Laton 14 Kills (EC) Smith 23 Assists











Menâ&#x20AC;&#x2122;s Basketball v. Caldwell College 7:30 PM

Womenâ&#x20AC;&#x2122;s Basketball v. Queens University 3 PM

Womenâ&#x20AC;&#x2122;s Basketball



Menâ&#x20AC;&#x2122;s Basketball v. UPR-Bayamon 7:30 PM



Menâ&#x20AC;&#x2122;s Soccer

Women Basketball v. UPR- Bayamon 3 PM


Bucaneers @ Green Bay Packers 1 PM

Bucaneers @ Tennessee Lightning @ Minnesota Titans 1 PM Wild 7:30 PM



Lightning v. Maple Leafs 7:30 PM


11/5 @ FGCU (Scrimmage) L 68-50 (EC) Bestry 12 Points (EC) Rausberg 6 Points, 8 Rebounds 11/12 v. West Florida W 60-58 (EC) Hesseldal 19 Points, 7 Rebounds (EC) Charles 12 Points, 9 Rebounds



USF Menâ&#x20AC;&#x2122;s Basketball v. Georgia Southern 7 PM


Lightning @ Detroit Red Wings 7:30 PM

Thursday 24

USF Womenâ&#x20AC;&#x2122;s Basketball v. Miami or Alaska @ Alaska 6 PM


USF Football v. West Virginia 8 PM

Menâ&#x20AC;&#x2122;s Basketball v. Shaw University 7:30 PM



82)9#%:#235#%+-; .3/%<'3=23(

Ä&#x160;Ä&#x2DC;Ä&#x17D;Ä&#x152;Ä&#x201C;Ä&#x2020;Ä&#x201C;Ä&#x2030;Ä&#x2022;Ä?Ä&#x201D;Ä&#x2122;Ä&#x201D;Ä&#x2DC;Ä&#x2021;Ä&#x17E; Ä&#x2018;Ä&#x160;Ä?Ä&#x17D;Ä&#x160;Ä&#x2018;Ä&#x17D;Ä&#x201C;Ä&#x2DC;Ä?Ä&#x17D;

42*)#%.#235%63/%+-7 .3/%0123(


>233?#)%@29A%+-B 63/%<'3=23(


PLFURSKRQHDVDFRPPHQWDWRUIRUWKHÄĽEDVNHWEDOO season where he can be heard on Eckerd will be looking to continue and improve upon WKHLUZLQQLQJZD\VIURPODVW\HDUWKDWVDZWKHPÂżQLVKUG in the Sunshine State Conference and following an upset of 2nd ranked Florida Southern, an appearance in the SSC WRXUQDPHQWÂżQDOVZKHUHWKH\ORVWWRWKHWRSVHHGHG5ROOLQV and then barely missed out on Division II March Madness. Key home games for the Tritons this year will be the ULYDOU\JDPHDJDLQVW7DPSDRQ-DQWKHPDWFKÄĽXSDJDLQVW last yearâ&#x20AC;&#x2122;s conference champs Rollins on Feb. 4 and senior night when they will take on Lynn University on Feb. 25. 7KH PRVW GLɡFXOW WLPH RI WKH VHDVRQ ZLOO EH WKH ÂżUVW round of conference games in the new year as the Tritons ZLOOEHDZD\IRUÂżYHRIVHYHQJDPHVLQFOXGLQJ5ROOLQVRQ Jan. 7 and at Florida Southern on Jan. 4. The Tritons will be looking to enter the hunt for the SSC regular season title, something that Eckerd has only won once in 1995, which seems a very realistic goal for an ambitious team with very good coaching. The Tritons will IDFHRÉąLQDQRQÄĽFRQIHUHQFHJDPHDJDLQVW&DOGZHOO&ROOHJH DWKRPHSP1RYLQWKH0F$UWKXU&HQWHU


Ä&#x17E;Ä&#x17D;Ä&#x201C;Ä&#x2C6;Ä&#x201D;Ä&#x2018;Ä&#x201C;Ä&#x201C;Ä&#x2030;Ä&#x2014;Ä&#x160;Ä&#x2DC;ÇŚÄ&#x160;Ä&#x2C6;Ä? !"#$%&'()*%#$

Itâ&#x20AC;&#x2122;s that time of year again. November is here, Thanksgiving is fast approaching and the NBA is still in lockout. What does it all mean? It means that it is time for some Eckerd College basketball at the McArthur Center, as the menâ&#x20AC;&#x2122;s team will be stepping onto the court in Coach Tom Ryanâ&#x20AC;&#x2122;s 16th season leading the Tritons. Look for a high tempo game coming from the experienced guards led by redshirt junior point guard Woody Taylor and senior guard Wayne Sears. Senior Lance Kearse and junior Darrien Mack will lead the forward corps for the Tritons. Inside the paint, Eckerd will rely heavily on junior Walade Wade, but also look out for the 6â&#x20AC;&#x2122; 10â&#x20AC;&#x2122; junior transfer from Northern State University, Marko Filipovic from Novi Sad, Serbia, as the Tritons are working to replace the inside gap left by departing seniors Dale Carn, Adio Faucher and Nick Agress. Eckerd will also miss the contributions of point guard Chris Gray and standout shooting guard John +DUSHU *UDGXDWH 1LFN $JUHVV Ī¾č ZLOO EH UHWXUQLQJ WR take up a new role for the Tritons when he gets behind the

='3-%>?6%@A>>% The Official Student Newspaper of Eckerd College






!"#$#%&'%()*+#,*%-*./01230+4 '%"()&)8++.)&:(%%&.8(+;&"*",$).&1'29









The Current Vol. 3 Issue 5