Page 1

CONSEJO SUPERIOR Dra. Marcela Oliveros Sandino Dr. Carlos Patricio Eastman Barona Dr. Gustavo Eastman Vélez Dra. Martha Sandino de Oliveros Dr. Armando Romero Oliveros Dr. Carlos Enrique Marín Vélez Dr. Fernando Laverde Morales Dr. Virgilio Ramón Martínez Dr. Jesús Báez Aparicio Dr. Luis Carlos Anzola Pachón - Representante Docentes

Presidente del Consejo Superior Dra. Marcela Oliveros Sandino

Rector Nacional Dr. Fernando Laverde Morales

Vicerrector Administrativo Dr. Virgilio Ramón Martínez

Vicerrector Académico Dr. Jesús Báez Aparicio

Secretaria General Dra. María Jetzabel Herrán Duarte

REVISTA TEORÍA Y PRAXIS INVESTIGATIVA Director - Editor Ph.D. Eduardo Mora Bejarano

Teoría y Praxis Investigativa/revista del Centro de Investigación y Desarrollo – CID/Fundación Universitaria del Área Andina/ ISSN 1900-9380/ Volumen 5 No. 2 /Julio – Diciembre de 2010. Calle 71 No. 1321, Bogotá D.C., Colombia. Correo electrónico revistateoriaypraxis@areandina.edu.co. El contenido de los documentos publicados es responsabilidad de los autores y no compromete al Director-editor de la revista, al Centro de Investigación y Desarrollo – CID, ni a la Fundación Universitaria del Área Andina. Se autoriza la reproducción citando la fuente.


COMITÉ CIENTÍFICO María Eugenia Guerrero Useda Ph.D., en Ciencias Físicas y Matématicas University Of Moldova República de Moldavia

Héctor Ariel Olmos Raccio M.Sc., en Cultura Argentina Universidad Tres de Febrero Argentina

María Rita Bertolozzi Ph.D., en Enfermería Universidad de Sao Pablo Brasil

Hebert Hernán Soto Gonzáles PosPh.D., en Biotecnología Universidad Federal de Sao Paulo Brasil Alex Giovanny Peniche Trujillo M.Sc., en Ciencias Básicas Universidad Santiago de Cali Colombia

Alba Idaly Muñoz Sánchez Ph.D., en Enfermería Universidad de Sao Pablo Brasil

Sergio Tobón Tobón Ph.D., en Modelos Educativos, Políticos y Culturales Universidad Complutense de Madrid España

Ana Helena Puerto Guerrero M.Sc., en Salud Pública Universidad de Antioquia – UDEA Colombia M.Sc., en Educación Universidad de la Sabana Colombia

César A. Rey Anacona Ph.D., en Psicología Clínica y de la Salud Universidad de Salamanca España

Armando Lucumí Moreno Ph.D., en Ciencias Bioquímicas Universidad Nacional Autónoma de México México

César Augusto García Ubaque Ph.D., en Ingeniería Universidad de los Andes Colombia

COMITÉ DE ÁRBITROS Esneider García Jimenez Máster en Dirección y Gerencia de Empresas Universidad Colegio Mayor de Nuestra Señora del Rosario Colombia

Mauricio Alejandro Díaz Uribe Maestría en Estudios Latinoamericanos Universidad de San Martin Centro de Estudios Latinoamericanos Colombia

Viviana Paola Becerra García M.Sc., en Ciencias de la Visión Universidad de la Salle Colombia

Ricardo Durán Baron Ph.D., en Ingenieria Universidad de Antioquia Colombia

Celmira Laza Vásquez M.Sc., en Enfermería Con énfasis en Cuidado de la Salud Materno Perinatal Universidad Nacional de Colombia Colombia

Alex Peniche Magister en Ciencias Biomédicas Universidad del Valle Colombia

Giovane Mendieta Izquierdo Doctorante Ciencias de la Salud Pública Universidad de Guadalajara Mexico

Nohora Stella Joya Doctorante en Bioética Universidad El Bosque Colombia Beatriz Peña Riveros Magíster en Salud Pública Universidad de Antioquia Colombia

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


COMITÉ EDITORIAL

COORDINACIÓN EDITORIAL

Eduardo Mora Bejarano Ph.D., en Ciencias Universidad de Sao Pablo Brasil

Marsory Anzola Sánchez

Diana Milena Quilaguy Ayure M.Sc., en Ciencias Microbiología Universidad Nacional de Colombia Colombia José Fernando Torres Avila M.Sc., en Ciencias Microbiología Universidad Nacional de Colombia Colombia Sonia Patricia Ruiz Galindo Maestrante en Estudios de Género, Mujer y Desarrollo Universidad Nacional de Colombia Colombia Gloria Marlen Aldana de Becerra Maestrante en Educación y Desarrollo Humano CINDE – Universidad Pedagógica Nacional Colombia

Maestrante en Docencia Universidad de La Salle Colombia

DISEÑO DE CARÁTULA Hector Córdoba Salamanca Docente Investigador Fundacion Universitaria del Area Andina Colombia hecordoba@areandina.edu.co

ARMADA DIGITAL, IMPRESIÓN Y ACABADOS Grupo Imágenes E-mail: ventas@grupoimagenes.com.co Tel: 347 5000

APOYO EDITORIAL

POLÍTICA EDITORIAL

Héctor Córdoba Salamanca Diseñador Gráfico Universidad Nacional de Colombia Colombia

La revista Teoría y Praxis Investigativa es una publicación académica de carácter científico, que tiene como propósito la divulgación de conocimiento generado a partir de investigaciones, reflexiones y disertaciones que contribuyan a ampliar el conocimiento en todos los campos de las ciencias.

María Consuelo García Rocha Administradora de Mercadeo, Publicidad y Ventas Fundación Universitaria del Área Andina Colombia

Esta publicación se dirige a la comunidad académica en general y de manera especial a docentes y estudiantes.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


4

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


5

Tabla de Contenido EDITORIAL ..........................................................................................................................

7

INVESTIGACIONES Impacto de herbicidas sobre microorganismos disolventes de fosfatos en suelo rizosférico de plantas de Solanum tuberosum José Luís Soto Gonzáles, Mario Andrade Sánchez, Passiz Mestas Zapana, Marcelo Motta de Oliveira Gonçalves, Hebert Hernán Soto González …........….......……..........

11

Alteraciones neurotoxicológicas y pruebas de visión cromática en pacientes consumidores de alcohol Julio Guzmán Vargas, Patricia Elena García Álvarez, Helman Alfredo Cruz, Julian Andrés Bolívar Fontecha, Lilyeth Catherine Casas Sandoval, Laura Consuelo Montenegro Tejada, Nathaly Remolina Alarcón ..............................................

21

Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia Dairo Muñoz Chiquillo ........................................................................................................

29

Sulfato ferroso y preeclampsia. Estudio realizado en dos hospitales de segundo nivel de Bogotá Tatiana Valentina Cabrera, Mauricio Jiménez ..………………………..…………………...............

43

Occidente: permanencia, cambio y ambivalencia en el imaginario sobre la naturaleza y el otro. Siglos XV-XX. Oriana Prieto Gaona ..........................................................................................................

53

Rol del terapeuta respiratorio frente al desplazamiento forzado en Colombia: Aproximacion a sus representaciones sociales Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero ........................

61

REVISIONES BIBLIOGRÁFICAS Micotoxinas y Aflatoxina B1, un problema en salud animal Hansen Wilber Murcia Rodríguez ..……………………………………………………....................

71

Polihidroxialcanoatos (PHAs): Biopolímeros producidos por microorganismos. Una solución frente a la contaminación del medio ambiente Julieth Yadira Serrano Riaño .............…………………………………………………...............…

79

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


6

Table of Contens EDITORIAL ..........................................................................................................................

7

RESEARCH Impact of herbicides on the solvent microorganisms of phosphates from soil rizospheric of plants Solanum tuberosum José Luís Soto Gonzáles, Mario Andrade Sánchez, Passiz Mestas Zapana, Marcelo Motta de Oliveira Gonçalves, Hebert Hernán Soto González …........….......……..........

11

Neurotoxicological alterations and testing colour vision in alcohol consumer patients Julio Guzmán Vargas, Patricia Elena García Álvarez, Helman Alfredo Cruz, Julian Andrés Bolívar Fontecha, Lilyeth Catherine Casas Sandoval, Laura Consuelo Montenegro Tejada, Nathaly Remolina Alarcón ..............................................

21

Klic house program. As a model business, education and food for the second childhood. Dairo Muñoz Chiquillo .........................................................................................................

29

Ferrous sulfate and preeclampsia. Case-control study conducted in two hospitals in Bogota. Tatiana Valentina Cabrera, Mauricio Jiménez ..………………………..…………………...............

43

West: permanence, change and ambivalence in the nature and the other imagery. Centuries XV-XX. Oriana Prieto Gaona ...........................................................................................................

53

Contrast of the role of the respiratory therapist and forced displacement in colombia. approach to social representations Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero .........................

61

REVIEWS Micotoxins And Aflatoxin B1, A Animal Health Problem Hansen Wilber Murcia Rodríguez ...……………………………………………………....................

71

Polyhydroxyalkanoates (PHAs) polymers produced by microorganisms. A solution to environmental pollution Julieth Yadira Serrano Riaño .............…………………………………………………...............…

79

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


EDITORIAL

7

A propósito de la inteligencia práctica o el arte y la ciencia del sentido común

S

e dice que el pensamiento y la creatividad constituyen dos facultades esenciales en el ser humano. Recuerdo que hace algunos años, el concepto de creatividad era reemplazada por conceptos como el razonamiento o coeficiente intelectual (CI). El CI es el resultado de un test estandarizado para medir las habilidades cognitivas. Howard Gardner en su teoría de las inteligencias múltiples, plantea que cada persona tiene – por lo menos – ocho inteligencias o habilidades cognoscitivas, a saber: lingüística, lógicomatemática, corporal y kinestésica, visual y espacial, musical, interpersonal, intrapersonal y naturalista. Las cuales se puede definir de la siguiente manera: 1. Lingüística. Se manifiesta por la habilidad para usar efectivamente el lenguaje hablado y escrito. 2. Lógica-matemática. Es la capacidad para resolver problemas aritméticos, juegos de estrategia, razonamiento abstracto, hacer experimentos. 3. Corporal y Quinésica. Permite procesar el conocimiento a través de las sensaciones corporales. Esta inteligencia es propia de deportistas, bailarines, personas que trabajan manualidades como costura y artesanías. 4. Visual y Espacial. 5. Musical. Se relaciona con la capacidad para expresarse en formas musicales y para identifican sonidos con facilidad.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


8

Editorial

6. Interpersonal. Permite entender los sentimientos de los demás y comunicarse efectivamente con otros. 7. Intrapersonal. Es la capacidad de conocerse a sí mismo: sus relaciones, emociones y vida interior. 8. Naturalista. Descubierta más recientemente, este tipo de inteligencia posibilita encontrar relaciones entre las diferentes especies o grupos de objetos y personas y ser sensibles ante ellas. Para Daniel Goleman, psiquiatra y autor del libro Inteligencia emocional e inteligencia social, el concepto de inteligencia, tal como lo conocíamos antes, medido en términos de CI, está revaluado, entre otras, por la inteligencia emocional, la cual tiene en cuenta aspectos como la conciencia de sí mismo, la capacidad de comunicarse con los demás, la receptividad a los sentimientos ajenos y la autoestima. Creo que todos y todas durante nuestra educación primaria, secundaria, en educación superior, inclusive en nuestros trabajos, encontramos personas muy “inteligentes”: recitan la tabla periódica, sacan la mejores notas, resuelven las ecuaciones de primero y segundo grado de manera magistral, son unos “pilos”, pero cuando se trata de abordar otras acciones de la vida, se bloquean, o en ocasiones hacen cosas “tontas”. Lo que indica, según Karl Albrecht, que el CI no cuenta toda la historia de la inteligencia humana. Albrecht habla de la inteligencia práctica o el arte y la ciencia del sentido común. Albrecht propone reflexionar sobre la inteligencia práctica, tal vez más importante que el CI. La inteligencia práctica, entendida como la habilidad de razonar con sentido común, de forma estructurada, cobra especial importancia en el mundo actual, en tanto que puede constituirse en una de las aptitudes vitales clave. Es posible encontrar personas que resuelven situaciones, toman decisiones de manera sencilla, rápida y obvia que contrasta con aquellos que se informan, estudian, hacen prototipos, estudios, y en ocasiones no resuelven nada o terminan complicando más las cosas. Deseo compartir algunas reflexiones sobre el libro Inteligencia práctica o el “arte y la ciencia del sentido común”, escrito por Karl Albrecht, cuya primera edición en español se hizo en el 2008. Albrecht plantea que quienes poseen “el sentido común” o la inteligencia práctica, son personas que toman buenas decisiones, tienen una capacidad aguda de pensar en términos de posibilidades y opciones, se adaptan a las ambigüedades e interpretan las complejidades, articulan partes de un problema con claridad. Normalmente trabajan hasta dar con una o varias soluciones y, por lo general, tienen ideas originales y creativas. A continuación quiero compartir algunas ideas encontradas en el libro de Albrecht (s/p), polémicas unas, otras obvias y otras para pensarlas:

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


9

Editorial

· Por primera vez en la historia de nuestra especie, nuestro entorno evoluciona más rápidamente que nuestro cerebro. Es posible que nos queden menos de cincuenta años para actuar, individual y colectivamente, y afrontar el caótico nuevo entorno que hemos creado. · Todo pensador pone en peligro alguna porción de un mundo en apariencia estable y nadie puede predecir por completo qué surgirá en su lugar. · Muchos ejecutivos que gastaban a manos llenas en tecnología de la información para modernizar y actualizar sus operaciones, a menudo invirtiendo decenas de millones de dólares en hardware y software informático, no veían un valor particular en invertir una cantidad mucho menor en mejorar el software humano. · Más importante que producir graduados capaces de usar un ordenador y navegar por Internet es producir trabajadores cualificados, gente capaz de pensar. · La tecnología de la información no ha hecho necesariamente a la gente más hábil; en lugar de eso, ha hecho que muchos trabajos sean más fáciles de realizar por personas con habilidades mentales limitadas. · Para Albrecht, la televisión, en tanto utilizada en forma acrítica, está volviendo a la gente menos lista. · La invitación de Albrecht es a fortalecer la inteligencia práctica, la habilidad mental para afrontar los desafíos y oportunidades de la vida, a respetar y abrazar nuestra locura, a desprendemos de la ilusión de que siempre somos entes sensatos y lógicos que en todo momento pensamos y hacemos lo correcto… y a estar dispuestos a aprender.

Fernando Laverde Morales Rector Nacional

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


INVESTIGACIONES

10

Impacto de herbicidas sobre microorganismos disolventes de fosfatos en suelo rizosférico de plantas de Solanum tuberosum José Luís Soto Gonzáles, Mario Andrade Sánchez, Passiz Mestas Zapana, Marcelo Motta de Oliveira Gonçalves, Hebert Hernán Soto González Alteraciones neurotoxicológicas y pruebas de visión cromática en pacientes consumidores de alcohol Julio Guzmán Vargas, Patricia Elena García Álvarez, Helman Alfredo Cruz, Julian Andrés Bolívar Fontecha, Lilyeth Catherine Casas Sandoval, Laura Consuelo Montenegro Tejada, Nathaly Remolina Alarcón Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia Dairo Muñoz Chiquillo Sulfato ferroso y preeclampsia. Estudio realizado en dos hospitales de segundo nivel de Bogotá Tatiana Valentina Cabrera, Mauricio Jiménez Occidente: permanencia, cambio y ambivalencia en el imaginario sobre la naturaleza y el otro. Siglos XV-XX. Oriana Prieto Gaona Rol del terapeuta respiratorio frente al desplazamiento forzado en Colombia: Aproximacion a sus representaciones sociales Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


11

Impacto de herbicidas sobre microorganismos disolventes de fosfatos en suelo rizosférico de plantas de Solanum tuberosum Impact of herbicides on the solvent microorganisms of phosphates from soil rizospheric of plants Solanum tuberosum José Luís Soto Gonzáles1, Mario Andrade Sánchez2, Passiz Mestas Zapana3, Marcelo Motta de Oliveira Gonçalves4, Hebert Hernán Soto Gonzáles5

Resumen El objetivo del presente estudio fue verificar el impacto de cuatro herbicidas: linuron, 2-4-D, dimethenamid y metribuzin, aplicados separadamente o mezclados sobre la actividad de microorganismos disolventes de fosfatos inorgánicos y sobre la densidad poblacional de bacterias y hongos provenientes de suelos rizosféricos de Solanum tuberosum. Plantas de S. tuberosum fueron bañadas con soluciones de herbicidas de linuron, 2,4-D, dimethenamid, metribuzin y dimethenamid+metribuzin con dosis de 1,50; 1,50; 0,50; y 1,50 + 0,75 kg ha-1, respectivamente. En cada parcela fue analizado los efectos de los herbicidas. Durante 2, 15, 30, 45 y 60 días luego de la aplicación del herbicida (DLAH), muestras de suelos rizosféricos y no rizosféricos fueron colectados y analizados, estimándose la densidad poblacional de bacterias y hongos, actividad de disolución de fosfatos inorgánicos. Se pudo observar con el herbicida 2,4-D una drástica disminución de la densidad poblacional bacteriana del suelo, en todas las épocas de evaluación, demostrando una mayor sensibilidad de este grupo de microorganismos con este compuesto. Todos los herbicidas provocaron una reducción en la densidad poblacional de hongos del suelo a partir del 15 DLAH. El uso de metribuzin y 2,4-D favorecieron mayores actividades de disolución de fosfato inorgánico a partir 15, 30 y 45 DLAH y a los 15 y 30 DLAH, respectivamente, no en tanto, afecto la biomasa microbiana del suelo. Este trabajo evidenció que la aplicación de los herbicidas distribuidos en la región rizosférica de S. tuberosum, afecta la densidad de microorganismos rizosféricos y su actividad de disolución de fosfatos. Palabras clave: bacterias, hongos, linuron, dimethenamid, metribuzin.

Abstract The objective of the present study was verifying the impact of four herbicides: linuron, 2-4-D, dimethenamid and metribuzin, applied separately or blended on the activity of solvent microorganisms of inorganic phosphates and on the populational density of bacterial and fungi coming from rhizospheric soil of Solanum tuberosum. Plants of S. tuberosum were sprites with solutions of linuron, 2,4-D, dimethenamid, metribuzin and dimethenamid+metribuzin with dose of 1,50; 1,50; 0,50; and 1,50 + 0,75 kg ha-1, respectively. During 2, 15, 30, 45 and 60 days after the application of the herbicide (DLAH), samples of rhizospheric soil and non rizospheric were collected and analyzed, as well the population density of bacteria and fungi, activity of solvent of inorganic phosphates. The herbicide 2,4-D shown a drastic decrease of the bacterial population density of the soils at all the evaluation times, demonstrating a bigger sensibility of this group of microorganisms to this compound. All the herbicides caused a reduction in the population density of the soil fungi, starting at 15 DLAH. The use of metribuzin and 2,4-D favored a higher dissolution activity of the inorganic phosphate starting 15, 30 and 45 DLAH, and 15 and 30 DLAH, respectively, not as long as, affect the soil microbial biomass. This work evidences that the application of the herbicides distributed in the rizospheric region of plants of S. tuberosum, affects the microorganisms density rizospheric and interfere in the phosphates dissolution. Key words: bacteria, fungi, linuron, dimethenamid, metribuzin. 1 2 3 4 5

Doctorante en producción vegetal, Universidad Estadual Paulista, Facultad de Ciencias Agrarias y Veterinarias - FCAV/UNESP, Brasil, jose.gonzales@posgrad.fcav.unesp.br. Biólogo, Universidad Nacional San Agustín – UNSA, Facultad de Ciencias Biológicas, Perú, msanchez@unsa.edu.pe. M.Sc. en nutrición, Universidad Federal de São Paulo – UNIFESP, Facultad de Nutrición, Brasil, pmestaz@hotmail.com. M.Sc. en agronomía, Universidad Federal Rural de Recife – UFRR - Facultad de Ciencias Agrarias y Veterinarias, Brasil, marcelo_mo@gmail.com. Ph.D. en biotecnología, Universidade de São Paulo – USP - Departamento de Biotecnología, Brasil, hsoto@usp.br - hebertgonzales@gmail.com.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


12

José Luís Soto Gonzáles, Mario Andrade Sánchez, Passiz Mestas Zapana, Marcelo Motta de Oliveira Gonçalves, Hebert Hernán Soto González

INTRODUCCIÓN Como todo cultivo agrícola, la papa (Solanum tuberosum) está sujeto a varios factores, bióticos y abióticos, que influyen en el crecimiento, desarrollo y productividad económica. Dentro de estos factores, se destaca la interferencia propiciada por la convivencia de este cultivo con las plantas dañinas, las cuales, según Lutman (1992) las plantas invasoras compiten por agua, luz y nutrientes, estando el grado de severidad de esa competición relacionada con el conjunto de especies y densidad de la comunidad infestante. El uso de excesivas cantidades de insumos agrícolas como herbicidas pueden afectar la calidad del suelo, siendo actualmente las prácticas agrícolas empleadas muy cuestionadas por la comunidad científica en cuanto a la sustentabilidad ecológica de agroecosistemas. La microbiota natural nativa de suelos como bacterias y hongos son las más sensibles a mudanzas ambientales, cuando los suelos son sometidos a diferentes tipos de manejos inadecuados y por lo tanto, la ausencia o presencia de estos microorganismos serian las más adecuadas como indicadores de la calidad de un suelo (Pankhurst, Doube & Gupta, 1997; Tótola & Chaer, 2002). Actualmente, está surgiendo un interés biotecnológico y científico en relación a la importancia y utilidad de la diversidad microbiana edáfica, los microorganismos desempeñan un papel fundamental en el mantenimiento de la calidad de suelos (Garbeva, Van Veen & Van Elsas, 2004). Los microorganismos del suelo influencian directa o indirectamente en la fertilidad y la productividad vegetal por medio de ciclage de nutrientes, supresión de fito-patógenos, fijación de nitrógeno, producción de fito-hormonas, producción de enzimas celulolíticas y la capacidad de metabolizar de agrotóxicos (Verma, Ladha & Tripathi, 2001). Tótola y Chaer (2002) afirman que las actividades de los microorganismos están plenamente integrados en el ciclo biogeoquímico del planeta, visto que influyen directamente en la disponibilidad de los nutrientes y mejoran las mudanzas del funcionamiento del ecosistema terrestre. El fósforo (P) a pesar de estar presente en grandes cantidades en la tierra, es encontrado en bajas concentraciones en la solución suelo, siendo de (0,1 a 1,0 mg L-1 de H2PO4-), por tanto, es considerado el nutriente mas critico para todas las formas de vida, y además por ser constituyente de biomoléculas, como ATP, ADN y fosfolípidos (Novais & Smyth, 1999). La dinámica del fósforo en suelos es bien compleja debido al fenómeno de

retención de este elemento químico, esto es por la transformación de P-lábil en P-no lábil, decurrente de la adsorción de este nutriente en los oxidroxidos de Fe y Al. La retención de P también se da por la precipitación con Fe y Al en suelos ácidos y con Ca en suelos alcalinos. La disponibilidad de fosfato inorgánico (Pi) en la solución suelo y la eficiencia de la fertilización fosfatada son reducidas en suelos tropicales, que generalmente presentan altos valores de oxidroxidos de Fe y Al y alta actividad de A13+ en la solución suelo (Novais & Smyth, 1999). Para re-disponibilizar el fósforo precipitado (P-Fe, P-Al y P-Ca), los microorganismos acidifican naturalmente el suelo rizosferico por medio de la liberación de protones y ácidos orgánicos, siendo denominados de microorganismos de disolventes de fosfatos inorgánico (Pi) (Novais & Smyth, 1999). Los microorganismos disolventes de (Pi) son los responsables por la liberación de ácidos orgánicos, los cuales actúan como liberadores de protones y agentes quelantes de iones Ca, Al y Fe, favoreciendo a los disolventes de (Pi) del suelo (Rodríguez & Fraga, 1999) y constituyen cerca de 5 - 10% de la microbiota total de los suelos. Varios microorganismos del suelo disuelven diferentes formas de fosfatos inorgánicos. Whitelaw, Harden & Helyar, (1999) comprobaron que el hongo Penicillum sp. son disolventes de Ca3(PO4)2, CaHPO4, FePO4.4H2O y AlPO4. Reyes, Bernier, Simard, Tanguay y Antoun (1999), detectaron correlación positiva entre cepas disolventes de fosfatos de Penicillum sp. y la producción de acido cítrico. Las bacterias de los géneros Flavobacterium, Microccocu, Rhizobium, Burkholderia, Achromobacter, Bacillus, Aereobacter y Pseudomonas están entre los géneros fosfodisolventes más eficientes, promoviendo el crecimiento de plantas a través de la exudación de fito-hormonios, vitaminas, sustancias pécticas y antibióticos. Además de eso, la población y la actividad de los microorganismos disolventes de fosfatos están relacionados con el manejo y tipo de suelo, siendo considerados como indicadores microbiológicos asociados al ciclo del P en el suelo (Rodríguez & Fraga 1999; Verma et al., 2001), y en cuanto en las poblaciones de hongos, se destacan los géneros Aspergillus y Penicillum (Silva, Narloch & Scharf, 2002). Sin embargo, actualmente existe poca literatura que evidencie los impactos negativos de las aplicaciones de herbicidas sobre la dinámica y actividad de los microorganismos en especial los disolventes de fosfatos inorgánicos (Pi) en agroecosistemas. En este trabajo se objetivo evaluar el impacto de herbicidas sobre la actividad y dinámica poblacional de los microorganismos disolventes de (Pi) de suelo rizosférico proveniente de cultivos de S. tuberosum.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Impacto de herbicidas sobre microorganismos disolventes de fosfatos en suelo rizosfĂŠrico de plantas de Solanum tuberosum

13

MATERIALES Y MÉTODOS La investigación se realizó en invernaderos y laboratorios pertenecientes al Departamento de Producción Vegetal de la Universidad Estadual Paulista – UNESP. Brasil. El sustrato utilizado en los experimentos fue del tipo Latosuelo Rojo-Amarillo, extraído del horizonte B del perfil de suelo proveniente de un årea sin historia de aplicación de agrotóxicos. Para el cultivo

de S. tuberosum, fueron utilizados vasos de plĂĄstico con capacidad para 15 litros de substrato fertilizado con (NPK): sulfato de amonio (1,0 g dm-3 de nitrĂłgeno), superfosfato simple (1,0 g dm-3 de P2O5) y cloruro de potasio (1,00 g dm-3 de K2O). El substrato fue analizado fĂ­sica y quĂ­micamente (Tabla 1).

Tabla 1.&DUDFWHUtVWLFDVItVLFRTXtPLFDVGHOVXHORXWLOL]DGRHQORVH[SHULPHQWRVGHVSXpV GHODIHUWLOL]DFLyQ6mR3DXOR%UDVLO CaracterĂ­stica quĂ­mica S+

02

 +$/

PJGP 

 

3UHVLQD





.

0 J

 6%

&7&

9

0PROFGP

 

&D





   





CaracterĂ­stica fĂ­sica $UHQDJUXHVD

$UHQDILQD

/LPR

$UFLOOD





JNJ  





Como material propagativo de S. tuberosum fue realizado a partir de semillas (tubĂŠrculos), siendo plantados dos tubĂŠrculos por cada vaso. La humedad del suelo fue mantenida por medio de irrigaciones periĂłdicas basadas en lecturas pluviomĂŠtricas de acuerdo a los requerimientos del cultivo. Fueron realizadas evaluaciones visuales de fito-toxicidad a los 2, 15, 30, 45 y 60 dĂ­as luego de la aplicaciĂłn del herbicida (DLAH), con el uso de una escala porcentual de notas variando entre 0 (cero) y 100 (cien), donde 0 implica ausencia de daĂąos y 100 la muerte de la planta. Para los experimentos de campo fueron utilizados un delineamiento al azar con esquema de parcelas subdivididas; en las parcelas fueron evaluados los efectos de los herbicidas, con cuatro repeticiones. Cuando las plantas alcanzaron una altura aproximada de 10 cm. y con presencia de hojas, fueron aspergidas con soluciĂłn de herbicidas (kg ha-1): linuron (1,50), 2,4D (1,50), dimethenamid (1,50), metribuzin (0,50) y mezcla de dimethenamid (1,50) + metribuzin (0,75)

distribuidos con la ayuda de un aspersor previamente calibrado. A partir del 2, 15, 30, 45 y 60 dĂ­as luego de la aplicaciĂłn de los herbicidas (DLAH), muestras de suelos rizosferico y no rizosferico fueron colectados. Para la colecta del suelo no rizosferico fueron realizados en parcelas sin presencia de crecimiento vegetal de plantas. Para la colecta de suelo rizosferico, se colectĂł cuidadosamente la parte de suelo adherido a la raĂ­z de cada planta. Las muestras de suelo fueron analizadas, estimĂĄndose la densidad poblacional de bacterias y hongos, la actividad fosfodisolventes de fosfato inorgĂĄnico (Pi) y el carbono de la biomasa microbiana del suelo. La humedad del suelo fue determinada, para una posterior conversiĂłn de los datos obtenidos en base al suelo seco. En la tabla 2, estĂĄn descritos el horario de aplicaciĂłn y la condiciĂłn de algunas caracterĂ­sticas edafo-climĂĄticas durante ese periodo.

Revista TEOR�A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de à rea Andina


14

JosÊ Luís Soto Gonzåles, Mario Andrade Sånchez, Passiz Mestas Zapana, Marcelo Motta de Oliveira Gonçalves, Hebert Hernån Soto Gonzålez

Tabla 2.&RQGLFLRQHVHGDIRFOLPiWLFDVUHJLVWUDGDVSRURFDVLyQGHODDSOLFDFLyQGH KHUELFLGDV6mR3DXOR%UDVLO 

CaracterĂ­sticas

Inicio

Final

+RUDULRGH$SOLFDFLyQ 

KPLQ

KPLQ

,QWHQVLGDG/XPLQRVD /X[ 

 

 

R 7HPSHUDWXUDDPELHQWDO & 





R 7HPSHUDWXUDGHOVXHOR & 





9HORFLGDGGHOYLHQWR PV 





7LSRGHVXHOR

Para estimar la densidad poblacional de microorganismos aproximada del suelo, fue utilizado segĂşn el mĂŠtodo de Wollum (1982) para el conteo de cĂŠlulas viables vivas por siembra en superficie, que consiste en preparar diluciones seriadas con 10 gramos de suelo en 90 mL-1 de agua estĂŠril, con diluciones hasta de 1/106 para bacterias y hongos. Para conteo de cĂŠlulas bacterianas, fueron utilizadas placas de Petri conteniendo 15 mL de medio de cultura Glucosa-Extracto de Levadura (MGEL), con pH 6,50, compuesto por los siguientes reactivos (g L-1): glicose,15,00; extracto de levadura, 3,00; ĂĄgar, 15,00; y ciclĂłeximida, 0,05. En condiciones asĂŠpticas, las placas fueron inoculadas con 0,1 mL de las diluciones 10-3, 10-4, 10-5 y 10-6, encubadas por siete dĂ­as a 28ÂşC, y procediĂŠndose al conteo diario del nĂşmero de unidades formadoras de colonias (UFC) con un contador Darkfield (American Optical). Y para el conteo de hongos fue utilizado el medio de cultivo Martin,

+~PHGR

pH 5,6, compuesto por los siguientes ingredientes (g L-1): glucosa, 12,00; peptona, 6,00; KH2PO4, 1,50; MgSO4, 1,00; Rosa Bengala, 0,03; agar, 15,00; estreptomicina, 0,03 y penicilina, 0,02 (Martin, 1950). Las diluciones utilizadas para el plaqueamiento fueron 10-2, 10-3 ,10-4, 10-5 y 10-6, siendo utilizado el procedimiento anteriormente descrito para el conteo de cĂŠlulas bacterianas. Con base en las caracterĂ­sticas fenotĂ­picas de las colonias, fueron aislados 45 hongos y 54 bacterias por placa. Para un litro de medio de cultivo utilizado para el crecimiento selectivo de hongos y de bacterias fueron adicionados 50 mL de la soluciĂłn estĂŠril de KHPO4 (35 g L-1) y 100 mL de la soluciĂłn estĂŠril de CaCl2 (46 g L-1) para formaciĂłn de P inorgĂĄnico insoluble (CaHPO4), permitiendo de esa forma el conteo de microorganismos disolventes de (Pi) por la formaciĂłn de halos transparentes al rededor de cada colonia (Figura 1).

Figura 1. FormaciĂłn de halos de disoluciĂłn de fosfato inorgĂĄnico producido por bacterias aisladas.

Revista TEOR�A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de à rea Andina


Impacto de herbicidas sobre microorganismos disolventes de fosfatos en suelo rizosfĂŠrico de plantas de Solanum tuberosum

Los microorganismos aislados con actividad fosfodisolventes fueron adicionados a la colecciĂłn de microorganismos del laboratorio. Para una posterior identificaciĂłn, pruebas de sensibilidad y resistencia in vitro a herbicidas y para otras futuras aplicaciones biotecnolĂłgicas aplicados a la agricultura. Para estimar el potencial de la actividad de los microorganismos disolventes de (Pi) en medio liquido, fue transferido 2 gramos de suelo de las muestras de cada repeticiĂłn para un tubo de ensayo con medio de cultura NBRI, pH 6,8-7,0, conteniendo (g L-1): (NH4)2SO4, 0,2; Ca3(PO4)2, 8,0; MgCl2.6H2O, 3,0; MgSO4.7H2O, 0,4; KCl, 0,6; y glucosa, 10 (Nautiyal, 1999). Luego de la incubaciĂłn por mĂĄs de 20 dĂ­as a 28ÂşC, la fase liquida fue sometido a una centrifugaciĂłn de 12.000 rpm por 45 minutos y se determino en el sobre nadante la cantidad de (Pi) por el mĂŠtodo calorimĂŠtrico de la vitamina C (Braga & Defelipo, 1974). Para la determinaciĂłn de la biomasa microbiana, fueron utilizados los mĂŠtodos de Brookes, Powlson & Jenkinson (1982) y de Raij et al. (1987). La interpretaciĂłn de los resultados, luego del anĂĄlisis de la variancia al 5 % de significancia, fue utilizando el criterio de agru-

15

pamiento de medias por el mĂŠtodo de Scout-Knott, para factores cualitativos, y el anĂĄlisis de regresiĂłn, para los factores cuantitativos. Este modelo fue escogido por su significancia y coeficiente de determinaciĂłn. Posteriormente, los modelos fueron sometidos a la prueba de identidad de modelos, comparados separadamente con el modelo-testigo (suelo rizosfĂŠrico sin aplicaciĂłn de herbicidas) (Regazzi, 1993). RESULTADOS Y DISCUSIĂ“N Las densidades poblacionales de microorganismos (bacterias y hongos) de suelo rizosfĂŠrico (SR) sin aplicaciĂłn de herbicidas fueron superiores a las observadas en suelos no rizosfĂŠricos (SNR), siendo este fenĂłmeno conocido como efecto rizosfĂŠrico (Tablas 3 y 4). Este efecto estarĂ­a relacionado con la exudaciĂłn radicular de compuestos orgĂĄnicos, como por ejemplo ĂĄcidos orgĂĄnicos, aminoĂĄcidos, azucares y varios otros metabolitos secundarios, que representan del 5 - 21% del total de carbono fijado por fotosĂ­ntesis por la planta. Los microorganismos pueden ser atraĂ­dos por procesos de quimiotaxis hacia la regiĂłn rizosfĂŠrica de la planta (Bacilio-JimĂŠnez et al., 2003).

Tabla 3.'HQVLGDGSREODFLRQDOGHEDFWHULDVGHVXHORREWHQLGRVDSDUWLUGHFRQWHRGHFpOXODV YLDEOHVGHPXHVWUDVGHVXHORQRUL]RVIpULFRVLQKHUELFLGD 6156+ \GHVXHORVWUDWDGRVFRQ KHUELFLGDVOLQXURQ 65/ GLPHWKHQDPLG 65' PHWULEX]LQ 650 GLPHWKHQ DPLGPHWULEX]LQ 65'0  G 65' \VXHORUL]RVIpULFRVLQKHUELFLGDV 656+ DORV\  GtDVOXHJRGHODDSOLFDFLyQGHORVKHUELFLGDV '/$+

Tratamientoa

(DLAH) 2

15

30

45

60



%DFWHULDV /RJ8)&J GHVXHORVHFR &9SDUFHOD     6156+

F

D

E F

F

656+

D

F

D D

D

65'

E

D

F E

F

650

D

D

D E

D

65$7

D

E

F F

E

65'

F

E

G F

F

65/

D

D

F E

F

D

0HGLDVVHJXLGDVSRUODPLVPDOHWUDHQODFROXPQD\SDUDFDGDJUXSRPLFURELDQRQRVRQGLIHUHQWHVHQWUH VLSRUFULWHULRGH6FRWW .QRWW 3  6FRWW .QRWW  

Segundo Thill (2003), el herbicida 2,4-D interfiere en la molĂŠcula de RNA-polimerasa de plantas, con consecuentes alteraciones en el metabolismo de los ĂĄcidos nucleicos y de las proteĂ­nas de las plantas. Mas el mecanismo de inhibiciĂłn de las poblaciones bacterianas del suelo es actualmente desconocido. Luego

de 30 DLAH, la mezcla comercial de los herbicidas ametryn + trifloxysulfuron-sodium causo una disminuciĂłn en la densidad poblacional de bacterias del suelo en relaciĂłn a los compuestos aislados (Tabla 3), enfatizando el efecto sinĂŠrgico de la mezcla o la acciĂłn fito-toxica y micro-toxica de los aditivos en

Revista TEOR�A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de à rea Andina


16

JosÊ Luís Soto Gonzåles, Mario Andrade Sånchez, Passiz Mestas Zapana, Marcelo Motta de Oliveira Gonçalves, Hebert Hernån Soto Gonzålez

la formulaciĂłn comercial. Estos exudados producidos por las plantas son considerados como la fuente de energĂ­a y nutrientes, que proporcionan el metabolismo y crecimiento de microorganismos (Marschner, 1995; Walker, Pal Bais, Grotewold & Vivanco, 2003). En cuanto al efecto de los herbicidas sobre

la microbiota del suelo, el herbicida 2,4-D fue el que mas afecto negativamente sobre la densidad poblacional bacteriana en todas las ĂŠpocas de evaluaciĂłn (15, 30, 45 y 60 DLAH), demostrando de esa forma una disminuciĂłn de las poblaciones bacterianas de la rizĂłsfera con el uso de este herbicida.

Tabla 4.'HQVLGDGSREODFLRQDOGHKRQJRVGHVXHORREWHQLGRVDSDUWLUGHFRQWHRGHFpOXODV YLDEOHVGHPXHVWUDVGHVXHORQRUL]RVIpULFRVLQKHUELFLGD 6156+ \GHVXHORVWUDWDGRVFRQORV KHUELFLGDVOLQXURQ 65/ GLPHWKHQDPLG 65' PHWULEX]LQ 650 GLPHWKHQDPLGPHWULEX]LQ 65'0 G 65' \VXHORUL]RVIpULFRVLQKHUELFLGDV 656+ DORV\  GtDVOXHJRGHODDSOLFDFLyQGHORVKHUELFLGDV '/$+

Tratamientoa

(DLAH) 2

15

30

45

60



+RQJRV ORJ8)&J GHVXHORVHFR &9SDUFHOD     6156+

G E D F

F

656+

D D D D

D

65'

F D D E

D

650

E D F D

D

65$7

E D D D

D

65'

D D D E

D

65/

E F D F

D

D

0HGLDVVHJXLGDVSRUODPLVPDOHWUDHQODFROXPQD\SDUDFDGDJUXSRPLFURELDQRQRVRQGLIHUHQWHVHQWUH VLSRUFULWHULRGH6FRWW.QRWW 3  6FRWW .QRWW  

Santos et al. (2004) tambiĂŠn verificaron efectos negativos de formulaciones comerciales de glyphosate sobre bacterias fijadoras de N2 de soya, sugiriendo ser decurrentes de la acciĂłn de aditivos en las formulaciones de los herbicidas. A los 15, 30, 45 y 60 DLAH, los herbicidas 2,4-D, ametryn y linuron presentaron las mayores reducciones en la densidad poblacional de hongos del suelo, anĂĄlogas para la densidad poblacional bacteriana del suelo, tambiĂŠn a los 15 DLAH (Tablas 3 y 4). Los hongos provenientes del suelo se mostraron, en general, sensibles a mayores concentraciones de herbicidas. A los 30, 45 y 60 DLAH (Tabla 4) se observĂł el restablecimiento de la densidad poblacional fĂşngica del suelo, que por el ajuste metabĂłlico de las poblaciones afectadas por los herbicidas o por el menor efecto de las concentraciones residuales de los herbicidas en el suelo. Analizando el efecto de los herbicidas en cada ĂŠpoca de evaluaciĂłn, se observo que el 2,4-D y linuron favorecieron las mayores actividades de microorganismos fosfodisolventes de (Pi) a los 15, 30 y 45 DLAH, respectivamente (Tabla 5), sin embargo no afectĂł la biomasa microbiana del suelo.

De acuerdo con las investigaciones de Moorman (1989), los agrotĂłxicos poco afectan a la biomasa microbiana del suelo, mas las poblaciones y actividades de determinados grupos funcionales son afectadas. En razĂłn de la dosis de metribuzin (0,50 g ha-1) y su efecto en la actividad de los microorganismos disolventes de fosfatos inorgĂĄnicos (Pi), acciĂłn bioestimulante y la alteraciĂłn del padrĂłn de exudaciĂłn radicular de las plantas luego de la aplicaciĂłn de este herbicida son sugeridas como un mecanismo de aumento de disolventes de fosfatos. Esa dosis de metribuzin es insuficiente para promover el crecimiento y/o disponibilizar C y energĂ­a para la actividad de los microorganismos. En estudios de fisiologĂ­a vegetal, Shaw y Burns (2004) afirman que la alteraciĂłn del padrĂłn de exudaciĂłn radicular de la planta por la presencia de herbicidas en su rizĂłsfera visa la estimulaciĂłn de los microorganismos degradadores de estos compuestos. Estos mismos autores constataron un aumento en la diversidad y cantidad de microorganismos degradadores de 2,4-D en la rizĂłsfera de Trifolium sp. y se observĂł luego de 60 dĂ­as de la aplicaciĂłn de ese herbicida. Como el presente experimento fue desa-

Revista TEOR�A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de à rea Andina


Impacto de herbicidas sobre microorganismos disolventes de fosfatos en suelo rizosfĂŠrico de plantas de Solanum tuberosum

17

Tabla 5.&DQWLGDGGHIRVIDWRLQRUJiQLFR 3L OLEHUDGRSRUODDFWLYLGDGGHPLFURELROyJLFD IRVIRGLVROYHQWHGHFD  32  FDQWLGDGGH3LOLEHUDGRSRUXQLGDGGHFDUERQRGHELRPDVD PLFURELDQD DSDUWLUGHPXHVWUDVGHVXHORQRUL]RVIpULFRVLQDSOLFDFLyQGHKHUELFLGD 6156+ \ GHVXHORVUL]RVIHULFRVWUDWDGRVFRQOLQXURQ 65/ GLPHWKHQDPLG 65' PHWULEX]LQ 650  GLPHWKHQDPLGPHWULEX]LQ 6UG0   G 65 ' \VXHORUL]RVIpULFRVLQKHUELFLGD 656+  DORV\GtDVOXHJR GHODDSOLFDFLyQGHORVKHUELFLGDV '/$+  

 Tratamientoa

DLAH 2

15

30

45

60

 $FWLYLGDGGHPLFURELROyJLFDGHGLVROYHQWHV GHIRVIDWRVLQRUJiQLFRV PJ/

&9SDUFHOD  

6156+

  E 

  D 

  D 

  F 

  D

656+

  E 

  F 

  F    F    E 

65'

  F 

  F 

  E 

650

  F 

  D    D    D    D 

65$7

  E 

  D    F    F    F 

  D    E 

65'

  D    F    F    E    F 

65/

  E 

  D    F    F    D 

D

0HGLDVVHJXLGDVSRUODPLVPDOHWUDHQODFROXPQD\SDUDFDGDJUXSRPLFURELDQR1RVRQGLIHUHQWHVHQWUH VLSRUFULWHULRGH6FRWW .QRWW 3  6FRWW .QRWW  

rrollado en suelo de textura arenosa y los herbicidas aplicados en pre-emergencia, la selectividad puede haber sido influenciada por la textura del suelo, por las lluvias o irrigaciones y por la temperatura; tales factores pueden modificar la distribuciĂłn de los herbicidas en el suelo, conforme afirman Klingman y Ashton (1968). Las altas precipitaciones pluviales sobre los suelos tratados con herbicidas de alta solubilidad pueden llevar a la absorciĂłn del producto hasta las camadas mas profundas del suelo, pudiendo llegar a la regiĂłn de desarrollo del cultivo y consecuentemente afectar la selectividad de biĂłtica. Rapparini, Bartoline y Fabbril (1991) tambiĂŠn demostraron que pendimethalin y metribuzin, causaron daĂąos foliares en plantas de S. tuberosum, mas no afectaron negativamente la producciĂłn de los tubĂŠrculos. De la misma forma Bremer (1966), Cohick (1973) y Lutman (1992) no tuvieron pĂŠrdidas en la producciĂłn en comparaciĂłn con mĂŠtodos quĂ­micos y mecĂĄnicos en el control de plantas invasoras en cultivos de S. tuberosum. A los 60 DLAH, los tratamientos fueron equivalentes en cuanto a la actividad de los microorganismos disolventes de (Pi) en el suelo rizosfĂŠrico (Tablas 3 y 4), indicando que las concentraciones residuales de

los herbicidas poco afectaron a la actividad de los microorganismos del suelo. El 2,4-D es disipado del suelo de dos a cuatro semanas luego de la aplicaciĂłn, y el dimethenamid presenta una media vida de 60 dĂ­as (Silva & Silva, 2007). La media vida del metribuzin todavĂ­a no se sabe y no es encontrada en la literatura. En los experimentos realizados con plantas de S. tuberosum, no fueron observados daĂąos y/o efectos fitotĂłxicos en estas plantas provocados por el uso de los herbicidas testados. Las diferentes respuestas observadas entre los cultivos cuando son tratados con un mismo herbicida segĂşn Munzert y Kees (1990), en los cuales demostraron que los daĂąos causados en una especie por un determinado herbicida puede variar con el tipo de cultivo utilizado. Igualmente Sharpe, Chirita, Budoi y Hogea (1994) no observaron ningĂşn efecto fitotĂłxico con los herbicidas dimethenamid, metribuzin, linuron y prometryne utilizados en los cultivos de esta especie, demostrando de esa manera que los efectos fitotĂłxicos son bien variados, dependen no solamente del cultivo utilizado, mas tambiĂŠn de otros factores, como el suelo y clima. Independiente de la fertilizaciĂłn con NPK o no, en nuestros experimentos, ningĂşn efecto fue observado sobre el nĂşmero de hongos y bacterias, a no ser por interacciones de los factores analizados

Revista TEOR�A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de à rea Andina


18

José Luís Soto Gonzáles, Mario Andrade Sánchez, Passiz Mestas Zapana, Marcelo Motta de Oliveira Gonçalves, Hebert Hernán Soto González

como (herbicidas). La ausencia de la influencia de la fertilización sobre el numero de bacterias del suelos, cultivados o no, también fue reportado por Sagardoy y Salerno (1983). Diferente que Nuernberg, Vidor y Stammel (1984) los cuales demostraron que el número de microorganismos si fue influenciado por la fertilización, obteniendo de esa manera una mayor población en suelo con fertilización mineral en relación al control (suelo no fertilizado). Nahas y Assis (1991) demostraron que el número de hongos, diferente de las bacterias, no sufrieron alteración en respuesta a la incorporación de nutrientes en el suelo. Al igual que Cattelan y Vidor (1990) también no encontraron variación en relación al número de hongos y ningún efecto significativo por la cantidad de P. Con base en los resultados mencionados, se concluye en este estudio que los herbicidas interfirieron en la densidad poblacional bacteriana y fúngica del suelo, siendo el herbicida 2-4-D el más tóxico para las bacterias del suelo. La actividad de los microorganismos disolventes de fosfatos inorgánicos (Pi) no fue influenciada negativamente debido a la aplicación de los herbicidas y siendo estimulada por la presencia de metribuzin. Cabe indicar que la ecología rizosférica es propia de cada especie vegetal y al mismo tiempo las densidades poblaciones de bacterias y hongos cultivables disolventes de fosfato inorgánico son también dependientes de factores bióticos y abióticos dentro de un agroecosistema. Es bien conocido que en suelo ácido los hongos son los mejores competidores que las bacterias. Se ha demostrado que la estructura de las comunidades microbianas es influenciada por el pH (Tabla 1) y las condiciones nutricionales del suelo en experimentos a corto plazo, mientras que en ensayos de mayor duración las especies vegetales ejercen un efecto altamente selectivo y grande como el tipo de suelo debido a cantidad y composición de los exudados de las raíces de las plantas (Marschner, 1995). AGRADECIMIENTOS

REFERENCIAS Bacilio-Jiménez, M., Aguilar-Flores, S., Ventura-Zapata, E., Pérez-Campos, Bouquelet, E. & Zenteno, E. (2003). Chemical characterization of root exudates from rice Oryza sativa and their effects on the chemotactic response of endophytic bacteria. Plant and Soil, 249(2), 271– 277. Braga, J. M. & Defelipo, B. V. (1974). Determinação espectrofotométrica de fósforo em extratos de solos e plantas. Revista Ceres, 21, 73-85. Bremer, P. M. (1966). The effect of cultivation on yield of the potato crop. En Britsh Crop protection conference weed, 8, Brighton, Proceedings. Brighton, Reino Unido: BCPC, (pp. 1217). Brookes, P. C., Powlson, D. S. & Jenkinson, D. S. (1982). Measurement of microbial biomass phosphorus in soil. Soil Biology & Biochemistry, 14(4), 319-329. Cattelan, J. & Vidor, C. (1990). Sistemas de culturas e a população microbiana do solo. Revista Brasileira de Ciência do Solo, 14, 125-132. Cohick, A. D. (1973). Sencor herbicide for the control of weeds in potatoes. Pflanzenschutz-nachr, Leverkusen, 26(1), 23-24. Garbeva, P., Van Veen, J. A. & Van Elsas, J. D. (2004). Microbial diversity in soil: Selection microbial populations by plant and soil type and implications for disease suppressiveness. Annual Review of Phytopathology, 42, 243-270. Khan, M. S., Zaidi, A. & Wani, P. A. (2007). Role of phosphate-solubilizing microorganisms in sustainable agriculture – a review. Agronomy for Sustainable Development, 27, 29-43.

- Este trabajo es dedicado a la memoria de mi Gran Maestro y Querido Profesor Dr. Crodowaldo Pavan (1919 – 2009).

Klingman, G. C. & Ashton, F. M. (1968). Weed Science: principles and practices. National Academic of Science - Weed Control, 2, 431-471.

- Al Consejo Nacional de Desarrollo Científico y Tecnológico (CNPq) por el apoyo financiero para la realización de este trabajo.

Lutman, P. J. W. (1992). Weeds in potatoes. En P. Harris (Ed.), The potatoes crop: the scientific basis for improvement (2a ed.) (pp. 373-379). London: Chapman & Hall.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


19 Marschner, H. (1995). Mineral nutrition of higher plants (2a ed.). London: Academic Press. Marschner, P. D., Crowley, C. & Yang, H (2004). Development of specific rhizosphere bacterial communities in relation to plants species, nutrition and soil type. Plant Soil, 261, 199-208. Martin, J. P. (1950). Use of acid, rose bengal, and streptomycin in the plate method for estimating soil fungi. Soil Science,69, 215-232. Moorman, T. B. (1989). A review of pesticide effects on microorganisms and microbial processes related to soil fertility. Journal of Crop Production, 2(1), 14-23. Munzert, M. & Kees, H. (1990). Further results for herbicide tolerance of potato cultivars. Kartoffelbau, Ribbesbüttel, 41(4), 126-129. Nahas, E. & Assis, L. C. (1991). Efeito da adição ao solo de fosfato solúvel obtido por via microbiológica a partir de fluorapatita. Revista Latinoamericana de Microbiología, 33, 225-229. Nautiyal, C. S. (1999). An efficient microbiological growth medium for screening phosphate solubilizing microorganisms. FEMS Microbiology Letters, 170, 265-270. Novais, R. F. & Smyth, T. J. (1999). Fósforo em solo e planta em condições tropicais. Viçosa, Brasil: Universidade Federal de Viçosa. Nuernberg, N. J., Vidor, C. & Stammel, J. G. (1984). Efeito de sucessões de culturas e tipos de adubação na densidade populacional e atividade microbiana do solo. Revista Brasileira de Ciência do Solo, 8(2), 197-203. Pankhurst, C. E., Doube, B. M & Gupta, V. V. S. R. (Eds.). (1997). Biological indicators of soil health. Boca Raton, Florida CRC Press.

Regazzi, A. J. (1993). Teste para verificar a igualdade de modelos de regressão e a igualdade de alguns parâmetros num modelo polinomial ortogonal. Revista Ceres, 40, 176-195. Reyes, I., Bernier, L., Simard, R., Tanguay, P. & Antoun, H. (1999). Characteristics of phosphate solubilization by an isolate of a tropical Penicillium rugulosum and two UV-induced mutants. FEMS Microbiology Ecology, 28, 291-295. Rodríguez, H. & Fraga, R. (1999). Phosphate solubilizing bacteria and their role in plant growth promotion. Biotechnology Advances, 17(4-5), 319-339. Sagardoy, M. A. & Salerno, C. M. (1983). Number, distribuition, and characterization of heterotrophic bacteria in some Argentine soils. Anales de Edafologia y Agrobiologia, 42, 2069-2081. Santos, J. B., Jacques, R. J. S., Procopio, S. O., Kasuya, M. C. M., Silva, A. A. & Santos, E. A. (2004). Efeitos de diferentes formulações comerciais de glyphosate sobre estirpes de Bradyrhizobium. Planta Daninha, 22(2), 293-299. Scott, A. J. & Knott, M. (1974). Cluster analysis method for grouping means in the analysis of variance. Biometrics, 30, 507-512. Sharpe, N., Chirita, N., Budoi, G. & Hogea, C. (1994). Research works on both selectivity and efficacy of the herbicides dimethenamid, alachlor and pendimenthalin for potato crop. En International Symposium On Crop Protection, 46TH. Belgium. Proceedings. Gent: BCPC, v.59, n.3b, p. 1361-1365. Shaw, L. J. & Burns, R. G. (2004). Enhanced mineralization of [U-(14)C]2,4-dichlorophenoxyacetic acid in soil from the rhizosphere of Trifolium pretense. Applied and Environmental Microbiology, 70(8), 4766-4774.

Raij, B. V., Quaggio, J. A., Cantarella, H., Ferreira, M. E., Lopes, A. S. & Bataglin, O. C. (1987). Análise química do solo para fins de fertilidade. Campinas, SP. Brasil: Fundação Cargill.

Silva, G. N., Narloch, C. & Scharf, R. (2002). Solubilização de fosfatos naturais por microrganismos isolados de cultivos de Pinus e Eucalyptus de Santa Catarina. Pesquisa Agropecuária Brasileira, 37(6), 847-854.

Rapparini, G., Bartoline, D. & Fabbri, M. (1991). Selectivity and degradation time of potato herbicides. Informativo Agropecuário, 47(29), 49-57.

Silva, A. A. & Silva, J. F. (Eds.). (2007). Tópicos em manejo de plantas daninhas. Viçosa, Brasil: Universidade Federal de Viçosa.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


20

Thill, D. (2003). Growth regulator herbicides. En Herbicide action course. West Lafayette, United States: Purdue University.

Walker, T. S., Pal Bais, H., Grotewold, E. & Vivanco, J. M. (2003). Root exudation and rhizosphere biology. Plant Physiology, 132, 44-51.

Tótola, M. R. & Chaer, G. M. (2002). Microrganismos e processos microbiológicos como indicadores da qualidade dos solos. En: V. H. A. Venegas, et al. (Eds.). Tópicos em Ciência do Solo. Viçosa, Brasil: Sociedade Brasileira de Ciência do Solo.

Whitelaw, M. A., Harden, T. J. & Helyar, K. R. (1999). Phosphate solubilization in solution culture by the soil fungus Penicillium radicum. Soil Biology & Biochemistry, 31, 655-665.

Verma, S. C., Ladha, J. K. & Tripathi, K. (2001). Evaluation of plant growth promoting and colonization ability of endophytic diazotrophic from deep water rice. Journal of Biotechnology, 91(2-3), 127-141.

Wollum, A. G. (1982). Cultural methods for soil microorganisms. En A. L. Page, R. H. Miller, & D. R. Keeney (Eds.), Methods of soil analysis. Madison, United States: Soil Science Society of America.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


21

Alteraciones neurotoxicológicas y pruebas de visión cromática en pacientes consumidores de alcohol Neurotoxicological alterations and testing colour vision in alcohol consumer patients Patricia Elena García Álvarez1, Julio Guzmán2, Helman Cruz3, Julián Andrés Bolívar Fontecha4, Lilyeth Catherine Casas Sandoval5, Laura Consuelo Montenegro Tejada6, Nathaly Remolina Alarcón7 Resumen Dado que las pruebas visuales han demostrado sensibilidad a disfunciones visuales adquiridas por neurointoxicación, es razonable, sugerir su uso en actividades de diagnóstico precoz de las enfermedades asociadas con el consumo de alcohol. Con el objetivo de establecer la prevalencia de alteraciones de la visión cromática en sujetos consumidores de alcohol y su correlación con los niveles de este, se realizó un estudio descriptivo de corte. La valoración de la visión cromática se realizó mediante la prueba Lanthony D-15. La prevalencia de discromatopsia no presentó incremento alguno con el consumo de alcohol, sin embargo, solo los consumidores crónicos presentaron cierto grado de discromatopsia. Palabras clave: Discromatopsia, Índice de Confusión Cromática, alcohol, neurotoxicología, pruebas de visión cromática. Abstract Since visual tests have demonstrated sensitivity to visual defects acquired by neurointoxicación, it is reasonable to suggest its use in early diagnosis procedures of illnesses associated with consumption of alcohol. In order to establish the prevalence and correlation of color vision disorders we performed a cross sectional study in alcoholic subjects. The assessment of color vision was performed using the Lanthony D-15 test. The prevalence of impaired color vision did not show to increase with alcohol consumption, however, only chronic users showed some degree of impaired color vision. Key words: Dischromatopsis, Chromatic Confusion Index, alcohol, neurotoxicology, chromatic vision tests. 1 2 3 4 5 6 7

Optómetra, Magister en Administración de Salud pattygarcia01@yahoo.com Optómetra, Magister en Administración de Salud, Magister en Educación, Especialista en Formulación y evaluación de proyectos de investigación social, julioguzman@cable.net.co. Optómetra, Especialista en Diagnóstico diferencial en cuidado primario ocular, helmancruz38@hotmail.com Optómetra, Especialista en Diagnóstico diferencial en cuidado primario ocular Optómetra Optómetra Optómetra

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


22

Julio Guzmán Vargas, Patricia Elena García Álvarez, Helman Alfredo Cruz, Julian Andrés Bolívar Fontecha, Lilyeth Catherine Casas Sandoval, Laura Consuelo Montenegro Tejada, Nathaly Remolina Alarcón

INTRODUCCIÓN La detección sistemática de enfermedades asociadas a neurointoxicación exige la aplicación de pruebas diagnósticas complejas y costosas; por lo que se demanda el uso de pruebas diagnósticas complementarias que presenten bajo costo, de carácter no-invasivo y de fácil aplicación. Como opción, se propone señalar alternativas optométricas, consideradas viables y costo efectivas que sirvan como complemento a las pruebas utilizadas en la prevención y detección temprana de patologías asociadas con exposición a agentes neurotóxicos (Hart, 1987). Según el Informe sobre la salud en el mundo 2002, el 4% de la carga de morbilidad y el 3,2% de la mortalidad mundial son atribuibles al alcohol y éste representa el principal riesgo para la salud en los países en desarrollo con baja mortalidad, y el tercero en los países desarrollados. Existe suficiente evidencia que sustenta el efecto del consumo de alcohol en la salud humana. Las sustancias psicoactivas, conocidas más comúnmente como drogas psicoactivas, son sustancias que al ser tomadas pueden modificar la conciencia, el estado de ánimo o los procesos de pensamiento de un individuo. El uso de estas sustancias se divide en tres categorías, según su estatus sociolegal. En primer lugar, muchas de estas sustancias son utilizadas como medicación. Los sistemas médicos occidentales y de otro tipo han reconocido desde hace mucho la utilidad de estas sustancias como medicación para aliviar el dolor, ayudar al sueño o a la lucidez y aliviar desórdenes del estado de ánimo. Actualmente, la mayoría de las medicaciones psicoactivas están restringidas al uso por prescripción médica, mediante un sistema de recetas. Ejemplo de ello es el empleo del estimulante metil-fenidato para tratar el trastorno de déficit de atención con hiperactividad (TDAH) de la infancia. Una segunda categoría de uso es su estatus ilegal o ilícito. De conformidad con tres convenciones internacionales, la mayoría de los países se han comprometido a considerar como ilegal el comercio y uso no médico de los opiáceos, cannabis, alucinógenos, cocaína y muchos otros estimulantes, al igual que de los hipnóticos y sedantes. Además de esta lista, los países o jurisdicciones locales, muchas ocasiones añaden sus propias sustancias prohibidas, por ejemplo bebidas alcohólicas y varios inhalantes. A pesar de tales prohibiciones, el uso ilícito de sustancias psicoactivas

está muy difundido en numerosas sociedades, particularmente entre adultos jóvenes, casi siempre con el propósito de disfrutar o beneficiarse de las propiedades psicoactivas de la sustancia. La tercera categoría de uso es el consumo legal o lícito, para cualquier propósito que elija su consumidor. Dichos propósitos pueden ser muy variables, y no necesariamente se relacionan con las propiedades psicoactivas de la sustancia. Por ejemplo, una bebida alcohólica puede ser una fuente de nutrientes, para calentar o refrescar el cuerpo, o para aliviar la sed; puede funcionar también para un propósito simbólico en una ronda de brindis o como sacramento. Sin embargo, sea cual sea su propósito, el uso de la sustancia inevitablemente va acompañado de sus propiedades psicoactivas. Las sustancias psicoactivas pueden producir efectos inmediatos sobre la liberación de neurotransmisores o sistemas de segundos mensajeros, aunque también es posible que se presenten muchos cambios que ocurren a nivel celular, tanto a corto como a largo plazo, luego del uso único o repetido de una sustancia. Los principales lugares de acción de la mayoría de las sustancias psicoactivas son los receptores de membranas celulares y su sucesión asociada de procesos de transducción de señales (Diederich et al., 1998; Diederich et al., 2002 & Vettori et al., 2000). Cuando un sistema favorecido por el uso crónico de sustancias se expone agudamente a la sustancia, disminuyen los efectos agudos, lo que representa la tolerancia celular. En ausencia de la sustancia, el sistema favorecido contribuye a la aparición de síntomas de abstinencia (Kapitany et al., 1993; Nestler & Aghajanian, 1997). La repetida estimulación de receptores por medio de drogas, puede producir alteraciones en la cantidad y función de los receptores. Por ejemplo, la exposición a largo plazo a la nicotina incrementa la cantidad de receptores nicotínicos de acetilcolina en el cerebro (Doyle et al., 2002). Existen ahora considerables evidencias de que la administración intermitente y repetida de sustancias estimulantes psicomotoras producen un incremento progresivo en sus efectos activadores psicomotores. Se ha demostrado la sensibilización psicomotora de la anfetamina, cocaína, metilfenidato, fencamfamina, morfina, fenciclidina, ecstasy, nicotina y etanol (Robinson & Berridge, 1993).

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Alteraciones neurotoxicológicas y pruebas de visión cromática en pacientes consumidores de alcohol

Si bien se ha establecido los efectos producidos por el etanol, probablemente se relacionan con un mayor ritmo de disparo de las neuronas dopaminérgicas del área tegmental ventral (ATV) y con la liberación de dopamina, probablemente como consecuencia secundaria de la activación del sistema GABA o la estimulación de opioides endógenos (Witkovsky, 2004). El incremento en la actividad dopaminérgica ocurre únicamente mientras la concentración de etanol en sangre va en aumento. Varios estudios han evidenciado que el alcoholismo crónico causa deficiencias del color. Kapitany et al. (1993) encontró que el 47,2% de alcohólicos crónicos manifestaban deficiencias adquiridas de la visión cromática. Cuando se deja el consumo de alcohol, se observa un marcado mejoramiento de estas alteraciones. Según Valic et al. (1997), la combinación del consumo de alcohol y la exposición ocupacional a solventes aumenta el riesgo de presentar alteraciones subclínicas de la visión al color. Un estudio de Verriest et al. (1980) en pacientes alcohólicos durante el periodo de deprivación, mostró que el alcoholismo causa una disminución en el desempeño en las pruebas de Ishihara, el anomaloscopio de Nagel, Panel D15 y 100 H, pero indica que el defecto en si mismo desaparecía en el periodo de desintoxicación. Método La muestra construida para efectos de este estudio se seleccionó con base en un muestreo aleatorio estratificado intencional con tres tamices muestrales, con un nivel de confianza de 95% y un margen de error máximo de 5%; sustentados en las estadísticas de la Encuesta sobre Salud Mental 2003 del Ministerio de la Protección Social, se estima el universo de consumidores de alcohol en 3.832.910 adultos y adultos jóvenes (rango de edad entre 18 y 44 años), la muestra a trabajar considera la necesidad de realizar inferencia estadística, fue de 131 individuos con rango de edad entre 18 y 44 años (primer tamiz muestral), con distribución aleatoria por género, con escolaridad mínima de educación media (segundo tamiz muestral), ubicación geográfica urbana y focalizada en Bogotá D.C (tercer tamiz muestral). Adicionalmente se controlaron por medición en escala cualitativa las variables: dosis, periodicidad, peso/talla, antigüedad en el consumo, condiciones físicas asociadas y factores predisponentes, entre otras variables principales. La muestra final se conformó tomando como base la dis-

23

tribución en los mismos grupos etarios quinquenales con límites de marca de clase concordantes con los criterios de inclusión. Los instrumentos de recolección y acopio de la información fueron diseñados y estandarizados con base en los parámetros de determinación de los niveles de consumo de alcohol establecidos por la Organización Mundial de la Salud (OMS), adicionados por la medición de las variables óculo-refractivas estandarizadas por el Área de Clínica optométrica del programa de optometría de la Fundación Universitaria del Área Andina. Se realizó un estudio descriptivo de corte con el fin de evaluar la asociación entre la discromatopsia y el consumo de alcohol, encontrando que la muestra construida para efectos del estudio correspondió a un total de 131 sujetos de los cuales 65, equivalentes al 49,61% del total eran hombres y los 66 restantes, equivalentes al 50,38% eran mujeres. La distribución por edad se realizó tomando como base la caracterización de grupos etarios agrupados quinquenalmente con límites de marca de clase concordantes con los criterios de inclusión, encontrando que 23 individuos, correspondientes al 17.55% se encontraban en el grupo de menores de 20 años; 39 individuos, correspondientes al 29.77% se encontraban en el grupo de 21 a 25 años; 31 individuos, correspondientes al 23.66% se encontraban en el grupo de 26 a 30 años; 16 individuos, correspondientes al 12.21% se encontraban en el grupo de 31 a 35 años y 22 individuos, correspondientes al 16.79% se encontraban en el grupo de 35 a 40 años. El promedio de edad se ubicó en 28.55 años para los hombres con una desviación estándar de 6.9 y en 26.08 años para las mujeres con una desviación estándar de 6.34; para el total de la muestra el promedio fue de 27.31 años y la desviación estándar de 6.72. La distribución por edad y sexo se caracterizó como referente inicial de la muestra tomando como base la distribución en los mismos grupos etarios quinquenales con límites de marca de clase concordantes con los criterios de inclusión. El grupo de 21 a 25 años se constituyó en el único grupo etario con distribución paramétrica en la muestra. Para establecer el nivel de consumo de alcohol se utilizó la prueba AUDIT, Cuestionario de Identificación de los Transtornos debidos al Consumo de Alcohol, de la Organización Mundial de la Salud. En relación con la frecuencia de consumo de alcohol, del total

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


24

Julio GuzmĂĄn Vargas, Patricia Elena GarcĂ­a Ă lvarez, Helman Alfredo Cruz, Julian AndrĂŠs BolĂ­var Fontecha, Lilyeth Catherine Casas Sandoval, Laura Consuelo Montenegro Tejada, Nathaly Remolina AlarcĂłn

de la muestra se encontrĂł que 26 sujetos distribuidos en 12 hombres y 14 mujeres, reportaron consumir alcohol una vez al mes; 68 sujetos distribuidos paramĂŠtricamente en 34 hombres y 34 mujeres, reportaron consumir alcohol de dos a cuatro veces por mes; de igual manera y con la misma tendencia 26 sujetos distribuidos paramĂŠtricamente en 13 hombres y 13 mujeres, reportaron consumir alcohol de dos a tres veces por semana; finalmente 11 sujetos distribuidos

en 6 hombres y 5 mujeres, reportaron consumir alcohol cuatro o mĂĄs veces por semana. La distribuciĂłn de acuerdo a los resultados de la valoraciĂłn del consumo de alcohol segĂşn la prueba AUDIT, se encuentran en la tabla 1. La muestra se clasifica en 4 grupos que corresponden a zona 1 o de bajo consumo, zona 2 o de consumo moderado, zona 3 o de consumo frecuente y zona 4 o de consumo permanente.

Tabla 1. DistribuciĂłn por nivel de dependencia de alcohol y gĂŠnero. SCREENING ALCOHOL TEST AUDIT

HOMBRES

MUJERES

TOTAL

ZONA 1







ZONA 2







ZONA 3







ZONA 4







El anĂĄlisis de las medidas de tendencia central de los valores de los resultados de la aplicaciĂłn de la prueba AUDIT como operacionalizador del Ă­ndice de consumo de alcohol, muestra una distribuciĂłn altamente dispersa tanto en hombres como en mujeres, indicando la utilizaciĂłn de otra serie de variables de mayor explicaciĂłn causal para el estudio. El anĂĄlisis de la variable cantidad de tragos consumidos por sesiĂłn, nos muestra que: el 5% de los sujetos de estudio, distribuidos en 3 hombres y 4 mujeres, totalizando 7 sujetos, ingiere o toma entre uno y dos tragos por sesiĂłn; 14 sujetos correspondientes al 11% de la muestra distribuidos en 3 hombres y 11 mujeres consumen entre tres y cuatro tragos de alcohol por sesiĂłn; 10 hombres y 16 mujeres que conforman un 20% del total de la muestra consumen entre 5 y 6 tragos por sesiĂłn; de igual manera el 24% de los sujetos de estudio, distribuidos en 15 hombres y 17 mujeres, totalizando 32 sujetos, ingiere o toma entre siete y nueve tragos por sesiĂłn; en tanto que los 52 individuos restantes constituyendo la moda de la serie, distribuidos en 34 hombres y 18 mujeres ingiere 10 o mĂĄs tragos por sesiĂłn. Este anĂĄlisis permite establecer, que para efectos de la muestra, la cantidad de tragos muestra una relaciĂłn directa y armĂłnica con el gĂŠnero, seĂąalando que los hombres consumen mayor cantidad de tragos por sesiĂłn.

La distribuciĂłn de frecuencias de la variable nivel de dependencia al alcohol, se encontrĂł que la mayor frecuencia tanto para hombres, como para mujeres y para el total de la poblaciĂłn, se ubicĂł en la zona 2, mostrando un nivel de dependencia moderado con un 44.27%; seguido del nivel de dependencia baja con el 33.59%. Vale la pena destacar los indicadores de prevalencia para la zona 4, consumo permanente con 20 % para hombres y 15% para mujeres. La variable Ă?ndice de ConfusiĂłn CromĂĄtica (ICC) - diferencias cromĂĄticas calculadas entre cada una de las pastillas del panel Lanthony D-15 desaturado dividida por 56.3 (valor que se obtiene cuando el ordenamiento es perfecto), operacionalizada como valor que se obtiene al calcular estadĂ­sticamente el promedio de las mediciones en ambos ojos. Para efecto del estudio se estableciĂł un rango de valores para el ICC con lĂ­mite inferior en 1 y lĂ­mite superior 4, estableciendo intervalos de clase de 0.50; encontrando la mayor frecuencia para los dos gĂŠneros en el valor 1.01 a 1.49, correspondiendo a un 57.25%, mostrando una relaciĂłn simĂŠtrica, directa entre el gĂŠnero y el Ă­ndice de confusiĂłn cromĂĄtica. (tablas 2 y 3).

Revista TEOR�A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de à rea Andina


Alteraciones neurotoxicolรณgicas y pruebas de visiรณn cromรกtica en pacientes consumidores de alcohol

25

Tabla 2. Distribuciรณn del รndice de Confusiรณn Cromรกtica. ICC

HOMBRES

MUJERES

TOTAL

1,00













1,01 - 1,49













1,50 - 1,99













2,00 - 2,49













2,50 - 2,99













3,00 - 3,49













3,50 - 3,99























 

Tabla 3. Medidas de tendencia central del รndice de Confusiรณn Cromรกtica. ICC - TENDENCIA CENTRAL

HOMBRES

MUJERES

TOTAL

PROMEDIO







MEDIANA







MODA







DESVIACION ESTรNDAR







El anรกlisis del coeficiente de correlaciรณn entre el รญndice de confusiรณn cromรกtica y el consumo ligado al sexo nos muestra una relaciรณn directa, armรณnica y

proporcional para los niveles de consumo moderado, frecuente y permanente (tabla 4).

Tabla 4. Coeficiente de correlaciรณn ICC y Gรฉnero ICC

HOMBRES

MUJERES

TOTAL

























































Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina


26

Julio Guzmán Vargas, Patricia Elena García Álvarez, Helman Alfredo Cruz, Julian Andrés Bolívar Fontecha, Lilyeth Catherine Casas Sandoval, Laura Consuelo Montenegro Tejada, Nathaly Remolina Alarcón

El análisis del coeficiente de correlación entre el Índice de Confusión Cromática (variable principal) y el nivel de consumo de alcohol, tomando como base que para efectos del estudio se estableció un rango de valores para el ICC con límite inferior en 1 y límite superior 4, estableciendo intervalos de clase de 0.50; arrojó como resultado una relación directa entre los niveles de consumo permanente y un mayor índice de confusión cromática para el género masculino y una relación directa entre los niveles de consumo bajo y moderado, y el índice de confusión cromática para los dos géneros. Por lo tanto, se concluye que no existe relación alguna entre el sexo y el nivel de consumo relacionados con la confusión cromática para todos los ejes de percepción. La relación del nivel de consumo, operacionalizado como promedio de ingesta alcohólica y antigüedad en el consumo, no muestra alteración estadísticamente significativa con el índice de confusión cromática representada en todos los ejes de diferenciación, tanto para la prueba pseudo iso cromática de Ishihara como para la prueba cromática desaturada de Lantonoy de 15 fichas. Discusión A pesar de que se han realizado muchos estudios sobre la asociación del consumo de alcohol y las enfermedades oculares sigue habiendo incertidumbre. Una revisión realizada por Wang et al. (2008) revela que existe una relación entre el consumo de alcohol y un mayor riesgo de catarata en estudios transversales, pero que varios estudios de cohorte prospectivos no han encontrado esta asociación. Refiere que los resultados de estudios poblacionales prospectivos sugieren que el consumo excesivo de alcohol tiene una ligera asociación con un mayor riesgo de degeneración macular relacionada con la edad. Los estudios de una asociación entre el consumo de alcohol y la retinopatía diabética se han limitado principalmente a los datos de corte transversal. Indica por su parte que hay poca evidencia de una asociación entre el consumo de alcohol y el glaucoma, y las conclusiones de la asociación entre el consumo de alcohol y aumento de la presión intraocular han sido inconsistentes. Por el contrario Yoshimune & Guohua (2001) afirman que además de las anomalías oculares inducidas por el alcohol entre los niños con síndrome de alcoholismo fetal, los estudios epidemiológicos han demostrado que el alcoholismo crónico se asocia con un aumento significativo del riesgo de cataratas, queratitis, las deficiencias de la visión del color y arco corneal.

Por otro lado, varios estudios han evidenciado que el alcoholismo crónico causa deficiencias del color. Mergler et al. (1988) evaluaron la relación entre el consumo de alcohol y la capacidad de discriminación del color en 136 personas de las cuales 16 estaban en tratamiento en un centro de desintoxicación. El consumo de alcohol fue obtenido a través de un cuestionario en el que se identificaban patrones de consumo. El consumo de alcohol varió de 0 a 5824 gramos por semana, con una media de 266 gramos por semana. En este estudio, la valoración de la visión cromática con pruebas cualitativas y cuantitativas mediante el Lanthony D-15, para todos los grupos de edad, la prevalencia de discromatopsia no presentó incremento alguno con el consumo de alcohol, sin embargo, solo los consumidores crónicos (más de 751 gramos por semana), presentaron cierto grado de discromatopsia lo cual podría explicarse a partir de alteraciones subclínicas de la visión al color. El análisis de regresión múltiple muestra que la pérdida de visión cromática se encuentra relacionada con la edad (p < 0.001) y aleatoriamente con el consumo de alcohol (p < 0.001). REFERENCIAS Diederich, N., Goetz, C. Raman, R., Pappert, E., Leurgans, S. & Piery, V. (1998). Poor visual discrimination and visual hallucinations in Parkinson´s disease. En: Clin Neuropharmacol., Vol. 21 No. 5. (pp. 289-295). Diederich, N., Raman, R., Leurgans, S. & Goetz, C. (2002). Progressive worsening of spatial and chromatic processing deficits in Parkinson Disease. En: Arch. Neurol., Vol. 59 No. 8. (pp.1249-1252). Doyle, S. E., McIvor, W.E. & Menaker, M. (2002). Circadian rhythmicity in dopamine content of mammalian retina: role of the photoreceptors. En: J. Neurochem., Vol. 83 No. 1. (pp. 211– 219). Hart, W. M. (1992). Color vision. En Hart, W. M., (ed.), Adler’s Physiology of the Eye: Clinical Application (pp. 708 –727). St. Louis, MO: Mosby-Year Book. Hart, W. M. (1987). Acquired dyschromatopsias. En: Surv. Ophthalmol., Vol. 32 No. 1 (pp.10–31).

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Alteraciones neurotoxicológicas y pruebas de visión cromática en pacientes consumidores de alcohol

Kapitany, T. Dietzel, M. Gruenberg, J. Frey, R. & Koppensteiner, L. (1993). Color vision deficiencies in the course of acute alcohol withdrawal. En: Biol. Psychiat., Vol. 33 No. 6. (pp.415422). Mergler, D., Blain, L., Lemaire, J. & Lanlande, F. (1988). Colour vision impairment and alcohol consumption. En: Neurotoxicol. Teratol., Vol. 10 No.3. (pp. 255–260). Ministerio de la Protección Social. El Consumo de Alcohol como Problema Social de Salud Pública. Dirección General de Salud Pública – MPS. Aldemar Parra Espitia. [en línea] Ginebra. [consultado el: 19-09-2010]. Disponible en Internet: www.descentralizadrogas. gov.co/tallerpre/El%20Consumo%20de%20 Alcohol%20como%20Problema%20Social%20de%20Salud%20P%C3%BAblica%20 %E2%80%93%20MPS%20.ppt consumidores de alcohol en colombia. Nestler, E. J., & Aghajanian, G. K. (1997). Molecular and cellular basis of addiction. En: Science, Vol. 278 No. 5335. (pp. 58–63). Organización Mundial de la Salud (2002). Informe sobre la salud en el mundo 2002: Reducir los riesgos y promover una vida sana. [en línea] Ginebra. [consultado el: 19-09-2010], Disponible en Internet: http://www.who.int/whr/2002/es/.

27

Robinson, T. E., & Berridge, K. C. (1993). The neural basis of drug craving: an incentive- sensitization theory of addiction. En: Brain Research Reviews, Vol. 18 No. 3 (pp. 247–291). Valic, A., Waldhör, T., Konnaris, C., Michitsch, A. & Wolf, C. (1997). Acquired dyschromatopsia in combined exposure to solvents and alcohol. En: Int. Arch. Occup. Environ. Health., Vol. 70 No. 6. (pp. 403– 406). Verriest, G., Francq, P. & Pierart, P. (1980). Results of colour vision tests in alcoholic and in mentally disordered subjects. En: Ophthalmologica, Vol. 180 No. 5. (pp. 247-256). Vettori, M. A., Corradi, D. & Coccini, T. (2000). Styrene-induced changes in amacrine retinal cells: an experimental study in the rat. En: Neurotoxicology, Vol. 21 No. 4. (pp. 607– 614). Witkovsky, P. (2004). Dopamine and retinal function. En: Documenta Ophthalmologica, Vol. 108 No. 1. (pp. 17–39). Wang, S., Wang, J., & Wong, T. (2008). Alcohol and eye diseases. En: Surv. Ophthalmol., Vol. 53 No. 5. (pp. 512-525). Yoshimune, H., & Guohua, L. I. (2001). Alcohol and eye diseases. A review of epidemiologic studies. En: J. of studies on Alcohol., Vol. 62 No. 3 (pp. 397-402).

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


28

Julio Guzmán Vargas, Patricia Elena García Álvarez, Helman Alfredo Cruz, Julian Andrés Bolívar Fontecha, Lilyeth Catherine Casas Sandoval, Laura Consuelo Montenegro Tejada, Nathaly Remolina Alarcón

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


29

Programa klic house Como modelo empresarial, educativo y de alimentos para la segunda infancia Resumido en la ecuación Ne + nn + nj = nf = he Klic house program As a model business, education and food for the second childhood Summarized in equation ne + nn + nj = nf = he DairoAntonio Muñoz Chiquillo1 Resumen El programa de Klic House, se configura en una oportunidad de inversión en la que los empresarios, universidades, organizaciones gubernamentales y no gubernamentales participan del desarrollo de la niñez colombiana en lo referente a alimentación, recreación y educación en un solo lugar; el modelo empresarial se desarrolla desde la escuela de la prospectiva y estudios de ciencias de la complejidad y el modelo pedagógico aplicado se fundamenta en una de las herramientas que proporciona la cibernética social como es la del desarrollo del cerebro tríadico. La operación del programa se realiza con el apoyo de tecnologías orientadas por expertos que interactúan con los niños y lo conducen a la aprehensión de nuevos saberes mediante el desarrollo de laboratorios; el aprendizaje es vivencial y gira en torno al juego. El programa se fundamenta en la ecuación, ne + nn + jn = nf = he donde ne corresponde a, niños educados, nn a niños nutridos y nj a juego en los niños. La sumatoria da como resultado nf que es niños felices lo cual es igual a he que es hombres exitosos. Klic House muestra cómo es posible desarrollar esta ecuación y como se diseña una empresa perdurable, sostenible en el tiempo, saludable y sobre todo con un alto sentido de responsabilidad social empresarial. Palabras clave: Segunda infancia, proyecto social, modelo empresarial perdurable. Abstract The Klic House program is an assemble investment opportunity for entrepreneurs, universities, governmental and nongovernmental organizations participating in the Colombian children development, with regard to nutrition, recreation and education in one place. The business model develops from the School of prospective studies of complexity science and applied educational model; based on the triadic brain development, tool provided by the social cybernetics. The program operation is performed with the support of technologies designed by experts who interact with children and lead to the apprehension of new knowledge through workshop activities, with an experiential and game based learning. The program is based on the equation: ne + nn + jn = ne nf = he, where “ne” stands for educated children, “nn” nurtured nurtured, “nj” playing children. The resulting sum is “nf” happy children which is equal to “he” successful men. The Klic House shows how this equation can be developed and designed as a company enduring, sustainable over time, healthy and above all with a high sense of business social responsibility. Key words: Second childhood, social project, enduring business model. 1

Máster en Dirección y Gerencia de Empresas.Universidad Colegio Mayor de Nuestra Señora del Rosario. damunoz3@areandina.edu.co

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


30

Dairo Muñoz Chiquillo

INTRODUCCIÓN Marco general de la ecuación propuesta Una de las características que define a un grupo humano y lo diferencia de otros grupos sociales es el de la cultura, en ella se expresan las raíces, las tradiciones, la lengua, la forma de educarse entre muchas otras. La educación es un factor determinante en el desarrollo de un pueblo y como tal, debe ser tomado en forma seria por los gobiernos, debe equipararse a la forma como se prepara para la guerra o se legisla para mantener el orden; un pueblo educado es capaz de tomar sus propias decisiones, de regularse a si mismo, de reinventarse día a día para ir superando las dificultades que le son propias, como su economía, su relación con los vecinos, la salud de sus habitantes, la energía, el desempleo, el analfabetismo, el maltrato infantil, la desnutrición, entre muchas otras adversidades. Con la educación como instrumento de desarrollo se logra que un pueblo se mire a si mismo y vea el compromiso que tiene por delante para la búsqueda de alternativas que coadyuven a tener un mejor país y así se llegue a que se dé por parte de los miembros de la sociedad la intervención directa de su saber, sobre la solución de problemas concretos. Uno de los problemas que aqueja a nuestro país es el de la explotación laboral o económica y trabajos riesgosos en menores (citado por el investigador Wilmar Collazos en el artículo aspectos normativos y deontológicos de la empresa en Colombia), esto refleja que hay un abandono de las instituciones como son las de gobierno y en la institución base que es la familia de estos infantes que se encuentran viviendo una vida totalmente diferente a la que tienen derecho; se expresa en la Constitución Política de Colombia de 1991 que: Son derechos de las niños: la vida, la integridad física, la salud y la seguridad social, la alimentación equilibrada, su nombre y nacionalidad, tener una familia y no ser separadas de ella, el cuidado suficiente y amor, educación, cultura, recreación, protección y la libre expresión de su opinión como niño que piensa y se compromete con las semejantes. Ellos serán protegidos contra toda forma de explotación laboral o económica y trabajos riesgosos. La familia, la sociedad y el Estado tienen la obli-

gación de asistir y proteger al niño para garantizar su desarrollo armónico e integral y el ejercicio pleno de sus derechos. Toda persona tiene facultades para exigir ante la autoridad competente el cumplimiento de la ley y la sanción de los infractores, pues los derechos de los niños prevalecen sobre los derechos de los adultos, (Art. 44). De acuerdo a lo señalado anteriormente formulo la siguiente pregunta, ¿cómo es entonces, que siendo una ley expresada en la constitución, no se le ha dado el trato adecuado, para que desde la base que es la niñez se trabaje en la educación y por ende en la cultura? Se ha visto como instituciones como la iglesia, el gobierno y la industria militar históricamente han definido el desarrollo de la humanidad y cada una de ellas ha intervenido en el tema educativo con la creación de universidades, colegios, fundaciones entre otros, hoy que se vislumbra una oportunidad interesante en las empresas para el desarrollo de un país, en nuestro caso Colombia, por qué no trabajar mancomunadamente en la creación de programas que promuevan la cultura y la educación desde la empresa como contribución voluntaria a la sociedad; esto sugiere que la sociedad proponga a los empresarios caminos de solución mediante la creación de proyectos o programas que se financien a través del sector empresarial. Es responsabilidad de los adultos asegurar un bienestar en todo sentido a nuestra niñez, pues en ellos se verá el cambio hacia el país y el mundo que se desea, pero el actuar esta en el hoy, en proporcionar herramientas educativas de calidad, programas innovadores que potencialicen notoriamente las capacidades de nuestros niños que lo conviertan en un líder, un intelectual o científico, claro esta, todo ello articulado a programas nutricionales y de recreación igualmente innovadores, por que debemos recordar que el centro del universo en la niñez esta en el juego, este asunto debe ser tomado en cuenta debido a que en el juego se desarrollan gran parte de las capacidades del ser humano y por ello los programas deben tender a una formación académica en torno al juego y a la generación de modelos que articulen la nutrición, la

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia

alimentación y el juego como instrumentos de apropiación de una cultura que aseguren o potencialicen a un mejor país. En esta parte del planteamiento me sumo a la idea expresada en la revista RS Responsabilidad Sostenibilidad por Restrepo, G ( 2005 ), presidente de almacenes éxito quien asegura que “…no hay mejor negocio que educar a los niños y para poderlos educar deben estar bien nutridos; estos niños cuando sean adultos tendrán la responsabilidad de crear nuevas empresas y nuevos mercados es decir, un nuevo tejido empresarial, que para que sea fuerte y sólido debe venir de personas educadas. Asegura Restrepo que no resulta costoso nutrir bien a un niño para que se desarrolle bien, no hacerlo es un pecado mortal...”. No ofrecerle nutrición adecuada es arruinarlo por no darle algo que necesita y que es tan simple, y que el país en su conjunto tiene la posibilidad de hacer, es una tragedia la cifra de muertes por desnutrición en el país, de acuerdo a un estudio de la fundación éxito, es del 12 % de los niños entre 0 y 4 años, el 12.6% de los niños que tienen entre 5 y 9 años sufren de desnutrición crónica, se estima que durante el último año en el mundo han fallecido mas niños por desnutrición que los que murieron en el tsunami del 2007.

31

real y hacer su aporte, esta participación no solo es de carácter económico sino que requiere también de un involucramiento en asuntos de administración, de gerencia y de operación, ya se están asomando esfuerzos de este tipo en empresas como Cementos de México (Cemex), que a través de programas de vivienda, además de ayudar con la financiación de materiales de construcción, asesoran al beneficiario en la mejor construcción y le prestan capacitación para que su inversión sea duradera. Desarrollo de la ecuación Lo mencionado anteriormente permite entender la ecuación que se planteó en el titulo, las convenciones se refieren a: ne : niños educados nn : niños nutridos nj : niños jugando nf : niños felices he : hombres exitosos

La empresa es quien al tomar estos programas e involucrarse en ellos no solo contribuirá con su difusión y financiación sino que será beneficiada de ellas mismas en el corto, mediano y largo plazo, pues en sus filas de empleados llegarán en algún momento a tener miembros que fueron beneficiarios de sus propios proyectos; para estas mujeres y hombres de futuro no se requiere que sean altos ejecutivos para definirlos como cultos o educados, basta con que tengan claridad en su libertad ideológica, liberarse de dogmas sociales y ser capaces de tomar decisiones y control de su propia vida, incluso, decidir como participa de la gobernabilidad, de la política, tener posturas frente a las absurdas guerras, contar con opinión, con sentido crítico, ser mujeres y hombres virtuosos y libres. La combinación de un modelo educativo innovador con un sistema de aprendizaje mediante el juego y ello sumado al suministro de alimentos en los niños hace que el resultado lleve a la configuración de niños felices que tendrán una alta probabilidad de ser hombres exitosos. La creación de programas que tengan esta mirada deben ser presentados a las empresas que tengan la voluntad de incrustarse en la sociedad

ne + nn + jn = nf = he Para lograr la concreción de esta ecuación y asegurar la participación de las empresas se debe hacer que el sector empresarial participe en la selección de los infantes a beneficiar, posteriormente la apropiación del modelo educativo propuesto en Klic house, que está basado en la cibernética social y desarrollo del cerebro tríadico, propuesta de Waldemar de Gregori, de igual forma esta diseñado teniendo en cuenta lo planteado en la educación expresiva que trata lo vital, la existencia, es asi como la empresa debe participar de la selección de estrategias que aseguren que los alimentos de los infantes sean suministrados efectivamente a la vez que se requiere del acompañamiento y seguimiento de los progresos de los niños durante su infancia. Con este ejemplo quiero ilustrar como la responsabilidad social empresarial va mas allá de la financiación de proyectos, es también la sensibilidad transformada a actuaciones que tocan directamente los problemas y le dan soluciones reales, con intervenciones reales.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


32

Dairo Muñoz Chiquillo

Cada profesional, cada adulto tiene la obligación de generar ideas, programas y proyectos que sirvan para configurar un mejor país y así entregarlos al sector empresarial para su ejecución ya que esto despierta el sentido solidario que a veces se adormece o se nubla por que vemos solamente nuestras propias necesidades y no las del colectivo. Cuando me refiero al sentido solidario no es solo la suma de muchas manos sino la suma de muchas empresas, organizaciones y países, esto se puede ver en casos como el de la fundación ecuatoriana Esquel que es concebida como una red de organizaciones no lucrativas latinoamericanas para el desarrollo social de sus regiones; los cito ya que en la definición de responsabilidad social empresarial dan un lugar importante a lo solidario, concretamente Esquel define responsabilidad social empresarial así: “debe entenderse como el libre y activo compromiso de uno o varios actores sociales por resolver los problemas de desarrollo de la sociedad y construirla Como comunidad democrática, sustentable y solidaria’. (Martínez, Juan Luís); como se puede ver con este ejemplo hay una clara posición ética de esta Fundación ya que ella implica una opción conciente de principios, valores y actitudes morales e intelectuales que puede ser adoptada por individuos, como por empresas, asociaciones, instituciones, no es una obligación legal, sino una decisión libre que ve como imperativo moral involucrarse en una causa. Para ilustrar el anterior planteamiento presento entonces un ejemplo real de lo que debe ser una empresa que nace con una misión centrada en la función social, es decir nace una empresa saludable: Klic House (KH) es un programa que tiene claridad sobre su responsabilidad social empresarial, por que se configura como una empresa: · Económicamente responsable · Públicamente responsable · Socialmente dispuesta · Socialmente competente · Socialmente inteligente · Socialmente ética

Para el diseño de este programa se han tomado como base informes del proyecto Millenium y de la FAO, a partir de los cuales se realizó un estudio preliminar aplicando metodologías de prospección, entre los cuales se considero el estudio sistémico de sectores estratégicos denominado ESSE. Las escuelas de la estrategia y la prospectiva nos da herramientas como los AESE, Análisis estructural de sectores estratégicos que permite conocer el presente o el hoy de un sector, incorporando estudios como son el análisis de hacinamientos, análisis de competidores, análisis de las fuerzas del mercado, levantamiento del panorama competitivo; con los resultados arrojados se realiza la prospección o planeación estratégica por escenarios con sus correspondientes herramientas de análisis que son: análisis estructural, análisis de actores y simulación de escenarios; los resultados indican las hipótesis de futuro. Con estas aproximaciones se inicio el programa mediante la elaboración de instrumentos, presupuestos, modelo pedagógico, infraestructura, recursos físicos y Humanos los cuales son descritos así: KH: Es un programa empresarial educativo y de alimentos para la segunda infancia que introduce un modelo educativo alternativo en temas de arte, ciencia y tecnología dirigido a niños entre los 5 y 12 años, sin distingo de sexos, raza, condición social, filiación política o religiosa que por su vocación y necesidad de aprender desean tener un espacio lúdico en el que asumen en forma voluntaria una preparación para beneficio propio, el de su grupo familiar y de la comunidad en general. El Centro está conformado por diversas unidades de trabajo los cuales cuentan con los recursos tecnológicos adecuados para el desarrollo de sus respectivos laboratorios y con una distribución física propicia para el aprendizaje. El recurso físico del centro se fundamenta en una locación cuya área es de 100 mts 2, hardware, software libre, conexión a Internet, dispositivos como cámaras digitales, webcam, escáner e impresoras, sistemas de información en línea, laboratorios de informática, Kits de pintura, cajas de herramientas, laboratorios de ciencias, electricidad y electrónica. La siguiente gráfica ilustra la información anteriormente descrita.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia

.+&ODVV

33

.+'HVLQJ

.+:HE

+DOO

.+7HDFK

.+6\VWHP

.+6HUYLFHV

.+$UW 

Figura 1'LVWULEXFLyQGHODViUHDVGHWUDEDMRGH.+

El valor de la inversión fue de aproximadamente $ 60.000.000.oo Sesenta millones de pesos; los equipos, materiales y demás recursos que se utilizaron

para la ejecución del programa están relacionados en la tabla 1. 

Tabla 15HFXUVRVItVLFRVGH.+

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


34

Dairo Muñoz Chiquillo

Los laboratorios son desarrollados en un tiempo determinado y están clasificados de acuerdo a la edad sugerida en la que ya los niños cuentan con los conceptos básicos previos; para el caso de los laborato-

rios de informática, aquí se muestran algunos de ellos en los que se señalan la edad recomendada para su ejecución y la duración aproximada.

Tabla 20XHVWUDGHODERUDWRULRVGHLQIRUPiWLFDGH.+

Aunque es el estudiante quien desarrolla en forma voluntaria los laboratorios, es de tener en cuenta que hay un componente pedagógico, el modelo propuesto en Klic house esta centrado en el desarrollo de competencias en los menores que le permitan aplicarlas en su vida diaria; si se tiene en cuenta que la competencia debe ser entendida como “saber hacer en contexto” implica también el saber entender; de lo anterior se puede decir que los niños que participan de klic house son personas competentes ya que además de hacer las cosas, las entiende y comprende las implicaciones de sus acciones. Las competencias adquiridas en el centro por los niños, se expresan al ser llevadas a la práctica en la que el saber teórico esta dirigido a pensar en la formación de ciudadanos idóneos para el mundo de la vida. Para concretar el saber teórico en la práctica los estudiantes con la orientación de un mentor adulto realizará experimentos que le permitan corroborar

sus predicciones y afianzarlas mediante laboratorios, de esta forma adquiere nuevos conocimientos. En el centro el niño interactúa con elementos naturales y artificiales empleando didácticas y metodologías adecuadas que fijan en su mente experiencias que hacen del aprendizaje una actividad vivenciada. Mensaje para inversionistas: A los empresarios, alcaldes, rectores de universidades, directores de colegios, directores de ONG`s y todo aquel ciudadano que quiera ofrecer este programa a los hijos de sus empleados, estudiantes, egresados y comunidad en general y a la vez patrocinar niños de escasos recursos, le será entregado un paquete de pasaportes junto con la documentación que reúne los lineamientos de tipo académico y administrativo para la incorporación del programa Klic House en la comunidad a intervenir, también se describe la metodología que permita cubrir el número

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia

de niños que sea solicitado, la descripción física del centro, la implementación de tecnologías, el modelo pedagógico y el recurso humano con que cuenta el programa para cada caso; lo cual también hacen parte de la documentación a entregar. Modelo de documentación La reglamentación y los aspectos legales para el funcionamiento se fundamenta en la Norma Nacional sobre Educación No Formal, dentro del Decreto 0114 del 15 de enero de 1996, emitido por el Ministerio Nacional de Educación y la Ley General de Educación 115 de 1.994. El programa cubre 3 áreas de la enseñanza de las artes que son: a. Aplicación de técnicas sobre superficies. b. Técnicas de dibujo y pintura. c. Manualidades con material reciclable. El programa cubre 3 áreas de la enseñanza de las ciencias que son: a. Observación del universo. b. Fenómenos naturales. c. Experimentación. Este programa cubre 3 áreas de la enseñanza de la tecnología que son: a. La informática como tecnología para la gestión personal.

35

potenciar la capacidad para crear, investigar, adoptar la tecnología que se requiere en los procesos de desarrollo del país y que le permita al educando ingresar al sector productivo”. Los principales objetivos que busca Klic House son los de propiciar un movimiento tecnológico renovador mediante la incorporación de un modelo de aprendizaje especialmente dirigido a la niñez y generar espacios de aprendizaje alternativos y a bajo costo a los menores del sector a intervenir. El recurso humano del Programa KLIC HOUSE esta conformado por un director cuya preparación es MBA en Dirección y Gerencia de empresas, Licenciado en ciencias de la educación con especialidad en química, especialista en multimedia educativa y en diseño de ambientes de aprendizaje, con experiencia en investigación y diseño de proyectos de ingeniería. Una coordinadora académica, licenciada en informática con estudios en artes, diseño y publicidad y con experiencia en la enseñanza a niños y jóvenes. Mentores itinerantes que corresponde a adultos formados en los campos de las artes, las ciencias y las tecnologías, licenciados y tecnólogos con experiencia en sus respectivos campos y en el trabajo con niños. El recurso físico se configura de acuerdo al número de niños a atender, sin embargo el programa se fundamenta en la prestación de servicios utilizando principalmente tecnologías, los requerimientos esenciales son la locación para prestar servicio, con baños, conexión a la red eléctrica y suficiente luz natural y artificial, debe contar con espacio suficiente para la ubicación de mesas y sillas.

b. Máquinas y herramientas. c. Electricidad y electrónica. El programa Klic House como medio de aprendizaje en áreas de arte, ciencia y tecnologías le da la oportunidad al participante de mejorar sus destrezas, habilidades y competencias para que ellos mismos sean generadores de nuevos saberes a partir de su interacción con mentores adultos; Este programa va encaminado a desarrollar competencias en los niños, con alta calidad humana y potencializar sus conocimientos en el uso de herramientas. Lo anterior esta consagrado en el numeral 13 del Artículo 5 de la Ley 115 de 1.994. en la que se expresa textualmente que en el ejercicio de educar debemos propender por “La promoción en la persona y en la sociedad, de

Se preparan los Kits de trabajo artístico, laboratorios de ciencias y laboratorios de tecnología de acuerdo al número de niños que participan. En cuanto a los aspectos metodológicos para el cubrimiento efectivo de los niños que el empresario desea patrocinar se diseña la programación cuidadosamente teniendo en cuenta el tiempo de tal manera que se conforman grupos con un número definido de participantes cada uno, cubriendo las jornadas de la mañana y de la tarde, con el fin de que los niños lleguen al centro en la jornada contraria a sus estudios. En el tiempo que resulta de la programación, cada niño recibe un número definido de sesiones para desarrollar los laboratorios.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


36

Dairo Muรฑoz Chiquillo

La siguiente tabla muestra un ejemplo de la distribuciรณn de los grupos:

Tabla 3. 'LVWULEXFLyQGHORVJUXSRVGXUDQWHORVPHVHVGHWUDEDMRHQODVMRUQDGDVGHOD PDxDQD\ODWDUGHFRQWUDULDDODMRUQDGDHVFRODU  MESES DIAS 

PRIMER MES L M

I

SEGUNDO MES

J V S L

M

I

J V S L

TERCER MES M

I

JORNADA

J V S MAร‘ANA



$ % & $ % & $ % & $ % & $ % & $ % & $0D  $ % & $ % & $ % & $ % & $ % & $ % &



$ % & $ % & $ % & $ % & $ % & $ % &



$ % & $ % & $ % & $ % & $ % & $ % & 

 MESES DIAS 

PRIMER MES L M

I

SEGUNDO MES

J V S L

M

I

J V S L

TERCER MES M

I

JORNADA

J V S TARDE



' ( ) ' ( ) ' ( ) ' ( ) ' ( ) ' ( ) $0D  ' ( ) ' ( ) ' ( ) ' ( ) ' ( ) ' ( )



' ( ) ' ( ) ' ( ) ' ( ) ' ( ) ' ( )



' ( ) ' ( ) ' ( ) ' ( ) ' ( ) ' ( ) 



Es importante resaltar que en el tiempo en el que un niรฑo asiste al centro con el patrocinio de un empresario, se lleva un registro de avances de las actividades y

del progreso de los niรฑos para lo cual se especifica las sesiones realizadas y las horas de trabajo invertidas en cada รกrea. Ver tabla 4.

Tabla 4. 6HVLRQHVGHWUDEDMR\KRUDVGHGHGLFDFLyQGHFDGDQLxRHQODViUHDVD GHVDUUROODU AREA DE TRABAJO

SESIONES

HORAS DE TRABAJO POR NIร‘O

6HVLRQHVGH$UWHV



K

6HVLRQHVGH&LHQFLDV 



K

6HVLRQHVGHWHFQRORJtD 



K

Totales

24

72 h



Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina


Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia

El acompañamiento para cada grupo de niños estará a cargo de adultos que se organizan de acuerdo al tamaño de los grupos, en las gráficas 6 y 7 se presenta un ejemplo de cómo es la configuración física del

37

lugar y como se distribuyen profesor, mentores y personas de apoyo para asegurar la efectividad del trabajo con los niños y también prestar especial cuidado de la responsabilidad que acarrea trabajar con niños:

Tabla 5. 3HUVRQDVTXHDFRPSDxDUDQDORVQLxRVHQFDGDVHVLyQGHWUDEDMR  

Cantidad

352)(625



0(1725(6



$6,67(17(



623257(



La distribución se muestra en la siguiente figura 

$6,67(17( 

0(1725 

0(1725

0(1725 

$6,67(17(  $6,67(17( 



623257( 

352)(625 

Figura 2.8ELFDFLyQGHODVSHUVRQDVTXHDFRPSDxDQHOSURFHVRHQFDGDVHVLyQ\ GLVWULEXFLyQGHORVSDUWLFLSDQWHVHQHOHVSDFLRItVLFR 

En cuanto a los costos que asume un inversionista para la ejecución del programa, corresponde a salarios, kits de trabajo y refrigerios para los niños, mientras que los equipos y elementos de trabajo son colocados por el centro. El presupuesto varía de acuerdo al número de niños a atender, sin embargo en las gráficas 8,9,10, 11, 12

y 13 se ilustran los costos mas comunes que resultan para la ejecución del programa Klic House en una empresa, colegio localidad, entre otros. Presupuesto global Los montos no están señalados en el presente documento pero pueden ser consultados en el plan de negocio establecido.

Tabla 6.&RQVROLGDGRGHORVFRVWRVGHOSURJUDPD.+  RUBROS

TOTAL

3(5621$/

 6DODULRVGHOWDOHQWRKXPDQRTXHSDUWLFLSD



(48,326

 $OTXLOHUGHORVHTXLSRVGH.+



0$7(5,$/(6

 .LWVGHWUDEDMRHQODViUHDV



&26726 $'0,1,675$7,926

*DVWRVGHRSHUDFLyQ 

352*5$0$'( $/,0(1726

5HIULJHULRVFRQVXPLGRVSRUORVQLxRVHQ FDGDVHVLyQ 

TOTAL



$

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


38

Dairo Muรฑoz Chiquillo

Descripciรณn de los gastos de personal

Tabla 7. *DVWRVGHSHUVRQDO 

FUNCIร“N DENTRO DEL PROYECTO

DEDICACIร“N

Personal Personal Klichouse externo

(horas en el programa por persona)

',5(&&,21 &225',1$&,21

352)(625



 5HSUHVHQWDQWHOHJDO (QFDUJDGRGHGRFHQWHV\  PHQWRUHV



TOTAL

























(QFDUJDGRGHPHQWRUHV 

0(1725

 ([SHUWRHQHOiUHD



9DULDEOH





623257(

 6HJXULGDGGHOOXJDU









3HUVRQDOGHDSR\RSDUD  WUDEDMRFRQQLxRV

9DULDEOH







/2*,67,&$

 0DQHMRGHHTXLSRV









6(59,&,26

 3HUVRQDOGHVHUYLFLRV JHQHUDOHV









$6,67(17(

TOTAL

Total de empleo generado

$

Descripciรณn de los gastos de equipos

Tabla 8. *DVWRVGHHTXLSRV

EQUIPOS

(dรญas de uso en el programa)



No Equipos  8VR GH HTXLSRV &iOFXORGHOFRVWRGLDULRSRU (OFHQWURFXHQWD GHOSURJUDPD XVR GH FDGD PiTXLQD FRQHTXLSRV PLFURVFRSLR FiPDUDV FX\DFDSDFLGDGHV SDUDWUDEDMDUFRQ SURWRERDUVHWF  QLxRV VLPXOWiQHDPHQWH  TOTAL

TOTAL  

$

Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina


Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia

Descripciรณn de los gastos de materiales Tabla 9. *DVWRVGHPDWHULDOHV 

Valor KIT (por participante)

MATERIALES

No KITS 

TOTAL 

$UWHV

0DWHULDOHV GH WUDEDMR HQWUHJDGRV DO QLxR SDUD OD HMHFXFLyQ GH ORV ODERUDWRULRV

SRUQLxR 



&LHQFLDV

0DWHULDOHV GH WUDEDMR HQWUHJDGRV DOQLxR SDUD OD HMHFXFLyQ GH ORV ODERUDWRULRV

SRUQLxR 



7HFQRORJtDV

0DWHULDOHV GH WUDEDMR HQWUHJDGRV DO QLxR SDUD OD HMHFXFLyQ GH ORV ODERUDWRULRV

SRUQLxR 



0DWHULDOHV  FRPSOHPHQWDULRV

0DWHULDOHVTXHSRUVXULHVJR 8QRSRUPHVD  VROR VRQ PDQLSXODGRV SRU ORVPHQWRUHV 

TOTAL





$



Descripciรณn de los gastos administrativos Tabla 10. &RVWRVTXHVHGHEHQFRQVLGHUDUSDUDODHMHFXFLyQGHOSURJUDPD.+  Fuentes ADMINISTRACION Programa KH $UULHQGRV S~EOLFRV

\

TOTAL

Externo

VHUYLFLRV /RFDFLyQ HQHUJtD LQWHUQHWDFXHGXFWR WHOHIRQtD 





(VWDQWHUtD 





0XHEOHV\HQVHUHV (YHQWRV GH ODQ]DPLHQWR \ GHFODXVXUD

,QDXJXUDFLRQHV  H[SRVLFLRQHV\FODXVXUDV



3XEOLFLGDG



,QWHUQHWSOHJDEOHV  SDVDFDOOHVYRODQWHV



3DSHOHUtD



)RWRFRSLDGRH LPSUHVLRQHV 



&RQWUDWRV

1RWDULDV 





&RVWRVGHDVHR 

(OHPHQWRV GH DVHR SDUD OD DWHQFLyQ GH QLxRV 





,PSUHYLVWRV TOTAL



 

$



Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina

39


40

Dairo MuĂąoz Chiquillo

DescripciĂłn del programa de alimentos Tabla 11.3URJUDPDGHDOLPHQWRV.+TXHVRQWRPDGRVSRUFDGDQLxRHQFDGDVHVLyQ PROGRAMA DE ALIMENTOS 5HIULJHULRV

CANTIDADES

TOTAL 

(Q FDGD VHVLyQ ORV QLxRV UHFLEHQ XQ UHIULJHULR UHSUHVHQWDGRHQXQDSURWHtQD\XQFDUERKLGUDWRGH RULJHQ QDWXUDO FRQ HOOR VH GD OD SRVLELOLGDG D ORV QLxRVGHHVFDVRVUHFXUVRVGHREWHQHUDOLPHQWDFLyQ EDODQFHDGD  

TOTAL

El tiempo de ejecuciĂłn seĂąalado en el cronograma es variable, se busca que las ĂĄreas a desarrollar se



$

distribuyan en forma equitativa como se seĂąala en la siguiente grafica.

Tabla 12. 'LVWULEXFLyQGHODViUHDVGHIRUPDFLyQGH.+FRQUHVSHFWRDOWLHPSR  MES

Mes 1

Mes 2

1

2

3

4

X

X

X

X

Mes 3

5

6

7

8

X

X

X

X

9

10 11 12

X

X

SEMANAS

 3URJUDPDGH$UWHV 3URJUDPDGH &LHQFLDV 3URJUDPDGH 7HFQRORJLD

X

X

CONCLUSIONES Klic House se configura como una buena oportunidad para que los inversionistas patrocinen niĂąos colombianos y de esta forma hagan sus aportes en educaciĂłn, recreaciĂłn y alimentaciĂłn en un solo lugar; este programa demuestra como se pueden diseĂąar empresas saludables, perdurables y de futuro en la que la inversiĂłn social es el pilar fundamental. Los estudios que ofrece la prospectiva y las ciencias de la complejidad permiten que se generen alternativas de soluciĂłn reales para las problemĂĄticas sociales que son tan agudas en nuestro sistema social, algunas de las soluciones que vale la pena mencionar son: Proporcionar alimentos nutritivos, desarrollar habilidades superiores a niĂąos de corta edad que en la escuela tradicional son subestimados, promover la enseĂąanza desescolarizada en Colombia, generar espacios lĂşdicos para el aprovechamiento del tiempo libre de un nĂşmero importante de niĂąos colombianos, sentar en la mesa a universidades, empresarios, orga-

nizaciones gubernamentales y no gubernamentales para invertir en este programa y realizar sus aportes. Aunque son muchos los agregados que se pueden mencionar, el mensaje final es que la ecuaciĂłn sobre la que se fundamenta el programa Klic House, es real y es posible, (ne + nn + jn = nf = he). Que no se quede un niĂąo sin comer diariamente, que no se quede un niĂąo sin ir a la escuela, que todos los niĂąos conozcan los parques temĂĄticos, museos, bibliotecas, cines y teatros; es posible hacer que la infancia de los niĂąos se convierta en una etapa feliz de sus vidas, cuando esto suceda es muy probable que cuando esos niĂąos crezcan su mentalidad estarĂĄ enfocada en la solidaridad, la cooperaciĂłn y el voluntariado, y estarĂĄn alejados de pensamientos vacios y egoĂ­stas que son tan comunes en el mundo de hoy. SerĂĄn niĂąos que desde hoy visitaran el futuro para entender el presente.

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


Programa Klic House: Modelo empresarial educativo y de alimentos para la segunda infancia

41

REFERENCIAS Ansoff, I. (1997). La dirección estratégica en la práctica empresarial. USA. Addison Wesley Iberoamericana. Di Gregori, W. Capital intelectual. McGraw-Hill / Interamericana de España, S.A. Godet, M. (1993). De la anticipación a la acción: manual de prospectiva y estrategia. Barcelona. Marcombo, D.L. Español.

Prahalad, C.K. (2005) La oportunidad de negocios en la base de la pirámide: un modelo de negocio rentable, que sirve a las comunidades más pobres. Grupo Editorial Norma. Restrepo, L. (2005) Análisis Estructural de Sectores Estratégicos. Bogotá Editorial Universidad del Rosario. Martínez, J, (2006) La acción social de la empresa, el caso español y latinoamericano, Prentice hall.

Mitzberg, H., Quinn J., et al.(1997) El Proceso Estratégico. Capitulo 1: Concepto de Estrategia, Capitulo 4: Análisis de estrategia a nivel de empresa. Pgs 104 – 112 Capitulo 5: Incrementalismo Lógico: Como manejar la formación de estrategia.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


42

Dairo Muñoz Chiquillo

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


43

Sulfato ferroso y preeclampsia. Estudio de casos y controles realizado en dos hospitales de Bogotá Ferrous sulfate and preeclampsia. Case-control study conducted in two hospitals in Bogota Tatiana Valentina Cabrera Sierra1, Mauricio Jiménez Romero2 Resumen La preeclampsia es una de las primeras causas de morbilidad y mortalidad materna, se ha descrito la posibilidad de que los suplementos de hierro que se dan a las gestantes, aumenten radicales libres que se encuentran involucrados en la fisiopatología de enfermedades como la preeclampsia. En este estudio se buscó identificar el riesgo de desarrollar preeclampsia atribuible al hecho de recibir sulfato ferroso en gestantes. Es un estudio de casos y controles de tipo retrospectivo donde se determinó que no existe relación de riesgo entre la administración de sulfato ferroso en gestantes con el desarrollo de preeclampsia, sin embargo se establece que hay que controlar todas las variables y los factores de riesgo de las gestantes, para futuras investigaciones en el tema. Palabras clave: preeclampsia, sulfato ferroso, embarazo, radicales libres. Abstract Preeclampsia is a major cause of maternal morbidity and mortality, has been described that iron supplements given to pregnant women could increased the free radicals, involved on the physiopathology diseases such as preeclampsia. This study aim to identify the risk of developing preeclampsia attributable to the intake of ferrous sulfate in pregnant women. This retrospective case-control study found no risk association between the intake of ferrous sulfate in pregnant women with development of preeclampsia. However, we identify the need to improve the study design in future studies in order to have a better control in all the variables and the risk factors in the pregnant population. Key words: preeclampsia, ferrous sulfate, pregnancy. free radicals.

1 Enfermera Universidad Nacional de Colombia. Estudiante Especialización en Epidemiología, tatianavalentina40@yahoo.es 2 Médico Gineco-obstetra Universidad Nacional de Combia- Universidad Militar Nueva Granada. Estudiante Especialización en Epidemiología, mauriciojimenez39@yahoo.es

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


44

Tatiana Valentina Cabrera, Mauricio Jimenez

INTRODUCCIÓN La suplencia con sulfato ferroso durante el embarazo se encuentra incluida en protocolos y guías de manejo clínicas, se da de manera gratuita y se considera beneficiosa, se recomienda que ésta se inicie una vez se detecte el embarazo y hasta el sexto mes de lactancia materna. Dicha recomendación se encuentra incluida en Colombia en la Guía Técnica para la Detección Temprana de Alteraciones del Embarazo que está contenida en la Resolución 412/2000 (Ministerio de Salud. Colombia. 2000). Existe evidencia científica de los riesgos que representa tanto para la madre como para el niño el hecho de que durante la gestación exista anemia de cualquier tipo siendo la ferropénica, derivada de la baja ingesta de hierro, la más común (OMS,2001; Stanco 2007). Por todo lo anterior y además por el hecho de que en Colombia la prevalencia de anemia ferropénica es del 46% en embarazadas (Coy, Castillo, Mora, Munévar, & Peña, 2007), se considera como un axioma que se debe suplementar el hierro durante el embarazo, pensando sólo en los efectos benéficos que éste puede tener, sin embargo no se piensa en los posibles riesgos, asumiendo que estos no existen (Calderón, 2007), por otra parte en la práctica es evidente que no todas las mujeres necesitan dicha suplencia, ya que inician el embarazo con niveles de hemoglobina y hematocrito normales y tienen una ingesta del mismo normal en la dieta, al formularles hierro se disminuye la costo eficiencia de los programas de control prenatal. Se encuentran evidencia teórica (Orhan, Onderoglu, Yücel, Sahin, 2003; Chaudhari, Tandon, Vaney, Agarwal. 2003), que hablan de la posibilidad, al menos teórica, de que los suplementos de hierro, aumenten el estrés oxidativo, ya de por si elevado en el embarazo, lo que se evidencia por el aumento de radicales libres y en general, especies reactivas al oxigeno que es una denominación que agrupa tanto a radicales libres como otros subproductos del metabolismo oxidativo que se han visto involucrados en la patogénesis de enfermedades propias del embarazo como la preeclampsia y la diabetes gestacional, así mismo están involucrados en la fisiopatología de enfermedades degenerativas como Alzheimer, arteriosclerosis, diabetes y otras (Calderón, 2007). La preeclampsia es una de las principales causas de mortalidad materna en el mundo (OMS, 2010), situación a la cual Colombia no es ajena (Cáceres,

Díaz, 2007). A pesar de los esfuerzos encaminados a disminuir la morbilidad y la mortalidad materno fetal a nivel mundial (Banco Interamericano de Desarrollo, 2004), la preeclampsia continua siendo una de las primeras causas que complica la gestación en un 6-8% de todos los embarazos. Observando un claro aumento de la incidencia en pacientes con factores riesgo en un 20.3% (Caritis, Sibai, Hauth, 1998), es sin duda la principal causa de mortalidad materna y perinatal (Acosta, 1999) en los países en desarrollo y las complicaciones derivadas de su presentación (Delgado, 2009) son un indicativo del acceso de las pacientes a los servicios médicos. El propósito de este estudio es medir el riesgo relativo de desarrollar preeclampsia atribuible al hecho de recibir sulfato ferroso en un grupo de pacientes de un hospital de segundo nivel y otro de tercer nivel, para determinar si la evidencia teórica se correlaciona con los hallazgos epidemiológicos al respecto. Para esto se realizó un estudio retrospectivo de casos y controles mediante la revisión de historias clínicas de mujeres a quienes se les atendió el parto y desarrollaron o no preeclampsia habiendo o no consumido sulfato ferroso durante al menos seis semanas en el embarazo. Materiales y Métodos Se trata de un estudio analítico de casos y controles de tipo retrospectivo, realizado en el año 2008 en gestantes que acudieron a control prenatal y fue atendido el parto en los hospitales de La Victoria y Bosa II Nivel. El hospital de Bosa se encuentra ubicado en la localidad del mismo nombre en el sector suroccidente de la ciudad de Bogotá y atiende predominantemente población de los estratos socioeconómicos 0, 1 y 2; por su parte el hospital de la Victoria se encuentra ubicado en el suroriente de la ciudad, atendiendo población de similar condición socioeconómica. Se seleccionó una población de 123 gestantes a quienes se les atendió el parto o se les practicó cesárea en los hospitales Bosa II Nivel y La Victoria en el año 2008, se tomaron como casos a 48 pacientes que desarrollaron preeclampsia y se tomaron como controles 75 pacientes que no desarrollaron preeclampsia; esta muestra se tomó con un margen de error del 5% y un nivel de significancia del 95% bajo una hipótesis unilateral. En los dos grupos, casos y controles, se tomaron pacientes que recibieron sulfato ferroso como suplencia nutricional al menos durante seis semanas y pacientes que no recibieron esta suplencia nutricional.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Sulfato ferroso y preeclampsia. Estudio de casos y controles realizado en dos hospitales de BogotĂĄ

Como criterios se exclusión, se consideró a gestantes en las cuales no se pudo determinar el consumo o no de la suplencia nutricional con sulfato ferroso y gestantes con antecedentes de hipertensión crónica, problemas renales y/o enfermedades metabólicas. Respecto a la recolección de la información, se diseùó un instrumento en Excel donde se recolectó información referente a aspectos demogråficos tales como edad, sexo y estado civil; criterios clínicos tales como tensión arterial, estado nutricional, entre otros y criterios paraclínicos tales como niveles de hemoglobina, hematocrito, depuración de creatinina y proteinuria en 24 horas, entre otros, que en total reunían información de 15 variables El registro de la información se realizó a partir de la historia clínica materna la cual se encontraba relacionada en bases de datos existentes en los hospitales, se contó con una autorización previa por parte de las directivas de los centros hospitalarios y la identidad de las pacientes se mantuvo en reserva trasladando al formulario únicamente la información pertinente bajo una codificación. 

45

DespuĂŠs de obtener los datos proporcionados por los instrumentos, ĂŠstos fueron analizados en el paquete estadĂ­stico SPSS 14.0, posterior a esto se llevĂł a cabo el anĂĄlisis univariado con los mĂŠtodos estadĂ­sticos Chi2 y la tĂŠcnica de desagregaciĂłn de Mantel â&#x20AC;&#x201C; Haenszel para observar la posible asociaciĂłn de las diferentes variables, asĂ­ mismo se calculĂł el Odds Ratio (OR) con un IC 95%. Con las variables que resultaron ser significativas a un nivel menor de 0,05 en el anĂĄlisis bivariado, se llevĂł a cabo un anĂĄlisis por medio de la tĂŠcnica de desagregaciĂłn de Mantel â&#x20AC;&#x201C; Haenszel para determinar si habĂ­a un grupo etĂĄreo en el cual esta asociaciĂłn fue mĂĄs significativa. Resultados En cuanto a la caracterizaciĂłn de la poblaciĂłn se observa que esta estĂĄ conformada principalmente por mujeres jĂłvenes, dado que el 71,5% del grupo estudiado es menor de 30 aĂąos, lo cual se observa en la figura 1.





  



  

 



)UHFXHQFLD



  





'HVYWtS 



0HGLD  

  1 



               

('$'

Figura 1. 'LVWULEXFLyQSRUHGDGGHODSREODFLyQHVWXGLDGD

El 61% de las gestantes objeto del estudio fueron primigestantes o secundigestantes lo cual estĂĄ relacionado

con el hecho de que la poblaciĂłn objeto del estudio es principalmente joven como se observa en la figura 2.

  



     

3RUFHQWDMH



   



















3$5,'$'



Figura2. 3DULGDGGHOJUXSRHVWXGLDGR

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


46

Tatiana Valentina Cabrera, Mauricio Jimenez

Se observa que un porcentaje significativo (30,9%) de gestantes no recibieron sulfato ferroso en la gesta-

ciĂłn, esto se evidencia en la tabla 1.

Tabla 1. 3RUFHQWDMHGHJHVWDQWHVTXHUHFLELHURQRQRVXOIDWRIHUURVR SULFATO FERROSO >=6.0sem. )UHFXHQFLD

3RUFHQWDMH YiOLGR

3RUFHQWDMH

6,





12













7RWDO





El estudio mostrĂł que al comparar la edad de las pacientes que desarrollaron preeclampsia vs las pacientes que no presentaron esta patologĂ­a, la diferencia fue estadĂ­sticamente significativa, de manera que mientras las gestantes con preeclampsia tenĂ­an una

edad promedio de 23,3 aĂąos Âą 6,1 aĂąos, las pacientes sin preeclampsia tenĂ­an una edad promedio de 26,6 Âą7,2 aĂąos. La prueba estadĂ­stica de ANOVA (tabla 2) mostrĂł una P = 0,011 que indica la significancia, lo cual se puede apreciar en la figura 3

Tabla 2.6LJQLILFDQFLDHVWDGtVWLFDGHHGDG\SDULGDG  ANOVA 6XPDGH FXDGUDGRV ('$'

JO

0HGLD FXDGUiWLFD

)

6LJ









,QWHUJUXSRV







,QWUDJUXSRV







7RWDO





3$5,'$' ,QWHUJUXSRV







,QWUDJUXSRV







7RWDO











,&('$'





 1





12

6,

35((&/$036,$

Figura 3,QWHUYDORVGHFRQILDQ]DGHHGDGHQHOJUXSRTXHSUHVHQWy SUHHFODPSVLD\HQHOJUXSRTXHQRODSUHVHQWy

Por otra parte la tabla 3 tambiĂŠn mostrĂł los promedios de paridad de los dos grupos donde se puede apreciar que el grupo con preeclampsia tenĂ­a una paridad de 1,9 vs el grupo sin preeclampsia con una

paridad de 2,9; para lo cual la prueba de ANOVA (tabla 2) tambiĂŠn mostrĂł existencias estadĂ­sticas significativas confirmando una menor paridad en el grupo de mujeres que desarrollaron preeclampsia.

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


Sulfato ferroso y preeclampsia. Estudio de casos y controles realizado en dos hospitales de BogotĂĄ

47

Tabla 3. &RQWLQJHQFLD\SUXHEDVGHFKLFXDGUDGRSDULGDG\SUHHFODPSVLD  Tabla de contingencia PARIDAD * PREECLAMPSIA 35((&/$036,$ 6, 3$5,'$'



GH3$5,'$' 















5HFXHQWR GH3$5,'$'

!HPE









5HFXHQWR GH3$5,'$' 5HFXHQWR

Total

GH3$5,'$'

12



5HFXHQWR

Total 38 100,0% 37 100,0% 48 100,0%

48

75

123

39,0%

61,0%

100,0%

Pruebas de chi-cuadrado 6LJDVLQWyWLFD ELODWHUDO

9DORU

JO

&KLFXDGUDGRGH3HDUVRQ

 D





5D]yQGHYHURVLPLOLWXG







$VRFLDFLyQOLQHDOSRUOLQHDO







1GHFDVRVYiOLGRV



DFDVLOODV  WLHQHQXQDIUHFXHQFLDHVSHUDGDLQIHULRUD/DIUHFXHQFLDPtQLPDHVSHUDGDHV 

AsĂ­ mismo, la paridad se caracterizĂł segĂşn el nĂşmero de embarazos para su asociaciĂłn con el desarrollo de preeclampsia confirmando mediante una relaciĂłn significativa p = 0,003; de hecho mientras el 53% de las primigestantes presentĂł preeclampsia, este porcentaje disminuyĂł a 45,9% en quienes habĂ­an tenido dos embarazos y a 20,8 en quienes habĂ­a tenido tres o mĂĄs embarazos como se puede observar en la tabla 5. En el presente estudio tambiĂŠn se pudo establecer que no hay asociaciĂłn entre el estado nutricional de la gestante y el desarrollo de preeclampsia, chi â&#x20AC;&#x201C; cuadrado = 0,236.

En cuanto a la relaciĂłn existente entre el estado civil de las gestantes y el desarrollo de preeclampsia se evidencia que no hay asociaciĂłn estadĂ­stica, chi â&#x20AC;&#x201C; cuadrado = 0,103. La mortalidad perinatal, no fue mĂĄs frecuente en la poblaciĂłn estudiada, chi cuadrado de Pearson = 0,70, tabla 4, aunque en los estudios sobre el tema la evidencia muestra que la mortalidad perinatal se aumentĂł en la preeclampsia, hay que tener en cuenta que esta principalmente se debe a la prematurez extrema debida sobre todo a preeclampsia grave, en el presente estudio muchos casos fueron de preeclampsia leve o moderada, por lo que no se aumentĂł la mortalidad perinatal.

Tabla 4.0XHUWHSHULQDWDO3UHHFODPSVLD   Tabla de contingencia 08(57(3(5,1$7$/ 35( 6, (&/$036,$ 12

5HFXHQWR GH35((&/$036,$ 5HFXHQWR GH35((&/$036,$

7RWDO

5HFXHQWR GH35((&/$036,$

6,

12





7RWDO 































Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


48

Tatiana Valentina Cabrera, Mauricio Jimenez

Pruebas de chi-cuadrado

&KLFXDGUDGRGH3HDUVRQ &RUUHFFLyQSRUFRQWLQXLGDGD 5D]yQGHYHURVLPLOLWXG

6LJDVLQWyWLFD ELODWHUDO

9DORU

JO

E

















(VWDGtVWLFRH[DFWRGH )LVKHU

6LJH[DFWD ELODWHUDO

6LJH[DFWD XQLODWHUDO



$VRFLDFLyQOLQHDOSRUOLQHDO



1GHFDVRVYiOLGRV









D &DOFXODGRVyORSDUDXQDWDEODGH[ EFDVLOODV  WLHQHQXQDIUHFXHQFLDHVSHUDGDLQIHULRUD/DIUHFXHQFLDPtQLPD HVSHUDGDHV

Correspondiendo con el objetivo principal de la investigaciรณn, se evaluรณ la relaciรณn de riesgo entre el consumo del sulfato ferroso y el desarrollo de preeclampsia, como se ve en la tabla 5, encontrando una relaciรณn de riesgo no significativa, con chi cuadrado = 0,64 asรญ se puede ver que mientras el 37,6% de las mujeres que usaron sulfato ferroso desarrollaron preeclampsia

en el grupo control fue el 42,1%. El anรกlisis de riesgo mostrรณ un OR = 0,83 (tabla 6) que aรบn cuando sugiere una relaciรณn de protecciรณn del sulfato ferroso, la relaciรณn no es significativa, sugiriendo una relaciรณn inocua entre el consumo de sulfato ferroso con el desarrollo de preeclampsia

Tabla 5.&RQVXPRGHVXOIDWRIHUURVR\GHVDUUROORGHSUHHFODPSVLD   Tabla de contingencia SULFATO FERROSO >=6.0sem. * PREECLAMPSIA 35((&/$036,$ 6,

12

7RWDO





































5HFXHQWR

68/)$72)(55262 6, ! VHP

GH68/)$72 )(55262! VHP

12

5HFXHQWR GH68/)$72 )(55262! VHP

7RWDO

5HFXHQWR GH68/)$72 )(55262! VHP

 Pruebas de chi-cuadrado

&KLFXDGUDGRGH3HDUVRQ

6LJDVLQWyWLFD ELODWHUDO

9DORU

JO

 E

















6LJH[DFWD ELODWHUDO

6LJH[DFWD XQLODWHUDO





D

&RUUHFFLyQSRUFRQWLQXLGDG 5D]yQGHYHURVLPLOLWXG (VWDGtVWLFRH[DFWRGH )LVKHU $VRFLDFLyQOLQHDOSRUOLQHDO



1GHFDVRVYiOLGRV







D &DOFXODGRVyORSDUDXQDWDEODGH[ EFDVLOODV  WLHQHQXQDIUHFXHQFLDHVSHUDGDLQIHULRUD/DIUHFXHQFLDPtQLPD HVSHUDGDHV

Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina


Sulfato ferroso y preeclampsia. Estudio de casos y controles realizado en dos hospitales de Bogotรก

49

Tabla 6. (VWLPDFLyQGHOULHVJRGHSUHHFODPSVLD\FRQVXPRGHVXOIDWRIHUURVR  Estimaciรณn de riesgo ,QWHUYDORGHFRQILDQ]DDO  9DORU

,QIHULRU

6XSHULRU

5D]yQGHODVYHQWDMDV SDUD68/)$72)(55262 ! VHP 6,12







3DUDODFRKRUWH35( (&/$036,$ 6,







3DUDODFRKRUWH35( (&/$036,$ 12







1GHFDVRVYiOLGRV





Al hacer el anรกlisis con tรฉcnica de Mantel-Haenszel, controlando la edad se encuentra que la variable sulfato ferroso no aumenta el riesgo de preeclampsia por grupo etรกreo, chi cuadrado = 0,713 (tablas 7 Y 8), esto puede ser debido a que en el grupo estudiado,

las pacientes muy jรณvenes o adolecentes son consideradas de alto riesgo, por lo que se envรญan tempranamente al ginecรณlogo de tercer nivel mejorando asรญ el pronรณstico con respecto a las demรกs pacientes incluidas en el estudio.

Tabla 7. (VWLPDFLyQGHOULHVJRGHSUHHFODPSVLDSRUJUXSRHWiUHR . Estimaciรณn de riesgo ,QWHUYDORGHFRQILDQ]DDO  ('$' $D

9DORU

,QIHULRU

5D]yQGHODVYHQWDMDVSDUD 68/)$72)(55262 ! VHP 6,12







3DUDODFRKRUWH35( (&/$036,$ 6,







3DUDODFRKRUWH35( (&/$036,$ 12







1GHFDVRVYiOLGRV D







3DUDODFRKRUWH35( (&/$036,$ 6,







3DUDODFRKRUWH35( (&/$036,$ 12













3DUDODFRKRUWH35( (&/$036,$ 6,







3DUDODFRKRUWH35( (&/$036,$ 12









5D]yQGHODVYHQWDMDVSDUD 68/)$72)(55262 ! VHP 6,12







3DUDODFRKRUWH35( (&/$036,$ 6,







3DUDODFRKRUWH35( (&/$036,$ 12











1GHFDVRVYiOLGRV D



5D]yQGHODVYHQWDMDVSDUD 68/)$72)(55262 ! VHP 6,12

1GHFDVRVYiOLGRV D



5D]yQGHODVYHQWDMDVSDUD 68/)$72)(55262 ! VHP 6,12

1GHFDVRVYiOLGRV D

6XSHULRU



5D]yQGHODVYHQWDMDVSDUD 68/)$72)(55262 ! VHP 6,12

3DUDODFRKRUWH35( (&/$036,$ 6, 3DUDODFRKRUWH35( (&/$036,$ 12 1GHFDVRVYiOLGRV

 



Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina


50

Tatiana Valentina Cabrera, Mauricio Jimenez

Tabla 8. 3UXHEDGHLQGHSHQGHQFLDFRQGLFLRQDO   Pruebas de independencia condicional &KLFXDGUDGR

JO

6LJDVLQWyWLFD ELODWHUDO

'H&RFKUDQ







0DQWHO+DHQV]HO







%DMRHOVXSXHVWRGHLQGHSHQGHQFLDFRQGLFLRQDOHOHVWDGtVWLFRGH&RFKUDQ VHGLVWULEX\HDVLQWyWLFDPHQWHVHJ~QXQDGLVWULEXFLyQGHFKLFXDGUDGRFRQ JOVyORVLHOQ~PHURGHHVWUDWRVHVILMRPLHQWUDVTXHHOHVWDGtVWLFRGH 0DQWHO+DHQV]HOVHGLVWULEX\HVLHPSUHDVLQWyWLFDPHQWHVHJ~QXQD GLVWULEXFLyQGHFKLFXDGUDGRFRQJO7HQJDSUHVHQWHTXHVHVXSULPHOD FRUUHFFLyQSRUFRQWLQXLGDGGHOHVWDGtVWLFRGH0DQWHO+DHQV]HOFXDQGROD VXPDGHODVGLIHUHQFLDVHQWUHORREVHUYDGR\ORHV SHUDGRHVLJXDOD

DiscusiĂłn de Resultados Existe bibliografĂ­a que afronta el tema de la administraciĂłn de sulfato ferroso a todas las gestantes y el riesgo que ello conllevarĂ­a para el desarrollo de preeclampsia, sin embargo estos trabajos se han limitado a la discusiĂłn teĂłrica y fisiopatolĂłgica del problema. El presente trabajo, mediante un estudio de casos y controles, buscĂł determinar si en la prĂĄctica la administraciĂłn de sulfato ferroso en el embarazo es un factor de riesgo para el desarrollo de preeclampsia. La muestra se calculĂł con base en el promedio de nacimientos anual en los centros hospitalarios en cuestiĂłn logrando incluir en el estudio a 123 gestantes, de las cuales el 39% habĂ­an desarrollado preeclampsia vs. 61% que no desarrollaron esta patologĂ­a. Diferentes publicaciones ubican la incidencia de la preeclampsia en cerca del 7-10% de todos los embarazos (Bautista. 1999; Burrows, Meyn & Weber. 2004), no obstante en el presente estudio la incidencia se sitĂşa en el 39%, este resultado se debe a que metodolĂłgicamente se incluyeron mĂĄs controles que casos, de manera que la relaciĂłn fue de 1,56: 1; donde por cada caso se incluyeron 1,56 controles. Se observa que un porcentaje significativo (30,9%) de gestantes no recibieron sulfato ferroso, por norma en Colombia todas las gestantes deben recibirlo, pero en la prĂĄctica muchas mujeres en gestaciĂłn no lo reciben debido a que no tienen acceso a los servicios de salud y a los controles prenatales de manera oportuna o por el hecho de que suspenden el micronutriente por los efectos secundarios a nivel gastrointestinal tales como nauseas y estreĂąimiento (Goodman, A., Goodman, L., & Gilman, 2003). AĂşn cuando en el presente estudio se determinĂł que la mortalidad perinatal, no fue mĂĄs frecuente en la po-

blaciĂłn estudiada, los estudios previos sobre el tema evidencian que la mortalidad perinatal se aumenta en la preeclampsia (RodrĂ­guez, Honermo, HernĂĄndez, Crespo & Triana. 1999), hay que tener en cuenta que dicha mortalidad principalmente se debe a la prematurez extrema resultado, sobre todo, de la preeclampsia grave, es de anotar que en el presente estudio muchos casos fueron de preeclampsia leve o moderada, lo que explica el por quĂŠ no se aumentĂł la mortalidad perinatal en el grupo estudiado. AsĂ­ mismo al hacer el cruce de variables entre el estado nutricional de la gestante y el desarrollo de preeclampsia, se obtuvo como resultado que no hay asociaciĂłn, lo cual difiere de la literatura existente donde se ubica como factor de riesgo para preeclampsia a mujeres con sobrepeso u obesidad. Tal como se planteĂł en la pregunta de investigaciĂłn, se evaluĂł la relaciĂłn de riesgo entre el consumo del sulfato ferroso y el desarrollo de preeclampsia, encontrando una relaciĂłn de riesgo no significativa, con un chi cuadrado = 0,64, asĂ­ se puede ver que mientras el 37,6% de las mujeres que usaron sulfato ferroso desarrollaron preeclampsia en el grupo control fue el 42,1%. El anĂĄlisis de riesgo mostrĂł un OR = 0,83 que aun cuando sugiere una relaciĂłn de protecciĂłn del sulfato ferroso, la relaciĂłn no es significativa, sugiriendo una relaciĂłn inocua entre el consumo de sulfato ferroso y desarrollo de preeclampsia, como antes se mencionĂł. Es importante seĂąalar que esta relaciĂłn de riesgo entre el consumo de sulfato ferroso y el desarrollo de preeclampsia, sĂłlo se habĂ­a abordado desde el punto de vista teĂłrico, siendo esta la primera aproximaciĂłn experimental del mismo, sin embargo es necesario no perder de vista que la preeclampsia es una enfermedad multifactorial, en la cual estĂĄn involucrados factores genĂŠticos, nutricionales, socioeconĂłmicos

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


Sulfato ferroso y preeclampsia. Estudio de casos y controles realizado en dos hospitales de Bogotá

(Sibai, Dekker & Kupferminc. 2005), los cuales en el presente estudio no fueron controlados, debido a que como se trata de un estudio retrospectivo, al revisar las historias clínicas no se encontraban todos los datos que permitieran controlar estas variables, sin embargo levanta aspectos importantes que pueden generar hipótesis para futuros estudios donde se puedan controlar todas las variables para llegar a conclusiones más certeras, además de ampliar la muestra y extender la observación a centros de bajo riesgo como hospitales de primer nivel a fin de controlar sesgos. REFERENCIAS Acosta, G. (1999). Viacrucis de la muerte materna. Documento de trabajo. Washington: Unicef. Oficina Regional para América Latina y el Caribe. Recuperado de: http:/sociales.reduaz.mx/ art_ant/mortalidad_materna_mexico.pdf Banco Interamericano de Desarrollo. (2004). Los Objetivos de Desarrollo del Milenio en América Latina y el Caribe. Retos, acciones y compromisos. Recuperado de: http:/www.iadb.org/sds/ publication/publication_3594_s.htm. Bautista, A. (1999). Hipertensión y Embarazo. Texto de Obstetricia y Perinatología. Bogotá: Universidad Nacional de Colombia. Burrows L, Meyn L & Weber A. (2004). La morbilidad materna asociada con el parto vaginal o por cesárea. Obstet Gynecol, (103), 907-12. Cáceres, F & Díaz, L. (2007). La Mortalidad Materna en el hospital universitario Ramón González Valencia entre 1994-2004. Revista Colombiana de Ginecología y Obstetricia, 58 (2), 58-99. Calderón, J. (2007). La suplementación con hierro y el aumento del estrés oxidativo en el embarazo: una paradoja poco discutida. Revista Colombiana de Obstetricia y Ginecología, 58 (4), 304-308. Caritis S. N, Sibai BM & Hauth J. (1998). Terapia con dosis bajas de aspirina para prevenir la preeclampsia en mujeres con alto riesgo, para el Instituto Nacional de Salud Infantil y Desarrollo Humano. J Med, 338, 701.

51

Coy L., Castillo M., Mora A., Munévar A. & Peña Y. (2007). Características hematológicas de donantes de sangre de Bogotá, D.C. Colombia (2.600 m.s.n.m.). Revista MED, 15 (1),43. Chaudhari, L., Tandon, O P., Vaney, N. & Agarwal, N. (2003). La peroxidación de lípidos y las enzimas antioxidantes en la diabetes gestacional. : Indian J. Physiol Pharmacol, 47, 441-446. Delgado M. (2009). El bajo peso al nacer: Otro ejemplo de inequidad en Colombia. Revista Colombiana de Ginecología y Obstetricia, 60 (2), 122. Goodman, A., Goodman, L., & Gilman, A. (2003). Las Bases Farmacológicas de la Terapéutica, Sulfato Ferroso. México, DF: Mc. Graw Hill Interamericana. Colombia, Ministerio de Salud. (2000). Guía para la detección temprana de las alteraciones del embarazo: Resolución 412. Organización Mundial de la Salud. (2010). Mortalidad materna. Recuperado de: http:who.int/making_pregnancy_safer/topics/maternal_mortality/es/index.html Organización Mundial de la Salud. (2001). Anemia por deficiencia de hierro: Evaluación, prevención y control. Una guía para los directores de programas. Recuperado de: http://www. who.int/nutrition/publications/micronutrients/ anaemia_iron_deficiency/WHO_NHD_01.3/ en/index.html. Orhan, H., Onderoglu, L., Yücel A & Sahin, G. (2003). Marcadores biológicos circulantes de estrés oxidativo en embarazos complicados. Arch Gynecol Obstet; 26, 189-195. Rodríguez, M., Honermo, J., Hernández, J., Crespo, T. & Triana, P. (1999). Enfermedad Hipertensiva: Algunas consideraciones sobre su influencia en los indicadores de Morbimortalidad perinatal. Revista Cubana de Obstetricia y Ginecología, 25 (2), 108-113. Stanco G. (2007). Funcionamiento intelectual y rendimiento escolar en niños con anemia y deficiencia de hierro. Colombia Médica, 38 (1), 24-33. Sibai, B., Dekker, G. & Kupferminc, M. (2005). Preeclampsia. The Lancet, 365 (9461), 785-799.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


52

Tatiana Valentina Cabrera, Mauricio Jimenez

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


53

Occidente: permanencia, cambio y ambivalencia en el imaginario sobre la naturaleza y el otro en América. Siglos XV-XX. The West: Permanence, change and ambivalence on the imaginary concerning nature and the other on America. XV-XX centuries Oriana Prieto Gaona1

Resumen El objetivo de este artículo es reconstruir las permanencias y cambios en el imaginario occidental sobre la naturaleza y el otro en América. Se trabajó esta perspectiva haciendo énfasis en las permanencias pues las reconstrucciones históricas usualmente propugnan por resaltar los cambios y las coyunturas lo que termina en una historia escalonada que no siempre explica fenómenos de larga duración como el de las relaciones entre los seres humanos y su entorno. Palabras clave: historia ambiental, subalternidad, América, occidente. Abstract This article intends to reconstruct the permanencies and changes within the West imaginary about the nature and the other on America. This perspective is worked emphasizing on the permanencies because the historical reconstructions as usually advocated to highlight the changes and joints, ending in a stepped history which usually does not explain long-term phenomena such as the relations between human beings and their environmet. Key words: environmental history, subalternity, America, the West.

1

Magíster en Historia, de la Universidad de los Andes. Centro de Investigación y Desarrollo de la Fundación Universitaria del Área Andina, Bogotá, Colombia, oprieto@areandina.edu.co

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


54

Oriana Prieto Gaona

INTRODUCCIÓN En el presente texto se analizaron las permanencias y cámbios en el imaginario sobre la naturaleza y el otro. El concepto el otro, se entiende a la luz de los planteamientos de David Arnold y Edward Said. Para Arnold (2000), la otredad está representada en lo que Said definió como el orientalismo. El orientalismo más que “un discurso verídico sobre oriente” (Said, 2004. Pág. 26) es un discurso a partir del cual la cultura occidental ha manipulado y dirigido a oriente para construirse a sí misma en detrimento del otro (Said, 2004). En palabras de Said, “el orientalismo es un estilo occidental que pretende dominar, restructurar y tener autoridad sobre oriente” (Said 2004. Pág. 26). La misma pretención es la que reconstruye Arnold (2000) a través del discurso que llamó “la tropicalidad” con base en el que se edificaron las relaciónes ambivalentes que occidente ha tenido con América. Es importante anotar que en este texto se reconoce la diversidad dentro de lo que hoy se entiende por “occidente”, del mismo modo que “el otro” esta compuesto de gran diversidad. Sin embargo, en aras de construir el discurso se hará referencia a occidente y a el otro como si cada uno de ellos fuera una unidad homogénea. Con occidente se hará referencia a las culturas europeas que han dominado durante los siglos posteriores al contácto con América. Se definió una periodización amplia que implicó limitar la argumentación a los siguientes puntos más relevantes para sustentar la tesis propuesta. Primero se definieron conceptos y categorías claves para la argumentación. Luego, se reconstruyeron las relaciones entre occidente y la naturaleza. Se disertó cómo occidente estableció una dualidad ambigua y ambivalente con referencia a la naturaleza y el otro antes y después del choque con el “Nuevo Mundo”. Finalmente se sustentó cómo, si bien la ambivalencia sincrónica de dos imaginarios occidentales sobre la naturaleza y el otro coexistieron en el periodo propuesto, se han dado cambios en la preminencia de unos imaginarios sobre otros. Homogenizar las categorías occidente y el otro resulta útil en la medida en que se trabajó sobre un periodo de tiempo amplio que partió con el preludio de la época definida por occidentales como la Modernidad y que se extiende hasta lo que algunos autores defi2

nieron como Postmodernidad. Aunque son variadas las cronologías que diversos autores han planteado para este periodo, y hablar de un origen geográfico es complejo, se retomará la afirmación de que la Modernidad tiene una ubicación espacio temporal concreta: occidente renacentista e ilustrado y que se configuró culturalmente en Europa occidental hacia el siglo XVI cristalizándose a finales del siglo XVIII con la Revolución Francesa e Industrial. Para el siglo XIX el proyecto consolidado se ejecutaba por las distintas colonias europeas alrededor de todo el mundo. (Berman 1994, Giddens, et al. 1996 & Dussel 1966). La Modernidad como época, como categoría y como construcción cultural de un grupo humano particular permite explicar varios hechos, entre ellos, las concepciones que occidente construyó sobre la naturaleza y sobre el otro. Concepciones que además se expandieron e hibridaron por todo el mundo hasta componer un cambio sobre la misma estructura que algunos llamaron Postmodernidad. La Postmodernidad se consolidó a partir de la segunda mitad del siglo XX en donde se dio el quiebre de las transformaciones que en este texto se tratarán (Harvey, 1990 & Lyotard 1993). Si bien la Historia define unos cambios trascendentales del pensamiento occidental que admiten separar conceptualmente a la Modernidad de un periodo precedente denotado como Medioevo, en el presente análisis se considera relevante mencionar algunas de las permanencias del Medioevo en la Modernidad que se traerán a colación para ilustrar las raíces de los imaginarios occidentales sobre la naturaleza y el otro. Una de estas hondas raíces está en la religión judéo-cristiana2. En teoría, la Modernidad rompió con el dominio eclesiástico, sin embargo, muchos de los imaginarios que tenían una explicación religiosa continuaron vigentes cambiando la explicación pero manteniendo el trasfondo de una misma idea. A continuación me refiero se va ha hacer referencia específica a uno de ellos en el que es posible analizar los rasgos atávicos de las ideas occidentales sobre la naturaleza y el otro. Para ello se utilizará la siguiente imagen de 1579 que proviene del texto Retórica Cristiana de Didacus Valdés. La representación corresponde a La Gran Cadena del Ser, una idea bíblica que resulta acorde con planteamientos platónicos acerca de la organización occidental del mundo natural. (Lovejoy, 1983).

Este contexto sociocultural como raiz fue también reconocido por William Cronon cuando reconstruyó las transformaciones sobre la idea de la wildernes que se encuentra relacionada con la tesis central del presente trabajo. En palabras de Cronon la wildernes, “fulfills the old romantic project of secularizing Judeo-Christian values so as to make a new cathedral not in a some petty human building but in God’s own creation, Nature itself” (Cronon 1995. Pág.81).

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Occidente: permanencia, cambio y ambivalencia en el imaginario sobre la naturaleza y el otro. Siglos XV-XX.

55

'LRV ÈQJHOHV +RPEUHV 0XMHUHV $QLPDOHV7HUUHVWUHV $QLPDOHV0DULQRV %HVWLDV 3ODQWDV 0LQHUDOHV Figura 1. La Gran Cadena del Ser Fuente: Great Chain of Being. Imagen consultada en la página de la Biblioteca Carnegie ubicada en Lewisburg, Pensilvania. URL: http://www.departments.bucknell.edu/history/carnegie/aristotle/chainofbeing.html La Gran Cadena del Ser muestra una escala jerárquica que ubica a Dios y al hombre (hecho a su imagen y semejanza), por encima de los otros seres que componen lo que hoy podemos entender como naturaleza. Dentro de la categoría de hombre se establecían jerarquías de género y raciales que se aceptaban con base en ordenes bíblicas. La naturaleza, desde el imaginario bíblico, fue a su vez relegada a un lugar inferior de la escala, separada de Dios y del hombre. Fue la naturaleza “salvaje” o lo que para Cronon (1995) sería una de las primeras ideas sobre la wilderness. Dicho imaginario está bien descrito por el mencionado autor cuando retoma un pasaje del éxodo que narra la perdición (la “salvajización” o caida en la escala) del pueblo de Moises despues de 40 años de vagar por el desierto que representa el espacio de la natu-

raleza: “They are entangled in the land, the wildernes hath shut them in” (Cronon 1995, Pág 71). Pero, como se planteó, esta imagen de la naturaleza y los imaginarios que la construyeron no desaparecieron con la Modernidad, por el contrario, incluso se podría afirmar que fueron la base del pensamiento evolucionista que marcó esta época. La diferencia entre una jerarquía hierática y la que se construyó con la Modernidad es que en la primera, el orden es inmutable, mientras que en la segunda se aceptó la noción de cambio en los seres vivos. Sin embargo, ambas mantienen en común esa jerarquización lineal que ubica al hombre blanco, europeo, “civilizado”, como descendiente legítimo y directo de la divinidad. (Ver Figura 2).

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


56

Oriana Prieto Gaona

Figura 2.&ODGRJUDPDGHODHYROXFLyQ 'LYHUVRVFODGRJUDPDVLQVSLUDGRVHQODVWHRUtDVGHODHYROXFLyQIUHFXHQWHPHQWH PRVWUDEDQXQGLDJUDPDXQLOLQHDO\HVFDORQDGRHQHOTXHFODVLILFDEDQHO³UHLQRQDWXUDO´ HQXQLFHOXODUHVSODQWDVDQLPDOHV\KRPEUH 

La diferencia entre el pensamiento occidental Moderno y su antecedente religioso fue de forma y no de fondo. De igual modo que, en el pensamiento religioso mencionado, Dios le otorgĂł el papel agente al hombre al ubicarlo por sobre de otros seres de la naturaleza, en la Modernidad el hombre siguiĂł siendo el actor agente aunque paulatinamente se pretendiĂł suprimir la potestad divina. Sin embargo, en ambos momentos el hombre occidental terminĂł por considerarse a sĂ­ mismo superior otras especies e incluso a otros hombres aduciendo su capacidad de modificar la naturaleza. Establecido, grosso modo, el imaginario sobre las caracterĂ­sticas jerĂĄrquicas entre occidente y la naturaleza, es posible ahora problematizar puntos mas finos de la discusiĂłn. Con el encuentro del Nuevo Mundo fue necesario ampliar la escala de las jerarquĂ­as. Los animales y plantas nuevos seguĂ­an teniendo un lugar adecuado en la Gran Cadena del Ser. (Ver Figura 1) No obstante, el encuentro con otros seres humanos de otras culturas representĂł un problema ampliamente discutido por la Escuela de Salamanca en el siglo XVI acerca de la humanidad o no de las gentes americanas. Aunque definir quĂŠ papel en el imaginario occidental ocuparĂ­an los nativos americanos se vio influenciado no solo por una curiosidad filantrĂłpica y tampoco por una meramente filogenĂŠtica, sino por grandes intereses econĂłmicos, mercantiles y de expansiĂłn territorial que igualmente marcaron fuertes relacions de poder. Como lo reconoce Crosby

(1999), los europeos ocuparon con preferencia los lugares con caracterĂ­sticas fisicas que les permitieron reproducir sus propios medios de producciĂłn (Crosby) y con ellos sus propios imaginarios. Con el Nuevo Mundo se configurĂł la idea ambigua sobre el nativo americano que se puede asociar iconogrĂĄficamente a las ideas occidentales maniqueas sobre el mundo y en particular sobre la naturaleza. Por un lado la idea de un nativo salvaje, canĂ­bal, que se remite a una naturaleza indĂłmita. Una naturaleza que devora, que enloquece y que obliga a los hombres a convertirse en bestias como es posible observar en diferentes narraciones occidentales. Desde las crĂłnicas que denuncian cĂłmo espaĂąoles, varados en cualquier lugar salvaje del Nuevo Mundo, se vieron obligados a consumir los cuerpos de sus propios compaĂąeros como lo hacĂ­an llas bestias; hasta novelas de principios del siglo XX como El corazĂłn de las tinieblas de Joseph Conrad o La VorĂĄgine de JosĂŠ Eustacio Rivera, en las que la selva los â&#x20AC;&#x153;obligaâ&#x20AC;? a vivir los limites de la corrupciĂłn humana. Por otro lado estĂĄ tambiĂŠn la idea de un salvaje bueno. La construcciĂłn de un salvaje rousseauiano en el que el estado â&#x20AC;&#x153;naturalâ&#x20AC;? o â&#x20AC;&#x153;primitivoâ&#x20AC;? del hombre resulta moralmente superior al â&#x20AC;&#x153;civilizadoâ&#x20AC;?. El salvaje de Rousseau resulta, prĂ­stino, sin pecado, y en la obra de Rousseau vive en armonĂ­a con el mundo que lo rodea. Este salvaje corresponde ademĂĄs a una imagen positiva de la naturaleza.

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


Occidente: permanencia, cambio y ambivalencia en el imaginario sobre la naturaleza y el otro. Siglos XV-XX.

La ambigüedad o ambivaelencia descritas son también rescatadas en lo Arnold (2000) reconoció como una parte central de su noción de tropicalidad: “Parte de la significación de tropicalidad reside en su propia ambivalencia. En parte sueño facinante de opulencia y exuberancia -islas paradisiacas en mares resplandecientes-, los tropicos significaron al mismo tiempo un mundo ex traño de crueldad y enfermedad, de opresión y exclavitud.” (Arnold 2000, Pág 130).

57

Para el autor citado, la historia de la tropicalidad tiene una larga y compleja referencia a lo oscuro como a lo edénico (Arnold, Pág 137) que también describe como una dualidad entre “lo paradisiaco y lo pestilente” (Arnold, Pág 139). Esta es la misma dualidad que nos trae a colación la relación occidental con la naturaleza americana. En obras del siglo XVI, como las de Theodore de Bry, (Figura 3) los nativos oscilan entre las victimas del despotismo español versus las imagenes del nativo canibal (Vignolo 2005, Págs 159-164).



Figura 3. Canibales comiendo Fuente: Theodore de Bry. Cannibals Eating. SXVI. Imagen consultada en la base de datos Art Museum Image Gallery. http://vnweb.hwwilsonweb.com/hww/results/results_common.jhtml;hwwilsonid=GJOOPTT5EJ0IVQA3DIKSFF4ADUNGIIV0

Ambas ideas occidentales sobre la naturaleza americana convivieron sincrónicamente. Sin embargo, durante la Modernidad prevaleció el imaginario de la naturaleza y el nativo como salvajes con necesidad de domesticación. El proyecto Moderno hasta bien entrado el siglo XX implicó la conquista técnica de la naturaleza, la modificación del entorno y la misión civilizadora occidental sobre otros culturales. La naturaleza esperada se entendía como el paisaje modificado, el triunfo del entorno culto, bien fuera agrario o industrializado. Los nativos salvajes por su parte se hallaban en una etapa que eventualmente tendrían

que superar gracias al influjo civilizador que legitimó todo tipo de actos beligerantes. Un ejemplo de este periodo es la matanza extensiva de Búfalos en los Estados Unidos con el objetivo de diezmar a los indíenas que vivian de ellos. Los pasajeros de los trenes estaban autorizados a disparar contra todos los que pudiesen matar (Figura 4). No eran animales para consumo, se dejaban descomponer en las llanuras. De este modo también se ejrció presión sobre los bienes de subsistencia de las comunidades nativas con el objetivo de diezmarlas (Doval 2009, Pág. 320).



Figura 4. Matanza de Búfalos en Estados Unidos Fuente: Passengers Shooting Buffalo. Imagen tomada de la galería First People. http://www.firstpeople.us/pictures/buffalo/ls/Passengers-Shooting-Buffalo.html

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


58

Oriana Prieto Gaona

No fue sino hasta la segunda mitad del siglo XX que el balance entre la ambivalente perspectiva de occidente frente a los nativos y la naturaleza empezó a inclinarse para el otro lado de la balanza. Con el desencanto de las postguerras, la rebelión ante los genocidios, la persecución de minorías étnicas, la presión visible y alarmante de la industrialización sobre los entornos naturales, el proyecto Moderno se vio hondamente criticado. Si bien continuaron las prácticas del capitalismo, se comenzaron a elaborar discursos que implicaron el “desarrollo sostenible” y en al ámbito agrario se tradujeron en la promoción de prácticas “limpias” y el retorno a los “saberes ancestrales” de otras culturas. Es por esta época que textos como el de Primavera Silenciosa tuvieron su origen y resonancia. Sin embargo, para autores como Arturo Escobar, en esta “revolución verde”, la naturaleza continuó teniendo un valor instrumental. Occiente nuevamente jerarquizó el mundo y a la naturaleza, se volvió a erigir su salvador y fue a partir de las ideas contemporaneas sobre el desarrollo que se construyó el “tercer mundo”: “Los estudios sobre la revolución verde están llenos de supuestos culturales con respecto a la ciencia, el progreso y la economía, en los cuales pueden dicernirse los matices autoritarios de un padre/salvador [occidente] que habla con desprendida condescendencia al hijo/nativo.” (Escobar 1998, Pág 304). Acercandononos mas a un momento contemporáneo, el buen salvaje y la naturaleza como madre, la “madre selva”, empezaron a cobrar protagonismo en los imaginarios y en el discurso. Ganó fuerza lo que Karl Butzer describe como “Un mito persistente: los indígenas cómo ecologistas”3. Por un lado se dio el surgimiento de nuevas corrientes políticas de corte ecológico y conservacionista. Por otro, el buen salvaje se transformó en la figura del nativo ecológico que para Astrid Ulloa encarna también los dos extremos de un mismo imaginario occidental: “En un extremo el nativo ecológico es superior en su diferencia (sabiduria ecológica) y, en el otro, es inferior y es necesario hacerlo semejante a la socidad dominante.” (Ulloa 2004, Pág. 313). Pero, la idea del nativo ecologico es la contrucción discursiva de los indígenas americanos como “iconos silvestres” (Ulloa, pág. 315). Los nativos (como si cada uno de los seres humanos no fuese nativo de algún lugar), que fueron sublimados

3

y entendidos como las personas no occidentales y preferiblemente pertenecientes a minorías étnicas, se convirtieron en los hijos protectores de la tierra. A su vez, la contraparte de la ambigüedad permaneció. El imaginario negativo del la naturaleza salvaje y el nativo salvaje coexistió como siempre con el del buen salvaje. El cambio en el imaginario frente a la naturaleza y el otro no fue entonces un cambio radical de la sustitución de un imaginario por otro sino mas bien de la preeminencia de uno sobre el otro. Sin embargo, los que siguen profiriendo los términos de los cambios y las gradaciones jerárquicas siguen siendo los centros de poder académicos y económicos dominados por la cultura occidental. Y, el problema central de la ambivalencia y el maniqueísmo en los imaginarios reinantes occidentales no está en que sea la misma estructura occidental la que decida los términos de sus “cambios”, y el orden de las jerarquías. El problema está en que es sólo una forma de concebir el mundo la que determina lo bueno y lo malo de los cambios y esencializa las formas alternativas de otros sujetos culturales. El hombre, como en La Gran Cadena del Ser, sigue en la gradación jerárquica aunque el hombre ya no se entienda en términos raciales sino en términos del que se encuentre arriba y dentro de los centros de poder. Hasta ahora, la naturaleza sigue considerándose un ente aislado y los nativos fueron convertidos en quienes por esencia se hallan mas cerca de ella. Epílogo: Siglo XXI La profundización occidental en el esencialismo del nativo ecológico se ha agudizado en los albores del siglo XXI. El imaginario sobre el otro como protector de la naturaleza desconoce la diversidad de relaciones que ese otro a construido con su entorno. Ese imaginario construye un otro, en este caso “nativo americano” único, y desconoce la diversidad y la hibridación del pensamiento indígena que hace 500 años se funde con el occidental. El Avatar hollywoodense niega la realida del nativo del tercer mundo que compró el sueño del desarrollo y la Modernidad y a quien hoy se le viene a vender un nuevo sueño verde que resulta poco productivo y hasta inconsecuente en el contexto del “subdesarrollo”.

“Sale (1990) claims that New World peoples lived in harmony with nature and refrained deliberately form altering their enviroments, to the degree that they were somehow able to mantain an idyllic ecological equilibrium” (Butzer 1992, Pág 347)..

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Occidente: permanencia, cambio y ambivalencia en el imaginario sobre la naturaleza y el otro. Siglos XV-XX.

REFERENCIAS Arnold, D. (2000). La naturaleza como problema histórico. El medio, la cultura y la expansión de Europa. México: Fondo de Cultura Económica. Berman, M. (1994). Brindis por la Modernidad. En: Giraldo, F. & Viviescas, F. Colombia: El despertar de la Modernidad. Bogotá: Foro Nacional por Colombia. Butzer, K. (1992). The americas before al after 1492: An introductión to current geográphical research. Annals of the association of american geographers, 82 (3). Cronon, Wi. The trouble with Wilderness; or, getting Back to the wrong nature. En: Cronon William (Editor). (1995). Uncommon Ground. Toward reinventing Nature. N.Y, Norton & Company. Crosby, A. (1999 [1988]). Imperialismo Ecológico. La expansión biológica de Europa, 900-1900. Barcelona, Crítica. Doval, G. (2009). Breve historia de los indios de Norteamerica. Madrid: Ediciones Nowtilius, S.L. Dussel, E. (1966). Europa, modernidad y etnocentrismo. En: Wallerstein, Immanuel (coordinador). Abrir las Ciencias Sociales. México: Siglo XXI Editores.

59

Escobar, A. (1998). La invención del tercer mundo. Construcción y deconstrucción del desarrrollo. Bogotá: Editorial Norma. Giddens, A. Bauman, Z., Luhmann, N & Beck, U.. (1996). El doble sentido de las consecuencias perversas de la modernidad. En: A. Giddens. Las consecuencias perversas de la Modernidad. Modernidad, contingencia y riesgo. Barcelona: Antrhropos. Harvey, D. (1990). La condición de la posmodernidad. Investigación sobre los orígenes del cambio cultural. Argentina: Amorrortu editores. Lyotard, J. F. (1993 [1979]). La condición Postmoderna. Informe sobre el saber. Barcelona: Planeta Agostini.

Said, E. (2004). Orientalismo. Barcelona: Random House Mondadori. Ulloa, A.(2004). La constucción del nativo ecológico. Complejidades, paradojas y dilemas de la relación entre los mivimientos indígenas y el ambientalismo en Colombia. Bogotá, Icanh. Vignolo, P. (2005). Hic sunt canibales: El canibalismo del nuevo mundo en el imaginario europeo (1492-1729). Anuario Colombiano de Historia Social y de la Cultura. No. 32, 2005, Pág. 151188.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


60

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


61

Rol del terapeuta respiratorio frente al desplazamiento forzado en Colombia. Aproximacion a sus representaciones sociales Contrast of the role of the respiratory therapist and forced displacement in Colombia. Approach to social representations Paola Arias Colina1, Leidy Becerra2, Claudia Liliana Cruz Moya3, Diana Quintero4 Resumen Introducción: Esta investigación cualitativa (fase II RS) aporta orientaciones en la comprensión del desplazamiento forzado en Colombia (DFC) desde las aproximaciones de sus representaciones sociales, esbozando al unísono, una reflexión sobre el rol a ejercer por el Terapeuta Respiratorio (TR).Métodos: inferencia Inductiva, interrogativa, Entrevistas a profundidad a 22 Profesionales cuya actividad converge en la asistencia de personas en condición de DFC de entes gubernamentales y ONG. Resultados: Las representaciones sociales (RS) de los profesionales de diversas disciplinas frente al rol de los TR, revelan que el rol del TR en el DFC va orientado a reducir la presencia de enfermedades respiratorias. Conclusiones: Las RS indican que los roles son asistenciales, gerencialesadministrativos, veedores de procesos estatales y de cooperación. Palabras clave: Enfermedad respiratoria, representación, social, rol, terapeuta respiratorio (Fuente: DesC y LILACS). Abstract Background: This qualitative research (Phase II RS) was intended to understand the forced displacement in Colombia (FDC) using the approach of social representations, in parallel becomes a reflection on the role of Respiratory Therapists (RT) in this problem. Methods: Inductive inference, questioning, depth interviews with 22 professionals whose activities converge in the care of people living in FDC of government agencies and NGOs. Results: The social representations (SR) of professionals from various disciplines with respect to the role of RT, reveal that the role of TR in the FDC is to reduce the incidence of respiratory diseases. Conclusions: The RS indicates that the roles are health care, managerial, administrative, providers of state and cooperative processes. Key words: respiratory disease, representation, social, role, respiratory therapist (Source: DesC and LILACS).

1 2 3

4

Terapeuta Respiratorio Programa de Terapia Respiratoria. Integrante del Semillero Respira. Fundación Universitaria del Área Andina. Bogotá. Colombia Paolaan22@hotmail.com. Terapeuta Respiratorio. Programa de Terapia Respiratoria. Integrante del Semillero Respira. Fundación Universitaria del Área Andina. Bogotá. Colombia lealbemo@yahoo.com Docente investigador Centro de investigación y desarrollo. Coordinador Semillero Respira Integrante de Grupo de Investigación Aire Libre. Fundación Universitaria del Área Andina. Terapeuta Respiratorio UMB, Auditora Clínica UMB, M. S.c. en Educación. Pontificia Universidad Javeriana.ccruz@areandina.edu.co. Terapeuta Respiratorio. Programa de Terapia Respiratoria. Integrante del Semillero Respira. Fundación Universitaria del Área Andina. . Bogotá. Colombia, Dianami87@hotmail.com

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


62

Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero

INTRODUCCIÓN El desplazamiento forzado en Colombia es una clara violación de los derechos humanos y el derecho internacional humanitario; en tal Acción se violan derechos fundamentales, como son: derecho a la vida, derecho a la libertad, derecho al trabajo, y otros de segunda generación, como son: el derecho a la propiedad privada, derecho a la libre opinión, derecho a la paz; el cual se ve como un fenómeno social, que surge como mecanismo de sobrevivencia de los colombianos que huyen de la violencia; cambiando totalmente su calidad de vida”( Valencia,2001).) El desplazamiento forzado en Colombia, se constituye como uno de los graves problemas sociales que viene afrontando nuestro país en las últimas décadas, así como lo demuestran las cifras oficiales sobre este fenómeno. Y en tal sentido, el terapeuta respiratorio (TR) como profesional proactivo, y ente integral de los diversos procesos comunitarios; reflexiona sobre los trastornos sociales del país, interviniendo como agente y actor dinámico gracias a los diversos perfiles en el área de la salud pública y el trabajo con las comunidades, favoreciendo la promoción de la salud y prevención de enfermedades respiratorias, en esta población con alto grado de vulnerabilidad. Respecto del estado actual del estudio en el artículo Necesidades en salud de la población desplazada por conflicto armado en Bogotá, señala el autor que en una situación de conflicto armado se generan condiciones que deterioran la calidad de vida de quienes lo padecen, de tal manera que el compromiso de la salud mental y de la estabilidad psicosocial, los problemas de alimentación las afecciones gastrointestinales y respiratorias, son los principales problemas de salud. Además, este panorama se complica con las dificultades de acceso a los servicios de salud, ya que en condiciones de desplazamiento, la problemática se hace gravosa (Mogollón, 2003). Las razones consecuentes al avance de la presente investigación social están circunscritas a la ausente formación de los TR en la actualidad en Colombia, respecto del rol que deben ejercer referente a este grupo poblacional, a la estimulación de prácticas sociales de mayor envergadura, a una propuesta de ruptura de paradigmas en cuanto a los modelos de investigación utilizados en terapia respiratoria, señalando la existencia de trabajos empíricos que lo demuestren, y desde la experiencia como TR se reconoce la nula de preparación de los TR en este aspecto, encontrando consecuentemente un terreno amplio y fértil para el desempeño de los profesionales en esta área.

Al unísono, indagando los diferentes medios y fuentes de información, es importante resaltar el número reducido en el país de investigaciones relacionadas con la pesquisa, y planteado de esta forma, se hace fundamental recordar que por medio de este proyecto, se planea cumplir algunos de los siguientes objetivos: describir las representaciones sociales del rol del terapeuta respiratorio respecto al desplazamiento en Colombia, a partir del desarrollo del enfoque cualitativo, determinar los roles del terapeuta respiratorio a partir de las experiencias considerativas de otros profesionales quienes laboran con esta población y destacar las acciones sociales ejercidas por los terapeutas respiratorios fuera de la órbita asistencial hospitalaria. La realización de este proyecto, orientado a una perspectiva social, enfoca la necesidad por incursionar e interactuar con diferentes ONGS y los profesionales que trabajan en ellas, con la finalidad de identificar las distintas funciones o roles que ejercen con esta comunidad; finalmente, creando un rol específico que ejecutara el terapeuta respiratorio. El estudio de las representaciones sociales, se proyecta en la centralización de ideas por parte de los diversos profesionales de la salud y otras ciencias para la planeación participativa e integración de funciones con esta población en situación de conflicto. Desde la perspectiva científica, este planteamiento investigativa e incentiva la integración y realización de propuestas para culminar, con el propósito inicial que es identificar el rol del Terapeuta Respiratorio en la problemática del desplazamiento forzado en Colombia. Desde la perspectiva legal, se toma como referencia la Ley 387 de 1995 (Mogollón,2003) , por la cual se adoptan las medidas para la prevención del desplazamiento forzado; la atención, la protección, consolidación y estabilización socioeconómica de los desplazados internos por la violencia en el país. Es en la comunicación social donde principalmente se construyen las representaciones sociales. Resumiendo, el enfoque de investigación cualitativa que acontece aquí, “las representaciones sociales” son tales por su condición originaria como de su producción, como por los fines que sigue y por la industriosa fundamentación. Las representaciones sociales se incorporan en la profesión de terapia respiratoria como una modalidad de investigación social incluida en los contenidos programáticos de formación en el país, que permita construir de manera dinámica las practicas en salud a partir de las condiciones de producción naturalisticas y de sentido

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Rol del terapeuta respiratorio frente al desplazamiento forzado en Colombia: Aproximacion a sus representaciones sociales

común de los diversos actores alrededor del tema de los roles ejecutados por los TR en el desplazamiento forzado en Colombia El trabajo desarrollado tuvo como objetivo general, identificar las representaciones sociales de los profesionales de otras áreas que laboran con personas en condición desplazamiento forzado en la ciudad de Bogotá respecto de los roles del Terapeuta Respiratorio frente a las personas en condición de Desplazamiento Forzado en Colombia; la pesquisa tiene como objetivo especifico determinar las actividades, funciones y perfiles en la formación de los Terapeutas Respiratorios para el servicio de estas personas en condición especial según los estatutos de diversas entidades que favorecen sus derechos como la Constitución política de Colombia. MATERIALES Y METODOS El estudio se desarrollo bajo el modelo de investigación cualitativa, resaltando un enfoque Inductivo e interrogativo, en el cual se busco describir las representaciones sociales (RS) de los profesionales de otras disciplinas de entes gubernamentales y no gubernamentales que trabajan con personas en condición de desplazamiento forzado en Colombia en la ciudad de Bogotá, respecto de los roles del Terapeuta respiratorio ejercidos multidimensionalmente en la población en circunstancia de DFC. Para la recolección de información se realizó 22 entrevistas semiestructuradas dirigidas a profesionales de diversas áreas disciplinares (22), en los meses de septiembre y noviembre de 2009, elegidos a conveniencia, de expertos y heterogéneo, integrado por (Terapeutas Respiratorios, Docentes universitarios, enfermeras, auxiliares judiciales, entes pertenecientes al Ministerio de Defensa, psicólogos, sociólogos, trabajadores sociales, y personal vinculado a instituciones como Organizaciones No Gubernamentales ONG`s). Los sujetos de estudio fueron hombres y mujeres, ciudadanos colombianos con un promedio de edad entre los 36 a 57 años, quienes ejercen labores profesionales en organismos u entidades estatales y no gubernamentales. Su nivel de formación es estudios superiores, con especialización en áreas administrativas y gerenciales, maestrías en investigación social y doctorado en ciencias políticas y humanas como antropología, sociología y psicología. La forma de entrevista que se aplico fue la semiestructurada con un tiempo de duración de 40 minutos por entrevistado, aplicando un guion avalado y revisado de carácter homogéneo para cada uno de los participantes, de tal manera que se responda a las tres

63

unidades eje de la representación social: contenido, estructura interna y núcleo central. En la superación, exploración y análisis de los datos de la diversas etapas del proceso cualitativo se acude a la propuesta múltiplo- metodológica referida por Jean-Claude Abric en su texto Prácticas Sociales y representaciones (Abric. 2001 citado por Mendieta, 2010), articulado en tres etapas: La primera, recolección del contenido, donde se utilizo la entrevista a profundidad como técnica, la segunda etapa permite indagar la estructura y el núcleo central en sistemas de categorías y por último la verificación de la centralidad, realizada a través de la verificación de los resultados obtenidos por medio del análisis. (Abric. 2001 citado por Mendieta, 2010). Resumiendo en líneas sencillas el procesamiento de la información una vez obtenidas las entrevistas se transcribieron en medio magnéticos, el siguiente paso correspondió al sistema axial de codificación, decodificación, identificación de categorías, núcleos centrales y campos semánticos como lo ilustran las graficas en la interpretación de la información obtenida. Como categorías de análisis se contemplan: Dentro de las categorías se encuentran los siguientes conceptos teóricos, como: rol, profesionales, salud publica experiencia, entidades protectoras de personas en situación de desplazamiento forzado. En las subcategorías se destacan conceptos como: desplazamiento, conflicto armado, factores generadores de desplazamiento forzado, condiciones de salud de personas en situación de desplazamiento forzado. Se recolecta la información a partir de la ejecución de los instrumentos antes descritos, se transcribieron, se codificó la información obtenida tomando como núcleo central a los diversos grupos profesionales, describiendo diferentes roles que se deben ejercer en este grupo poblacional basados en los lineamientos de la salud pública y entidades que protegen a estas personas; así como su experiencia en la interacción profesionaly el desplazado, obteniendo como ilustración el conflicto armado que genera factores de desplazamiento y por ende, modifican las condiciones de salud en este tipo de personas. Centralmente se revisaron conexos conceptuales y teóricos relacionados con los roles de un Terapeuta Respiratorio en la asistencia de personas en condición de desplazamiento forzado en Colombia, también se realiza una conceptualización de los estatutos de la Asociación Colombiana de Terapia Respiratoria.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


64

Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero

RESULTADOS La codificación de la información ejercida en el interior del procedimiento sistemático de construcción decanto en resultados reveladores de los roles que a futuro se sugiere desempeñaría el Terapeuta Respiratorio, además del tipo de atención asistencial, la enseñanza, prevención de las enfermedades y promoción de la salud, la creación de proyectos dirigidos a la salud pública y participación de grupos investigación en los diversos entornos que rodean a este profesional.

Sin más preámbulo, las representaciones sociales de los profesionales de diferentes áreas que en la actualidad asisten a personas en condición de desplazamiento forzado en Colombia ubica en su núcleo a los roles aplicados en desplazados y sus correspondientes elementos periféricos como perfil de acuerdo al tipo de refuerzo que se requiera, asistencial en los diversos niveles de atención, rol administrativo y gerencial de entidades gubernamentales o no gubernamentales, desarrollo de planes y programas de promoción de la salud, rol docente, rol investigador como se lo exhibe la (Figura.1)

Figura 1. 5HSUHVHQWDFLRQHV VRFLDOHV GH ORV SURIHVLRQDOHV GH GLYHUVDV iUHDV TXH ODERUDQ FRQ SHUVRQDVGHVSOD]DGDVHQ%RJRWiIUHQWHDORV5ROHVGHO75HQSHUVRQDVHQFRQGLFLyQGH'HVSOD]D PLHQWRIRU]DGRHQ&RORPELD

Referente a la categoría de los Roles del TR en el manejo de personas en condición de Desplazamiento forzado en Colombia, las representaciones sociales de los profesionales sujetos a estudio acerca de esta denominación, posee en su núcleo central de la representación social asistencial y en los elementos periféricos contienen subcategorias asistencia en niveles de atención conforme a los estatutos de la secretaria distrital y

Ministerio de protección social, a nivel de los distintos servicios en salud, los terapeutas respiratorios a nivel asistencial en primer nivel de atención favorecen a la población en condición en desplazamiento forzado concordante con los preceptos de la Asociación Colombiana de Facultades de Terapia Respiratoria y el Colegio Colombiano de Terapia Respiratoria como es de observar en la figura 2.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Rol del terapeuta respiratorio frente al desplazamiento forzado en Colombia: Aproximacion a sus representaciones sociales

65

Figura 2. 5HSUHVHQWDFLRQHV VRFLDOHV GH ORV SURIHVLRQDOHV GH GLYHUVDV iUHDV TXH ODERUDQ FRQ SHUVRQDVGHVSOD]DGDVHQ%RJRWiIUHQWHDO5RODVLVWHQFLDOGHO75HQSHUVRQDVHQFRQGLFLyQGH 'HVSOD]DPLHQWRIRU]DGRHQ&RORPELD

Referente a la categorรญa de anรกlisis Rol administrativo y gestor de proyectos y programas en salud respiratoria dirigidos a la comunidad en condiciรณn de desplazamiento forzado en la ciudad de Bogotรก, la estructura la integran el nรบcleo central la planificaciรณn y ejecuciรณn de actividades educativas en la comunidad y los respectivos elementos perifรฉricos seguimiento de factores de riesgo de enfermedades de tracto superior inferior en menores de 1 aรฑo. Vigilancia y prevenciรณn de infecciรณn respiratoria aguda en niรฑos menores de 5 aรฑos, administraciรณn y gestiรณn educativa de Salas ERA en primer nivel de atenciรณn, de acuerdo con lo estatuido por el Comitรฉ distrital de

enfermedades respiratorias de la Secretaria de Salud del Distrito. Creaciรณn de unidades respiratorias locales de ubicaciรณn geogrรกfica por localidades en Bogotรก para seguimiento de actividades de prevenciรณn de patologรญa respiratoria en las personas en condiciรณn de desplazamiento en los diversos grupos etรฉreos de acuerdo a los objetivos del milenio (ODM), a los estatutos del Ministerio de protecciรณn social y la Asociaciรณn Colombiana de Facultades de Terapia Respiratoria (ACOLFATER) y el Colegio Colombiano de Terapia Respiratoria (COCOLTER) anรกlisis plasmado en la figura 3 a continuaciรณn

 6HJXLPLHQWR GH ORV IDFWRUHV GH ULHVJR GH HQIHUPHGDGHV GH WUDFWR VXSHULRU LQIHULRU HQ PHQRUHVGHDxR

 9LJLODQFLD \ SUHYHQFLyQ  GH ,QIHFFLyQ 5HVSLUDWRULD DJXGD HQQLxRVPHQRUHVGHDxRV  &UHDU XQLGDGHV  GH  DWHQ FLRQ HQ VDOXG UHVSLUDWR ULDORFDOHV

$GPLQLVWUDFLyQ \ JHVWLyQHGXFDWLYD GH 6DODV (5$ HQ SULPHU QLYHO GH DWHQFLyQ GH DFXHUGR FRQ OR HVWDWXLGR SRU HO &RPLWp GLVWULWDO GH HQIHUPH GDGHV UHVSLUDWRULDV GH OD 6HFUH WDULDGH6DOXGGHO'LVWULWR

(QFRQFRUGDQFLDFRQ ORV HVWDWXWRV GHO FRPLWH GLVWULWDO GH HIHUPHGDGHV UHVSLUDWR ULDVOD6'6$&2/$7(5 &&2/7(5

Figura 3. 5HSUHVHQWDFLRQHV VRFLDOHV GH ORV SURIHVLRQDOHV GH GLYHUVDV iUHDV TXH ODERUDQ FRQ SHUVRQDVGHVSOD]DGDVHQ%RJRWiIUHQWHDO5RODGPLQLVWUDWLYR\JHVWRUGHSODQHV\SURJUDPDVHQ VDOXGUHVSLUDWRULDHQSHUVRQDVHQFRQGLFLyQGH'HVSOD]DPLHQWRIRU]DGRHQ&RORPELD

Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina


66

Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero

Se exhibe a continuación en la figura 4 la representación social de los profesionales que en la actualidad atienden personas en condición de desplazamiento forzado respecto de la categoría rol docente e investigador cuya estructura metodológica contiene en su núcleo central las actividades de docencia e investigación en salud respiratoria y los elementos periféricos

incorporados por los sujetos entrevistados y resultado del proceso de codificación axial y selectiva se obtiene como elementos periféricos el trabajo cooperativo con instituciones de educación superior, creación de grupos y líneas en investigación sobre salud respiratoria en personas en condición de desplazamiento forzado

Figura 4. 5HSUHVHQWDFLRQHV VRFLDOHV GH ORV SURIHVLRQDOHV GH GLYHUVDV iUHDV TXH ODERUDQ FRQ SHUVRQDVGHVSOD]DGDVHQ%RJRWiIUHQWHDO5ROUHIHUHQWHDDFWLYLGDGHVGHGRFHQFLDHLQYHVWLJDFLyQ HQVDOXGUHVSLUDWRULDHQSHUVRQDVHQFRQGLFLyQGH'HVSOD]DPLHQWRIRU]DGRHQ&RORPELD

En la figura numero 5 expone las Representaciones Sociales de los profesionales sujetos de estudio respecto de los roles del Terapeuta Respiratorio en la asistencia de personas en condición de desplazamiento forzado en Colombia ; en cuyo núcleo central acompasa resumidamente el requerimiento en la creación de entidades u organismos no gubernamentales en salud respiratoria dirigidos a estas personas en condición de vulnerabilidad, los elementos periféricos secundarios son la cobertura y protección al derecho a la salud del menor y el anciano deslazado, el liderazgo del terapeuta respiratorio en la creación de programas dirigidos a la comunidad vul-

nerada, vigilancia epidemiológica en grupos críticos con asentamiento en la capital, hallazgo de focos de infección respiratoria y las practicas establecidas por la población vector, establecer un modelo de pedagogía popular acerca de las medidas de prevención de la enfermedad respiratoria en menores de 5 años y en ancianos, generar conferencias informativas en la ONG acerca del sistema de salud, los servicios, las redes y la accesión a los mismos. De igual forma crear desde a ONG un observatorio pedagógico en asocio con las universidades para el seguimiento del caudal sintomático en la población en condición de desplazamiento forzado con asentamiento en la capital.

Figura 5. 5HSUHVHQWDFLRQHV VRFLDOHV GH ORV SURIHVLRQDOHV GH GLYHUVDV iUHDV TXH ODERUDQ FRQ SHUVRQDVGHVSOD]DGDVHQ%RJRWiIUHQWHDO5ROGHFUHDFLyQGH21*CVGLULJLGDVDSHUVRQDVHQ FRQGLFLyQGH'HVSOD]DPLHQWRIRU]DGRHQ&RORPELD

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Rol del terapeuta respiratorio frente al desplazamiento forzado en Colombia: Aproximacion a sus representaciones sociales

DISCUSION El fenómeno del desplazamiento forzado en Colombia ha surgido desde épocas, aun con los primeros pobladores de diferentes territorios dado por el movimiento de personas de un departamento a otro, producido por diversos factores generadores del mismo: entre los cuales se encuentran el conflicto armado, amenazas y violación de los derechos humanos, el narcotráfico, y la presencia de grupos al margen de la ley, el desempleo, la exclusión social, el analfabetismo entre otros (CONGRESO DE COLOMBIA. Ley 387de 1997). (MENCOLDES, 2003). Se analiza en cuanto al fenómeno del desplazamiento que es una figura persistente en el país, en lugar de mitigarse con las acciones sociales del estado, al contrario se recrudece aun mas y se acrecienta como una inmensa bola de nieve; y en consecuencia los profesionales del área de la salud deben repensar la ejecución de sus prácticas dirigidas al común de los sujetos del área urbana, pero esta situación de inmigración ha hecho reevaluar el norte de la aplicación de la terapia farmacológica y no farmacológica (GAD Grupo de Apoyo a Organizaciones de Desplazados, 2000). La metodología aquí presentada resalta un enfoque de representaciones sociales, inquiriendo analizar y relacionar los datos obtenidos con la construcción textual hecha por las organizaciones y entidades privadas y públicas respecto de la proyección social del terapeuta respiratorio en personas en condición de desplazamiento forzado en Colombia. En aplicaciones reales, debido a que las instituciones de salud que se dedican especialmente a la atención al desplazado son pocas y que los profesionales tienen conocimientos insuficientes acerca de la problemática, en este trabajo se abordaron a otros profesionales de la salud a fin de intentar representar una visión más real de la dificultad. Este trabajo ha mostrado las limitaciones de atención a las que se enfrenta el profesional a la hora de revolverse una problemática social, resumiéndose los resultados de esta forma. Existen falencias en la formación investigativa dirigida al profesional y no hay motivación suficiente para que éste genere estudios y estrategias frente a situaciones reales de conflicto social. Esto haya su razón en que su plan de estudios se enfoca en la práctica asistencial, más no en la creación de investigaciones, teorías o prácticas novedosas. Esto se hace más evidente en la existencia de artículos y parámetros científicos de otras profesiones del

67

área de la salud, mientras que en Terapia Respiratoria no se encuentran formulaciones acerca de hechos científicos o ponencias que reflexionen o generen nuevas propuestas acerca del tema. Es necesario ampliar el campo de acción de los Terapeutas Respiratorios mediante incentivos que le permitan romper los límites de la atención asistencial y convertirse en profesionales integrales que no sólo traten, sino que también prevengan y generen nuevas propuestas dinámicas frente al desplazamiento en el país El desplazamiento forzado en Colombia desde tiempos remotos por diversos factores relacionados con el conflicto armado en el que se ha sumido el país; los problemas económicos, culturales y sociales que generan pugnas interpersonales, así como maltrato, la violencia intrafamiliar, problemas de hacinamiento y otras afecciones que de una u otra forma alteran la salud respiratoria del individuo obligando al cuidado respiratorio a brindar a este grupo un importante tratamiento como vigilancia de los síntomas; reto para los profesionales del área de la salud respiratoria, especialmente a los Terapeutas Respiratorios, debido a los altos índices de morbimortalidad causada por enfermedades respiratorias que se presentan en este cuadro social. Las representaciones sociales de los profesionales objetos de estudio señala que debido a la formación integral del profesional en Terapia Respiratoria estos podrían brindar una atención integral basada en promoción de la salud y prevención de enfermedades respiratorias en esta población vulnerable; a su vez el Terapeuta Respiratorio, interactúa colectivamente con diversas disciplinas en la generación de impactos globales en multiplicidad de tareas sociales, donde no se hacen distinciones diferenciadoras de su especialidad, es decir el terapeuta respiratorio como cualquier otro profesional está invitado a incorporarse a las actividades que legalmente adopta el estado colombiano en pro de la protección constitucional de los derechos fundamentales de los desplazados en el país, siendo un garante permanente de los preceptos legales consignados en la constitución, leyes, decretos, resoluciones, estatutos societarios. El terapeuta respiratorio posee potestad para aplicar sus conocimientos al servicio de la comunidad desplazada, según las representaciones sociales referidas en la presente investigación, ya que la única forma de penetrar los problemas de salud respiratoria de los sectores de la sociedad es desplegando el abanico

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


68

Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero

de posibilidades de atención sobre esta población es a través de la extensión donde la comunidad cumpla con el numeral 5 del estatuto orgánico de la Asociación Colombiana de Facultades de terapia respiratoria. La investigación cualitativa es un método abierto a la descripción de un determinado proceso en que de forma exhaustiva se siguen los hechos que rodean un grupo humano específico acerca de una temática emergente y de interés al investigador, reflexionándose como necesidad académica el hacer hincapié en la preparación por parte de los Terapeutas Respiratorios en técnicas y enfoques cualitativos, ya que se observo falencias metodológicas derivadas de la ignorancia procedimental del modelo cualitativo. Sin embargo a pesar de los tropiezos intelectuales, se puede llegar al consenso de las representaciones sociales para el caso particular motivo de estudio que los principales roles del Terapeuta Respiratorio, además de la atención asistencial, son: enseñanza, prevención de las enfermedades respiratorias y promoción de la salud, creación de proyectos dirigidos a la salud ocupacional y participación en grupos investigativos en los diferentes entornos que rodean a este profesional. El espacio a estas funciones sólo las puede iniciar el profesional para incursionar en ellas y progresar, caracterizándose no como funcionario asistencial sino como un experto integral adaptando los atributos proyectándolo a la planificación, ejecución, control y evaluación del abanico de roles entronizados en la sociedad. SUGERENCIAS De la manera más respetuosa se sugiere a la comunidad académica de terapeutas respiratorios en formación y profesionales del área, el reconocer en la investigación cualitativa un semblante posible y seguro de reconocer sus prácticas y acercarse a una realidad desde la subjetividad; ha sido cotidianamente aprendido y enseñado en las escuelas los modelos estrictos cuantitativos de valoración de fenómenos patológicos aislados, pero que NO tocan las fibras más recónditas de las necesidades en salud respiratoria de la población colombiana en general y más aun cuando esta es inmigrante por factores adversos a su voluntad. El desarrollo repetitivo de modelo de investigación cualitativo en terapia respiratoria favorece desde sus diverso enfoques el descubrir teorías constructivas

dentro de un universo lógico de la interpretación de los perfiles de acción de los Terapeutas respiratorios más aun cuando la concepción antropocéntrica, los usos, costumbres y valores de la sociedad han cambiado y aun mas cuando el concepto del eje salud enfermedad ha sido trasformado por condiciones como la violencia, el conflicto, la marginación y la guerra; siendo presuntamente ambicioso para los terapeutas respiratorios construir su lex artis sobre realidades y no sobre imaginarios y cortas u ausentes experiencias clínicas. De otro lado, los principios rectores de la educación superior impone la planificación, ejecución, evaluación y control de actividades tendientes la proyección social, siendo la mejor oportunidad para que los programas de terapia respiratoria empoderen sus herramientas intelectivas en pro de favorecer con los resultados de investigación social en salud respiratoria a un grupo poblacional tan frágil como lo son los desplazados por el conflicto armado en Colombia cuyos asentamientos están en la ciudad capital, donde se concentra el mayor número de escuelas de formación de terapeutas respiratorios, sin olvidar que los servicios en salud no son para las elites sino para los habitantes del territorio en toda su extensión. Finalmente, los programas de Terapia Respiratoria deben procurar en lo posible en incorporar acciones educativas de extensión en el que se apliquen integralmente los roles y perfiles de su quehacer en beneficio de las personas en condición de desplazamiento forzado cuyo asentamiento ha sido la ciudad capital, en donde se encuentran las facultades actualmente. Para ser reconocida y legitimada una profesión debe en lo posible estudiar y analizar sus prácticas bajo modelos sencillos, expeditos y económicos como los aportados por los enfoques de investigación cualitativa, en pro de enriquecer la lex artis, re ingeniar los próximos objetos de formación y vivir a la vanguardia de una sistematización menos convencional al recurrir a elementos más lógicos de teorización del quehacer profesional a través de los métodos inductivos. Agradecimientos Las autoras rinden especial reconocimiento a la comunidad de terapeutas respiratorios de la nación por su persistencia e insistencia en mantener la formación académica en el país; agradecen al programa de terapia respiratoria de la Fundación Universitaria

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Rol del terapeuta respiratorio frente al desplazamiento forzado en Colombia: Aproximacion a sus representaciones sociales

del Área Andina y a la Asociación Colombiana de Facultades de terapia respiratoria ACOLFATER, por la cooperación y solidaridad administrativa al facilitar las fuentes bibliográficas constitutivas del marco teórico y conceptual para desarrollo de este proyecto. REFERENCIAS Abric, J. (2001) Prácticas sociales y representaciones. Filosofía y cultura contemporánea. México: Ediciones Coyoacán. . Berger, P. Luckman (1998) T. La construcción social de la realidad. Buenos Aires: Amorrortu edit. 1998. ACOLFATER ( 2003) Estatutos y políticas. Fundación universitaria del Área Andina.. CONGRESO DE COLOMBIA. Ley 387de 1997. Publicado en Diario Oficial (en línea). Colombia: Senado de la República. 24 de julio de 1997 (citado en 9 de octubre de 2008). Recuperado de: http://www.secretariasenado.gov. co/leyes/L0387_97.HTM

69

MENCOLDES (2003). Análisis de la política y ruta de atención a la población en situación de desplazamiento en Bogotá. Mesa de trabajo de Bogotá sobre desplazamiento interno [en línea]. Colombia: Salud y Desplazamiento. Junio Recuperado de: www.disaster-info.net/desplazados/informes/mencoldes/06/04analisis.htm. (citado 9 de octubre de 2008). Mendieta, G, Salamanca, y , Sánchez, A. (2008). Representaciones sociales. Revista Teoría y praxis investigativa. 3 (2).30-37. Mogollón(2003). Necesidades en salud de la población Desplazada por conflicto armado en Bogotá. En: Revista Española de Salud Pública. Vol. 77. No 2. Marzo-Abril. Valencia (2001). Compilación sobre desplazamiento. Normas, Doctrinas y jurisprudencia nacional e internacional. Bogotá D.C. Diciembre de. Pág. 37, 38, 443. REFERENCIAS BIBLIOGRAFICAS COMPLEMENTARIAS

Facultad de ciencias de la salud (1993). Terapia Respiratoria [en línea]. Colombia: Uniboyaca. 26de mayo de 1993 (citado en 8 de octubre de 2008). Recuperado de: www.uniboyaca.edu. co/TerRespir.htm

Castillo O. O. (2005) Poblaciones en situación de desplazamiento forzado en Colombia. Una revisión de las cifras del sistema de información ‘RUT’. En: Cuadernos de Desarrollo Rural [en línea]. Recuperado de: <http://redalyc. uaemex.mx/redalyc/src/inicio/ArtPdfRed. jsp?iCve=11705503> ISSN 0122-1450

GAD (Grupo de Apoyo a Organizaciones de Desplazados). (2000).Informe sobre desplazamiento forzado en Colombia [en línea]. Colombia: Equipo Nizkor y Derechos Derechos Human Rights. Marzo. Recuperado De: http://www. derechos.org/nizkor/colombia/doc/gad1e. htm(Citado 9 de octubre de 2008).

Ramos, R. (2008) Trabajo de investigación. Ciencia (en línea). México: Universidad Atenas Veracruzana. 20 de septiembre de 2008 (citado en 9 de octubre de 2008). Recuperado de: http://virtual.uav.edu.mx/tmp/13852312200908.doc

Giménez, G. (1997) Materiales para una teoría de las identidades sociales. En Frontera Norte. México. Vol. 9. No.18 Julio-Diciembre de 1997.

CODHES (Consultoría para los derechos humanos y el desplazamiento). (2006). Cifras Codhes (en línea). Colombia: Codhes. 15 de febrero de 2006 (citado en 9 de octubre de 2008) Recuperado de: www.acnur.org/país/docs/943.pdf

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Paola Arias Colina, Leidy Becerra, Claudia Liliana Cruz Moya, Diana Quintero

REVISIONES BIBLIOGRAFICAS

70

Micotoxinas y Aflatoxina B1, un problema en salud animal Hansen Wilber Murcia Rodríguez

Polihidroxialcanoatos (PHAs): Biopolímeros producidos por microorganismos. Una solución frente a la contaminación del medio ambiente Julieth Yadira Serrano Riaño

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


71

Micotoxinas y Aflatoxina B1, un problema en salud animal Micotoxins and Aflatoxin B1, a animal health problem Hansen Wilber Murcia Rodríguez1

Resumen Las micotoxinas son metabolitos secundarios producidos por algunas cepas de hongos micotoxigénicos que crecen sobre diferentes tipos de granos utilizados en alimentación de animales de producción. Al momento de ser ingeridas estas toxinas son metabolizadas por un tipo de enzimas llamadas citocromo P450 (CYP450), una familia de enzimas relacionadas con la biotransformación de productos endógenos y xenobióticos. Una de las más importantes micotoxinas se conoce como aflatoxina B1 (AFB1). El producto de biotransformación de la AFB1 es una molécula altamente reactiva conocida como AFB1-8,9-epóxido (AFBO). Este producto es capaz de reaccionar con proteínas y ADN produciendo efectos citotóxicos y mutagénicos. Esto se ve representado en problemas en la salud animal y humana. Palabras clave: Aflatoxina B1, micotoxinas, salud animal, hongos micotoxigénicos, Aflatoxina B1 epóxido. Abstract Mycotoxins are secondary metabolites produced by some fungi mycotoxigenic strains that are able to grow on different kinds of production animal feedstuff. When ingested, these toxins are metabolized by cytochrome P450 enzymes (CYP450), a family of enzymes related with biotransformation of endogenous and xenobiotic molecules. One of the most important mycotoxins is known as aflatoxin B1 (AFB1) and its biotransformation product is known as AFB1-8,9-epoxide (AFBO). This enzymatic product is able to react with cellular proteins and DNA causing cytotoxic and mutagenic effects, producing great animal and human health consequences. Key words: Aflatoxin B1, micotoxins, animal health, micotoxigenic fungi, epoxic Aflatoxin B1.

1

hmurcia@areandina.edu.co

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


72

Hansen Wilber Murcia Rodríguez

INTRODUCCIÓN Las Micotoxinas Las micotoxinas surgen como compuestos de interés toxicológico luego de descubrirse su rol como agentes etiológicos de la “enfermedad X” de los pavos reportada en los años 60. Esta enfermedad asociada al consumo de una harina de maní procedente de Brasil causó la muerte de más de 100.000 pavitos en Inglaterra. Con el tiempo se descubrió que ciertas sustancias tóxicas aisladas del alimento causaron dicha enfermedad. Estas sustancias se denominaron “aflatoxinas” ya que el principal hongo productor de estas resultó ser Aspergillus flavus (Sargeant, Sheridan, O`Kelly & Carnaghan, 1961). Después de las aflatoxinas se descubrieron otras micotoxinas entre las cuales se incluyen los tricoticenos, la ocratoxina A, la zearalenona y hacia finales de la década de los noventa un grupo de micotoxinas producidas por hongos del género Fusarium a las cuales se les dio el nombre de fumonisinas (Bezuidenhout et al, 1988). La habilidad de las micotoxinas para inducir varios tipos de cáncer en animales domésticos y de experimentación constituye una gran preocupación para la salud pública. En 1993 la Agencia Internacional de Investigación sobre el Cáncer clasificó las micotoxinas de acuerdo a su carcinogenicidad, encontrando micotoxinas clasificables en el grupo 1 correspondientes a compuestos carcinógenos para humanos (como la aflatoxina B1), en el grupo 2 correspondiente a compuestos posiblemente carcinógenos para humanos (aflatoxina M1, ocratoxina, fumonisina B1) y en el grupo 3, correspondiente a compuestos no carcinógenos para humanos (como zearalenona y tricoticenos) (Lesson et al., 1995). Teniendo en cuenta que los metabolitos primarios son aquellas moléculas sintetizadas durante el crecimiento del hongo, las micotoxinas son metabolitos secundarios producidos cuando la fase de crecimiento termina o cuando hay deficiencias en nutrientes esenciales. Bajo estas condiciones los procesos de síntesis se encaminan hacia la producción de pigmentos, antibióticos y micotoxinas, los cuales son excretados de manera abundante durante la fase estacionaria de crecimiento del hongo. Cuando las micotoxinas son producidas en granos o alimentos destinados a la alimentación de animales o humanos se convierten en un peligro potencial tanto para la salud humana como para la salud y producción animal (Díaz, 1995). Hasta el 2004 se habían detectado y clasificado como micotoxinas más de 300 metabolitos secundarios provenientes de hongos filamentosos. Estas sustancias son producidas principalmente por los géneros Aspergillus, Penicillium y Fusarium. Se conoce que estos compuestos causan enfermedades severas incluyendo ciertos tipos de cáncer, dismi-

nución de la respuesta inmune, e hiperestrogenismo, entre otras (Bünger et al., 2004). Después de haberse descubierto el efecto carcinogénico de las aflatoxinas, la búsqueda de micotoxinas ha llevado a la identificación de más de 10 tipos de hongos toxigénicos, cuya genética y metabolismo han sido descritos recientemente. Debido a esto se han generado diferentes estrategias para inactivar o disminuir el impacto de la presencia de micotoxinas, en especial de las aflatoxinas, en los lugares de almacenamiento (Tabla 1) (Groopman, Kensler & Wild, 2008). Diferentes factores afectan el crecimiento de los hongos toxigénicos, clasificándose estas condiciones en intrínsecas y extrínsecas. Las condiciones intrínsecas hacen referencia a las condiciones del sustrato sobre el cual crece el hongo e incluyen la composición de carbohidratos, grasas, proteína, macro y microelementos, entre otros. Además de la composición del grano existen otros factores como la actividad del agua (Aw), pH y potencial de óxido-reducción (Díaz, 1996a). Los factores extrínsecos están relacionados con la atmósfera en la cual se encuentra almacenado el grano y puede crecer un hongo toxigénico como humedad de la atmósfera de almacenamiento (óptima >70%), temperatura atmosférica la cual varia de acuerdo al hongo y adecuado suministro de oxígeno, el cual no es un factor limitante en condiciones normales de almacenamiento (Díaz, 1996a). Por lo general se afectan sustratos como el maíz, el trigo, el sorgo, la torta de algodón, la cebada y el maní (Díaz, 1996b). Los hongos toxigénicos se clasifican de acuerdo con el momento de infección en hongos de campo (fitopatogénicos) que infectan las plantas antes de la cosecha y hongos de almacenamiento (saprofíticos) que invaden los granos almacenados. Dentro del primer grupo se encuentran los géneros Fusarium (el más común), Alternaria, Cladosporium, Helminthosporium, Pullaria y Aspergillus. Entre los hongos saprofíticos los géneros más importantes son Aspergillus y Penicillium (Díaz, 1996a). Es importante anotar que la presencia del hongo toxigénico en un sustrato no implica por necesidad la existencia de micotoxinas. Esto se debe a que generalmente solo un pequeño porcentaje de las cepas de hongos posee la capacidad genética de sintetizar micotoxinas y a que la producción de estos metabolitos ocurre solo bajo estrictas condiciones ambientales que no siempre se cumplen (Díaz, 1996a).

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Micotoxinas y Aflatoxina B1, un problema en salud animal

73

Tabla 1(VWUDWHJLDVSDUDUHGXFLUODH[SRVLFLyQ\HOULHVJRGHSUHVHQFLDGH

DIODWR[LQDV $GDSWDGRGH*URRSPDQHWDO  Tipo de intervenciĂłn

Enfoque

Resultado

3ULPDULR

&RQGLFLRQHVGH DOPDFHQDPLHQWRSRV FRVHFKD

5HGXFFLyQHQODH[SRVLFLyQ DDIODWR[LQDVPHGLGRSRUOD UHGXFFLyQGHORVQLYHOHVGH  DGXFWRVDIODWR[LQDDOE~PLQD

3ULPDULR

$JHQWHVDGVRUEHQWHV DOXPLQRVLOLFDWRV 

5HGXFFLyQHQODH[SRVLFLyQ DDIODWR[LQDHQDQLPDOHV PRGHOR\HQVD\RVFOtQLFRV

3ULPDULR

&ORURILOLQD

(ILFDFLDGHPRVWUDGDHQ PRGHORVH[SHULPHQWDOHV\ XQGHUHGXFFLyQHQ DGXFWRVDIODWR[LQD$'1 XULQDULRVHQHQVD\RVFOtQLFRV KXPDQRV

6HFXQGDULR

3ROLIHQROHVGHWpYHUGH

3UHYHQFLyQGHFiQFHU GHPRVWUDGRHQUDWDV\ UHGXFFLyQGHELRPDUFDGRUHV GDxRR[LGDWLYRDO$'1 HQ HQVD\RVFOtQLFRV

6HFXQGDULR

'LWLROHWLRQHV ROWLSUD] 

(ILFDFLDGHPRVWUDGDHQOD SUHYHQFLyQGHWXPRUHV KHSiWLFRVHQUDWDV\PRGX ODFLyQGHELRPDUFDGRUHV SDUDDIODWR[LQDSUHGLFLHQGR HOHIHFWRSURWHFWRUVHJ~Q HQVD\RVFOtQLFRV

%URWHVGHEUyFROL VXOIRUDIDQR

3UHYHQFLyQGHFiQFHUHQ PRGHORVPXULQRV5HGXF FLyQGRVLVGHSHQGLHQWHGH DGXFWRVDIODWR[LQD$'1HQ HQVD\RVFOtQLFRVKXPDQRV

6HFXQGDULR

Aflatoxinas Las aflatoxinas (AF) son un grupo de metabolitos heterocĂ­clicos sintetizados por algunas cepas de Aspergillus flavus y Aspergillus parasiticus. La palabra aflatoxina se deriva del principal hongo productor de esta (Aspergillus flavus) y del sufijo toxina. Los Aspergillus son generalmente hongos de almacenamiento y por lo comĂşn no contaminan los granos antes de la cosecha, sin embargo, condiciones de estrĂŠs en las plantas y daĂąo producido por insectos pueden dar lugar a la infecciĂłn a nivel de campo y a la producciĂłn de AF en los granos aĂşn no cosechados (DĂ­az, 1996b). Estudios realizados por el Laboratorio de ToxicologĂ­a de la Facultad de Medicina Veterinaria y Zootecnia de la Universidad Nacional de Colombia demostraron la presencia de varias especies del gĂŠnero Aspergillus spp. en muestras de maĂ­z y mazorca tomadas en la regiĂłn del atlĂĄntico colombiano, donde se encontraron niveles muy altos de aflatoxinas, en especial la B1 y la B2. Al parecer la gran producciĂłn de estas micotoxinas y gran incidencia de hongos aflatoxigĂŠnicos se encontraron relacionadas con aspectos medioambientales como elevadas precipitaciones, plagas y di-

versidad de hongos aflatoxigĂŠnicos y cepas presentes con gran capacidad de sĂ­ntesis de aflatoxinas (AcuĂąa, DĂ­az & Espitia 2005), demostrando la importancia de las condiciones tanto macro como microambientales para el crecimiento de hongos micotoxigĂŠnicos y la producciĂłn de micotoxinas. En otro estudio se corroborĂł la prevalencia del gĂŠnero Aspergillus spp. en granos de maĂ­z y algodĂłn, en especial las especies A. flavus y A. parasiticus, este Ăşltimo capaz de producir las cuatro aflatoxinas de ocurrencia natural (B1, B2, G1 y G2) (DĂ­az, Lozano & AcuĂąa, 2009). Hasta el momento se han identificado cerca de 18 tipos de aflatoxinas, siendo las Ăşnicas que se presentan de manera natural la B1, B2, G1 y G2, mientras las demĂĄs aflatoxinas como M1, M2, P1, Q1, aflatoxicol, etc. se presentan como productos del metabolismo (productos de biotransformaciĂłn) de sistemas microbianos o animales. La existencia de cepas aflatoxigĂŠnicas de Aspergillus spp. y presencia de aflatoxinas ha sido reportada en los cinco continentes (DĂ­az, 1996b) donde se han hecho grandes esfuerzos por controlar tanto el crecimiento del hongo toxigĂŠnico como de la producciĂłn de la micotoxina (DĂ­az et al., 2009; Felix D` Mello, Macdonald, Postel, Dijksma, Dujardin, & Placinta., 1998).

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


74

Hansen Wilber Murcia RodrĂ­guez

Efectos De La Afb1 En La Salud Animal AdemĂĄs de los efectos carcinĂłgenos se conocen efectos adversos de las micotoxinas en la salud en general tanto de animales de producciĂłn como mascotas. Dentro de los sĂ­ntomas se encuentran la reducciĂłn en la ganancia de peso, efectos adversos en la reproducciĂłn, daĂąo al sistema inmunolĂłgico, sĂ­ntomas severos de intoxicaciĂłn e incluso muerte cuando la dosis de micotoxina es demasiado alta (Hussein & Brasel, 2001; Leeson , Diaz & Summers, 1995). Diferentes estudios han demostrado los efectos adversos sobre el sistema inmune de pollos en estadios tempranos del desarrollo (Qureshi, Brake, Hamilton, Hagler, & Nesheim, 1998) y efectos hematolĂłgicos y hepĂĄticos significativos a altas concentraciones en adultos (Del Bianchi, Oliveira, Albuquerque, Guerra & Correa, 2005) y durante el desarrollo, evaluando su efecto en enzimas sĂŠricas, renales y hepĂĄticas (Quezada, Cuellar, Jaramillo-JuĂĄrez, Valdivia & Reyes, 2000). TambiĂŠn se han presentado efectos

hepatotĂłxicos a altas concentraciones en codornices (Oliveira et al. 2002), ademĂĄs de afectar la producciĂłn de huevos (Ogido et al., 2004). Dentro de las aflatoxinas, la AFB1 se encuentra como un compuesto altamente tĂłxico para la mayorĂ­a de las especies y en especial aquellas muy susceptibles como la trucha arco iris, los gatos o los patos. En ensayos in vitro la toxicidad de la aflatoxinas G1, B2 y G2 es aproximadamente 50, 20 y 10% de la que presenta la AFB1, respectivamente. Existen diferencias de susceptibilidad entre animales de diferentes especies frente a la AFB1. Los animales mĂĄs susceptibles son el pato, el conejo y el gato, mientras que los mĂĄs resistentes son el pollo, ratĂłn, hĂĄmster y rata (Tabla 2). En las aves la susceptibilidad varĂ­a teniendo como mĂĄs susceptibles a los patos, seguido de los pavos, gansos, faisanes y los pollos como la especie aviar menos afectada. A su vez los animales jĂłvenes son mĂĄs susceptibles que los adultos y las hembras mĂĄs resistentes que los machos (DĂ­az, 1996b).

Tabla 2. '/RUDODJXGDGH$)%HQGLIHUHQWHVHVSHFLHV $GDSWDGRGH'tD]E  Especie



&RQHMR

DL50 (mg/kg)  

3DWLWR



*DWR



&HUGR



7UXFKDDUFRLULV LQWUDSHULWRQHDO

 3HUUR



&RED\R



2YHMD



0LFR



3ROOLWR



5DWyQ



+iPVWHU



5DWD



AlteraciĂłn del Adn y Carcinogenicidad La AFB1 se bioactiva a travĂŠs de las citocromos P450 a un metabolito electrofĂ­lico altamente reactivo e inestable que una vez formado reacciona con macromolĂŠculas, especialmente con el ADN (produce alquilaciĂłn del ADN). Este metabolito, conocido como aflatoxina-8,9-epĂłxido (AFBO) es capaz de unirse a los residuos de guanina de los ĂĄcidos nucleicos causando alteraciones irreversibles que pueden



llevar a carcinogenicidad, mutagenicidad y teratogenicidad (Do & Choi, 2007; Eaton & Gallager, 1994; Ferguson & Philpott, 2008; Verma, 2004). La biotransformaciĂłn de la AFB1 se inicia en las enzimas citocromo P450 (CYP450) donde sufre oxidaciĂłn a AFBO. La forma epĂłxido puede conjugarse con glutatiĂłn para continuar con la vĂ­a de detoxificaciĂłn o ser hidrolizada por una epĂłxido hidrolasa para generar un hidrodiol (AFB1-8,9-dihidrodiol o dhd-AFB1), el cual puede reaccionar fuertemente con proteĂ­nas

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


75

Micotoxinas y Aflatoxina B1, un problema en salud animal

y tener efectos citotรณxicos. En los casos en que el epรณxido llega a conjugarse con glutatiรณn, o la AFB1 no sufre epoxidaciรณn sino adiciรณn grupos OH- y pos$IODWR[LQD%

terior conjugaciรณn con acido glucurรณnico o sulfato, los efectos tรณxicos de la molรฉcula se ven neutralizados (Figura 1) (Eaton & Gallagher, 1994).

0HWDEROLWRVKLGUR[LODGRV &<3 V

/LSR[LJHQDVD V

3+6

8'3*767 *OXFXUyQLGRV\FRQMXJDGRV FRQVXOIDWR

$IODWR[LQD%HSy[LGR H[RHQGRHVWHURLVyPHURV *67 V

$GXFWRV GH$'1

5HSDUDFLyQ GHO$'1

(Sy[LGR KLGURODVD" 0XWDFLRQHV

&RQMXJDGRV*6+

'LKLGURGLRO

8QLyQDSURWHtQDV &$1&(5

0XHUWHFHOXODU

7R[LFLGDG

 Figura 1. 5XWDVGHELRWUDQVIRUPDFLyQGHOD$)% 0RGLILFDGRGH(DWRQ\ *DOODJKHU &<3 V FLWRFURPR3 V 3+6SURVWDJODQGLQD+VLQWDVD *67 V JOXWDWLyQ6WUDQVIHUDVD V 8'3*7 V 8'3JOXFXURQRVLOWUDQVIHUDVD V 67 VXOIRWUDQVIHUDVDV

tratos รณptimos para epoxidaciรณn, como la AFM1, AFQ1 (Figura 2) (Gallagher, Kunze, Stapleton & Eaton, 1996; Guengerich et al., 1998; Guengerich, Johnson, Ueng, Yamazaki & Shimada, 1996).

Se han reconocido que tanto la CYP1A2 como la 3A4 son capaces de oxidar la AFB1 tanto a formas reactivas que incluyen la AFB1 endo-8,9-epรณxido y AFB1 exo-8,9-epรณxido (forma mas toxica del epรณxido), como a productos no activos que no son sus-

2

2

2 2+ 2 2

2

2 2

+  

+

2 $)0



2

+ 2+



D

2

2

2

2&+

+

2&+ 2 + D

2

$)% 2

2&+

2 $)4 2

2 2 2

+

2 2

+ 2

2 +

2

+

2&+



2

2&+

$)%H[RR[LGH

$)%HQGRR[LGH

Figura 2.3URGXFWRVGHR[LGDFLyQGHOD$)% 7RPDGRGH*XHQJHULFKHWDO 

Revista TEORรA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigaciรณn y Desarrollo โ€ข CID / Fundaciรณn Universitaria de รrea Andina


76

Hansen Wilber Murcia Rodríguez

Bioactivación de la Afb1 En Aves y Mamíferos El hecho de que se presenten diferentes tipos de citocromos P450 capaces de transformar la AFB1 a formas reactivas (fase I de detoxificación), además de una pobre conjugación de estas formas reactivas con glutatión o sulfatos (fase II de detoxificación) hace que diferentes especies de aves y de mamíferos presenten diferentes niveles de susceptibilidad. En la mayoría de las especies de mamíferos la biotransformación de la AFB1 ocurre a través de citocromos P450, encontrándose a las citocromo 1A1, 2A3, 2B7, 2C8, 2K1 y 3A3/4 implicadas en la activación hepática y producción de AFBO (Klein et al., 2003). En humanos se han reportado estas mismas citocromos como agentes bioactivadores de la AFB1 (Doi, Patterson, Gallagher, 2002; Omiecinski, Remmel &Hosagrahara,1999) al igual que a la CYP2A6 (Pelkonen, Rautio, A., Raunio, H. & Pasanen, 2000). Las enzimas citocromo P450 aviares parecen ser del mismo tipo de aquellas encontradas en mamíferos, incluyendo la especie humana. Por ejemplo, estudios realizados por Nebbia, Dacasto, Rossetto, Giuliano y Carletti en el 2003 demostraron la presencia de CYP2B1, 3E1, 1A1 y 3A4 en pollos. Asi mismo, Gorman, Walton, Sinclair y Sinclair en el año de 1998, realizando “immunoblots” de microsomas extraídos de embriones de pato y pollo identificaron otólogos aviares CYP1A1, 1A2, 1A4 y 1A5. En pavos, especie altamente sensible a los efectos adversos de las aflatoxinas se ha atribuido el efecto tóxico a la actividad de las enzimas CYP1A1 y 3A4, capaces de biotransformar la AFB1 a su forma epóxido (Klein, Buckner, Kelly & Coulombe, 2000). En esta especie se ha demostrado que el efecto es más pronunciado en aves jóvenes que en adultas y se ha demostrando que cantidades relativamente bajas de AFB1 presentes en el alimento pueden llegar a causar efectos deletéreos (Klein, Van Vleet, Hall & Coulombe, 2002). También se ha encontrado un ortólogo aviar de la citocromo 1A5 humana que ha presentado actividad metoxiresorufin O-dealquilasa y oxidación del AFB1 (Yip & Coulombe Jr., 2006), lo cual ayuda a explicar la alta susceptibilidad de los pavos, ya que el efecto de la aflatoxina depende de su oxidación a la forma exo-epóxido. En embriones de pollos como de patos y pavos se ha demostrado actividad EROD (etoxiresorufin ortodeetilasa), los cual indica la presencia de citocromos 1A que no necesariamente corresponden a ortólogos

a los de mamíferos, pero que presentan una actividad enzimática similar (Brunström & Halldin, 1998). Yip y Coulombe en el 2006 demostraron la presencia de un ortólogo de pollos en pavos, la CYP1A5, con capacidad tanto de oxidar la AFB1 a su forma epóxido como de producir AFM1. En patos, pollos, pavos y codornices se demostró la capacidad de biotransformación de la AFB1 a su forma AFBO (Lozano & Díaz, 2005), pero no se determinó cual o cuales de los ortólogos aviares eran los responsables de la transformación de la aflatoxina a su forma epóxido. Aunque las aflatoxinas y sus efectos tóxicos se conocen desde los años sesenta (Newberne & Butler; 1969; Patterson, 1973), las enzimas responsables de su metabolismo en algunas especies de mamíferos y en muchas especies aviares (especialmente pollos, patos, pavos y codornices) no han sido caracterizadas de manera completa. Por esto es necesario investigar cuales enzimas de la superfamilia de las citocromos P450 son las responsables del metabolismo y bioactivación de la AFB1 en especies aviares de interés comercial. REFERENCIAS Acuña, C.A., Díaz, G.J., Espitia, M.E. (2005). Aflatoxinas en maíz: reporte de caso en la costa atlántica colombiana. Revista de la Facultad de Medicina Veterinaria 52: 156-162. Bezuidenhout, S.C., Gelderblom, W.C.A., Gorst Allman, C.P., Horak, R.M., Marasas, W.F.O., Spiteller, G., Vleggaar, R. (1988). Structure elucidation of the fumonisins, mycotoxins from Fusarium moniliforme. Journal of the Chemical Society. Chemical Communications 743-745. Brunström, B., Halldin, K. (1998). EROD induction by environmental contaminants in avian embryo livers. Comparative Biochemistry and Physiology Part C 121: 213–219. Bünger, J., Westphal, G., Mönnich, A., Hinnendahl, B., Hallier, E., Müller, M. (2004). Cytotoxicity of occupationally and environmentally relevant mycotoxins. Toxicology 202: 199–211. Del Bianchi, M., Oliveira, C.A.F., Albuquerque, R., Guerra, J.L., Correa B. (2005). Effects of prolonged oral administration of aflatoxin B1 and fumonisin B1 in broiler chickens. Poultry Science 84: 1835-1840.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


Micotoxinas y Aflatoxina B1, un problema en salud animal

Díaz, G. J. (1995). Regulación de los niveles máximos tolerables de micotoxinas en materias primas y alimentos terminados. Veterinaria al Día 1(3):22-27. Díaz, G., J. (1996a). Micotoxinas y micotoxicosis en salud humana y animal. Primera Parte. Veterinaria al Día 2(1):28-34. Díaz, G., J. (1996b). Micotoxinas y micotoxicosis en salud humana y animal. Segunda Parte. Veterinaria al Día 2(3):3-8. Díaz, G.J., Lozano, M.C., Acuña, A. (2009). Prevalence of Aspergillus species on selected Colombian animal feedstuffs and ability of Aspergillus section Flavi to produce aflatoxins. World Mycotoxin Journal 2 (1): 31-34. Do, J.H., Choi, D. (2007). Aflatoxins: detection, toxicity, and biosynthesis. Biotechnology and Bioprocesses Eng. 12: 585-593. Doi, A.M., Patterson, P.E., Gallagher, E.P. (2002). Variability in aflatoxin B1–macromolecular binding and relationship to biotransformation enzyme expression in human prenatal and adult liver. Toxicology and Applied Pharmacology 181: 48–59. Eaton, D.L., Gallagher, E.P. (1994). Mechanisms of aflatoxin carcinogenesis. Annual Review of Pharmacology and Toxicology 34: 135-172. Felix D` Mello, J.P., Macdonald, A.M.C., Postel, D., Dijksma, W.T.P., Dujardin, A., Placinta, C.M. (1998). Pesticide use and mycotoxin production in Fusarium and Aspergillus phytopathogens. European Journal of Plant Pathology 104: 741-751. Ferguson, L.R., Philpott, M. (2008). Nutrition and mutagenesis. Annual Review of Nutrition 28: 313–29. Gallagher, E., Kunze, K.L., Stapleton, P.L., Eaton, D.L. (1996). The Kinetics of aflatoxin B1 oxidation by human cDNA-expressed and human liver microsomal cytochromes P450 1A2 and 3A4. Toxicology and Applied Pharmacology 141: 595-606.

77

Gorman, N., Walton, H.S., Sinclair, J.F., Sinclair, P.R. (1998). CYP1A-catalyzed uroporphyrinogen oxidation in hepatic microsomas from non-mammalian vertebrates (chick and duck embryos, scup and alligator). Comparative Biochemistry and Physiology Part C 121: 405– 412. Groopman, J.D., Kensler, T.W., Wild, C.P. (2008). Protective interventions to prevent aflatoxininduced carcinogenesis in developing countries. Annual Review of Pubblic Health 29: 187–203. Guengerich, F.P., Johnson, W.W., Shimada, T., Ueng, Y., Yamazaki, H., Langouët, S. (1998). Activation and detoxication of aflatoxin B1. Mutation Research 402:121-128. Guengerich, F.P., Johnson, W.W., Ueng, Y., Yamazaki, H., Shimada, T (1996). Involvement of cytochrome P450, glutathione S-transferase and epoxide hydrolase in the metabolism of aflatoxin B1 and relevance to risk of human liver cancer. Environmental Health Perspectives 104(3): 557 – 562. Hussein, H.S., Brasel, J.M. (2001). Toxicity, metabolism, and impact of mycotoxins on humans and animals. Toxicology 167: 101–134. Klein, P.J., Van Vleet, T.R., Hall, J.O., Coulombe Jr., R.A. (2003). Effects of dietary butylated hydroxytoluene on aflatoxin B1-relevant metabolic enzymes in turkeys. Food Chemistry and Toxicology 41: 671–678. Klein, P.J., Van Vleet, T.R., Hall, J.O., Coulombe, R.A. (2002). Biochemical factors underlying the age-related sensitivity of turkeys to aflatoxin B1. Comparative Biochemistry and Physiology Part C132: 193–201. Klein P., Buckner R., Kelly J. and Coulombe R. (2000). Biochemical basis for the extreme sensivity of turkeys to aflatoxin B1. Toxicology and Applied Pharmacology 151:152-158. Leeson S., Diaz G.J., and Summers J.D. (1995). Poultry metabolic disorders and mycotoxins. University Books, Guelph, Ontario, pp 249280.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


78

Hansen Wilber Murcia Rodríguez

Lozano, M.C. and Diaz, G.J. (2005). Microsomal and cytosolic phase I biotransformation of aflatoxin B1 in four poultry species. British Poultry Science 47:734-741. Nebbia, C., Dacasto, M., Rossetto, A., Giuliano, A., Carletti, M. (2003). Comparative expression of liver cytochrome P450-dependent monooxygenases in the horse and in other agricultural and laboratory species. Veterinary Journal 165: 5364. Newberne, P.M., Butler, W.H. (1969). Acute and chronic effects of aflatoxin on the liver of domestic and laboratory animals: A review. Cancer Research 29: 236-250. Ogido, R., Oliveira, C.A.F., Ledoux, D.R., Rottinghaus, G.E., Corrêa, B., Butkeraitis, P., Reis, T.A., Gonçales, E., Albuquerque, R. (2004). Effects of prolonged administration of aflatoxin B1 and fumonisin B1 in laying japanese quail. Poultry Science 83: 1953-1958. Oliveira, C.A.F., Rosmaninho, J.F., Butkeraitis, P., Corrêa B., Reis, T.A., Guerra, J.L., Albuquerque, R., Moro, M.E.G. (2002). Effect of low levels of dietary aflatoxin B1 on laying japanese quail. Poultry Science 81: 976-980. Omiecinski, C.J., Remmel, R.P., Hosagrahara, V.P. (1999). Concise review of the cytochrome P450s and their roles in toxicology. Toxicological Sciences 48: 151-156.

Pelkonen, O., Rautio, A., Raunio, H., Pasanen, M. (2000). CYP2A6: a human coumarin 7-hydroxylase. Toxicology 144: 139–147. Quezada, T., Cuellar H., Jaramillo-Juárez, F., Valdivia, A.G., Reyes, J.L. (2000). Effects of aflatoxin B1 on the liver and kidney of broiler chickens during development. Comparative biochemostry and Physiology Part C 125: 265–272. Qureshi, M.A., Brake, J., Hamilton, P.B. Hagler, W.M., Nesheim S. (1998). Dietary exposure of broiler breeders to aflatoxin results in immune dysfunction in progeny chicks. Poultry Science 77: 812-819. Sargeant, K., Sheridan, A., O`kelly, J., Carnaghan, R.B.A. (1961). Toxicity associated with certain samples of groundnuts. Nature 192: 10961097. SAS Institute Inc. (2008). SAS/STAT® 9.2 User’s Guide. Cary, NC: SAS Institute Inc. Verma, R.J. (2004). Aflatoxin causes DNA damage. International Journal of Human Genetics 4(4): 231-236. Yip, S.S.M., Coulombe Jr., R.A. (2006). Molecular cloning and expression of a novel cytochrome P450 from turkey liver with aflatoxin B1 oxidizing activity. Chemical Research in Toxicology. 19: 30-37.

Patterrson, D.S.P. (1973). Metabolism as a factor in determining the toxic action of the aflatoxins in different animal species. Food and Cosmetics Toxicology 11: 287-294.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


79

Polihidroxialcanoatos (PHAs): Biopolímeros producidos por microorganismos. Una solución frente a la contaminación del medio ambiente Polyhydroxyalkanoates (PHAs) polymers produced by microorganisms. A solution to environmental pollution Julieth Yadira Serrano Riaño1 Resumen Los polihidroxialcanoatos (PHAs) son biopolímeros que algunos microorganismos acumulan como reserva de carbono y energía, son producidos cuando hay limitaciones nutricionales en el medio. El sistema genético asociado con la producción de PHAs codifica para diversas proteínas formadoras de gránulos citoplasmáticos. Estos biopolímeros han cobrado gran importancia debido a que pueden ser utilizados reemplazando materiales como el plástico, que actualmente genera gran acumulación y que se ha convertido en un alto foco de contaminación ambiental debido a su lenta degradabilidad. La principal ventaja de los polihidroxialcanoatos frente a los plásticos derivado del petróleo es que al ser producidos por microorganismos son biodegradables por lo tanto no hay una acumulación; los PHAs tienen diversas aplicaciones entre las que se encuentran: empaques de larga y corta duración, injertos utilizados en medicina, productos de higiene y biocombustibles. Palabras clave: biopolímeros, polihidroxialcanoatos, contaminación ambiental, microorganismos, biodegradabilidad. Abstract The polyhydroxyalkanoates (PHAs) are biopolymers that some microorganisms accumulate as carbon and energy reserve, they are produced under nutritional limitations in the culture media. The genetic system associated with the production of PHAs coding for various proteins forming the cytoplasmatic granule. These biopolymers have gained great importance because they can be used to replace other materials like plastic, due to its slow degradability accumulate in large quantities that have become a high source of environmental pollution. The main advantage of the polyhydroxyalkanoates is that they are produced by microorganisms are consumed by them, therefore there is no accumulation, in contrast with plastics derived from oil; the PHAs have various applications among which are: packaging of short and long term, grafts used in medicine, hygiene products and biofuels. Key words: biopolymers, polyhydroxyalkanoates, environmental pollution, microorganisms, biodegradability.

1

Magister en microbiología de la Universidad Nacional de Colombia, Centro de Investigación y Desarrollo de la Fundación Universitaria del Área Andina, Bogotá, Colombia. jserrano@areandina.edu.co

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


80

Julieth Yadira Serrano RiaĂąo

INTRODUCCIĂ&#x201C;N Los plĂĄsticos derivados del petrĂłleo (sintĂŠticos, no biodegradables), han sido utilizados desde la dĂŠcada de los 40s, segĂşn la Enviromental ProtecciĂłn Agency [EPA], solo en Estados Unidos en el aĂąo 2009 se generaron 13 millones de toneladas de plĂĄsticos en envases y embalajes, casi 11 millones de toneladas en objetos duraderos, como electrodomĂŠsticos, y alrededor de 7 millones de toneladas en objetos no duraderos como platos y tazas. En los paĂ­ses desarrollados se observa un uso mayor de este material; por ejemplo el consumo per capita en Estados Unidos es de 80 kg, en Europa 60 Kg, y en paĂ­ses como India es de 2 Kg. (Kato, Bao, Kang, Fokui & Doi, 2000), lo que refleja que sin lugar a dudas este material es imprescindible en la ĂŠpoca actual. SituaciĂłn que ha generado acumulaciĂłn y que se ha convertido en un grave problema de contaminaciĂłn ambiental (Ojumu, Yu & Solomon, 2004).Un Informe del PNUMA (Programa de Naciones Unidas para el Medio Ambiente) en el 2005 ha seĂąalado que para ese aĂąo se encontraban mĂĄs de 13.000 fragmentos de desechos plĂĄsticos flotando sobre cada kilĂłmetro cuadrado del ocĂŠano citado por (Allsopp, Wallers, Santillo & Johnston, 2007). A su vez, en el paĂ­s segĂşn la Armada Nacional de Colombia [ARC], (2004) existen datos que revelan que en las playas se desechan en un dĂ­a 2.875 unidades de plĂĄstico. La contaminaciĂłn debido a la acumulaciĂłn de plĂĄstico es un problema que ha sido de manera ineficientemente abordada ya que los mĂŠtodos utilizados para la disminuciĂłn de este problema resultan inĂştiles frente a la producciĂłn desbordada del mismo. Por lo mencionado es de vital importancia generar nuevas alternativas que sean competitivas y amigables con el medio ambiente; por tal razĂłn el hombre ha buscado en la biotecnologĂ­a soluciones que son viables y que brindan soluciones mĂĄs eficientes. Es allĂ­ donde aparecen los polihidroxialcanoatos (PHAs), poliĂŠsteres de hidroxialcanoatos que conservan ca-

racterĂ­sticas propias del plĂĄstico sintĂŠtico, con la ventaja de ser completamente degradados pocos meses despuĂŠs de su uso. Los grĂĄnulos de PHA son producidos intracelularmente por mĂĄs de 300 bacterias diferentes incluyendo Eubacterias y Archeas (Braunegg, LefebriĂśe & Genser, 1998; Ojumu et al., 2004). Una vez se conocieron las bondades de este material biodegradable, las investigaciones apuntan a crear estrategias que superen la principal desventaja existente y es su alto costo de producciĂłn frente a los plĂĄsticos derivados del petrĂłleo; la utilizaciĂłn en el medio de cultivo de fuentes de carbono econĂłmicas, y optimizaciĂłn en los procesos de fermentaciĂłn, recuperaciĂłn y purificaciĂłn del biopolĂ­mero son las estrategias mĂĄs usadas (Choi, Lee & Han, 1998). A su vez el empleo de microorganismos recombinantes como Escherichia coli, ayuda a resolver algunas limitaciones tecnolĂłgicas que se pueden presentar con los mĂŠtodos anteriores ya que permiten manejar a fondo la parte metabĂłlica y cinĂŠtica del microorganismo, por lo tanto y de manera directa la producciĂłn de PHAs. (GarcĂ­a et al., 2004; Hein, SĂśhling, Gottshalk & SteinbĂźchel 1997; Park & Lee, 2002; Sato, Nomura, Abe, Doi & Tsuge, 2007). CaracterĂ­sticas generales de los PHAs Los grĂĄnulos de PHAs sirven como almacenamiento de energĂ­a y carbono cuando en el medio hay abundancia de este y dĂŠficit de elementos como nitrĂłgeno, fĂłsforo, magnesio entre otros (Lee, Choi & Wong, 1999), lo que los hace mĂĄs resistentes bajo esta condiciĂłn de estrĂŠs (Hezayen, SteinbĂźchel, & Rehm, 2002; Rehm & SteinbĂźchel, 1999; SteinbĂźchel & Eversloh, 2003). Su tamaĂąo oscila entre 0.2 - 0.5 Îźm con un nĂşmero aproximado de 8-10 grĂĄnulos por cĂŠlula y con un peso molecular de 2x105-3x106 daltons (Figura 1), sin embargo esto varĂ­a dependiendo de la especie (Ojumu et al., 2004). A su vez pueden acumular biopolĂ­mero hasta el 90% de su peso seco (Reddy & Rashm, 2003; Sudesch, Abe & Doi, 2000). 

3VHXGRPRQDVDHUXJLQRVD 3RO\HVWHUJUDQXOXP

 Figura 1. ,PDJHQ SRU PLFURVFRSLD HOHFWUyQLFD GRQGH VH PXHVWUD OD DFXPXODFLyQGH3+$VSRU3VHXGRPRQDVDHUXJLQRVD 5HKP

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


Polihidroxialcanoatos (PHAs): BiopolĂ­meros producidos por microorganismos.

Síntesis de PHAs La composición monomÊrica de los biopolímeros de PHAs es muy variada, depende de las rutas metabólicas por las cuales fueron sintetizados y por la fuente de carbono externa que se usa como materia prima para dicha ruta. Provienen båsicamente de tres vías metabólicas: la degradación de azucares mediante la obtención de Acetil CoA, la degradación de åcidos grasos (β-oxidación) y/o biosíntesis de åcidos grasos (Aldor & Keasling, 2003). Clasificación de PHAs Los polihidroxialcanoatos se clasifican de acuerdo con la naturaleza de sus unidades monómeras, si el polímero estå formado por solo un tipo de unidades se denomina homopolímero (Anderson & Dawes, 1990; Chung et al., 2001). A su vez, si estå integrado por monómeros con distinta longitud de åtomos de carbono en el mismo granulo se refiere entonces a un copolímero (Zhao & Chen, 2007). Del mismo modo si los monómeros que forman el polímero poseen cada uno de 3-5 åtomos de carbono se conocen como PHAs de cadena corta (scl - PHA), y PHAs

Clase

Subunidad

81

de cadena media (mcl - PHA) cuando contienen de 6-14 ĂĄtomos de carbono. La razĂłn por la cual un PHAs se forma como un polĂ­mero de cadena corta o media estĂĄ relacionada directamente con la enzima encargada de la sĂ­ntesis (sintasa) ya que esta tiene una especificidad de sustrato que puede actuar sobre monĂłmeros con diferente nĂşmero de ĂĄtomos de carbono (Anderson & Dawes, 1990). Las PHA sintasas son las enzimas que catalizan la conversiĂłn de sustratos (R)-3-hidroxiacil-CoA a PHAs con la liberaciĂłn de CoA, es decir une los monĂłmeros formando el polĂ­mero (Rehm & SteinbĂźchel, 1999). Hacen parte de una familia de enzimas que poseen cualidades no muy comunes considerando la funciĂłn en la formaciĂłn de estructuras intracelulares insolubles en agua (los grĂĄnulos de PHA) y la asociaciĂłn de estas inclusiones con una monocapa lipĂ­dica (Rehm, 2003). Estas enzimas estĂĄn unidas a las superficie de los grĂĄnulos y como todas ellas tienen una especificidad de sustrato, en este caso pueden aceptar monĂłmeros con diferente nĂşmero de carbonos, caracterĂ­stica principal por la cual se clasifican (figura 2).

Especies

Sustrato +$6&/&R$

I

3KD&

5DLVWRQLDHXWURSKD aN'D 3KD&

II aN'D

III IV

3KD&

3KD(

aN'DaN'D 3KD&

3KD5

aN'DaN'D

3VHXGRPRQDV DHUXJLQRVD

&&

+$6&/&R$ +$6&/&R$+$6&/&R$ +$0&/&R$ Â&#x2022;&

+$6&/&R$

$OORFKURPDWLXP YLQRVXP

+$0&/&R$>&&@ +$&R$+$&R$

%DFLOOXVPHJDWHULXP

+$6&/&R$

Figura 2.&ODVLILFDFLyQGHODVLQWDVDV 6HHVSHFLILFDODHVSHFLHPRGHORGHFDGD FODVH\HOVXVWUDWRGRQGHDFW~D 5HKP 

Las PHA sintasas clase I tienen como microorganismo modelo Ralstonia eutropha, estĂĄn compuestas de una sola clase de subunidad (PhaC), y actĂşan sobre tioĂŠsteres CoA de varios 3 hidroxialcanoatos de cadena corta (Eversloh, Bergander, Luftmann & SteinbĂźchel, 2001; Rehm, 2003). Las PHA sintasas Clase II tambiĂŠn se componen de una sola subunidad (PhaC) y son activas sobre tioĂŠsteres CoA de varios 3-hidroxialcanoatos pero en este caso de cadena media (preferencialmente ĂĄcidos grasos 3-hidroxi), el PHA resultante de la producciĂłn de un microorganismo que posee esta clase de enzima tiene muchas

aplicaciones debido a su gran similitud con el lĂĄtex los microorganismos representantes de este grupo son en su mayorĂ­a las bacterias del gĂŠnero Pseudomonas, principalmente Pseudomonas aeruginosa (Rehm,2003). Las PHA sintasas Clase III son representadas por Allochromatium vinosum, a diferencia de las dos anteriores estĂĄn conformadas por dos subunidades (PhaC y PhaE), pero al igual que las de clase I prefierentioĂŠsteres CoAde3-hidroxialcanoatosdecadena corta (Rehm, 2003); por Ăşltimo las sintasas clase IV

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


82

Julieth Yadira Serrano RiaĂąo

dependiendo del microorganismo y con diferente orden; sin embargo el gen de la PHA sintasa (phaC) se encuentra presente en todos los cluster independientemente del microorganismo, lo que sugiere que es una enzima crucial en todas las rutas de sĂ­ntesis de PHA (Anderson & Dawes, 1990; Madison & Huisman, 1999; Rehm & SteinbĂźchel, 1999) (Figura 3). Se habla con detalle de la organizaciĂłn del cluster productor de PHAs de cadena media producidos por sintasa tipo II ya que han cobrado gran interĂŠs debido a su propiedad de elastĂłmeros y gran similitud con el lĂĄtex. El cluster de este tipo de PHA estĂĄ conformado por 6 genes en su orden (phaC1, phaZ, phaC2, phaD, phaF y phaI) y se han descrito principalmente en el gĂŠnero Pseudomonas (Rehm, 2003).

poseen dos subunidades (PhaC y PhaR) actĂşan sobre tioĂŠsteresCoAde3-hidroxialcanoatosdecadenacorta y su microorganismo representante es Bacillus megaterium (McCool & Cannon, 2001). Cluster de sĂ­ntesis de PHA Un cluster se refiere a una agrupaciĂłn de genes contiguos enfocados hacia una misma funciĂłn, en este caso los grĂĄnulos de PHA son formados por un grupo de genes que codifican proteĂ­nas que no solo producen la inclusiĂłn sino tambiĂŠn la estabilizan y la degradan cuando sea necesario. Se han descrito diferentes cluster de sĂ­ntesis de PHA a partir de una gran variedad de bacterias; se observan diferentes genes D 5HXWURSKD SKD&

SKD$

SKD%

E =UDPLJHUD SKD&

SKD$

SKD%

F &YLQRVXP SKD&

SKD(

SKD$

SKD)

SKD%

G $FDYLDH SKD3

SKD&

SKD-

H 3ROHRYRUDQV SKD&

SKD=

SKD&

SKD'

SKD)

SKD,

I 3DXUHRIDFLHQV SKD&

SKD=

SKD&

SKD'

SKD)

SKD-

Figura 3. Cluster de PHAs en diferentes microorganismos. $XQTXH WRGRVSUHVHQWDQXQDRUJDQL]DFLyQGLIHUHQWH\JHQHVGLIHUHQWHVWRGRVSUHVHQWDQ SKD& TXH FRGLILFD SDUD OD HQ]LPD VLQWDVD UHVSRQVDEOH GH OD SROLPHUL]DFLyQ 6XUL\DPRQJNRO:HVHODNH1DULQH0RORQH\ 6KDK 

Sintasas (phaC1 y phaC2) Los genes phaC1 y phaC2 son los genes encargados de la codificaciĂłn de las PHA sintasas se encuentran separados por la depolimerasa PhaZ y solo se expresa una a la vez, el que se exprese el gen phaC1 y phaC2 depende del microorganismo y del sustrato proporcionado. En su secuencia primaria y secundaria son idĂŠnticas entre un 50 y 60 % y las dos presentan especificidad de sustrato similares (Hezayen et al., 2002; Liebergesell et al., 1991; Zhang, Kolves, Lenz & Goodwin, 2003). Son las enzimas mĂĄs estudiadas de todas las implicadas en la producciĂłn del granulo. Se han realizado diferentes estudios sobre la estructura y comporta-

miento general de esta proteĂ­na, uno de los mĂĄs representativos es el realizado por Rehm & SteinbĂźchel en 1999, donde realizaron un alineamiento mĂşltiple utilizando las estructuras primarias de 59 sintasas no solo de clase II sino tambiĂŠn de las clases I, III y IV. AllĂ­, demostraron la presencia de seis regiones de secuencias de aminoĂĄcidos conservados y ocho residuos idĂŠnticos en todas las secuencias (Rehm & SteinbĂźchel, 1999). En el caso de las sintasas tipo II la PhaC1 posee una longitud de 559 aminoĂĄcidos y la PhaC2 de 560. Los ocho residuos conservados varĂ­an ligeramente en cuanto a su posiciĂłn entre la PhaC1 y PhaC2, en la PhaC1 se ubican de la siguiente manera: serina (S) en la posiciĂłn 238, cisteĂ­na (C) en la 296, glicina (G) en la 299, acido

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


Polihidroxialcanoatos (PHAs): BiopolĂ­meros producidos por microorganismos.

aspĂĄrtico (D) en la 328, triptĂłfano (W) en la 397, acido aspĂĄrtico (D) en la 451, glicina (G) en la 478e histidina (H) en la479). Tres residuos (C296; D 451; H479) son los pertenecientes a la triada catalĂ­tica es decir, son los aminoĂĄcidos que tienen la funciĂłn directa con el sustrato. Se evidenciĂł tambiĂŠn que todas las PHA sintasas pertenecen a la familia de las lipasas que se caracterizan por contener un motivo funcional denominado caja lipasa [GX(S/C)XG] residuos 294298, en la cual la serina, el sitio activo esencial de las lipasas,es reemplazado con una cisteĂ­na (Gerngross, Snell, Peoples & Sinskey, 1994; Jian, Ye, Wu & Zhang, 2004;MĂźh & Sinskey, 1999).

2007; Jendrossek & Handrick 2002; Ohura, Kasuya & Doi, 1999). Se ubican en la superficie del granulo e hidrolizan todas las inclusiones de PHAs incluso los formados por monĂłmeros poco usuales, lo que demuestra que actĂşa sobre gran cantidad de sustratos como acurre con otras esterasas (Sandoval et al., 2005) (Figura4). Genes phaD, phaF y PhaI Seguido del gen phaC2 se encuentra el gen phaD, un gen del cual no se conoce mucho pero estudios como el de Klinke, Roo, Witholt & Kessler, 2000 en donde mutan este gen demuestran que es importante en cuanto a la biosĂ­ntesis y acumulaciĂłn del granulo ya que si habĂ­a ausencia o mutaciĂłn de este se observaban efectos en la acumulaciĂłn del polĂ­mero y reducciĂłn de la producciĂłn de PHAmcl a menos del 20%. El gen phaF se conoce como fascina y actĂşa de dos maneras, primero como un elemento estructural que se necesita para la elongaciĂłn del polĂ­mero creando una interacciĂłn polĂ­mero-proteĂ­na (PHA-PhaF), y como un activador transcripcional de phaC1 actuando directamente sobre la regiĂłn reguladora del gen. La otra fascina PhaI es la otra proteĂ­na asociada al grĂĄnulo que se sugiere tiene una funciĂłn reguladora sobre el gen phaF actuando como represor del mismo (Figura4) (Prieto, 1999; Chen, 2010).

Depolimerasa phaZ El gen que codifica esta proteĂ­na (phaZ) se encuentra en medio de las sintasas y su producto cumple una funciĂłn fundamental, ya que como se mencionĂł anteriormente los grĂĄnulos de PHA se forman en la cĂŠlula como reserva de carbono y energĂ­a de esta manera cuando se necesita en los procesos celulares es fundamental la presencia de una enzima que degrade esta inclusiĂłn y es ahĂ­ donde la proteĂ­na PhaZ aparece. Esta proteĂ­na se conoce con el nombre de depolimerasa y estĂĄ relacionada estructuralmente con la familia de las esterasas. Estas enzimas catalizan la liberaciĂłn de (R)-3-hidroxi-acil /aril -CoA derivados de polĂ­meros intracelulares (De Eugenio et al.,

transcription

phaC1

phaZ

phaC2

phaD

phaF

phaI

Depolymerase Phasins PHA polymerases

PHA granule

Uknown Proteins

83

CoA

(R)-3-hydroxyacyl-CoA CoA

Monolayer phospholipid membrane

Figura 4. OrganizaciĂłn genĂŠtica del cluster phaC1ZC2DFI involucrado en la sĂ­ntesis de PHAmcl. /DVIXQFLRQHVSXWDWLYDVGHDOJXQDVSURWHtQDVVRQLQGLFDGDV &KHQ 

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


84

Julieth Yadira Serrano RiaĂąo

DegradaciĂłn de PHAs La principal ventaja de los polihidroxialcanoatos es su biodegradabilidad y esto lo logran ya que los grĂĄnulos son hidrolizados por microorganismo que buscan en ellos fuentes de carbono y energĂ­a; lo hacen por medio de depolimerasas que son secretadas de las cĂŠlulas y se adhieren a la superficie del polĂ­mero

convirtiĂŠndola en unidades de monĂłmeros independientes. El tiempo que demora la degradaciĂłn depende de la naturaleza propia del polĂ­mero asĂ­ como tambiĂŠn las condiciones ambientales a las que sean expuestos, se ha observado degradaciĂłn de los PHAs en gran cantidad de ambientes incluyendo aerobios, anaerobios, salinos, marinos y otros (Ojumu, Yu & Solomon, 2004) (Figura 5).

Figura 5. DegradaciĂłn completa de PHA en menos de 50 dĂ­as bajo  condiciones tropicales 6XGHVKHWDO  

Aplicaciones de PHAs Se han reportado cerca de 150 monĂłmeros diferentes formadores de PHAs, esto indica no solo que son ricos estructuralmente sino ademĂĄs que pueden tener aplicaciones variadas, razĂłn por la cual se pueden encontrar en empaques (envolturas de elementos de aseo y alimentos, en general envases de plĂĄsticos desechables o de larga duraciĂłn); al ser biocompatibles tambiĂŠn se utilizan en medicina como en injertos, reemplazando parte de tejidos, o como materia prima de implementos mĂŠdicos, tambiĂŠn en productos de higiene y en biocombustibles (Lee, et al, 1999). CONCLUSIONES En este artĂ­culo se describe otra manera de combatir la acumulaciĂłn y actualmente contaminaciĂłn debida al uso desenfrenado del plĂĄstico de origen petroquĂ­mico; se hace ĂŠnfasis en el uso de microorganismos para la producciĂłn de polihidroxialcanoatos (PHAs); material con caracterĂ­sticas similares al plĂĄstico y totalmente biodegradable, tienen aplicaciones variadas como en empaques, matera prima para productos de higiene y biocombustibles y gracias a su biocompatibilidad tiene gran aplicaciĂłn en el campo de la medicina. Los PHAs son polĂ­meros formados por monĂłmeros que son unidos gracias a la acciĂłn de una enzima denominada PHA sintasa. Existen varias clases de esta enzima, sin embargo la PHA sintasa clase II llama es de interĂŠs ya que produce grĂĄnulos

de PHA de cadena media que son los que presentan mayor variedad de aplicaciones por su caracterĂ­stica de ser similar al lĂĄtex. Los grĂĄnulos se forman cuando los microorganismos se encuentran bajo ciertas condiciones de estrĂŠs especĂ­ficamente cuando en el medio hay abundancia de carbono y dĂŠficit de elementos como nitrĂłgeno, fĂłsforo, magnesio entre otros, por tanto sirven como almacenamiento de energĂ­a y carbono. La maquinaria genĂŠtica encargada de producir los grĂĄnulos es compleja y ordenada estĂĄ conformada por un grupo de genes â&#x20AC;&#x153;clusterâ&#x20AC;? encargados no solo de la formaciĂłn sino tambiĂŠn de la estabilizaciĂłn y degradaciĂłn del granulo cuando el microorganismo necesita utilizar la reserva de energĂ­a que acumulo en la inclusiĂłn. Es necesario seguir con el estudio detallado de estos microorganismos ya que proveen una fuente inagotable de recursos y de nuevas alternativas que suplen muchas de las necesidades que actualmente demanda la sociedad o que afrontara en el futuro. REFERENCIAS Allsopp, M; Walters, A; Santillo, D; Johnston, P. (2007).ContaminaciĂłn por plĂĄstico en los ocĂŠanos del mundo. Recuperado de: http://www. greenpeace.org/espana/es/reports/contaminaci-n-por-plasticos-en/.

Revista TEORĂ?A Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de InvestigaciĂłn y Desarrollo â&#x20AC;˘ CID / FundaciĂłn Universitaria de Ă rea Andina


Polihidroxialcanoatos (PHAs): Biopolímeros producidos por microorganismos.

Aldor, L. & Keasling, J. (2003). Process design for microbial plastic factories: metabolic engineering of polyhydroxyalkanoates. Current Opinion in biotechnology,14, 475-483. Anderson, A. & Dawes, E. (1990) .Occurrence, metabolism, metabolic role, and industrial uses of bacterial polyhydroxyalkanoates. Microbiological reviews,54 (4),450-472. Armada Nacional de Colombia. (2004). Playas y mares más limpios. Recuperado de http://www. armada.mil.co/index.php?idcategoria=57167. Braunegg,G.,Lefebvre,G.,Genser,K.(1998).Polyhyd roxyalkanoates,biopolyesters from renewable resources:Physiological and engineering aspects. Journal of Biotechnology,65,127-161. Chen, G.Q. (2010). Plastics from Bacteria. Natural Functions and Applications. Microbiology Monographs. (Vol 14): Münster, Germany: Alexander Steinbüchel. Choi, J., Lee, S., Han, K. (1998). Clonning of the Alcaligenes latus Polyhydroxyalkanoate Biosynthesis Genes and Use of These Genes for Enhanced Production of Poly (3.hydroxybutyrate) in Escherichia coli. Applied and Environmental Microbiology, 64, 4897-4903. Chung, D., Choi, M., Song, J., Yoon, S., Kang, I. & Huh, N. (2001).Intracellular degradation of two structurally different polyhydroxyalkanoic acids accumulated in Pseudomonas putida and Pseudomonas citronellolis from mixtures of octanoic acid and 5-phenylvaleric acid. International Journal of Biological Macromolecules, 29, 243–250. De Eugenio, L., Garcia, P., Luengo, J., Sanz, J., San Roman, J., Garcia, J. & Prieto, M. (2007). Depolymerase gene from Pseudomonas putida, and characterization of the gene product. depolymerase gene of Pseudomonas stutzeriand analysis of the function of substrate-binding domains. Applied and Environmental Microbiology, 65, 189–197. Enviromental Protection Agency. Plastics. Recuperado de http://www.epa.gov/epawaste/conserve/materials/plastics.htm.

85

Eversloh, T., Bergander, K., Luftmann, H. & Steinbüchel, A. (2001). Identification of a new class of biopolymer: bacterian or synthesis of a sulfurcontaining polymer with thioester linkages.Mycrobiology,147,11-19. García, B., Olivera, E., Sandoval, A., Barrau, E., Arias, S., Naharro, G. & Luengo, J. (2004). Strategy for cloning large gene assemblages as illustrated using the phenylacetate and polyhydroxyalkanoate gene clusters. Applied and environmental Microbiology, 70 (8), 5019-5025. Gerngross, T., Snell, K., Peoples, O. & Sinskey, A. (1994). Overexpression and Purification of the Soluble Polyhydroxyalkanoate Synthase from Alcaligenes eutrophus: Evidence for a Required Posttranslational Modification for Catalytic Activity. Biochemistry, 33, 9311-9320. Hein, S., Söhling, B., Gottschalk, G. & Steinbüchel, A. (1997). Biosynthesis of poly(4-hydroxybutyric acid) by recombinant strains of Escherichia coli. FEMS Microbiology Letters, 153, 411418. Hezayen, F., Steinbüchel, A. & Rehm, B. (2002). Biochemical and enzymological properties of the polyhydroxybutyrate synthase from the extremely halophilic archae on strain 56. Archives of Biochemistry and Biophysics, 403, 284–291. Jendrossek, D. & Handrick, R. (2002). Microbial degradation of polyhydroxyalkanoates. Annual Review of Microbiology, 56, 403–422. Jiang, Y., Ye, J., Wu, H. & Zhang, H. (2004). Cloning and expression of the polyhydroxyalkanoate depolymerase gene from Pseudomonas putida, and characterization of the gene product. Biotechnology Letters, 26, 585–1588. Kato, M., Bao, H., Kang, C., Fukui, T., Doi, Y. (2000). Production of a novel copolyester of 3¬hydroxybutyric acid and medium-chain-length 3-hydroxyalkanoic acids by Pseudomonas sp. 61-3 from sugars. Applied and environmental Microbiology, 45, 363-370. Klinke, S., Roo, G., Witholt, B. & Kessler, B. (2000). Role of phaDin Accumulation of Medium-Chain-Length Poly (3-Hydroxyalkanoates) in Pseudomonas oleovorans. Applied and Environmental Microbiology,66, 3705¬-3710.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


86

Julieth Yadira Serrano Riaño

Lee, S., Choi, J.& Wong, H. (1999). Recent advances in polyhydroxyalkanoate production by bacterial fermentation: mini-review. International Journal of biological macromolecules, 25, 31-36. Liebergesell, M., Hustede, E., Timm, A., Steinbüchel, A., Fuller R., Lenz, R. &Schlegel, H. (1991). Formation of poly(3-hydroxyalkanoates) by phototrophic and chemolithotrophic bacteria. Archives of Microbiology,155, 415–421. Madison, L. & Huisman, G. (1999). Metabolic engineering of poly(3-hidroxyalkanoates) from DNA to plastic. Microbiology and Molecular Biology Reviews, 63 (1), 21-53. McCool, G. & Cannon, M. (2001). PhaC and PhaRare required for polyhydroxyalkanoic acid synthase activity in Bacillus megaterium. The Journal ofBacteriology,183, 4235-4243. Müh, U., Sinskey, A., Kirby, D., Lane, W. & Stubbe, J. (1999). PHA Synthase from Chromatium vinosum: Cysteine 149 Is Involved in Covalent Catalysis. Biochemistry, 38, 826-837. Ohura, T., Kasuya, K. & Doi, Y. (1999). Cloning and characterization of the polyhydroxybutyrate depolymerase gene of Pseudomonas stutzeri and analysis of the function of substrate-binding domains. Applied and Environmental Microbiology, 65, 189–197. Ojumo, T., Yu, J. & Solomon, B. (2004) .Production of Polyhydroxyalkanoates, a bacterian biodegradable polymer. African Journal of Biotechnology, 3, 18-24. Park, S., Park, J. & Lee, S. (2002). Metabolic engineering of Escherichia coli for the production of medium-chain-length polyhydroxyalkanoates rich in specific monomers. FEMS Microbiology Letters, 214, 217-222. Prieto, M; Buhler, B; Jung, K; Witholt, B; Kessler, B. (2007). PhaF, a polyhydroxyalkanoate granuleassociated protein of Pseudomonas oleovorans GPo1 involved in the regulatory expression system for pha genes. Journal of Bacteriology, 181, 858–868. Reddy, C. & Rashmi, V. (2003).Polyhydroxyalkanoates: an overview Bioresource Technology, 87, 137–146.

Rehm, B. (2003). Poliéster synthases: natural catalysts for plastics. Biochemical Journal, 376, 15-33. Rehm, B. & Steinbüchel, A. (1999). Biochemical and genetic analysis of PHA synthases and other proteins reequires for PHA synthesis. International Journa lof biológical macromolecules,25, 3-19. Sandoval, A., Arias-Barrau, E., Arcos, M., Bermejo, F., Canedo, L., Naharro G., et al. (2005). Production of 3-hydroxy-n-phenylalkanoic acids by a genetically engineered strain of Pseudomonas putida. Applied Microbiology and Biotechnology, 67, 97–105. Sato S., Nomura C., Abe H., Doi Y. & Tsuge T. 2007. Poly [(R)-3-Hydroxybutyrate] formation in Escherichia coli from Glucose through an Enoyl-CoA hydratase-mediated Pathway. Journal of Bioscience and Bioengineering, 103 (1), 38–44. Steinbüchel, A. & Eversloh, T. (2003) . Metabolic engineering and path way construction for biotechnological production of relevant polyhydroxyalkanoates in microorganisms. Biochemical Engineering Journal,16,81-96. Sudesh, K., Abe, H. & Doi, Y. (2000). Synthesis, structure and properties of polyhydroxyalkanoates: biological polyesters. Polymer Chemistry Laboratory, 25, 1503-1555. Suriyamongkol. P.; Weselake, R.; Narine, S.; Moloney, M.; Shah, S. (2007). Biotechnological approaches for the production of polyhydroxyalkanoates in microorganisms and plants – A review. Biotechnology Advances, 25, 148-175. Zhang, S., Kolves, S., Lenz, R. & Goodwin, S. (2003). Mechanism of the polymerization reaction initiated and catalyzed by the polyhydroxybutyrate synthase of Ralstoniaeutropha. Biomacromolecules,4, 504-509. Zhao, W. & Chen, G. (2007). Production and Characterization of terpolyester poly (3-hydroxybutyrate-co-3-hydroxyvalerate-co-3-hydroxyhexanoate) by recombinant Aeromonas hydrophila 4AK4 harboring genes phaAB. ProcessBiochemistry,42, 1342–1347.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


87

REVISTA TEORÍA Y PRAXIS INVESTIGATIVA INSTRUCCIONES PARA LOS AUTORES1 revistateoriaypraxis@areandina.edu.co INTRODUCCIÓN La revista Teoría y Praxis Investigativa es una publicación multidisciplinar, académica, de carácter científico, que tiene como propósito la divulgación de conocimiento generado a partir de investigaciones, reflexiones y disertaciones que contribuyan a ampliar el conocimiento científico en todos los campos del saber. La revista cuenta con ISSN 1900-9380 y puede consultarse en: http://www.areandina.edu.co/portal/index.php?Itemid=38 7&id=510&option=com_content&view=article. Teoría y Praxis Investigativa está incluida en Dialnet (dialnet.unirioja.es), google (www.google.com) y en los enlaces de CLACSO (www.biblioteca. clacso.edu.ar/enlaces) y se encuentra en proceso de indexación en el Índice Bibliográfico Nacional Publindex. La revista recibe documentos durante todo el año, publica dos números anuales y ocasionalmente publica un suplemento especializado en un tema de actualidad. Se acepta para publicación trabajos inéditos en español y en inglés, que no hayan sido publicados o presentados simultáneamente a publicación en otra revista nacional o internacional y que pertenezcan a una de las siguientes categorías propuestas por Publindex: Artículo de investigación científica y tecnológica. Documento que presenta, de manera detallada, los resultados originales de proyectos terminados de investigación. Artículo de reflexión. Documento que presenta resultados de investigación terminada desde una perspectiva analítica, interpretativa o crítica del autor, sobre un tema específico, recurriendo a fuentes originales. Artículo de revisión. Documento resultado de una investigación terminada donde se analizan, sistematizan e integran los resultados de investigaciones publicadas o no publicadas, sobre un campo en ciencia o tecnología, con el fin de dar cuenta de los avances y las tendencias de desarrollo. Se caracteriza por presentar una cuidadosa revisión bibliográfica de por lo menos 50 referencias.

Cartas al editor. Posiciones críticas, analíticas o interpretativas sobre los documentos publicados en la revista, que a juicio del Comité editorial constituyen un aporte importante a la discusión del tema por parte de la comunidad científica de referencia. Editorial. Documento escrito por el editor, un miembro del comité editorial o un investigador invitado sobre orientaciones en el dominio temático de la revista. Traducción. Traducciones de textos clásicos o de actualidad o transcripciones de documentos históricos o de interés particular en el dominio de publicación de la revista. Reseña bibliográfica. Tener en cuenta los siguientes aspectos: Con relación a la reseña: a) la reseña consiste en una lectura crítica positiva de un libro, se sugiere que sea de un tema que el autor conozca ampliamente; b) puede incluirse máximo tres referencias bibliográficas; c) la reseña estará encabezada por la bibliografía completa de la obra reseñada siguiendo las normas del Manual de la American Psychological Association (APA); d) se puede iniciar con una semblanza del autor de la obra; e) el nombre del autor de la reseña debe escribirse al final del texto. Con relación a la obra reseñada: a) La publicación debe ser científica o académica; b) el tema objeto de la obra ha de ser relevante; c) se debe tener en cuenta la especialización y prestigio del(los) autor(es), y de la entidad editora; d) el libro reseñado no debe tener más de dos años de publicado; e) dado el carácter científico de la revista, se excluyen reseñas de obras de divulgación, libros de texto y materiales exclusivamente didácticos, o de cualquier obra que defienda o propugne principios contrarios a los valores implícitos o explícitos de la Fundación Universitaria del Área Andina. Documento de reflexión no derivado de investigación. Otros: Entrevistas, reportajes, ensayos, etc. El Comité Editorial dará prelación a los artículos de investigación, revisión y reflexión. ESTRUCTURA GENERAL DEL DOCUMENTO

Artículo corto. Documento breve que presenta resultados originales preliminares o parciales de una investigación científica o tecnológica, que por lo general requieren de una pronta difusión. Reporte de caso. Documento que presenta los resultados de un estudio sobre una situación particular con el fin de dar a conocer las experiencias técnicas y metodológicas consideradas en un caso específico. Incluye una revisión sistemática comentada de la literatura sobre casos análogos. Revisión de tema. Documento resultado de la revisión crítica de la literatura sobre un tema en particular. 1

Los artículos sometidos a la revista deben contener: título en español y en inglés (máximo 20 palabras), autores con nombres y apellidos (indicar con nota al pie de página y números arábigos: título académico de mayor nivel e institución de obtención del título, nombre y dependencia de la institución que tiene los derechos patrimoniales de la publicación, ciudad, país y correo electrónico de contacto), resumen en español y en inglés (máximo 200 palabras), palabras clave en español e inglés (tres a seis palabras), introducción, contenido del documento, conclusiones, recomendaciones (opcional), agradecimientos (opcional) y referencias. En el caso de los artículos de investigación, el contenido del documento corresponde a: materiales y métodos, resultados y discusión.

Diana Milena Quilaguy Ayure, M.Sc. en Microbiología de la Universidad Nacional de Colombia. Centro de Investigación y Desarrollo de la Fundación Universitaria del Área Andina, Bogotá, Colombia. dquilaguy@areandina.edu.co.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


88 PAUTAS DE ELABORACIÓN El documento debe ser presentado como un archivo Word con letra tipo “Times New Roman” tamaño 12 puntos, interlineado sencillo en papel tamaño carta con márgenes de 3 cm. en todos los lados, texto justificado en una columna con estilo normal y páginas numeradas consecutivamente. El documento debe estar escrito en lenguaje científico con extensión máxima de páginas así: 20 para artículo de investigación y traducciones, 15 para artículos de revisión, 10 para artículos de reflexión, ocho para artículos cortos, cinco para reportes de caso, revisiones de tema y reseñas bibliográficas y dos para cartas al editor. Adicional a esto se debe tener en cuenta las siguientes indicaciones: 1) presentar la información en forma ordenada y coherente con redacción adecuada, en voz activa y en la forma impersonal de los verbos (se + verbo); 2) ser consistente en el manejo de los tiempos verbales (ej.: métodos y resultados en tiempo pretérito y discusión y conclusiones en presente); 3) usar un solo espacio de barra entre palabras, posterior a una coma, punto y coma, dos puntos, paréntesis, punto seguido, etc.; 4) dejar un espacio entre párrafo y párrafo y entre referencia y referencia; 5) los títulos del artículo, resumen y abstract, deben ir centrados, en negrilla y con mayúscula inicial; 6) los títulos como introducción, materiales y métodos, resultados, referencias, etc. deben presentarse justificados en mayúscula sostenidas con negrilla; 7) los subtítulos deben ir en negrilla con mayúscula inicial; 8) utilizar el Sistema Internacional de Unidades (SI); 9) los pié de página solo deben utilizarse en caso de aclaraciones importantes o derechos de copia; 10) las abreviaciones deben colocarse entre paréntesis inmediatamente después del significado completo la primera vez que se utilicen. Tablas y figuras Las tablas y figuras se incluyen en página separada después de las referencias, siempre deben estar tituladas y numeradas consecutivamente y deben citarse dentro del texto en el lugar apropiado (ej.: Figura 1, Tabla 1). Los títulos se colocan con mayúscula inicial y centrados, seguidos del número correspondiente, los de las tablas van en la parte superior y los de las figuras se colocan en la parte inferior. Aunque las tablas y figuras son parte integral del texto, estas deben contener la información suficiente para que puedan comprenderse por sí solas. Si son tomadas o adaptadas de otra fuente, siempre se debe referenciar la fuente original. Para la elaboración de las tablas y figuras, por favor tener en cuenta las siguientes consideraciones: 1) toda la información debe estar acorde con el idioma del texto, ser legible y sin mayúscula sostenida; 2) para hacer aclaraciones se debe utilizar letras con superíndice y colocar la información en la parte inferior; 3) para separar decimales, utilizar punto (.) y no coma (,); 4) ) en las tablas sólo deben incluirse líneas horizontales, no verticales; 5) los dibujos, fotografías y gráficas deben ser presentados en jpg., con tamaño máximo de 215 x 280 mm., con resolución mínima de 350 ppi y más de 200 Kb. Citas y referencias Para la elaboración de las citas y referencias debe seguirse el Manual de la American Psychological Association (APA) última edición (6ª). A continuación se presentan algunos ejemplos de citaciones y referencias, información adicional puede ser consultada en la página web http://owl.english.purdue.edu/owl/ resource/560/01/.

Ejemplos de citaciones en el texto: - Un autor al inicio: Rodríguez (2003) señala que… / Al final: xxxxxx xxxxxx (Rodríguez, 2003). - Dos autores al inicio: Martínez y Castro (2001) plantean que... / Al final: xxxxxxxx xxxxxxxx (Martínez & Castro, 2001). - De tres a cinco autores al inicio: Jiménez, Contreras, Díaz y Moya (2005) encontraron que... / Si se cita de nuevo: Jiménez et al. (2005) sostienen que… / Al final: xxxxx xxxxx (Jiménez, Contreras, Díaz & Moya, 2005). / Si se cita de nuevo al final: xxxxx xxxxx (Jiménez et al., 2005). - Seis o más autores al inicio: Ramírez et al. (2004) encontraron que… / Al final: xxxxxx xxxxxx (Ramírez et al., 2004). - Cita textual menor de 40 palabras: Con base en su estudio, Gómez y Pérez (1999) “xxxxxxx xxxxxxxx” (p. 23), xxxxx xx. / Al final: Con base en estos resultados, “xxxxxxx xxxxxxxx” (Gómez & Pérez, 1999, p. 23). - Cita textual mayor de 40 palabras (a 1.3 cm.): Caicedo y Pérez (1998) sugieren…: Xxx xxx xxx xxx xxx xxx xxx xxx xxx xxx Xxx xxx xxx xxx xxx xxx xxx xxx xxx xxx. Xxx xxx xxx xxx xxx xxx xxx xxx xxx xxx. Xxx xxx xxx xxx xxx xxx xxx xxx xxx xxx xxx (p. 121). - Trabajos sin autor (decretos y leyes): (“Constitución Política de Colombia”, 1991). - Distintos autores que apoyan una misma idea (colocar en orden alfabético): Xxxxx xxxx xxxx (Cárdenas, Prieto & Vanegas, 2005; Díaz-Gómez & Ayala-Beltrán, 2003; Rivas et al., 2009). - Un autor que cita a otro autor al inicio: Córdoba y Méndez (1999 citados en Esguerra & Ruíz, 2005) señalan que… / Al final: Xxxxx xxxx (Córdoba & Méndez, 1999 citados en Esguerra & Ruíz, 2005). Esta cita debe aparecer en la lista de referencias (Esguerra...) y no del autor citado (Córdoba…). - Dos obras citadas del mismo autor que tienen el mismo año, al inicio: Perales y Montoya (2007 a) debatieron acerca de…. Perales y Montoya (2007 b) concluyeron… / Al final: Xxxx xxx (Perales & Montoya 2007 a). Xxxxxx xxxx (Perales & Montoya 2007 b). - Autores distintos con el mismo apellido al inicio (utilizar iniciales de los nombres): P.C. Lara (2005) y D.S. Lara (2008) encontraron… / Al final: xxxx xxx (P.C. Lara, 2005; D.S. Lara 2008). - Publicación de una institución al inicio: Según el estudio de la Organización de las Naciones Unidas [ONU], (2007), xxx xxx. / Si se cita de nuevo: De acuerdo con el reporte de la ONU (2007), xxxx… / Al final: xxx xxx (Organización de las Naciones Unidas [ONU], 2007). / Si se cita de nuevo al final: xxx xxx (ONU, 2007). - Sin fecha de publicación conocida al inicio: García (s.f) verificó… / Al final: xxx xxx (García, s.f). - Comunicaciones personales (en casos muy especiales en los que el emisor es una autoridad en su área): El director general H. Cortés (comunicación personal, 15 de febrero, 2008) afirmó que…

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


89 En la lista de referencias solo deben colocarse las que fueron citadas dentro del texto y debe seguirse las siguientes indicaciones: 1) organizar en orden alfabético según el apellido de los autores; 2) utilizar sangría francesa; 3) si hay más de un trabajo de un mismo autor(es), ordenar cronológicamente del más antiguo al más reciente; 4) para artículos de siete o más autores, colocar los seis primeros seguidos por et al.; 5) verificar que las fuentes electrónicas provengan de una institución reconocida o de una base de datos; 6) reemplazar el URL cuando el Digital Object Identifier (DOI) esté disponible. Ejemplos para la sección de referencias: Libro: Apellido, A. A. (año de publicación). Título del libro (ed.). Lugar de publicación: Editorial. Leavell, H. & Clark, E. (1998). Medicina preventiva para la comunidad: Una aproximación epidemiológica (3a ed.). Madrid, España: McGraw Hill Book Co.

Libro sin autor o editor: Título del libro (ed.). (Año de publicación). Lugar de publicación: Editorial. Larousse Diccionario Enciclopédico (5a.ed.). (1999). Bogotá, D.C., Colombia: Larousse, S.A. Libro electrónico: Apellido, A. A. (año de publicación). Título del libro. Recuperado de URL de la fuente Magallón, M. (1998). Filosofía política de la educación. Recuperado de http://... Artículo de revista electrónica sin versión impresa: Apellido, A. A. (Año de publicación). Título del artículo. Título de la revista, Vol(N°), pág.-pág. Recuperado de http:// www... O doi:####... Díaz, M. (2001). Clasificación para la categorización y la organización de la Web. Context.net, 3(12), 12-14. Recuperado de http://www....

Libro con editor: Apellido, A. A. (Ed.). (año de publicación). Título del libro. Lugar de publicación: Editorial.

Brownlie, D. (2007). Toward effective poster presentations: An annotated bibliography. European Journal of Marketing, 41(11), 1245-1283. doi:10.1108/03090560710821161.

Castillo, A. J. (Ed.). (2003). Administración educativa. Medellín, Colombia: Publicaciones antioqueñas.

PROCESO DE ENVÍO Y EVALUACIÓN

Capítulo de Libro: Autor, A. A. del capítulo. (Año de publicación). Título del capítulo. En Editor del libro (Ed.), Título del libro (pp. xx-xxx). Lugar de publicación: Editorial.

Los documentos deben ser enviados al correo: revistateoriaypraxis@areandina.edu.co, dirigido al editor de la revista (Eduardo Mora Bejarano), anexando lo siguiente: - Ficha de identificación de autores.

Noguera, N. & Miranda, P. (2001). La industria de la información. En J. Cortés & F. C. Méndez (Eds.), La documentación y sus tecnologías (pp. 245-328). Bogotá, Colombia: Ediciones Pirámide.

- Carta firmada por todos los autores donde se remite el documento y se declare que el documento es inédito y no ha sido publicado o sometido a otra revista.

Artículo de revista científica: Apellido, A. A. (año de publicación). Título del artículo. Título de la revista, Vol(N°), pág.-pág.

- Cuando las imágenes son de otro(s) autor(es) se debe adjuntar autorización por escrito del autor(es) original(es).

Contreras, F. V., Polania, A. & Rodríguez, A. (2009). Autoeficacia, ansiedad y rendimiento académico en estudiantes. Diversitas: Perspectivas en Educación, 1(2), 188-194. Artículo de revista no especializada: Apellido, A. A. (año, día y mes de publicación). Título del artículo. Título de la revista, Vol(N°), pág.- pág. Vargas, M. (1993, 28 de septiembre). Ventas arriba. Magazine, 14(2), 43-48. Artículo de periódico: Apellido, A. A. (año, día y mes de publicación). Título del artículo. Título del periódico, p. pág. Cárdenas, E. (1993, 2 de abril). Hacía una cultura virtual. El Tiempo, pp. 8,12. Tiempo para cultivar la familia (2005, 13 de marzo). El Colombiano, pp. 4-8. Tesis: Apellido, A. A. (año de publicación). Título de la tesis (Tesis de xxxx, institución, lugar de publicación). Recuperado de http://www... Flores, A. (2009). La reorganización de la biblioteca del Hospital Tunjuelito (Tesis de licenciatura, Universidad Nacional de Colombia, Manizales, Colombia). Recuperado de http:// www...

- Lista de chequeo.

La remisión de una contribución a Teoría y Praxis Investigativa, implica que el(los) autor(es) cede(n) los derechos de publicación y difusión a la revista, por cualquier medio conocido o por conocer. La recepción del documento se notifica por correo electrónico. Los trabajos son sometidos a selección inicial por parte del Comité Editorial y en el transcurso de 20 días hábiles se comunica a los autores la aceptación o no para evaluación. Los documentos que no se ajusten a las instrucciones dadas por la revista no serán evaluados. Posteriormente se envía el documento a evaluación por pares académicos, quienes emiten un concepto, la aceptación para publicación dependerá de la calidad científica y el cumplimiento de las instrucciones dadas por la revista. La respuesta será enviada por correo electrónico dentro de los 90 días hábiles después de dada la respuesta de aceptación para evaluación. El Comité Editorial se reserva el derecho de aceptar, rechazar, solicitar modificaciones y hacer las correcciones que se estimen necesarias para ajustar el documento al estilo de la revista. En caso de solicitar modificaciones, los autores cuentan con 20 días hábiles para enviar el documento corregido. La revisión de los artículos se hará respetando el derecho de los autores a la confidencialidad en cuanto a la información, resultados y esfuerzo creativo. Así mismo se respetará el derecho a la confidencialidad de los evaluadores. El autor principal recibirá un (1) ejemplar del número de la revista en que sea publicado el documento. En caso de necesitar certificación de aceptación o publicación, esta se debe solicitar al editor al correo revistateoriaypraxis@areandina.edu.co.

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina


90

Revista TEORÍA Y PRAXIS INVESTIGATIVA, Volumen 5 - No. 2, Julio - Diciembre 2010 Centro de Investigación y Desarrollo • CID / Fundación Universitaria de Área Andina

Revista Teoria y praxis Investigativa  

publicacion academico cientifica, volumen 5-2

Read more
Read more
Similar to
Popular now
Just for you