__MAIN_TEXT__
feature-image

Page 1

STUDIO SYN_ LONDON / ATHENS

We are a London and Athens-based architectural practice. We always stay true to the initial position of our practice – contemporary, imaginative and critical. In London, Studio Syn is represented by Dejan Mrdja and Ursula Dimitriou. 2XUMRLQWH[SHULHQFHVSDQVRYHU\HDUVLQDUFKLWHFWXUHDQGLQWHULRUGHVLJQ:HDUHFRQ¿GHQWLQDSURIHVVLRQDOVHWWLQJ directing a design team and working closely with the client and local authorities when delivering projects. :HDOZD\VPDNHVXUHWKDWRXUGHVLJQVDUHVLWHVSHFL¿FRXUDUJXPHQWVVXEVWDQWLDWHGRXUDHVWKHWLFVFRQWHPSRUDU\RXUWHFKQLFDO drawings buildable and that our completed projects make our clients proud. We are not afraid to make bold statements, we understand budgets and we appreciate the importance of nuances that make designs inspiring for years to come. The selected sample of works is just a segment of a diverse portfolio and a wide range of skills and experiences that we, the founding members of Studio Syn possess.

1

Studio Syn, Selected Residential Projects


THE FACTORY Commercial Refurbishment with Flexible Working Space Dalston, London This large commercial East London reburbishment includes DFRPSOHWHUHLPDJLQLQJRIWKHJURXQGÀRRUQHZJOD]LQJDQG H[WHQVLYHLQWHULRUZRUNV7KHOD\RXWLQFOXGHVÀH[LEOHRI¿FH VSDFHUHWDLOVSDFHHYHQWVSDFHEUHDNRXWDUHDVDQGD FRIIHHVKRS6WXGLR6<1GHVLJQHGWKHOD\RXWODQGVFDSH DLUFRQGLWLRQLQJV\VWHPEDFNRIKRXVHDQGDFFHVVWRGHOLYHU DQLQWHJUDWHGGHVLJQVROXWLRQ$VWKHSURMHFWZDVGHYHORSHGLQ SKDVHV6WXGLR6<1PDQDJHGPXOWLSOHSODQQLQJDSSOLFDWLRQV VLPXOWDQHRXV\ZLWKWKHORFDOSODQQLQJGHSDUWPHQW

2

PORTFOLIO, Studio SYN, London / Athens

Project Data: EXGJHW…N area 1000m²

Key Words: ÀH[LEOHRI¿FHVSDFH refurbishment, start-up retails, local businesses


THE FACTORY Designing a Flexible Floor Plan for a Resilient Mix of Complementary Activities

3

PORTFOLIO, Studio SYN, London / Athens


THE FACTORY Careful Coordination of Building Services, Structure, Partitions, Access, Fire Escape, External Landscape and New Facade Glazing to Optimise the %HQH¿WVRI1HZ'HVLJQIRU8VHUV

4

PORTFOLIO, Studio SYN, London / Athens


THE FACTORY A Vibrant Community is Generated as a Result of Good Design and HIgh Quality of Refurbishment Works

5

PORTFOLIO, Studio SYN, London / Athens


BARNES STREET Residential Extension Limehouse, London The house is located in a conservation area in Tower Halmets. :HKDGH[WHQVLYHFRQVXOWDWLRQVZLWKWKHSODQQLQJRI¿FHUV during the planning determination period. The design was radically changed as a result, so the planning would be secured. We worked closely with the structural engineer on detailing the structure of the extension. We worked closely with the contractor on site, often correcting their mistakes and ¿QGLQJVROXWLRQVWRPLQLPLVHDERUWLYHZRUNDQGNHHSWKHSURMHFW on target. Project Data: House extension 30m² £100.000 completed #residential #extension #refurbishment #conservationarea

3

Studio Syn, Selected Residential Projects


BARNES STREET Residential Extension Limehouse, London

4

Studio Syn, Selected Residential Projects


BARNES STREET Residential Extension Limehouse, London

before

5

after

Studio Syn, Selected Residential Projects


VOTANIKOS HOUSE Residential Refurbishment Athens Studio Syn refurbished a neo-classical residential building in central Athens. The brief asked for two units with shared courtyard and roof terrace. We worked on exposing the historic layered building fabric and complementing it with contemporary materials where needed. As many design decisions were solely dependent on exposing the historic fabric and could not be anticipated in advance, Studio Syn worked very closely with the client and contractors on site to devise suitable techniques.

Project Data: House refurbishment 120m² completed #residential #refurbishment #renovation #athens

6

Studio Syn, Selected Residential Projects


VOTANIKOS HOUSE Residential Refurbishment Athens

7

Studio Syn, Selected Residential Projects


VOTANIKOS HOUSE Residential Refurbishment Athens

8

Studio Syn, Selected Residential Projects


VICTORIA APARTMENT Residential Refurbishment Athens Studio Syn refurbished an apartment in downtown Athens for a graphic designer and a diplomat couple. The focus of the apartment remodelling was to deliver a contemporary and neutral design to suit the lifestyle of a creative professional and traveller couple who recently moved to Athens from working abroad. Project Data: Apartment refurbishment 100m² completed

#residential #newbuild #athens

9

Studio Syn, Selected Residential Projects


VICTORIA APARTMENT Residential Refurbishment Athens

10

Studio Syn, Selected Residential Projects


VICTORIA APARTMENT Residential Refurbishment Athens

11

Studio Syn, Selected Residential Projects


KINNOUL MANSIONS Residential Refurbishment Clapton, London 7KLVLVDJURXQGÀRRUDSDUWPHQWUHIXUELVKPHQWSURMHFWLQ Clapton in East London. Due to the outdated and dilapidated FRQGLWLRQRIWKHLQWHULRUDWWKHWLPHRISXUFKDVHWKHHQWLUHÀDW had to be refurbished. We kept in close contact with the clients throughout the design and construction phases to deliver a non-obtrusive design that will suit clients’ busy life in between /RQGRQDQG6\GQH\DQGDOORZIRUWKHLUJXHVWVWRXVHWKHÀDWLQ their absence. Project Data: Apartment refurbishment 100m² completed

#residential #refurbishment #bespokedesign

12

Studio Syn, Selected Residential Projects


KINNOUL MANSIONS Residential Refurbishment Clapton, London

13

Studio Syn, Selected Residential Projects


MALTA ROAD Loft Conversion and Refurbishment Leyton, London The house is located in Leyton area of East London. The loft conversion and refurbishment falls within the permitted development. We have interrogated a range of design gestures to deliver a project that differs from the standard permitted GHYHORSPHQWORIWFRQYHUVLRQ7KHGHVLJQLVVXEWO\UHÀHFWLQJWKH character of the clients by delivering a joyful and soft loft design. We introduced a range of inovative solutions for the entrance SRUFKQGÀRRUHQVXLWHDQGVWDLUFDVHGHVLJQ$OORIWKHVHEHLQJ mindful of the budget and site restrictions. Project Data: Loft conversion and refurbishent 40m² £80.000 ongoing

#residential #loftconversion #refurbishment #permitteddevelopment

Skylight window over the landing to ensure airy feeling in the whole of stairwell. Approx. dimensions 1m x1m. It can be openable to provide access to the roof.

1000

Large star-gazing VELUX window (openable) above the bed in the master bedroom. Dimensions 1.2m x 1.2m or similar. TBC in design stage 3

Skylight window (fixed) above the dark corner in the master bedroom. Smaller in size than the stairwell landing skylight. Approx. dimensions .75m x 0.75m. This window is optional.

750

Main master bedroom window. This is effectively floor-to-ceiling french balcony door with even door leaves. It takes up maximum possible width between the party wall and the outrigger, removing the need for any cladding apart from window surrounds. This can be done in zinc, material TBC. Permitted Development asks for approx150mm setback (200mm along the roof line). The protruding balcony balustrade will align with the the wall surface on the floor below.

Balustrade at 1100mm above FFL, details and material to be decided in the next stage to fully take into account the details and materiality of the window surround.

Drain pipes will be rerouted where required as part of the detailed facade design considerations

1200 If any repair to the roof is required, it can be done using tiles removed from the place of the new star-gazing window.

The main window on the small room is centred on the facade. Smaller leaf, above the bathroom window, is openable and the larger is fixed. Balustrade at 1100mm above FFL

150

Front facade refurbishment presents an interesting design challenge due to the current cladding which conceals most of it at the moment. It will require several steps: 1. To be stripped of the existing facade tiles and cleaned of mortar as much as possible. 2. After this point, we can decide to go down one of the two routes: 3. Refurbish it using STO acrylic render or similar. Exact texture and colour to be confirmed once samples are received. 4. Alternatively, the facade is primed and painted. Colours tbc

Studio Syn, Selected Residential Projects

The design intent is to use a slate or shingle roof cladding that will respond to the PD rule, but its product range will also provide an opportunity to explore creating an interesting colour scheme. Examples on SK-08

Large star-gazing VELUX window openable) above the bed in the master bedroom. Dimensions 1.2m x 1.2m or similar. TBC in design stage 3

14

200

Permitted Development rules ask that the roof extension is set back 200mm along the slope of the existing roof. Practically it means a horizontal set back of approx. 150mm from the outer face of the existing wall.

Permitted Development rules ask for roof extensions to be clad in a material similar to the original roof. This is why most of neighbouring extensions use simple artificial slate roof cladding in red or dark red.


MALTA ROAD Loft Conversion and Refurbishment Leyton, London

15

Studio Syn, Selected Residential Projects


MALTA ROAD Loft Conversion and Refurbishment Leyton, London

Proposed views of the house

Existing views of the house

16

Studio Syn, Selected Residential Projects


YOGA HOUSE New Build Residential Lagonisi, Greece 7KLVSURMHFWLVIRUDGHWDFKHGKRXVHZLWKDÀH[LEOHLQWHUQDO layout. The interior space is designed for a yoga studio. The house can be easily converted into a guest house to supplement the main residential building on whole land it is situated.

Project Data: New build residential property study #residential #newbuild #yogastudio #thresholdspaces

17

Studio Syn, Selected Residential Projects


YOGA HOUSE New Build Residential Lagonisi, Greece

18

Studio Syn, Selected Residential Projects


DYONISSOS Residential New Build Athens These are two semi-detached houses in a hilly suburb of Athens for one of the judges of the supreme court. The design sought to take advantage of the sloping terrain, ensure privacy for each of the two houses, provide extensive underground car park. A strong stone wall allows for approach on one side and the house to develop as cubes of various heights on the other. Studio Syn took this project from conception till completion.

Project Data: New build residential 350m² completed #residential #newbuild #athens

19

Studio Syn, Selected Residential Projects


DYONISSOS Residential New Build Athens

20

Studio Syn, Selected Residential Projects


NOTTING HILL Residential Extension Study West London Project for a large rear extension in Notting Hill. Extension comprised a generous family and guest space at the back of the existing house, crowned with 2 landscaped lightwells and underpinned by a large basement. The library was an integral part of the level change. The initial design stages were complete and planning permission secured.

Project Data: private residency 450m² £250.000 completed

#residential #extension #refurbishment

new wall with brickwork to match existing

A

new wall with brickwork to match existing

new green roof, with horizontal skylight

existing windows to be replaced with french doors in painted hardwood to match existing Brick wall under the window to be lowered.

+15.30 +15.30

rain water harvesting tank

new green roof +13.65(first floor)

+13.60 +13.65(first floor)

w.c.

+13.60

new painted metal railings existing parapets to be lowered.

play room enlarge window previously approved

steam room

+10.00(ground floor)

+10.00 detail behind

+10.00(ground floor)

workshop

full height glazing, with external hardwood bris soleil

wine cellar

new metal painted rails

existing door to be centered on the wall

new hardwood bris soleil

new double full height glazing

new wall with brickwork to match existing

skylight for basement

existing garden sheds repaired

1

A

safe room

FRONT (NORTH WEST) ELEVATION

2

existing door to be centred below window above

REAR (SOUTH EAST) ELEVATION

B

B

utility/ laundry

A

living room rain water harvesting tank

plant

+10.00 new wall with brickwork to match existing

new green roof with horizontal skylight

existing parapet to be lowered.

new painted metal railings

bedroom

new green roof solar panels

+15.30 new wall with brickwork to match existing

+13.65(first floor)

kitchenette TV

1

BASEMENT PLAN

w.c.

w.c.

A

lounge kitchen

B

+10.00(ground floor)

B

kitchen

+10.00(ground floor) new painted metal railings

new wall with brickwork to match existing

w.c.

3

hallway

A

full height glazing, with external hardwood bris soleil

SIDE(NORTH EAST) ELEVATION

4

study library

new openable wooden bris soleil

storage

existing parapet to be modified skylights existing parapets to be lowered. new painted metal railings on top of the parapets new green roof

existing windows to be replaced with french doors in painted hardwood to match existing Brick wall under the window to be lowered.

A

B

B

bedroom

bedroom

S O L A R

P A N E L S

hall

bedroom

bathroom

2

GROUND PLAN

bedroom

EXISTING WALLS

3

FIRST FLOOR PLAN

NEW WALLS

GUY STANSFELD ARCHITECTS LIMITED Revisions

Project Title

137 BLENHEIM CRESCENT Drawing Title

PROPOSED PLANS

21

Studio Syn, Selected Residential Projects

Drawn By

Date

30/04/07

OD Checked By

Drawing Number

GSA827/PROP/PL03

Scale

1 100

SECTION A-A

SIDE(WEST) ELEVATION


LADYWELL HOUSE Residential Extension and Refurbishment Devon Studio Syn are currently redesigning a detached house in the south of Devon, extending the kitchen area over a small stream runing below and opening it up towards the adjacent forest. The interior spaces are also being remodelled. The project is planned for completion this year. Project Data: House extension and refurbishment 100m² ongoing #residential #refurbishment #renovation #devon

Proposed extension

22

Studio Syn, Selected Residential Projects

3URSRVHGÀRRUSODQ

Existing property


NOSAKHARI CONCEPT STORE Commercial Interior Fit-Out Homerton, London This large commercial East London reburbishment includes DFRPSOHWHUHLPDJLQLQJRIWKHJURXQGÀRRUQHZJOD]LQJ DQGH[WHQVLYHLQWHULRUZRUNV'HMDQZRUNHGZLWKODQGVFDSH GHVLJQHUOLJKWLQJGHVLJQHUVWUXFWXUDOHQJLQHHUWRGHOLYHUDQ LQWHJUDWHGGHVLJQVROXWLRQ$VWKHSURMHFWZDVEHLQJGHYHORSHG LQSKDVHV'HMDQLVPDQDJLQJPXOWLSOHSODQQLQJDSSOLFDWLRQV WKDWDUH¿OHGZLWKWKHORFDOSODQQLQJGHSDUWPHQWVLPXOWDQHRXV\

RI¿FH

Project Data: Commerical refurbishment 1000m² 500k completed #commercialarchitecture #refurbishment #interiordesign D

ZRUNVKRS

F

E

A

A

B

B

C

C D

E

F

1 1RVDNKDULWHDP 'HVLJQ0DNH

, ,QYLWHG&UHDWLYHV

&OLHQWV

lighting feature

movable screen VHPLWUDQVOXFHQW

RI¿FH XJK YLHZVWKUR

movable screen VHPLWUDQVOXFHQW

EHVSRNHGLVSOD\ furniture

Morning Lane

¿[HGVFUHHQ opaque

store axis the main s a l a n o g dia

kitchen

VKRZURRP

28

PORTFOLIO, Orsalia Maria Dimitriou, PhD

ZRUNVKRS


NOSAKHARI GARDEN STUDIO Commercial Extension Homerton, London This large commercial East London reburbishment includes DFRPSOHWHUHLPDJLQLQJRIWKHJURXQGÀRRUQHZJOD]LQJ DQGH[WHQVLYHLQWHULRUZRUNV'HMDQZRUNHGZLWKODQGVFDSH GHVLJQHUOLJKWLQJGHVLJQHUVWUXFWXUDOHQJLQHHUWRGHOLYHUDQ LQWHJUDWHGGHVLJQVROXWLRQ$VWKHSURMHFWZDVEHLQJGHYHORSHG LQSKDVHV'HMDQLVPDQDJLQJPXOWLSOHSODQQLQJDSSOLFDWLRQV WKDWDUH¿OHGZLWKWKHORFDOSODQQLQJGHSDUWPHQWVLPXOWDQHRXV\ Project Data: Commerical refurbishment 1000m² 500k completed #commercialarchitecture #refurbishment #interiordesign

1.

5RRÀQJPPDOORZDQFH7%&6LQJOHSO\ membrane or Corrugated metal Rigid Insulation Tapering to gutter: 2° slope 5RRÀQJ%DVHPP )ODWURRÀQJEDVHPP ,QVXODWLRQPP Void for recessed lighting 5DIWHUPP 3O\ZRRG%RDUGPP 3ODVWHUVNLP)LQLVKPP

1(,*+%285,1* *$5'(1 $&&(6672 7(55$&(

300

400

2. 3. 4. 5. 6. 7.  9.

2740 700

2000

$//(<:$<

Cross bracing for roof structure

170

0.64

87,/,7< 6725(

+$,5'5(66(56 %$&.(175$1&(

2740

&2857<$5'

2910

2100

2775

2600 (FFL To Ceiling)

87,/,7<6725(



0.36

TOP OF %/2&.:25.

0.36

&RQFUHWHJURXQGÁRRU VODEGLPHQVLRQV7%&ZLWK construction / engineer &RQFUHWHJURXQGÁRRU VODEGLPHQVLRQV7%&ZLWK construction / engineer

PORTFOLIO, Orsalia Maria Dimitriou, PhD

&2857<$5'

0.69

0.00

29

*$5'(12)),&(

7+,6:$//,6 217+(6,7( %281'$5<$1' ,668%-(&772 3$57<:$// $*5((0(17

1. 2. 3. 4. 5.

)ORRULQJPP 8QGHUÁRRUKHDWLQJPP$OORZDQFH 3O\ZRRGPP 5LJLGLQVXODWLRQPP$OORZDQFH &RQFUHWH6ODEPP

3920 1. 2. 3. 4. 5. 6. 7.

3ODVWHUERDUGPP 3O\ZRRGPP ,QVXODWLRQPP &ROXPQVPP 7%$WLPEHURUVWHHO

3O\ZRRGPP 7LPEHU%DWRQVPP 7%$7LPEHURU)LEUHFHPHQWFODGGLQJPP allowance


NOSAKHARI SHOPFRONT STUDIES Shopfront Design Homerton, London This large commercial East London reburbishment includes DFRPSOHWHUHLPDJLQLQJRIWKHJURXQGÀRRUQHZJOD]LQJ DQGH[WHQVLYHLQWHULRUZRUNV'HMDQZRUNHGZLWKODQGVFDSH GHVLJQHUOLJKWLQJGHVLJQHUVWUXFWXUDOHQJLQHHUWRGHOLYHUDQ LQWHJUDWHGGHVLJQVROXWLRQ$VWKHSURMHFWZDVEHLQJGHYHORSHG LQSKDVHV'HMDQLVPDQDJLQJPXOWLSOHSODQQLQJDSSOLFDWLRQV WKDWDUH¿OHGZLWKWKHORFDOSODQQLQJGHSDUWPHQWVLPXOWDQHRXV\ Project Data: Commerical refurbishment 1000m² 500k completed #commercialarchitecture #refurbishment #interiordesign

30

PORTFOLIO, Orsalia Maria Dimitriou, PhD


NOSAKHARI FLEXIBLE FURNITURE Product Design Homerton, London This large commercial East London reburbishment includes DFRPSOHWHUHLPDJLQLQJRIWKHJURXQGÀRRUQHZJOD]LQJ DQGH[WHQVLYHLQWHULRUZRUNV'HMDQZRUNHGZLWKODQGVFDSH GHVLJQHUOLJKWLQJGHVLJQHUVWUXFWXUDOHQJLQHHUWRGHOLYHUDQ LQWHJUDWHGGHVLJQVROXWLRQ$VWKHSURMHFWZDVEHLQJGHYHORSHG LQSKDVHV'HMDQLVPDQDJLQJPXOWLSOHSODQQLQJDSSOLFDWLRQV WKDWDUH¿OHGZLWKWKHORFDOSODQQLQJGHSDUWPHQWVLPXOWDQHRXV\ Project Data: Commerical refurbishment 1000m² 500k completed #commercialarchitecture #refurbishment #interiordesign

31

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PEEKABOO FASHION STORE Commercial Interior Fit-Out Belgrade /RFDWHGLQ%HOJUDGH¶VFRPPHUFLDOGLVWULFWWKHVWRUHVGLVSOD\ ZRUNE\VHYHUDOIDVKLRQGHVLJQHUV7KHLQWHULRURUWKHODUJHU VWRUHGHYHORSVDURXQGDVWDJHOLNHGLVSOD\IHDWXUHWKDWXVHV OLJKW DV\VWHPRIFRQFHDOHGOLJKW¿WWLQJV WRIRFXVVKRSSHUV¶ DWWHQWLRQRQGLVSOD\HGJDUPHQWV7KHLQWHULRURIWKHVPDOOHU VKRSXQIROGVIURPWZRZDOOWRZDOOFORVHWVPD[LPLVLQJ SUHFLRXVFLUFXODWLRQDUHDZKLOHVLPXOWDQHRXVO\SURYLGLQJ DORWRIGLVSOD\DQGVWRUDJHVSDFH'HOLYHUHGZLWKDWLJKW EXGJHWERWKSURMHFWVUHTXLUHGDVWURQJVHFRQGDU\OLQHRI WKLQNLQJEDVHGVROHO\RQFRVWRIVHUYLFHVDQGPDWHULDOV ([FHOVSUHDGVKHHWVZHUHXVHGDVDQHTXDOGHVLJQWRROWR&$' Project Data: %HOJUDGH6HUELD ¼DQG¼PðDQG PðLQWHULRUVFRPPHUFLDO FRPSOHWHGH[KLELWHGDW6DORQ RI$UFKLWHFWXUH%HOJUDGH

32

PORTFOLIO, Orsalia Maria Dimitriou, PhD


THE SHOP Shopfront Design Athens 7KH6KRSLVDVWRUHRIFRQWHPSRUDU\XUEDQFORWKLQJLQWKHFHQWUH RI$WKHQV 7KH FOLHQW UHTXHVWHG WKUHH GLIIHUHQW GHVLJQV IRU WKH VKRSZLQGRZHDFKRQHIRUDGLIIHUHQWFROOHFWLRQVSULQJVXPPHU DQGDXWXPQ3ULQWVRQFDUGERDUGDVWURWXUISODVWLFDQLPDOVDQG ULEERQVDOODWWDFKHGWRGH[LRQIUDPHZHUHFUHDWLQJDIXQQ\DQG VXUSULVLQJVWDJHIRUWKHPDQHTXLQV ,W ZDV DOVR D TXHVW WR FUHDWH D UHVXOW WKDW ZRXOG DWWUDFWLQJ WKH SDVVHUE\V DWWHQWLRQ ZLWKRXW RYHUVKDGRZLQJ WKH H[KLELWHG FORWKHV 

33

PORTFOLIO, Orsalia Maria Dimitriou, PhD


MAYOR HALL Urban Design Competition Ioannina 7KH FRPSHWLWLRQ EULHI UHTXLUHG WKH SUHOLPLQDU\ GUDZLQJV RI D QHZPD\RUKDOOLQWKHFLW\RI,RDQQLQDLQ*UHHFH7KHSURSRVHG VROXWLRQ DSDUW IURP EHLQJ D IXQFWLRQLQJ FRQWHPSRUDU\ EXLOGLQJ FUHDWHVDQHZSXEOLFVSDFHWKDWFRQWLQXHVLQWKHLQWHULRURIWKH EXLOGLQJ 7KH HPEUDFLQJ SRVLWLRQ RI WKH EXLOGLQJ DQG WKH ÀX[ RI WKH PRYHPHQWV RI WKH SXEOLF LQYRNH SHUPHDELOLW\ DQG FLYLF SDUWLFLSDWLRQ7KHHQWU\ZRQWKHVHFRQGSULFH

SRVVLWLRQKHOG$66,67$17$5&+,7(&7$&+,7(&785$/ 7($000$1'$/$.,B.9$=$.$6B.'$6.$/$.,6

37

PORTFOLIO, Orsalia Maria Dimitriou, PhD


AMVYX WAREHOUSE Industrial New Build Mesogea, Attica 7KHEXLOGLQJFRQLVWVRIWZRSDUWVVWRUDJHVSDFHRFFXS\LQJWKH PDMRULW\RIRQWKHJURXQGÀRRUDQGRQWKHEDVHPHQWDQGRI¿FH VSDFHRQWKHJURXQGOHYHO'LIIHUHQWYROXPHWULFWUHDWPHQWPDUNV WKHIXQFWLRQV7KHXQLIRUPLW\RIVWRUDJHDUHDLVFRQWUDVWHGZLWK WKHODYLVKQHVVRIWKHRI¿FHV7RWRQHWKHFRQWUDVWGRZQIDFDGHV DUHWUHDWHGE\WKHVDPHPDWHULDO7KHKLJKWDQGWKHVL]HRIWKH ZDUHKRXVHLVWKHPD[LPXPDOORZHGE\XUEDQUHJXODWLRQV SRVVLWLRQKHOG$5&+,7(&7$1721,6*(25*,$',6(1*, 1((56

38

PORTFOLIO, Orsalia Maria Dimitriou, PhD


KAMPERIS WAREHOUSE Industrial New Build Attica 0HVRJHDLVWKHQHLJKERXULQJDUHDRI$WKHQVQHZDLUSRUWZKLFKLV QRZDGD\VGHYHORSLQJLQWHQVLYHO\DVDQLQGXVWULDODQGZDUHKRXVH TXDUWHU 7KH FXVWRPHU ZDQWHG WR FRQVWUXFW D ORJLVWLF ZDUHKRXVH ZLWK RI¿FHIDFLOLWLHVLQRUGHUWRUHQW7KHUHTXLUHPHQWVZHUHWRFUHDWH WKHVWRUDJHVSDFHUHQWDEOHWRWZRGLIIHUHQWFXVWRPHUV7KHVRIWHU easier to excavate soil found in the back of the plot during the JHRORJLFDO VWXG\GHWHUPLQHGWKHSRVLWLRQRIWKHEDVHPHQW7KH PDLQ8EHDPFROXPQVWUXFWXUHSDUWLDOO\IROORZVWKHEDVHPHQW V FRQFUHWH FROXPQV JULG 7ZR IXQFWLRQV VWRUDJH DQG RI¿FH DUH HQKDQFHGE\WKHXVHRIGLIIHUHQWPDWHULDOV

SRVVLWLRQKHOG$5&+,7(&7$1721,6*(25*,$',6(1*, 1((56

39

PORTFOLIO, Orsalia Maria Dimitriou, PhD


ALFA ROMEO SHOWROOM Commercial New Build Athens 7KHGXDOLW\RIWKHEXLOGLQJEHLQJDWWKHVDPHWLPHERWKVKRZURRP DQGJDUDJHZDVXQL¿HGZLWKWKHLQGXVWULDOVNLQ 7KH PHUH IXQFWLRQDOLVP RI WKH SURFHVV RI UHSDLU DQG GLVSOD\ PDUNHGWKHGLIIHUHQWLDWLRQLQWKHLQWHULRUZKLFKDUHFXVWRPLVHGWR UHVSRQGWRWKHDHVWKHWLFVRI$OID5RPHREUDQG

SRVVLWLRQKHOG$5&+,7(&7.$3213(5*$0,$1$5&+, 7(&76

40

PORTFOLIO, Orsalia Maria Dimitriou, PhD


LANCIA, FIAT & SUZUKI PAVILIONS Pavilion Design International Car Expo, Athens The design of the pavilion had to represent the aesthetics of HDFKFRPSDQ\ZKLOHHQFRPSDVVLQJHOHPHQWVRIVXUSULVHLQRUGHU to attract the visitors of the exhibition inside the pavilion and also YLVXDOO\HQJDJHWKHPIRUWKHORQJHVWSRVVLEOHWLPH ,PSRUWDQWHOHPHQWVWKDWLQÀXHQFHGWKHGHVLJQDUHWKHGLUHFWLRQRI WKHÀRZRIYLVLWRUVWKHVL]HDQGORFDWLRQRIWKHH[KLELWLRQVSDFH DQGWKHPDUNHWLQJVWUDWHJLHVRIHDFKRIWKHFRPSDQLHV

RQUUKVKQPJGNF#4%*+6'%6-#2102'4)#/Ä +#0#4%*+6'%65

41

PORTFOLIO, Orsalia Maria Dimitriou, PhD


OFFICE AND RETAIL BUILDING Commercial New Build Mesogeion Avenue, Athens 7KLV PL[HGXVH EXLOGLQJ LV RQ RQH RI WKH EXVLHVW DQG IDVWHVW $WKHQLDQ DYHQXHV 7KH YROXPH RI WKH EXLOGLQJ ZDVGHVLJQHGZLWKWKHLQWHQWLRQRIFDSWXULQJIUDJPHQWVRI GULYHUV DWWHQWLRQZKLOHVSHHGLQJDORQJLQWKHLUFDUV 7KHEDVHRIWKHEXLOGLQJFRQVLVWVRIWKUHHUHWDLOXQLWVZKLFK H[WHQGWRWKHEDVHPHQWDVVWRUDJHVSDFH7KHXSSHUÀRRUV DUH RSHQ SODQ RI¿FHV DQG DUH DFFHVVHG E\ D VHSDUDWH HQWUDQFH7KHGLIIHUHQFHEHWZHHQUHWDLODQGRI¿FHXQLWVLV DFFHQWXDWHGE\WKHEUHDNRIPDLQYROXPHLQWZRDQGWKH XVHRIGLIIHUHQWPDWHULDOV

SRVVLWLRQKHOG$5&+,7(&7.$3213(5*$0,$1$5&+, 7(&76

42

PORTFOLIO, Orsalia Maria Dimitriou, PhD


TWIN BUILDINGS Residential New Build Porto Rafti 7KH FXVWRPHU RZQHG WZR QHLJKERXULQJ SORWV LQ 3RUWR 5DIWL that could not be converted into one larger plot because of the OHJLVODWLYHUHTXLUHPHQWVRIWKHDUHD7KHUHIRUHWZRDWWDFKHGEXW DXWRQRPRXVKDELWDWLRQEXLOGLQJVKDGWREHEXLOW7KHVL]HRIHDFK EXLOGLQJ LV WKH PD[LPXP DOORZHG DQG LW LV FRPSRVHG RI WKUHH ÀRRUV DQG WKH SLORWL 7KH SLORWL PD[LPLVHV WKH YLHZ WR WKH VHD IURQW LQ HYHU\ DSDUWPHQW DQG DGGV P WR WKH DOORZHG KHLJKW RI WKHEXLOGLQJ(DFKDSDUWPHQWKDVDOLYLQJURRPDQGGLQQLQJURRP IDFLQJ WKH VHD D VHUYLFH ]RQH FRQWDLQLQJ WKH NLWFKHQ DQG WKH EDWKURRPVDQGWKHEHGURRPVIDFLQJWKHQRUWKKLOOV7KHIDFDGHV RIWKHWZREXLOGLQJVKDYHVLPLODUFKDUDFWHUDQGDUHGHULYHGIURP WKHDUHD VFKDUDFWHULVWLFV SRVVLWLRQKHOG$5&+,7(&7$1721,6*(25*,$',6(1*, 1((56

43

PORTFOLIO, Orsalia Maria Dimitriou, PhD


DYONISSOS Residential New Build Athens 7KLVLVDJURXQGÀRRUDSDUWPHQWUHIXUELVKPHQWSURMHFWLQ &ODSWRQLQ(DVW/RQGRQ'XHWRWKHRXWGDWHGDQGGLODSLGDWHG FRQGLWLRQRIWKHLQWHULRUDWWKHWLPHRISXUFKDVHWKHHQWLUHÀDW KDGWREHUHIXUELVKHG8UVXODNHSWLQFORVHFRQWDFWZLWKWKH clients throughout the design and construction phases to deliver DQRQREWUXVLYHGHVLJQWKDWZLOOVXLWFOLHQWV¶EXV\OLIHLQEHWZHHQ /RQGRQDQG6\GQH\DQGDOORZIRUWKHLUJXHVWVWRXVHWKHÀDWLQ WKHLUDEVHQFH

Project Data: $SDUWPHQWUHIXUELVKPHQW 100m² completed #residential #newbuild #athens

44

PORTFOLIO, Orsalia Maria Dimitriou, PhD


DYONISSOS Residential New Build Athens

45

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PALIA PENTELI Residential Entrance Design Athens The brief required the replacement of the existing residence's JDWHZLWKDQHZRQHZLWKDQDGGLWLRQRIDJDUDJHVKHOWHU$Q/ VKDSHG FRQFUHWH HOHPHQW XQL¿HV WKH HQWUDQFH DQG WKH JDUDJH 7KHZRRGSODQNVWKDWDUHFODGGLQJWKHGRRUVDUH¿WWHGDSDUWMXVW HQRXJKWRDOORZIRUDVKRUWJOLPSVHDWWKHLQWHULRUIURPRXWVLGH The strict geometrical shape of the entrance complex built in rough and unadorned materials is complimenting residence's HOHJDQWDQGVLPSOHVW\OH

(4106(#%#&' 

6(&7,21$$

&216758&7,21'(7$,/6

46

PORTFOLIO, Orsalia Maria Dimitriou, PhD

522)3/$1

6+(/7(53/$1

3/$1


D. AREOPAGITOU Facade Design Competition Athens

7KH FRPSHWLWLRQ ZDV DQ DWWHPSW WR VWRS WKH FDPSDLJQ IRU GHPROLVKLQJ WZR OLVWHG EXLOGLQJ WKDW DUH EHWZHHQ WKH$FURSROLV DQGWKH1HZ$FURSROLV0XVHXPDQGWKXVSDUWLDOO\EORFNLQJWKH FOHDU OLQH RI VLJKW EHWZHHQ WKHVH WZR DWKHQLDQ ODQGPDUNV 2XU proposal tries to achieve a reconciliation: as these buildings DUHWXUQLQJWKHLUEDFNVWRWKHPXVHXPWKH\QHHGWRHVWDEOLVKD QHZUHODWLRQVKLSZLWKLWDQGLQWKHVDPHZD\WKDWEXLOGLQJVRIDOO DGMDFHQWEORFNVDUHIDFLQJWKHPXVHXPVRVKRXOGWKHVHWZR 0RUSKRORJ\ RI WKH PDLQ IDFDGHV LV UHFUHDWHG RQ WRS RI WKH HTXLYDOHQWVHFRQGDU\RQHV3HUIRUDWHGVWDLQOHVVVWHHOSDQHOVDUH ¿[HGRQWRPHWDOIUDPHVDQGSRVLWLRQHGPPLQIURQWIURPWKH H[LVWLQJIDFDGHV7KHPRWLIRQWKHSDQHOVUHSUHVHQWVWKHIDFDGHV RQ ' $UHRSDJLWRX DQG 0LWVDLRQ 6WUHHWV DQG LV FUHDWHG E\ PRGLI\LQJ SHUIRUDWLRQ GHQVLW\ 3HUIRUDWLRQV DOORZ IRU YHQWLODWLRQ DQG FUHDWH VKDGH ZLWKRXW REVWUXFWLQJ GD\OLJKW 3DQHO VXUIDFHV DUHWUHDWHGZLWKHOHFWULFLW\WRJDLQ\HOORZJUD\VKDGHVWKDWPDWFK ZLWKWKHURFNRI$FURSROLVGRPLQDWLQJWKHVLJKW

47

PORTFOLIO, Orsalia Maria Dimitriou, PhD




MANIATIS HOTEL Hospitality Fit-Out Sparta 0DQLDWLV KRWHO LV VLWXDWHG LQ WKH KLVWRULF FHQWUH RI 6SDUWD 7KH RULJLQDO EXLOGLQJ ZDV FRQVWUXFWHG LQ WKH ¶V DQG D GUDVWLF UHQRYDWLRQRIOREE\DQGUHVWDXUDQWDUHDZDVQHHGHG$PLQLPDO VROXWLRQ ZDV SURSRVHG LQ RUGHU WR EH FRKHUHQW WR WKH 6SDUWDQ ULJRURXVDQGVLQFHUHFKDUDFWHU 7KHFHQWUDOSRLQWRIWKHVSDFHGHVLJQWKHUHFHSWLRQLVORFDWHG EHWZHHQ WKH UHVWDXUDQW DQG WKH OREE\ 0RELOH JODVV SDUWLWLRQ ZDOOVDUHXVHGWRVHSDUDWHRUXQLI\WKHVSDFHGHSHQGLQJRQWKH QHHGDOORZLQJWKHVXQOLJKWWRSHQHWUDWHDWDQ\WLPH 7KH UHODWLYHO\ VPDOO GLPHQVLRQV RI WKH VSDFH DUH YLVXDOO\ LQFUHDVHGE\XVLQJDVSHFLDOZDOOSDLQWLQJWHFKQLTXHZLWKPHWDO JORVV )RU WKH VDPH UHDVRQ D ORW RI WUDQVSDUHQW DQG PHWDOOLF IXUQLWXUH LV XVHG 7KH IXUQLWXUH ZDV VHOHFWHG ZLWK GHVLUH WR UHVHPEOHWKHVSRQWDQHLW\DQGFRPIRUWQHVVRIDKRXVHDQGQRW DQDXVWHUHORJLFRIDKRWHOOREE\6RPHSDUWVRILOOXPLQDWLRQDUH FXVWRPPDGHLQRUGHUWRFRQWULEXWHWRWKHVSDFH¶VFKDUDFWHU SRVVLWLRQKHOG$5&+,7(&7:)250'(6,*1

0$1,$7,6+27(/B35(66&/,33,1*6 38%/,6+(',10$,621'(&25$7,210$<

48

PORTFOLIO, Orsalia Maria Dimitriou, PhD


ELOUNDA BAY HOTEL Hospitality Fit-Out Crete (ORXQGD %OXH %D\ LV VLWXDWHG LQ &UHWH DQG WKRXJK LV RSHQ GXULQJ WKH ZKROH \HDU LW IXQFWLRQV PDLQO\ DV D VXPPHU UHVRUW 7KHSURMHFWUHTXLUHGWKHUHQRYDWLRQRIWKHOREE\EDUUHVWDXUDQW URRPVFRQIHUHQFHURRPDVZHOODVIDoDGHXSOLIW:HZDQWHGWR FUHDWH DQ DPELHQW WKDW ZRXOG EH FRQWHPSRUDU\ FRORXUIXO DQG IUHVK7KHEURZQWLOHÀRRUZDVUHSODFHGZLWKDOLJKWEHLJHHSR[\ RQHWKDWLQFUHDVHGOXPLQRVLW\WRWKHOREE\DQGUHFHSWLRQVSDFH 6LPSOHIXUQLWXUHSLHFHVZHUHFRPELQHGZLWKNH\GHVLJQHOHPHQWV OLNH WKH UHFHSWLRQ IXUQLWXUH WKH EDU VKHOYHV DQG WKH UHVWDXUDQW VKXWWHUVPRVWRIWKHPPDGHRIORFDOPDWHULDOVDQGFRORXUVRIWKH &UHWDQ(DUWK

SRVVLWLRQKHOG$66,67$17$5&+,7(&7:)250'(6,*1

49

PORTFOLIO, Orsalia Maria Dimitriou, PhD


ELOUNDA BAY HOTEL Hospitality Fit-Out Crete

50

PORTFOLIO, Orsalia Maria Dimitriou, PhD


POLIS GRAND HOTEL Hospitality Fit-Out Athens 3ROLVKRWHOLVVLWXDWHGLQWKHFHQWUHRI$WKHQV7KHRULJLQDO EXLOGLQJZDVGRQHLQWKH¶VDQGUHQRYDWLRQRIDOOSXEOLF VSDFHV UHFHSWLRQDQGDVPDOOOREE\EDURQWKH¿UVWOHYHO WRLOHWVDQGRI¿FHVRQWKHVHFRQGUHVWDXUDQWNLWFKHQOREE\DQG ELVWURRQWKHWKLUGDQGURRIJDUGHQRQWKHWHUUDFH ZDVQHHGHG 7KHLQWHQWLRQZDVWRFUHDWHDFRPSOHWHO\QHZDWPRVSKHUH WKDWZRXOGEHIUHVKDQGIULHQGO\'XHWRWKHUHVWULFWHGVSDFH HVSHFLDOO\RQWKHWKLUGOHYHOWKHUHZHUHSURSRVHGVROXWLRQVZLWK WUDQVIRUPDEOHFKDUDFWHULHIXUQLWXUHWKDWFRXOGVHUYHGLIIHUHQW IXQFWLRQVPRYDEOHSDUWLWLRQZDOOVLQRUGHUWRVPXGJHWKHOLPLWV RIHDFKIXQFWLRQ7KHDLUFRQGLWLRQGXFWVDUHYLVLEOHLQVWHDGRI EHLQJKLGGHQLQVXVSHQGHGFHLOLQJRIIHULQJDGGLWLRQDOKHLJKWLQ WKHWKLUGOHYHO 7KHXVHRIDUWZRUNVVXFKDVWKHZLUHVFXOSWXUHVLQWKH HQWUDQFHDQGWKHOREE\DQGWKHIRXUPHWHUORQJSHDUOFKDQGHOLHU WKDWLVXQLI\LQJWKH¿UVWDQGVHFRQGOHYHOFRQWULEXWHVWRWKH IRUWKFRPLQJDQGGLVWLQFWDWPRVSKHUHRIWKHKRWHOVSDFHV

SRVVLWLRQKHOG$5&+,7(&7:)250'(6,*1

51

PORTFOLIO, Orsalia Maria Dimitriou, PhD


POLIS GRAND HOTEL Hospitality Fit-Out Athens

52

PORTFOLIO, Orsalia Maria Dimitriou, PhD


ATLANTIS HOTEL

MALIA HOTEL

Hospitality Fit-Out

Hospitality Fit-Out

Crete

Crete

53

PORTFOLIO, Orsalia Maria Dimitriou, PhD


EPHEMERAL STRUCTURES FOR THE OLYMPIC GAMES Pavilion Design 

Athens 7KHVWUXFWXUHLVWUDQVSRUWHGDQGVWRUHGDVDFRQWDLQHU:KHQLQVWDOOHG RQDVLWHWKHFRQWDLQHURSHQVDQGFUHDWHVDVSDFHIRUDVLPSOHJDPH 7KHJDPHJLYHVDQRSSRUWXQLW\WRSHRSOHWRH[SUHVVWKHPVHOYHVSXEOLFO\ LQZULWWHQIRUP$WWKHIURQWVLGHRIWKHFRQWDLQHUWKHWH[WVDUHGLVSOD\HG RQ SXEOLF VSDFH RQ D PHFKDQLFDO VFUHHQ$W WKH EDFN VLGH WH[WV DUH SUHSDUHGGLVFXVVHGDQGQHJRWLDWHG Parasite / Ephemeral 7KHVWUXFWXUHLVQRWPRXQWHGEXWXQIROGHG,WFDQIXQFWLRQIXOO\RUSDUWLDOO\ RSHQ DGDSWLQJ LWV VKDSH WR WKH VLWH :KHQ LW LV LQVWDOOHG WKH FRQWDLQHU EUHDNV WR GLIIHUHQW UHFWDQJXODU VXUIDFHV WKH LQVLGH LV H[SRVHG DQG D VSDFH LV FUHDWHG IURP YHUWLFDO DQG KRUL]RQWDO UHFWDQJXODU HOHPHQWV Using rectangular forms and rough materials the structure adapts to the PRUSKRORJ\RIWKHXUEDQVSDFHRI$WKHQV,WVPDLQIDFDGH WKHVFUHHQ  LVFKDQJLQJHYHU\WLPHLWLVXVHG,WVHSKHPHUDOLW\DQGLWVFKDQJHDELOLW\ DUHH[SUHVVHGLQLWVIRUPZKHQLWLVRSHQ 1

2SHQDQGDGMXVWIHHWEHIRUHSODFH

8

2SHQSDQHODQG¿[KRUL]RQWDO\

2

Unlock and pull open panel of screen lights

9

3XOORXWDQGKXQJÀRRU

3

8QORFNVFUHHQFRYHUDQG¿[LQKRUL]RQWDOSRVLWLRQ

10 3XOORXWOLEUDU\

4

&RQHFWSRZHUVXSSO\

11 Close panel

5 Unlock and open entrance ramp 6

3XVKURRIXSDQG¿[LQSRVLWLRQ

7 8QORFNEDFNGRRUDQGOHWURSHVVOLGHJHQWO\

54

PORTFOLIO, Orsalia Maria Dimitriou, PhD

 







 

 



12 Open tent




STEGI RECEPTION Interior Design Athens 5HQRYDWLRQRIWKHLQWHULRUSXEOLFOREE\UHFHSWLRQHQKDQFLQJ WKHXVHUH[SHULHQFH7KLVUHFHSWLRQGHVLJQLVRQHLQDVHULHV RIGHVLJQIRUGLIIHUHQWSXEOLFDUHDVLQ6WHJLWKDWLQWHQGWRWXUQ VLPSOHSXEOLFO\DFFHVVLEOHVSDFHVLQWRLQWHUQLRUODQGVFDSHV

IJĮȝİȓĮ

55

PORTFOLIO, Orsalia Maria Dimitriou, PhD


MONOLOGOS Exhibition Design Barcelona 7KH3URMHFWUHTXLUHGERWKWKHFXUDWLRQRIDQH[KLELWLRQDQGWKH GHVLJQRIWKHH[KLELWLRQVSDFHZKLFKZDVLQVLGHWKHPRQDVWHU\ RI 6DQWD 0DULD GH 3HGUDOYHV LQ %DUFHORQD 7KH WRSLF RI WKH exhibition had to be related to "malestar= being in an bad FRQGLWLRQ7KHWRSLFWKDWZDVFKRVHQZDVVROLWXGHH[SUHVVHGDV PLVFRPPXQLFDWLRQ7KHZRUNVWKDWZHUHFKRVHQDUHFULWLFL]LQJWKH rupture of social and personal relationships and are culminating ZLWKZKLWHDVLWHVSHFL¿FLQVWDOODWLRQDERXWDOLHQDWLRQ 7KH FKDUDFWHU RI WKH VSDFH ZDV PDLQWDLQHG E\ PLQLPL]LQJ DQ\ LQWHUYHQWLRQ QHFHVVDU\ IRU WKH H[KLELWLRQ DQG OHDYLQJ DV PDQ\ XQFRYHUHG VXUIDFHV DV SRVVLEOH &RQFUHWH /VKDSHG SDQHOV LQ QDWXUDOFRORXUZHUHXVHGIRUH[KLELWLQJWKHZRUNVDQGGLUHFWLQJ WKH SXEOLF 7KH VSDWLDO FKDUDFWHULVWLFV ZHUH FRPSOHWHO\ DQG GHOLEHUDWHO\ HUDVHG LQVLGH ZKLWH7KH YLVLWRU HQWHUV DQG LV GLUHFWHG WKRXJK FRUULGRUV ZLWK LPSHFFDEOH ZKLWH VXUIDFHV WR SULYDWH YLHZLQJ ERRWKV +H LV OLVWHQLQJ WR D LQFRPSUHKHQVLEOH PXUPXU7KHVRXQGVWRSVLQVLGHWKHERRWKV+HDORQHFDQSHHS WRDZKLWHYRLGFXEH 678'(17352-(&7B,1&2//$%25$7,21:,7+69,//$5 9$=48(=$1'3,1*/(6,$6

56

PORTFOLIO, Orsalia Maria Dimitriou, PhD


LONDON CONTEMPORARY MUSIC FESTIVAL / LCMF Temporary Interior Fit-Out London, UK /&0)³WKHFDSLWDO¶VPRVWDGYHQWXURXVDQGDPELWLRXVIHVWLYDO RIQHZPXVLF´DVQDPHGE\7KH*XDUGLDQWRRNRYHUDIRUPHU FDUSHWIDFWRU\MXVWRII%ULFN/DQHEHWZHHQ0DUFKDQG0D\ WRRIIHUWZRZHHNVRIPXVLFDUWDQGSHUIRUPDQFH6WXGLR 6<1GHYHORSHGDVSDWLDOFRQFHSWWKURXJKDQLQWHQVHFUHDWLYH GLDORJXHZLWKWKHRUJDQL]HUVDQGGHOLYHUHGWKH¿WRXWRQDQ H[WUHPHO\WLJKWEXGJHWDQGWLPHVFDOH%UXWDOFRQFUHWHLQWHULRU SUHVHQWHGDQDHVWKHWLFLQVSLUDWLRQDQGDQDFRXVWLFFKDOOHQJH 0H]]DQLQHEDOXVWUDGHRUJDQLFDOO\H[WHQGHGWKHLQWHULRUDQG comprised an unorthodox combination of a modular scaffolding V\VWHPDQGEOXH\DFKWLQJURSH7KH¿WRXWIXUWKHULQFOXGHG DXGLHQFHVHDWLQJEDUDUHDOLJKWLQJVWDJHVHWGHVLJQLQVWDOOLQJ DXQLTXHVSHDNHUVRXQGV\VWHPDQGYDULRXVDFRXVWLFDQG YLVXDOFRQWUROV Project Data: PXVLFIHVWLYDO¿WRXW Pð …

#artsandculture #temporaryspaces #performativespaces

57

PORTFOLIO, Orsalia Maria Dimitriou, PhD


LONDON CONTEMPORARY MUSIC FESTIVAL / LCMF Temporary Interior Fit-Out London, UK

2.550m

6.5

0m

4.80m

module (option diamod)

4.80m

5.150m

m

50

1.565

3.1

m

rope

m

11.

0m

315

1.25

1.80

m

m

80

30

2.3

num. modules =

len gth

:U

P2

9.4

len gth

:D

35m

OW N

14.

343

58

PORTFOLIO, Orsalia Maria Dimitriou, PhD

TOTAL Stairs rope: (14.343+29435) x 2 = 87.557m

m


RAINBOW OF DESIRES Pavilion Design Dalston, London ³5DLQERZRIGHVLUHV´LVDVHWRIVPDOOSDYLOLRQVLQVWDOOHGLQWKH RSHQVSDFHVRIWKH5KRGHVHVWDWHLQ'DOVWRQ'XULQJDSHULRGRI three months the pavilions are doubling as performative devices DQGZRUNVKRSVSDFHVEDVHGRQWKHWHFKQLTXHVRIWKHWKHDWUHRI WKH2SSUHVVHGDQGVSDFHVRIFRPPXQDOHYHU\GD\OLIH SXEOLF VHDWLQJDUHDDQRSHQNLWFKHQDQH[FKDQJHOLEUDU\DFLQHPD  The central space becomes an active public space and the FHQWUDOVWDJHRIIRUXPWKHDWUHKRVWLQJWKHRSHQSHUIRUPDQFHV ,QWKH7KHDWUHRIWKH2SSUHVVHGWKHDXGLHQFHEHFRPHVDFWLYH VXFKWKDWDV³VSHFWDFWRUV´WKH\H[SORUHVKRZDQDO\VHDQG WUDQVIRUPWKHUHDOLW\LQZKLFKWKH\DUHOLYLQJ±WKHUHDOLW\RIOLYLQJ LQDVRFLDOKRXVLQJHVWDWHDFXUUHQWO\µHQGDQJHUHG´W\SHRIVSDFH LQ/RQGRQWKURXJKSURFHVVHVRISULYDWLVDWLRQDQGJHQWUL¿FDWLRQ 7KHVRFLDOKRXVLQJWHQDQWVRIWHQ¿QGWKHPVHOYHVVLOHQFHGDQG XQDEOHWRUHDFWWRWKHGHWHULRUDWLRQRIWKHLUHQYLURQPHQWWKHLU VRFLDOPDUJLQDOLVDWLRQDQGWKHLULPPLQHQWHYLFWLRQV:HSURSRVH DSHULRGLFDOZRUNVKRSZLWKWKHVRFLDOKRXVLQJWHQDQWVEDVHGRQ %RDO¶VWHFKQLTXHVWKDWXVHWKHDWUHDVPHDQVRISURPRWLQJVRFLDO DQGSROLWLFDOFKDQJH³5DLQERZRIGHVLUHV´FUHDWHVVRFLDOFXOWXUDO DQGPDWHULDOYDOXHIRUWKHFRPPXQLW\RIWKHHVWDWHUHVLGHQWV7KH PDWHULDOUHIHUVWRWKHDFWXDOVSDFHWKHRSHQVSDFHRIWKHHVWDWH WKDWWXUQVLQWRFRPPRQVSDFH7KHVRFLDOYDOXHUHJDUGVWKH VKDULQJRIH[SHULHQFHVGHVLUHVDQGDIIHFWVWKHVWUHQJWKHQLQJRI WKHFRPPXQLW\7KHFXOWXUDOYDOXHLVFUHDWHGWKURXJKWKHWKHDWUH LWLVWKHFXOWXUHRIWKHHVWDWHRIVRFLDOKRXVLQJRILWVUHVLGHQWV WKHVWRULHVRIHYHU\GD\OLYHVRIH[FHSWLRQDOHYHQWVDQGRIWKHLU VWUXJJOHVLWWKHWKHLUVKDUHGKLVWRU\DVDFROOHFWLYHDVVHW$FRP PRQVZKRVHPDLQYDOXHVHPSRZHUPHQWDQGUHVLOLHQFHVWD\ LQWKHKDQGVRIWKHFRPPRQHUVRQFHWKH³5DLQERZRIGHVLUHV´ PRYHVWRDGLIIHUHQWHVWDWH

59

PORTFOLIO, Orsalia Maria Dimitriou, PhD


RAINBOW OF DESIRES Pavilion Design Dalston, London

60

PORTFOLIO, Orsalia Maria Dimitriou, PhD


NOTRE DAME The Divine Body: Memento Mori and Collective Sublimations of the Death Drive Urban Design Competition Paris

61

PORTFOLIO, Orsalia Maria Dimitriou, PhD


NOTRE DAME The Divine Body: Memento Mori and Collective Sublimations of the Death Drive Urban Design Competition Paris

2XUSURSRVDOIRU1RWUH'DPHLVVXSSRUWHGE\WZR SULQFLSOHV7KH¿UVWRQHLVWKH0HPHQWR0RULUHÀHFWLRQ RQPRUWDOLW\RULJLQDWLQJIURPWKHPHGLHYDO&KULVWLDQ WKHRU\7KHVHFRQGLVWKH&ROOHFWLYH6XEOLPDWLRQRI WKH'HDWK'ULYHDSSOLFDWLRQRIDUFKLYDOWKHRU\DQG SV\FKRDQDO\VLVRQWKHOLVWHGERG\RIWKHFKXUFK ,QVWHDGRIVSHQGLQJELOOLRQVIRUUHQRYDWLRQZHSURSRVHD UDGLFDO\HWVXEOLPHJHVWXUHWRHQKDQFHWKHVSLULWXDODQG PDWHULDODVSHFWVRI1RWUH'DPHDQGGHOLYHUDQHFRQRPLF DQGHOHJDQWVROXWLRQ,WZLOOFRPPXQLFDWHWKHIHHOLQJRI DZHFRPLQJIURPERWKGLYLQHDQGQDWXUDOIRUFHV 7KHWKHRUHWLFDOIUDPHZRUNLVEDVHGRQ'HUULGD¶VSKLORVRSK\ GHYHORSHGLQ$UFKLYH)HYHU)RU'HUULGDDUFKLYHVFDQEH

62

PORTFOLIO, Orsalia Maria Dimitriou, PhD

H[SORUHGWKURXJKSV\FKRDQDO\VLV±WKH\FDUU\ERWKOLIHDQG GHDWKGULYHV7KHOLIHGULYHLVWKHGULYHWKDWOHDGVWRZDUGV WKHFUHDWLRQDQGSUHVHUYDWLRQRIOLIHZKHUHDVWKHGHDWKGULYH FRXQWHUDFWVOLIHDQGDOZD\VSXVKHVWRZDUGVH[WLQFWLRQ:KHQ LWFRPHVWRDUFKLWHFWXUHOLVWHGEXLOGLQJVFDQEHXQGHUVWRRG as the manifestation of the life drive because their material LQWHJULW\LVSUHVHUYHG<HWEXLOGLQJVDOZD\VGHJHQHUDWHDQG WKLVLQDUFKLYDOWHUPVLVWKHPDQLIHVWDWLRQRIWKHGHDWKGULYH ,Q)UHXGLDQSV\FKRDQDO\VLVWKHWZRGULYHVPXVWEHLQD EDODQFH,PEDODQFHFDQOHDGWRPDVRFKLVPRUVHOIGHVWUXFWLRQ :HVKDOOWKHUHIRUHFRQVLGHU1RWUH'DPHDKLVWRULFEXLOGLQJ WREHDQDUFKLYH,IWKHGHDWKGULYHLVQRWUHOHDVHGLW FDQEHFDWDVWURSKLFWRWKHDUFKLYHLWVHOI2XULQWHQWLRQ

is to release the death drive inherent to all archives and IDFLOLWDWHWKHGHFD\WRWDNHSODFHIUHHO\IRUWKHVDNHRI 1RWUH'DPH¶VDUFKLWHFWXUH¶VORQJHYLW\DQGZHOIDUH 7KHSURSRVDOLVUHDOLVHGLQWKUHHVWDJHV,Q6WDJHZH¶OO ³SULPHWKHEDVH´E\DSSO\LQJWKH\DNLVXJLWHFKQLTXH FRQWUROOHG EXUQLQJIRUZRRGSUHVHUYDWLRQ WRWKHUHPDLQLQJURRIDQG WKHZRRGHQSDUWVRIWKHFKXUFK7KHVXUURXQGLQJSDUNDQG URDGVDUHDOVRWREHFKDUUHGWRFUHDWHDVXLWDEOHVHWWLQJ,Q 6WDJHQHZSDWKVZLOOEHFDUYHG+HDY\EUDVVVKHHWVZLOOEH laid over the charred rubble to pave the main access to the FKXUFK%UDVVZLOODJHJUDFHIXOO\DQGLQV\QFKURQ\ZLWKWKH PHWDODUWHIDFWVDOUHDG\VFDWWHUHGDFURVVWKHVLWH,Q6WDJH VHHGVRIGDUNOHDIHGYHJHWDWLRQZLOOEHSODQWHGDQGDOORZHGWR

IUHHO\H[SDQGFRPSOHPHQWLQJWKHPDVWHUSODQDQGWKHUXLQ 7KH¿QDOUHVXOWZLOOEHDQ$UFDGLDQODQGVFDSHDEHDXWLIXO )UHQFKVW\OHJDUGHQHQYHORSLQJWKHUHPDLQVRIWKHFKXUFK 0DVVHDQGRWKHUFHUHPRQLHVZLOOFRQWLQXHWDNLQJSODFH7KH FKXUFKZLOOVHUYHDVDPHPHQWRPRULDV\PEROLFUHPLQGHU RIPRUWDOLW\GLYLQH-XGJPHQWDQGWKHVDOYDWLRQRIWKH VRXOEULQJLQJGHDWKWRWKHIRUHIURQWRIFRQVFLRXVQHVV 2XUSURSRVDOZLOOFUHDWHDODQGVFDSHIRULQVSLUDWLRQ FRQWHPSODWLRQSUD\DQGDGPLUDWLRQDVWKHFKXUFK¶VERG\ regains its place as the most impressive Parisian monument WUDQVFHQGLQJLWVQDWLRQDODQGUHOLJLRXVPDWHULDOLW\DQGEHFRPLQJ DV\PERORIH[DOWDWLRQDQGSULGH±DV\PEROIRUKXPDQLW\


WHITE HOUSE REDUX Urban Design Competition Washington D.C. $5HPLQGHUIRUWKH(OHFWHGDQGWKH8QHOHFWHG7KH:KLWH +RXVHEHDUVWKHWUDFHRIHYHU\LQGLYLGXDOZKRKDVEHHQJLYHQ WKHULJKWWRUHVLGHLQLW:KDWWKHUHLVQRWUDFHRIDUHWKRVH ZKRWULHGDQGIDLOHGWRJDLQWKLVRI¿FH:LWKRXWWKHVHWKH 8QHOHFWHGWKHUHZRXOGEHQR(OHFWHG7KH2WKHU+RXVHLV DVSDWLDOUHSUHVHQWDWLRQRIWKH8QHOHFWHG,WLVDPLUURURIWKH :KLWH+RXVHVWULSSHGRILWVIXQFWLRQV,WFRXQWHUZHLJKWVWKH :KLWH+RXVH,WVHUYHVQRWDVDPHPRULDOEXWDVDUHPLQGHU RIWKHERG\RIHIIRUWVDVSLUDWLRQVKRSHVDQGGHVLUHVWKDW KDYHIHGLQWRDQGEXLOWXSWKH$PHULFDQHOHFWRUDOV\VWHP

Project Data: international concept FRPSHWLWLRQ:DVKLQJWRQ'& 86$

63

PORTFOLIO, Orsalia Maria Dimitriou, PhD


WHITE HOUSE REDUX Urban Design Competition Washington D.C.

64

PORTFOLIO, Orsalia Maria Dimitriou, PhD


AQUARIUM AND RESEARCH CENTER 6FLHQWL¿F)DFLOLW\6WXGHQW3URMHFW Ydrousa Based in the phrase "theatre is the mirror of life" the form of WKH EXLOGLQJ LV DFWXDOO\ DQ LQYHUVLRQ D PLUURULQJ RI WKH H[LVWLQJ EXLOGLQJFRQGLWLRQVLQWKHFHQWUHRI$WKHQVZKLFKDUHGRPLQDWHG E\ D UHSHWLWLYH UHFWDQJXODU JULG 7KH VKHOO RI WKH VFKRRO LV IRUPHG E\ QRQ UHFWDQJXODU VXUIDFHV ZKLOH WKH PHWDO VWUXFWXUH ZKLFKVXSSRUWVWKHVKHOODQGRUJDQL]HVWKHKXPDQPRYHPHQWLV RUJDQL]HGLQDQRUWKRJRQDOJULG%\XVLQJDV\VWHPRIPRXQWDEOH SODWIRUPV DQG VWDLUV DWWDFKHG RQ WKH JULG D YDULHW\ RI WKHDWUH VFHQHVFDQEHFUDWHGLQVLGHWKHEXLOGLQJRULQWKHLQQHU\DUG The educational spaces are composing the base of the building WKDWRSHQVWRZDUGVWKHVPDOOHUVWUHHWVZKLFKPDLQWDLQDVWURQJ QHLJKERXUKRRGIHHOLQJ7KHWKHDWULFDOSHUIRUPDQFHLVE\WKDWZD\ LQWHUIHULQJ ZLWK WKH GDLO\ DFWLYLW\ RI WKH GLVWULFW 7KH YLGHRWHTXH DQGWKHWKHDWUHDUHIRUPLQJWZRGLVWLQFWYROXPHVLQWKHWRSRIWKH EXLOGLQJWKDWDUHXQLWHGE\WKHIR\HUDQGDUHWXUQLQJWRZDUGVWKH PDLQDYHQXHH[SUHVVLQJWKHLUSXEOLFFKDUDFWHU

65

PORTFOLIO, Orsalia Maria Dimitriou, PhD


AQUARIUM AND RESEARCH CENTER 6FLHQWL¿F)DFLOLW\6WXGHQW3URMHFW Ydrousa

66

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PUBLIC SCHOOL OF THEATRICAL STUDIES Arts & Culture Building, Student Project Leoforos Alexandras, Athens 6RSKRFOHV VDLG ³WKHDWUH LV WKH PLUURU RI OLIH´ ,QVSLUHG E\ WKDW SKUDVH WKH IRUP RI WKH EXLOGLQJ LV DFWXDOO\ DQ LQYHUVLRQ D mirroring of the existing building conditions in the centre of $WKHQVZKLFKDUHGRPLQDWHGE\DUHSHWLWLYHUHFWDQJXODUJULG7KH ³VKHOO´RIWKHVFKRROLVIRUPHGE\QRQUHFWDQJXODUVXUIDFHVZKLOH WKHPHWDOVWUXFWXUHZKLFKVXSSRUWVWKHVKHOODQGRUJDQL]HVWKH KXPDQPRYHPHQWLVRUJDQL]HGLQDQRUWKRJRQDOJULG%\XVLQJ DV\VWHPRIPRXQWDEOHSODWIRUPVDQGVWDLUVDWWDFKHGRQWKHJULG DYDULHW\RIWKHDWUHVFHQHVFDQEHFUDWHGLQVLGHWKHEXLOGLQJRU LQWKHLQQHU\DUG The educational spaces are composing the base of the building WKDWRSHQVWRZDUGVWKHVPDOOHUVWUHHWVZKLFKPDLQWDLQDVWURQJ QHLJKERXUKRRGIHHOLQJ7KHWKHDWULFDOSHUIRUPDQFHLVE\WKDWZD\ LQWHUIHULQJ ZLWK WKH GDLO\ DFWLYLW\ RI WKH GLVWULFW 7KH YLGHRWHTXH DQGWKHWKHDWUHDUHIRUPLQJWZRGLVWLQFWYROXPHVLQWKHWRSRIWKH EXLOGLQJWKDWDUHXQLWHGE\WKHIR\HUDQGDUHWXUQLQJWRZDUGVWKH PDLQDYHQXHH[SUHVVLQJWKHLUSXEOLFFKDUDFWHU

67

PORTFOLIO, Orsalia Maria Dimitriou, PhD


ARTWORK, INSTALLATION & PERFORMANCE

68

PORTFOLIO, Orsalia Maria Dimitriou, PhD


BALANCING ACTS I – V Art Installation Dalston, London

³7KH\DUHDOOODGLHV 7KH\DUHGRLQJRN 7KHKDYHSURGXFHGDQGUHSURGXFHGDQGWKH\DUHPRUHRU OHVV¿QHO\SODFHGZLWKLQWKLVSHUSHWXDWLQJF\FOHNHHSLQJWKLQJV WRJHWKHU6RPHKRZ 2QHPRUHWR\RQHPRUHQXUVHU\UK\PHH[WUDXQSDLGZRUNORDG DQRWKHUNLORDQRWKHULGHDRIURPDQWLFGLQQHUDQRWKHUGURSRI PLONDQGWKH\DUHJRLQJGRZQ <HVWKHZHLJKWPLJKWEHLQVLJQL¿FDQWEXWLWLVMXVWHQRXJKWR VKLIWWKHLUEDODQFH´ 8UVXOD'LPLWULRXWHDPHGXSZLWK$OHVVDQGUD.LODD/RQGRQ EDVHGSKRWRJUDSKHUWRSURGXFHDVHULHVRILQVWDOODWLRQSLHFHV LQVSLUHGE\FKDOOHQJHGZRPHQIDFHEDODQFLQJEHWZHHQGRPHV WLFSURIHVVLRQDODQGSULYDWHOLYHV7KHZRUNVZHUH¿UVWGLV SOD\HGDW0HDQZKLOH'DOVWRQSURMHFWE\6WXGLR6<1

69

PORTFOLIO, Orsalia Maria Dimitriou, PhD


BALANCING ACTS I – V Art Installation Dalston, London

70

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PLUTO PANTOKRATOR Art Installation London 3OXWR 3DQWRNUDWRU LV DQ LPPHUVLYH LQVWDOODWLRQ UHSXUSRVLQJ HOHPHQWV RI ZRUNV SURGXFHG LQ EHWZHHQ  DQG  DW &HQWUDO6DLQW0DUWLQVRYHUWKHFRXUVHRIWKH0$)LQH$UWV7KH installation attempts to seek out and distil core thoughts on KXPDQ FRQGLWLRQ DQG QLKLOLVP VKDUHG E\ WKH ZRUNV FRPSULVLQJ WKHLQVWDOODWLRQ,WDOVRPDUNVWKHHQGRIWKHSHULRGRIWZR\HDUVRI LQWHQVHDUWSURGXFWLRQLQ&60¶V$UFKZD\VWXGLRV +RZHYHU WKH LQVWDOODWLRQ LV SULPDULO\ D WULEXWH WR D VLEOLQJ ZKR SDVVHGDZD\\HDUVDJRLQKLVHDUO\\RXWK$YLGHRLQWHJUDOWR WKHLQVWDOODWLRQVKRZVDGVFDQRIWKHFKLOG¶VPDUEOHEXVWSODFHG LQWKHFHQWUHRIWKHURWDWLQJLPDJH7KHWUDMHFWRU\RIWKHFDPHUD DURXQGWKHEXVWPDWFKHVWKHWUDMHFWRU\RIWKHSODQHW3OXWRDURXQG WKH6XQ1HYHUHQGLQJURWDWLRQRIWKHFDPHUDDURXQGWKHEXVW ORFNVWKHEXVWDQGWKHYLHZHULQDOLPER7KHOLWXSFHQWUDODOWDU OLNH DUHD LV MX[WDSRVHG ZLWK WKH FURVVOLNH VFUHHQ RQ ZKLFK WKH ORRSLQJYLGHRLVEHLQJSURMHFWHG&RQFHDOHGVSHDNHUVLQIXVHWKH DLULQWKHURRPLQORQJUHSHWLWLYHXQGXODWLQJVRXQGV 7KHWLWOHRIWKHZRUNSRLQWVDW3OXWRWKHUXOHURIWKHXQGHUZRUOG LQ*UHHNP\WKRORJ\DQGDVVLJQVWKHWLWOH3DQWRNUDWRUWRWKHGHLW\ ZKLFKLVFRPPRQO\XVHGIRU&KULVWZLWKWKHPHDQLQJµ$OPLJKW\¶ +HUH WKH WLWOH 3DQWRNUDWRU SDVVHG RQ WR 3OXWR VXJJHVWV D GLIIHUHQWRXWORRNDWRXUKXPDQRSWLRQV%ODFNEDQQHUVRQHLWKHU VLGHRIWKHLQVWDOODWLRQIXUWKHUHYRNH3OXWRZLWKLWVIRXUPRRQV The installation has been documented in the format of video and SKRWRVVKRZQEHORZ

71

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CHASING SYNCHRONY Art Performance Brighton 7KLVFROODERUDWLYHSHUIRUPDWLYHGUDZLQJZRUNLVDTXHVWIRU WKRVHEULHIPRPHQWRIV\QFKURQ\LQZKLFKWKHERG\DFWLRQVRI PDQ\EHFRPHSHUIHFWO\FRRUGLQDWHGRIIHULQJDFRQ¿UPDWLRQRI RQHDQRWKHU¶VH[LVWHQFHDQGDÀHHWLQJFKDQFHWRVHHPLQJO\ H[WHQWRQH¶VFRQVFLRXVQHVVLQWRWKHRQHRIDIHOORZSDUWLFLSDQW

72

PORTFOLIO, Orsalia Maria Dimitriou, PhD


(UN)DRAWING FOR TWO Art Performance London 8Q 'UDZLQJIRU7ZRLVDSHUIRUPDWLYHGUDZLQJZRUNWKDWLVUH YLVLWLQJ7RROV)RU1HZ:D\VRI%HLQJE\GUDZLQJRXWWKHVKDSH RIWKHFURVVOLNHGUDZLQJERDUGRQWKHH[DFWZDOODJDLQVWZKLFK LWXVHGWROHDQ KWWSVYLPHRFRP

73

PORTFOLIO, Orsalia Maria Dimitriou, PhD


THE TOWER OF BRIXTON Art Installation London 6WXGLR6<1UXQVDGHVLJQXQLW6WXGLRDW%$$UFKLWHFWXUHDW &HQWUDO6DLQW0DUWLQV7KLV\HDUWKHGHVLJQEULHI³5DGLFDO$UWV &ULWLFDO$UFKLWHFWXUH´ORRNHGDWWKHDUHDRI%UL[WRQDQGDW¿QGLQJ QHZVSDWLDOWDFWLFVDQGW\SRORJLHVWKDWVXSSRUWFXOWXUDOSURGXF WLRQUHODWHGWRUDGLFDOFUHDWLYHSUDFWLFHV6WXGHQWZRUNVZHUH SUHVHQWHGDVGUDZLQJVPRGHOVYLGHRVDOOFRPLQJWRJHWKHUDVD EHVSRNHVLWHVSHFL¿FLQVWDOODWLRQ

74

PORTFOLIO, Orsalia Maria Dimitriou, PhD


POWER GAMES Art Installation Valeta Fortress, Malta $Q LQVWDOODWLRQ OLWHUDOO\ RQ WKH HGJH RI WKH 9DOOHWWD )RUWUHVV$Q RYHUVL]HGWDEOHJDPHEXLOWZLWKLQVLWXIRXQGPDWHULDOHQJDJLQJ FRQFHSWVRIJUHHGLQHVVDQGSRZHUVHL]XUH 7KHZLQQHULVWKHSOD\HUZKRUHDFKHV¿UVWWKHFHQWUDOWRZHUDQG VHL]HV WKH SRZHU 3OD\HUV IDFH GLIIHUHQW RSWLRQV LQ HDFK RQH RI WKH JDPH¶V SRVLWLRQV 7KH RQHV ZKR VHOHFW HWKLFDO RU HDV\ XQWURXEOHGRSWLRQVGLH2QO\WKHJUHHGLHVWDQGPRVWGHWHUPLQHG FDQZLQ%XWKLVKHUHQGLVQRWDVKDSS\DVLWVHHPV 7KHJDPHLVQDUUDWHG

75

PORTFOLIO, Orsalia Maria Dimitriou, PhD


VOODOO ROOM Art Installation Valeta Fortress, Malta 9RRGRURRPSDYLOLRQLVDVSDWLDOH[SHULPHQWRQLQIRUPDWLRQDFFHVV (QFORVHGDQGLQWURYHUWLWLVUHYHUVLQJWKHFKDUDFWHULVWLFVRIWKH W\SLFDO LQIR VWDQG 7KH RXWHU ZDOOV DUH PDGH RI VFUDS PDWHULDO IRXQG LQ WKH DUHD 7KLV UHVXOWV LQ DQ XQSROLVKHG DSSHDUDQFH 9LVLWRUVDUHWUHDWHGDVLQLWLDWHV,QVLGHWKHOLJKWLVYHU\GLP7KH space providing information lies in the core of the space but it FDQQRWEHDFFHVVHGRUYLHZHGGLUHFWO\9LVLWRUVVKRXOGFURVVD VHWRIQDUURZFRUULGRUVVWHSLQWRXQVWDEOHÀRRUDQGVHDUFKIRUWKH FRUH$QLPDJLQDU\YRRGRRZLWFKOXUNVLQVLGH7KHLQIRUPDWLRQLV JUDQWHGWRWKHEUDYHRQHV

76

PORTFOLIO, Orsalia Maria Dimitriou, PhD


BIRTH, INTEROGATION, SURGERY, DEATH Art Performance Barcelona :HZDQWHGWRLOOXVWUDWHIRXULQWHQVHVLWXDWLRQVLQZKLFKWKHYL VXDOLQIRUPDWLRQUHPDLQVWKHVDPHZKLOHWKHVSDFHLVGHVFULEHG DXUDOO\7KHVWDEOHYLVXDOLQIRUPDWLRQLVDVWURQJSKRWRJUDSKLF ÀDVKWKDWLVGLUHFWHGWRWKHSDUWLFLSDQWV7KHGRXEOHEDVHSHU IRUPVWKHEHDWVRIWKHKHDUW,EUHDWKHRQDPLFURSKRQHWKDW LVFRQQHFWHGWRDQDPSOL¿HU7KHSDUWLFLSDQWVDUHVLWWLQJRQD VHPLFLUFOHDQGZHDUHRQWKHFHQWHU7KHOLJKWVWXUQRIIDQGWKH VSDFHUHPDLQVFRPSOHWHO\GDUN

Birth

J

Heart beat )ODVK )LUVWEUHDWKSDUDOOHOKHDUWEHDWLQJ 6RXQGVIDGHRXWVLPXOWDQHRXVO\ 6LOHQFH 'DUN

Interrogation 6WURQJKHDUWEHDWIDVWEUHDWKLQJ )ODVK 6WURQJKHDUWEHDWEUHDWKLQJJHWVPRUHVWHDG\PRUH controlled 6RXQGVIDGHRXWVLPXOWDQHRXVO\ 6LOHQFH 'DUN

Surgery $EVROXWHO\UK\WKPLFDOKHDUWEHDWDEVROXWHO\UK\WKPL cal breath through a mask )ODVK $EVROXWHO\UK\WKPLFDOKHDUWEHDWDEVROXWHO\UK\WKPL cal breath through a mask 6RXQGVIDGHRXWVLPXOWDQHRXVO\ 6LOHQFH 'DUN

N D

J N D

J N D

J

Death 6ORZKHDUWEHDWVORZVEUHDWK Last breath )ODVK 6LOHQFH 'DUNQHVV

Lights turn on 77

3(5)250$1&(,17+($8',725,802)83&B,1&2/ /$%25$7,21:,7+*25$16/$9,&

PORTFOLIO, Orsalia Maria Dimitriou, PhD

N D


REMEMBER ME Art Object / Product Design Barcelona 7KHODPSZDVFUHDWHGDVDÀDVKLQJJLIWWRWKHORYHGRQHVZKR OLYHDEURDG(QWLUHODPSFDQEHGLVPDQWOHGDQG¿WWHGLQDQDUURZ ER[HDV\WRSRVWDEURDG7KHODPSZDVWREHUHDVVHPEOHGZLWKLQ PLQXWHV$Q\LPDJHFDQEHDWWDFKHGWRWKHSDSHUFRYHU;UD\V ZHUH XVHG LQ WKH SLFWXUHG H[DPSOH DV PHDVVDJHV RI DEVROXWH LQWLPDF\DQGVLQFHULW\ 2QFH WXUQHG RQ WKH ODPS UHPLQGHV WR WKH ORYHG RQHV RI \RXU DEVHQFH\HWSDUWLDOSUHVHQFH

product design

78

PORTFOLIO, Orsalia Maria Dimitriou, PhD


HOMAGE AT JOAN BROSSA Art Installation Barcelona ,167$//$7,21,1&2//$%25$7,21:,7+'(632,1$ 76$)28$1'5(1((+$5,5, 7KLVLVDSURMHFWGHGLFDWHGWR-RDQ%URVVD  D &DWDODQDEVWUDFWSRHWDQGDUWLVWZKRVHZRUNLVFKDUDFWHUL]HGE\ LURQ\DQGDOOHJRU\,WIRFXVHVRQWKHWUDQVIRUPDWLRQRIDSRHP LQWRDQLQVWDOODWLRQZKLFKWRRNSODFHDW%DUFHORQHWD%DUFHORQD 7KHFRQVWUXFWLRQLVEDVHGRQWKHFKLOGUHQ VJDPHZKHUHWKHWZR FDQVDQGDFRQQHFWLQJVWULQJDUHXVHGWRIRUPDWHOHSKRQH 7KHFRQVWUXFWLRQLVV\PEROLFDQGDQDORJRXVWRWKHFKRVHQ SRHP 7KHFDQVDUHV\PEROLVLQJWKHLGHDV FRQWDLQHUV7KHVWULQJLV FRQQHFWLQJWKHPDFWXDOO\DQGPHWDSKRULFDOO\7KHUHSHWLWLRQ RIWHOHSKRQHVLVLQVWUXFWLQJWKHUK\WKP(DFKRQHRIWKHPLV FRPSRVHGRIWZRHTXDOSDUWVWKDWDUHLQWKHEHJLQQLQJDQGWKH HQGRILWDVZHOODVRIDWKLUGSDUWWKDWFRQQHFWVWKHPMXVWDV %URVVD VSRHPLVVWDUWLQJDQGHQGLQJZLWKWZRVDPHYHUVHV ZKLOHDWKLUGGLIIHUHQWRQHXQLWHVWKHP 7KHOLQHDULW\RIWKHLUIRUPUHIHUVWRWKHDUHD VFKDUDFWHUWKH VWURQJOLQHRIWKHKRUL]RQWKHEUHDNRIWKHEXLOGLQJVDQGWKH HGJHRIWKHZRRGHQGHFN7KHPDWHULDOVDQGFRORXUVDUHNHSW DVVLPSOHDVSRVVLEOHDQGUHIHUWRWKHVLPSOHDQGGLUHFWZD\RI %URVVD VH[SUHVVLRQ

7KHSXEOLFLVSDUWLFLSDWLQJDFWLYHO\LQWKHLQVWDOODWLRQ7KHYLVLWRU LVOLVWHQLQJIURPRQHFDQ,QWKHRWKHUVLGHWKHUHLVWKHVHD,V WKHVHDWDONLQJ"&DQDQ\ERG\OLVWHQWRWKH¿VKHVPRYLQJLQWKH ZDWHU"7KHYLVLWRULVXQDYRLGDEO\WKLQNLQJ,GHDVDUHPRYLQJLQ WKHEUDLQZLWKRXWDQ\VSHFL¿FVXEMHFW7KH\PRYHLQWRWKHZDWHU )UHH

$TXDULXP 7KHUK\PH 7KHUK\WKP The moulds of the forms I see 7KH¿VKHVLQWR 7KHZDWHU The ideas ,QWKHKHDGWKH\VHHP To move ,QDVLPLODUZD\ 7KHUK\PH 7KHUK\WKP The moulds of the forms

79

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CITY IS MY HOME Art Performance London :KDWZRXOG\RXGHVLJQLI\RXZHUHDVNHGWRFUHDWHDSURGXFW WKDWFRPSULVHVDVSHFWVRIVXVWDLQDELOLW\HQHUJ\VDYLQJHI ¿FLHQF\RIIXQFWLRQDQGPDWHULDOVZKLOHKDYLQJLQPLQGGLIIHUHQW social groups? 6\QWKHWLFDFUHDWHG &,7<,60<+20(Œ&,7<,60<+20(ŒLVDGHVLJQFRQFHSW WKDWKDVDQDQVZHURQFXUUHQWHFRORJLFDOLVVXHVZKLOHEHLQJVR FLDOO\UHVSRQVLEOH,WDSSURSULDWHVH[LVWLQJXUEDQREMHFWVDQGIXU QLWXUHGLVFDUGHGRQWKHVWUHHWVDQGMR\IXOO\UHLQYHQWVWKHLUXVH :KLOHDOOGHVLJQSURGXFWVHFRIULHQGO\RQHVLQFOXGHGGRKDYHD FRVWRISURGXFWLRQ&,7<,60<+20(ŒSURGXFWVKDYHQRQH 7KH\DUHFRVWIUHHDEVROXWHO\HFRORJLFDOYDVWO\DFFHVVLEOHDQG HQJDJHWKHLUXVHUVZLWKWKHFLW\VHWWLQJDQGWKHLUIHOORZFLWL]HQV &,7<,60<+20(ŒSURGXFWVDUHLQYHUWLQJWKHGRPHVWLF HQYLURQPHQWE\IDFLOLWDWLQJGDLO\GRPHVWLFDFWLYLWLHVLQWKHFLW\ VSDFH,QWKDWZD\WKHLUXVHUVGRQRWKDYHWRFRQVXPHDQ\QHZ SURGXFWVDQGµKLGH¶WKHPLQWKHLUKRXVHLQWHULRUVEXWFDQVDWLVI\ WKHLUIXQFWLRQDODQGDHVWKHWLFDOQHHGVRQWKHVWUHHWV &,7<,60<+20(ŒSURGXFWVDUHKHUH7KH\DUHRXWWKHUH 7KH\DUHIRUHYHU\ERG\$QGPRVWLPSRUWDQWO\±WKH\DUHIRU IUHH

80

PORTFOLIO, Orsalia Maria Dimitriou, PhD


TIRISM SHORT VIDEO Art Video Belgrade 7LULVP LV D VKRUW ORZ¿ YLGHR 7KH ¿YH HSLVRGHV RI WKH YLGHR GHVFULEHP\¿UVWYLVLWWR%HOJUDGHDQG1RYL6DG6HUELDJLYLQJ RQO\ WKH RXWOLQHV RI P\ GDLO\ DFWLYLWLHV &DUHIXOO\ DYRLGLQJ DQG GHOLEHUDWHO\ QHJOHFWLQJ WKH PDLQ UHDVRQV RI P\ YLVLW WR 6HUELD WKHYLGHRLVGHSLFWLQJRQO\SHFXOLDULWLHVRIWKH6HUELDQFLWLHVWKDW, DPYLVLWLQJVPDOOSHUVRQDOGHWDLOVLQP\FORVHVWHQYLURQPHQWDQG JOLWFKHVLQWKHYLGHRHTXLSPHQWXVHGIRUWKHPDNLQJRIWKDWYLGHR 7LULVPZDVSUHVHQWHGLQ'HSXWQDOH)LOP)HVWLYDOLQ/LQ]$XVWULD

81

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CAMP GAIDOURONISSI Resourcefulness and Sustainability of Self-Made Housing

*DLGRXURQLVVLDVPDOOLVODQGVRXWKRI&UHWHKDVRQO\¿YH SHUPDQHQWLQKDELWDQWV6HYHUDOKXQGUHGRWKHUVWHPSRUDU\ UHVLGHQWVFDPSRXWRQWKHLVODQGGXULQJWKHVXPPHU $OORIWKHPDWWHPSWWRSURWHFWWKHPVHOYHVIURPWKHLVODQGV VWURQJVXQDQGQRUWKZLQGV$QGVLQFHWKHUHDUHQRVWRUHVRI DQ\VRUWRQWKHLVODQGWKHLQKDELWDQWV±ERWKWKHSHUPDQHQWDQG WHPSRUDU\RQHV±JRDERXWFRQVWUXFWLQJIHQFHVVKHOWHUVWHQWV DQGVKDGHXVLQJPRVWO\WKHPDWHULDOWKDWKDVZDVKHGDVKRUHRU WKHVFUDSWKDWRWKHUYLVLWRUVKDYHOHIWEHKLQGDVUXEELVK ,QWHUHVWLQJO\HQRXJKSHUPDQHQWLQKDELWDQWVWDNHWKLVDUWRI UHF\FOLQJDOLWWOHIXUWKHU«

82

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CAMP GAIDOURONISSI Resourcefulness and Sustainability of Self-Made Housing

83

PORTFOLIO, Orsalia Maria Dimitriou, PhD


ACADEMIC WORK A PHOTOGRAPHIC RECORD OF A NUMBER OF WORKS, SEE CV FOR FULL LIST

84

PORTFOLIO, Orsalia Maria Dimitriou, PhD


AVATON Anarchy, Democracy and Other Ways of Political Participation Documentary Film

$YDWRQLVDGRFXPHQWDU\DQGDWWKHVDPHWLPHDYLVXDOH[SHUL PHQWOLQNHGWR8UVXOD¶V3K'UHVHDUFKLQWKHGHSDUWPHQWRI 9LVXDO&XOWXUHVLQ*ROGVPLWKV8QLYHUVLW\ 7KH¿OPGHDOVZLWKRQHRIWKHLVVXHVDULVLQJIURPWKHUHVHDUFK ±WKHLVVXHRISXEOLFVSDFHµPDQDJHPHQW¶±DQGLQYHVWLJDWHV WKHGLIIHUHQFHVDQGSRWHQWLDOVRIVWDWHRZQHGSXEOLFVSDFHVDQG VTXDWWHGVHOIPDQDJHGFRPPRQV 7KHIRFDOSRLQWRIWKH¿OPLV([DUFKHLDDUHDRI$WKHQVWKHPDLQ public square [plateia] in its centre and a squatted park[parkaki] DOVRLQWKHVDPHDUHD 7KH¿OPHGLWRULV+DULV/DORXVLV

85

PORTFOLIO, Orsalia Maria Dimitriou, PhD

,GHDOL]HGQRWLRQVRISXEOLFVSDFHVDVXQFRQWHVWHGVSDFHVRI GHPRFUDF\DQGFLYLOL]DWLRQDUHIUHTXHQWO\WKHOHDGLQJYLVLRQVRI WKHRI¿FLDO*UHHN6WDWHSROLWLFVFRQFHUQLQJLVVXHVVXFKDVWKH design of space and extending to the political rights of the citi ]HQV$9$721FKDOOHQJHVWKHDVVXPSWLRQWKDWSXEOLFVSDFHLVD VSDFHWKDWH[LVWVµQDWXUDOO\¶LQWKHFLW\DQGDOVRWKDWLWLVFUHDWHG DQGRIIHUHGE\WKH6WDWHWRLWVFLWL]HQVEXWLVLQVWHDGDPDOOHDEOH VSDFHWKDWLVFRQVWDQWO\FRQWHVWHGDQGFUHDWHGE\DFWLRQVDQG IRUFHVERWKRIWKHDXWKRULW\DQGRIVRFLDOJURXSV 7KH¿OPLQYHVWLJDWHVDQXPEHURIFRQWHPSRUDU\DFWLRQVGHULY LQJIURPGLIIHUHQWVRFLDOJURXSVWKDWWRRNSODFHGXULQJWKHODVW WZR\HDUVLQ([DUKLDDUHDRI$WKHQVDQGLQÀXHQFHGGUDVWLFDOO\ both the constitution of the public sphere and the actual shape RIWKHSXEOLFVSDFH7KH¿UVWNH\VWXG\([DUKLDVTXDUHJDLQV LWVQRWRULHW\DVWKHFRUHRIXUEDQZDUIDUHWDNLQJSODFHDQQXDOO\ EHWZHHQULRWHUVDQGWKHSROLFH$WWKHVDPHWLPHLWLVWKHV\P EROLFFHQWUHRIDOWHUQDWLYHSROLWLFDOJURXSVDOHLVXUHVSDFHIRU VWXGHQWVDQG\RXQJSHRSOHDGHDOLQJSRLQWIRUGUXJDGGLFWVDQG

WKHFRPPHUFLDOFHQWUHRIWKHQHLJKERUKRRG&ODLPVIRUµSXEOLF QHVV¶DQGULJKWVWRWKHVTXDUHDUHWKHRXWFRPHVRIPXOWLSOH FRQWHVWDWLRQVWKDWRFFDVLRQDOO\WDNHWKHIRUPRIYLROHQWHYLFWLRQV DQGVWUXJJOHV 7KHVHFRQGNH\VWXG\3DUNDNLHPHUJHGDIWHUWKHXUEDQULRWVRI 'HFHPEHU3DUNDNLDVSDFHWKDWLVSUDFWLFDOO\LOOHJDOLV UHJXODWHGE\DQRSHQDVVHPEO\WKDWRSHUDWHVRQDFRQVHQVXV EDVH3DUNDNLLVDSODWIRUPRIIUHHVSHHFKDQGH[SUHVVLRQIRU WKHPDMRULW\RILWVXVHUVDQGDWWKHVDPHWLPHSUREOHPDWLFDQG G\VIXQFWLRQDOVSDFHERWKIRUWKHDXWKRULW\DQGWKHPDLQVWUHDP PHGLD 7KH¿OPUDLVHVTXHVWLRQVDERXWWKHLGHQWLW\DQGIRUPDWLRQRIWKH SXEOLFVSDFHWKHFRQWLQXRXVO\FRQWHVWHGDQGLQVWDEOHFKDUDFWHU of the notion of public and searches for altenative methods of DGPLQLVWHULQJWKHVSDFHDQGWKHUHIRUHQHZSRWHQWLDOVRISROLWL FDOSDUWLFLSDWLRQ


AVATON Anarchy, Democracy and Other Ways of Political Participation Documentary Film

Screening at 13th Thessaloniki Film Festival

Screening at Usurp Gallery, London

Screening at TINAG Festival, London

)LOPGLVFXVVLRQ KWWSVZZZ\RXWXEHFRPZDWFK"Y [E4;S\NNN

$YDWRQZDVSUHVHQWHGDW8VXUS*DOOHU\LQ/RQGRQRQ DVSDUWRIDVFUHHQLQJGHYRWHGWRVRFLDOGRFXPHQWDULHV

)LUVWSXEOLFVFUHHQLQJRIµ$YDWRQ¶DW7,1$*IHVWLYDOLQ%ULFN /DQH/RQGRQ

Παγκόσμια εκμετάλλευση/World Sales Oρσαλία Δημητρίου/Orsalia Dimitriou T. +44 207 241 5751, +44 787 295 9881 orsaliad@gmail.com

176 ΕΛΛΗΝΙΚΟ ΠΑΝΟΡΑΜΑ 13ο Φεστιβάλ Ντοκιμαντέρ Θεσσαλονίκης 2011

Άβατον Avaton (Sanctuary) Το Άβατον είναι ένα ντοκιμαντέρ βασισμένο σε διδακτορικό ερευνητικό υλικό που συλλέχτηκε από τον Δεκέμβρη του 2008 έως τον Σεπτέμβρη του 2010 για την περιοχή των Εξαρχείων στην Αθήνα. Το ντοκιμαντέρ ερευνά το θέμα της έννοιας και διαχείρισης του Δημόσιου χώρου σε μια τεταμένη και ιδιαίτερη περιοχή, καθώς κάτοικοι, καταστηματάρχες, ναρκομανείς, έμποροι, Δήμος, αστυνομία, αναρχικοί και αντιεξουσιαστες μάχονται για τη χρήση, την κατάληψη και τον ελέγχο του χώρου. Ποιοι είναι οι καλοί και ποιοι οι κακοί; Ποιοι οι παράνομοι, ποιοι οι τραμπούκοι και ποιος τελικά έχει δικαίωμα στον δημόσιο χώρο;

Σκηνοθεσία-Σενάριο - Φωτογραφία-Ήχος / Direction - Screenplay - Cinematography-Sound: Oρσαλία Δημητρίου/Orsalia Dimitriou Μοντάζ/Editing: Χάρης Λαλούσης/Haris Laloussis Μουσική/Music: Lost Bodies Παραγωγός/Producer: Oρσαλία Δημητρίου/Orsalia Dimitriou Blue Ray Έγχρωμο/Color 34’

Avaton [Sanctuary] is a documentary based on PhD research material about the Athens district of Exarcheia collected from December 2008 to September 2010. The documentary investigates the meaning and management of public space in a tense and singular urban area where the inhabitants, the shop owners, the drug addicts and dealers, the Municipality, the police, the anarchists and the antiauthoritarians fight each other for the use, occupation and control of public space. Who are the good guys and who are the bad guys? Who’s breaking the law, who are the bullies and, ultimately, who has a right to public space?

Φιλμογραφία/Filmography 2010 Άβατον/Avaton [Sanctuary]

Oρσαλία Δημητρίου Orsalia Dimitriou Ελλάδα/Greece 2010

86

PORTFOLIO, Orsalia Maria Dimitriou, PhD


URBAN REALITIES BLIND DATE Ljubljana

,QFRRSHUDWLRQZLWKWKH0XVHXPRI$UFKLWHFWXUHDQG'HVLJQ /MXEOMDQDDQLQWHUDFWLYH%OLQG'DWHRI(XURSHDQDUFKLWHFWV SODQQHUVDQGH[SHUWVLQXUEDQGHYHORSPHQWZLOOEHRUJDQLVHGLQ DXWXPQ8QGHUWKHWLWOH³8UEDQ5HDOLWLHV´DFROODERUDWLRQRI WKUHHVHOHFWHGWHDPVWRJHWKHUZLWKORFDOH[SHUWVZLOOEHVWDUWHG ,QYLWHGDUFKLWHFWVDQGSODQQHUVZLOOZRUNRQDFRQFUHWHWRSLFDQG RQDEDQGRQHGFRQVWUXFWLRQSLWVLQWKHFLW\RI/MXEOMDQD $FLW\ZDONWKURXJK/MXEOMDQDRSHQHGWKHHYHQW7KHWHDPV GLVFRYHUDEDQGRQHGSLWVDQGOHDUQHGDERXWWKHH[LVWLQJUHDOLW\ $SURSRVDORIIXWXUHXVHVRIWKHVHVLWHVZDVGHYHORSHGZLWKLQD GLVFXVVLRQRIWKHLQWHUQDWLRQDOWHDPVDQGORFDOH[SHUWV7KHYL VLRQVIRUQHZXUEDQUHDOLWLHVZLOOEHSUHVHQWHGWRDQGGLVFXVVHG ZLWKWKHDXGLHQFHLQDSXEOLFHYHQWLQWKHHYHQLQJ Background /MXEOMDQD¶VZLGHUFHQWHUKLGHVDWOHDVWWHQFRQVWUXFWLRQSLWV ZKLFKDUHGHYDVWDWHGIRU\HDUV$IWHUWKHFROODSVHRIWKHELJJHVW FRQVWUXFWLRQFRPSDQLHVLQ6ORYHQLDWKHLUUHPDLQVLQ/MXEOMDQD HYRNHVPDQ\SUREOHPV7KLVXQ¿QLVKHGFRQVWUXFWLRQSLWVDUH HPSW\DQGGHJUDGHG7KRXJKWWKHUHLVDVWURQJJHQWUL¿FDWLRQ DQGDOVRWXULVWL¿FDWLRQSURFHVVJRLQJRQLQWKHFLW\FHQWUHRI /MXEOMDQD7KHPD\RU=RUDQ-DQNRYLüLVVWLOOFRQYLQFHGWKDW /MXEOMDQDLVWKHPRVWEHDXWLIXOFLW\LQWKHZRUOG ³6ORYHQLDLVQRWDIULHQGO\FRXQWU\LQWHUPVRIIRUHLJQLQYHVWPHQW DQGWKHDWWLWXGHWRZDUGVWKRVHZKRJDWKHUWKHFRXUDJHDQG HYHQWKHLURZQPRQH\WREXLOGVRPHWKLQJQHZLW¶VTXLWHVKRFN LQJ´VDLG&VDED7RWKGLUHFWRURIWKHSURMHFWFRPSDQ\(PRQLND QHZSDVVHQJHUVKRSSLQJFHQWHUZLWKDIRRWWRZHUZKLFK VKRXOGEHFRQVWUXFWHGRXWRIWKHKROHDWWKHUDLOZD\VWDWLRQ $FFRUGLQJWR7RWKPXQLFLSDOFRQWULEXWLRQDQGFRPSHQVDWLRQIRU EXLOGLQJODQGDUHH[WUHPHO\KLJK±DPRQJWKHKLJKHVWLQ(XURSH DVZHOODVODERXUFRVWVDQGEXUHDXFUDF\ZKLFKLVYHU\FRPSOL FDWHG

87

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CONTESTED SQUARES AND SOCIAL UPRISING Central Saint Martins, London

$VSDUWRIWKH&RQWHVWHG6SDFHVIRUXPWDNLQJSODFHLQWKH &URVVLQJDW&HQWUDO6DLQW0DUWLQVGXULQJWKH&60GHJUHHVKRZ WKHURXQGWDEOHGLVFXVVLRQ³&RQWHVWHG6TXDUHV6RFLDO8SULVLQJ DQG3ROLWLFDO,PDJLQDULHVLQWKH$JHRI1HROLEHUDO&ULVLV´KHOGRQ 7KXUVGD\WK-XQHGLVFXVVHGZK\XUEDQVSDFHVEHFRPH FUXFLDOLQIDFLOLWDWLQJVRFLDOSURWHVWVDQGKRZWKHSURGXFWLRQRI these spaces as contested is related to urban imaginaries and FRQWHVWHGIXWXUHV7KLVHYHQWZDVSDUWRIWKHµ([SDQGHG%RXQG DULHV5HVWOHVV)XWXUHV¶SURJUDPPHDW&60±DQRI¿FLDOHYHQW OLVWLQJRIWKH/RQGRQ)HVWLYDORI$UFKLWHFWXUH 6SHDNHUV2UVDOLD'LPLWULRX*LXOLD&DUDEHOOL&DUO)UDVHU&KDLU Gunter Gassner $ERXW 8QGHUV\VWHPZLGHFRQGLWLRQVRIQHROLEHUDOFULVLVZLWKLQ(X URSHXUEDQVSDFHKDVUHHPHUJHGDVDFHQWUDOVLWHRISROLWLFDO FRQWHVWDWLRQ7KURXJKDURXQGWDEOHGLVFXVVLRQFRQFHUQLQJWKH VRFLDOXSULVLQJVZLWKLQ$WKHQV.LHY/RQGRQDQG0RVWDUWKH GLVFXVVDQWVZLOOEULQJWKHLUH[LVWLQJFRUSXVRIHYLGHQFHEDVHG UHVHDUFKWREHDURQWKHTXHVWLRQRIKRZDQGZK\SXEOLFVSDFH LVPRELOLVHGLQWKHFRQWH[WRIVWDWHFULVLV,QSDUWLFXODUWKHVH PRYHPHQWV¶UHQHZHGHPSKDVLVRQDUHYLWDOLVHGGLVFRXUVHDQG SUDFWLFHRIFLWL]HQGHPRFUDF\LQMHFWVDVHQVHRIXUJHQF\LQWR

88

PORTFOLIO, Orsalia Maria Dimitriou, PhD

WKHUHDSSURSULDWLRQRISXEOLFVTXDUHVDVVSDFHVWKDWDUHWUDQV IRUPHGEH\RQGPHUHSK\VLFDOORFDWLRQVDQGLQWRWKHV\PEROLF ORFXVRIQHZLPDJLQDULHVDQGDVSLUDWLRQVIRUDUHMXYHQDWHG µERG\SROLWLF¶ 8UVXOD'LPLWULRXGLVFXVVHGWKHUHODWLRQVKLSRIVRFLDOPRYHPHQWV ZLWKFULWLFDOGHPRFUDF\DQGSUDFWLFHVRIFRPPRQLQJLQ$WKHQLDQ SXEOLFVSDFHV


CRISIS AND INNOVATION IN MODERN GREECE Princeton University, New Jersey

3DUWLFLSDWLQJLQDQH[FLWLQJFRQIHUHQFHDW3ULQFHWRQ8QLYHUVLW\ WKDWH[SORUHGWKHLQWHUSOD\EHWZHHQPRPHQWVRI&ULVLVDQG SURFHVVHVRI,QQRYDWLRQLQ0RGHUQ*UHHFH2UVDOLDRI6WXGLR 6\QWKHWLFDSUHVHQWHGDSDSHUGLVFXVVLQJSRVVLEOHQHZDUHQDV WKDWGHHSHQWKHGHPRFUDWLFSDUWLFLSDWLRQZRUNDVFUHDWLYHDQG emancipating spaces amidst the crisis and extend the notion of SXEOLFVSKHUH 3LFWXUHVRI6WXGLR6\QWKHWLFDVKRZLQJ1DYDULQRX3DUNRQHRI WKHSDSHU¶VNH\VWXGLHVLQWKHFHQWUHRI$WKHQV1DYDULQRX 3DUNXVHGWREHDSDUNLQJSORWWKDWZDVRFFXSLHGRQE\ GLIIHUHQWFLYLOJURXSVDQGWXUQHGLQWRDSXEOLFVSDFH7KHSDUN LVGHVLJQHGEXLOWPDLQWDLQHGDQGPDQDJHGFROOHFWLYHO\E\LWV XVHUV

PRINCETON UNIVERSITY Seeger Center for Hellenic Studies

Fourth International Graduate Student Conference in Modern Greek Studies

Crisis

Innovation

and

in Modern Greece

Friday, May 4, 2012

Room 103, Scheide Caldwell House

!HT

Welcome:

!HT

CULTURE/LITERATURE

Dimitri Gondicas (Princeton University) Chair:(IÀH5HQW]RX(Princeton University)

Danai Otatzi (Aristotle University of Thessaloniki) ¸,U[LYPUN4VKLYUP[`!(+LSPJH[L;YHUZP[PVU9LÅLJ[LKPU7:V\[ZVZ»3LHUKLY¹ Eleftheria Tsirakoglou (Aristotle University of Thessaloniki) ¸0UUV]H[PVUPU4VKLYU.YLLR-PJ[PVU!;OL*HZLVM5PRVSHVZ,WPZRVWVWV\SVZ¹ Respondent: Merih Erol (Princeton University) !UVVU3<5*/ !WT

POLITICS/SOCIETY

Chair: Nikos Panou (Princeton University)

Lamprini Rori (University of Paris I, Panthéon-Sorbonne) ¸3LHKLYZOPW,SLJ[PVU)L[^LLU*YPZPZHUK0UUV]H[PVUPU.YLLR7HY[`7VSP[PJZ¹ Iris Polyzos (National Technical University of Athens) ¸*OPULZL,U[YLWYLUL\YPHS4PNYH[PVUPU([OLUZ! 7YHJ[PJLZHUK5L^7LYZWLJ[P]LZ+\YPUN[OL9LJLU[,JVUVTPJ*YPZPZ¹ Respondent: Georgia Mavrodi (Princeton University) !WT*6--,,)9,(2 !WT

PLACE/SPACE

Chair: Dimitri Gondicas (Princeton University)

Lefteris Theodosis (Polytechnic University of Catalonia, Barcelona) ¸7YVZWLJ[ZVM:\Y]P]HS!*VUZ[HU[PUVZ+V_PHKPZHUK[OL4PUPZ[Y`VM9LJVUZ[Y\J[PVU  ¹ Respondent: Kostas Tampakis (Princeton University) Orsalia Dimitriou (Goldsmiths, University of London) ¸9L4HRPUN7\ISPJ:WHJLZ!;OL,TLYNLUJLVM*VTTVUZPU[OL*LU[YLVM([OLUZ¹ Respondent:

Konstantinos Kalantzis (Princeton University)

!WT9,*,7;065

Cosponsored by the Princeton Institute for International and Regional Studies

89

PORTFOLIO, Orsalia Maria Dimitriou, PhD


SPATIAL POLITICS: ON COMMONS AND PUBLIC SPACES Central Saint Martins, London

,QFUHDVLQJO\XQGHUQHROLEHUDODWWDFNWKHXUEDQSXEOLFVSDFHV EHFRPHVLPXOWDQHRXVO\WKHWHUUDLQRIYLROHQWFRQÀLFWVWKHORFL RIXUEDQPRYHPHQWVDQGWHVWLQJJURXQGVRIFULWLFDOSROLWLFDO PRGHOV7KHQRWLRQDQGVSDWLDOPDWHULDOLVDWLRQRIWKHFRPPRQV RIWHQVSULQJLQJIURPXUEDQPRYHPHQWVDQGSXEOLFVSDFHVLV SHUFHLYHGDVDGHIHQVHWRZDUGVWKHQHROLEHUDOHQFORVXUHVDV DFUHDWLYHSRZHUWKDWVKDSHVRXUUHDOLW\DQGIXWXUHSRVVLELOLWLHV DQGDVHPERGLPHQWRIFULWLFDOGHPRFUDF\:HDUHH[DPLQLQJWKH LGHDRIWKHFRPPRQVWKHLUFRQWHPSRUDU\UHOHYDQFHDVVSDWLDO SUDFWLFHVDQGWKHUHODWLRQEHWZHHQWKHFRPPRQVDQGSXEOLF VSDFH7KHHYHQWRSHQVZLWKDWDONE\6WDYURV6WDYULGHVDQGLV IROORZHGE\D¿OPVFUHHQLQJE\2UVDOLD'LPLWULRX )ULGD\0D\±/90+/HFWXUH7KHDWUH&HQ WUDO6DLQW0DUWLQV*UDQDU\6TXDUH.LQJV&URVV1&$$

Spatial Politics: On Commons and Public Spaces

Talk and Film Screening

Friday 22 May 2015, 18:00 — 20:00

A double event on the idea of the commons, their contemporary relevance as spatial practices, their potential as materialisations of direct democracy and tools of political dissent and the relation between the commons and the public. The event opens with a talk by Stavros Stavrides and is followed by a film screening by Orsalia Dimitriou.

LVMH Lecture Theatre Central Saint Martins, Granary Square, Kings Cross, N1C 4AA.

Stavros Stavrides is Assosiate Professor at the School of Architecture, National Technical University of Athens. Orsalia Dimitriou is a practicing architect and associate lecturer at Central Saint Martins and Oxford Brookes University.

90

PORTFOLIO, Orsalia Maria Dimitriou, PhD

Free, open to the public. Tickets: www.platform-theatre.com


SPATIALITIES OF REVOLT AND DEMOCRATIC GOVERNANCE Bishopsgate Institute, London $SUHVHQWDWLRQRI$QDVWDVLD.DYDGD 6HQLRU/HFWXUHULQWKH 'HSDUWPHQWRI-RXUQDOLVPDQG0DVV&RPPXQLFDWLRQDWWKH8QL YHUVLW\RI:HVWPLQVWHU DQG8UVXOD'LPLWULRXRI6WXGLR6\QWKHW LFDLQ7KLV,V1RWD*DWHZD\)HVWLYDODWWKH%LVKRSVJDWH ,QVWLWXWHRQ³6SDWLDOLWLHVRIUHYROWDQGGHPRFUDWLFJRYHUQDQFH ,QGLJQDQWPRYHPHQWLQ6\QWDJPD6TXDUH´ 8VLQJ¿OPPDWHULDOIURPWKH,QGLJQDQWPRYHPHQWLQ6\QWDJPD 6TXDUH $WKHQV LQWKHVXPPHURIDQGEDVHGRQDQ LQWHUGLVFLSOLQDU\SHUVSHFWLYH XUEDQGHVLJQVRFLDOPRYHPHQWV DQGPHGLD WKLVSUHVHQWDWLRQH[SORUHGWKHVSDWLDOGLPHQVLRQRI

91

PORTFOLIO, Orsalia Maria Dimitriou, PhD

VRFLDOPRYHPHQWVDQGWKHUHODWLRQVKLSEHWZHHQVSDFHFRP PXQLFDWLRQDQGSROLWLFDOSDUWLFLSDWLRQ,VWKHRFFXSDWLRQRISXEOLF VTXDUHVSURGXFLQJDQHZNLQGRIµSXEOLF¶LQXUEDQFHQWUHV"+RZ GRWKHVHSULQFLSOHVVKDSHDQGDUHWXUQVKDSHGE\WKHRQOLQH DQGRIÀLQHVSDFHVRFFXSLHGE\WKHPRYHPHQW"+RZGRFRP mercial and state pressures limit the uses of these spaces for social movements? 7KHSUHVHQWDWLRQZDVIROORZHGE\DQLQVSLUDWLRQDODQGHQJDJLQJ GLVFXVVLRQ


COMMON/ SQUATTED/ AUTONOMOUS/ MUNICIPAL/ PUBLIC SPACE Univeresity College London

$FROODERUDWLRQEHWZHHQ8UVXOD'LPLWULRXRI6\QWKHWLFDDQG 'HVLJQHU0DU\,NRQLDGRXRI)XWXUH$QHFGRWHV7KHSRVWHUZDV SUHVHQWHGRQWKH/RVWLQ6SDFHLQWHUGLVFLSOLQDU\ZRUNVKRSDW 8&/RQQGDQGUG'HFHPEHURUJDQLVHGE\WKH%DUWOHWW 6FKRRORI$UFKLWHFWXUHWKH,QVWLWXWHRI%HKDYLRXUDO1HXURVFL HQFHRI8&/DQGWKH&HQWUHIRU(YROXWLRQDU\&RPSXWLQJLQ $UFKLWHFWXUHRI8(/ 7KHZRUNVKRSKRVWHGGHEDWHVLGHDVDQGQRWLRQVRIVSDFH7KH SXUSRVHZDVWRSURYLGHDSODWIRUPIURPZKLFKW\SLFDOO\GLVSD UDWHGLVFLSOLQHVFRQVLGHULQJVSDWLDOLVVXHVPD\µ¿QG¶RQHDQRWKHU LQRUGHUWRGLVFXVVGHEDWHDQGGHYHORSLGHDVRQVSDFH 7KHSRVWHUWLWOHGµ&20021648$77('$872120286 081,&,3$/38%/,&63$&(¶H[SORUHGWKHQRWLRQRIVSDFHDVD VRFLDOFRQVWUXFWLRQ

COMMON / SQUATTED / AUTONOMOUS / MUNICIPAL / PUBLIC SPACE

Orsalia Dimitiriou Dipl Architect Engineer ARB PhD candidate, Goldsmiths University of London email exp02od@gold.ac.uk

The multiple social definitions of public space

blog http://studiosynthetica.wordpress.com

Orsalia Dimitriou Goldsmiths University of London, Department of Visual Cultures

Idealised notions of public spaces, as uncontested spaces of democracy and culture, are frequently the leading visions of the official Greek State politics concerning issues such as the design of space and the political rights of the citizens. Such idealised notions are challenged in a number of public spaces in Athens where social claims over the space are manifested intensively. The claims vary from violent disputes and evictions to the creative formation of a new type of ‘commons’ serving as venues of political participation beyond those provided by the official political system.

Methodology and research questions Using primary sources such as video documentation and personal interviews and employing a body of theory on public spaces and the notion of public by Mitchell, Deutsche, Lefebvre and Foucault, the research challenges the assumption present in Greek urban policies and discourses that public space exists ‘naturally’ in the city and that it is created and offered by the State to its citizens. It is instead a malleable space that is constantly contested and necessarily ambiguous, combining aspects of its ideal manifestations and the problematic, conflicting ones, its inclusions and its exclusions.

Key Study Area , Exarcheia, Athens µ6SDFHLVDFULWLFDODVSHFWRIRXUHYHU\GD\OLYHVLWLVRQHRIWKH EDVLFXQGHUO\LQJRUJDQLVDWLRQDOV\VWHPVIRUDOOOLYLQJWKLQJV 0DQ\GLVFLSOLQHVDUHFRQFHUQHGZLWKQRWLRQVRIVSDFHDQGFRQ VLGHULWVUROHLQWKHLUVSHFL¿FVWXGLHVEXWWKHVHDUHFRPPRQO\ FRQ¿QHGZLWKLQWKHLUSDUWLFXODU¿HOGV)RUH[DPSOH3KLORVRSKL FDOHQTXLULHVSURIIHUQRWLRQVRIVSDFHDVDµWKLQJ¶LWVUHODWLRQWR WLPHJHRPHWU\DQGVRFLHW\DQGKRZVSDFHPD\EHSHUFHLYHG G\QDPLFDOO\LQUHODWLRQWRWKHXVHUVRFLHW\SODFHDQGFRPSOH[L W\)LHOGVVXFKDVHQYLURQPHQWDOSV\FKRORJ\EHKDYLRXUDOQHXUR VFLHQFHDQLPDO VSDWLDO FRJQLWLRQDQGF\EHUQHWLFVSURYLGHLQ VLJKWVLQWRWKHFRJQLWLRQSHUFHSWLRQDQGRUJDQLVDWLRQRIVSDFH LQRUGHUWRKHOSXQGHUVWDQGWKHPHFKDQLVPVWKURXJKZKLFK EHKDYLRXUHPHUJHVDVZHOODVKRZZHEHKDYHDQGUHVSRQGWR VSDFHDQGFRQWH[W6SDWLDORUJDQLVDWLRQKDVEHHQVKRZQWREH DVLJQL¿FDQWDVSHFWRIVRFLDO DQLPDODQGKXPDQ JURXSVDQG LQVHFWVRFLHWLHVDVZHOODVDELRWLFFRPSRQHQWV7KHFRQFHSW RIFROOHFWLYHLQWHOOLJHQFHLVXWLOLVHGVLJQL¿FDQWO\LQYDULRXV¿HOGV RIUHVHDUFKWRGHPRQVWUDWHSDWWHUQVRIVSDWLDORUJDQLVDWLRQ through computer simulations and modelling: offering exciting PHDQVIRUGHYHORSLQJDQGUHSUHVHQWLQJVSDWLDOSURSHUWLHV¶

92

PORTFOLIO, Orsalia Maria Dimitriou, PhD

The research investigates a number of contemporary actions, deriving from different social groups, that took place during the last two years in Exarheia area of Athens and influenced drastically both the constitution of the public sphere and the actual shape of the public space. The first key study, Exarhia square gains its notoriety as the core of urban warfare taking place annually between rioters and the police and is negatively characterised by mainstream media. At the same time it is the symbolic centre of alternative political groups, a leisure space for students and young people, a dealing point for drug addicts and the commercial centre of the neighbourhood. Claims for ‘publicness’ and rights to the square are the outcomes of multiple contestations that lead to precarious coalitions between the different groups (like the association of inhabitants aligning with the shop owners and the anarchists against the drug addicts) and occasional violent eruptions. The second key study, Parkaki is a squat of a parking lot that was turned into a park. Parkaki, a space that is practically illegal, is regulated by an open assembly that operates on a consensus base. As the squatters claim, the space is a result of the urban riots of December 2008 that fortified and united the individual voices of resistance to State politics. Parkaki is a platform of free-speech and expression for the majority of its users and at the same time a problematic and dysfunctional space for the authority.

Reference Deutsche, R. (1991), “Uneven Development: Public Art in New York City”, in Ghirardo, D. (ed.) (1991), Out of site: A social Critique of Architecture, Seattle: Bay Press Deutsche, R. (1996). Evictions: Art and spatial politics. Boston: MIT Press. Foucault, M.(1967), Of Other Spaces, Heterotopias, available at: http://foucault.info/documents/heteroTopia/foucault.heteroTopia.en.html Lefebvre, H. (1991), The Production of Space, [trans. D. Nicholson-Smith, first pub. 1974], Oxford: Blackwell. Lefebvre, H. (1977) ,The Right to the City, Greek Edition [Trans.: TourniKiotis, P. and Lorain,C.] Athens: Papazisis edition. Mitchell, D. (2003), The Right to the City: Social Justice and the Fight for Public Space, New York: Guilford Press.


WORKSHOPS

93

PORTFOLIO, Orsalia Maria Dimitriou, PhD


MAKING WEEK 2016 Workshop at Central Saint Martins with BA Architecture Students ,Q)HEUXDU\6WXGLR6\Q¶V8UVXODDQG'HMDQZRUNHG WRJHWKHUZLWKDWHDPRI&HQWUDO6DLQW0DUWLQV%$$UFKLWHFWXUH VWXGHQWVWRGHVLJQDSDYLOLRQVWUXFWXUHWRVKRZFDVHWKHLUZRUNV DWWKH(QGRIWKH<HDUVKRZ7KHVKRZLVDFWXDOO\WDNLQJSODFH QH[WZHHN-XQH2YHUDFRXUVHRIDQLQWHQVLYH ZHHNRIGHVLJQLQJPRGHOPDNLQJDQGSURWRW\SHEXLOGLQJWKH WKLUG\HDUVWXGHQWVRIVWXGLRUXQE\8UVXOD'LPLWLURXDWXWRUDW &60ZHUHMRLQHGE\DQXPEHURIVHFRQG\HDUVWXGHQWV 2QWKH¿UVWGD\WKHZRUNVKRSVWDUWHGZLWKDEUDLQVWRUPLQJ VHVVLRQWKDWLQYROYHGWKHHQWLUHVWURQJJURXSWKHQPRYHG RQWRLQGLYLGXDOOLEUDU\EDVHGUHVHDUFKDIWHUZKLFKWKHHPHUJ LQJLGHDVZHUHGLVFXVVHG7KHLGHDVWDFNOHGWKHPDQXIDFWXU LQJSURFHVV &1&DQGODVHUFXWWLQJ WKHVHOHFWHGPDWHULDOV SO\ZRRGVKHHWV ZD\VRIH[KLELWLQJZRUNFLUFXODWLRQDQGWKH RYHUDOODSSHDUDQFH %\GD\WKUHHDURXQG¿YHFRPSOHWHO\GLIIHUHQWLGHDVFDPHIRUWK DVHTXDOO\GHYHORSHG ,QDQLQIRUPDOEXWLQWHQVHKRXUORQJVHVVLRQWKHVWXGHQWV WRJHWKHUZLWK8UVXODDQG'HMDQLQWHUURJDWHGDOOWKHSURSRVDOV discussed their pros and cons and developed a solution that EURXJKWWKHEHVWLGHDVWRJHWKHULQDVLQJOHSURMHFW )RUWKHUHPDLQLQJWZRGD\VRIWKHPDNLQJZHHNWKHJURXSVSOLW into smaller teams to manufacture a scale model of the entire SDYLOLRQDQGDVHJPHQW

94

PORTFOLIO, Orsalia Maria Dimitriou, PhD


MAKING WEEK 2016 Workshop at Central Saint Martins with BA Architecture Students

95

PORTFOLIO, Orsalia Maria Dimitriou, PhD


MAKING WEEK 2018 Workshop at Central Saint Martins with BA Architecture Students ,Q)HEUXDU\6WXGLR6<1OHDGDJURXSRIVHFRQGDQGWKLUG \HDU%$VWXGHQWVDW&HQWUDO6DLQW0DUWLQV¶0DNLQJ:HHN'XU LQJWKHZHHNORQJLQWHQVHGHVLJQDQGPDNLQJSURFHVVWKHVWX GHQWVGHVLJQHGDQXPEHURIEHVSRNHWLPEHUMRLQWVGHYHORSHG DFRQVWUXFWLRQVHTXHQFHFRPSLOHGFXWWLQJWHPSODWHVSURGXFHV SURWRW\SHVDQGSUHSDUHGGLJLWDO¿OHVIRUODUJHVFDOHSURGXFWLRQ 6WXGHQWVZHUH'DOLD0DHOODO6RR\RXQJ%DH%HQ%UDGIRUG 6KLMLD+XDQJ-RKQ/DQJUDQ%HOLV0HPLN6N\0RRUHFOXEH 4LQ[XH:DQJ/DXULDQQH'XFDVVH$JDWD'\GDN0DUWD(V FULEDQR:HLKDQJ+X$GDP0XVFDW/DXUD5REOHV%DUUHUR 7LSKDLQH9DULJDV-HVVLFD:KLWH-LD4LQJ<XH0DNLQJ:HHN ZDVRUJDQLVHGE\*UHJRU\5RVV6WDJH7ZROHDGHU

96

PORTFOLIO, Orsalia Maria Dimitriou, PhD


MAKING WEEK 2018 Workshop at Central Saint Martins with BA Architecture Students

Day 1 Sketch models Wedges joints Play on gravity

Sketch of a joint using wedges

Different iterations of model joints with wedges.

WEDGES

Different pictures of joints using wedges.

10 12

DAY 4: THURSDAY Refining Joint Systems

11

13

Day 4 Refining Joint Systems

Day 4 Refining Joint Systems

Day 4 Refining Joint Systems

Day 4 Refining Joint Systems

Day 4 Refining Joint Systems

The shelving system is completely modular and can be adapted to each student needs. Or used to define the form of the building. Developping different adaptations of the final joint to adapt to different surfaces and angles.

Each key hole is located on a structural pillar at different heights and distances which gives liberty to the builder.

The cross key hole can be orientated differently to have angled planes to keep movement and variety in the structure as well as to present books or magazines. Each joint can hang of the main stucture vertically with horizontal or angled planes attaching on top to make the structure modular. 28

29

97

PORTFOLIO, Orsalia Maria Dimitriou, PhD

32

33

34

35


FOUR CORNERS OF THE WORLD Summer School 2018 Dalston, London

8UVXODDQG'HMDQRI6WXGLR6<1WHDPHGXSZLWK(ULNDDQG $QGHUVRI2I¿FH7(1WRWRIRUPDWXWRUWHDPDQGOHDGWKH IRXUWK6725(¶VDUFKLWHFWXUDOVXPPHUVFKRROWKDWWRRNSODFH DW'DOVWRQ¶V*LOOHWW6TXDUH/RQGRQLQ-XO\DQG$XJXVW 6725(¶V/RQGRQ6XPPHU6FKRRO7KURXJKPDWHULDOWHVW LQJDQGLPPHGLDWHHQJDJHPHQWZLWKDQDFWLYHXUEDQVLWHZH H[SORUHGDUFKLWHFWXUHDUWSUDFWLFHDQGSHUIRUPDQFHWRXQGHU VWDQGWKHG\QDPLFVRISXEOLFVSDFH7KLV\HDU¶VGHVLJQVZHUH GHYHORSHGLQFROODERUDWLRQZLWK+DFNQH\3LUDWHVDVWRU\WHOOLQJ JURXSORFDOWRWKHDUHD7KHVXPPHUVFKRROFXOPLQDWHGLQD FHOHEUDWRU\SHUIRUPDQFHE\,QIRU0RWLRQ Watch the video here: KWWSVYLPHRFRP

98

PORTFOLIO, Orsalia Maria Dimitriou, PhD


FOUR CORNERS OF THE WORLD Summer School 2018 Dalston, London

99

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PERFORMING ARCHITECTURE BODY, MOVEMENT, SPACE 2018 Workshop at Central Saint Martins with Ma and BA Architecture Students ,QDQG8UVXOD'LPLWULRX(OL]D6RURJD$OLNL.\OLND DQG.\YHOL$QDVWDVLDGLOHGWZRZRUNVKRSVIRU%$DQG0$DUFKL WHFWXUHVWXGHQWVRI&HQWUDO6DLQW0DUWLQVDQG&DUGLII8QLYHUVLW\ %RWKZRUNVKRSVIRFXVHGRQSHUIRUPLQJDUFKLWHFWXUHH[SORULQJ WKHUHODWLRQVKLSEHWZHHQWKHERG\DQGVSDFHWKRXJKDVHULHVRI FROODERUDWLYHH[HUFLVHV

100

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PERFORMING ARCHITECTURE BODY, MOVEMENT, SPACE 2019 Workshop with MA Architectural Design Students from Cardiff and BA Architecture Students from London In 2018 and 2019 Ursula Dimitriou, Eliza Soroga, Aliki Kylika and Kyveli Anastasiadi led two workshops for BA and MA architecture students of Central Saint Martins and Cardiff University. Both workshops focused on performing architecture, exploring the relationship between the body and space though a series of collaborative exercises.

101

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PERFORMANCE ARCHITECTURE BODY, MOVEMENT, SPACE 2020 Online Summer School 2020

102

PORTFOLIO, Orsalia Maria Dimitriou, PhD


PERFORMANCE ARCHITECTURE BODY, MOVEMENT, SPACE Online Summer School 2020 Studio SYN, in association with VIPA and RIPS, is organizing a PERFORMANCE ARCHITECTURE Online Summer School, from 20 June to 11 July 2020. The school will run 3-hour classes every Saturday from 10:00 to 13:00 (BST) over 4 weekends. Deadline for applications is 13 June 2020. *Discover the interconnections of architecture Performance Architecture Online Summer School is an exciting learning journey designed to inspire, broaden and challenge the possibilities of spatial representation and design. Architecture is combined with other disciplines including art, cinematography and performance. *Architecture is a dynamic discipline The course is applying the toolbox of performance in architectural thinking, towards the production of spatial actions and

103

PORTFOLIO, Orsalia Maria Dimitriou, PhD

bodily geometries in space. It is taught by a team of Londonbased interdisciplinary and international architects and artists including Ursula Dimitriou (StudioSyn), Aliki Kylika (VIPA) and Eliza Soroga (RIPS). *Play with the city; be curious, be caring, be resourceful This is an incredible opportunity for students / professionals who want to learn new skills, extend their thinking, emerge to an urban cultural landscape, be part of an interdisciplinary and international team, and diversify their project portfolios. More about the summer school and info on how to apply can be found on the website https://performarch.com/


DESIGNING THE COMMONS New Cross, London

This workshop, open to all CSM students, seek to investigate the role of designers in imagining the commons, setting common goals, resource sharing and participatory design. The project will take place at THE FIELD in New Cross – “an experiment in creating a new kind of local institution that utilizes arts and education tools and practices to create a hub for, and to be a catalyst of meetings, conversations, debate, ideas, learning and self-organised action for our area.” The space of THE FIELD, in operation since February 2014, has secured a 5 year rent-free lease and it is run by an organising committee of local residents. All core decisions are taken during assemblies with open participation in a horizontal basis. Project goal and outcome The participants would design and build a set of collaborative and communicative devices (furniture, cart, stall, objects, etc).The brief, design processes, methods and materials will be negotiated between the participants and the open community of THE FIELD. Time The workshop will take place once a week during four weeks. The participants should commit in attending at least three out of four workshops. The proposing starting date is the Saturday 25th of April. 25 April-a talk on the idea of the commons, a presentation from the participants of 7+(),(/'DERXWWKHVSDFHWKH¿UVWSDUWRIRUJDQL]LQJDQGQHJRWLDWLQJWKHGHVLJQRXWFRPHEHWZHHQ¿HOGHUVFRPPXQLW\DQG participants and a welcoming food party. 2 May –design 15-16 May materials, construction methods and making Participation is free The project is funded by Restless Futures

104

PORTFOLIO, Orsalia Maria Dimitriou, PhD


RESTLESS FUTURES: IMAGINING THE COMMONS FILM New Cross, London This workshop investigated the role of designers in imagining the commons, setting common goals, resource sharing and participatory design. Open to CSM students, the project took place at THE FIELD in New Cross, an experiment in creating a new kind of local institution that utilises arts and education tools and practices to create a hub for, and to be a catalyst of meetings, conversations, debate, ideas, learning and self-organised action for our area. This event was a part of the Restless Futures programme. The workshop organiser was Orsalia Dimitriou. Video credit: Paul J Cochrane

https://www.youtube.com/watch?v=4gda0tVz8QU

105

PORTFOLIO, Orsalia Maria Dimitriou, PhD


GRAPHICS, POSTERS & PUBLICATIONS

106

PORTFOLIO, Orsalia Maria Dimitriou, PhD


HOW TO MAKE A READING MACHINE THAT IS ACTUALLY A WRITING MACHINE London, Copenhagen

By Christina Christoforou, Orsalia Dimitriou, Adam Drewes, Martin Glaz Serup, Ann-Marie Hanlon, and Andreas Wolfsteiner , printed in a rizograph machine with the precious technical assistance of Tryk-Tryk-Tryk

107

PORTFOLIO, Orsalia Maria Dimitriou, PhD


MAKING DO

// Dialogues From Out of This World

London

Making Do is a collective of artists and designers and an independent publication, based in London. The projects developed by Making Do are informed by a culture of open source editorial tools and cross disciplinary collaborations. Through the new issue, Making Do proposes a dialogue between children, artists and designers as a methodology for creative production. The Making Do editors invited twelve artists and designers to ZRUNLQSDUWQHUVKLSZLWK0DQRU¿HOG3ULPDU\6FKRROLQ/RQGRQ investigating what are the parameters of this dialogue and how can the boundaries within education shift through collective processes and shared authorship? Workshops: Anette Bjelland, Orsalia Dimitriou, Pippa Gatty, Annie Pender, Jarrod Sanderson, Carla Wright, Ania Bas, Sophie Beard , Christina Christoforou, Andrea Francke , Tanya .DSULHOLDQ7UDFH\:DOOHUDQGWKH\HDUVWXGHQWVRI0DQRU¿HOG Primary School

108

PORTFOLIO, Orsalia Maria Dimitriou, PhD


NEW CROSS COMMONERS London

109

PORTFOLIO, Orsalia Maria Dimitriou, PhD

Posters


NEW CROSS COMMONERS

Publication

London

COMMON— TALES

110

PORTFOLIO, Orsalia Maria Dimitriou, PhD

WORK — SHOPS: — POWER SHUFFLE! — HAVING / NOT HAVING


GAME DESIGN

111

PORTFOLIO, Orsalia Maria Dimitriou, PhD


BERLIN IN FLAMES 6XEMHFWL¿FDWLRQRIWKH'HDWK'ULYH Berlin

A Top Trumps card game with Berlin’s landmark buildings. 2

Name; East B/West B; Typology; 1. Date of construction; 2. Distance from the Km 0(Donhoff plaz); 3. Area; 4. Height; 5. Date of listing; 6. Leftdness.

1

rl Marx

17 Ka

East

ate

nburg G

Brande

er on Tow Televisi

Year of

from istance

D

91 ion: 17 complet Year of 1,57 0 (km): km m e fro Distanc 2 71 q m): Area (s (m): 27 Height s: 51% Leftnes

Area

Height

Year of

8

(m): 36

ion: complet e from

Distanc

85%

s: Leftnes

53 ion: 19 complet Year of m): 2,73 km0 (k m fro e Distanc 0 q m): 30 Area (s

1963 m): 1,94

km0 (k

Height

m): 1330

q Area (s Height

n: 1963

Year

e from

(m): 4

Distanc %

s: 80 Leftnes

(m): 13

P

lace oyal Pa Berlin R

TR

3 UM

P

Height

Year of

ion: complet e from

Distanc

q Area (s Height

m): 1,38

km0 (k

0 ): 29 00

m

(m): 26

% ess: 24

Leftn

019

1845/2

Height

82

(m): 39

s: Leftnes

37%

Berlin bitation ite d'Ha

sserturm

39 Un

19 Wa Botzow

East

Brewery

e olaikirch

West

38 Nik East

East

76

ion: 19

Year of

38

m): 1, km0 (k e from Distanc 300 15 ): qm Area (s (m): 32 Height s: 89% Leftnes

1

s: 50%

P

18

complet

580

Area

6

m): 0,74

km0 (k

3 97 (sq m):

TR

East

Year of

(m): 6

from istance

D

42

ion: 17

complet

Leftnes

UM

East

m): 0,88

km0 (k

096 q m): 7

Area (s

s: 83%

publik der Re Palast

pletio of com

Opera

East

Year of

Leftnes

TO

PORTFOLIO, Orsalia Maria Dimitriou, PhD

West

69

P

112

East

m): 1,63

TO

3

36 Ph

km0 (k

1326 (sq m):

in nic Berl ilharmo

16 Kin

ion: 19

complet

in State

37 Berl

East

ational o Intern

East

dlung Buchan

85

Year of

ion: 18 complet e from

Distanc

q m): Area (s Height

29 500

(m): 14 s: 60%

Leftnes

m): 2,52

km0 (k

km0 e from

Distanc

0 q m): 52

Area (s

Height

(m): 36

2% ftness:

Le

77

ion: 18

complet

Year of

93

(km): 2,

43 ion: 12 complet Year of m): 0,90 km0 (k e from nc ta is D 400 q m): 2 Area (s 44 ): (m t Heigh s: 48% Leftnes

58

ion: 19

complet

0 (km):

m km tance fro

Dis

Area

3 241 (sq m):

Height

,94

(m): 52

%

s: 70 Leftnes

10.49


HOW TO “SCRABBLE-A-MANUAL” Copenhagen

For the Copenhagen Interart Symposium on ‘How to do things with academia’ organized by the University of Copenhagen on 16-19 June 2011 , the organizers had an extraordinary call for manuals instead of papers! This is a manual which is also a game that Orsalia did in collaboration with illustrator Christina Christoforou and graphic designer Mary Ikoniadou Scrabble-a-manual involves around new ways of producing knowledge. Academia evolves and revolves around a textual word. Different knowledge, on nature, on art works, on human behaviour is described and analysed by a text. We wanted to test a production of meaning based on a visual language and at the same time challenge what knowledge is. Can knowledge for example derive from an invented mythical device and the ways to construct it? 6FUDEEOHDPDQXDODOVRUHÀHFWVRQWKHZD\DFDGHPLFWH[WVDUH constructed, they are not tabula rasa but are acceptable once based on notions already proved by other academics. Plus the academic ‘speech’ has to form a logic sequence, which might be a traditional logic or something completely new and inventive, but the logic behind the sequence should always be MXVWL¿HG Scrabble-a-manual is a collaborative action, both in its conception and in its realisation. The participants have to negotiate the ‘logic’ behind their manuals and can add or expand the manual of one of their fellow players. The typical manual is a way to instruct someone to produce/ assemble/montage/construct/do something that already exists. Furthermore the way it should be constructed/delivered/etc it is already known to the person who is writing the manual. Scrabble-a-manual on the contrary calls for open-ended manuDOVZKHUHWKH¿QDORXWFRPHLVQRWNQRZQEHIRUHDQGFDQEH altered on the way. It is more dependable on the existing tools FDUGVSLFWRJUDPV WKDQD¿QDOFORVHHQGHGSURGXFW Scrabble-a-manual aims at producing fantastic/impressive/ impossible notions but the interest is mainly on the process (the manual, and the way the manual is constructed by playing). Scrabble-a-manual draws inspiration by the ways an academic text is produced (using notions of others, logic sequence, open end) but it calls for larger collaborations, creativity and most importantly, amusement. Won’t we all learn more by playing?

113

PORTFOLIO, Orsalia Maria Dimitriou, PhD

Activity description The activity proposed is to play a custom-made scrabble; instead of the word-building game, the participants would be involved in a manual-building game where the letters of the original game will be replaced by pictograms extracted from different manuals (these will vary from Ikea assembly manuals to instructive manuals on how to build a house, how to kill a rat, amongst others). The participants will be divided in teams (of approximately three people so they will not have to wait too long for their turn to play). All teams will be given the same amount of identical cards. In each team, the players will be allowed the same amount of cards- picked randomly from the bag; the players will take their turn to play one by one placing their cards on the provided board. The player’s aim is to get rid of their cards by constructing a sequence on the board or by attaching their card to another player’s sequence; the aim of the game is to produce a manual. The manuals produced will have to be named during the process of the game to the rest of the players. The participants can construct an absurd or incoherent manual sequence as long as they can provide an argument that explain it to their fellow players which in their turn can choose to accept the ‘logic’ of it, or not. So far, the rules of the game are very similar a game of scrabble. However, since we would like the participants to concentrate in creating inventive manuals we would not like to insert a point system in the game. Scrabble-a-manual is a call for different manuals that at the end of the game or at the end of the symposium can be used as scripts for movies, for performances, for PhD methodologies, for imaginary devices, for art objects. When there are no more cards to be placed on the board or when the players decide to end the game (whichever comes ¿UVW DSOD\HUIURPHDFKWHDPZLOOSUHVHQWWKHOLVWRIWKHPDQXals to the rest of the teams and he /she will write a set of instructions as a result from the experience of playing or inspired by one of the manuals on the board. At the end we will have a long list of different manuals and a smaller list of sets of instructions to accompany some of the visual cards/pictograms.


HOW TO “SCRABBLE-A-MANUAL” Copenhagen

114

PORTFOLIO, Orsalia Maria Dimitriou, PhD


TEACHING: DESIGN STUDIO STUDENT PROJECTS

115

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Studio brief 2012/13: Scenario 2025 Architecture is “politics only pursued by other means” Berthold Lubetkin 7KLVSURMHFWVKRXOGEHGH¿QHGDQGGHYHORSHGWKURXJKDFULWLFDO forecasting of a future contextual scenario; based on your own well-supported analysis and projection of the different systems and processes that have generated the current reality and that may be informing a future set in year 2025, when you would be engaged in an active practice. The research from your dissertation should provide with a conceptual background to inform \RXUVSHFL¿FDSSURDFKWRWKHVHVFHQDULRV7KHLQWHQWLRQRIWKLV setting is to invite you to develop a research and analysis of the current trends related to the social, economic, political, cultural and technological contexts, based in a perspective that needs to start in our recent past. You will need to track the developments that are shaping our present scenarios and agendas, where these are coming from and, therefore, where these may be heading; which kind of issues and possibilities these may bring and how architecture may, therefore, respond.

116

PORTFOLIO, PORT TFOLIIO, Orsalia Maria M ria Dimitriou, PhD Ma

Studio brief 2013/14: Context, Concept, Content Think, for example, on the evolution of: - Lifestyles (i.e. relation between live and work); its impact on the familiar, social and economic structures and how these are developed in space and time; - the current world order and how it may shift; i.e. how would this affect the balance between global and local? How the current cultural, social, economic and political hegemonies would change? - London as global metropolis and its effects; will current processes accelerate or shift? - sustainability and how it would be integrated, in terms of environment but also in terms of socioeconomical development; - the price of land; the technologies and economies related to construction; the affordability of space. - a long list of etc... These scenarios need to be devised from a research and not just from your intuition. You need to consider few aspects to focus on and to consequently produce a design response, rather than considering many.

The general agenda of the design projects of stage 3 is related to the investigation of different ways of articulating the complexity of this context and its situations, focussing on the area around and within Bemerton Estate, at Barnsbury, Islington. The shared initial research question is how to actively connect the Bemerton Estate with its surrounding areas through material, spatial and programmatic agencies and agents. The vicinity of the area of study should provide with the possibility of having a direct experience of the context and the different situations it contains, informing your approaches and proposals. The design process is stage 3 should, therefore, be informed E\DVWUDWHJLFLGHQWL¿FDWLRQDQGXQGHUVWDQGLQJRIWKHGLIIHUHQW HQWLWLHVLGHQWLWLHVDQGSURFHVVHVWKDWGH¿QHWKHDUHDRIVWXG\ analysing their current and potential interactions.

7KLVSURMHFWLVD¿UVWDSSURDFKWRWKHJHQHUDOFRQFHUQVRIVWDJH 3 regarding the articulation and improvement of the spatial and social connections of Bemerton Estate with its wider context as an agent of regeneration. The area of intervention will be the strip between Caledonian Road and Bemerton Estates, which is a contained yet complex urban setting. The general aim is to investigate the different situations related to social, spatial and temporal patterns around the area and to produce an intervention that would enable this strip to generate connections and interactions between Bemerton Estates, Caledonian Road and Barnsbury. Your design task is, therefore, to develop DVLWHVSHFL¿FLQWHUYHQWLRQDFRPELQDWLRQRILQGRRUVDQGRXWdoors public space that will act as an interface, an active agent of juxtaposition of different users through spatial, programmatic and material agencies.


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Jordan Cottage Project: Peckham Parliament Studio brief for 2012/2013: Scenario 2025 Location: Kings Cross, London

117

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Jordan Cottage Project: Peckham Parliament Studio brief for 2012/2013: Scenario 2025 Location: Kings Cross, London

118

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Lily Papadopoulos Project: The Peckham Agency, Women’s Centre Studio brief for 2012/2013: Scenario 2025 Location: Peckham, London

119

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Lily Papadopoulos Project: The Peckham Agency, Women’s Centre Studio brief for 2012/2013: Scenario 2025 Location: Peckham, London

120

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE 6WXGHQW$OLQD$OLP]KDQRYD Project: Bread is Gold City Farm Studio brief for 2013/14: Context, Concept, Content Location: Kings Cross, London

121

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE 6WXGHQW$OLQD$OLP]KDQRYD Project: Bread is Gold City Farm Studio brief for 2013/14: Context, Concept, Content Location: Kings Cross, London

122

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Alistair Moule Project: The Bemerton Experiment Studio brief for 2013/14: Context, Concept, Content Location: Kings Cross, London

123

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Alistair Moule Project: The Bemerton Experiment Studio brief for 2013/14: Context, Concept, Content Location: Kings Cross, London

124

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Meya Tazi Project: “Be the Mertons” Soap Opera Studio Studio brief for 2012/2013: Context, Concept, Content Location: Kings Cross, London

125

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Meya Tazi Project: “Be the Mertons” Soap Opera Studio Studio brief for 2012/2013: Context, Concept, Content Location: Kings Cross, London

126

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Studio brief 2014/15: Imagining the Commons Connect-empower-evolve! Once a rough area of London, Dalston is now synonymous ZLWKKLSVWHUFXOWXUH<HWDOWKRXJKKHDYLO\JHQWUL¿HGWKHDUHD LVVWLOOKRPHWR¿QDQFLDOO\ORZHUFODVVHVDQGLVVWLOORQHRIWKH most ethnically and culturally diverse areas of London. An area where boutique cafes, cocktail bars and disco pizza coexist with pawn shops, Afro-Caribbean hair parlours, car repair workshops, hamams and mosques; an area connected with three relatively new public spaces but also segregated by infrastrucWXUHOLQHV KHDY\WUDI¿FVWUHHWVWZRUDLOZD\VHWF  ,VJHQWUL¿FDWLRQUHDOO\XQDYRLGDEOH"%DVHGRQIDFWWKDWDOPRVW WZRWKLUGVRI³'DOVWRQLWHV´OLYHLQFRXQFLOÀDWVLVLWIDLUWRLPDJLQH a future only for the newcomers? Does Dalston need another expensive housing complex, another chain supermarket, another bank? How to connect instead of segregate? Can we imagine self-managed, non-hierarchical common spaces, on the threshold between the market and the state? Can we imagine a space for empowered users without the need for a boss, or a charity, or the state?

127

PORTFOLIO, Orsalia Maria Dimitriou, PhD

Studio brief 2015/16: 5DGLFDO$UW5DGLFDO/LYLQJ

The purpose of this studio is to imagine the future of the comPRQVLQKLJKO\GHQVHXUEDQSORWVGH¿QHGE\VWURQJERXQGDULHV (the street, the high-rise, the market, the public space, the train OLQH DLPLQJWRFRQQHFWHPSRZHUDQGHYHQWXDOO\¿JKWEDFN Remember that innovation can only come when imagining different social relations and realities. The emphasis of this studio is on materiality and social relations. Being critical towards standard architectural approach, which focuses on the material and geometrical construction, this studio is going to approach design as a creative and critical tool that aims to connect the material with social practices imagining a future of social relationships, build on communication, connection and common goals that can empower local communities and resist their erosion and expulsion.

Any architectural design project requires engaging with a strategic understanding of the social and physical context into which it will be implemented, developed through a comprehensive process of analysis and experimentation. Our society is in a constant process of evolution that may be more or less noticeable. If architecture can be considered as a sort of intersection of space, in its materiality, and time, through our dwelling, then the conception and production of an architectural proposal requires an understanding of the context and the situations and processes around and within it. Stage 3 is focussed on the development of a strategic approach to design, a critical exploration and experimentation of the potential agency that architecture may have. We emphasise the role of the design process as a form of critical practice, in itself; supported by a comprehensive research and analysis.

This studio asks you to envisage spaces, tactics and new types of living related to radical creative practices. You are invited to ORRNDWWKHVSHFL¿FLWLHVRIORFDODQGLQWHUQDWLRQDODUWLVWLFJURXSV that challenge social conventions. We will question the production of culture, the boundaries between producing art and living inside art, the future of dwelling, live-work units, creative live-in spaces, art residencies and cultural institutions. You are to design spaces that will enable artists to live, work, perform, share resources, ideas, form collectives, engage with the community and the context, engage with audiences, experiment, challenge the cultural and residential status quo and form resilience. Your proposal should be a hybrid of residential and cultural spaces. You are strongly encouraged to look at art practices of social character, engagement and communities of artists. Identify practices that question or require different forms of living and inhabitation than the standard market solutions. Remember that innovation can only come when imagining different social relations and realities.


CENTRAL SAINT MARTINS BA ARCHITECTURE 6WXGHQW&KDUQMHHY.DQJ Project: The Realities of Dalston Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

1

6

2

7

8

3

9

4

10

11

3

3 12

2

2

1

1

13

SHOP 14

243

G

G

5

128

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE 6WXGHQW&KDUQMHHY.DQJ Project: The Realities of Dalston Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

BURNING OFF THAT MUFFIN!

I THINK I MIGHT TAKE THE ELEVATOR NEXT TIME AROUND

I’M EXCITING TO SEE WHAT ACTIVITIES THEY HAVE GOING ON AT THE FIELD

S H I L O A H P E N T I C O S TA L C H U R C H B 1

1

4

6

10

9

5

7

8

9

3

ASHWIN STREET

12

A

11

3

2

1

B

129

PORTFOLIO, Orsalia Maria Dimitriou, PhD

THE GARDEN LOOKS MUCH BUSIER THAN NORMAL FOR A TUESDAY, MUST BE GOOD FOR THE CAFE!


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Emma Twine Project: Buttermere Walk High Street Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

130

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Emma Twine Project: Buttermere Walk High Street Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

131

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Hannan Abdulamir 3URMHFW:HDYHUV¶)DFWRU\ Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

THE DALSTON FABRIC

132

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Hannan Abdulamir 3URMHFW:HDYHUV¶)DFWRU\ Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

133

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Serhan Tekbas 3URMHFW:HDYHUV¶&ROOHFWLYH Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

134

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Serhan Tekbas 3URMHFW:HDYHUV¶&ROOHFWLYH Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

INTERNAL SECONDARY STRUCTURE: CORTEN STEEL FRAME PRIMARY STRUCTURE: COMPOSED OF CONCRETE WALLS, STEEL/ CORTEN STEEL COLUMNS & BEAMS

EXPLODED AXONOMETRIC OF THE ‘WEAVERS CAFE’

2 1

EXTERNAL SECONDARY STRUCTURE: CORTEN STEEL FRAME

LEVEL 2

GROUND FLOOR

N

9

11

10

2

14 12 8 13 6

7

5 4 15

1

3

2

135

PORTFOLIO, Orsalia Maria Dimitriou, PhD

1


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Vittoria Lenzi Project: Shadow Express Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

136

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Vittoria Lenzi Project: Shadow Express Studio brief for 2014/15: Imagining the Commons Location: Dalston, London

site

structural wall witholding elevator shaft

structural beams containing the staircase + test theatre

UNIT 1 : structural beams carrying the load of the cantilever roof and glass facade

arcola theatre

london saz colvestone school primary school

elderly centre

turkish community centre

mapping model showing location of the original building in which agents come from.

top level

top floor

first level

steel rods in reinforced concrete floors - they ar oiled like Vitra Fire station in order to cope wit

first floor

openable windows by sliding above each other

ground level

platform level

sreen for outfoor cinema + shade for internal atrium

gillette square

railing becoming bracing holds onto the tail of the building and gives both a conceptural idea of string puppets while also improving ridley road market

ground floor

trainline

gallery frame as bracing

platform level dalston lane

plan view of model highlighting the flow of agents into the proposal.: the white ringed roads are highlighted once more to emphasise the urban scale accessibility of the site.

ucture buckle

137

double beam helps to counterwight cantilever

if hanging glass facade from cantilever this will cause a very week joint on the top.

by creating two triangular braces which anchor onto the structure’s tail the facade is secured

PORTFOLIO, Orsalia Maria Dimitriou, PhD

door passage leading to gallery and restaurant/cafe.

steps

beams supporting stairs

frame as bracing

screen


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Adolfs Kristapsons ns Project: Only Dead Fish Go with the Flow FDO/LYLQJ 6WXGLREULHIIRU5DGLFDO$UW5DGLFDO/LYLQJ Location: Hackney Wick, London

138

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Adolfs Kristapsons Project: Only Dead Fish Go with the Flow 6WXGLREULHIIRU5DGLFDO$UW5DGLFDO/LYLQJ Location: Hackney Wick, London

139

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Studio brief 2017/18: Radical Arts - Critical Architecture

Studio brief 2018/19: New Ways of Being

Studio brief 2019/20: ,PDJLQLQJ&ROODERUDWLYH)XWXUHV

Exercising socio-political critique via cultural critique

This year’s studio asks you to interrogate existing architectural market-prescribed spatial typologies and models of cultural production and to envisage new spatial tactics, arrangements and typologies that will house experimental, radical and sociallyempowering art practices.

µ7KHDUFKLWHFW¶VRQO\RSWLRQLVWR¿QGDFRXUVHIRUUHYROXWLRQDU\ SUD[LVRXWVLGHWKHWUDGLWLRQDOERXQGDULHVRIKLV¿HOG¶

2XUYHKLFOHIRU¿QGLQJRXWWKHVHQHZZD\VRIEHLQJLVWKHLQWHUrelation between art and architecture. We will operate on the junction of the two disciplines, address relevant issues simultaneously from the periphery and the centre. You are invited to ORRNDWWKHVSHFL¿FLWLHVRIORFDODQGLQWHUQDWLRQDODUWLVWLFJURXSV that challenge social conventions and existing power hierarchies.

This year our studio has worked together with an MA studio at the School of Architecture in Dessau led by Professor Ivan Kucina. Our collaboration is based on sharing interests in commons, arts, collaborative developments, alternative futures and radical actions. Referring to the 100 year of Bauhaus, its collaborative design process and its vision of design that can make social change, we asked the students to imagine an alternative world in which empathy motivates our personality instead of individual success, solidarity runs our society instead of market competitiveness, and collaboration transforms our cities instead RISUR¿WPDNLQJ

This year’s studio asks you to envisage new spatial tactics, arrangements and typologies that support cultural production related to radical creative practices. You are invited to look at WKHVSHFL¿FLWLHVRIORFDODQGLQWHUQDWLRQDODUWLVWLFJURXSVWKDW challenge social conventions and existing power hierarchies. We will question the spatial and social boundaries between the productions, circulation and consumption of art; we will seek similarities between producing art and living inside art, and interrogate the future of cultural institutions; we will enquire about the role of art as a catalyst for social and political betterment and we will experiment with new situations, scenarios, programmes, forms and spatial typologies that are produced by and for radical art and cultural practices. Your proposal should be a cultural space that will include a variety of private, public and common areas. You are strongly encouraged to select as your users/protagonists art practices of social character, engagement and communities of artists. You should identify practices that offer alternative forms of operation and question the typical art market solutions - look for multisensory, collaborative, participatory and transitory practices. You are encouraged to think about cultural spaces in broad terms: do learn from spaces of institutions that are typically associated with culture like opera houses, concert halls, theatres, art galleries and museums, but also consider the less obvious, ephemeral and everyday cultures and their spatial manifestations such as cooking classes, circuses, clubs, social clubs, libraries, open schools, hybrid art and business platforms, writers’ clubs, street theatre. You are also invited to think of a wide range of visual, performative and sound art.

We will question the spatial and social boundaries between the productions, circulation and consumption of art; we will seek similarities between producing art and living inside art, and interrogate the future of cultural institutions; we will enquire about the role of art as a catalyst for social and political betterment and we will experiment with new situations, scenarios, programmes, forms and spatial typologies that are produced by situated art and cultural practices. Your proposal should be a cultural space that will include a variety of private, public and common areas. You are strongly encouraged to select as your users/protagonists art practices of social character, engagement and communities of artists. You should identify practices that offer alternative forms of operation and question the typical art market solutions - look for multisensory, collaborative, participatory and transitory practices. You are encouraged to think about cultural spaces in broad terms: do learn from spaces of institutions that are typically associated with culture like opera houses, concert halls, theatres, art galleries and museums, but also consider the less obvious, ephemeral and everyday cultures and their spatial manifestations such as cooking classes, circuses, clubs, social clubs, libraries, open schools, hybrid art and business platforms, writers’ clubs, street theatre. You are also invited to think of a wide range of visual, performative and sound art. Throughout the design process you will think laterally and out of the box, and build up your communication tools. At every stage TXHVWLRQKRZFDQUHSUHVHQWDWLRQVRID¿QDODUFKLWHFWXUDOGHVLJQ convey a meaning that extends beyond of what is to be built to what is imagined.

140

PORTFOLIO, Orsalia Maria Dimitriou, PhD

Joan Ockman, Architecture, Criticism, Ideology

Imagining Collaborative Futures is a call for an adventure towards new utopian horizons that can generate innovations for global social, political and cultural sustainability in the face of the ongoing converging crises. Students focused on Fleet Street in the City of London, its rich history and current posiWLRQLQWKHZRUOG¶VOHDGLQJ¿QDQFLDOFHQWUH7KH\YLVLWHG0D\GD\ Rooms, a building on Fleet Street dedicated to social movements, experimental culture and marginalised groups. At Mayday Rooms, they explored Concrete Action Archive, a history of collective architectural practices. They interrogated spatial strategies of existing market-prescribed architectural and spatial typologies and envisaged new spatial tactics, arrangements and typologies to house experimental, radical and socially-empowering collaborative practices. Throughout the year, we have kept a close contact with our partner studio in Dessau. We shared resource and knowledge through online groups, joined each other’s reviews and organised a study trip to Dessau. The body of work produced will contribute towards a shared resource base. Through this process, students are prompted to discover their own critical practice. Furthermore, the students were encouraged to develop their communication skills to answer the question - how can repreVHQWDWLRQVRID¿QDODUFKLWHFWXUDOGHVLJQFRQYH\DPHDQLQJWKDW extends beyond of what is built to what is imagined? The architectural design presented in this section of the catalogue offer bold vision of collaborative futures that are critically responding to the socio-political paradigms of today.


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Qinxue Wang Project: Happening Performance Factory Studio brief for 2017/18: Radical Arts, Critical Architecture Location: Brixton, London

141

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Qinxue Wang Project: Happening Performance Factory Studio brief for 2017/18: Radical Arts, Critical Architecture Location: Brixton, London

142

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Minh Duc Le Pham Winner of Best Project of Spatial Practices Award Project: Le Brixton Garbage Therapy Studio brief for 2018/19: New Ways of Being Location: Brixton, London

143

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE Student: Minh Duc Le Pham Winner of Best Project of Spatial Practices Award Project: Le Brixton Garbage Therapy Studio brief for 2018/19: New Ways of Being Location: Brixton, London

144

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE In Collaboration with MA Architecture School in Dessau, Germany Student: Finn Crawford Project: Radical Temperance 6WXGLREULHIIRU,PDJLQLQJ&ROODERUDWLYH)XWXUHV Location:Fleet Street, London

145

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE In Collaboration with MA Architecture School in Dessau, Germany Student: Finn Crawford Project: Radical Temperance 6WXGLREULHIIRU,PDJLQLQJ&ROODERUDWLYH)XWXUHV Location:Fleet Street, London

146

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE In Collaboration with MA Architecture School in Dessau, Germany 6WXGHQW6]R¿D%RKRVORYHF Project: Temple of Meditation 6WXGLREULHIIRU,PDJLQLQJ&ROODERUDWLYH)XWXUHV Location:Fleet Street, London

147

PORTFOLIO, Orsalia Maria Dimitriou, PhD


CENTRAL SAINT MARTINS BA ARCHITECTURE In Collaboration with MA Architecture School in Dessau, Germany 6WXGHQW6]R¿D%RKRVORYHF month 1

Project: Temple of Meditation 6WXGLREULHIIRU,PDJLQLQJ&ROODERUDWLYH)XWXUHV Location:Fleet Street, London

©½º¼ÇÄÊùijÄÄǸÄÁÊÂúù˾ºÌ»ÇÄ the top

month 3

The ceiling sheets are suspended on horizontal metal pipes running through the column. The planting bowl with holes sits on the top of the column

month 4

The tree of 2-5 years old ordered and placed in the planting bowl

month 4

—¶¸ÀIJÁÁ¾ÈÅÁ¶¸º¹¾ÃȾ¹ºɽºÅÁ¶Ãɾü bowl with excavated soils from the basement

2

Th e Tree of Life

+

Outside e terraces/ Elevated walking steps

Transitiion zone / Walking Hall

Individu ual meditation spaces

Transitiion zone / Walking Hall

Group M Meditation Hall

Entranc ce Hall

148

PORTFOLIO, Orsalia Maria Dimitriou, PhD

month 7

ɽººɶÁºȽijÄÄǾü¾È̺Á¹ÉļºÉ½ºÇ and placed on the top of bowl and ceiling

month 24

Transparent handrails are placed at the º¹¼ºÈ¶Ã¹ÉÄÅijÄÄǁIJÇÈÉÁºËºÁ¾È¾Ã½¶·itable with vegetation and visitors after stability check of structure


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Studio brief 2018/19: Situated Art - Critical Architecture The unit is facilitating a relation between conceptual spatial theories in art, architecture, urbanism, performativity, participatory design and activism. Such a spatial approach ties in with WKH¿HOGRIH[SHUWLVHRIWKHXQLWOHDGHUVDQGLVUHOHYDQWWRWKHLU interest in interrelating theoretical and practical knowledge gained through teaching, researching, running live projects, workshops and through a dynamic engagement with artist and activist groups. The Unit Situated Art – Critical Architecture will envisage innovative spatial tactics, arrangements and typologies that support cultural production related to situated creative practices. We will question the spatial and social boundaries between the productions, circulation and consumption of art and interrogate the future of cultural institutions; we will enquire about the role of art as a catalyst for social and political betterment and we will experiment with new situations, scenarios, programmes, forms and spatial typologies that are produced by and for radical art and cultural practices.

149 1 14 49

P PO PORTFOLIO, ORT RTFO RT FOL LIIO, Or O Orsalia rsa salliia Maria Mari Ma ria Dimitriou, Diim D miittrrio iou u, PhD PhD hD

The Unit will situate itself in the dense and exciting cultural grounds of Athens, Greece - a city with a rich background and history, currently suffering an economic crisis that has impacted the socio-political and urban fabric. This crisis-ridden metropolis FRQVWLWXWHVDQH[WUHPHO\G\QDPLFFXOWXUDO¿HOGLWLVWKHFUDGOH of numerous alternative bottom-up cultural practices, but is also is chosen by large international institutions such as Documenta and the Dutch Art Institute and Onassio Foundation as their venue. While these large institutions claim to have chosen Athens because it embodies the economic, political, social, and cultural dilemmas that Europe faces more broadly, the critics point out the issues revolving around ‘cultural exploitation of crisis’, ‘exoticism’ and ‘colonisation’.

There is an urgent necessity for a profound reformulation of the existing design approaches for the reactivation of this cityscape which will prioritise the common values of social inclusion, cultural diversity and the well-being of the citizens over any other particular economic interest. The Unit will look for solutions that will go beyond a building in the narrow sense of the term as it will be open up to a range of spatial arrangements varying from ephemeral to monumental and including visual, performative or aural expressions of architecture.


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Zirui An Project: Oberon Dreamworks Studio brief for 2018/19: Situated Art, Critical Architecture Location: Psyri, Athens

150

PORTFOLIO, Orsalia Maria Dimitriou, PhD


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Zirui An Project: Oberon Dreamworks Studio brief for 2018/19: Situated Art, Critical Architecture Location: Psyri, Athens

151 1 15 51

P PO PORTFOLIO, ORT RTFOLI FOLI FO LIO IO, Or O Orsalia rsali salliia Maria sa Ma M ari ria Dimitriou, Dimi Di mittrrio ou u,, PhD PhD hD


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Yifan Wang Project: Art Studios Studio brief for 2018/19: Situated Art, Critical Architecture Location: Psyri, Athens Free Platform

Free Platform

Roof Steps

Roof Steps Roof Steps

Steel Structure

Warehouse Theater

12.050 9.350 6.550 5.800

± 0.000

152

PORTFOLIO, Orsalia Maria Dimitriou, PhD


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN C

Student: Yifan Wang Project: Art Studios Studio brief for 2018/19: Situated Art, Critical Architecture Location: Psyri, Athens

A

B D

The boundary of each functional area to be weaken which provide more free DQGÀH[LEOHVSDFHIRUDUWDFWLYLWLHV

Flexible space which can promote the occurence of art activities and actions.

153

Platforms of different heights make it the perfect venue for performance.

Flexible segmentation devide the space into two seperate area.

PORTFOLIO, Orsalia Maria Dimitriou, PhD

Every platform can be the stage.

The performance and exhibitions can take palce in places over the whole building in any combinations.

It is hard to imagine where the performance EHJLQDQG¿QLVK

Flexible segmentation devide the space into three seperate area.


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Xin Chen

w te At

.M

St

Te at re

of

th

eO

pp

re s

ed

Project: Parliament of the Oppressed Studio brief for 2018/19: Situated Art, Critical Architecture Location: Brixton, London

ch ur

Ch

Lamb

154

from Saltoun road

PORTFOLIO, Orsalia Maria Dimitriou, PhD

e ur sq sh u r d stre etscaoe 2 from win

all

s et stre

t ee str

sc ao e1

H own eth T

ca oe 1

fro m st reet Effra road


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Xin Chen Project: Parliament of the Oppressed Studio brief for 2018/19: Situated Art, Critical Architecture Location: Brixton, London

14.000

10.000

5.500 3.500 3.000 2.500 0.200

elavation 1:200

155

PORTFOLIO, Orsalia Maria Dimitriou, PhD

section A-A 1:200


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Shuotian Wu 3URMHFW7KHDWUH5HYROXWLRQ Studio brief for 2018/19: Situated Art, Critical Architecture Location: Psyri, Athens

+23.100

+17.700

+14.200

+10.600

+6.400 +3.600 +0.000

156

PORTFOLIO, Orsalia Maria Dimitriou, PhD


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Shuotian Wu 3URMHFW7KHDWUH5HYROXWLRQ Studio brief for 2018/19: Situated Art, Critical Architecture Location: Psyri, Athens

This is the second installation in this street, which was translated from a long shot. The troupe left the original city and arrived at the new performance destination. When the train entered the station, the players got off the train and walked out of the platform. Then, a panning camera, the picture gradually turned from the station head to the beach on the right side, and a group of parade team marches through the frame.

I

X II

III

VI

IX

VIII

V VII

IV

157

PORTFOLIO, Orsalia Maria Dimitriou, PhD


WELSH SCHOOL OF ARCHITECTURE MA ARCHITECTURAL DESIGN Student: Shuotian Wu 3URMHFW7KHDWUH5HYROXWLRQ Studio brief for 2018/19: Situated Art, Critical Architecture Location: Psyri, Athens

When I selected an abandoned building as site, it is inevitable to premeditate its original foundation. Thoroughly removing old buildings is a reckless decision. Take the current situation of this community into consideration, there has been no new construction for a long time, and any new installation will be abrupt on the street. So I need to hide the installation into the old building. Instead of completely be covered up, it was merged with some old walls or old structural columns. By this way, the installation look like derivatives of historical relics, keeping in harmony with the surroundings, revitalizing the ruined house. The new and old parts have the following design methods: connection, juxtaposition, and overlay, which confers on it a sense of place and identity through their historic continuity and cultural associations.

Rservation part

Surrounding condition

O i i

158

PORTFOLIO, Orsalia Maria Dimitriou, PhD

l

di i


ON THE FOLLOWING PAGES IS A SAMPLE OF ARCHITECTURAL PROJECTS THAT DEJAN AND URSULA WORKED ON IN LONDON BEFORE SETTING UP STUDIO SYN


VICE MAGAZINE HQ 9HUVDWLOH&RQWHPSRUDU\2I¿FH5HIXUELVKPHQW

Shoreditch, London 7KLVLVDUHIXUELVKPHQWSURMHFWRIDQROGIDFWRU\LQ6KRUHGLWFK /RQGRQLQWRDYHUVDWLOHRI¿FHVSDFHIRU9LFH0DJD]LQH 9DULRXVDUHDVDFURVVWKUHHÀRRUVRIWKHEXLGOLQJZHUH VWULSSHGGRZQWRVWUXFWXUHUHSXUSRVHGDQGUHIXUELVKHG:H ZRUNHGFORVHO\ZLWKWKHFOLHQWFRQVXOWDQWVDQGWKHWHQDQWIURP FRQFHSWLRQWKURXJKWRFRPSOHWLRQWRGHOLYHUWKHSURMHFWWRD KLJKVWDQGDUGDQGWLPHO\UHVSRQGWREULHIFKDQJHV5HGXFHG PDWHULDOVSDOOHWHFRQVLVWHGRIEODFNDQGJDOYDQLVHGPHWDO DQGZKLWHSDLQWHGVXUIDFHVWRSURYLGHD¿UP\HWYLVXDOO\ ÀH[LEOHEDVHIRUD¿WRXWE\WKHWHQDQWDWDODWHUGDWH Project Data: budget £2m area 1200m²

6

Key Words: YHUVDWLOHRI¿FHVSDFH refurbishment, magazine HQ, functional aesthetics

PORTFOLIO, Studio SYN, London / Athens


VICE MAGAZINE HQ Careful Integration of Exposed A/C Ducts, Cable Trays and Lighting Creates a Minimal and Industrial Look and Easy Maintenance and Alteration

7

PORTFOLIO, Studio SYN, London / Athens


VICE MAGAZINE HQ All Refurbishment Aspects Take into Consideration the Existing Building Fabric, Building upon its 1960s Heritage

8

PORTFOLIO, Studio SYN, London / Athens


CHAPTER ARTS CENTRE Arts & Culture Centre Refurbishment Cardiff, Wales This regional arts centre has a long tradition of delivering a range of cultural programmes and the proposal aimed to VWUHQJWKHQWKLVE\LPSURYLQJDQGXSJUDGLQJWKHSXEOLFSDUWVRI WKHEXLOGLQJ7KHLQVLGHRIWKHEXLOGLQJZDVRSHQHGXSWRZDUGV WKHRXWVLGHUHIXUELVKLQJWKHFDIHDUHDWKHUHFHSWLRQDUHDDQG E\H[WHQGLQJWKHHQWUDQFHZHLQWURGXFHGDOLJKWER[DWWKHIURQW RIWKHEXLOGLQJDQGDGGLQJDQHZPXOWLSXUSRVHVSDFHWRWKH PL[ Project Data: EXGJHW…P area 3500m²

9

Key Words: arts & culture refurbishment, interior design, reception design, desk space design, public building

PORTFOLIO, Studio SYN, London / Athens


CHAPTER ARTS CENTRE 2 401

Airy, Exciting and Practical Design of the Reception Workspace and Lobby Makes both the Employees and Visitors Happy

IW-41:gallery wall

1000

WF-42 Magnetic black vinyl wall finish

IR-21: retained glazed doors

1520

filing/ workstation under desk

800

B0F-05:leaflet display with felt skirt

CL

1130

CL

CL

1075

1050

boarded over

IR-23: retained glazed doors

new planter 1800mm from external wall

XW-44 Timber bench w1/44

w1/45

w1/42

w1/43

new door painted with blackboard paint

ST-02 balastrade

new column box section 150

1000

RS-31

artist's terrace

895

GL-21 roof light

850

W1/47

d1/11

XW-32 cables XP-01 support of existing masonry pier to SE spec and details (alternative corbel?)

RS-41

CL-21 acoustic ceiling position and size of steels to be confirmed

H/L pipe run refer to M&E spec and dwgs

CL-21 acoustic ceiling

CL-02 pb ceiling

CL-21 acoustic ceiling

acrylic opal programme holder flood lig enginee

bar

IW-22 wall lining

channels packed with timber offcuts

XW-21 timber fencing

vent duct to M+E spec and dwgs structural opening to wall nom. 900mm x 400mm

GL-31

GL-31

20mm iroko lining to guide rails and overhead shutter guide track for overhead shutter

4800 shutter opening

GL-02 folding screen

G.35

FX-18 form reeses in IW-22 wall lining for radiator

A

XW-41 concrete bench

courtyard G.29

trench heater to M+E spec

flat panel radiator refer to M&E spec and dwgs

dG/35.4

5400 overall length of desk

F

dG/35.5

FS-02 slab

Section B-B

1

Long section through Cafe and Patio

BOX OFFICE - GALLERY ENTRANCE PLAN

CL-03

RS-01

new roof, insulation and membrane

RS-02

ventilator grille to M+E spec and drawings

BOF-03:Envirolite HT-40K stacking door

ventilator grille behind signage M+E spec and drawings

CL-03:boxing out to beams

1090

ductwork to M+E spec and drawings B 412

aluminium lettering fixed back to grille with painted finish CL-01:plasterboard ceiling

w1/10

W1/47

20mm iroko lining to guide rails and overhead shutter

WF-42 Magnetic black vinyl wall finish

GL-21 roof light w1/45

theatre

theatre foyer

1.60

1.61

PT-33:blackboard paint to door and wall

swivel screen

FX-17 new retractable seating w1/11

box office lightbox sign to soffit

IR-41:retained glazed screen

boarded over

d1/60.22

2480

ST-21 balustrade

w1/12

cut out plywood lettering fixed to ventilator grille colour tbc

GL-61 secondary glazing

FX-16 curtain track

w1/13

gl-01 frameless glazing

90

RWP

GL-11 light box

IR-21:retained glazed door

IR-41:retained glazed screen+door

d1/60.4

CL-03

CL-03

CL-03

CL-03

support of existing masonry pier to SE spec and details (alternative corbel?)

welded plate 100mm wide B0F-05:leaflet display with felt skirt

B0F-05

continuous T5 light

PT-12 magnetic paint

concourse

BOF-05 leaflet display

XW-31 bike hoops

wG/9

clean existing tiling

B0F-01: Box office desk

B0F-02:storage

G.30

wG/8

BOF-01 desk

cafe

bar

G.30

G.35

yellow polyester powder coatted trunking data+power cover 10mm perspex finger jointed sheet tapped into10mm edge of bracket

existing masonry pier behind new liniing

GL-01

B0F-01: Box office desk

B0F-05: acrylic opal programme holder existing tiling cleaned

acrylic opal programme holder

10mm perspex finger jointed sheet tapped into10mm edge of bracket

700

H/L pipe run refer to M&E spec and dwgs

ventilation grille with signage PT-33 blackboard paint

dG/30.7

dG/30.11

new opening to gallery with sliding pocket door dG/30.10

dG/30.11

dG/30.7

IR-41 retain glazed screen behind box office

B

10

Section B-B

PORTFOLIO, Studio SYN, London / Athens

yellow polyester powder coatted trunking data+power cover

3

existing chimney pier retained

Long section through concourse

2

BOX OFFICE -SECTION

401

BOXBOX OFFICE - IN FRONT OF DESK

B 3

Scale

10mm perspex finger jointed sheet tapped into10mm edge of bracket


CHAPTER ARTS CENTRE Getting the Atmosphere Right in the Theatre, Cafe Kitchen, and Cafe Seating Area. It is all in the Details and Right Selection of Furniture and Finishes

3ECTIONS 

! !  !

reinforced ceiling edge /bump rail for maintenance

Directional lights on tracks

Continuous T5 light

"Star constellation" lights fixed to dark blue painted suspended ceiling

WF-51 50mm basotech foam

light fittings to M&E spec and drawings

CL-22 acoustic insulation to ceiling

existing speaker system re-used

Curtain track concealed behind timber downstand

IW-13 acoustic partition

hearing loop re-used

new monitoring room

FX-10 red velvet curtain

GL-51 Porthole 300x1000mm

speaker Red painted timber architrave

existing screen retained

acoustic scrim, colour to match curtains over speakers

FF-24 Red carpet to curve up rear wall

FX-15 Dark blue velvet curtains

existing alcove FX-22 Star BR seats

emergency break glass Fire extinguisher fixed to wall existing speakers moved back into alcove

FX-14 red perforated fabric to front of speakers

SK-13 Red Carpet skirting

0LAN

 !  !

CL-01 plasterboard ceiling

CL-01: plasterboard ceiling

Stud lining with plasterboard face

IW-21 Lining

Existing window to be removed. Refer to window schedule

T5 Fluorescent lights

bar

kitchen

G.35

1750

G.26

BF-03 Wall mounted painted profiled steel cabinets with top hinged profiled acrylic doors, toggle lockable to the underside

18mm ply blackboard spaced off wall on 50mm batons

HL plan

500

bar G.35

Welded lugs bolted to face of vertical RHS

Electrical (sockets) to M+E details

50

47

Stainless steel sill and upstand Continuous T5 lights

A

11

Purpose built cabinets with Wisa ply doors on heavy duty concealed hinges, 3 No. per door

Moisture -resistant MDF with paint finish

1050

1050 120

Continuous T5 Lights

IMC Leg frame

SECTION CC

ML plan

Continuous T5 lights

830

Vinyl safety flooring with coved skirting

Vinyl safety flooring with coved skirting

IMC Bar Support frame secured through bottom plate into floor

18mm moisture-resistant MDF base panel

Continuous T5 lights

A

120

Services run within frame

Stainless steel upstand

IMC Bartender Unit

Services within frame

IMC Bar Support frame secured through bottom plate into floor

Brown Wisa ply sill BF-02 Brown Wisa ply counter-top

18mm moisture-resistant MDF

650

IMC Bottle Cooler

Moisture-resistant MDF with paint finish

Through-the-bar ,xing 6 Point Boxa T-Bar chilled-to-tap bar font (50mm clearance hole in the bar)

15 100

205

CF-04 Stainless steel counter-top

1030

70

35.5

25mm clear air gap at top and both sides of bottle coolers

IMC Bartender Unit

Continuous T5 Lights

BF-01 Corian serving counter

Continuous T5 Lights

Through-the-bar /xing 6 Point Boxa T-Bar chilled-to-tap bar font (50mm clearance hole in the bar)

546

New ,xed window

BF-01 Iroko bar counter

IMC Leg frame

SECTION AA Bar

Cafe

PORTFOLIO, Studio SYN, London / Athens

LL plan

SECTION GG Cinema 2 & projection room

ST-24 balustrade and handrail

FF 15 on FS12 floor

FF-24 on FS-11 curved floor ST-31 new timber steps void below floor

FS-11 stage area with FF-24 carpet over

form 3No. new openings for low level ventilation supply below seating. grilles to be acoustically dampened. Refer to MPA details

DG/21

A

circular ventilation grilles below seats, refer to M&E spec and drawings

1500 to projection lens

speaker Emergency lighting

CINEMA 2 - G.05

PROJECTION ROOM G.04


NEW FRITH STREET GALLERY *DOOHU\DQG2I¿FH5HIXUELVKPHQWDQG)LW2XW Central London 7KHSURMHFWHQWDLOHGDFRPSOHWHRYHUKDXORIWKHH[LVWLQJVSDFH 7KURXJKDFORVHFROODERUDWLRQZLWKDVFWUXFWXUDOHQJLQHHU 6WXGLR6<1UHHYDOXWHGWKHH[LVWLQJVWUXFWXUHDGGHGDEHVSRNH VWDLUFDVHOHDGLQJGRZQWRWKHEDVHPHQWDQGVWULSSHGGRZQWKH LQWHULRUWRLWVVKHOOEHIRUHUHLPDJLQLQJLWDVDJDOOHU\ 6SHFLDOFDUHZDVJLYHQWRWKHRI¿FHVSDFHDVWKHFRPPHULFDO VLGHRIWKHJDOOHU\EXVLQHVVDOORZHGIRUWKHUHIXUELVKPHQWLQWKH ¿UVWSODFH6N\OLJKWVZHUHRSHQHGLQWKHH[LVWLQJJURXQGÀRRU DWWKHEDFNVODEWREULQJOLJKWWRWKHRI¿FHORFDWHGRQWKHORZHU ÀRRU Project Data: EXGJHW…N area 300m²

12

Key Words: arts & culture refurbishment, interior design, RI¿FHGHVLJQ furniture design.

PORTFOLIO, Studio SYN, London / Athens


NEW FRITH STREET GALLERY E-03 5 505 144

5800

1552

1552

1552

1000

proposed steel frame 930

%HVSRNH'HVLJQRI7KH*DOOHU\¶V2I¿FH6SDFHDQG)XUQLWXUH7KH 2I¿FHZLWKLWV*ODVV:DOOV%HFRPHV3DUWRIWKH*DOOHU\LWVHOI

oregon pine veneer 4700 V

1664

400

100

880

E-04

43

30 30 80

20

oregon pine SVL

175

930

cable outlet (d.80mm) hafele :631.32.004to be centered with group of plugs above the working surface

400

20

130

20

140

1664 130

400

140

E-02

2000

190 100

oregon pine SVL

5 505

E-01

4

PLAN

1

AXONOMETRIC

5

SCALE 1:25

SECTION SCALE 1:25

SCALE 1:25

5 505 440

1127

397

25

507

440 520

1127

440

1127

220

880

100

Tx2

iTx4

520

5A

iTx4

2

Tx2

505

5A

5A

550

Tx2

275

iTx4

5A

520

580

440

100

520

581.4

440

100

520

580

440

100

50

100 100

100

275

750

818

Tx2

100

5mm shadow gap 2mm shadow gap

iTx4

5A

800

380

380

Tx2

25

iTx4

Tx2 5A

5A

100

iTx4

Tx2

550

iTx4

blocking as necessary

750

562

230

iTx4

5A

18 134 153

18 202

Tx2

5A

2000

iTx4

Tx2

800

640

Tx2 5A

400

2000

iTx4

18 212

concealed dynamic drawer runners (length 650mm) hafele :421.55.765

100

25

18

880

5800

5 505

SECTION IN DRAWERS LEVEL

2

ELEVATION A

6

SCALE 1:25

7

SCALE 1:25

ELEVATION B SCALE 1:25

5 505 240

1127

100

240

100

1127

100

240

100

1127

A

806080

880

330

3

1200

100

240

100

1200

100

1200

100

260

80

100 82

Tx2

120

5A

750

25

100

50

275 240

100

100

172 100

iTx4

25

EQB

5A

50

Tx2

100

iTx4

275

EQB

5A

550

Tx2

EQA EQA EQA EQA

iTx4

5A

275

Tx2

800

iTx4

cable access from basement ceiling

5mm shadow gap

50 100

V

275

505

82

100

50x50mm steel profile

1800

100 200 100

1000

1925 (distance from point A)

100

100

100

100

880

2175 (distance from point A)

5 505

SECTION IN SHADOW GAP LEVEL

3

8

SCALE 1:25

ELEVATION C

9

SCALE 1:25

ELEVATION D SCALE 1:25

GUY STANSFELD ARCHITECTS LIMITED Revisions

Project Title

Drawn By

Date

Checked By

Drawing Number

15.01.07

OD

FRITH STREET GALLERY @ GOLDEN SQUARE Drawing Title

PLEASE NOTE

4

GSA814/DET505

Scale

1:25

WORKSPACE TABLE

318 KENSAL ROAD LONDON W10 5BZ www.stansfeld. com T. +44 20 8962 8666 F. +44 20 8962 8777 guy@stansfeld.com

--- Do not scale, use figured dimensions only. --- All dimensions to be verified on site prior to the commencement of any work or the production of any shop drawing. --- This drawing to be read in conjunction with all related Architect's and Engineer's drawings and any other relevant information

4

508

508 5mm shadow gap

door hinges to be full overlay

door hinges to be full overlay

25

JOINT AT CENTRE OF DESK IF NECESSARY POWER SET INTO UNDERSIDE OF DESK

300

5-508

800

800

5-508

10

750

oregon pine SLV

joint to align with top of drawers

blocking as necessary

750

25

1010

440

1010

440

SITE 925

3

3

3

508

508

508

SITE

5mm shadow gap

100

1010

440

1010

440

SECTION

3

18

door hinges to be full overlay

2900

1:25

5mm shadow gap

4

4

508

508

PLAN - UNDER DESK

2

1:25

Cable management running on inside desk thickness accessed through grommets in desk top tbc.

PLAN - WORKSURFACE 1:25

8 19

joint to align with top of drawers

GROMMET

100

750

19

100 25 250 25 250

750

5

100

25

25

painted MDF oregon pine SLV

35 100

PENCIL ROUND

100

9

550

1

100

18

508

515

3

100

25

350

SITE

oregon pine SLV

5mm shadow gap between SVL and MDF shelves above

18

power and tel/com sockets set into bottom of the desk

7

100 100 100

SITE

25

18

SITE

12

5mm shadow gap

EQ.A

EQ.A

60

925

680

60

EQ.B

EQ.B

800

EQ.B

5

SITE

FIXED PANEL

4

SECTION

5

1:25

ELEVATION 1:25

MDF ON UNDERSIDE OF DESK TEL/DATA AND POWER POINTS MOUNTED TO UNDERSIDE OF DESK

7 painted MDF oregon pine SLV

DETAIL

8

1:25

DETAIL 1:25 GENERAL NOTES

oregon pine SLV 10

5mm shadow gap

FIXED PANEL

25

9

1. ALL CARCASSING ON THE SVL UNITS TO BE 19MM SVL WITH SOLID CONCEALED LIPPINGS. ALL DOORS AND DRAWER FRONTS TO BE 19MM SVL. ALL INTERIOR DRAWER LINERS, DIVIDERS ETC. TO BE CONSTRUCTED LACQUERED MDF. 2. ALL CARCASSING ON THE MDF UNITS TO BE 18MM PAINTED MDF. ALL DOORS AND DRAWER FRONTS TO BE 25MM PAINTED MDF.

14

4. ALL MDF TO BE ZERO FORMALDAHIDE TYPE (MEDITE ZF AVAILABLE FROM WILLIAM ETTE EUROPE - 01702 619 044)

3

5. SAMPLES OF ALL VENEERS AND SPRAY FINISHES TO BE APPROVED BY ARCHITECT PRIOR TO MANUFACTURE 33

18

7

19

3. ALL DRAWER RUNNERS TO BE BEST QUALITY CONCEALED FULLY EXTENDING TYPE TO ARCHITECT'S APPROVAL (DRAWN TO ACCOMODATE HAFELE DYNAMIC RUNNERS (CONCEALED, CLIP FIXING, FULL EXTENSION) CAT NO: 421.35.760 8

6. ALL FITTINGS TO BE IN SATIN CHROME OR SATIN STAINLESS STEEL

35

10

7. JOINTS BETWEEN SHEETS OF MATERIAL ARE SHOWN ON DRAWING. ANY AMENDMENTS BY THE JOINER ARE TO BE DISCUSSED WITH THE ARCHITECT PRIOR TO CONSTRUCTION.

10

oregon pine SLV skirting

DOOR

6

SECTION 1:25

RECESSED DETAIL TO RUN VERTICALLY ALONG SIDE OF DRAWER FRONTS TO ALLOW FOR EASY OPENING

19

GUY STANSFELD ARCHITECTS LIMITED Revisions

Project Title

A - 23.02.07 - TS - ISSUED FOR ORDER OF MATERIALS B - 09.03.07 - TS - GRAIN DIRECTION

FRITH STREET GALLERY @ GOLDEN SQUARE Drawing Title

OFFICE DESK

9

13

PORTFOLIO, Studio SYN, London / Athens

DETAIL 1:25

10

DETAIL 1:25

PLEASE NOTE

--- Do not scale, use figured dimensions only. --- All dimensions to be verified on site prior to the commencement of any work or the production of any shop drawing. --- This drawing to be read in conjunction with all related Architect's and Engineer's drawings and any other relevant information

Drawn By

Date

Drawing Number

16.02.07

OD Checked By

Scale

GSA814/DET508B

1:25 1:50 1:5 318 KENSAL ROAD LONDON W10 5BZ www.stansfeld. com T. +44 20 8962 8666 F. +44 20 8962 8777 guy@stansfeld.com


NEW FRITH STREET GALLERY 6DPH7LPEHU0DWHULDO3DOHWWHLV8VHGWKURXJKRXWWKH*DOOHU\WR 8QLI\DOO)XQFWLRQV

14

PORTFOLIO, Studio SYN, London / Athens


ST. BOTOLPH’S CULTURAL QUARTER 8UEDQ5HJHQHUDWLRQ3URMHFW &ROFKHVWHU8. 6W%RWROSK¶VLVGHVLJQHGWREHWKHQHZWRZQFHQWUHKXE &RPSRVHGRIQHZO\EXLOWDQGUHIXUELVKHGEXLOGLQJVLWVKRXOG SURYLGHDFWLYLWLHVWKURXJKDVXFFHVVIXOPL[RIDSDUWPHQWV RI¿FHVPDUNHWVUHVWDXUDQWVEDUVJDOOHULHVDUWLVWVWXGLRVD KRWHODQGFRQIHUHQFHIDFLOLWLHVDOOERXQGWRJHWKHUE\DGHQVH DQGKLJKO\SHUPHDEOHQHWZRUNRISXEOLFVSDFHV7KHHQWLUH GHYHORSPHQWLVHQYLVLRQHGDVDQHFRHQJLQHHULQJWULXPSK

Project Data: EXGJHW…P DUHDPð DZDUGZLQQLQJSURSRVDO

15

Key Words: arts & culture, refurbishment, regeneration, public building community

PORTFOLIO, Studio SYN, London / Athens


ST. BOTOLPH’S CULTURAL QUARTER Ground Floor Circulation Designed as Interior Circulation, Blurring the Boundaries Between Outside and Inside, To Create a Community

-ADEIN#OLCHESTERAPLACEFORLOCAL INDEPENDENTMAKERS PRODUCERSAND GROWERSTOINTERACTDIRECTLYWITHTHE PUBLIC

SHOPOR RESTAURANT

SHOPIN EXISTING 1UEEN 3TREET

(IGHQUALITYPUBLICREALMCONTINUOUS PAVEDSURFACESSHAREDBYPEDESTRIANS ANDTHEOCCASIONALVEHICLE WITH ARCHAEOLOGICALTRACESMARKEDINTHE PAVEMENT

2OMANWALLWALKS

/YSTERBAR PLAYGARDEN

RESTAURANT TERRACE

WALLEDGARDEN BINS RECYCLING

1UEENS7ALK

TURNING CIRCLE

ENVIRONMENTAL WORKSHOPS

ANEVENTSPACE HOSTINGPERFORMANCES FESTIVALSANDALSO THEFARMER´SMARKET !CTIVITIESSPILLOUT ONTO1UEEN3TREET 3T "OTOLPH´S3TEPSAND /LD4HEATRE3QUARE

APARTMENT

3TR EET

SHOP APARTMENT

SHOP

SHOP

SHOP

SHOP SHOP

SHOP

0R

I

Y OR

3

TRE

ET

!CONTINUOUSAND PERMEABLESHAREDTERRAIN FULLOFMOVEMENTAND ACTIVITY

PRIVATE GARDENS

APARTMENT

SHOP

SHOP

SHOP NURSERY

CAFm

.ICHOLAS"UTLER AUTHOROF4HEATREIN#OLCHESTER

STAIRSANDLIFT COMPLETENORTH SOUTHROUTE FROMCASTLETO 3T"OTOLPH´S 0RIORY

&IRSTSITE

SHOP

APARTMENT

APARTMENT

SCHOOLGROUPSOUTDOOR TEACHING

ET

3IXALTERNATIVEENTRY POINTSINTOTHE QUARTERFROMTHE EAST LINKINGTHETOWN CENTREWITH&IRSTSITE AND"ERRY½ELDS0ARK

DEPARTUREPOINTFOR OPENSTUDIOSTOUR

BOULES TOURNAMENT

TRE

N3

EE

1U

/LD4HEATRE 3QUAREBUSKERS ANDBANDS

EXISTINGTREES

OLPHS 7ALK

PICNICS

3T"OTOLPH´S 0LACE

DISABLEDANDCARCLUBPARKING

3T"OT

1UEEN´S 7ALK

±(OWMANY#OLCESTRIANSTODAY KNOWTHATTHECHASMWHICH HOUSESTHE%ASTERN.ATIONAL BUSESHALFWAYDOWN1UEEN 3TREETISTHEPLACEWHERE+EAN DECLAIMED3HAKESPEARE $ICKENSREAD0ICKWICKAND %LLEN4ERRYAPPEAREDIN 3HAW²

CYCLE HOOPS

GALLERY

EEN

&IRSTSITE OUTDOORART INSTALLATIONS

KITE¾YING

RIGHT OF WAY

WALLEDGARDEN

1U

&IRSTSITE

3UMMER3OUNDS 3TREET-USIC

FOLLY

CREATIVEBUSINESS CENTRERECEPTION

"ERRY½ELDS 0ARK STUDENTINSTALLATIONS INTHE-INORIES

GARDEN -INORIES7ALK

APARTMENT

!HUB WITHA CRITICALMASS OFPOPULAR CREATIVEAND COMMERCIAL ACTIVITY BUILDINGON #OLCHESTER´S REALHISTORICAL STRENGTHS

SHOP PARK

SHOP INNEW BUILDING

3T"OTOLPH´S0LACE CYCLE HOOPS

SHOPINNEW BUILDING

APARTMENT

RECYCLING ANDREFUSE

#OLCHESTER /YSTER"AR

APARTMENT

ALLE Y

SHOPINEXISTING 1UEEN3TREET

APARTMENT

SHOPINEXISTING 1UEEN3TREET

/YSTER"AR GARDENAND PLAYAREA

SHOP RESTAURANT

KITCHEN

CAFmBARIN EXISTINGOLD POLICESTATION

KITCHEN

APARTMENT KITCHEN

APARTMENT

RESTAURANT

/LD4HEATRE 3QUARE CAFm

SHOPINEXISTING  1UEEN 3TREET

RESTAURANT

UE

UTAVEN

CHESTN

HORSE

RESTAURANT

URANT

RESTA

4HE'ARAGE GLASSROOFOVER MARKETSAND OTHEREVENTS

TERRACE

NWALL

2OMA

LWA GRAVE

LKALON

GFOOT

OFWA

LL

BENCH CYCLEHOOPS

(ERITAGE#ENTRE PARKING CAFm LIFT PmTANQUEBOULES TERRAIN CAFm TERRACE

WALK

UTTREE

CHESTN

HORSE

BENCHES STAIR

´ IDENTS PTORES RAMPU DPARKING N LANEA

EXISTING TREE

O

0RIORY3TREET

16

PORTFOLIO, Studio SYN, London / Athens

3T"OTOLPH´S0RIORY

M


SADLER SQUARE Mixed-use Development 'HUE\8. 7KLVPL[HGXVHVFKHPHZDVFRQFHLYHGDVDQDUFKLWHFWXUDO IUDPHIRUDYLEUDQWQHZGHVWLQDWLRQDWRQHHQGRI'HUE\¶VFLW\ FHQWUH7KHGHYHORSPHQWPLPLFV'HUE\¶VXUEDQUK\WKPDQG EUDNHVGRZQLQWRLQGLYLGXDOEXLOGLQJV7KHIRXURI¿FHEXLOGLQJV VXUURXQGDFHQWUDOSHGHVWULDQSXEOLFVSDFH0L[HGXVH approach adds 25 apartments and 16 retail/restaurant units HQKDQFLQJWKHHFRQRPLFDQGHQYLURQPHQWDOVXVWDLQDELOLW\RIWKH VFKHPH/RFDOO\VRXUFHGPDWHULDOVSKRWRYROWDLFVVHGXPURRIV KHDWUHFRYHU\V\VWHPVDOOFRQWULEXWHWRD KLJK%5(($0UDWLQJ Project Data: EXGJHW…P DUHDPð planning consent granted

17

Key Words FRPWHSRUDU\RI¿FH UHJHQHUDWLRQ mixed-use FLW\FHQWUH

PORTFOLIO, Studio SYN, London / Athens


SADLER SQUARE )RXU0L[HG8VH2I¿FH 5HVLGHQWLDO%XLOGLQJV Seamlessly Integrated in the City Centre

18

PORTFOLIO, Studio SYN, London / Athens


SADLER SQUARE 2I¿FH6SDFHV$UH'HVLJQHGWREH%ULJKW7UDQVSDUHQWZLWK*UHDW Views and Comfortable in Terms of Light and Break-Out Spaces

19

PORTFOLIO, Studio SYN, London / Athens


CULTURAL BUSINESSES HEADQUATERS Ground-Breaking Mix of Cultural Activities Abu Dhabi /RFDWHGZLWKLQWKHKHDUWRIDODUJHDQGFRPSOH[&XOWXUDO 4XDUWHUWKH&XOWXUDO%XVLQHVVHVDQG$UWV7UDLQLQJEXLOGLQJ FRPSULVHVDVHULHVRIWHQDQWHGVSDFHVIRUµFUHDWLYHLQGXVWULHV¶ RI¿FHVIRUDUWLQGXVWU\SURIHVVLRQDOVDQGZRUNVKRSVIRFXVLQJ ERWKRQFRQWHPSRUDU\DQGWUDGLWLRQDODUWLVWLFSUDFWLFHV7KH VSDFHVDUHORJLVWLFDOO\VHUYLFHGDQGORFDWHGLQWKHODUJHU VFKHPHLQVXFKDZD\DVWRHQFRXUDJHFRQWDFWEHWZHHQ YDULRXVXVHUVVRWKDWDYLEUDQWDUWLVWLFFRPPXQLW\LVFUHDWHG 8QLTXHVLWHFRQGLWLRQVDQGDGLVWLQFWLQWHUORFNLQJSURJUDPPH PL[UHTXLUHGVSHFLDODWWHQWLRQWRLVVXHVVXFKDVGD\OLJKW VKDGLQJSXEOLFUHDOPDFFHVVDQGVSDWLDOÀH[LELOLW\

Project Data: budget £33m (£400m PDVWHUSODQ  DUHDPð PðPDVWHUSODQ) Key Words: arts & culture, cultural businesses, integration, the big picture,

20

PORTFOLIO, Studio SYN, London / Athens


CULTURAL BUSINESSES HEADQUATERS Integration of Plants and Natural Cycles in the Everyday Activities LQWKH+HDGTXDUWHUV'HVLJQ5HÀHFWLYHRI1DWXUDO/DQGVFDSH Formations

21

PORTFOLIO, Studio SYN, London / Athens


CULTURAL BUSINESSES HEADQUATERS Building Layout and Circulation Folded in Two Loops to Create 3RLQWVRI8UEDQ)RFXVDQG&RQJUHJDWLRQRI8VHUV

22

PORTFOLIO, Studio SYN, London / Athens


CULTURAL BUSINESSES HEADQUATERS Low-Rise and Small Window-to-Window Distances Create a 6HQVHRI3ODFHDQG%ULQJ8VHUV&ORVHU7RJHWKHU$OO2I¿FHDQG Studio Designs Respond to the Needs of Harsh Sunny Climate

23

PORTFOLIO, Studio SYN, London / Athens

Profile for studio_syn

Studio Syn - Portfolio  

Studio Syn are a London and Athens-based practice working in architecture, education, art and research. You can get in touch with us via stu...

Studio Syn - Portfolio  

Studio Syn are a London and Athens-based practice working in architecture, education, art and research. You can get in touch with us via stu...

Advertisement

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded