Issuu on Google+

1(:3$/7=25$&/( 7+(

9ROXPH,VVXH;

RUDFOHQHZSDOW]HGX

7KXUVGD\'HFHPEHU

:(,*+,1*237,216 0D\RU'XQJDQGLVFXVVHVSRWHQWLDO YLOODJHDQGWRZQUHVWUXFWXULQJ SEE STORY ON PAGE 3 EDITORIAL ON PAGE 9

3+272%<0$;,0$/7(5

8831HZ3DOW]&KDSWHUFDOOV IRUXVHRIUHVHUYHIXQGVWR VWDELOL]HEXGJHWVLWXDWLRQ

INSIDE THE NEW PALTZ ORACLE

Â&#x2021;1LQH&DQGLGDWHV0D\(QWHU0D\RUDO5DFH3J Â&#x2021;$OFRKROLF(QHUJ\'ULQN%DQQHG3J Â&#x2021;7RZQ%XGJHW'HEDWH6HWWOHG3J

STORY ON PAGE 6 3+272%<-8/,(0$160$11


-XOLH0DQVPDQQ (',725,1&+,()

3LHUFH/\GRQ 0$1$*,1*(',725 BBBBBBBBBBBBBBBBB

-XVWLQ0F&DUWK\ 1(:6(',725

8QLYHUVLW\3ROLFH%ORWWHU

'LVFODLPHU7KLVLVRQO\DSDUWLDOOLVWLQJ)RUDOOLQFLGHQWVSOHDVHYLVLWWKH8QLYHUVLW\3ROLFH'HSDUWPHQW ,QFLGHQW'096XVSHQVLRQ 'DWH /RFDWLRQ5($5&+

,QFLGHQW'LVRUGHUO\&RQGXFW 'DWH /RFDWLRQ)2%

06DUUHVWHGIRUDVXVSHQGHGGULYHU¶V OLFHQVH

)6VDLGVKHDFFLGHQWDOO\EURNHD ZRRGHQJDWHVXEMHFWDJUHHGWRSD\ UHVWLWXWLRQ0DWWHUUHIHUUHGWRFDPSXV MXGLFLDO

=DQ6WUXPIHOG )($785(6(',725

0D[LP$OWHU

$576 (17(57$,10(17(',725 :(%&+,()

$QGUHZ:\ULFK 632576(',725 62&,$/0(',$&+,() BBBBBBBBBBBBBBBBB

/DXUD/XHQJDV 3+272*5$3+<(',725

'HUHN=LPPHUPDQQ &$57221,67

BBBBBBBBBBBBBBBBB

0DHYH+DOOLGD\ 5\DQ3DWULFN+DQUDKDQ 6DPDQWKD+XHUWDV 3HWH7KRPSVRQ 3DPHOD9LYDQFR &23<(',7256 BBBBBBBBBBBBBBBBB

(OL]DEHWK'DPLDQR %86,1(660$1$*(5 BBBBBBBBBBBBBBBBB

3DWULFN0DUW] .DWKU\Q6PLWK ',675,%87,210$1$*(56 )HOLFH%HUQDER6XQ\D%KXWWD$QGUHZ&DUGHQ.DLWO\Q 'D\6DUDK)LQH1LFN)RGHUD(OH[LV*ROGEHUJ$OHF +RURZLW]6DUDK+XUG(PLO\.XUODQG&KHOVHD/D'XH %HFN\/RQJOH\-HVVLFD0LQJRLD'DQLHOOH4XLWRQL0L FKHOOH5DYLW-RUGDQ6LZHN$OH[6LOYHUEHUJ(PLO\6XV VHOO&DW7DFRSLQD$VKOH\7KRPSVRQ&KULV7KXUVWRQ 1HNDL\D7URWPDQ-HQQLIHU9RQ:LOOHU+DUULV:LFKDUG .HOO\<RXQJ$QQLH<X

67$))

$ERXW 7KH1HZ3DOW]2UDFOH 7KH1HZ3DOW] 2UDFOHLVWKHRIÃ&#x20AC;FLDO VWXGHQWQHZVSDSHU RI681<1HZ3DOW] 2XUFLUFXODWLRQLV 7KH1HZ3DOW] 2UDFOHLVVSRQVRUHG E\WKH6WXGHQW$VVRFLDWLRQDQG SDUWLDOO\IXQGHGE\WKHVWXGHQW DFWLYLW\IHH 7KH1HZ3DOW]2UDFOHLVORFDWHG LQWKH6WXGHQW8QLRQURRP 'HDGOLQHIRUDOOVXEPLVVLRQVLV SPRQ6XQGD\VLQ7KH1HZ 3DOW]2UDFOHRIÃ&#x20AC;FHDQGE\HPDLODW RUDFOH#QHZSDOW]HGX $OODGYHUWLVHPHQWVPXVWEH WXUQHGLQE\SPRQ)ULGD\V XQOHVVRWKHUZLVHVSHFLÃ&#x20AC;HGE\WKH EXVLQHVVPDQDJHU&RPPXQLW\ DQQRXQFHPHQWVDUHSXEOLVKHG JUDWXLWRXVO\EXWDUHVXEMHFWWR UHVWULFWLRQGXHWRVSDFHOLPLWDWLRQV 7KHUHLVQRJXDUDQWHHRISXEOLFD WLRQ&RQWHQWVRIWKLVSDSHUFDQQRW EHUHSURGXFHGZLWKRXWWKHZULWWHQ SHUPLVVLRQRIWKHHGLWRULQFKLHI 7KH1HZ3DOW]2UDFOHLVSXE OLVKHGZHHNO\WKURXJKRXWWKHIDOO DQGVSULQJVHPHVWHUVRQ7KXUV GD\V,WLVDYDLODEOHLQDOOUHVLGHQFH KDOOVDQGDFDGHPLFEXLOGLQJVLQ WKH1HZ3DOW]FRPPXQLW\DQGRQ OLQHDWRUDFOHQHZSDOW]HGX)RUPRUH LQIRUPDWLRQFDOO7KH ID[OLQHLV 7KH1HZ3DOW]2UDFOHKROGVDV VLJQPHQWPHHWLQJVHYHU\6XQGD\ DWSPLQ6WXGHQW8QLRQURRP $UWLFOHVSKRWRJUDSKVDQGLO OXVWUDWLRQVDUHDVVLJQHGWRWKHSRRO RIVWDIIDQGFRQWULEXWRUV

9ROXPH  ,VVXH;

,QFLGHQW'UXJV 'DWH /RFDWLRQ&3+ 83'UHFHLYHGDQDQRQ\PRXVSKRQH FDOOUHJDUGLQJGUXJGHDOLQJ&DOOXQ IRXQGHG 681<1HZ3DOW] 8QLYHUVLW\3ROLFH'HSDUWPHQW (PHUJHQFLHV

)LYH'D\ )RUHFDVW )ULGD\'HF

,QGH[ 1HZV  (GLWRULDO  /HWWHUV  7KH*XQN%% 7KH'HHS(QG% 6SRUWV

0RVWO\6XQQ\ +LJK /RZ 6DWXUGD\'HF

0RVWO\6XQQ\ +LJK /RZ 6XQGD\'HF

3DUWO\&ORXG\ +LJK /RZ 0RQGD\'HF

3DUWO\&ORXG\ +LJK /RZ 7XHVGD\'HF

3DUWO\&ORXG\ +LJK /RZ


The  New  Paltz  Oracle

NEWS

Pg 3

Town  and  Village  Contemplate  Consolidation By  Maxim  Alter A&E  Editor  |  Malter42@newpaltz.edu

In  approximately  two  years,  the  Town  and   Village  of  New  Paltz  could  potentially  merge   into  a  single  body  of  government,  altering  the   way  local  services  and  departments  are  run. According   to   Village   Mayor   Terry   Dun-­ gan,   town   and   village   municipal   boards   will   be   receiving   recommendations   on   a   possible   UHVWUXFWXULQJ IURP WKH 1HZ 3DOW]EDVHG ÂżUP Fairweather  Consulting  after  a  year-­long  study   is  completed  sometime  this  July. 7KH ÂżUP LV FXUUHQWO\ ORRNLQJ DW D IXOO range  of  options  that  could  be  voted  upon  by   the   public,   which   include   cooperative   agree-­ ments   between   town   and   village   departments   and  complete  municipal  consolidation. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s  something  that  comes  up  periodically   and  itâ&#x20AC;&#x2122;s  coming  from  people  that  are  concerned   about  the  costs,â&#x20AC;?  Dungan  said.  â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s  a  con-­ cern  of  redundant  taxation  and  if  we  just  had   one  government,  things  would  be  simpler.â&#x20AC;? According   to   Dungan,   once   the   Fair-­ weather   Consulting   study   is   complete   the   Town   Board   or   Village   Board   of   Trustees   FRXOGLQLWLDWHDSXEOLFYRWHRQWKHÂżUPÂśVUHF-­ ommendations  or  the  public  could  petition  for   a  change. Dungan  said  the  consolidation  of  the  town   and  village  has  been  a  widely  discussed  topic   over  the  past  20  years,  and  the  elimination  of   the  village  government  was  previously  put  to  a  

public  referendum. Although  the  option  was  defeated  during   DYRWHKHVDLGLWFRXOGEHEURXJKWEDFNDJDLQ in  2011. â&#x20AC;&#x153;You   [wouldnâ&#x20AC;&#x2122;t]   have   a   village   anymore   DQGWKHWRZQKDVQRFKRLFHEXWWRWDNHUHVSRQ-­ sibility  for  it,â&#x20AC;?  Dungan  said.  â&#x20AC;&#x153;So,  I  guess  one   RI WKH GUDZEDFNV WR WKDW LV HYHU\ERG\ ZKR lives  in  the  town  has  no  voice  in  the  matter.  Itâ&#x20AC;&#x2122;s   OLNHÂľKHUHKDYHWKHYLOODJHϫ 'XQJDQVDLGWKHVWXG\LVDOVRORRNLQJDW the  option  of  a  coterminous  town  and  village,   which  would  allow  the  village  to  annex  the  en-­ tire  property  of  the  town  and  share  its  borders. If  this  option  were  decided  upon,  Dungan   said  the  village  would  be  responsible  for  gov-­ erning  the  entire  area. â&#x20AC;&#x153;You  can  dissolve  a  village  but  you  canâ&#x20AC;&#x2122;t   dissolve  a  town,â&#x20AC;?  he  said.  â&#x20AC;&#x153;So,  thereâ&#x20AC;&#x2122;s  one  day   a   year   when   the   village   board   meets   as   the   WRZQERDUGWRFRQGXFWVSHFLÂżFWRZQEXVLQHVV that  the  town  has  to  do,  but  other  than  that,  it   functions  as  a  village.â&#x20AC;? Dungan  said  he  is  in  support  of  this  meth-­ od  because  he  believes  village  government  is   PRUHHIÂżFLHQWWKDQWRZQJRYHUQPHQW Âł<RXU WRZQ VXSHUYLVRU \RXU WRZQ FOHUN and   your   town   highway   superintendent   are   all   independently   elected,â&#x20AC;?   he   said.   â&#x20AC;&#x153;If   they   donâ&#x20AC;&#x2122;t  get  along  well,  your  town  functions  very   badly.   With   a   village,   you   have   your   mayor,   your   board   of   trustees   and   thatâ&#x20AC;&#x2122;s   it.   Every-­ body   under   them   is   a   hired   professional,   and  

they  do  what  the  board  directs.  Itâ&#x20AC;&#x2122;s  much  more   straightforward  and  things  happen  as  they  are   supposed  to.â&#x20AC;? According  to  Town  Supervisor  Toni  Ho-­ NDQVRQ LI WKH WRZQ DQG YLOODJH ZHUH WR XQ-­ dergo   full   consolidation   there   would   be   only   one  board,  and  either  a  mayor  or  a  supervisor   would  exist  depending  on  the  form  of  govern-­ ment  selected. She   said   both   a   cooperative   agreement   and   consolidation   of   some   town   and   village   GHSDUWPHQWVFRXOGSRWHQWLDOO\NHHSWKHFXUUHQW structure  of  two  boards,  a  mayor  and  a  super-­ visor,  but  each  could  still  have  the  potential  to   save  money. â&#x20AC;&#x153;There   are   currently   four   full-­time   and   two  part-­time  staff  combined  for  both  depart-­ PHQWV´ VKH VDLG Âł,I FRQVROLGDWHG WKH ZRUN could  be  done  by  less  staff  and  there  is  a  sav-­ ings.  Consolidating  highway  and  building  de-­ partments  are  on  a  larger  scale  and  also  have   potential  [for  savings].â&#x20AC;? +RNDQVRPVDLGRWKHUDGYDQWDJHVRIFRQ-­ solidation,  include  a  reduction  in  bureaucracy,   OHVV ÂżJKWLQJ DQG D PRUH HIÂżFLHQW GHOLYHU\ RI town  and  village  services. If   consolidation   were   to   occur,   Dungan   said   the   town   and   village   could   share   a   pur-­ chasing   department   and   could   enjoy   greater   purchasing  power. Âł7KLQJV OLNH KHDOWK LQVXUDQFH DQG RWKHU supplies  and  services  could  be  less  expensive   that  way,â&#x20AC;?  he  said.

Dungan   said   there   has   also   been   discus-­ sion   of   consolidating   the   highway   services   in  New  Paltz,  so  that  the  Town  of  New  Paltz   Highway   Department   could   manage   the   vil-­ lage  streets. :KLOH+RNDQVRQLVZDLWLQJWRFKRRVHKHU IDYRULWHRSWLRQVKHVDLGVKHORRNVIRUZDUGWR WKHFRQVXOWLQJÂżUPÂśVDQDO\VLV â&#x20AC;&#x153;The   state   is   actively   encouraging   the   reduction  of  the  number  of  municipal  govern-­ ments,â&#x20AC;?  she  said.  â&#x20AC;&#x153;To  this  end,  the  state  offers   grant  funding  for  studies  and  is  offering  three   years   of   enhanced   state   aid   to   any   govern-­ ment  consolidations.  In  these  economic  times,   [thatâ&#x20AC;&#x2122;s]  a  big  incentive.â&#x20AC;? After  interviewing  a  consultant  responsi-­ ble  for  over  three-­dozen  consolidation  studies,   Dungan  said  he  was  told  in  almost  every  case   when   changes   were   made   to   municipalities   that  there  was  very  rarely  full  consolidation. Dungan   said   he   doesnâ&#x20AC;&#x2122;t   see   the   topic   of   a  possible  merger  or  consolidation  greatly  af-­ IHFWLQJWKHPD\RUDOUDFHLQ0D\EHFDXVHWKHÂż-­ nal  decision  and  implementation  would  not  oc-­ cur  for  a  few  years.  And  if  New  Paltz  were  to   eventually  have  a  coterminous  government,  he   VDLGWKHUHZRXOGPRVWOLNHO\VWLOOEHDPD\RU â&#x20AC;&#x153;Whomever  you  elect  needs  to  be  some-­ one  who  is  going  to  manage  it  well,â&#x20AC;?  he  said.   â&#x20AC;&#x153;Whether  itâ&#x20AC;&#x2122;s  a  small  village  or  a  large  village,   really  the  issues  are  the  same.  Iâ&#x20AC;&#x2122;m  sure  it  will   come  up  in  the  discussions.  Weâ&#x20AC;&#x2122;ll  really  have   to  wait  and  see.â&#x20AC;?

Mayoral  Race  Candidates  Start  Their  Engines By  Julie  Mansmann Editor-­in-­Chief  |  Jmansmann60@newpaltz.edu

Nine  people  have  expressed  interest  in  be-­ coming  the  next  mayor  of  the  Village  of  New   Paltz  after  elections  are  held  in  May.   Current  Mayor  Terry  Dungan  said  that  al-­ though   three   of   the   nine   people   who   have   ex-­ pressed  interest  in  the  position  have  not  done  so   SXEOLFO\WKHSRWHQWLDOÂżHOGRIFDQGLGDWHVFRXOG be  the  largest  in  recent  village  history.   â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s  not  common;Íž  itâ&#x20AC;&#x2122;s  New  Paltz,â&#x20AC;?  he  said.   â&#x20AC;&#x153;We  are  a  particularly  opinionated  community.   Different  people  who  have  considered  running   have  different  things  that  have  gotten  them  up-­ VHWZKHUHDORWRIWKHPKDYHVDLGÂľ:HOOLI,ZDV PD\RU,FRXOGÂż[WKLVϫ 7KHSRWHQWLDOÂżHOGPD\UDQJHIURPWKHLQ-­ cumbent  and  other  village  business  owners  and   UHVLGHQWVWRDEORJJHUIURP%URRNO\QDQGDIRU-­ PHU1HZ<RUN&LW\ÂżUHÂżJKWHU Democratic   blogger   Jeremy   Blaber   an-­

nounced  his  candidacy  in  an  Aug.  17  post  on  his   blog  called  blabernews.blogspot.com,  which  he   VDLGFRYHUVSROLWLFVLQKLVQDWLYH%URRNO\QDUHD 1HZ<RUN&LW\DQG8OVWHU&RXQW\ Although  Blaber  was  not  a  resident  of  the   village  at  the  time  he  announced  his  candidacy   â&#x20AC;&#x201C;  which  is  a  requirement  to  be  able  to  vote  in   the  election  â&#x20AC;&#x201C;  he  said  he  plans  to  reach  out  to   UHVLGHQWVDQGWDNHWKHSRVLWLRQ â&#x20AC;&#x153;I  plan  to  run  a  very  aggressive  race  to  be-­ come  the  villageâ&#x20AC;&#x2122;s  next  mayor,â&#x20AC;?  he  said. 3DWULFLD )LW]SDWULFN D ORFDO UHVLGHQW ZKR said   she   has   served   on   different   boards   and   groups  in  the  area,  has  also  publicly  announced   her   intention   to   run   for   the   position   of   village   mayor. 7KHIRUPHU1HZ<RUN&LW\ÂżUHÂżJKWHUVDLG she  sees  the  position  as  a  consideration  for  part-­ WLPH HPSOR\PHQW )LW]SDWULFN VDLG KHU H[SHUL-­ ence  on  different  boards  and  an  understanding   of   â&#x20AC;&#x153;the   basics   of   budgets,â&#x20AC;?   in   addition   to   her  

ZRUNDVDÂżUHÂżJKWHUKDVSUHSDUHGKHUWREHWKH next  mayor  of  the  village. â&#x20AC;&#x153;Challenges   in   the   village   require   sus-­ tained   and   concentrated   effort,â&#x20AC;?   she   said.   â&#x20AC;&#x153;I   ZLOOGRP\EHVWWRSURPRWHZKDWLVZRUNLQJDQG [be]  strong  enough  to  initiate  changes  necessary   for  New  Paltzâ&#x20AC;&#x2122;s  continued  growth.â&#x20AC;? )LW]SDWULFN%ODEHUDQGRWKHUVLQWHUHVWHGLQ EHFRPLQJWKHPD\RURI1HZ3DOW]FRXOGWDNHRQ the  incumbent  Dungan,  who  said  he  is  running   for   the   same   reasons   he   did   nearly   four   years   ago   â&#x20AC;&#x201C;   to   ensure   that   the   village   is   â&#x20AC;&#x153;well   man-­ aged.â&#x20AC;? In   2007,   Dungan   defeated   former   Mayor   Jason  West  for  the  position.  The  mayor  said  that   he   would   continue   to   better   relations   between   the  village  and  the  Town  of  New  Paltz,  which   KHVDLGKDGLPSURYHGVLQFHKHWRRNRIÂżFH Dungan   said   major   challenges   the   next   mayor   of   the   village   could   face   are   related   to   environmental  issues  and  the  economy,  having  

Thursday,  December  2,  2010

VDLG WKDW NHHSLQJ WKH YLOODJH IXQFWLRQLQJ ZLWK a   reasonable   level   of   service   without   increas-­ LQJH[SHQVHVLVJRLQJWREHÂłUHDOO\GLIÂżFXOWDOO around.â&#x20AC;? Âł3HRSOH KDYH VSRNHQ WR PH DERXW WKHLU economic  circumstances  at  home,â&#x20AC;?  he  said.  â&#x20AC;&#x153;We   just  canâ&#x20AC;&#x2122;t  increase  the  budget.â&#x20AC;?   According  to  Dungan,  any  village  resident   18   years   of   age   or   older   is   eligible   to   vote   at   the  polling  place  in  Village  Hall.  The  elections   DUHKHOGLQGHSHQGHQWO\IURPWKH8OVWHU&RXQW\ Board  of  Elections.  Anyone  registered  and  eli-­ gible  to  vote  in  the  village  can  run  for  mayor.   Dungan   said   mayoral   elections   are   held   every   four  years,  and  three  seats  on  the  Village  Board   of  Trustees  will  also  be  up  for  grabs  this  year.   Those   interested   in   running   for   mayor   PXVWKDYHQRPLQDWLRQSHWLWLRQVVLJQHGE\ÂżYH percent   of   the   voters   who   cast   their   ballots   in   the  last  election,  Dungan  said.  This  process  will   begin  in  March.  


Pg 4

NEWS

News Briefs

The  New  Paltz  Oracle

Appeals  Approved  in  Student  Senate

National   House  Republicans  have  temporar-­ ily  blocked  legislation  to  feed  school   meals  to  thousands  more  hungry   children. Republicans  used  a  procedural  ma-­ neuver  Wednesday  to  try  to  amend   the  $4.5  billion  bill,  which  would  give   more  needy  children  the  opportunity   to  eat  free  lunches  at  school  and  make   those  lunches  healthier.  First  Lady  Mi-­ chelle  Obama  has  lobbied  for  the  bill   as  part  of  her  â&#x20AC;&#x153;Letâ&#x20AC;&#x2122;s  Moveâ&#x20AC;?  campaign   to  combat  childhood  obesity. ***** Sponsors  of  Californiaâ&#x20AC;&#x2122;s  same-­sex   marriage  ban  on  Wednesday  asked  one   of  the  judges  from  the  appeals  court   panel  that  will  hear  arguments  on  the   measureâ&#x20AC;&#x2122;s  constitutionality  next  week   to  remove  himself  from  the  case. ,QSDSHUVÂżOHGZLWKWKHWK86&LUFXLW Court  of  Appeals  in  San  Francisco,   lawyers  for  Proposition  8â&#x20AC;&#x2122;s  support-­ ers  said  Judge  Stephen  Reinhardtâ&#x20AC;&#x2122;s   â&#x20AC;&#x153;impartiality  might  reasonably  be   questionedâ&#x20AC;?  because  his  wife  heads   the  Southern  California  chapter  of  the   American  Civil  Liberties  Union. ***** Nearly  50,000  prison  inmates  claimed   more  than  $130  million  in  tax  refunds   this  year  without  providing  any  wage   information  to  the  IRS,  a  government   investigator  says  in  a  report  to  be   released  Thursday. The  Treasury  inspector  general  for  tax   administration  stops  short  of  saying  the   refunds  were  fraudulently  claimed.  It   does,  however,  say  the  Internal  Rev-­ enue  Service  should  investigate  further.   International  Briefs  on  Page  5

PHOTO  BY  LAURA  LUENGAS

Two  appeals  made  by  Student  Association  President  Jennifer  Sanchez  and  the  Recycling  Club  were  approved  by  the  student  senate. By  Pamela  Vivanco Copy  Editor  |  Pvivanco57@newpaltz.edu

The   50th   student   senate   approved   two   appeals  at  its  Nov.  30  general  meeting. The  legislative  body  approved  an  appeal   made  by  Student  Association  (SA)  President   Jennifer  Sanchez  regarding  Mr.  New  Paltz:  A   Male  Beauty  Pageant,  an  event  aimed  to  raise   money  for  The  Pakistan  Relief  Effort. Sanchez   explained   that   she   planned   to   appeal   before   the   Programming   Board   on   Wednesday  for  event  funds  in  hopes  that  she   would  have  a  clear  idea  by  then  of  how  much   money   was   going   to   be   spent   and   have   the   paperwork  in  a  week  in  advance.  But  due  to   Thanksgiving  break,  the  Programming  Board   meeting  was  rescheduled  for  Nov.  29. â&#x20AC;&#x153;I   didnâ&#x20AC;&#x2122;t   meet   with   my   candidates.   I   didnâ&#x20AC;&#x2122;t   even   know   who   my   candidates   were   until   [Tuesday]   so   thereâ&#x20AC;&#x2122;s   no   way   I   could   have   presented   for   the   Programming   Board  

[on  Monday],â&#x20AC;?  said  Sanchez. 6L[FDQGLGDWHVZHUHFRQÂżUPHGWRSDUWLF-­ ipate  in  the  pageant  on  Tuesday  and  Sanchez   said  she  would  need  $45  for  media  technolo-­ gy,  and  an  additional  amount  for  decorations   for  the  events  and  props  for  candidates. The   senate   voted   to   reimburse   Sanchez   as  long  as  she  does  not  spend  over  $300  with   the   stipulation   that   she   provide   a   clear   ac-­ count  of  how  she  spent  the  money. The   legislative   body   also   approved   an   appeal   made   by   Recycling   Club   President   Lauren  Brois  regarding  funds  to  provide  food   at  the  clubâ&#x20AC;&#x2122;s  Dec.  7  Sustainable  Craft  Fair. In   an   effort   to   provide   food   at   the   fair   from   local   vendors   that   have   at   least   some   local  and  organic  ingredients,  Brois  said  the   Recycling  Clubâ&#x20AC;&#x2122;s  line  item  requested  $202.64   to  spend  at  Main  Course  and  Rock  da  Pasta.   The  $202.64  was  originally  rejected  by   the  Budget  and  Finance  Committee. â&#x20AC;&#x153;We   are   just   appealing   the   denial   be-­

cause   we   feel   that   offering   free   food   really   makes  an  event  have  a  lot  more  people  go  to   it,â&#x20AC;?  said  Brois. Because   they   are   expecting   about   200   people   to   attend   the   event,   instead   of   the   original  request,  Brois  appealed  for  $202.64   to  get  pizza  for  the  event  â&#x20AC;&#x153;maybe  from  Rinoâ&#x20AC;&#x2122;s   because  they  have  some  green  business  tech-­ niques.â&#x20AC;?   Vice   President   of   Finance   Youssouf   Kouyo  said  he  denied  Recycling  Clubâ&#x20AC;&#x2122;s  orig-­ inal  request  because  the  fair  was  expected  to   be  a  big  event  and  including  food  might  have   been   â&#x20AC;&#x153;messyâ&#x20AC;?   and   not   everybody   would   be   able  to  get  food.   Although   some   senators   agreed   with   Kouyo,   the   club   was   approved   the   funds   to   get  pizza  for  the  event.   The  next  general  student  senate  meeting   will   be   held   on   Tuesday,   Dec.   7   in   Student   Union  418.

Judicial  Board  Suggests  Bylaw  Amendments By  Pete  Thompson Copy  Editor  |  Pthompson51@newpaltz.edu

The   campus   judicial   board   recently   made  suggestions  to  the  student  senate  re-­ garding   possible   bylaws   to   avoid   appeals   similar   to   ones   that   were   made   over   the   past  few  weeks. These   suggestions   were   made   in   hopes  of  resolving  problems  and  miscom-­ munication  over  budgeting  for  conference   DWWHQGDQFH DQG WKH KDQGOLQJ RI ÂżQDQFHV raised  for  charities. â&#x20AC;&#x153;There   havenâ&#x20AC;&#x2122;t   been   any   bylaw   amendments   passed   yet,â&#x20AC;?   said   Chief   Jus-­ tice   of   the   Judicial   Board   Travis   Nanek.   â&#x20AC;&#x153;It   has   to   be   approved   by   the   whole   sen-­ ate.â&#x20AC;? Discussion   was   sparked   in   regard   to   the   conference   budget   after   two   separate   groups,   each   planning   to   attend   the   2010  

American   Speech-­Language-­Hearing   As-­ sociation  Convention,  presumed  they  had   the   entire   maximum   $1,800   per   confer-­ ence  limit  to  utilize. Nanek   said   a   major   cause   of   the   dis-­ crepancy  was  the  lack  of  a  Vice  President   RI )LQDQFH LQ RIÂżFH DW WKH WLPH EXW WKH board  still  thought  of  ways  around  it. â&#x20AC;&#x153;The  judicial  board  had  suggested  â&#x20AC;Ś   that   the   senate   possibly   think   of   another   line   in   the   budget   to   deal   with   presenters   and  non-­presenters,â&#x20AC;?  he  said. Thereâ&#x20AC;&#x2122;s   currently   only   one   line,   but   implementing   another   would   allow   for   each  group  to  have  a  different  limit. The   second   appeal   that   bylaws   have   been   in   talks   about   is   the   problem   that   arose   with   charity   funds   raised   by   Invis-­ ible  Children. Suggestions  were  made  to  perfect  the   procedure   to   ensure   that   money   is   still  

Thursday,  December  2,  2010

there  in  the  Student  Associationâ&#x20AC;&#x2122;s  posses-­ sion  if  anyone  quits,  and  clarifying  who  it   will  be  sent  to.  They  also  wanted  to  allow   the   actual   organization   to   communicate   with  the  charity. â&#x20AC;&#x153;[The  judicial  board  suggested]  to  al-­ ways  make  sure  that  a  letter  is  in  the  busi-­ QHVV RIÂżFH VD\LQJ ZKR WKH PRQH\ JRHV out  to  and  how  much  money,â&#x20AC;?  Nanek  said,   â&#x20AC;&#x153;and  this  will  be  sent  with  the  money.  We   have   a   dispersing   agent   whoâ&#x20AC;&#x2122;s   supposed   to  be  sending  these  things  out,  but  howâ&#x20AC;&#x2122;s   she  supposed  to  send  it  out  if  she  doesnâ&#x20AC;&#x2122;t   know  where  to  send  it?â&#x20AC;? Although  these  suggestions  have  been   made,  the  amending  of  appropriate  bylaws   is   ultimately   up   to   the   senate,   with   the   writing  being  a  very  meticulous  process. â&#x20AC;&#x153;One   word   can   change   the   entire   meaning  of  a  bylaw,â&#x20AC;?  SA  President  Jenni-­ fer  Sanchez  said.


The  New  Paltz  Oracle

NEWS

Council  Talks  Policy  and  Pageantry By  Pete  Thompson Copy  Editor  |  Pthompson51@newpaltz.edu

At  the  last  Council  of  Organizations  meet-­ ing,   held   on   Monday,   Nov.   29   at   7:30   p.m.   in   Student   Union   (SU)   62/63,   feedback   was   re-­ ceived  on  the  drug  policy. Vice   President   of   Academic   Affairs   and   Governance   Caitlin   Ryan   began   by   inquiring   whether  or  not  the  council  would  be  interested   in   looking   at   legislation   under   analysis   by   the   Student  Association  (SA)  to  create  a  system  of   checks   and   balances.   She   then   addressed   the   legislation  recently  passed  by  senate  discussing   WKHGUXJSROLF\RSHQLQJWKHĂ&#x20AC;RRUWRUHSUHVHQWD-­ tives  for  any  opinions,  questions  or  concerns. â&#x20AC;&#x153;As  the  policy  stands  right  now,â&#x20AC;?  she  said,   â&#x20AC;&#x153;â&#x20AC;Śwe   have   the   most   strict   standard   in   the   SUNY  system.â&#x20AC;? According   to   Ryan,   SUNY   New   Paltz   updated   its   one-­strike   policy   for   marijuana   in   the  80s,  but  still  remains  more  strict  due  to  the   schoolâ&#x20AC;&#x2122;s  reputation. â&#x20AC;&#x153;[Rather   than   your   personal   or   moral  

stance,]   think   about   how   you   want   the   school   to   view   doing   drugs,â&#x20AC;?   Sen.   Marc   Pottak   said.   â&#x20AC;&#x153;[Tell  us]  what  you  want  to  see  the  policy  be-­ come  and  weâ&#x20AC;&#x2122;ll  try  to  come  to  a  middle  ground   on  it.â&#x20AC;? The   general   consensus   found   the   New   Paltz   exclusive   two   strike   rule   to   be   fairly   harsh,  and  many  believe  it  should  either  be  the   same  as  other  schools,  or  possibly  have  a  strike   substituted  for  community  service. Once  the  discussion  ended,  Council  Chair   Shayna  Bentley  said  that  Winterfest  will  be  tak-­ ing   place   on   Sunday,   Dec.   5   at   5   p.m.   in   the   Student   Unionâ&#x20AC;&#x2122;s   (SU)   Multi-­Purpose   Room   (MPR).  The  festival  will  feature  a  number  of  lo-­ cal  town  and  campus  musicians  and  slam  poets. â&#x20AC;&#x153;It   will   be   a   nice   intro   to   a   lot   of   genres   of   music,â&#x20AC;?   New   Paltz   Comics   Unleashed   rep-­ resentative  Kevin  Kleeman  said.  â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re  really   making  it  all  for  you,  so  please  come  check  it   out.â&#x20AC;? SA  President  Jennifer  Sanchez  was  next  to   address  the  council,  informing  all  that  her  Paki-­ stan  relief  effort,  the  Mr.  New  Paltz  fundraiser,  

will  be  taking  place  on  Wednesday,  Dec.  8  at  9   p.m.  in  SU  MPR.  Anyone  can  attend,  and  she  is   still   looking   for   any   willing   participants.   This   will  entail  a  talent,  swimsuit,  formal  dress  and   orange  and  blue  segments. After   Coakleyâ&#x20AC;&#x2122;s   reminder,   Bentley   ad-­ dressed  the  council  again,  informing  that  sheâ&#x20AC;&#x2122;ll   be   meeting   with   the   two   club   sports   advisors   to  make  stronger  connections,  and  that  a  roster   will  be  required  for  any  SA  funded  trips.  This   will  entail  a  full  list  of  names,  phone  numbers   and  banner  IDs. 0DU\2Âś/HDU\WKHQWRRNWKHĂ&#x20AC;RRUGLVFXVV-­ ing  the  upcoming  car  sharing  program  on  cam-­ pus.   This   addition   will   provide   students   with   the  opportunity  to  rent  a  Toyota  Prius  or  RAV-­4   by  signing  either  out  online. 7RFRQFOXGHWKHVHPHVWHUÂśVÂżQDOPHHWLQJ Vice   President   of   Finance   Youssouf   Kouyo   reminded   all   representatives   of   the   mandatory   paperwork   training   sessions   heâ&#x20AC;&#x2122;ll   be   holding.   These  will  take  place  on  Thursday,  Feb.  4  from   6:30  to  7:30  p.m.  or  7:30  to  8:30  p.m.,  and  Fri-­ day,  Feb.  5  from  4  to  5  p.m.

NYPIRG  Targets  Phthalate-­Laced  Toys By  Jaleesa  Baulkman Contributing  Writer  |  N02015275@newpaltz.edu

New  York  Public  Interest  Research  Group  (NYP-­ IRG)  chapters  from  the  SUNY  New  Paltz  and  Purchase   College  presented  the  groupâ&#x20AC;&#x2122;s  25th  annual  â&#x20AC;&#x153;Trouble  in   Toylandâ&#x20AC;?  report,  which  found  that  unsafe  toys  are  still   available  for  purchase  in  many  American  stores. The  group  presented  its  November  2010  toy  safe-­ W\ VXUYH\ ÂżQGLQJV RQ 1RY  LQ 6WXGHQW 8QLRQ  right  before  the  beginning  of  one  of  the  busiest  shop-­ ping  seasons  in  America. NYPIRG  members  like  Ilana  Wexler,  a  third-­year   sociology  major  with  a  concentration  in  human  servic-­ es,  hope  the  report  will  â&#x20AC;&#x153;call  for  higher  regulation  in  the   toy  industry.â&#x20AC;? This  yearâ&#x20AC;&#x2122;s  report  emphasized  two  toxic  hazards   that  were  mentioned  in  the  U.  S.  Congressâ&#x20AC;&#x2122;  2008  Con-­ sumer   Product   Safety   Improvement  Act   that   was   put   PHOTO  COURTESY  OF  WAKEMEDVOICES.ORG into  effect  this  year. NYPIRGâ&#x20AC;&#x2122;s  â&#x20AC;&#x153;Trouble  in  Toylandâ&#x20AC;?  report   NYPIRGâ&#x20AC;&#x2122;s   annual   report   revealed   the   results   of   laboratory  tests  conducted  by  the  United  States  Public   found  that  the  Dora  the  Explorer  backpack   Interest   Research   Group   on   toys   for   toxic   chemicals,   contained  phthalates. LGHQWLÂżHGWR\VWKDWSRVHGFKRNLQJKD]DUGVDQGRIIHUHG (CPSC),  a  federal  agency  established  during  adminis-­ tration   of   then-­president   Richard   Nixon,   according   to   tips  to  consumers  about  shopping  safely.   The  report  listed  a  few  toys  that  contain  or  are  sus-­ the  report. The  report  said  the  act  expanded  CPSCâ&#x20AC;&#x2122;s  budget   pected  of  containing  harmful  chemicals  or  pose  a  threat   and   endowed   it   with   more   power   to   issue   recalls   of   to  a  childâ&#x20AC;&#x2122;s  welfare. $FFRUGLQJ WR 1<3,5*ÂśV ÂżQGLQJV WKHUH DUH VWLOO products   and   hold   corporate   wrongdoers   accountable.   many  childrenâ&#x20AC;&#x2122;s  products,  such  as  the  Dora  the  Explorer   Within  the  last  year,  CPSC  has  recalled  more  than  half   backpack,  that  contain  phthalates,  toxic  chemicals  used   a   million   toys   for   violation   of   the   lead   paint   standard   as   plastic   softeners   that   can   be   absorbed   through   the   on  childrenâ&#x20AC;&#x2122;s  products,  which  was  banned  in  the  Con-­ skin,   inhaled   or   ingested.   Some   of   the   chemicalâ&#x20AC;&#x2122;s   ad-­ sumer   Product   Safety   Improvement  Act   according   to   verse  health  effects  include  early  onset  puberty  in  girls   the  report. â&#x20AC;&#x153;The  CSPC  is  doing  a  good  job  under  its  expand-­ and  lower  sperm  count  in  boys,  according  to  the  report. These   issues   were   addressed   in   2008   with   the   ed  authority,â&#x20AC;?  said  Ryan  Long,  the  project  coordinator   &RQVXPHU 3URGXFW 6DIHW\ ,PSURYHPHQW $FW WKH ÂżUVW for   the   SUNY   New   Paltz   chapter   of   NYPIRG.   â&#x20AC;&#x153;But   overhaul  of  the  Consumer  Product  Safety  Commission   there  is  still  more  work  to  be  done,  especially  when  it  

comes   to   eliminating   choking   hazards   and   regulating   tens  of  thousands  of  chemicals  that  are  in  toys  that  our   children  play  with  every  day.â&#x20AC;? NYPIRG  has  announced  the  circulation  of  a  peti-­ tion  to  the  CPSC  to  expand  small  parts  tests  to  better   protect  toddlers  from  choking. In   2009,   as   a   result   of   the   Consumer   Product   Safety  Improvement  Act,  a  ban  was  put  in  place  on  toys   and  children  products  that  contained  more  than  0.1  per-­ cent  of  phthalates.  Despite  the  ban,  however,  NYPIRG   found  childrenâ&#x20AC;&#x2122;s  products  that  contained  concentrations   of  phthalates  up  to  30  percent.  The  report  found  this  to   be  a  concern  because  children  are  particularly  vulner-­ able  to  chemicals  that  could  affect  proper  development. NYPIRG  presented  Trouble  in  Toyland  in  hopes   of   increasing   public   awareness   about   toys   that   have   been  labeled  unsafe  for  children  as  well  as  which  local   stores  have  been  selling  these  toys. â&#x20AC;&#x153;What   we   are   trying   to   do   is   come   to   the   point   where  this  [CPSC]  is  no  longer  needed  for  the  protec-­ tion  of  children,â&#x20AC;?  said  Kevin  Stump,  the  project  coor-­ dinator  for  the  Purchase  College  chapter  of  NYPIRG. Stump  and  Long  found  questionable  toys  in  a  few   stores  in  Fishkill,  New  Paltz,  Poughkeepsie  and  White   Plains. Long   found   the   toyset   Babyâ&#x20AC;&#x2122;s   First   Train-­Lok-­ mock  Train  and  Building  Blocks  in  Enchanted  Toys,  a   toy  store  in  New  Paltz.  Stump  found  three  questionable   toys  in  six  stores.  One  of  those  toys  was  Fisher  Priceâ&#x20AC;&#x2122;s   Letâ&#x20AC;&#x2122;s   Get   Building!   Construction   Play-­set,   which   was   found  in  Toysâ&#x20AC;?Râ&#x20AC;?Us  and  Target,  both  located  in  Pough-­ keepsie,  and  Walmart  in  Fishkill. NYPIRGâ&#x20AC;&#x2122;s   â&#x20AC;&#x153;Trouble   in   Toylandâ&#x20AC;?   report   has   of-­ fered   safety   guidelines   for   purchasing   toys   for   small   children  for  a  quarter  of  a  century,  and  have  led  to  at   least   150   recalls   and   other   regulatory   action   over   the   years,  said  Long.

Thursday,  December  2,  2010

Pg 5

World Briefs International   Two  more  walls  have  given  way  inside   Pompeiiâ&#x20AC;&#x2122;s  2,000-­year-­old  archaeologi-­ FDOVLWH,WDOLDQRIÂżFLDOVVDLG:HGQHV-­ day  â&#x20AC;&#x201D;  the  second  collapse  at  the   popular  tourist  attraction  in  as  many   days. 2IÂżFLDOVVRXJKWWRSOD\GRZQWKH latest  collapses,  saying  they  only   concerned  the  upper  parts  of  two  walls   that  had  no  artistic  value.  But  the   repeated  damage  at  one  of  the  worldâ&#x20AC;&#x2122;s   most  important  archaeological  sites  is   proving  an  embarrassment  for  Italy,   and  giving  credence  to  accusations   that  the  entire  ancient  city  is  in  a  state   of  decay. ***** The  retired  British  couple  were  sail-­ ing  the  world  on  a  38â&#x20AC;&#x201C;foot  yacht  that   represented  most  of  their  life  savings   when  Somali  pirates  captured  them   last  year,  demanding  the  sort  of  huge   ransom  a  multimillionaire  or  a  multi-­ national  company  might  cough  up. The  fact  that  Paul  and  Rachel  Chan-­ dler  couldnâ&#x20AC;&#x2122;t  pay  a  big  ransom  helped   stretch  out  their  ordeal  388  agoniz-­ ing  days  â&#x20AC;&#x201D;  until  Sunday,  when  they   were  released  thin  and  exhausted,  but   smiling.  It  was  one  of  the  longest  and   most  dramatic  hostage  situations  since   the  Somali  piracy  boom  began  several   years  ago.   Compiled  from  the  AP  Newswire


Pg 6

NEWS

The  New  Paltz  Oracle

7  Key  Points Union  Urges  College  to  Utilize  Reserves The  UUP  New  Paltz  Chapter

By  Julie  Mansmann

Editor-­in-­Chief  |  Jmansmann60@newpaltz.edu

Members   of   the   SUNY   New   Paltz   chap-­ ter  of  the  United  University  Professions  (UUP)   recently  called  for  college  administrators  to  uti-­ lize  reserve  funds  in  order  to  save  faculty  posi-­ tions  and  curb  cuts  that  could  be  introduced  as   WKHFROOHJHFRSHVZLWKDPLOOLRQGHÂżFLW New  Paltz  UUP  Chapter  President  Richard   Kelder  and  Vice  President  for  Academics  Peter   Brown  were  joined  by  the  secretary  of  the  state   branch  of  UUP,  Eileen  Landy,  and  other  union   members   last   week   when   they   released   their   RIÂżFLDO VWDWHPHQW UHJDUGLQJ WKH EXGJHW SODQ-­ ning   process.   In   their   seven-­point   statement,   UUP   members   said   administrators   should   do   everything  in  their  power  to  avoid  elimination   of  programs  and  personnel  as  they  take  sugges-­ tions  and  make  decisions  on  how  to  reduce  the   collegeâ&#x20AC;&#x2122;s  economy  in  light  of  the  shortfall.   Kelder  said  cuts  in  state  support  have  led   to   academic   programs   being   phased   out   and   jobs  to  be  lost  at  schools  like  SUNY  Albany  and   SUNY  Geneseo,  and  he  hopes  similar  choices   will  not  be  made  at  SUNY  New  Paltz.   â&#x20AC;&#x153;Public  higher  education  is  a  public  good,   and  it  is  under  attack,â&#x20AC;?  Kelder  said.       Brown  said  the  school  could  keep  â&#x20AC;&#x153;every   single  program  and  employee  hereâ&#x20AC;?  if  they  used   millions   of   dollars   in   reserve   funds   stored   in   over  400  accounts. Though   he   said   he   does   not   know   how   much   funding   is   available   and   if   that   money   could  legally  be  used,  Brown  said  the  time  to   use  â&#x20AC;&#x153;rainy  dayâ&#x20AC;?  funds  for  emergencies  is  now.   â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s   not   only   raining,   itâ&#x20AC;&#x2122;s   pouring,â&#x20AC;?   he   said.   However,   Vice   President   of   Finance   and   Administration  Jackie  DiStefano  said  cash  bal-­ ances  and  all  related  revenue  and  expenditures   are  maintained  in  individual  accounts  for  sepa-­ rate  activities  and  purposes  to  comply  with  cer-­ tain  policies  and  mandates.   DiStefano  said  administrators  believe  UUP   members   and   others   are   focusing   on   the   cash   balances  that  exist  at  a  given  point  in  time  in  a   myriad  of  accounts  that  comprise  the  schoolâ&#x20AC;&#x2122;s   Income  Fund  Reimbursable  (IFR)  Fund,  State   University  Tuition  Reimbursable  Account  (SU-­ 75$  )XQG WKH 6875$ 2YHUĂ&#x20AC;RZ )XQG DQG the   Core   Instructional   Budget   Stabilization   Fund.   (DFKRIWKHVHIXQGVVHUYHVVSHFLÂżFSXUSRV-­ es.  DiStefano  said  administrators  feel  that  using   these  funds  as  a  long  term  solution  to  the  budget   imbalance  would  be  â&#x20AC;&#x153;short-­sighted.â&#x20AC;? â&#x20AC;&#x153;We  respectfully  disagree  with  the  unionâ&#x20AC;&#x2122;s   opinion   that   cash   in   every   IFR   and   SUTRA  

account   should   be   used   to   â&#x20AC;&#x2DC;stabilizeâ&#x20AC;&#x2122;   our   core   LQVWUXFWLRQDO EXGJHW´ VKH VDLG Âł>,WÂśV@ ÂżVFDOO\ irresponsible.â&#x20AC;?   According   to   DiStefano,   the   UUP   mem-­ bers  are  referring  to  the  $6.2  million  in  central   cash  balances  available  in  the  IFR  and  SUTRA   funds   that   are   managed   in   accordance   with   681< SROLFLHV 1HZ <RUN 6WDWH ÂżQDQFH ODZ DQG WKH 2IÂżFH RI WKH 6WDWH &RQWUROOHU UHJXOD-­ tions.  All  accounts  also  have  a  campus  manager   and  signatory.   The  SUTRA  fund  is  a  â&#x20AC;&#x153;special  fundâ&#x20AC;?  dedi-­ cated   to   campus   operations   funded   from   and   in   support   of   tuition   revenue   collected   from   our   summer   session   programs,   school   of   edu-­ cation   contract   courses   and   fees   received   for   students  to  participate  in  the  overseas  academic   programs,   DiStefano   said.   She   also   said   the  

â&#x20AC;&#x153;New  Paltz  is   one  symptom   of  a  pretty  bad   diseaseâ&#x20AC;?  â&#x20AC;&#x201D;  Eileen  Landy

IFR  fund  is  a  self-­supported  fund  dedicated  to   VSHFLÂżF FDPSXV RSHUDWLRQV DQG DFWLYLWLHV DQG funded  from  revenues  generated  by  these  pro-­ grams  and  student  fees.  These  funds  are  spent   LQVXSSRUWRIWKHVSHFLÂżFSXUSRVHIRUZKLFKWKH revenue   is   generated,   she   said.   IFR   accounts   include  technology,  course,  health,  application   and  late  payment  fees,  among  others.   Brown  cited  some  IFR  accounts  as  being   earmarked   by   administrators   for   certain   pur-­ poses,   who   he   said   would   â&#x20AC;&#x153;rather   see   us   cut   personnelâ&#x20AC;?   than   use   these   funds.   He   said   he   feels  administrators  should  be  more  forthcom-­ ing  about  how  these  funds  can  be  used  and  how   much  money  is  available.   â&#x20AC;&#x153;This  information  should  be  made  public,â&#x20AC;?   Brown  said.  â&#x20AC;&#x153;There  are  a  number  of  ways  these   funds   are   used,   but   this   is   not   totally   clear   to   us.â&#x20AC;? But   DiStefano   said   students   have   a   right   to  have  those  funds  designated  for  the  purposes   they  were  told  they  were  for,  and  they  should   not  to  be  diverted  into  the  collegeâ&#x20AC;&#x2122;s  core  operat-­ ing  budget.

The   administrator   said   members   of   the   campus  community  should  remember  that  these   kinds  of  cash  reserves  are  available  â&#x20AC;&#x153;one  timeâ&#x20AC;?   in  that  once  these  funds  are  spent,  they  are  gone   and  without  replenishment. â&#x20AC;&#x153;It  is  not  a  source  of  cash  that  can  provide   a  sustainable  or  ongoing  â&#x20AC;&#x2DC;plugâ&#x20AC;&#x2122;  in  the  gap  be-­ tween  revenue  and  expenses.  And  as  our  reve-­ nue  continues  to  diminish,  so  does  our  ability  to   generate   reserves,â&#x20AC;?   DiStefano   said.   â&#x20AC;&#x153;We   must   take  action  to  reduce  our  expenditures.â&#x20AC;? The  level  of  these  balances  is  reviewed  by   the   Middle   States   Commission   as   part   of   the   ÂżVFDOFRPSRQHQWRIWKHUHDFFUHGLWDWLRQSURFHVV that   is   underway   at   SUNY   New   Paltz.   DiSte-­ fano   said   a   review   of   guidelines,   policies   and   procedures  from  other  educational  and  business   sources,  including  the  National  Association  of   &ROOHJH DQG 8QLYHUVLW\ %XVLQHVV 2IÂżFHUV DQG WKH *RYHUQPHQWDO )LQDQFLDO 2IÂżFHUV$VVRFLD-­ tion   in   conjunction   with   guidance   from   inde-­ pendent  auditors  and  bond  rating  agencies  sug-­ gest  that  an  appropriate  level  of  unrestricted  net   cash  reserves  would  be  25  percent  of  operating   expenses  or  the  equivalent  of  three  months  of   expenses.  If  this  percentage  were  to  be  applied   to  SUNY  New  Paltz  operating  expenses,  DiS-­ tefano  said  a  reserve  of  approximately  $18  mil-­ lion  should  be  maintained. DiStefano   said   administration   does   not   hold  excess  cash  balance  that  can  be  spent  with-­ out  great  thought,  and  that  heavy  considerations   should   be   weighed   when   deciding   if   dipping   into  this  funding  is  necessary. â&#x20AC;&#x153;Maintaining   adequate   reserves   is   essen-­ WLDOWRHVWDEOLVKLQJÂżQDQFLDOVWDELOLW\´VKHVDLG â&#x20AC;&#x153;It  is  critical  that  a  campus  maintain  adequate   UHVHUYHVWRHQVXUHLWVORQJWHUPÂżQDQFLDOYLDELO-­ ity   and   the   sustainability   of   the   programs   we   provide.â&#x20AC;? However,  members  of  the  union  said  they   IHHO WKDW EHFDXVH VWDWH RIÂżFLDOV KDYH GHFLGHG not  to  invest  in  the  future  of  public  education,  a   serious  situation  affecting  the  future  of  SUNY   students  developed  and  this  funding  should  be   considered. â&#x20AC;&#x153;SUNY  is  being  attacked  across  the  state,â&#x20AC;?   Landy   said.   â&#x20AC;&#x153;New   Paltz   is   one   symptom   of   a   pretty  bad  disease.â&#x20AC;? Members  of  the  union  at  SUNY  New  Paltz   will   be   sending   a   letter   to   Interim   President   Donald  Christian  with  questions  and  concerns   regarding   the   budget   planning   process,   which   was  signed  by  multiple  departmental  chairs  and   faculty  members.  Administrators  said  the  cam-­ pus  community  can  log  on  to  budget.newpaltz. edu  throughout  the  academic  year  for  updates.

Thursday,  December  2,  2010

Budget  Statement   Written  by  the  Executive  Committee

1.  In  the  short  term,  SUNY  should   draw  on  its  reserves  to  stabilize  the   university  system.   2.  New  York  State  urgently  needs   to  reserve  underfunding  SUNY   and  increase  the  stateâ&#x20AC;&#x2122;s  support  for   public  higher  education.     3.  Accessibility  to  SUNY  and   diversity  should  be  maintained   through  a  tuition  policy  that  does   not  shut  out  students  of  color  and   RWKHUÂżUVWJHQHUDWLRQFROOHJHDSSOL-­ cants,  whose  numbers  have  drasti-­ cally  decreased  in  recent  years.     4.  New  York  State  needs  to  re-­ establish  a  fairer,  more  progressive   tax  structure,  so  that  the  wealthiest   citizens  once  again  pay  their  share   of  responsibility  pay  their  share  of   responsibility  for  the  public  good.   5.  At  the  federal  level,  we  need  to   realign  priorities  to  strengthen  the   support  for  public  higher  education   across  the  country.   6.  We  need  visionary  leadership   for  the  SUNY  chancellor  and  the   Legislature,  which  should  strongly   support,  rather  than  undermine   SUNYâ&#x20AC;&#x2122;s  mission.   7.  In  view  of  the  recent  program   cuts  at  SUNY  Albany,  we  need  to   DIÂżUPWKHWUDGLWLRQDOLPSRUWDQFHRI the  humanities  for  a  liberal  educa-­ tion  by  restoring  and  strengthening   programs  in  foreign  languages,  the   classics  and  philosophy.  


The  New  Paltz  Oracle

NEWS

Pg 7

New  York  Bans  â&#x20AC;&#x2DC;Blackoutâ&#x20AC;&#x2122;  Beverage

By  Ryan  Patrick  Hanrahan Copy  Editor  |  Rhanrahan13@newpaltz.edu

New   York   has   become   the   latest   state   among   many   to   ban   stimulant-­infused   alcoholic   beverages   like   the   popularized   Four   Loko. The  ban  stems  from  cases  of  alcohol  poisoning  at  institutions   such  as  Ramapo  College  in  New  Jersey  and  growing  concerns  over   the  prevalence  of  Four  Loko,  popularly  known  as  â&#x20AC;&#x153;blackout  in  a   can,â&#x20AC;?  being  consumed  by  underage  drinkers. Four  Loko  and  similar  products  contain  about  12  percent  al-­ cohol  by  volume,  the  equivalent  of  about  three  cans  of  beer.  The   products   also   contain   caffeine,   taurine   and   guarana   which,   along   with  the  alcohol,  create  a  potent,  synergic  beverage. According  to  a  study  by  the  Food  and  Drug  Administration,   consumption  of  chemical  stimulants  such  as  caffeine  and  guarana   PHOTO  COURTESY  OF  FLICKR.COM mask   the   effects   of   alcohol,   a   depressant,   on   the   body.   This   can   cause   consumers   to   think   they   are   less   intoxicated   than   they   ac-­ Stimulant-­infused  alcoholic  beverages  like  Four  Loko  are  not  avail-­ tually   are,   leading   them   to   continue   drinking   even   if   their   blood   able  for  purchase  in  New  York  State  after  Dec.  10. alcohol  content  is  already  at  dangerous  levels. Haughton   said   companies   that   combine   alcohol   and   stimu-­ The  New  York  State  Liquor  Authority  mandated  an  end  to  dis-­ lants  are  primarily  concerned  with  making  money  and  likely  do  not   tribution  of  the  drinks  to  stores  after  Nov.  19.  Stores  will  no  longer   value  the  safety  of  underage  drinkers. carry  the  beverage  after  Dec.  10,  and  stores  found  with  the  drink   â&#x20AC;&#x153;You  still  have  a  developing  brain  in  your  teens,â&#x20AC;?  Haughton   after  this  date  will  be  penalized. said.  â&#x20AC;&#x153;Alcohol  is  toxic  to  the  brain.  [Why]  would  [you]  want  to  add   Mixing  alcohol  with  caffeine  and  other  stimulants  isnâ&#x20AC;&#x2122;t  a  re-­ a  toxin  to  a  brain  that  is  still  in  the  developmental  stage?â&#x20AC;? cent  trend,  however.  Mixing  energy  drinks  such  as  Red  Bull  with   Haughton  believes  protecting  underage  consumers  from  these   alcohol  at  bars  is  common,  and  beverages  such  as  Irish  coffee  have   products   is   a   larger   concern   than   the   loss   fans   of   the   drinks   will   long  been  popular. experience. Peter  Haughton  MD,  director  of  the  University  Health  Service   â&#x20AC;&#x153;As   a   civilized   society,   our   role   is   to   focus   on   and   protect   at  SUNY  New  Paltz  said  he  agrees  with  the  ban. young  people,â&#x20AC;?  Haughton  said.

Second-­year   undeclared   student   Audrey   Brand   is   unhappy   with  New  Yorkâ&#x20AC;&#x2122;s  recent  ban,  but  said  that  due  to  abuse  of  the  drink,   she  understands  why  it  was  put  in  place. â&#x20AC;&#x153;I  think  that  it  sucks,â&#x20AC;?  Brand  said.  â&#x20AC;&#x153;But  I  guess  we  deserve  it   as  part  of  the  general  group  that  is  using  it  so  stupidly.â&#x20AC;? Vijay   Buddiga,   a   second-­year   international   relations   major,   said  although  heâ&#x20AC;&#x2122;s  had  some  bad  experiences  with  Four  Loko,  he   doesnâ&#x20AC;&#x2122;t  believe  it  should  be  banned.  Buddiga  believes  that  by  ban-­ ning  the  drink,  people  will  just  acquire  it  through  other  means,  such   as  buying  it  in  other  states,  and  abuse  of  the  drinks  could  get  worse. â&#x20AC;&#x153;When  people  drink  one  or  two  of  those,  they  get  [intoxicated]   and  do  some  terrible  things,  but  I  donâ&#x20AC;&#x2122;t  think  it  should  be  illegal,â&#x20AC;?   he  said.  â&#x20AC;&#x153;The  more  itâ&#x20AC;&#x2122;s  criminalized,  the  more  dangerous  it  is.â&#x20AC;? Buddiga   also   believed   the   drink   was   a   fad,   and   if   it   hadnâ&#x20AC;&#x2122;t   been  banned,  its  popularity  would  have  eventually  died  out. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s  a  lot  of  hype,  and  itâ&#x20AC;&#x2122;s  a  new  thing  â&#x20AC;Ś  Four  Loko  would   have  died  out  solely  on  the  fact  that  itâ&#x20AC;&#x2122;s  a  terrible  drink  and  some-­ thing  would  have  beaten  it,â&#x20AC;?  Buddiga  said. Emily   Mocha,   a   second-­year   English   major,   said   she   thinks   the  makers  of  Four  Loko  should  change  the  recipe  of  the  product   so  that  it  is  less  dangerous,  and  remarket  it.  However,  she  also  said   she   feels   it   is   the   responsibility   of   the   consumers   to   be   cautious   when  consuming  alcoholic  beverages,  especially  synergistic  drinks   like  Four  Loko. Haughton  said  that  while  drinking  alcohol  in  excess  is  a  bad   idea,  drinking  in  moderation  or  drinking  socially  is  acceptable. He   said   he   believes   beverages   like   Four   Loko   increase   the   prevalence  of  binge  drinking,  which  is  why  he  supports  the  ban. â&#x20AC;&#x153;It  has  to  go,â&#x20AC;?  he  said  of  the  drinks.

NYS  Coastal  Sea  Levels  Projected  to  Rise By  Pamela  Vivanco Copy  Editor  |  Pvivanco57@newpaltz.edu

A  new  report  from  Sea  Level  Rise  Task  Force  predicts  sea   levels  could  rise  more  than  four  feet  in  New  York  State  coastal   areas  over  the  next  70  years. In  its  report,  the  Sea  Level  Task  Force  announced  that  New   York  Harbors  has  experienced  a  sea  level  increase  of  15  inches   within  the  past  150  years.  Since  the  1960s,  harbor  gauges  have   risen  four  to  six  inches. According  to  the  report,  â&#x20AC;&#x153;sea  level  rise  will  have  dramatic   implications  for  New  Yorkâ&#x20AC;&#x2122;s  coastal  communities  and  their  natu-­ ral  resources.â&#x20AC;?  The  report  also  said  that  sea  level  rise  affecting  the   Lower  Hudson  Valley  and  Long  Island  is  projected  to  be  two  to   ÂżYHLQFKHVE\WKHVDQGWRLQFKHVE\WKHHQGRIWKLV century. â&#x20AC;&#x153;However,  rapid  melt  of  land-­based  ice  could  double  these   projections  in  the  next  few  decades,  with  a  potential  rise  of  up  to   55  inches  by  the  end  of  the  century,â&#x20AC;?  the  report  stated. Sociology   Chair   Brian   Obach   said   that   although   little   can   be   done   at   this   point   to   prevent   at   least   some   rise   in   sea   level,   â&#x20AC;&#x153;we  can  take  action  now  to  try  to  prevent  further  increases  in  the   distant   future,   but   what   will   happen   in   the   next   few   decades   is   already  in  motion.â&#x20AC;? The  report  also  found  that  utilities  and  infrastructure  systems   which   modern   society   relies   on   like   sewage,   stormwater,   fuel   storage   and   solid   waste   management   and   transportation   make  

PHOTO  COURTESY  OF  FLICKR.COM

Sea  level  rise  is  projected  between  one  and  two  feet  by  the  end  of  the   century,  a  new  report  from  Sea  Level  Task  Force  said. such  areas  vulnerable  to  rising  sea  levels. â&#x20AC;&#x153;We   have   hundreds   of   miles   of   coast   line   and   the   Hudson   River   estuary   which   is   also   affected   by   sea   level   change,â&#x20AC;?   said   Obach.   â&#x20AC;&#x153;Many   of   these   areas   are   highly   developed-­-­like   New   York  City  and  Long  Island-­-­which  makes  us  especially  vulnerable   to  rising  sea  levels  and  storm  surges  in  coastal  areas.â&#x20AC;? Obach  said  there  are  many  steps  students  can  take  in  their   personal  lives  to  help  prevent  climate  change,  but  the  scale  of  the   crisis  New  York  faces  is  going  to  require  more  than  personal  life-­

Thursday,  December  2,  2010

style  changes.  Political  action  is  required  in  order  to  change  the   policies   that   promote   overconsumption   and   ecological   destruc-­ tion,  he  said. â&#x20AC;&#x153;Anything  that  you  can  do  to  use  less  energy  helps-­-­turn  off   your   computer   when   not   in   use,   donâ&#x20AC;&#x2122;t   leave   lights   on,   walk   or   bike  instead  of  driving,  buy  less  crap  that  you  donâ&#x20AC;&#x2122;t  really  need   anyway,  stop  eating  meat,  recycle,â&#x20AC;?  said  Obach.   Recycling  Coordinator  Lauren  Brois  agreed  with  Obach  and   said  taking  steps  to  directly  decrease  the  creation  of  unnecessary   greenhouse   gases   or   reducing   oneâ&#x20AC;&#x2122;s   â&#x20AC;&#x153;carbon   footprint,â&#x20AC;?   which   is   the   amount   of   greenhouse   gases   produced   by   individuals   or   groups  will  help  prevent  global  climate  change. Brois  said  one  way  to  do  this  is  by  recycling  and  using  less. â&#x20AC;&#x153;By  reusing  something  many  times  you  can  save  energy.  For   example,  one  reusable  coffee  cup  takes  less  energy  to  make  than   many   paper   cups,   and   lessens   the   need   to   harvest   trees   for   the   paper,â&#x20AC;?   said   Brois.   â&#x20AC;&#x153;Reduce:   Use   less   stuff   and   save   energy   â&#x20AC;Ś   Recycle:   by   purchasing   recycled   materials   you   can   prevent   the   use  of  new  materials,  which  need  to  be  mined/harvested  from  the   earth.  Using  recycled  materials  thus  prevents  ecosystem  disrup-­ tion.â&#x20AC;? Although  Obach  recognizes  that  there  are  many  groups  on   campus   doing   work   to   reduce   ecological   impact,   he   said   those   who  are  not  striving  to  be  part  of  the  solution  are  part  of  the  prob-­ lem. â&#x20AC;&#x153;This  is  a  problem  that  will  not  go  away  and  its  impact  will   be  devastating.  It  cannot  be  ignored,â&#x20AC;?  he  said.  â&#x20AC;&#x153;Get  involved.â&#x20AC;?


NEWS

Pg 8

The  New  Paltz  Oracle

Town  of  New  Paltz  Passes  Final  2011  Budget By  Justin  McCarthy 1HZV(GLWRU_Jmccarthy46@newpaltz.edu

The  New  Paltz  Town  Board  passed  the   ¿QDOEXGJHWZLWKRQO\DSHUFHQW LQFUHDVHDIWHUZHHNVRIGHEDWHRYHUKRZWR UHDFKDÃ&#x20AC;DWEXGJHW $OWKRXJK WKH EXGJHW XOWLPDWHO\ KDG DQLQFUHDVHWKHERDUGZDVDEOHWRSUHYHQW FXWWLQJ IXQGLQJ IRU WKH SROLFH GHSDUWPHQW QLJKW GLVSDWFKHU ZKLFK KDG EHHQ D KLJK-­ O\ FRQWHQWLRXV LVVXH WKDW KDG GLYLGHG WKH ERDUG $FFRUGLQJ WR 7RZQ 6XSHUYLVRU 7RQL +RNDQVRQ ZKR KDG YHKHPHQWO\ RSSRVHG FXWWLQJ IXQGLQJ IRU WKH QLJKW GLVSDWFKHU SRVLWLRQVKHPDGHDGHDOZLWKERDUGPHP-­ EHUVZKRZHUHLQIDYRURIFXWWLQJWKHSRVL-­ WLRQ7KHERDUGKDGSUHYLRXVO\YRWHGWR UHPRYHWKHGLVSDWFKHU¶VIXQGLQJIURPWKH EXGJHW EXW UHFRQVLGHUHG DIWHU +RNDQVRQ DJUHHG WR PDNH FXWV LQ RWKHU DUHDV RI WKH EXGJHW ³0\ IHHOLQJ ZDV WKDW DQ\ UHGXFWLRQ

LQ VWDII ZDV JRLQJ WR EH D UHGXFWLRQ LQ VHUYLFHVWRWKHSXEOLFEXWDWWKDWPRPHQW ZKHQ,OHDUQHGWKDWWKHYRWHZDVQRWJRLQJ WRFKDQJH,VWDUWHGVD\LQJµ,ZLOOJLYHXS DQ\RWKHUSHUVRQQHO:KDWGR,QHHGWRGR WRJHWWKLVEDFNLQ"¶´+RNDQVRQVDLG³$QG WKH\VDLGWKH\ZRXOGRQO\WDNHLWIURPSHU-­ VRQQHO , ZRXOG KDYH WR ¿QG SHUVRQQHO WR FXW´ +RNDQVRQ VDLG VKH ZDV DEOH WR ¿QG LQSHUVRQQHOWRFXWIURPWKHEXG-­ JHW 6KH VDLG VKH PDGH URRP IRU WKH GLV-­ SDWFKHUSRVLWLRQE\HOLPLQDWLQJDVHDVRQDO ¿HOG PDLQWHQDQFH SRVLWLRQ UHGXFLQJ D IXOOWLPH SRVLWLRQ LQ WKH FOHUN¶V RI¿FH WR D³KDOIWLPH´SRVLWLRQDQGE\UHYRNLQJDQ DSSURYDO WKDW ZDV RULJLQDOO\ PDGH WR XS-­ JUDGH D MXVWLFH FRXUW HPSOR\HH SRVLWLRQ IURPSDUWWLPHWRIXOOWLPH ³,W PD\ HQG XS UHVXOWLQJ LQ D UHGXF-­ WLRQ RI KRXUV DW WKH MXVWLFH FRXUW EXW WR PH KDYLQJ VRPHERG\ EH LQFRQYHQLHQFHG DERXWZKHQWKH\FDQSD\WKHLUWLFNHWLVDORW OHVV WUDXPDWLF WR WKH FRPPXQLW\ WKDQ QRW

KDYLQJDQLJKWGLVSDWFKHU´VDLG+RNDQVRQ â&#x20AC;&#x153;[The  other  board  members]  accepted  that,   DQG WKH\ SXW WKH GLVSDWFKHU SRVLWLRQ EDFN LQ,WZDVYHU\VWUHVVIXO´ $FFRUGLQJ WR ERDUG PHPEHU .LWW\ %URZQ IXQGLQJ FXWV ZHUH DOVR PDGH WR SHUVRQQHO RI WKH 0RULHOOR SRRO VWDII DQG RWKHU UHFUHDWLRQ SHUVRQQHO 6KH DOVR VDLG +RNDQVRQ IRXQG D  HUURU LQ WKH EXLOGLQJDQGJURXQGVOLQH :KLOH %URZQ ZDV DPRQJ WKH ERDUG PHPEHUV ZKR RULJLQDOO\ YRWHG WR UHPRYH IXQGLQJ IRU WKH QLJKW GLVSDWFKHU SRVLWLRQ VKH VDLG VKH DJUHHG XQGHU WKH FRQGLWLRQ WKDW+RNDQVRQIRXQGRWKHUSHUVRQQHOIXQG-­ LQJWRFXW ³:KDW ZH ZHUH ORRNLQJ IRU ZDV UH-­ GXQGDQFLHV DQG    >WKH GLVSDWFKHU SRVL-­ WLRQ@ ZDV D SODFH ZKHUH ZH WKRXJKW ZH FRXOG PDNH VRPH VDYLQJV´ %URZQ VDLG ³%XW7RQLIHOWVRVWURQJO\WKDWLWQHHGHGWR VWD\LQSODFHDQGVKHZDVZLOOLQJWRPDNH FXWV LQ RWKHU SHUVRQQHO OLQHV WR VDYH WKDW OLQH´

+RNDQVRQ DQG IHOORZ ERDUG PHPEHU 'DYLG /HZLV KDG VSHQW D QLJKW VKLIW ZLWK WKH SROLFH GLVSDWFKHU +RNDQVRQ VDLG VKH IHOWLWZDVLPSHUDWLYHWRNHHSWKHSRVLWLRQ ³$UHGXFWLRQLQ>RWKHU@VHUYLFHVLVQRW JRLQJWREHOLIHWKUHDWHQLQJWKHZD\,EH-­ OLHYHLWZRXOGEHLIZHGLGQRWKDYHDQLJKW GLVSDWFKHU´+RNDQVRQVDLG :KLOHVKHDJUHHGWKHWRZQERDUGKDG VHWWOHG RQ WKH  EXGJHW ZLWK D VKRUW WHUPJRDORIÃ&#x20AC;DWWHQLQJWKHLQFUHDVHIRUWKLV \HDUVKHKRSHVWRGUDZPRUHEXVLQHVVHVWR 1HZ 3DOW] VR WKDW WKH\ FDQ ³LQFUHDVH WKH SRRORIPRQH\´WKHWRZQKDVDQG³JLYHD UHOLHIWRWKHKRPHRZQHUV´ +RNDQVRQ VDLG VKH¶V FXUUHQWO\ ZRUN-­ LQJRQGHYHORSLQJZDWHUDQGVHZHUSODQWV LQ WKH WRZQ¶V ³OLJKW LQGXVWULDO ]RQH´ ,Q WHUPVRIQH[W\HDU¶VEXGJHWKRZHYHUVKH KRSHVWKHWRZQZLOOQRWEHDVSUHVVXUHGWR PDNHFXWV ³0D\EHWKLQJVZLOOEHEHWWHUQH[W\HDU ¿QDQFLDOO\´VDLG+RNDQVRQ³7KDW¶VUHDOO\ ZKDW,¶PEDQNLQJRQ´

ATTENTION  STUDENTS!!! <RXU6SULQJ5HVLGHQFH$ZDLWV<RX HURRY!              

SOUTHSIDE  TERRACE  APARTMENTS OFFERS  SEMESTER  LEASES 6WXGLRRQH WZREHGURRPDSDUWPHQWV +HDWDQG+RWZDWHULQFOXGHG $OODSDUWPHQWVDUHIXUQLVKHG :DONLQJGLVWDQFHWRWKHFROOHJHDQGWRZQ &DOOIRU3ULFHV

SOUTHSIDE  TERRACE  APARTMENTS 4  SOUTHSIDE  AVENUE NEW  PALTZ,  NY  12561 LIMITED  AVAILABILITY! (845)  255-­7205 Thursday,  December  2,  2010


The GUNK Thursday, dECEMBER 2, 2010

PLUS...

Photo by Brian J. Kearney

Students compete for a place on the New Paltz Slam Team at the

GRAND SLAM Story on page 6B

THE MIAMI THEATRE PLAYERS Students put on the Broadway “Peanuts” classic

AND MORE!


  The  New  Paltz  Oracle

2B  |  FEATURES EVENT FEATURE

HOT OFF THE FRYING ZAN

Spicing Up New Paltz

SOUTH ASIAN CULTURAL ASSOCIATION TO HOLD ANNUAL DINNER

By  Zan  Strumfeld

By  Zan  Strumfeld

Features  Editor

Features  Editor  |  Sstrumfeld34@newpaltz.edu

Sstrumfeld34@newpaltz.edu

Right  before  I  left  for  Thanksgiving  break,  I  real-­ ized  I  had  a  whole  bundle  of  brown  bananas.  What   better   way   to   contribute   to   Thanksgiving   dinner   than  the  best  banana  bread  ever  made?    So  hereâ&#x20AC;&#x2122;s:

Banana  Fanna  Fo  Zanna Youâ&#x20AC;&#x2122;ll  need: FXSVĂ&#x20AC;RXU DOOSXUSRVH

1  teaspoon  baking  soda 1/4  teaspoon  salt 1/2  cup  butter  or  margarine 3/4  cup  brown  sugar,  lightly  packed 2  eggs 4-­5  mashed  overripe  bananas   1  cup  chocolate  chip  morsels

PHOTO  BY  ZAN  STRUMFELD

Get   ready   to   make   the   greatest   thing   in   the   world   by   preheating  the  oven  to  350  degrees.  Lightly  grease  a  9â&#x20AC;?   x   5â&#x20AC;?   loaf   pan   (glass   or   metal).   In   a   large   bowl,   com-­ ELQHWKHĂ&#x20AC;RXUEDNLQJVRGDDQGVDOW,QDVHFRQGERZO mix  the  butter,  brown  sugar  and  eggs.  Then  stir  in  the   mashed  bananas,  until  blended.  Stir  banana  mixture  into   WKHĂ&#x20AC;RXUPL[WXUHXQWLOQLFHO\PRLVWHQHG6WLULQPRVWRI the  chocolate  chips,  but  save  some!  Only  eat  a  couple   also,  cause  I  know  you  just  did.  Pour  the  mixture  into   the   greased   loaf   pan.   Then,   best   part:   sprinkle   the   re-­ maining  morsels  on  top  of  batter.  Bake  in  the  oven  for   65-­75  minutes,  or,  if  youâ&#x20AC;&#x2122;re  anxious  because  the  smell   LVÂżOWHULQJWKURXJKRXWWKHKRXVHVWLFNDWRRWKSLFNLQWR the  center.  If  it  comes  out  clean,  itâ&#x20AC;&#x2122;s  done!  Let  it  cool  for   a  few  minutes  and  then  devour!  

The   Taj   Mahal   will   be   coming   to   SUNY   New   Paltz   in   the   form   of   a   dinner   with   the   South   Asian   Cultural   As-­ sociation   (SACA).   Sticking   to   their   annual   event,   the   or-­ ganization  will  be  holding  â&#x20AC;&#x153;A   Night  at  the  Taj  Mahalâ&#x20AC;?  in  the   Student   Union   (SU)   Multi-­ Purpose   Room   on   Friday,   Dec.  3  at  8  p.m. With   the   Taj   Mahal   as   their   theme,   the   room   will   have   various   decorations,   as   well   as   information   about   the   mausoleum.   The   event   will   offer   authentic   Indian   food   provided  by  New  Paltz  Indian   Restaurant.     There   will   also   be  a  number  of  performances,   including   a   skit,   Bollywood   dancers   and   a   fashion   show,   modeling   cultural   and   tradi-­ tional  clothes  of  the  area.  

This   year   in   particular   will   hold   more   people,   since   IRU WKH ÂżUVW WLPH WKH GLQQHU will  be  held  in  the  SU  instead   of  the  College  Terrace.   Sushma   Kasinathan,   a   fourth-­year   biology   major   and   the   current   president   of   SACA,   is   excited   about   the   upcoming  event.  She  said  the   organization  is  a  way  for  stu-­ dents   of   South  Asian   descent   to   come   together   and   display   their  cultures.   Although  the  organization   is  for  everyone,  it  is  predomi-­ nantly   Indian   and   Pakistani.   However,  Kasinathan  said  that   other   students   come   to   meet-­ ings   just   to   learn   about   the   cultures. â&#x20AC;&#x153;I   had   always   been   inter-­ ested  in  my  culture,â&#x20AC;?  she  said.   â&#x20AC;&#x153;I   grew   up   in   a   predominant-­ ly   white   neighborhood   and   ZDVQÂśW UHDOO\ LQĂ&#x20AC;XHQFHG E\

Indian  culture.â&#x20AC;? The   dinner   is   sponsored   by   the   Asian   Studies   depart-­ ment,   Jam   Asia   and   Indian   Hawks,  which  is  an  organiza-­ tion   for   Indian   graduate   stu-­ dents.  Anyone  who  is  interest-­ ed   can   attend   the   free   dinner,   but   with   limited   food,   it   will   EHRQDÂżUVWFRPHÂżUVWVHUYHG basis.   â&#x20AC;&#x153;Overall  the  events  weâ&#x20AC;&#x2122;ve   had   were   very   successful,â&#x20AC;?   VDLG IRXUWK\HDU ÂżQDQFH PD-­ jor  Tarun  Behl.  â&#x20AC;&#x153;It  helps  allow   the   New   Paltz   campus   to   see   South   Asian   culture   repre-­ sented  through  music,  culture,   dancing,  etc.â&#x20AC;? The  organization  will  also   continue   their   meetings   next   semester   every   other   Thurs-­ day,   usually   in   rooms   408   or   414  of  the  SU  at  8  p.m.

PHOTO  COURTESY  OF  SUSHMA  KASINATHAN

Last  year,  South  Asian  Cultural  Association  held  its  annual  dinner  with  the  theme  of  Bollywood  Through  the  Ages.

Thursday,  December  2,  2010


FEATURES  |  3B  

The  New  Paltz  Oracle TREND FEATURE

Facebook Advertising Raises Concerns SUNY NEW PALTZ STUDENTS AND FACULTY DISCUSS THEIR EXPERIENCES WITH THE INTERNET By  Bianca  Mendez Contributing  Writer  |  Bmendez57@newpaltz.edu

Stacy   Mazzara   was   checking   her   Facebook   when   she   noticed   the   adver-­ tisements  on  the  side  of  the  page  relating   to  her  interests.  Mazzara,  a  second-­year   communication  and    media  and  Spanish   major,   regularly   checks   her   Facebook   QRWL¿FDWLRQV DQG VKDUHV LQIRUPDWLRQ with  her  friends. “It  has  been  recently  occurring  over   the  past  year,”  she  said.  “I  get  advertise-­ ments   for   things   like   Mando   Books   in   New  Paltz  and  sushi,  and  anyone  could   look   at   my   Facebook SUR¿OH DQG NQRZ that   I   go   to   SUNY   New   Paltz   and   that   my  favorite  food  is  sushi.”   According   to   Facebook.com,   it   is   home   to   over   500   million   users   who   spend   700   billion   minutes   per   month   logged  on  sharing  information. ³$GYHUWLVHUV DUH GH¿QLWHO\ WDNLQJ advantage  of  social  media,”  said  Judith   Halasz,  a  sociology  professor  at  SUNY  

New   Paltz.   “They   can   call   information   that  users  wouldn’t  normally  share  with   advertisers.”   Although   the   nation   may   be   begin-­ ning   to   fear   what   Facebook   is   doing   is   an  invasion  of  privacy,  some  on  campus   KDYHFRQÀLFWLQJYLHZV Mazzara  does  not  think  it  is  an  inva-­ sion  of  privacy.   “I   don’t   feel   like   my   privacy   has   been   invaded,   possibly   because   the   ads   that  show  up  on  my  account  tend  to  be   pretty   impersonal.   Sometimes   ads   even   pop   up   that   relate   to   research   I   did   for   a  class  and  have  nothing  to  do  with  my   own  personal  interest,”  said  Mazarra. Robert   Miller,   a   professor   in   the   communication   and   media   department,   also  agreed  it  is  not  an  invasion  of  pri-­ vacy. “People   are   inviting   advertisers   on   their  pages  based  on  what  they  put  on,”   said  Miller. However,   Halasz   disagreed   and  

said   advertising   was   never   Facebook’s   original   intention.   Facebook   is   a   social   network   intended   to   bring   family   and   friends  together  through  status  updates,   photos  and  applications.   With  all  of  the  information  they  pro-­ vide,   users   have   the   ability   to   control   their  privacy  settings. ³(YHQLI\RXPDNH\RXUSUR¿OHSUL-­ vate,  Facebook  is  sharing  your  informa-­ tion  with  an  entity  that  you  don’t  know,”   Halasz  said.   Miller  urges  users  to  be  careful  with   the  information  they  put  out. “People   need   to   be   aware   of   what   kind   of   information   they’re   releasing,”   said  Miller.  “They  have  to  start  making   decisions  about  what  they  put  online.” Second-­year  undeclared  major  Juli-­ anne  Moore  has  also  recently  found  out   that  the  advertisements  on  her  page  are   based  on  her  interests.   “I  would  always  notice  them  on  the   side  and  think  ‘Hey,  I  like  that’  but  never  

thought  too  much  about  it,”  said  Moore.   “After   awhile,   I   became   suspicious   about   how   advertisements   always   per-­ WDLQHGWRP\VSHFL¿FLQWHUHVWVDQGWKDW¶V ZKHQ,¿JXUHGRXWFacebook  ‘sees’  what   you  like.” The   more   people   use   the   Internet,   the  more  advertisers  are  likely  to  target   consumers  through  it. Miller   does   not   feel   it   will   have   an   effect  on  people’s  use  of  the  Internet.   “Ads  will  not  attract  people  to  social   networks.  Ads  are  attracting  people  who   are  already  there,”  said  Miller.   Both  Moore  and  Mazzara  agree  they   will   continue   using   Facebook   and   the   Internet  as  well. “I   actually   think   it’s   a   good   idea   to   have   advertisements   on   the   side   of   Facebook  based  on  what  you  like,”  said   Moore.    “If  it’s  something  you  like  you   will  be  interested  and  notice  it.”  

UPGRADE YOUR CAREER – ONLINE. ON-SITE. OR BOTH. Hofstra’s M.S. in Computer Science is a flexible program designed for working professionals. If you are a software engineer, software developer or computer science professional, Hofstra University’s Master of Science in Computer Science program is designed with you in mind. Improve your skills and advance your career while accommodating your demanding schedule. Take classes online, in the classroom, or do both. Our program offers maximum flexibility and challenging course work in areas such as medical informatics, cyber security, data mining, and mobile computing. Our graduates have gone on to become successful entrepreneurs, continue their education in doctoral studies, or pursue successful careers in software engineering and project management, database administration, and systems and network administration and security analysis. Hofstra alumni are currently working in software manufacturing, health care, communication, banking and financial services, government organizations and research laboratories. ! Find Out More

Graduate Open House January 12 @ 6 p.m. hofstra.edu/grad-day

find your edge®

Thursday,  December  2,  2010


The  New  Paltz  Oracle

4B  |  FEATURES CLUB FEATURE

Heeling Animal Hunger

CENTER FOR HEELING TO RAISE MONEY FOR KEEPING PETS FED IN HOMES By  Maria  A.  Matua Contributing  Writer  |  N02039845@newpaltz.edu

PHOTOS  COURTESY  OF  MAXIM  ALTER,  PAMELA  VIVANCO

Center  for  Heeling  has  started  its  second  annual  pet   food  drive  to  help  keep  pets  at  home  and  not  in  shelters.

The   second   annual   pet   food   drive   hosted   by   Center   for   Heeling   is   taking   place  now  until  Dec.  31  in  hopes  to  “keep   pets  at  home  and  out  of  shelters,”  accord-­ ing  to  the  Center  for  Heeling’s  website.   Last  year,  1,500  pounds  of  food  were   collected   and   donated   to   local   food   pan-­ tries  across  Ulster  County. Susan   Gleeson,   owner   of   Center   for   Heeling  and  founder  of  the  pet  drive,  has   worked  with  dogs  her  whole  life.  Gleeson   worked  in  veterinary  hospitals  across  the   Hudson  Valley   before   starting   Center   for   Heeling,   a   place   where   owners   and   dogs   are   encouraged   “to   build   a   strong   bond,   and  healthy  environment  for  both  human   and   canine,”   according   to   the   business’   website.   Gleeson   started   this   pet   drive   after   noticing  that  families  were  having  trouble   providing   food   for   their   pets,   especially   during  the  holiday  season. “I  know  in  this  economy,  people  are   struggling   to   feed   their   pets,”   said   Glee-­

son.  “My  pet  is  a  part  of  my  family  and  I   would  be  devastated  if  I  couldn’t  feed  it.” Family  of  New  Paltz  Food  Pantry  re-­ ceived   pet   food   last   week   and   according   to   director   Kathy   Cartagena,   the   food   is   already  gone.   Kevin   Koller,   who   runs   Bark   Place   of  Ulster  in  Highland,  N.Y.  with  his  wife,   conducts   training   classes   for   dogs   along   with  Gleeson.  Koller  and  his  wife  agreed   to  make  their  business  a  drop-­off  location   for  the  food  after  realizing  the  great  need   that  families  have  for  pet  food.   “I   know   there   are   some   people   that   are  hurting,”  said  Koller.  “They  turn  their   pets   into   the   ASPCA   because   they   can’t   handle  them  anymore.”   Gleeson  said  she  wants  to  make  sure   that   families   do   not   have   to   choose   be-­ tween  feeding  their  pets  and  feeding  their   kids.   “I’ve  had  a  few  instances  where  food   pantries   have   called   me   for   a   crisis   and   I’ve   gone   directly   to   the   homes   (to   drop   off  pet  food),”  said  Gleeson.   Rosanne   Platoni,   owner   of   Sue’s  

Zoo   in   New   Paltz,   was   more   than   happy   to   make   her   business   a   drop-­off   location   for   the   pet   food.   With   the   large   number   of  food  drives  in  existence,  Platoni  thinks   that   the   importance   of   pet   food   drives   is   not  acknowledged.   “People   don’t   realize   that   pets   need   food  too,”  said  Platoni.   Gleeson  has  worked  with  many  peo-­ ple  to  make  this  pet  food  drive  successful   and   has   found   that   people   come   together   in  times  of  need.     “I’ve  realized  how  much  compassion   people  have  for  total  strangers,”  said  Glee-­ son.   Food   pantries   only   allow   pet   food   on  their  shelves  during  the  Thanksgiving   and  Christmas  holidays  because  they  lack   extra   room   to   hold   the   it   all   year   round.   Gleeson  hopes  to  change  that.   “I  would  love  to  be  able  to  open  a  pet   food  pantry  available  all  year  round,”  said   Gleeson. If  you  are  interested  in  donating  food,   visit   centerforheeling.com   for   participat-­ ing  drop-­off  locations  and  pantries.  

BEARD EXPERIMENT

Scruff  Times  No  More  

No Shave Novembeard: FINAL RESULTS

FRANK GREENAWAY ORACLE CHOSEN WINNER!

JOHN MICHAEL CASTILLO

TYLER PRINCEGARDINER

SEAN BAILEY

RAY VASSARSEMANCHIK

NEIL PICKUS

FIRST  FOUR  PHOTOS  BY  CHRIS  THURSTON.  LAST  TWO  PHOTOS  PROVIDED  BY  NEIL  PICKUS

Thursday,  December  2,  2010


                                         FEATURES  |  5B  

The  New  Paltz  Oracle CLUB PROFILE

Wand Waving and World Saving

SUNY NEW PALTZâ&#x20AC;&#x2122;S DUMBLEDOREâ&#x20AC;&#x2122;S ARMY STARTS MAGICAL MOVEMENT

FAMILIAR FACES ...with  Annie  Yu

Theresa Kilmer Supervisor  of   Jazzmanâ&#x20AC;&#x2122;s  Cafes  

Annie  Yu+RZGLG\RX¿QG\RXUVHOIDW681< 1HZ3DOW]" Theresa  Kilmer,ZDVWKHUHWDLOVXSHUYLVRUIRU 6RGH[RDW0DULVW&ROOHJH,ZRUNHGIRU681< 1HZ3DOW]DW&DPS5RFNLOOIRUWKHVXPPHULQ DQG

7KH681<1HZ3DOW]FKDSWHURI'XPEOHGRUH¶V$UP\¶VPLVVLRQLQYROYHVVDYLQJWKHZRUOG3+272%</$85$/8(1*$6 By  Pete  Thompson Copy  Editor  |  Pthompson51@newpaltz.edu

Since   Harry   Potterâ&#x20AC;&#x2122;s   triumph   over   HYLO LV OLPLWHG WR KLV ¿FWLRQDO ZL]DUGLQJ ZRUOG SURJUHVVLYHO\PLQGHG IDQDWLFV RQ campus   have   taken   to   arms   in   the   real   ZRUOGZLWKWKHLURZQ'XPEOHGRUH¶V$UP\ RI1HZ3DOW] 7KH JURXS IRXQGHG E\ VHFRQG \HDU(QJOLVKPDMRU%HYHUO\6FKUHLEHULQ 0DUFKLVRQHRIPDQ\FKDSWHUVRI WKH LQWHUQDWLRQDO +DUU\ 3RWWHU $OOLDQFH +3$ DQGIDUPRUHWKDQDPHUHIDQFOXE &ODVVL¿HGDVRQHRIWKHDGYRFDF\RUJDQL ]DWLRQV RQ FDPSXV WKH FOXE EULQJV IRO ORZHUVRI-.5RZOLQJ¶V¿FWLRQWRJHWKHU LQFRPEDWLQJJOREDOLQMXVWLFHV ³,VWDUWHGWKHJURXSEHFDXVH,ZDQWHG WR¿QGSHRSOHZKRVKDUHGP\SDVVLRQRI +DUU\ 3RWWHU DQG DGYRFDF\´ 6FKUHLEHU VDLG³,SDUWLFLSDWHGLQWKH+HOSLQJ+DLWL &DPSDLJQWKURXJKWKH+3$DQGLWIHOWVR JRRGWRKHOSUDLVHDQG,ZDQWHG WRVKDUHWKDWZLWKSHRSOHRQFDPSXV´ :LWK LWV PLVVLRQ VWDWHPHQW GHFODU LQJ D JRDO WR ³PDNH FLYLF HQJDJHPHQW H[FLWLQJ E\ FKDQQHOLQJ WKH HQWHUWDLQ PHQWVDWXUDWHG IDFHWV RI RXU FXOWXUH WRZDUG PRELOL]DWLRQ IRU GHHS DQG ODVW LQJ VRFLDO FKDQJH´ WKH DOOLDQFH FUHDWHV FDPSDLJQV WKDW SDUDOOHO LVVXHV ZLWKLQ WKH 3RWWHU XQLYHUVH KRSLQJ WR EULQJ

VRPHRILWVPDJLFLQWRRXURZQ 7KHPRVWUHFHQWRIWKHLQWHUQDWLRQDO FRDOLWLRQ¶VHQGHDYRUVLVWKH'HDWKO\+DO ORZV&DPSDLJQ6SDQQLQJIURP1RYHP EHUWR-XO\±RUWKHQLQHPRQWKV EHWZHHQ¿OPUHOHDVHVWKHFDPSDLJQDLPV to   seek   out   and   destroy   seven   horcruxes   RIWKHUHDOZRUOG 7KH ¿UVW RI WKHVH LV WKH 6WDUYDWLRQ :DJHV +RUFUX[ ZKLFK WKH +3$ LV EDW WOLQJWKURXJKSHWLWLRQLQJIRU7LPH:DUQHU SDUHQW FRPSDQ\ RI :DUQHU %URWKHUV WR XVH)DLU7UDGHFKRFRODWHIRUDQ\DSSURSUL DWH+DUU\3RWWHUSURGXFWV6LPLODUWRWKH VODYHOLNH FRQGLWLRQV RI WKH KRXVH HOYHV DQ HQG WR WKLV ZRXOG FHDVH H[SORLWDWLRQ starvation  and  child  slavery  under  Harryâ&#x20AC;&#x2122;s   QDPH 7KLV ZDV NLFNHG RII LPPHGLDWHO\ EHIRUHWKHSUHPLHUHRI³+DUU\3RWWHUDQG WKH'HDWKO\+DOORZV3DUW,´RQ1RY DW/XPRV3DUWLHVKHOGDURXQGWKHZRUOG ³>:H@EURXJKWÃ&#x20AC;DVKOLJKWVRUFDQGOHV WRPRYLHWKHDWHUVIRUWKHPLGQLJKWUHOHDVH WR FDWFK SHRSOH¶V DWWHQWLRQ´ 6FKUHLEHU VDLG³:HMXVWJRWXSLQIURQWRIWKHWKH DWHUDQGWROGHYHU\RQHZKDWZHZHUHGR LQJDQGDVNHGWKHPWRVLJQRXUSHWLWLRQ´ 7KHJURXSDOVRSODQVRQEULQJLQJWKH SHWLWLRQ WR FODVVURRPV KRSLQJ WR UDLVH DZDUHQHVVDQGJDLQVXSSRUWIURPPRUHRI WKHVWXGHQWERG\

³,W¶VVRPHWKLQJWKDWKDVOLWHUDOO\JRQH RQIRUDOOP\OLIH´VDLG(QJOLVKDQGKLVWR U\PDMRU0HJDQ:LOOLDPVZKRVHUYHVDV WKHJURXS¶VSXEOLFUHODWLRQVFRRUGLQDWRU $OWKRXJK WKHLU PLVVLRQ LQYROYHV VDYLQJWKHZRUOGZKHWKHUPDNLQJTXLOWV IRU *RRGZLOO RU EX\LQJ ZDWHU ERWWOHV WR VWXQWWKHZDWHUFULVLVPHPEHUVRIWKHDO OLDQFH VWLOO PDQDJH WR KDYH D JRRG WLPH ZLWK RWKHU PRUH OLJKWKHDUWHG HYHQWV OLNH ¿OP VFUHHQLQJV VXFK DV ³$ 9HU\ 3RWWHU0XVLFDO´ ³, ORYH LW´ VDLG WKLUG\HDU FUHDWLYH ZULWLQJ PDMRU 1LFROH 3HWURQH ³$ZH VRPHSHRSOHFDQZRUNWRJHWKHUKHOSRXW other  people  and  at  the  same  time  have  an   DPD]LQJWLPHWDONLQJDERXW+DUU\3RWWHU´ 'XPEOHGRUH¶V $UP\ LV FXUUHQWO\ ZRUNLQJRQHVWDEOLVKLQJD4XLGGLWFKWHDP DQGFRQVLGHULQJKRVWLQJLWVRZQ<XOH%DOO VRPHWLPHLQ$SULO ³, ZRXOG ORYH WR VHH 'XPEOHGRUH¶V $UP\ EHFRPH UHFRJQL]HG RQ FDPSXV DV VRPHWKLQJ WKDW¶V QRW MXVW µD +DUU\ 3RW WHUFOXE¶´6FKUHLEHUVDLG³7KHUHLVZD\ PRUHWRRXUFOXE«ZHDUHDFWXDOO\WU\LQJ WRPDNHDGLIIHUHQFH´ $Q\RQH LQWHUHVWHG LQ EULQJLQJ PRUH PDJLF LQWR WKH ZRUOG FDQ DOLJQ ZLWK 'XPEOHGRUH¶V $UP\ RI 1HZ 3DOW] RQ Wednesdays   in   Student   Union   405   at   8   SP

7KXUVGD\'HFHPEHU

AY:KDWLV\RXUIDYRULWHWKLQJDERXW\RXUMRE" TK,OLNHWRRYHUVHHWKHGLIIHUHQWVKRSV,¶YH EHHQZLWK-D]]PDQ¶VDVVXSHUYLVRUIRUVL[\HDUV ,OLNHWRGHDOZLWKFXVWRPHUVHUYLFH AY:KDWLV\RXUIDYRULWHWKLQJWRHDWRUGULQNDW -D]]PDQ¶V" TK,OLNHWKHFDUDPHOODWWHDQGWKHDVVRUWHG EDNHGJRRGVWKDWZHKDYHKHUHWKDWDUHEDNHG RQWKHSUHPLVHV AY:LWKWKHKROLGD\VFRPLQJXSLVWKHUHDQ\ WKLQJ\RX¶UHSDUWLFXODUO\H[FLWHGDERXW" TK,¶PORRNLQJIRUZDUGWRWKHSRVVLELOLW\RI P\GDXJKWHU&RUSRUDO&ROOHHQ:HOVK>ZKRLV VWDWLRQHG@LQ)UDQNIXUW*HUPDQ\FRPLQJKRPH $OVRVSHQGLQJWKHKROLGD\ZLWKIULHQGVDQGIDP LO\ AY$Q\UHVROXWLRQVIRUWKHQHZ\HDU" TK :KLVSHUV 7RTXLWVPRNLQJ AY,I\RXFRXOGEHDQ\ZKHUHLQWKHZRUOGULJKW QRZZKHUHZRXOG\RXEHDQGZK\" TK,ZRXOGORYHWREHLQ)UDQNIXUW*HUPDQ\ ZLWKP\GDXJKWHU:HKDYHDYHU\FORVHUHOD WLRQVKLSDQG,ORYHKHUYHU\PXFK AY$Q\WKLQJHOVH\RXZDQWWRVD\WRWKHVWX GHQWVDW681<1HZ3DOW]" TK:HHQMR\KDYLQJWKHPDQGWKHLUEXVLQHVV DQGZHHQMR\KDYLQJWKHPZRUNZLWKXV:H NQRZPRVWRIWKHVWXGHQWVE\QDPH:HWKDQN \RXIRUEHLQJDSDUWRIRXUWHDP$OVRLIHYHU\ RQHFRXOGVD\DSUD\HUIRURXUVROGLHUVSOHDVH GRVRWKDWWKH\FRPHKRPHVDIHO\


6B  |  ARTS  &  ENTERTAINMENT

The  New  Paltz  Oracle

PERFORMANCE FEATURE

War of the Words

NEW PALTZ SLAM POETS DUKE IT OUT FOR A SPOT ON THE TEAM

:LWKRYHUDXGLHQFHPHPEHUVORRNLQJRQÂżQDOLVWVWRRNWKH0F.HQQD7KHDWUHVWDJH7XHVGD\1RYWRFRPSHWHIRUDVSRWRQWKH6ODP7HDPPHOTO  BY  BRIAN  J.  KEARNEY By  Maeve  Halliday SRLQWLVWKHSRHWU\Âś7KHUHLVQRERDUGRIHOLWLVWMXGJHV students  James  Warren  and  Kate  Brady.   Copy  Editor  |  Mhalliday74@newpaltz.edu grading  your  poetry.  It  isnâ&#x20AC;&#x2122;t  the  olympics.  There  is  no   To   break   the   tie,   Brady   and   Warren   were   put   on   the   spot   and   asked   to   perform   a   third   poem.   While   most   people   were   heading   home   for   snobbish  institution  of  poetry  slam.â&#x20AC;? Exceeding  the  three-­minute  time  limit  resulted  in   $IWHU DQ HIIRUW E\ ERWK SRHWV WKH MXGJHV DZDUGHG   Thanksgiving   break,   a   congregation   of   over   150   students  chose  to  stay  on  campus  Tuesday,  Nov.  23   a   penalty,   reducing   the   offending   poetâ&#x20AC;&#x2122;s   score.   The   Brady  as  the  winner. â&#x20AC;&#x153;That  tie  with  [Warren]  was  intense,â&#x20AC;?  Brady  said.   and  pile  into  McKenna  Theatre  for  a  night  of  spoken   time  limit,  which  caught  many  of  the  evenings  com-­ petitors,  was  treated  as  a  necessity  and  the  audience   â&#x20AC;&#x153;[Warren]  and  I  are  the  co-­presidents  of  [Rap  Poetry   word  poetry  and  serious  competition.   After  preliminary  poetry  slams  on  Sept.  22,  Oct.   was  encouraged  by  the  slamâ&#x20AC;&#x2122;s  host  Sean  Gallagher  to   Music]  this  year,  so  it  was  a  pretty  crazy  coincidence   when  we  had  to  duke  it  out  for  the  last  spot.â&#x20AC;?  DQG 1RY   ÂżQDOLVWV WRRN WKH VWDJH WR FRP-­ shout  â&#x20AC;&#x153;Fuck,  timeâ&#x20AC;?  whenever  poets  were  penalized. The  New  Paltz  Slam  Team  won  the  Wade-­Lewis   Attendees  were  also  treated  to  an  opening  perfor-­ pete  for  a  spot  on  the  2010-­11  New  Paltz  Slam  Team,   deciding  who  will  go  to  the  College  Unions  Poetry   Poetry   Slam   Invitational   last   semester,   beating   out   mance  by  featured  poet  Alvin  Lau,  who  has  won  nu-­ teams  from  around  the  country,  including  many  Ivy   merous  accolades  and  been  featured  on  two  seasons   Slam  Invitational  (CUPSI)  in  April. The   competing   poets   were   scored   by   a   panel   /HDJXHVFKRROV:LWKODUJHVKRHVWRÂżOO)DOOH\VDLG of  HBOâ&#x20AC;&#x2122;s  Def  Poetry  Jam.  A  self-­described  Chinese   RI ÂżYH LPSDUWLDO MXGJHV FKRVHQ IURP WKH DXGLHQFH VKHLVFRQÂżGHQWWKDWWKLVVHDVRQÂśVWHDPLVPRUHWKDQ hip-­hop   Charlie   Brown,   Lau   performed   poetry   that   YDULHGLQVXEMHFWPDWWHULQFOXGLQJRQHDERXWDQH[SH-­ MXVWEHIRUHWKHVODPEHJDQ7KHVHMXGJHVVFRUHGSR-­ capable  of  succeeding  again. Âł7KHUHDUHDORWRIÂżUVW\HDUPHPEHUVZKRKDYH rience  of  losing  hair  during  chemotherapy  in  â&#x20AC;&#x153;Love     ets   on   both   content   and   performance   on   a   scale   of   0.0   to   10.0.   Of   the   scores   each   poet   received,   the   very  little  experience  in  slam,  and  Iâ&#x20AC;&#x2122;m  electric  with   Song  to  My  Hair.â&#x20AC;? Falley  commended  all  15  of  the  competing  stu-­ high   and   low   scores   were   dropped   and   the   middle   the  thought  of  introducing  them  to  famous  slam  po-­ three   were   added   together,   giving   the   poet   a   total     ets,  exposing  them  to  the  scene,  throwing  them  into   dents   on   their   performances,   and   was   regretful   that   ÂżHUFH FRPSHWLWLRQ DQG DWWHQGLQJ UHJLRQDO DQG QD-­ the  clubâ&#x20AC;&#x2122;s  budget  would  only  allow  for  six  poets  to   from  zero  to  30. Some   audience   members   voiced   dissatisfaction   tional   competitions   where   they   will   meet   hundreds   attend  CUPSI.   â&#x20AC;&#x153;Hopefully  with  the  growing  success  of  the  team   with  the  scoring  system,  saying  that  it  might  be  better   of  poets,â&#x20AC;?  she  said.  â&#x20AC;&#x153;It  will  be  like  watching  someone   we  can  request  more  budget  money  to  widen  the  pro-­ WRKDYHÂłDWOHDVWRQHSURIHVVLRQDOMXGJHRQWKHSDQ-­ WKHÂżUVWWLPHWKDWWKH\VHHVQRZ´ After   a   second   round,   students   Sabrina   gram  in  the  future,â&#x20AC;?  she  said. el.â&#x20AC;?  Slam  Team  coach  and  former  SUNY  New  Paltz   Adikes,   Chris   Milea,   Breanna   Metcalf-­Os-­ For   those   interested   in   following   the   prog-­ student  Megan  Falley  said  she  disagreed.   â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s  not  how  a  poetry  slam  works,  ever,â&#x20AC;?  Fall-­ hinsky,   Jackie   Wolozin   and   Karly   Fesolwich   ress   of   the   slam   team   in   their   upcoming   com-­ H\ VDLG Âł7KH UDQGRP MXGJHV UHPLQGV SRHWV RI WKH emerged   victorious,   winning   a   spot   on   the   team.   petitions,   information   is   located   on   the   groupâ&#x20AC;&#x2122;s     classic  slam  tag  line,  â&#x20AC;&#x2DC;the  point  is  not  the  points,  the   7KH ÂżQDO VSRW FDPH GRZQ WR D WLH EHWZHHQ   RIÂżFLDOFacebook  page.  

Thursday,  December  2,  2010


ARTS  &  ENTERTAINMENT  |  7B  

The  New  Paltz  Oracle THEATRE FEATURE

New Paltz Players Perform â&#x20AC;&#x2DC;Peanutsâ&#x20AC;&#x2122;

STUDENT-RUN GROUP CLOSES CURTAIN ON â&#x20AC;&#x153;YOUâ&#x20AC;&#x2122;RE A GOOD MAN, CHARLIE BROWNâ&#x20AC;?

7KHDOOVWXGHQWFDVWDQGFUHZRI7KH0LDPL7KHDWUH3OD\HUVSHUIRUPHG³<RXœUH$*RRG0DQ&KDUOLH%URZQ´IURP1RYWR3+27263529,'('%<$11(77(6725&.0$1                                 By  Maxim  Alter A&E  Editor  |  Malter42@newpaltz.edu

In   the   opening   to   the   musical   comedy   â&#x20AC;&#x153;Youâ&#x20AC;&#x2122;re  A  Good  Man,  Charlie  Brown,â&#x20AC;?  the  au-­ dience   is   made   aware   of   the   titular   characterâ&#x20AC;&#x2122;s   IDLOXUHVDQGDEVHQFHRIFRQÂżGHQFH%XWIRU*UHJ Gondek,   a   second-­year   undeclared   major   por-­ traying  Charlie  Brown  during  The  Miami  The-­ atre  Playersâ&#x20AC;&#x2122;  November  production  of  the  classic   SOD\FRQÂżGHQFHDQGVXFFHVVZHUHHDV\WRREWDLQ â&#x20AC;&#x153;I  felt  that  I  could  experiment  and  try  dif-­ ferent  things  in  terms  of  acting,  and  I  didnâ&#x20AC;&#x2122;t  feel   DWDOOLQWLPLGDWHGRULQVHFXUHWRGRVR´KHVDLG â&#x20AC;&#x153;[The  Miami  Theatre  Players]  are  different  be-­ cause   the   group   creates   an   environment   where   everyone  has  a  voice  and  anyone  can  help  par-­ WLFLSDWH,WLVDSODFHZKHUHSDVVLRQDWHFRPPLW ted  students  can  work  together  on  something  that   WKH\DUHWUXO\LQWHUHVWHGLQ´ With   cheers   and   laughs,   the   entirely   stu-­ GHQWUXQ JURXS WRRN WKHLU ÂżQDO ERZ RI WKH VH mester  in  Parker  Theatre,  ending  their  fall  2010   production  of  the  â&#x20AC;&#x153;Peanutsâ&#x20AC;?  comic  strip-­inspired   %URDGZD\KLWRQ6XQGD\1RY With   lyrics   and   music   originally   written   by   American   composer   Clark   Gesner   and   characters   created   by   cartoon-­ LVW &KDUOHV 0 6FKXO] Âł<RXÂśUH A   Good   Man,   Charlie   Brownâ&#x20AC;?   follows   Patty,   Schroeder,   Lucy,   Snoopy   and   the   rest   of   the   gang   on   a   normal   day   while   &KDUOLH %URZQ VHDUFKHV WR ÂżJ ure   out   whether   or   not   he   is,  

LQIDFWDÂłJRRGPDQ´ According  to  Director  Annette  Storckman,   the  group  chose  the  play  because  it  was  a  good   transition  from  their  previous  production  of  â&#x20AC;&#x153;The   WK$QQXDO3XWQDP&RXQW\6SHOOLQJ%HH´$QG while  it  shares  a  similar  feel  and  style,  she  said  it   gave  the  group  the  opportunity  to  do  something   GLIIHUHQWZLWKDVPDOOQXPEHURISDUWLFLSDQWV Funded   entirely   by   the   Student   Associa-­ tion  and  produced  outside  of  the  Department  of   Theatre  Arts,  Storckman  said  the  production  was   surprisingly   easy   to   put   together   with   only   her   IHOORZVWXGHQWV â&#x20AC;&#x153;I   marvel   at   everyoneâ&#x20AC;&#x2122;s   professionalism,â&#x20AC;?   VKHVDLGÂł7KH0LDPL7KHDWUH3OD\HUVDVORQJDV I  have  been  a  member,  have  been  very  collabora-­ WLYH7KLVVHPHVWHUZDVQRH[FHSWLRQ´ The  show  and  all  those  who  partici-­ pated  have  continued  to  receive  excellent   feedback   since   the   last   performance   date,   Storckman   VDLG /L] 2Âś1HDO the   actress   who   p o r t r a y e d   Lucy   in  

the  original  Broadway  production  of  â&#x20AC;&#x153;Youâ&#x20AC;&#x2122;re  A   Good  Man,  Charlie  Brownâ&#x20AC;?  even  came  to  see  the   WHDPÂśVSURGXFWLRQDQGÂłORYHGLW´ Storckman  said  the  cooperative  and  coordi-­ nated  efforts  of  the  cast  and  crew  helped  the  play   FRPHWRJHWKHUGHVSLWHDQ\EXPSVDORQJWKHZD\ 2QHKDPSHULQJGHWDLOVKHVDLGZDVWKDWWKH group   was   only   able   to   obtain   rehearsal   space   in  Parker  Theatre  for  two  days  due  to  schedul-­ LQJDQGIXQGLQJLVVXHV$OVRHYHQWKRXJKWKH\ applied  for  the  rights  for  â&#x20AC;&#x153;Youâ&#x20AC;&#x2122;re  A  Good  Man,   Charlie  Brownâ&#x20AC;?  the  moment  it  was  voted  in,  they   did   not   receive   rehearsal   materials   until   about   WZRDQGDKDOIZHHNVXQWLOWKHVKRZÂśVSUHPLHUH â&#x20AC;&#x153;We   were   working   with   downloaded   VFULSWV´VKHVDLGÂł7KHSLWEHJDQUHKHDUV ing  as  soon  as  we  got  the  materials,   DQGVWLOOWKH\ZHUHSKHQRPHQDO´ Assistant   Director   Sam   Grossman   said   joining   the   the-­ atre   group   can   provide   a   great   release   from   the   stressful   life   of   a   college   stu-­

dent,   which   is   why   members   range   from   a   va-­ riety   of   different   majors   and   minors,   rather   WKDQMXVWWKHDWUH As   a   secondary   education   English   major,   Grossman  said  he  immediately  became  attracted   WR 7KH 0LDPL 7KHDWUH 3OD\HUV GXULQJ KLV ÂżUVW \HDULQ1HZ3DOW]EHFDXVHRIWKHJURXSÂśVRSHQ QHVVLQLQYLWLQJDQ\RQHWRSDUWLFLSDWHLQVKRZV â&#x20AC;&#x153;Although   all   students   are   allowed   to   try   out  for  the  main  stage  performances  that  are  put   on  by  the  theatre  department,  I  felt  intimidated  as   an  incoming  freshman  and  Miami  was  the  stress-­ IUHHDOWHUQDWLYH,KDGEHHQORRNLQJIRU´KHVDLG Even  if  a  participant  does  not  have  training   or   much   knowledge   in   the   craft   of   performing   or  theatre,  Storckman  said  anyone  is  welcome  to   FRPHOHDUQDQGKDYHIXQ No  matter  what  the  challenges,  Storckman   said   she   has   enjoyed   working   with   her   fellow   group   members   and   watching   them   build   upon   WKHLUVNLOOVWRFUHDWHWKHEHVWSURGXFWLRQSRVVLEOH â&#x20AC;&#x153;It  is  the  most  rewarding  experience  to  give   them  some  tools  and  watch  them  thrive  in  their   UROHV´VKHVDLGÂł7KHFUHDWLYHWHDPLVDPD]LQJ It  is,  again,  extremely  rewarding  to  see  all   of   us   students   bringing   the   things   we   have   learned   and   are   passionate   DERXWWRFUHDWHDVKRZ´ After   a   vote   from   the   entire   group,   The   Miami   Theatre   Playersâ&#x20AC;&#x2122;   next   production   will   be   â&#x20AC;&#x153;Spring   Awakeningâ&#x20AC;?  and  is  aimed  for  some   WLPHLQ0D\ 3+272&2857(6<2)MUNAUD.ORG

Thursday,  December  2,  2010


8B  |  ARTS  &  ENTERTAINMENT

The  New  Paltz  Oracle

ART FEATURE

Embracing the Artistic Journey METALS STUDENT SEBASTIAN BAUER BUILDS UPON THE CREATIVE PROCESS

Sebastian  Bauer,  a  metals  major,  recently  discovered  his  passion  the  artistic  process.                                                                                                                                                                                                                                            PHOTO  BY  LAURA  LUENGAS                                   By  Andrew  Wyrich D GLIIHUHQW VWHS WKDW ZRXOG OHDG WR WKH ¿QLVKHG Bauer   believed   the   newly   formed   collage   rolls   of   paper   Bauer   remembered   being   fasci-­ Sports  Editor  |  Andrew.wyrich63@newpaltz.edu product.  This  included  a  collage  project  he  had   ZDV LQWHUHVWLQJ EHFDXVH KH ZDV ¿WWLQJ WRJHWKHU nated   with   Legos,   oftentimes   building   differ-­ Every  piece  of  art  starts  out  as  an  idea,  and   WRPDNHWKLVVHPHVWHU,QKLV¿UVWPHWDODVVLJQ-­ pieces  of  his  own  drawings,  so  he  could  see  how   ent  things  modeled  after  what  he  would  read  in   books.   for   second-­year   student   Sebastian   Bauer,   the   ment,  Bauer  was  told  to  select  a  word  and  mount   each  one  was  altered.   it   on   something.     He   said   instead   of   thinking   “I   think   that   the   shapes   and   forms   in   my   “I   remember   I   read   a   book   once,   it   had   journey  the  idea  takes  is  more  important  than  the   about  what  word  he  wanted  and  how  he  wanted   abstract  art  are  very  personal  to  myself,”  Bauer   a   castle   in   it,   and   I   decided   to   get   the   in-­ destination  at  which  it  ends.   it   to   be   presented   said.   “ I   a pproach   a   dividual   parts   and   build   the   castle   on   my     For  Bauer,  a  metals  major,  art  is  something   graphically,   he   project  often  with   own,”  Bauer  said. he  said  will  always  be  important  to  life.  His  art-­ not   ‘how   can   my   Bauer  feels  that  his  attraction  to  Legos  and   work  will  always  be  the  constant  in  his  ever  busy   thought  more  about   how   he   could   con-­ end   result   be   dif-­ the   t echnical   side  of  art  are  not  surprising  consid-­ and  changing  lifestyle.   struct   the   word,   ferent,’   but   rather   ering  his  interest  in  math  and  geometry.   When   he   is   not   rock   climbing   or   bik-­ ‘how  can  the  pro-­ As  for  the  future,  Bauer  continues  to  work   ing,   Bauer   spends   most   of   his   nights   in   the   which  ended  up  be-­ coming   a   3D-­like     cess   of   making   on  different  projects.   studios   on   campus   working   on   his   latest     image.   it   be   different,’   I   His  most  recent  project  is  in  response  to  an   artistic  endeavor.   “Logic   would   think  that  leads  to   “odd   fact”  he  learned  about  Heinz  Ketchup.  Bau-­ “[Art]   is   an   aspect   of   my   life   that   I’m   seem   ‘here   is   my   a   unique   end   re-­ er  said  that  Heinz  has  created  a  “perfect”  ratio  of   most  serious  about  and  will  be  something  I  can   sult  in  itself.”   salt,  protein  and  sugar  and  because  of  this  “your   dedicate   myself   to,”   Bauer   said.   “You   are   con-­ end   result,   how   do   I   get   to   that?’”   This   discov-­ body  loves  the  stuff.”   stantly  doing  new  things  in  your  life,  but  every-­ Bauer   said.   “I   ery   of   an   interest   After  learning  this,  Bauer  decided  to  make  a   one   has   a   part   of   their   life   they   don’t   want   to   have   an   idea   of   in   the   process   of   “pseudo-­sacred”  shelf  for  the  Ketchup.   half-­ass  and  art  is  one  of  the  things  I  am  hands     that,   but   I   feel   it’s   making   art   led   “It  looks  like  it  would  be  for  something  cov-­ down  serious  about.”   more   important   him  to  change  his   eted,”   Bauer   said.   “It   has   some   negative   space   But  despite  these  works  being  the  anchor  in   to   realize   how   to   get   to   that   end   result   in     major  to  metals,  and  was  recently  accepted  into   that  the  ketchup  rests  upon.”   Bauer’s  life,  he  said  he  cares  more  about  the  way   BFA  metals  program.   Bauer   hopes   to   continue   his   artistic   life-­ KLVDUWLVFUHDWHGUDWKHUWKDQWKH¿QLVKHGSURGXFW a  different  way.”   Going   with   his   process-­oriented   style,   he   %DXHU¶VYHQWXUHLQWRDUWEHJDQDW¿YHZKHQ style,  and  allow  the  process  and  journey  to  dic-­ Recently  he  discovered  that  his  biggest  strength   artistically  has  been  the  process  in  which  a  piece   took  ten  technical  drawings  he  had  created  and   his  grandmother  would  give  him  “big  10  ft.  long   tate  his  course.   photocopied   them.   After   this,   he   would   adjust   rolls  of  paper”  that  he  would  draw  large  “Marvin     “Ideally,  I’d  have  my  own  studio,  but  other   of  work  is  made.   different   proportions   and   would   use   them   to   the  Martian”  comics  on.   opportunities   can   present   themselves,”   Bauer   In   many   of   his   painting   classes   this   year,   make  different  abstract  landscapes.   Besides   spending   hours   drawing   on   large   said.  “I’m  going  to  take  it  as  it  comes.” Bauer  said  he  deconstructed  his  paintings  to  add  

I approach a project often with not ‘how can my end result be different,’ but rather ‘how can the process of making it be different’”

— SEBASTIAN BAUER

Thursday,  December  2,  2010


ARTS  &  ENTERTAINMENT  |  9B  

The  New  Paltz  Oracle MUSIC REVIEW

Haters Gonna Hate, But Kanye’s Great RAPPER KANYE WEST’S NEWEST RELEASE SAVES RADIO, FOR NOW By  Pierce  Lydon Managing  Editor  |  Lydon47@newpaltz.edu

Pop  music  is  stale.  Who  will  save  it? Lady   GaGa?   Lady   GaGa   is   a   bad   singer-­ songwriter   in   the   vein   of   Vanessa   Carlton,   traipsing   around   in   a   better   wardrobe   with   a   better   stage   presence,   singing   songs   that   are   just   as   cookie-­cutter   as   that   “I   would   walk   a   thousand  miles”  travesty. Jay–Z?   Too   rich.   Too   disconnected.  Yeah,   “Empire  State  of  Mind”  is  awesome,  but  prob-­ ably  not  if  you’re  from  California. Eminem?   He’s   like   the   opposite   of   the   Hulk.  We  only  like  him  when  he’s  angry.   Justin   Timberlake?   Missed   his   shot   to   become   the   new   King   of   Pop.   Didn’t   his   last   album   come  out  in  2006?   Justin   Bieber?   One   day.   Right   now,   he’s   too   young   for   anyone   to   take   him  seriously. Who,   then?   Who   will   make   the   ra-­

dio  listenable  for  the  next  six  months?  I  have  an   answer  for  you: Kanye  West. Now   before   you   continue,   forget   about   Taylor   Swift.   Forget   about   all   of   the   TMZ   gar-­ bage   you’ve   heard   about   West.   Forget   all   of   the   G.O.O.D.   Friday   songs   West   has   put   out   over   the   past   couple   of   months.   Forget   that   one   song   calling   for   “a   toast   to   the   douche   bags.”   You’re   letting   stuff   that   doesn’t   matter   get  in  the  way. Now   listen,   My   Beautiful   Dark   Twisted   Fantasy  is  the  best  album  that  will  come  out  this   year.  Hell,  it  might  be  the  best  album  that  comes   out  next  year,  too. On   Fantasy,  West   weaves   a   narrative   of   dreams   and   nightmares,   winning   and   los-­ ing,  life  and  death,  love  and  sex,  revolu-­ tion   and   survival   through   13   tracks   that   combine   pop   culture   with   the   ups   and   downs   of   relationships   and   a   fear   of   the   future.   Throughout   the   album,   West   plays   with   juxtaposition   and   your   own   expecta-­ tions  of  words.  For  instance,  most  people  know   “Runaway”   as   the   song   that   has   the   infamous   “toast  to  the  douche  bags”  line.  But  did  ev-­ eryone   who   writes   that   track   off   actually   listen   to   it?   It   works   alone,   but   even   bet-­ ter  in  the  context  of  the  album.  Alone,  it  is   simply   an   apology.  West   is   not   celebrat-­ ing   douche   bags;;   he’s   grieving   for   his   own  douchebaggery!   The   narrative   of   the   album   is   important   to   remember   when   lis-­ tening  to  West.  For  as  many  single-­ worthy   songs   as   he   may   put   out,   everything   has   served   as   a   part   of   a   larger  whole.  West  has  grown  through   his   music.   There’s   the   obvious   mini   arc  of  College  Dropout  to  Late  Regis-­ tration   to   Graduation.   And   while   that   last  album  serves  as  a  celebration  of  his   successes  to  that  point,  he  followed  it  up   eartbreak. To  continue   with  808s  &  Heartbreak.   with   the   college   metaphor,   maybe   808s  was  a  realization  of  what  the   real  world  has  in  store  for  every-­ 808s may   have   one.   For  West,   808s   been  a  record  of  self-­examina-­ tion  about  how  his  success  has  

robbed  him  of  something.   On  this  album,  we  are  introduced  to  West’s   Fantasy  from  the  get-­go.  Nicki  Minaj  delivers  a   monologue  that  focuses  on  the  “sick  addiction”   WKDWSHRSOHKDYHWRWKH³WZLVWHG¿FWLRQ´WKDWLV propagated  through  the  media  about  celebrities.   The   song   that   follows   is   the   highest   point   on   the  album  which  is  to  say  that  it’s  all  downhill   for  West  from  there  on  out,  thankfully  the  same   can’t   be   said   for   the   listener.   He   makes   a   deal   with  the  devil  in  this  song  that  informs  the  entire   rest  of  the  album.  He  seemingly  trades  fame  and   riches  for  the  ability  to  have  a  lasting,  meaning-­ ful  relationship  with  a  woman. The   real   relief   about   this   album   is   that   it   doesn’t  ever  sound  like  what  many  detractors  of   Drake  and  similar  rappers  would  call  “emo  rap.”   There  is  a  ton  of  emotion  here  but  West  goes  hard   the  whole  time.  He  has  mastered  the  art  of  being   vulnerable  while  still  being  very  strong.  The  du-­ ality  of  the  album  informs  everything. One  thing  that  is  very  different  from  his  last   two  outings  is  the  amount  of  guest  spots.  There   are   multiple   appearances   by   Jay-­Z,   Pusha   T,   Rick  Ross,  Minaj  and  surprisingly  Justin  Vernon   of  Bon  Iver  fame,  as  well  as  one-­off  performanc-­ es  from  John  Legend,  Raekwon  and  KiD  CuDi.   Fortunately,  the  album  never  feels  crowded.  This   might  be  because  no  song  is  shorter  than  4:17  but   all  of  the  guests  are  not  themselves  in  this  con-­ text.   (Bon   Iver   fans   won’t   even   recognize  Ver-­ non’s   voice   on   “Monster.”)   Instead,   they   serve   the  purpose  of  furthering  West’s  narrative,  of  il-­ lustrating  his  ideas.  Chris  Rock  shows ��up  for  a   bit  also,  but  even  he  is  a  character.  He  isn’t  Chris   Rock.  When  West  doesn’t  outshine  his  guests,  it   doesn’t  take  away  from  the  quality  of  the  record.   When  is  the  last  time  anyone  could  say  that  about a  hip-­hop  record? This  record  hits  you  everywhere  it  needs  to:   the   head,   the   heart   and   the   ol’   general   and   his   GXIÀHEDJV,WQHYHUOHWVXS:KDWLVJUHDWDERXW it   is   that   there’s   something   for   everyone.   Need   some   introspective   headphone   hip-­hop?   West’s   right  there  listening  to  the  other  ear  bud.  Need  to   get  psyched  to  go  out?  West’s  driving  the  party   bus.  Need  to  have  your  faith  restored  in  hip-­hop,   nay,  music  in  general?  West  is  behind  the  pulpit,   up  in  the  choir  loft  and  in  the  back  getting  drunk   off  the  sacraments. He’ll  make  you  believe.

Thursday,  December  2,  2010

ALL  PHOTOS  COURTESY  OF  BLOGSPOT.COM


10B  |  ARTS  &  ENTERTAINMENT

The  New  Paltz  Oracle

MOVIE REVIEW

LATEST HARRY POTTER FILM EXCELS ABOVE THE REST By  Andrew  Wyrich Sports  Editor  |  Andrew.wyrich63@newpaltz.edu

David  Yates  must  have  received  some  extra  help   on  his  wingardium  leviosa  spell,  because  the  level   of  quality  for  â&#x20AC;&#x153;Harry  Potter  and  the  Deathly  Hal-­ lows:  Part  1â&#x20AC;?  has  certainly  risen.   I  have  always  been  an  avid  fan  of  Harry   Potter.   The   series   has   grown   up   with   me,   and   I   canâ&#x20AC;&#x2122;t   think   of   anything   else   that   has   truly  captivated  me  as  much  as  the  magical   world   of   Harry   Potter.   I   remember   being   DFKLOGSLFNLQJXSWKHÂżUVWERRNDQGUHDG ing  it  with  my  grandmother,  and  anxiously   awaiting  the  release  of  the  seventh  book  all   those  years  ago.   That   being   said,   the   movies   have   been   something  that  I  have  always  struggled  to  truly   enjoy.  Each  movie  has  its  pros  and  cons  and  I  have   SUHWW\VWURQJRSLQLRQVRQHDFKRQH7KHÂżUVWWZRDUH childish  fun  and  almost  word-­for-­word  adaptations   RI WKH ERRNV ZKLOH WKH WKLUG ÂżOP LV EULOOLDQWO\ GL rected  and  has  its  own  identity.   0DQ\RIWKHRWKHUÂżOPVKRZHYHUVHHPHGWR struggle  and  fall  into  the  wrong  direction.  â&#x20AC;&#x153;Goblet   of  Fireâ&#x20AC;?  has  its  redeeming  moments,  but  is  over-­ all  pretty  lackluster.  â&#x20AC;&#x153;Order  of  the  Phoenixâ&#x20AC;?  has  a   pretty  cool  ending  but  fails  to  really  capture  the   feeling   of   the   book.   â&#x20AC;&#x153;Half-­Blood   Princeâ&#x20AC;?   mixes   humor  with  the  impending  doom  pretty  well  but   fails  to  recognize  the  deep  connections  and  intri-­ cacies  that  Voldemortâ&#x20AC;&#x2122;s  past  has.     â&#x20AC;&#x153;Deathly  Hallows:  Part  1â&#x20AC;?  changes  all  of  that.   ,FDQVD\ZLWKRXWDGRXEWWKDWLWZDVWKHEHVWÂżOPLQ the  series  (even  trumping  Alfonso  CuarĂłnâ&#x20AC;&#x2122;s  â&#x20AC;&#x153;Pris-­ oner   of  Azkabanâ&#x20AC;?),   and   while   only   being   half   of   a   QRYHOLWIHOWOLNHWKHPRVWFRPSOHWHÂżOPRIWKHIUDQ chise.   Each   predecessor   in   Harry   Potterâ&#x20AC;&#x2122;s   nine-­year   cinematic   lifespan   â&#x20AC;&#x201C;   except   for   â&#x20AC;&#x153;Azkaban,â&#x20AC;?   â&#x20AC;&#x201C;   has   left   me   feeling   empty   because   of   the   ODFN RI FLQHPDWLF YDOXH WKH ÂżOPV KDYH Each  novel  gave  the  directors  so  much   potential  to  create  an  epic  tale  of  tri-­ umph  and  tragedy,  but  they  failed  to   convert  that  to  the  silver  screen.   â&#x20AC;&#x153;Deathly   Hallows:   Part   1â&#x20AC;?   QRW RQO\ UHFRJQL]HG WKLV Ă&#x20AC;DZ but   completely   overturns   it.   I   Top:  Harry  Potter  with  friends  Hermione  and  Ron.  Bottom:  Voldemort   ZDV VWXSHÂżHG E\ WKH ÂżOPÂśV PHOTOS  COURTESY  OF  CRAZYTHEMES.COM

Thursday,  December  2,  2010

dark  tone,  and  ability  to  have  the  audience  truly  feel   the  constant  terror  and  oppression  that  Harry  and  the   wizarding  world  are  subjected  to.  The  movie  is  more   bleak,  more  dramatically  themed  and  the  most  com-­ SOH[3RWWHUÂżOP\HW*RQHDUHWKHGD\VRI+DUU\DQG his  friends  getting  into  mischief  at  Hogwarts.   Yates  uses  incredible  cinematography  to  capture   WKH URDPLQJ QDWXUH RI WKH ÂżOP Âł'HDWKO\ +DOORZV Part  1â&#x20AC;?  is  essentially  about  Harry,  Ron  and  Hermione   traveling  through  England  in  search  of  the  Horcrux-­ es  that  hold  pieces  of  Voldemortâ&#x20AC;&#x2122;s  soul.  The  camera   shots  are  long  and  oftentimes  spanning  across  large   landscapes,  almost  allowing  the  audience  to  believe   they  too  are  running  across  snow-­covered  forests  and   barren  landscapes.  The  way  many  of  the  scenes  are   shot  reminds  me  of  â&#x20AC;&#x153;The  Lord  of  the  Ringsâ&#x20AC;?  movies.   Almost   every   scene   fades   to   black   while   adding   to   WKHGDUNWKHPHVRIWKHÂżOPÂąDQGLPPHUVHVWKHDXGL ence  even  more. 7KH ÂżOP DOVR VXFFHHGV DW VKRZLQJ WKH GHHSHU human   element   of   the   situation   at   hand.  The   movie   opens   with   Hermione   erasing   herself   from   her   par-­ entsâ&#x20AC;&#x2122;  memory  to  protect  them.  No  other  movie  came   close  to  something  so  depressing.  Another  scene  that   stuck   out   was   Charity   Burbage   being   murdered   by   Voldemort  at  Malfoy  Manor. Helpless  and  afraid,  she  reaches  out  to  Snape  as   he  sits  across  the  table,  calling  him  her  friend.  Snape,   who  has  been  cold-­hearted  and  stone-­faced  through-­ out  the  entire  series,  actually  shows  a  momentâ&#x20AC;&#x2122;s  re-­ gret  in  his  decision  before  ultimately  allowing  Volde-­ mort  to  kill  her.  This  bit  of  emotion  shows  the  inner   struggle   Snape   is   dealing   with   as   he   works   for   the   Dark  Lord.   The   acting   in   â&#x20AC;&#x153;Deathly   Hallows:   Part   1â&#x20AC;?   also   sticks  out  like  the  tip  of  a  wand  after  a  lumos  charm.   Emma   Watson   (Hermione)   essentially   steals   the   show  with  her  compassionate  but  commanding  char-­ acter,  and  is  the  rock  that  holds  both  Ron  and  Harry   together.  Ralph  Fiennes  (Voldemort)  is  actually  scary   â&#x20AC;&#x201C;  which  is  impressive  considering  some  of  the  other   ÂżOPVÂśSRUWUD\DORIWKH'DUN/RUG7KHÂżQDOVFHQHRI WKHÂżOPDFWXDOO\VHQWFKLOOVGRZQP\VSLQH 2YHUDOOWKLVÂżOPVKLQHVLQFRPSDULVRQWRWKHRWK er   movies   in   the   franchise.  While   leading   up   to   the   HSLFÂżQDOHWKDWZLOOFRPHRXWLQ-XO\LWVWDQGVDORQH quite  well.  â&#x20AC;&#x153;Deathly  Hallows:  Part  1â&#x20AC;?  is  an  outstand-­ LQJ DGGLWLRQ WR WKH 3RWWHU VDJD DQG LW ÂżQDOO\ VKRZ FDVHGWKHSUHYDOHQWDQGLPSRUWDQWWKHPHVRIWKHÂżQDO few  novels.


ARTS  &  ENTERTAINMENT  |11B  

The  New  Paltz  Oracle MUSIC REVIEW

Stale Songs Fail to Soothe

BELLE & SEBASTIAN FALL SHORT OF PREVIOUS ALBUMS WITH NEWEST EFFORT

By  Zan  Strumfeld

Features  Editor  |  Sstrumfeld34@newpaltz.edu

After   a   four-­year   hiatus   since   2006â&#x20AC;&#x2122;s   The   Life   Pursuit,   Belle   &   Sebastian   reconvened   in   February   2010,   quickly   creating   Write   About   Love.   But   the   seven-­piece   group   jumped   too   quickly  into  recording,  releasing  the  album  just   eight   months   later.   While   fans   could   have   pre-­ dicted  the  same  catchy,  upbeat  rhythms  and  Brit-­ pop   sounds   off   of   The   Life   Pursuit   and   2003â&#x20AC;&#x2122;s   Dear  Catastrophe  Waitress,  Write  About  Love  is   missing  something:  progress.  Almost  every  song   off   of   Write  About   Love   has   been   heard   before   and  done  better  on  previous  albums.   See,   itâ&#x20AC;&#x2122;s   important   to   understand   Belle   &   6HEDVWLDQ KLVWRU\ 7KHLU ÂżUVW DOEXP ÂśV Ti-­ germilk,   and   the   four   albums   after   that   can   all   EHJURXSHGLQWKHVDPHVRUWRIJHQUHÂżOOHGZLWK

melancholy   but   intimate   tracks,   like   â&#x20AC;&#x153;The   Boy   :LWKWKH$UDE6WUDS´DQGDOZD\VZLWKDVXEWOH WRXFKRIZLWOLNHÂł6KHÂśV/RVLQJ,W´/DWHUWKH\ HPSKDVL]HG WKLV ZLW ZLWK Dear   Catastrophe   WaitressRIIHULQJDQHZVLGHWRWKHEDQGDVWKH\ explored   their   creative   ambition.   They   proved   they  had  so  much  hidden  beneath  their  Scottish   VOHHYHV HVSHFLDOO\ ZLWK WKH VKLQ\ DGYHQWXUH RI The  Life  Pursuit.  Yet  this  ambition  did  not  con-­ tinue  to  rise. Write  About  Love  is  still  a  good  album  for   DQ\ OLVWHQHU ,W KDV SRSS\ PHORGLHV HVSHFLDOO\ RQVRQJVOLNHÂł&RPHRQ6LVWHU´DQGÂł,:DQWWKH :RUOG WR 6WRS´ ZKLFK DUH GHÂżQLWH WRHWDSSHUV Âł6XQGD\ÂśV 3UHWW\ ,FRQV´ UHĂ&#x20AC;HFWV RQ WKHLU ROGHU material   on   a   lighter   note,   being   equally   as   catchy  and  fun.  But,  itâ&#x20AC;&#x2122;s  completely  missing  that   ÂłZRZ´IDFWRU

2QHKXJHGRZQIDOOWRWKHDOEXPLVWKHDS-­ SHDUDQFH RI 1RUDK -RQHV RQ Âł/LWWOH /RX 8JO\ -DFN3URSKHW-RKQ´,WÂśVWKDWUDLQ\GD\NLQGRI song  Jones  loves  to  sing,  but  its  dreariness  drags   PRUHLQWRDÂłGLG,UHDOO\MXVWVWHSLQDSXGGOH"´ YHUVXVÂł,ZDQWWRVWD\LQEHGDQGOLVWHQWRPXVLF´ ,WÂśVIRXUDQGDKDOIPLQXWHVZRUWKVNLSSLQJ 2QHWKLQJWKDWDOZD\VFRPHVDVDVKRFNHU LVWKHLUHYHUQRWVRVXEWOHORYHRI*RGVSHFLÂż-­ FDOO\LQÂł7KH*KRVWRI5RFNVFKRRO´Âł,ÂśYHVHHQ *RGLQWKHVXQ,ÂśYHVHHQ*RGLQWKHVWUHHW*RG before  bed  and  the  promise  of  sleep  /  God  in  my   dreams.â&#x20AC;?  The  song  isnâ&#x20AC;&#x2122;t  even  that  bad,  but  some-­ times  one  can  forget  their  emphasis  on  the  one   DERYH DQG LW FDQ EH TXLWH XQFRPIRUWDEOH ZKHQ youâ&#x20AC;&#x2122;re  singing  it. /LNHSUHYLRXVDOEXPVPDLQVRQJZULWHU6WX-­ DUW0XUGRFKFRQWLQXHVWRFRPSODLQDERXWZRUN-­

LQJWKHQLQHWR¿YHLQWKHWLWOHWUDFN³,KDWHP\ MRE,œPZRUNLQJZD\WRRPXFK HYHU\GD\,œP VWXFNLQDQRI¿FH ´ZKLFKLVEDVLFDOO\DSRRUO\ H[HFXWHGYHUVLRQRI³6WHS,QWR0\2I¿FH%DE\´ off  of  Dear  Catastrophe  Waitress.   :KDW ZDV WKH SRLQW RI WKH DOEXP" 7KH\ should  have  spent  their  time  focusing  on  provid-­ LQJDFRPHEDFNZLWKEUDQGQHZPDWHULDO7KH\ needed  to  present  their  next  stage  because  even   WKRXJK WKHLU WUXH IDQV ZLOO DOZD\V ORYH WKHP WKH\ ZRQœW DOZD\V EH WKHUH LI WKH EDQG GRHVQœW strive  to  make  improvements. This  album  is  a  fun  listen,  but  nothing  more   WKDQ WKDW ,W GRHVQœW H[SUHVV DQ\WKLQJ QHZ RU VKRZKRSHIRUVRPHWKLQJGLIIHUHQWLQIXWXUHDO-­ EXPV+RSHIXOO\%HOOH 6HEDVWLDQZLOOVWHHURII WKHLUFXUUHQWSDWKDQGUHPLQGIDQVZK\WKH\ZHUH ORYHGLQWKH¿UVWSODFH



My first choice: SUNY Rockland

Your next steps begin at Fordham University.

Fordham can start you on the road to a successful and rewarding career with masterâ&#x20AC;&#x2122;s, doctoral and professional diploma programs designed to jumpstart your future.

On break from a four-year college? Earn up to 4 credits in 3 weeks at RCCâ&#x20AC;&#x2122;s WINTERSESSION â&#x20AC;&#x201D; January 3-21, 2011

> More than 40 courses available, including online > Check online for complete listing > Credits transfer to four-year colleges* > Only $146 per credit

Our Graduate School of Education areas of study include: â&#x20AC;˘ Curriculum and Teaching â&#x20AC;˘ Educational Leadership, Administration and Policy â&#x20AC;˘ Psychological and Educational Services

tion sessio3np.!m. a rm fo in n a Join us for ednesday, 5 January 2011 | 1-

te r | W Li ncol n Cen

For more information or to rsvp: www.fordham.edu/gse | gse_admiss@fordham.edu | (212) 636-6400

*Check with your four-year college to ensure transferability.

GRADUATE SCHOOL OF EDUCATION

REGISTER NOVEMBER 22, 2010 ď&#x161;ťJANUARY 3, 2011 IN THE TECHNOLOGY CENTER www.sunyrockland.edu/go/wintersession 1-800-RCC-SOON 11-0697_GSE SUNY New Paltz Ad.indd

Thursday,  December  2,  2010

1

11/15/10

12:27 PM


%_7+('((3(1'

7KH1HZ3DOW]2UDFOH

7KLV:HHNLQWKH'HHS(QG

Kim Marra 0DMRU3DLQWLQJ <HDU6HFRQG ³,XVXDOO\WU\DQGWKLQNRID FRQFHSWDQGXVHLWLQDIHZ SLHFHVVRLWGHYHORSVDQG FKDQJHVDORQJWKHZD\,WDNH DORWRILQÃ&#x20AC;XHQFHIURPP\ IULHQGVDQGWHDFKHUVDQGDP H[FLWHGWRVWDUWGHYHORSLQJD PRUHSHUVRQDOVW\OH´

3+2726&2857(6<2)(0,/<1(5=,*&$37,21%</$85$/8(1*$6

7KXUVGD\$SULO


7KH1HZ3DOW]2UDFOH

23,1,21

3J

&$57221%<'(5(.=,00(50$11

-2,1,1*)25&(6)25$%(77(5&20081,7< ,W LV WLPH IRU WKH7RZQ DQG9LOODJH RI 1HZ 3DOW] WR PHUJH LQWR D VLQJOH ERG\RIJRYHUQPHQW $ FRQVROLGDWLRQ RI WKHVH WZR JRY HUQLQJ ERGLHV ZRXOG UHGXFH FRVWV IRU WD[SD\HUVDQGPDNHFOHDUHUVRPHRIWKH PXUN\ ERXQGDULHV WKDW VHSDUDWH YLOODJH DQGWRZQ,QDWLPHZKHQORFDOEXGJHWV DFURVVWKHQDWLRQDUHSDVVHGDIWHUKDYLQJ PDGH KXJH VDFUL¿FHV WR VHUYLFHV WDNHQ KHIW\WROOVRQWD[SD\HUV¶ZDOOHWVRUERWK ZH EHOLHYH WKH VWXG\ EHLQJ FRQGXFWHG IRUWKLVVXPPHULV1HZ3DOW]¶VRSSRUWX QLW\WR¿QDOO\GHFLGHRQDSODQWRUHGXFH LWVSHUVRQDOFRVWVDQGWKHFRPSOH[LW\RI WKHORFDOJRYHUQPHQWWKH\OLYHXQGHU $OWKRXJK KDUG GDWD RQ WKH DPRXQW UHVLGHQWV FRXOG VDYH IURP D SRVVLEOH PHUJH LV QRW \HW DYDLODEOH LW LV FHUWDLQ WKDWUHVLGHQWVOLYLQJLQWKHQHZERG\RI

JRYHUQPHQWZLOOSUR¿WIURPDYDULHW\RI EHQH¿WV WKDW PXQLFLSDOLWLHV RIWHQ HQMR\ DIWHUFRQVROLGDWLQJVHUYLFHV $GYDQWDJHVRIDPHUJHEHWZHHQWKH WRZQ DQG YLOODJH FRXOG LQFOXGH IHZHU ORFDO JRYHUQPHQWDO HPSOR\HHV WR SD\ OHVV LQ ¿JKWLQJ EHWZHHQ ORFDO RI¿FLDOV DQG D JUHDWHU PHDQV RI FRRSHUDWLRQ DPRQJVW WRZQ DQGRU YLOODJH HOHFWHG UHSUHVHQWDWLYHV REOLJDWRU\ FRVWV RI WKH WRZQ OLNH KHDOWK LQVXUDQFH DQG KLJK ZD\ VHUYLFHV FRXOG EH UHGXFHG DQG D ³JUHDWHU SXUFKDVLQJ SRZHU´ XQGHU WKH QHZERG\RIJRYHUQPHQW $FFRUGLQJ WR 681< 1HZ 3DOW] SURIHVVRU RI VWDWH DQG ORFDO SROLWFV *HUDOG %HQMDPLQ PDQ\ PXQLFL SDOLWLHV DUH RIWHQ UHVLVWDQW WR HIIRUWV WRZDUGVFRQVROLGDWLRQ ³$OWKRXJK WKH OD\HULQJ DQG FRP

SOH[LW\ RI ORFDO JRYHUQPHQW LQ 1HZ <RUN LQFUHDVHV FRVWV DQG UHGXFHV WKH DFFRXQWDELOLW\ RI HOHFWHG RI¿FLDOV WR WKH FLWL]HQU\´ KH ZDV TXRWHG LQ ³1HZ <RUN 6WDWH *RYHUQPHQW´ E\ 5REHUW % :DUG ³HIIRUWV WR UHGXFH WKH QXPEHU RI ORFDO JRYHUQPHQWV KDYH PHW ZLWK OLWWOHVXFFHVV´ :H EHOLHYH D PHUJH LV OHJLWLPDWH DQG ZH VWURQJO\ EHOLHYH FRQVROLGDWLQJ 1HZ 3DOW] VHUYLFHV DQGRU JRYHUQPHQW ZLOOEHDJUHDWEHQH¿WWRWKHFRPPXQLW\ 1HZ <RUN *RYHUQRUHOHFW $QGUHZ &XRPRPDGHJRYHUQPHQWFRQVROLGDWLRQ LQ 1HZ<RUN 6WDWH SDUW RI KLV SODWIRUP DV KH FDPSDLJQHG LQ WKH JXEHUQDWRULDO HOHFWLRQ ³*RYHUQPHQW LQ 1HZ <RUN LV WRR ELJ LQHIIHFWLYH DQG H[SHQVLYH´ &XR PR¶V ZHEVLWH VDLG ³:H PXVW PDNH

LW HDVLHU WR FRQVROLGDWH RU VKDUH VHU YLFHV DPRQJ RXU PRUH WKDQ  ORFDOJRYHUQPHQWV´ %\ YRWLQJ WR PHUJH WKH WRZQ DQG WKH YLOODJH UHVLGHQWV FDQ UHGXFH ZKDW WKH\¶UHSD\LQJDQGDGYDQWDJHWKHLUPX QLFLSDOLW\ZLWKDQXPEHURIEHQH¿WVWKDW FRQVROLGDWHGJRYHUQPHQWVHQMR\ :HKRSHWKDWUHVLGHQWVRI1HZ3DOW] DFNQRZOHGJHWKLVDQGEULQJLWWRDYRWH QH[W\HDU (GLWRULDOVUHSUHVHQWWKHYLHZVRIWKHPDMRU LW\RIWKHHGLWRULDOERDUG&ROXPQVRSHGV DQGOHWWHUVH[FOXGLQJHGLWRULDOVDUHVROHO\ WKRVHRIWKHZULWHUVDQGGRQRWQHFHVVDULO\ UHSUHVHQWWKHYLHZVRI7KH1HZ3DOW]2UDFOH LWVVWDIIPHPEHUVWKHFDPSXVDQGXQLYHUVLW\ RUWKH7RZQRU9LOODJHRI1HZ3DOW]

/HWWHUVWRWKHHGLWRUFDQEHVXEPLWWHGWRRUDFOH#QHZSDOW]HGX RUYLDPDLOWR6WXGHQW8QLRQE\SPRQ6XQGD\V :HDVNWKDWOHWWHUVDUHQRPRUHWKDQZRUGVGXHWRVSDFLDOOLPLWDWLRQV 7KXUVGD\'HFHPEHU


3J

'HDU,QWHULP3UHVLGHQW&KULVWLDQ 2YHU WKH SDVW IHZ ZHHNV 8QLWHG 8QLYHUVLW\3URIHVVLRQV 883 ([HFXWLYH %RDUG PHPEHUV DQG DFDGHPLF GHSDUW PHQW FKDLUV KDYH HQJDJHG LQ H[WHQVLYH GLVFXVVLRQ DERXW WKH EXGJHW VLWXDWLRQ :H KDYH FRPH WRJHWKHU DV SURIHVVLRQ DOV DQG DFDGHPLFV IXOOWLPH DQG SDUW WLPH HPSOR\HHV DQG UHSUHVHQWDWLYHV RI YDULRXV FRQVWLWXHQFLHV DFURVV FDPSXV :H KDYH KHOG YDULRXV PHHWLQJV DQG PDLQWDLQHG GLDORJXH WKURXJK DGGLWLRQDO VPDOOHUPHHWLQJVDQGHPDLOH[FKDQJHV ,Q DQ HIIRUW WR UHVSRQG WR \RXU FDOOV IRU FRQVWUXFWLYH LGHDV DQG VXJJHVWLRQV ZH KDYHVSHQWFRQVLGHUDEOHWLPHGLVFXVVLQJ WKH EXGJHW VLWXDWLRQ ZLWK FDPSXV FRP PXQLW\ PHPEHUV ZH UHSUHVHQW LQ RUGHU WRJHWDFOHDUSLFWXUHRIWKHH[SHULHQFHV DQG SHUFHSWLRQV RI WKRVH DW WKH JURXQG OHYHORIPDQ\RIRXUFDPSXVRSHUDWLRQV 2XU IRUHPRVW REMHFWLYHV DUH WR IRVWHU FRPPXQLFDWLRQ DERXW DQG XQGHUVWDQG LQJRIWKHVHULRXVQHVVRIWKHEXGJHWFUL VLVDQGGHYHORSFRQVWUXFWLYHVXJJHVWLRQV IRUDGGUHVVLQJEXGJHWVKRUWIDOOVLQZD\V WKDWSUHVHUYHWKHPLVVLRQRI681<1HZ 3DOW] DQG PDLQWDLQ HPSOR\PHQW IRU DOO ZKRFXUUHQWO\VHUYHRXULQVWLWXWLRQ $VDUHVXOWRIRXULQIRUPDWLRQVKDU LQJ LW LV FOHDU WR XV WKDW D VXEVWDQWLDO SRUWLRQRIWKHFDPSXVFRPPXQLW\LVQRW DGHTXDWHO\ LQIRUPHG DERXW DFWLRQV \RX DOUHDG\ KDYH WDNHQ RU PD\ EH SODQQLQJ WR WDNH DW YDULRXV OHYHOV RI WKH FROOHJH :KLOHZHKDYHWULHGWRWDSSHRSOH¶V¿UVW KDQG NQRZOHGJH DQG XQGHUVWDQGLQJ RI FRUH FDPSXV IXQFWLRQV DQG DFWLYLWLHV LQ RUGHU WR GHYHORS FRQVWUXFWLYH DQG SUDF WLFDOVXJJHVWLRQVWRVDYHPRQH\DQGXVH UHVRXUFHV HI¿FLHQWO\ DQG HIIHFWLYHO\ ZH DUH KDPSHUHG E\ DQ LQDGHTXDWH XQGHU VWDQGLQJRIZKDWKDVDOUHDG\EHHQGRQH WR DGGUHVV EXGJHW VKRUWIDOOV $OWKRXJK PDQ\ RI XV NQRZ VRPH WKLQJV QRQH RI XVFDQVHHWKHFRPSUHKHQVLYHSLFWXUHRI ZKDWKDVEHHQGRQHDQGZKDWPD\EHRQ WKHKRUL]RQ:HEHOLHYHZHFDQPRUHHI IHFWLYHO\ FRQIURQW WKH EXGJHW FULVLV E\ ZRUNLQJ WRJHWKHU WR XQFRYHU WKH EHVW SRVVLEOH DOWHUQDWLYHV ,Q WKH LQWHUHVWV RI PRYLQJ IRUZDUG ZH DVN WKDW \RX FRQ VLGHUWKHDWWDFKHGTXHVWLRQVDQGSURYLGH XVZLWKDVPXFKLQIRUPDWLRQDVSRVVLEOH LQUHVSRQVHWRWKRVHTXHVWLRQV:HWUXO\ EHOLHYHWKDWDV\VWHPDWLFSUHVHQWDWLRQRI UHOHYDQWLQIRUPDWLRQWRWKHFDPSXVFRP

23,1,21

/(77(56 PXQLW\ ZLOO IDFLOLWDWH FRQVWUXFWLYH GLD ORJXHWKDWFDQOHDGWRQHZLGHDVDVZHOO DV SRVVLEOH UHIRUPXODWLRQ RI LGHDV WKDW KDYH EHHQ ³Ã&#x20AC;RDWHG´ EXW QRW V\VWHPDWL FDOO\YHWWHG :H UHDOL]H WKDW RXU OLVW LV ORQJ DQG WKDWVRPHRIWKHTXHVWLRQVDUHFRPSOH[ EXW ZH DVVXPH WKDW VRPH DQVZHUV DUH UHDGLO\ DYDLODEOH WR DGPLQLVWUDWRUV ZKR DUH GHDOLQJ ZLWK WKH LVVXHV DW KDQG RQ D IRFXVHG EDVLV ,I \RX DUH DEOH WR SUR YLGHXVZLWKDVPDQ\DQVZHUVDVSRVVLEOH LQ ZULWLQJ ZLWKLQ WKH QH[W WZR WR WKUHH ZHHNV LW ZLOO KHOS XV WR IDFLOLWDWH FRQ VWUXFWLYHGLDORJXHLQIRUPDWLRQJDWKHULQJ DQG SUHVHQWDWLRQ RI VXJJHVWLRQV IRU \RX WRFRQVLGHU:HKDYHVFKHGXOHGDVHULHV RIPHHWLQJVDQGKRSHWREHDEOHWRPRYH IRUZDUGIURPDPRUHLQIRUPHGSHUVSHF WLYHWKDQZHIHHOZHKDYHDWWKHPRPHQW :H DSSUHFLDWH \RXU HIIRUWV WR EH WUDQVSDUHQW DQG KRSH ZH FDQ IDFLOLWDWH PRUH HIIHFWLYH FDPSXVZLGH SUREOHP VROYLQJ LQ RUGHU WR JHW XV WKURXJK WKHVH GLI¿FXOW WLPHV :H XQGHUVWDQG WKH VHUL RXV VLWXDWLRQ \RX IDFH DQG VXSSRUW \RX LQ IXUWKHULQJ RXU FROOHFWLYH PLVVLRQ WR SURYLGH VWXGHQWV ZLWK WKH EHVW SRVVLEOH HGXFDWLRQDOH[SHULHQFHDW1HZ3DOW]

$DURQ,VDEHOOH(OHPHQWDU\(GXFDWLRQ 0DUJDUHW-RKQVRQ$UW(GXFDWLRQ $P\.HVVHOPDQ:RPHQ¶V6WXGLHV (OOHQ.RQRZLW]$UW+LVWRU\ 7KRPDV1ROHQ%LRORJ\ %ULDQ2EDFK6RFLRORJ\ 7KRPDV2OVHQ(QJOLVK *RZUL3DUDPHVZDUDQ(GXFDWLRQDO6WXGLHV )UHGHULFN9ROOPHU*HRORJ\ 

7KH1HZ3DOW]2UDFOH

ZKLFK YDFDQW IXOOWLPH SRVLWLRQV KDYH EHHQ¿OOHGDQGZKLFKRQHVKDYHUHPDLQ XQ¿OOHG" H+RZZLOO¿OOLQJYDFDQWSRVLWLRQVLQWKH IXWXUHEHSULRULWL]HG" 3DUW7LPH(PSOR\HHV :KDW LI DQ\ HIIRUWV ZLOO EH PDGH WR NHHSSDUWWLPHHPSOR\HHVDWDOHYHOWKDW ZRXOG HQWLWOH WKHP WR FRQWLQXHG KHDOWK EHQH¿WV"

48(67,216 5HVSRQVHVWR%XGJHW&XWVWR'DWH D:KDWVSHFL¿FFXWVKDYHEHHQPDGH LQ DOO DUHDV RI WKH FROOHJH RYHU WKH ODVW WKUHH\HDUVLQUHVSRQVHWRWKHEXGJHWVLWX DWLRQ" E+RZPXFKPRQH\ZDVVDYHGE\PDN LQJHDFKRIWKHVHFXWV"  D +DYH WKHUH EHHQ LQFUHDVHV LQ UHY HQXHJHQHUDWLQJ DFWLYLWLHV RYHU WKH ODVW WKUHH\HDUV" E ,I VR ZKDW DUH WKH\ DQG KRZ PXFK DGGLWLRQDO UHYHQXH KDV EHHQ JHQHUDWHG WKURXJKHDFK"

&DSLWDO&RQVWUXFWLRQ5HQRYDWLRQVDQG([SDQVLRQ  D :LOO WKHUH EH DQ\ FXUWDLOPHQW RI SODQQHGFDSLWDOFRQVWUXFWLRQUHQRYDWLRQV RU H[SDQVLRQ DQG LI VR ZKLFK SURMHFWV ZLOOEHFXUWDLOHG" E+DVWKHH[SHQVHIRUVWDI¿QJDQGPDLQ WHQDQFHXSNHHS RI QHZ IDFLOLWLHV EHHQ IDFWRUHG LQWR ORQJWHUP SODQQLQJ IRU UH VRXUFHFRQVWUDLQWVLQWRWKHIXWXUH"

5HVHUYH)XQGV &DQ\RXSURYLGHXVZLWKDOLVWRI DOOWKHUHVHUYHIXQGVDW681<1HZ3DOW] LQFOXGLQJ WKRVH FRQWUROOHG FHQWUDOO\ DQG WKRVHDGPLQLVWHUHGE\WKH3URYRVW'HDQV 6WDWXVRI6XJJHVWLRQV5HFHLYHG DQG RWKHUV" 3OHDVH VSHFLI\ WKH DPRXQW D:KDWKDVEHFRPHRIWKHOLVWRILGHDV RI IXQGV LQ HDFK WKHLU YDULRXV IXQGLQJ FROOHFWHGIRUVDYLQJPRQH\RQFDPSXV" VRXUFHV WXLWLRQIHHVHWF DQGWKHW\SL 6LQFHUHO\ E&DQ\RXSURYLGHXVZLWKDOLVWRIWKH FDODQQXDODPRXQWVRIUHSOHQLVKPHQWDV 5LFKDUG.HOGHU3UHVLGHQW883 VXJJHVWLRQV WKDW KDYH EHHQ LPSOHPHQW ZHOO DV DQ\ OHJDO UHVWULFWLRQV DWWDFKHG 1HZ3DOW]&KDSWHU HG DQG WKH FRVW VDYLQJV DVVRFLDWHG ZLWK WKHUHWR" HDFK" 0HPEHUVRIWKH([HFXWLYH&RPPLWWHH F&DQ\RXSURYLGHXVZLWKDOLVWRIVXJ *HQHUDO4XHVWLRQV 3HWHU '* %URZQ 93 IRU $FDGHP JHVWLRQVWKDWZHUHQRWLPSOHPHQWHGDQG ,VWKHUHDPRUDWRULXPRQWKHGHYHORS LFV/LQGD6PLWK93IRU3URIHVVLRQDOV WKH UDWLRQDOH IRU WKHLU UHMHFWLRQ" :KDW PHQWRIQHZDFDGHPLFRUXQLWSURJUDPV <YRQQH $VSHQJUHQ 93 IRU 3DUW 7LP VDYLQJVZRXOGKDYHEHHQUHDOL]HGLIWKH\ RU RQ LQFUHDVHV LQ WKH VFRSH RI H[LVWLQJ HUV &ROOHHQ %UXOH\ 6HFUHWDU\ $ODQ ZHUHLPSOHPHQWHG" SURJUDPV" 'XQHIVN\ 7UHDVXUHU  /DUU\ )LDONRZ G$UHWKHUHDQ\VXJJHVWLRQVWKDWSUHVHQW  D ,V DQ\ RI WKH FXUUHQW DVVHVVPHQW *ULHYDQFH2I¿FHU$FDGHPLF'HOHJDWHV ORQJWHUP VROXWLRQV WR DGGUHVV H[SHFWHG ZRUN EHLQJ GRQH E\ WKH IDFXOW\ QRW UH 6XVDQ /HKUHU %HWK (ODLQH :LOVRQ 6X EXGJHWVKRUWIDOOVLQWRWKHIXWXUH" TXLUHGIRUDFFUHGLWDWLRQ" VDQ3XUHW]-RKQ+DLQ+HDWKHU:KDOHQ H :HUH WKHUH DQ\ GLVFXVVLRQVVXJJHV E &DQ ZH GHOD\ *( DVVHVVPHQW XQWLO 6PLWK -HIIUH\ 0LOOHU -RHO /HINRZLW] WLRQVIRUZD\VWRLQFUHDVHUHYHQXH",IVR VXFKWLPHDVIXQGLQJLVUHVWRUHG" $-:LOOLDPV0\HUV-HII&UDQH0DU\ ZKDW ZHUH WKH\" +DYH DQ\ EHHQ LPSOH $UHWKHUHDQ\SODQVWRHOLPLQDWHH[ DQQ)DOOHN3URIHVVLRQDO'HOHJDWHV'RQ PHQWHGDQGWRZKDWOHYHORIVXFFHVV" LVWLQJSURJUDPVRUFRPELQHGHSDUWPHQWV QD*RRGPDQ(G)HOWRQ*OHQQ0F1LWW XQLWVWKDWFXUUHQWO\RSHUDWHVHSDUDWHO\" 6WDWHZLGH([HFXWLYH%RDUGPHPEHU 9DFDQW3RVLWLRQV +DVWKHUHEHHQDQDVVHVVPHQWRIKRZ  D &DQ \RX SURYLGH XV ZLWK D OLVW RI LQFUHDVHG FODVV VL]H DQGRU LQFUHDVHG 'HSDUWPHQWDO&KDLUV FXUUHQWO\XQ¿OOHGIXOOWLPHSRVLWLRQV" WHDFKLQJ ORDG LQ FRQMXQFWLRQ ZLWK FRQ %DEDFN$]DGL (OHFWULFDO DQG &RPSXWHU E'RHVWKLVQXPEHULQFOXGHXQ¿OOHG0& WLQXHGVHUYLFHGHPDQGV ZLOOLPSDFWSUR (QJLQHHULQJ SRVLWLRQVDQGLIQRWZKDW0&SRVLWLRQV IHVVLRQDO GHYHORSPHQW VFKRODUVKLS DQG .DUDQMD.HLWD&DUUROO%ODFN6WXGLHV DUHFXUUHQWO\XQ¿OOHG" UHVHDUFK" 0DU\&KULVWHQVHQ)RUHLJQ/DQJXDJHV F&DQ\RXSURYLGHXVZLWKDOLVWRIDQ\ &DUROH&RZDQ0XVLF QHZ SRVLWLRQV WKDW KDYH EHHQ FUHDWHG 9LFWRU'H0XQFN$QWKURSRORJ\ RYHUWKHSDVWWKUHH\HDUV" 'DQLHO)UHHGPDQ&KHPLVWU\ G:KDWLVWKHEDVLVIRUGHFLVLRQVDERXW

7KXUVGD\'HFHPEHU


SPORTS

The  New  Paltz  Oracle

Pg 11

SPORTS THE  NEW  PALTZ  ORACLE

LE

AD

S T Rob EN ert   N B Pa IS ru le ge T y   O  13 TH ET OP

ON THE RIGHT TRACK

7KH:RPHQœV&URVV&RXQWU\WHDPSODFHG¿IWKRXWRIDW681<$&VDQGWKRXWRIWHDPVDWWKHUHJLRQDOFKDPSLRQVKLSV By  Cat  Tacopina   Staff  Writer  |  Ctacopina97@newpaltz.edu

Womenâ&#x20AC;&#x2122;s   Cross   Country   ended   itâ&#x20AC;&#x2122;s   season   on  the  right  track,  jumping  up  one  place  in  the   SUNYAC   conference   and   moving   up   three   spots   at   the   NCAA   Division   III   Atlantic   Re-­ gional  Cross  Country  Championships.   7KHZRPHQÂśVWHDPSODFHGÂżIWKRXWRIDW 681<$&VDQGWKRXWRIWHDPVDWWKHUH gional  championships. â&#x20AC;&#x153;We   had   a   really   excellent   season,â&#x20AC;?   said   Cross  Country  Head  Coach  Mike  Trunkes.  â&#x20AC;&#x153;We   have  done  a  lot  of  great  work  this  season  and  it   sets  us  up  to  do  even  better  in  the  future.â&#x20AC;? Trunkes   and   team   members   are   in   agree-­ ment  that  this  season  was  a  drastic  improvement   from   last   season.   Aside   from   the   accomplish-­ ments  the  team  has  made  as  a  collective  group,   individuals  have  also  succeeded  such  as  second-­ year  Nichole  Wischoff  and  fourth-­year  Danielle   Harmon,  who  now  holds  the  SUNY  New  Paltz   UHFRUGIRUWKH.ZLWKDWLPHRI Âł'DQLHOOH KDV GHÂżQLWHO\ EHHQ RXU PRVW

consistent  runner  over  the  past  four  years.  She   always  pushes  herself  to  do  her  best  and  has  a   TXLHWDVVXUHGFRQÂżGHQFHWRKHU´7UXQNHVVDLG â&#x20AC;&#x153;Her   and   Nichole   have   been   very   back   and   forth   this   season.   They  are  always  push-­ ing   each   other   to   do   better   than   the   other,   which   sets   a   good   ex-­ ample   for   the   rest   of   the  team  and  brings  us   as   a   group   to   the   next   level.â&#x20AC;? This   season,   Trunkes  said  Wischoff   and   Harmon   have   had   the   most   success   run-­ ning   Cross   Country   for  New  Paltzâ&#x20AC;&#x2122;s  Wom-­ enâ&#x20AC;&#x2122;s  Team.    Both  women  clocked  strong  times   throughout  the  entire  season  and  their  successes   have  pushed  the  others  to  improve  themselves.   Not   only   do   they   have   this   to   drive   them,   but  

PHOTO  COURTESY  OF  NEW  PALTZ  SPORTS  INFORMATION

they  also  are  both  gifted  runners  who  are  always   willing  to  work  extremely  hard. Harmon  attributed  her  success  to  all  of  the   hard  work  she  put  into   the  season.   â&#x20AC;&#x153;I  think  that  people   can   be   naturally   fast,   but   I   also   think   that   that   does   not   amount   to  much  if  you  are  not   willing   to   work   hard   for  what  you  want  and   get  to  where  you  want   to  go,â&#x20AC;?  Harmon  said.   Working  hard  was   something   Wischoff   believed   was   impor-­ tant  as  well.   â&#x20AC;&#x153;I   have   been   working   really   hard,â&#x20AC;?   said  Wischoff  when  asked  the  same  question,  â&#x20AC;&#x153;I   UXQDERXWPLOHVSHUZHHNDQG,WKLQNWKDW is  what  has  made  me  better.  If  we  all  put  in  the   effort  we  can  put  ourselves  even  higher  in  the  

â&#x20AC;&#x153;We   have   done   a   lot   of   great   work   this   season  and  it  sets  us   up  to  do  even  better   in  the  futureâ&#x20AC;?  â&#x20AC;&#x201D;  Mike  Trunkes

7KXUVGD\'HFHPEHU

standings.â&#x20AC;? New  Paltzâ&#x20AC;&#x2122;s  main  competitors  every  year  are   the  SUNYAC  schools,  and  they  are  the  schools   that   Trunkes   wants   to   keep   the   most   focus   on   now  and  in  the  future.   â&#x20AC;&#x153;We   are   really   proud   and   excited   that   we   were  able  to  beat  Brockport  and  Oneonta,  who   are  both  nationally  ranked  teams,â&#x20AC;?  Trunkes  said.   Âł&RUWODQG*HQHVHRDQG3ODWWVEXUJKÂżQLVKHGLQ the  top  three  for  the  championships  this  season   and  are  all  nationally  ranked.  Next  season,  we   are  looking  to  be  more  competitive  with  these   teams.â&#x20AC;? Along   with   upping   the   competitiveness   of   the   team,   Trunkes   and   his   athletes   are   focus-­ ing  mostly  on  the  championship  stretch  for  next   season,   and   are   looking   to   keep   growing   as   a   team. â&#x20AC;&#x153;I  think  that  if  everyone  works  really  hard,   we  can  get  to  where  we  need  to  be.  It  takes  com-­ mitment  and  time,  but  we  have  a  young  team,   and  I  think  that  if  everyone  buckles  down,  weâ&#x20AC;&#x2122;re   going  to  be  able  to  just  run,â&#x20AC;?  Trunkes  said.


The  New  Paltz  Oracle

SPORTS

Pg 12

Quidditch  Flies  Into  SUNY  New  Paltz   By  Cat  Tacopina   Staff  Writer  |  Ctacopina97@newpaltz.edu

Muggles,   can   prepare   to     man   their   brooms  now  that  Quidditch  is  coming  back   to  New  Paltz.   'XPEOHGRUHÂśV$UP\WKHRIÂżFLDO+DUU\ Potter   Fan   Club   at   SUNY   New   Paltz,   is   planning   on   re-­introducing   a   competitive   Muggle  Quidditch  team  next  semester.     â&#x20AC;&#x153;We  wanted  to  bring  it  back,  especially   since  College  Quidditch  is  becoming  more   recognized,â&#x20AC;?   said   founder   and   president   of  the  New  Paltz  chapter  of  Dumbledoreâ&#x20AC;&#x2122;s   Army  Beverly  Schreiber.  â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re  really  ex-­ cited  about  it.â&#x20AC;? In   the   wake   of   the   â&#x20AC;&#x153;Potter   maniaâ&#x20AC;?   that   has  swept  the  world  in  the  past  few  months   ZLWK WKH UHOHDVH RI Âł+DUU\ 3RWWHU DQG WKH 'HDWKO\+DOORZV3DUW´DQGWKHRSHQLQJ RIWKH:L]DUGLQJ:RUOGRI+DUU\3RWWHUDW Universal   Studios,   SUNY   New   Paltz   fans   will  soon  have  a  chance  to  show  their  skills.   Schreiber   said   that   the   school   had   a  

Quidditch  team  a  couple  of  years  ago,  but   the  team  has  since  disbanded. Muggle   Quidditch   (also   known   as   â&#x20AC;&#x153;Ground  Quidditchâ&#x20AC;?)  has  picked  up  plenty   of  momentum  since  its  creation  at  Middle-­ bury  College  in  2006.  The  game  has  since   been  featured  on  the  front  page  of  The  Wall   Street  Journal,  ESPN  Magazine  and  CBS.     In   2010,   the   fourth   Quidditch   World   Cup   was  hosted  by  the  International  Quidditch   Association   in   New   York   City   with   46   schools   in   attendance,   20,000   spectators   and  757  athletes  represented  in  total.   The   World   Cup   was   taken   by   Middle-­ bury  College  for  the  fourth  year  in  a  row,   but   neighbor   Vassar   College   was   able   to   obtain  fourth  place  out  of  the  46  schools. Of   course   since   all   of   the   players   at   New   Paltz   are   muggles,   Quidditch   cannot   EHSOD\HGWKHVDPHZD\LWLVLQWKH+DUU\ 3RWWHU XQLYHUVH DXWKRU -. 5RZOLQJ ÂżUVW imagined   more   than   a   decade   ago.    As   in   WKH +DUU\ 3RWWHU ERRNV WHDPV FRQVLVW RI VHYHQ SOD\HUV D NHHSHU WKUHH FKDVHUV

two  beaters  and  a  seeker.  The  only  differ-­ ences  are  that  players,  while  they  do  have   broomsticks,   run   on   the   ground   with   the   broomstick   in   between   their   legs   and   the   VQLWFK LV QRW D JROGHQ EDOO WKDW Ă&#x20AC;LHV LW LV a  person.  The  snitch  in  Muggle  Quidditch   is  a  student,  usually  a  cross-­country  runner   who  is  allowed  to  run  anywhere  he  or  she   wants   and   is   the   only   person   in   the   game   allowed   to   do   so.     The   snitch   dresses   en-­ tirely  in  yellow  and  the  game  is  over  once   the  seeker  from  either  team  playing  catches   up  to  them  and  tags  them.  Once  the  snitch   is  tagged,  the  game  is  over. While  New  Paltzâ&#x20AC;&#x2122;s  soon-­to-­be  team  will   probably  not  be  seeing  the  New  York  City   tournament  anytime  soon,  it  is  certainly  the   goal  for  the  future.   â&#x20AC;&#x153;We  want  to  start  by  having  all-­campus   tryouts   next   semester,â&#x20AC;?   said   Schreiber.     â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ll  play  within  the  campus  to  start,  but   we  would  like  to  play  Vassar  soon  and  ul-­ timately  get  to  the  World  Cup  in  New  York   City.â&#x20AC;?

Dumbledoreâ&#x20AC;&#x2122;s  Army  is  hoping  that  stu-­ dents  join  the  team,  and  are  already  think-­ ing  of  ways  to  get  people  involved. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re   going   to   try   as   best   we   can   to   JHWORWVRISHRSOHLQYROYHG´VDLGÂżUVW\HDU 3XEOLF 5HODWLRQV 2IÂżFHU 1LFROH %ULQNOH\ â&#x20AC;&#x153;I  would  really  like  to  have  members  of  the   club  walk  around  with  broomsticks  for  the   day  so  that  people  will  take  notice.â&#x20AC;? Despite   this,   the   club   may   not   need   to   do  much  to  get  people  involved,  let  alone   LQWHUHVWHG+DUU\3RWWHUIDQVRQFDPSXVDUH already  brimming  with  excitement  over  the   possibility  of  a  Quidditch  team.   â&#x20AC;&#x153;I   know   the   school   had   one   a   couple   years  ago,  and  I  always  thought  it  was  cool   watching   people   running   around   on   the   Quad   with   broomsticks,â&#x20AC;?   said   fourth-­year   art   education   major   Mimi   Grossman.   â&#x20AC;&#x153;It   would  be  really  fun  to  see  it  come  back.â&#x20AC;? First-­year   undeclared   student   Lauren   Levin  already  has  plans  to  try  out.   â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m  looking  forward  to  it,â&#x20AC;?  Levin  said.   â&#x20AC;&#x153;Count  me  in!â&#x20AC;?

   

ONLINEWINTERSESSION2011 Â&#x201D;Earn4creditsin3weeks! Â&#x201D;Getajumpstart,complete

 Â&#x201D;

requirements,graduate sooner!

Takeacoursefromthe comfortofyourhome,a beach,oranylocation!



ClassesstartJanuary3rd REGISTERNOW!

WWW.PURCHASE.EDU/WINTER (914)251Ͳ6500Â&#x201D;winter@purchase.edu

Thursday,  December  2,  2010


The  New  Paltz  Oracle

Pg 13

SPORTS

Bruley  Brings  Tennis  From  Worst  to  First ByAndrew  Wyrich   6SRUWV(GLWRU_Andrew.wyrich63@newpaltz.edu

7KHEHLJHSDLQWRI5REHUW%UXOH\¶VRI¿FHZDOOVLVEDUHO\YLV LEOHEHQHDWKWKHDZDUGVDQGSLFWXUHVKLJKOLJKWLQJKLV\HDUVRI VXFFHVVIXOWHQQLVDW681<1HZ3DOW]+RZHYHU%UXOH\¶VVXFFHVV IXOWHQXUHDVDWHQQLVKHDGFRDFKZDVQRWDOZD\VKLVSODQDQGEHJDQ E\FKDQFH %UXOH\ WKH :RPHQ¶V 7HQQLV FRDFK DW 681< 1HZ 3DOW] EURXJKWWKHSURJUDPIURPODVWSODFHWRFRQWHQWLRQVLQFHEHLQJDS pointed  to  the  position  in  1998  and  is  the  most  successful  coach  in   :RPHQ¶V7HQQLVKLVWRU\DFFRXQWLQJIRUSHUFHQWRIWKHSURJUDP¶V YLFWRULHVLQFOXGLQJD681<$&FKDPSLRQVKLSWKLVSDVWVHDVRQ %UXOH\ ZDV UHFRJQL]HG E\ KLV SHHUV DQG DZDUGHG KLV IRXUWK &RDFKRIWKH<HDUDZDUGIRUWKH+DZN¶VVXFFHVV %UXOH\ZKRJUHZXSLQ(QJODQGFDPHWRWKH8QLWHG6WDWHV WRSXUVXHDFRDFKLQJSRVLWLRQLQKLVOLIH¶VJUHDWHVWSDVVLRQVRFFHU 6RFFHUKDGFRQVXPHGHYHU\ZDNLQJPRPHQWRIKLVFKLOGKRRG DQGDGXOWOLIH$VDFKLOGKLVIDWKHUFRDFKHGKLVVRFFHUWHDPZKLOH KLVIDWKHUDQGERWKKLVEURWKHUVSOD\HGFULFNHW)ROORZLQJLQWKHLU IRRWVWHSV %UXOH\ VDLG KLV SDVVLRQ IRU DWKOHWLFV EHJDQ WR GHYHORS DQGKHSOD\HGIRUYDUVLW\SURJUDPVLQKLJKVFKRRODQGPLGGOH VFKRRO ³,ZDVYHU\UDUHO\LQFODVV´%UXOH\VDLG³,KDGWKHEHVWKLJK VFKRROFDUHHU\RXFRXOGDVNIRU´ $VDIUHVKPDQFRDFKHVRIWKHVHQLRUWHDPVZRXOGRIWHQWLPHV DVN%UXOH\WROHDYHKLVFODVVHVWRKHOSWKHWHDP¿OOLQPLVVLQJSOD\ HUV%UXOH\GHVFULEHGDWKOHWLFVDVDPDMRUSDUWRIKLVOLIHKHVDLG WKDWPDQ\GD\VKHZRXOGRQO\FRPHEDFNWRKLVKRPHWRHDWDQG JHWFKDQJHG´ %HVLGHV VRFFHU %UXOH\ ZDV DOVR VXUURXQGHG E\ WHQQLV IURP D\RXQJDJH%UXOH\JUHZXSPLQXWHVDZD\IURP:LPEOHGRQ DQGVHUYHGDVDEDOOER\LQWKHWRXUQDPHQW+HSOD\HGIRUKLV high  schoolâ&#x20AC;&#x2122;s  tennis  team,  and  described  tennis  as  a  â&#x20AC;&#x153;huge  part  of   >KLV@OLIH´ :KLOH EHFRPLQJ D SURIHVVLRQDO VRFFHU SOD\HU ZDV DOZD\V %UXOH\¶VGUHDPKHUHDOL]HGWKDWKLVJRDOPD\KDYHEHHQWRRKLJK DQG HYHQWXDOO\ VLJQHG RQ WR SOD\ VHPLSURIHVVLRQDO VRFFHU %UX OH\ SOD\HG  VHDVRQV ZLWK &RULQWKLDQ &DVXDOV RI WKH ,VWKPLDQ /HDJXHSOD\LQJULJKWEDFNDQGFHQWHUKDOI ³0\OLIHLQ(QJODQGZDVFRPSOHWHO\REVHVVHGZLWKVRFFHU´ %UXOH\VDLG³0\ZKROHOLIHUHYROYHGDURXQG>LW@´ :KLOH ZRUNLQJ DW D VRFFHU FDPS LQ WKH 8QLWHG 6WDWHV RQH VXPPHU%UXOH\¶VOLIHFKDQJHGIRUHYHUDQGKLVSDWKWREHFRPLQJD FRDFKDW681<1HZ3DOW]EHJDQ %UXOH\PHWKLVIXWXUHZLIH&ROOHHQZKHQVKHZDVWKH+HDG &RDFKRI:RPHQ¶V6RFFHUDW681<$OEDQ\$IWHUGDWLQJIRUDIHZ \HDUVWKHFRXSOHPRYHGWRJHWKHUWR(QJODQGZKHUH&ROOHHQSOD\HG IRUWKH0LOOZDOODQG$UVHQDOFOXEVLQWKH(QJOLVK3UHPLHU/HDJXH $FFRUGLQJWR%UXOH\&ROOHHQEHFDPHKRPHVLFNDQGEHJDQWR VHDUFKIRUMREVRQWKH1&$$ZHEVLWHDIWHUDIHZ\HDUV6KHHYHQWX DOO\ODQGHGWKH:RPHQ¶V+HDG&RDFKLQJMREDW681<1HZ3DOW] DIWHUDWHOHSKRQHLQWHUYLHZZLWKWKHQ$WKOHWLF'LUHFWRU-LP=DODFFD ,WZDVWKLVFRQYHUVDWLRQWKDWZRXOGOHDG%UXOH\WRWKH8QLWHG 6WDWHVIRUJRRG ³, FDPH EDFN KRPH RQH GD\ DQG &ROOHHQ VDLG ,¶P PRYLQJ RXW´%UXOH\VDLG³,ZDVOLNHZHOO,¶PQRWZLQQLQJWKDWDUJXPHQW´ &ROOHHQPRYHGEDFNWRWKH8QLWHG6WDWHVLQ-XO\ZKLOH%UXOH\

%UXOH\¶VWHDPVKDYHZRQSHUFHQWRI1HZ3DOW]V¶V:RPHQ¶V7HQQLVSURJUDP¶VZLQV

PRYHGLQ1RYDQGZDVKLUHGE\WKHQ0HQ¶V6RFFHU+HDG&RDFK 6WXDUW5RELQVRQWRDFWDVDQDGYLVRUWR1HZ3DOW]¶VWHDP $FFRUGLQJWR%UXOH\WKHGD\VFKRROVWDUWHGLQ$XJXVW %RE6LUDFXVH WKH:RPHQ¶V7HQQLVFRDFKVLQFH UHVLJQHGWR WDNHDKLJKVFKRRODWKOHWLFGLUHFWRUMRE,QUHVSRQVH1HZ3DOW]¶V DWKOHWLFGHSDUWPHQWKDGDPHHWLQJWR¿QGDQHZFRDFKRUULVNFXW WLQJWKHSURJUDPIRUWKHVHDVRQ %UXOH\WRRNWKHMREEHFDXVHRIKLVNQRZOHGJHRIWHQQLV ³,WRRNWKHMREQRWUHDOO\NQRZLQJZKDW,ZDVGRLQJ,ZDV UHDOO\MXVWRIIWKHERDW´%UXOH\VDLG 7UDQVLWLRQLQJ IURP WHDFKLQJ VRFFHU WR FRDFKLQJ WHQQLV ZDV WRWDOO\GLIIHUHQW%UXOH\VDLG:KLOHKHGLGHPSOR\DVSHFWVRIKLV VRFFHUFRDFKLQJVXFKDVIRRWZRUNGULOOVDQGFRQGLWLRQLQJ%UXOH\ ZDVXVHGWRWKHWHDPDVSHFWRIVRFFHUDQGKDGWRDGMXVWWRWHDFKLQJ WKHLQGLYLGXDODVSHFWVWKDWWHQQLVUHTXLUHV ³,W¶VDGLIIHUHQWNLQGRIVSRUW´%UXOH\VDLG³6RFFHULVDWHDP VSRUWEXWWHQQLVZKLOHZHDUHDWHDPLVVWLOODYHU\LQGLYLGXDOL]HG NLQGRIWKLQJ´ %UXOH\¶V¿UVWWHDP¿QLVKHGDQGZDV1RLQWKHFRQIHU HQFHKRZHYHUWKHWHDPKDGD³JRRGWLPH´DQG%UXOH\¶VFRDFKLQJ VW\OHJDLQHGKLPFRQVLGHUDEOHIHHGEDFN7KHUHVSRQVHWRKLVFRDFK LQJZDVVRZHOOUHFHLYHGWKDWKHZDVRIIHUHGWKHKHDGFRDFKLQJMRE IRUWKH0HQ¶V7HQQLVWHDPDVZHOO ,QDQGWKHWHDPVORZO\EHJDQWRZLQPRUHJDPHV DQG ULVH LQ WKH FRQIHUHQFH UDQNV DQG LQ  WKH WHDP ZRQ  JDPHVZKLFKZDVWKHKLJKHVWDPRXQWLQWHDPKLVWRU\ 'XULQJ WKLV WLPH RI VORZ VXFFHVV %UXOH\ EHJDQ UHFUXLWLQJ SOD\HUVLQFOXGLQJRQHRIWKHPRVWLPSRUWDQWUHFUXLWPHQWVLQ%UX OH\¶VFDUHHU.HUU\)DUUHO $FFRUGLQJWR%UXOH\WKH5RFNYLOOH&HQWUH/RQJ,VODQGQDWLYH KDGQRLQWHQWLRQRIFRPLQJWR1HZ3DOW]%XWDIWHUDQRYHUQLJKW VWD\)DUUHOGHFLGHGWRWXUQGRZQDVFKRODUVKLSWRD'LYLVLRQ,SUR JUDPDQGEHWKHFHQWHUSRLQWRIDUHEXLOGLQJ1HZ3DOW]SURJUDP

Thursday,  December  2,  2010

3+272&2857(6<2)672&.7213+272

,QWKH:RPHQ¶V7HQQLVWHDP¿QLVKHGEHVWLQJWKH UHFRUGWKH\VHWWKHSUHYLRXV\HDUDQGZRQWKH6WDWH8QLYHUVLW\RI 1HZ<RUN$WKOHWLF&RQIHUHQFH 681<$& &KDPSLRQVKLS%UXOH\ VDLGWKDWLWZDVWKH¿UVWWLPHLQ\HDUVWKDWD1HZ3DOW]ZRPHQ¶V WHDP KDG ZRQ D FRQIHUHQFH FKDPSLRQVKLS %HVLGHV ZLQQLQJ WKH FKDPSLRQVKLS%UXOH\ZDVDZDUGHG&RDFKRIWKH<HDUDQG)DUUHO ZRQ)HPDOH$WKOHWHRIWKH<HDUIRUWKHGHSDUWPHQW ³,QVXFKDVKRUWVSDFHRIWLPHZHVWDUWHGWROD\WKHIRXQGDWLRQ IRUZKDWZHDUHWRGD\DSRZHUKRXVHIRUZRPHQ¶VWHQQLV´%UXOH\ VDLG³6LQFHZHKDYHQHYHUORRNHGEDFN´ %UXOH\ EHOLHYHG WKDW KLV WHDP ZLQQLQJ WKH FKDPSLRQVKLS ³EURNHWKHPROG´DW1HZ3DOW]DQGDORWRIFRDFKHVDWWKHVFKRROEH FDPHLQVSLUHGE\WKHWHQQLVWHDP¶VDELOLW\WRULVHIURPZRUVWWR¿UVW 6LQFHWKHWHDP¶VFKDPSLRQVKLSLQ%UXOH\KDVNHSWWKH WHDPLQWKHWRSWZRSRVLWLRQVLQWKH681<$&HYHU\VHDVRQDQGKDV ZRQIRXU&RDFKRIWKH<HDUVKDGWKUHHIHPDOHDWKOHWHVRIWKH\HDU DQGIRXUFKDPSLRQVKLSVDORQJWKHZD\LQFOXGLQJWKHLUPRVWUHFHQW FKDPSLRQVKLSWKLVSDVW2FWREHU :KLOHKHEHOLHYHVWKHWHDP¶VFKDPSLRQVKLSLQZDVRQH RIKLVJUHDWHVWPRPHQWVLQWHQQLVKHZDVH[WUHPHO\KDSS\ZLWKWKLV \HDU¶VFKDPSLRQVKLS ³:HZHQWLQWRWKH681<$&VDQGQRZD\ZHUHZHWKHIDYRU LWHVJRLQJLQ´%UXOH\VDLG³7RVHHKRZWKHVL[ZRPHQVWHSSHGXS DQGZHQWIRULWSOD\LQJIHDUOHVVWHQQLVWKDWZDVJUHDW,ZDVYHU\ SURXG´ %UXOH\VDLGWKDWODVWVHDVRQ¶VWHDPLVWKHVWURQJHVWKHKDVHYHU SXW WRJHWKHU DQG 1HZ 3DOW]¶V WHQQLV SURJUDP LV QRZ FRQVLGHUHG RQHRIWKHWRSRIWKHHDVWFRDVWDORQJZLWK:LOOLDPV$PKHUVW :HOOVOH\DQG7XIWV+HEHOLHYHVWKDWWKHSURJUDP¶VULVHWRVXFFHVVLV LPSRUWDQWFRQVLGHULQJWKDWLWLVD³WLQ\VWDWHVFKRRO´ ³2WKHUVWDWHVFKRROVVHHZKDWZH¶YHGRQHDQGVD\µZK\FDQ¶W ZHEHWKHQH[W1HZ3DOW]"¶´%UXOH\VDLG³:HKDYHGULYHQWKHOHYHO RIWHQQLVLQRXUFRQIHUHQFHEHFDXVHRIZKDWZHKDYHGRQH´


Pg 14

SPORTS

The  New  Paltz  Oracle

Ventriglia  Aims  For  Victory

By  Andrew  Wyrich   6SRUWV(GLWRU_Andrew.wyrich63@newpaltz.edu

Gene   Ventrigliaâ&#x20AC;&#x2122;s   1965   New   Paltz   Menâ&#x20AC;&#x2122;s   Soccer  team  won  an  NCAA  regional  title,  dur-­ ing   what   he   called   the   â&#x20AC;&#x153;golden   ageâ&#x20AC;?   of   New   3DOW]VRFFHU)RUW\ÂżYH\HDUVODWHUKHZLOOEHRQ the  sidelines  hoping  to  coach  his  former  team  to   another  one.   Ventriglia,  who  coached  West  Point  for  25   years  before  coming  to  SUNY  New  Paltz,  was   appointed  by  Athletic  Director  Stuart  Robinson   DQGZLOOWDNHRYHUIRUIRUPHUFRDFK(ULF:DWVRQ when  the  Menâ&#x20AC;&#x2122;s  Soccer  team  starts  next  season.   â&#x20AC;&#x153;My  interest  in  coming  back  here  is  stron-­ ger  than  just  being  a  coach,â&#x20AC;?  Ventriglia  said.  â&#x20AC;&#x153;I   feel  like  itâ&#x20AC;&#x2122;s  coming  home.â&#x20AC;?   Robinson  said  that  Ventriglia  was  appoint-­ ed  to  be  the  coach,  instead  of  going  through  an   entire  hiring  process,  to  make  sure  the  recruit-­ ment  cycle  was  not  hindered  for  the  coming  sea-­ VRQDQGEHFDXVHKLVH[WHQVLYHWUDFNUHFRUGDVD head  coach  has  shown  that  he  has  been  success-­ IXODWHYHU\OHYHORIFRDFKLQJ â&#x20AC;&#x153;My  expectation  is  that  he  is  going  to  bring   us  stability  and  share  the  knowledge  of  the  sport   DQGORYHRIWKHJDPH´5RELQVRQVDLG Besides   coaching   at   West   Point,   Ventri-­ gliaâ&#x20AC;&#x2122;s  coaching  record  includes  a  233-­33-­15  re-­ cord  as  the  head  coach  of  the  New  Paltz  High   School,   Goshen   High   School   and   Highland   High  School  Boysâ&#x20AC;&#x2122;  Soccer  programs.   Ventriglia   said   while   at   the   helm   of   the   Highland  High  School  program,  he  coached  the   team   to   two   state   championships,   and   in   1984   the  team  went  24-­0.   In   1985   Ventriglia   was   hired   as   the   head   coach   to   start   a   Womenâ&#x20AC;&#x2122;s   Soccer   program   at   West  Point.   +LV H[SHULHQFHV DW GLIIHUHQW OHYHOV RI FRDFKLQJ DUH VRPHWKLQJ KH EHOLHYHV JLYHV KLP ÂłDQRYHUDOOEDFNJURXQG´WKDWZLOOEHKHOSIXODV KHWDNHVRYHUWKH+DZNV 9HQWULJOLDVHUYHGDVDQDVVLVWDQWYROXQWHHU FRDFKIRU:DWVRQRYHUWKHODVWVHDVRQDQGKDV already   begun   thinking   about   his   plan   for   the   teamâ&#x20AC;&#x2122;s  future.   â&#x20AC;&#x153;The  team  has  all  the  ingredients,  we  are  a   YHU\JRRGWHDP´9HQWULJOLDVDLGÂł%XWZHQHHG to  play  faster  and  share  the  ball.â&#x20AC;?   7R DFKLHYH WKHVH JRDOV 9HQWULJOLD VDLG he  will  push  the  team  in  training  sessions,  and   KRSHVWKDWSUDFWLFLQJHYHU\GD\ZLOOOHDGWREHW-­ ter  handling  of  the  ball.  He  said  that  he  will  start   RII E\ KDYLQJ WKH WHDP SUDFWLFH ÂłRQ D VPDOOHU OHYHO´ DQG ZLOO HYHQWXDOO\ UDLVH WKH OHYHO WR something  similar  to  a  game.  He  hopes  that  this   ZLOO LPSURYH WKH WHDPÂśV SDVVLQJ DQG DELOLW\ WR keep  the  game  small  in  the  minds  of  players.  

Ventriglia   immigrated   from   Italy   to   play   IRU1HZ3DOW]ÂśVWHDPDQGEDUHO\VSRNH(QJOLVK when  he  started  playing  in  America.  He  said  that   his  time  on  the  team  shaped  him  as  a  person    and   he  hopes  to  inspire  his  players  in  the  same  way.   â&#x20AC;&#x153;I  always  felt  a  need  to  do  the  same,â&#x20AC;?  Ven-­ triglia   said.   â&#x20AC;&#x153;We   want   to   win   championships,   WKDWÂśVREYLRXVEXWWKHUHLVPRUHWRLWWKDQWKDW´ Ventriglia  said  that  he  will  stress  that  play-­ HUVFRQWLQXHWRVWULYHDFDGHPLFDOO\DQGZLOOWU\ WR PDNH D GLIIHUHQFH LQ KLV SOD\HUVÂś OLYHV OLNH his  teammates  and  coaches  did  for  him  when  he   played.   â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s  my  job,  taking  all  of  those  things  in   ZKHQWKH\OHDYHKHUH,ZDQWWRPDNHVXUHWKH\ KDYH D JRRG H[SHULHQFH´ 9HQWULJOLD VDLG Âł,WÂśV not   just   about   soccer.   I   hope   in   the   end   that   I   made  a  little  difference.â&#x20AC;?   The   coach   of   the   1965   team   Ventriglia   played   on,   Al   Miller,   is   someone   Ventriglia   remembers   fondly   and   hopes   to   emulate   as   he   coaches  going  forward.  Ventriglia  said  the  team   was   focused,   committed   and   had   a   sense   of   team.   â&#x20AC;&#x153;[The   sense   of   team]   is   paramount,   you   cant  win  without  it,â&#x20AC;?  Ventriglia  said.  â&#x20AC;&#x153;That  is  the   kind  of  atmosphere  I  want  to  create.â&#x20AC;? Part   of   this   atmosphere   will   be   getting   players  to  recognize  the  opportunity  they  are  re-­ FHLYLQJ9HQWULJOLDVDLG+HVDLGLISOD\HUVFKHU-­ LVKWKHWLPHWKH\KDYHRQWKHÂżHOGHPEUDFHWKH WHDPKDYHIXQDQGOHDUQIURPWKHLUVHDVRQWKH team  will  succeed.   Ventriglia   called   himself   a   â&#x20AC;&#x153;hands   on   FRDFK´DQGDÂłSOD\HUÂśVFRDFK´ZKRZLOOEHYHU\ DQLPDWHG RQ WKH ÂżHOG DQG KDYH D SDVVLRQ IRU the  game.  He  said  that  throughout  his  coaching   career,   he   has   stressed   that   he   doesnâ&#x20AC;&#x2122;t   want   to   FKDQJHDSOD\HUWRÂżWDFHUWDLQPROG â&#x20AC;&#x153;I  donâ&#x20AC;&#x2122;t  like  to  kill  a  special  gift  a  player   has,â&#x20AC;?  Ventriglia  said.  â&#x20AC;&#x153;I  want  them  to  be  them-­ VHOYHV´ Despite  all  of  his  coaching,  he  realizes  that   there   is   only   so   much   he   can   do,   and   that   the   team  is  likely  to  make  mistakes.   â&#x20AC;&#x153;They   are   young   men,   they   are   going   to   make   mistakes,â&#x20AC;?  Ventriglia   said.   â&#x20AC;&#x153;I   donâ&#x20AC;&#x2122;t   want   them  to  be  afraid  to  make  mistakes  though.â&#x20AC;?     As  for  next  season,  Ventriglia  hopes  to  con-­ WLQXHWKHVXFFHVVWKDWWKHWHDPKDVEHHQKDYLQJ RYHUWKHODVWIHZ\HDUV7KH+DZNVUHFRUG last  season  was  the  best  record  the  program  has   had  since  2004,  and  the  team  fell  out  of  confer-­ HQFHFRQWHQWLRQRQWKHÂżQDOGD\RIFRQIHUHQFH play.   Âł:HDUHFORVH´9HQWULJOLDVDLGÂł:HKDYH the  tools  and  we  should  be  good,  I  can  promise   you  that.â&#x20AC;?  

Ventriglia  coached  at  West  Point  for  25  years  before  becoming  the  New  Paltz  Menâ&#x20AC;&#x2122;s  Soccer  Coach. 3+272&2857(6<2)$50<632576,1)250$7,21%$&.3$*(3+272&2857(6<2)$50<632576,1)250$7,21

Thursday,  December  2,  2010


The  New  Paltz  Oracle

SPORTS

Pg 15

The  Future  of  the  Field  

With  the  Winter  Meetings  right  around  the  corner,  the  base-­ EDOO ZRUOG PD\ VRRQ EH LQ D Ã&#x20AC;XUU\ )UHH DJHQWV ZLOO VLJQ ZLWK different  teams  and  more  than  likely  a  blockbuster  trade  no  one   VDZFRPLQJZLOOVWHDOKHDGOLQHV7HDPVZLOOJLYHWKHLUIDQVHDUO\ &KULVWPDVSUHVHQWVZUDSSHGZLWKWKHSURPLVHRIDEHWWHUIXWXUH )RUPDQ\EDVHEDOOIDQVWKLVLVWKHEHVWWLPHRIWKH\HDUDQG'H FHPEHUDQG-DQXDU\DUHDZLQWHUZRQGHUODQG +RZHYHUIRUWKH0HWVLWZLOOEHDFROGDQGEOHDNZLQWHUDV SD\UROOFRPPLWPHQWVZLOODOOEXWFULSSOHWKHWHDP¿QDQFLDOO\XQ WLOQH[WRIIVHDVRQ,QVWHDGRIRSHQLQJDSUHVHQWFRQWDLQLQJ&OLII Lee  or  Carl  Crawford,  Mets  fans  will  potentially  see  small  pack-­ DJHVZLWKWKHOLNHVRI&KULV<RXQJLQVLGH 6DQG\$OGHUVRQDQGRXUQHZO\UHYDPSHGIURQWRI¿FHZLOOEH IRUFHGWRZRUNZLWKDPLQLPDODPRXQWRIPRQH\WR¿OOLQVRPHRI the  glaring  holes  our  team  has  â&#x20AC;&#x201C;  likely  meaning  any  real  chance   RIFRQWHQGLQJLQLVDOOEDVHGRQOXFNDQGµZKDW±LI¶V¶ %XWDOOKRSHVKRXOGQRWEHORVW The   Mets   can   use   this   year   as   a   stepping   stone   towards   a   EULJKWHU IXWXUH 0LNH 3HOIUH\ -RQ 1LHVH ,NH 'DYLV DQG -RVK 7KROHZLOOKDYHDQRWKHU\HDUWRGHYHORSDQGEHFRPHWKHSOD\HUV WKDWWKH0HWVQHHGWKHPWREH 3HOIUH\LQSDUWLFXODUPDGHJUHDWVWULGHVWRZDUGVEHFRPLQJ WKHWRSRIWKHOLQHVWDUWHUPDQ\0HWVIDQVHQYLVLRQHGKLPWREH ³%LJ3HOI´VWDUWHGRIIWKHFDPSDLJQDVDSRWHQWLDO&\<RXQJ FDQGLGDWHJRLQJZLWKD(5$KHDGLQJLQWR-XO\'H VSLWHDKRUUHQGRXV-XO\3HOIUH\¿QLVKHGWKHVHDVRQZLWKD (5$DQGZDVWKHDQFKRUWKH0HWVURWDWLRQQHHGHG3HOIUH\¶V QHUYRXVQHVVDQGLQHIIHFWLYHQHVVWKDWSODJXHGKLPLQWKHEHJLQ QLQJRIWKH\HDUVHHPHGWRYDQLVKDQGKLVSLWFKHVKDGDFRP PDQGLQJVLQNWRWKHPWKDWGHPROLVKHGEDWWHUV,I³3HOI´LVDEOH to  harness  the  strong  points  of  his  2010  season,  and  continue  to   grow  in  this  coming  year,  there  is  no  reason  to  think  that  he  wonâ&#x20AC;&#x2122;t   EHFRPHDSHUHQQLDO1RVWDUWHUIRUWKH0HWVIRU\HDUVWRFRPH 1LHVH LV DQRWKHU SLWFKHU ZKR VXUSULVHG PDQ\ SHRSOH ODVW year  and  became  a  strong  candidate  for  a  middle  of  the  rotation   VRXWKSDZ:KLOH1LHVHZLOOQHYHUOHDGDURWDWLRQWRJUHDWQHVVKH FRXOGEHFRPHDFRPSOLPHQWDU\SLHFHWKDWPDQ\WHDPVODFN+LV FXWWHULVVKDUSDQGZLWK¿QHUWXQLQJFRXOGKDYHDVWURQJSLWFKWKDW LVUHPLQLVFHQWRI$QG\3HWWLWWH¶VVLJQDWXUHSLWFK1LHVHVHHPHG WREXUQRXWODWHODVW\HDUWKURZLQJLQQLQJVRYHUWKHFRXUVH

3+272&2857(6<2)FLICKR.COM%$&.3$*(3+272&2857(6<2)FLICKR.COM

-RQ1LHVHKDVSRWHQWLDOWREHFRPHDVROLGVWDUWHUIRUWKH0HWVLQWKHIXWXUHDVVKRZQE\KLVIRXUZLQVLQ-XQHODVWVHDVRQ of   his   rookie   year,   but   showed   glimpses   of   becoming   a   steady   SLWFKHU,IKHLVDEOHWRFRQWLQXHKLVVWHDG\KDQGZKLOHLPSURYLQJ KLVSLWFKHV1LHVHUHSUHVHQWVDQRWKHUVWURQJDUPWKDWFRXOGURXQG RXWIXWXUH0HWV¶URWDWLRQV (YHU\RQH¶V IDYRULWH 0HWV URRNLH 'DYLV KDG D VWURQJ ¿UVW VHDVRQDW¿UVWEDVHLQ0DQ\EHOLHYHWKDW'DYLVKDV$GDP Dunn   like   power,   and   could   become   a   strong   presence   in   the   PLGGOHRIWKH0HWV¶OLQHXSZKLOHDOVR¿HOGLQJKLVSRVLWLRQFRP SDUDEOHWRWKHEHVWLQWKHJDPH6WLOOWKLVWUDQVIRUPDWLRQLVJRLQJ WRWDNHWLPH'DYLVVKRZHGÃ&#x20AC;DVKHVRIEHLQJDVWHDG\WKUHDWODVW \HDU ¿QLVKLQJ WKH VHDVRQ ZLWK  KRPHUXQV DQG  5%,V EXW DOVRVKRZHGWKDWKHLVVWLOOUDZ$QRWKHU\HDURIEDWWLQJIRXUWKLQ WKH0HWVOLQHXSZLOODOORZ'DYLVWREORVVRP,WKLQNKHLVJRLQJ WRKDYHDEUHDNRXW\HDUQH[W\HDUDQGZLOOEHDGULYLQJIRUFHIRU WKH0HWVORRNLQJWRDQGEH\RQG )LQDOO\WKHQHZO\DQRLQWHGFDWFKHURIWKHIXWXUH7KROHZLOO KDYHDFKDQFHWRSURYHLIKHLVWKHUHDOGHDO7KROHKDVLPSUHVVHG LQKLVWLPHRQWKHELJOHDJXHFOXEODVW\HDUDQGZDVHYHQWXDOO\ QDPHGWKHVWDUWLQJFDWFKHUE\-HUU\0DQXHO7KROHVWDUWHGKLV FDOOXSRQ¿UHDQGZDVKLWWLQJDURXQGXQWLOWKHPLGGOHRI September  and  showed  that  he  has  the  ability  to  slap  singles  and   JHWRQEDVH,QWHUPVRIKLWWLQJ7KROHUHPLQGVPHDORWRIIRUPHU

Thursday,  December  2,  2010

0HW3DXO/R'XFDDQG,WKLQN7KROHVKRXOGPROGLQWRDVWURQJ 1RKLWWHUDIWHUDQRWKHUVHDVRQRIEHLQJWKHUHJXODUEDFNVWRS Besides   these   players   growing   next   season,   the   Mets   will   DOVREHDEOHWREULQJXSSOD\HUVOLNH-HQQU\0HMLD5XEHQ7HMDGD )HUQDQGR0DUWLQH]'LOORQ*HHDQGPD\EHHYHQ.LUN1LHXZHQ KXLVWKURXJKRXWWKHVHDVRQ±IXUWKHULQJWKHKRPHJURZQPRYH PHQWWKDW$OGHUVRQVHHPVWREHSUHVVLQJ While  2011  seems  like  it  will  be  a  season  of  mediocrity,  it   ZLOOEHDQLPSRUWDQW\HDUORRNLQJIRUZDUG0DQ\RIWKH0HWV NH\ SOD\HUV DUH YHU\ UDZ DQG QHHG D \HDU WR EHFRPH WKH IXOO Ã&#x20AC;HGJHGPDMRUOHDJXHUVWKH\VKRXOGEHFRPH$QRWKHU\HDURIH[ SHULHQFHFRXSOHGZLWKWKH¿QDQFLDOÃ&#x20AC;H[LELOLW\WKHWHDPZLOOKDYH QH[WRIIVHDVRQ VD\JRRGE\HWR&DUORV%HOWUDQ2OOLH3HUH]DQG /XLV&DVWLOOR VKRXOGEHDSHUIHFWPL[WXUHIRUDFRPSHWLWLYH0HWV EDOOFOXELQWKHIXWXUH


SPORTS

DU

WHAT’S INSIDE

MB L QU EDO ID RE’ DI S A PA TC RM GE H T Y 12 EA PL M AN S

THE  NEW  PALTZ  ORACLE

FINISH

LINE Gene Ventriglia Set To Coach Men’s Soccer PAGE 14

A Look Into The Mets’ Promising Future PAGE 15

PHOTO  BY  LAURA  LUENGAS SIDE  PHOTOS  COURTESY  OF  STOCKTON  PHOTO

WOMEN’S CROSS COUNTRY ENDS 2010 FALL CAMPAIGN: PAGE 11


The New Paltz Oracle, Volume 82, Issue 10