Page 1

Rolls-Royce Motor Cars Sunningdale


Malgosia Bela by Mario Sorrenti

messika.com

Miss Monroe Collection

52 London End, Old Beaconsfield, Buckinghamshire, HP9 2JH

T: 01494 677 782 www.beaconsfieldfinejewellery.com


And the world stood still...


Welcome

At Rolls-Royce Motor Cars Sunningdale we believe the Rolls-Royce experience is an exciting journey and a luxurious experience which each individual customer is taken through by our experienced team. We have recently redeveloped our Rolls-Royce Showroom, [LMGLRS[WLS[GEWIWXLI6SPPW6S]GIJEQMP]EXMXW½RIWX%W well as being easily accessible our Sunningdale dealership is a haven away from the City for our customers where they can take time to enjoy the experience and be immersed within the Rolls-Royce brand. Every enquiry we receive is given personal attention and SYVXIEQMWJYPP]GSQQMXXIHXSSJJIVMRKE½VWXGPEWWWIVZMGI for you to enjoy what we believe to be a truly unique experience of this superb marque. The team comes with a wealth of experience within the luxury motor industry and understands that commissioning a Rolls-Royce is a personal experience. 'LSSWMRKXLIWTIGM½GEXMSRJVSQE[MHIVERKISJSTXMSRW and designing a Rolls-Royce as individual as its owner by adding bespoke options, adds elegant touches which VI¾IGXXLIS[RIV´WTIVWSREPMX]8LMWGERFIHSRIEXXLI dealership in our VIP private lounge using the Rolls6S]GIGSR½KYVEXSVEPSRKWMHIEWIPIGXMSRSJTEMRX½RMWLIW ERH PIEXLIV MRXIVMSVW XS KIX E JIIP JSV XLI ½REP HIWMKR Sunningdale also offers a selection of Approved Preowned vehicles.

As an Authorised Rolls-Royce Motor Car Dealer, you are assured of complete peace of mind in the knowledge that when you buy a Preowned Rolls-Royce Motor Car it has undergone the most stringent checks prior to being offered for sale and comes with a minimum of 2 years Rolls-Royce Warranty and 2 Cars free scheduled maintenance. Joel Russell our Customer Relationship Manager is on hand to maintain the smooth running ERH YT OIIT SJ SYV GYWXSQIV´W GEVW SRGI XLI] LEZI taken delivery, offering a wide range of service options. Accessories are also available from Sunningdale whether it is a personalised addition to your Rolls-Royce or a gift for someone special. Customers are also given the opportunity to visit The Home of Rolls-Royce Motor Cars at Goodwood, to experience Rolls-Royce Motor Cars being assembled by hand. They will also witness the exquisite detail and craftsmanship which goes into every piece of leather and wood veneer which is hand made at Goodwood. We look forward to welcoming you to our showroom soon. Jon Morgan, General Sales Manager Rolls-Royce Motor Cars Sunningdale

7

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


info@lanimah.com . lanimah.com


CONTENTS

The Rolls-Royce Wraith....................................................................................................................20 The Third Russian Debutante Ball in London.......................................................................30 Michel Roux Jnr test drives the new Rolls-Royce Wraith..............................................40 An Open Letter from the Chairman and Chief Executive..............................................44 Rolls-Royce Celebrates Fifth Successive Sales Record....................................................48 Rolls-Royce Phantom Declared Worlds Best Super-Luxury Car................................56 Rolls-Royce Motor Cars Waterspeed........................................................................................63 Rolls-Royce To Bring Serentiy To The 2015 Geneva Motor Show...........................66 Rolls-Royce Phantom Drophead Coupé Bespoke Waterspeed Collection.......70 British Supercar Show at Salon Privé........................................................................................82 4LERXSQ1IXVSTSPMXER'SPPIGXMSR(IFYXIHEX4EVMW1SRHMEP(I0´%YXSQSFMPI Rolls-Royce: The Beginning.............................................................................................................101 Rolls-Royce Phantom Series II....................................................................................................114 Ghost Series II – Design Evolved..................................................................................................128 Rolls-Royce Unveils The Suhail Collection.............................................................................144 Contact Us..............................................................................................................................................159

Designed and  Published  by: MMC  Media  Ltd,  Tel:  0044  1253  319882/3      www.mmcmedia.com Please  Contact  Steve  Streetly  or  Chris  Shorley  to  discuss  your  bespoke  publishing  requirements. Layout  by  Cas  Streetly.  Sales  Manager  -­  Ashley  Shorley.

DISCLAIMER

mmcmedia

No part  of  this  publication  may  be  copied  or  reproduced  in  any  form  or  by  any  means,  electronic,  mechanical,  photocopy  or Otherwise  without  the  express  permission  of  the  publishers


Brand new on the Wentworth Estate

35,&(21APP/,&$7,21

01344 845050 www.buckinghams.com WENT WORTH E 67$7(‡9,5*,1,$:$7(5‡A6&27‡ S811,1*'$/( 6 Station Approach, Virginia Water, Surrey GU25 4DL

13

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Coworth Park, Ascot

'39286=49679-87

(36',)78)6'300)'8-32´7 '39286=,397),38)0 8,%86);6-8)78,)690)7 ,)%(83'3;368,4%6/ Dorchester Collection’s luxury country house hotel and spa, and as you emerge from the tree-lined driveway, you’ll be greeted by the glorious wildflower meadow and fresh ODYHQGHUVFHQW 

78%=-278=0) An understated palette of subtle colours lends an air of calm to the spacious rooms and suites. For Georgian charm with an eccentric decorative flair, opt to stay in the Mansion House. If you prefer a little more seclusion, you’ll find the self-contained converted Stables and Cottages more to your liking. To experience the ultimate in privacy, splash out on the spectacular Grade II listed Dower House, with its own private kitchen, dining room and three luxurious bedrooms.

Can’t sit still types can take part in quintessentially English activities such as tennis, croquet, horse riding or explore the grounds on one of the hotel’s bicycles. Take polo lessons with Guards Polo Academy at Coworth Park on one of the two professional polo fields. Golf fans can also gain special access to play at the nearby Wentworth Club. Children are catered for with everything from riding lessons to treasure hunts at the kids’ club, which is guaranteed to keep even the most high-spirited kids entertained. Those looking to avoid anything remotely strenuous can simply pick a quiet place to enjoy a delectable picnic.

6)0%<)(

Feel yourself relax from the moment you discover Coworth Parkâ&#x20AC;&#x2122;s picturesque parkland, on the borders of Windsor Great ParkMXVW PLQXWHVIURPFHQWUDO/RQGRQThis luxurious getaway is high-end style without the stuffiness. A romantic retreat for couples and a favourite with families seeking a relaxing break with a dash of adventure.

74%-2(90+)2') Head to the eco-luxury spa for a refreshing swim in the inviting indoor pool, work out in the gym, indulge in a relaxing treatment like an aromatherapy massage, or look perfectly polished with a â&#x20AC;&#x2DC;hot-to-trotâ&#x20AC;&#x2122; pedicure.When you feel peckish a healthy bite at The Spatisserie with a chilledglass of champagne should hit the spot.

-2(90+)2')

'39286= 78=0)  -8´7 ;,%8

'3;368,4%6/ -7%00%&398

74)'-%03'' %7-327 $WUXO\PHPRUDEOHVHWWLQJIRUZHGGLQJVDQGUHFHSWLRQV DQGD UHIUHVKLQJ FKDQJHRIVFHQHU\IRUEXVLQHVV2XUIRXUHYHQWVSDFHV FDQFDWHUIRUXSWRJXHVWVFKRRVHIURPWKHOLJKWDQGDLU\*DUGHQ DQG2YDOURRPVZLWKWKHLUSULYDWHWHUUDFHVWKHVWXQQLQJYLVWDIURPWKH 2DN5RRPDQGWKHFDVWOHOLNHFKDUPRIWKH7RZHU+RXVHRYHUORRNLQJ

Mansion House, Weston Suite

&)783*&6-8-7, Restaurant Coworth Parkâ&#x20AC;&#x2122;s Best of British menu shows true passion for the finest locally-sourced seasonal ingredients,LQDUHOD[HG DQGFRQWHPSRUDU\VHWWLQJIf itâ&#x20AC;&#x2122;sGHOLFLRXVEUDVVHULHVW\OHIRRG\RX IDYRXUsampleThe Barnâ&#x20AC;&#x2122;s rustic charm where youâ&#x20AC;&#x2122;re more than welcome to keepyour muddy boots on, or dine al fresco taking in the scenic Berkshire countryside views. Afternoon tea on the terrace or in the Drawing Room, with delicious cakes and pastries overlooking the meadow, is another summer must-do.

Restaurant Coworth Park

COWARTH PARK Blacknest Road, Ascot Berkshire SL5 7SE +44 (0)1344 876 600 GRUFKHVWHUFROOHFWLRQFRP UHVHUYDWLRQV&3$#GRUFKHVWHUFROOHFWLRQFRP


Owning a Rolls-Royce, like driving one, is an effortless pleasure, made even simpler by the high standards of aftercare our dealerships offer. They will provide help and advice about any aspect of your car. They will also help you keep your investment in perfect condition so it continues to perform as well as it did the day it left Goodwood. “Taking delivery of your Rolls-Royce is undoubtedly one of life's genuine pleasures. But this is just the beginning of a unique ownership experience.” Torsten Müller-Ötvös, Chief Executive

17

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


â&#x20AC;&#x153;The Steinway is not only an instrument, it is a work of art of the first rank."

Christoph Eschenbach

For information on Steinway & Sons pianos or to arrange a private appointment to visit our London showrooms, please call 0207 487 3391 or email info@steinway.co.uk WWW.STEINWAYHALL.CO.UK


±8LIVI´WEWIRWISJIJJSVXPIWW grace and elegance, but at the same time something more contemporary and daring.” Giles Taylor, Director of Design

THE ROLLS-ROYCE WRAITH The most potent and technologically advanced Rolls-Royce in history, Wraith is a car for the curious, XLI GSR½HIRX ERH XLI FSPH *VSQ XLI ZIV] SYXWIX XLI [SVHW SJ XLI GSQTER] GSJSYRHIV Sir Henry Royce had informed everything that our designers, engineers and craftspeople had set out XSEGLMIZI³8EOIXLIFIWXXLEXI\MWXWERHQEOIMXFIXXIV[LIRMXHSIWRSXI\MWXHIWMKRMX´

21

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


THE LEGENDARY HOTEL OF THE BEACHCOMBER GROUP HAS BEEN RENOVATED

Royal  Palm,  the  most  prestigious  address  in  the  Indian  Ocean,   reopens  its  doors  after  more  than  four  months  of  major   renovation.   Shortly before its 30th birthday next year, each suite, as well as all public areas of the Mauritian hotel, have been completely revamped, refurbished and re-­decorated. It will now offer 69 suites with sea views that combine modernity and luxury. The â&#x20AC;&#x153;Ocean Suiteâ&#x20AC;?, a brand new suite category, has been created. /RFDWHGRQWKHJURXQGRURQWKHĂ&#x20AC;UVW Ă RRU IDFLQJ WKH WXUTXRLVH ODJRRQ WKHVH Ă&#x20AC;IWHHQ QHZ DFFRPPRGDWLRQ types of 110m2 each, include a

spacious bedroom, a separate living room, a large bathroom and a double terrace overlooking the gardens and the sea. Guest now can also enjoy the redesigned settings of then GoÊlette Restaurant and Le Bar Plage. In addition, the hotel is pleased to offer its guests a completely new dining experience directly from Italy. Among the new additions to the high-­end facilities of the hotel, a new 25-­metre pool has been built along the beach, facing the lagoon. The

Royal Princess, a beautiful crewed new luxury yacht measuring 66.6 feet (20.30 meters), allows the Royal Palm JXHVWVWRH[SHULHQFHDXQLTXHPDULQH adventure. Bathed in soft lighting, the rooms combine delicate and bold KXHV Ă&#x20AC;QH IDEULFV Ă&#x20AC;QLVKHV LQ ZRRG and marble, as well as custom-­made wooden furniture crafted by local DUWLVDQV *HQHUDO 0DQDJHU -DFTXHV 6LOYDQWLVVDWLVĂ&#x20AC;HGWKDWWKHKRWHOLVĂ&#x20AC;QDOO\ ready to welcome back its guests and make them live exceptional

PRPHQWVRQFHDJDLQ:KHQLWFRPHVWRĂ&#x20AC;QHGLQLQJ the French chef Michel de Matteis, awarded â&#x20AC;&#x153;The Best Craftsman of Franceâ&#x20AC;? (Meilleur Ouvrier de France), who has been in charge of the Palace kitchens for over 10 years, now offers entirely fresh menus, also in the QHZ,WDOLDQUHVWDXUDQW5R\DO3DOP0DXULWLXVĂ&#x20AC;WVPRUH than ever in the lineage of the leading international hotels. More stylish, more spacious and brighter than before, the Beachcomber hotel maintains its soul and its timeless elegance. Located on the sheltered north-­west coast, stretching along a pure white sandy EHDFK5R\DO3DOPLVDWUDQTXLOWURSLFDOKDYHQZLWKDQ uncompromising commitment to excellence.

Seychelles and a majestic property in Marrakech. These KRWHOV UHSUHVHQW WKH KLJKHVW TXDOLW\ ZKHQ LW FRPHV WR luxury and variety.

About  Beachcomber  Hotels Pioneer (since 1952) of the Mauritian hotel industry, Beachcomber Hotels owns and manages eight of WKHĂ&#x20AC;QHVWKRWHOVLQ0DXULWLXVDQLVODQGUHVRUWLQWKH

To  book  a  holiday  to  the  Royal  Palm  call   Beachcomber  on  01483  445  685.   www.beachcombertours.co.uk


25

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


“Classic designs  of  stand  alone  character  and  lasting  beauty”

“Proud members of The Guild of Master Craftsmen”

Beautifully detailed  oak  framed  barns Tel: 0844 800 0708

‡ Web: www.classicbarns.co.uk ‡ Email: info@classicbarns.co.uk

27

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Wraith, the boldest expression of Rolls-Royce yet. The striking fastback silhouette exudes elegance and power. The aerodynamic lines and wide rear track reinforce the promise of athletic prowess and dynamism, which is further accentuated by the prominent shoulders. The compelling design can be further enhanced by exclusive X[SXSRI TEMRX GSQFMREXMSRW [LMGL EHH HI½RMXMSR ERH provide even more opportunity for people to personalise the car to their taste.

Every detail has been considered - even the position of the Spirit of Ecstasy. Sitting further forward on the grille and angled by a few degrees, she has a more determined air to complement the power, style and drama of Wraith.

Wraith pushes all the boundaries of Rolls-Royce. The vertical grille is deeply recessed to create an air of foreboding, while the twin exhausts are instantly dramatic. Frameless coach doors and the absence of a b-pillar add an elegant touch, and make stepping in and out of Wraith effortless.

There is also the choice of three new exclusive wheel designs. A 20” seven-spoke design comes as standard, [MXL ² WIZIRWTSOI ERH ½ZIWTSOI TEVX TSPMWLIH bi-colour choices available as an option.

29

WRAITH - CHALLENGING EXPECTATIONS

Wraith is a Rolls-Royce through and through. The classic 2:1 proportions of the wheel to body height remain, as does the long rear overhang, self-righting wheel centres and signature rear-hinged coach doors.


THE THIRD RUSSIAN DEBUTANTE BALL IN LONDON Date: 15 November 2015 Location: Grosvenor House A JW Marriott Hotel, London

One of the most anticipated annual events in London's cultural and social calendar, the Russian Debutante Ball will take place for the third time on November 15, 2015. Famous artists, cultural professionals, businessmen and everyone who is passionate about Russian culture and history will come together at the imposing Grosvenor House on Park Lane in the heart of London. The Ball is aimed at reviving the great traditions of Russian balls abroad, attracting attention to the rich history of Russian culture, and preserving cultural and ethical values for future generations. The Ballâ&#x20AC;&#x2122;s eventful programme is geared towards fans of Russian classical opera and ballet and those who enjoy dancing to classical and modern tunes.

The Second Russian Debutante Ball in London, which took place on November 2nd 2014 in the historical building of Old Billingsgate was organised under the patronage of a descendant of the House of Romanovs, Princess Olga Andreevna Romanoff, the daughter of Prince Andrei Alexandrovich and the granddaughter of Grand Duke Alexander Mikhailovich and Grand Duchess Xenia Alexandrovna. InfoWatch CEO Natalya Kaspersky and Hollywood actress Olga Kurylenko were honorary guests. Guests heard performances by soprano Venera Gimadieva and baritone Pavel Chernykh, both from the Bolshoi Theatre Opera Company, and appreciated the artistry of the Vienna State Ballet leading dancers, Ketevan Papava and Kirill Kourlaev.

As featured on BBC, CNN, Channel4, Russia Today, Euronews, Die Welt,Vedomosti, Echo Moskvy, Kommersant and many other renowned media outlets.

31

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


MYSEA is a boutique yacht brokerage and concierge company with offices in Monaco, London and Athens offering a new approach to large yacht charter and sales. In addition, we are one of the first yachting companies to offer a select number of exclusive villas and chalets to our clients to enhance their vacation portfolio. We pride ourselves in a fully tailor made, discrete and professional approach to ensure our clientâ&#x20AC;&#x2122;s needs are met. Our dedicated team has firsthand industry knowledge, long established experience and local presence to make sure every expectation is managed to perfection.

The imposing Grosvenor House hotel on Park Lane in the heart of London has a distinguished, glamorous, and aristocratic pedigree stretching back nearly 350 years. Located in glamorous Mayfair, Grosvenor House has one of London's most desirable addresses with the West End and Knightsbridge just a short stroll away. The opening of the new Grosvenor House hotel in May 1929 was an outstanding event, and an important addition to the London social scene. Since then it has been host to thousands of social occasions including annual company dinner dances and Christmas parties, and both public and private events.

M Y S E A Contact our London Office for more details:

In September 2008 after a four-year, multi-million pound restoration programme, Grosvenor House rebranded as a JW Marriott Hotel. The new design of the hotel created an environment of simple elegance ensuring many original features of the period had been retained. Details within the hotel including service, space and culinary experiences were crafted to make guests feel welcome.

Tim Clark | MYSEA ltd | Imperial House | 15-19 Kingsway | London WC2B 6UN Tel: +44 (0) 207 836 6498 | Mob: +44 (0)7881 805 517 Email: tim@mysealtd.com | Web: www.mysealtd.com Tim Clark

L O N D O N

-

M O N A C O

-

A T H E N S

33

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


T H E N E X T C H A P T E R AT L O N D O N ’ S H I S T O R I C G R O S V E N O R H O U S E Grosvenor House, A JW Marriott Hotel is one of London’s most iconic hotels. Centrally located in the heart of London in Mayfair, close to famous shopping districts and cultural attractions, the Hotel overlooks Hyde Park and holds one of the capital’s most desirable addresses in ‘Park Lane’. In ‘The Next Chapter’ of a rich and fascinating history, Grosvenor House has unveiled a refurbished suite collection in Premium Park View, Park View and Executive categories and a brand new Executive Lounge. The suites convey the quintessentially British elegance and charm that Grosvenor House is known and loved for with a new sense of freshness, calm and light that captures the contemporary notions of luxury and the needs of the global traveller. The décor is based on a palette of soft neutrals with accents of colour that echo the changing seasons of Hyde Park. Culinary experiences include JW Steakhouse, a classic American steakhouse with prime, USDA and Aberdeen Angus steak as well as the world-famous JW Cheesecake. Corrigan’s Mayfair offers the best from land and sea in a traditional British setting and award-winning afternoon tea is available in The Park Room. For a drink, sample one of 200 types of rare, single barrel and pre-prohibition Bourbons at the Bourbon Bar or a cocktail from the playful menu at the Red Bar.

Grosvenor House, A JW Marriott Hotel | 86-90 Park Lane | London W1K 7TN Tel; +44(0)20 7499 6363 W: londongrosvenorhouse.co.uk


inspirational living

at the perfect address

All of our homes are individually designed, optimising the space both inside and out. Distinctive architecture and landscaping blend perfectly with their surroundings and the interiors create living environments that are both inspirational and functional. Exclusive locations, stylish homes and the highest quality specifications. Coming Soon! A development of two 6 bedroomed family homes. Each home has its own swimming pool with Jacuzzi and cinema. Call for more information.

www.chartridgeplc.co.uk 01494 672250

The Third Russian Debutante Ball will take place in the Great Room at Grosvenor House. First launched as an Art Deco skating rink, the Great Room is the venue of many prominent awards evenings, charity balls and the like. Since the 1930s, the Great Room has hosted the world's oldest charitable ball, the Royal Caledonian Ball, and it is one of the largest ballrooms in Europe holding up to 2000 guests. The Great Room's charm lies not only in its PDJQLĂ&#x20AC;FHQWVFDOH,WVVZHHSLQJVWDLUFDVHDQG fairytale chandeliers are the perfect setting for any social event.

37

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Creating Luxury Environments

Interior Design Consultancy and Showroom

CONCEPT INTERIORS 131-135 Oatlands Drive, Weybridge, Surrey, KT13 9LB T 01932 241380 www.concept-interior.co.uk


Michel Roux Jnr test drives the new Rolls-Royce Wraith “One is so accustomed to seeing Rolls-Royces slipping silently WKURXJK 0D\IDLU RU SXUULQJ GRZQ WR$VFRW LQ D  PSK WUDIÀF stream that one is apt to forget that these cars are just about the fastest non-sporting proposition of their time.” - The Earl of Cardigan writing in Britannia & Eve, May 1930

Ve h i c l e S u p p l i e d   b y   R o l l s   R o y c e   M o t o r c a r s   S u n n i n g d a l e Fo r   f u r t h e r   i n f o r m a t i o n ,   c o n t a c t   Te l :   0 1 3 4 4   8 7 1 2 0 0

41

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Patron of one of another great Mayfair institution Michel Roux Jr took it for a spin. â&#x20AC;&#x153;This is a car that GHĂ&#x20AC;HVH[SHFWDWLRQVLQIDFWRQĂ&#x20AC;UVWJODQFH\RXZRXOGQ¡W immediately recognise Wraith as a Rolls-Royce, however, RQFH\RXRSHQWKHGRRUV\RXVHHWKDWFKDUDFWHULVWLFĂ&#x20AC;QLVK quality and class. For me this would be the perfect car to take for a weekendsâ&#x20AC;&#x2122; driving in France â&#x20AC;&#x201C; an experience Iâ&#x20AC;&#x2122;m sure will be one of pure pleasure, comfort and style.â&#x20AC;?

There is something just right about the sight of a Rolls-Royce silently stalking the streets of Londonâ&#x20AC;&#x2122;s Mayfair. Both display a quiet grandeur whilst being the preserve of the well-heeled and discerning. However, these most British of institutions have evolved and prospered; as Mayfairâ&#x20AC;&#x2122;s gentry made way for brass-plaque fronted hedge fund houses, so Rolls-Royce has grown up from its position as genteel conveyance of choice of the aristocracy.

43

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


AN OPEN LETTER FROM THE CHAIRMAN AND THE CHIEF EXECUTIVE OF ROLLS-ROYCE MOTOR CARS ON THE SUBJECT OF A NEW ROLLS-ROYCE The launch of Phantom in 2003 marked the beginning of the renaissance of Rolls-Royce Motor Cars. Since then, we have set a new benchmark for what a super-luxury car should be â&#x20AC;&#x201C; unique, hand-crafted, beautiful and rare. Often imitated, Phantom has never been equalled and continues to be hailed as â&#x20AC;&#x2DC;The Best Car in the Worldâ&#x20AC;&#x2122; by our customers and media alike. Twelve years later, after the introduction of successful new models like Ghost and Wraith, Rolls-Royce stands proudly at the pinnacle RI%ULWLVKOX[XU\PDQXIDFWXULQJ FRQĂ&#x20AC;UPLQJRXUFXVWRGLDQVKLSRI this precious marque. Now we have reached another seminal moment in Rolls-Royceâ&#x20AC;&#x2122;s 111-year journey. 7RGD\ZHFRQĂ&#x20AC;UPWKDWZHDUHGHYHORSLQJDQDOOQHZ5ROOV5R\FH with exceptional presence, elegance and purpose: Many discerning customers have urged us to develop this new car â&#x20AC;&#x201C; and we have listened. At Rolls-Royce Motor Cars we are uniquely focused on the desires of our customers and are driven

THIS NEW ROLLS-ROYCE WILL BE EFFORTLESS ... EVERYWHERE. by our own thirst to innovate. So we challenged our engineers and design team, led by Director of Design Giles Taylor, to create a different and exceptional new car. This car will embody all the values and capabilities that drove our two Founding Fathers to secure Rolls-Royceâ&#x20AC;&#x2122;s reputation, early last century, by taking top honours in rigorous overland adventures such as the Scottish Reliability Trials, the London to Edinburgh event and the Alpine Trials. Rolls-Royces conveyed pioneers and adventurers like Lawrence of Arabia across the vastness of unexplored deserts and over mountain ranges. In other parts of the world including Australia, India and the Americas, Rolls-Royces carried their owners over challenging terrain with absolute reliability and comfort. History sets our precedent and our future calls us to action.

Â&#x2021;$FDUWKDWRIIHUVWKHOX[XU\RID5ROOV5R\FHLQDYHKLFOH that can cross any terrain Â&#x2021;$FDUWKDWPHHWVRXUFXVWRPHUV¡KLJKO\PRELOH contemporary lifestyle expectations Â&#x2021;$5ROOV5R\FHWKDWLVDVPXFKDERXWWKHSLRQHHULQJ adventurous spirit of Charles Rolls as it is about Sir Henry Royceâ&#x20AC;&#x2122;s dedication to engineering and innovation Â&#x2021;$FDUWKDWDSSURSULDWHO\UHĂ HFWV5ROOV5R\FH¡VEUDQG promise of effortless luxury Â&#x2021;$KLJKERGLHGFDUZLWKDQDOOQHZDOXPLQLXPDUFKLWHFWXUH Â&#x2021;$XQLTXHQHZPRWRUFDUZRUWK\RIFDUU\LQJWKH6SLULWRI Ecstasy into the future

This new journey begins now.We will take our time in developing and perfecting this new concept in luxury. We will include our customers, enthusiasts and media along the way and will keep you informed of our progress. Until then, rest assured, we are creating a motor car in the greatest traditions of our marque.

Sir Henry Royce famously said: â&#x20AC;&#x153;When it does not exist, design itâ&#x20AC;?. We are doing just that.

Peter Schwarzenbauer, Chairman

Torsten Mueller-Oetvoes, Chief Executive


Leather Luxury Specialist Baxter Opens Doors to First Flagship Showroom in the UK During London Design Festival Flagship Showroom is Spearheaded by Interior Designer Anna Grace-Davidson and her team at Anna Casa

SURXGWR WRRSHQ RSHQWKH WKHGRRUV GRRUVWRWR WKHLU Ă&#x20AC;UVW RIĂ&#x20AC;FLDO Baxter LV SURXG WKHLU ÄąUVW RÄ´FLDO 8. 8. Ă DJVKLS VKRZURRP LQ WKH KHDUW RI 0D\IDLU¡V LQWHULRU IJDJVKLSVKRZURRPLQWKHOX[XULRXVKHDUWRI/RQGRQĹ&#x2013;VLQWHULRU GHVLJQ KXE RQ +D\ +LOO &KDPSLRQLQJ LQQRYDWLRQ DQG GHVLJQKXE&KDPSLRQLQJLQQRYDWLRQDQGVRSKLVWLFDWHGVW\OH VRSKLVWLFDWHGVW\OHWKHOX[XU\EUDQGRSHQHGGXULQJLonWKH OX[XU\ EUDQG RSHQHG GXULQJ London Design Festival don LV Design FestivalE\ DQG LV VSHDUKHDGHG E\ OHDGLQJ DQG VSHDUKHDGHG OHDGLQJ LQWHULRU GHVLJQHU Anna LQWHULRUGHVLJQHUAnna Grace-DavidsonDQGKHUH[SHUW Grace-DavidsonDQGKHUH[SHUWWHDPDWAnna Casa. WHDPDWAnna Casa. 7KH GHEXW FROOHFWLRQ IHDWXUHV D YDULHW\ RI EHDXWLIXO SLHFHV 7KHGHEXWFROOHFWLRQIHDWXUHVDYDULHW\RIEHDXWLIXOSLHFHV LQVSLUHGE\GHVLJQWKURXJKWKHGHFDGHVIURPXQLTXHYLQWDJH LQVSLUHG GHVLJQ WKURXJK WKH GHFDGHV IURP XQLTXH GHVNV WR E\ FODVVLF Ĺ&#x2013;V VW\OH VRIDV DQG DUPFKDLUV WKURXJK YLQWDJHGHVNVWRFODVVLF¡VVW\OHVRIDVDQGDUPFKDLUV WR FRQWHPSRUDU\ WDEOHV DQG OLJKWLQJ WKHUH LV VRPHWKLQJ IRU WKURXJK WR FRQWHPSRUDU\ WDEOHV DQGWRQHV OLJKWLQJ LV HYHU\ GLVFHUQLQJ FOLHQW %HDXWLIXO VWURQJ FDQWKHUH EH VHHQ VRPHWKLQJWKH IRUFROOHFWLRQ HYHU\ GLVFHUQLQJ FOLHQW %HDXWLIXO WKURXJKRXW DQG DUH HPSKDVLVHG ZKHQVWURQJ SDLUHG WRQHV FDQ EH VHHQ WKURXJKRXW WKH FROOHFWLRQ DQG DUH ZLWKPDWHULDOVVXFKDVEUDVVRQWKHVPDOOWDEOHVDQGODPSV HPSKDVLVHGZKHQSDLUHGZLWKPDWHULDOVVXFKDVEUDVVRQ WKHVPDOOWDEOHVDQGODPSV 7KHUHDUHDQXPEHURIVWDQGRXWSLHFHVLQFOXGLQJWKHLFRQLF â&#x20AC;&#x153;I am thrilled to be a part of Baxter ensuring Chester MoonVRIDE\DFFODLPHGGHVLJQHUPaola Navone, thatTactile the brand remains at Vincenzo the forefront DQG WKH VRID E\ DUFKLWHFW De of Cottis the high-end luxury furni-ture market,â&#x20AC;? said ZKLFKVKRZFDVHWKHSHUIHFWLQWHUSUHWDWLRQRI%D[WHUĹ&#x2013;VVHQVRU\ Anna-Grace Davidson, Interior Designer and TXDOLWLHVRIOHDWKHUZLWKLWVVRIWHPEUDFLQJOLQHVTXLOWLQJDQG Creative Director at Anna Casa. FDUHIXODWWHQWLRQWRGHWDLO Dragaâ&#x20AC;&#x153;Baxter E Aurelâ&#x20AC;&#x2122;sÄąQHO\GHWDLOHGDalma ChairsZLWKWXIWHG has built a legacy on being devoted OHDWKHUtoSOXV WKHLU GLVWLQFWLYH LURQ DQG FRSSHU the highest levels of quality and Loren craft, Side Tables DYDLODEOH LQ VHYHUDO QDWXUDO DQG PHWDOOLF ÄąQLVKHV LV preserving their excellence by continuously DOVR IHDWXUHG )LQDOO\ Roberto Lazzoniâ&#x20AC;&#x2122;s Colette producing artistic, cutting edge creationsChair VKRZFDVHV EUDQG QHZ DQG SULQWHG which %D[WHUĹ&#x2013;V sets them apart in FRORXUHG the industry. I am VRIW OHDWKHUXSKROVWHU\ proud to oversee their growth and expansion

7KHUH DUH IRU D QXPEHU RI VWDQGRXWcraftsmanship SLHFHV LQFOXGLQJ WKH 5HQRZQHG YDOXLQJ traditional ZLWK D LFRQLFChester MoonVRIDE\DFFODLPHGGHVLJQHUPaola SDVVLRQDWH DSSURDFK WR TXDOLW\ ,WDOLDQ GHVLJQ %D[WHU KDV ORQJ Navone, DQG WKH Tactile VRID E\ DUFKLWHFW VincenzoLQ EHHQ HVWDEOLVKHG DV RQH RI EHVW OHDWKHU IXUQLWXUH FRPSDQLHV De Cottis ZKLFK VKRZFDVH WKH SHUIHFW LQWHUSUHWDWLRQ WKHLQGXVWU\ RI %D[WHU¡V VHQVRU\ TXDOLWLHV RI OHDWKHU ZLWK LWV VRIW HPEUDFLQJ OLQHV TXLOWLQJ DQG FDUHIXO DWWHQWLRQ WR GHWDLO +DYLQJZRUNHGZLWK%D[WHUIRURYHU\HDUVWKHWHDPDWAnna 'UDJD($XUHO¡VĂ&#x20AC;QHO\GHWDLOHGDalma Chairs ZLWKWXIWHG CasaDUHGHOLJKWHGWREHPDQDJLQJWKHIJDJVKLSVKRZURRP OHDWKHUSOXVWKHLUGLVWLQFWLYHLURQDQGFRSSHULoren Side DQG ZLOO RÄłHU FOLHQWV NQRZOHGJH VNLOO LQGHSWK DGYLFH DQG TablesDYDLODEOHLQVHYHUDOQDWXUDODQGPHWDOOLFĂ&#x20AC;QLVKHV JXLGDQFHRQÄąQLVKHVDQGOHDWKHUVIRUDOO%D[WHUSURGXFWV LV DOVR IHDWXUHG )LQDOO\ 5REHUWR /D]]RQL¡V &ROHWWH Chair VKRZFDVHV %D[WHU¡V EUDQG QHZ FRORXUHG DQG SULQWHGVRIWOHDWKHUXSKROVWHU\

here in London,â&#x20AC;?'DYLGVRQFRQWLQXHG Ĺ&#x2014;, DP WKULOOHG WR EH D SDUW RI %D[WHU HQVXULQJ WKDW WKH EUDQG UHPDLQV DW WKH IRUHIURQW RI WKH KLJKHQG OX[XU\ IXUQLWXUHIRU PDUNHWĹ&#x2DC; VDLGtraditional $QQD*UDFHcraftsmanship 'DYLGVRQ ,QWHULRUZLWK 5HQRZQHG YDOXLQJ 'HVLJQHUDQG&UHDWLYH'LUHFWRUDW$QQD&DVD D SDVVLRQDWH DSSURDFK WR TXDOLW\ ,WDOLDQ GHVLJQ %D[WHU KDVORQJEHHQHVWDEOLVKHGDVRQHRIEHVWOHDWKHUIXUQLWXUH Ĺ&#x2014;%D[WHU KDV EXLOW D OHJDF\ RQ EHLQJ GHYRWHG WR WKH FRPSDQLHVLQWKHLQGXVWU\ KLJKHVW OHYHOV RI TXDOLW\ DQG FUDIW SUHVHUYLQJ WKHLU H[FHOOHQFH E\ FRQWLQXRXVO\ SURGXFLQJ DUWLVWLF FXWWLQJ +DYLQJZRUNHGZLWK%D[WHUIRURYHU\HDUVWKHWHDPDW HGJHFUHDWLRQVZKLFKVHWVWKHPDSDUWLQWKHLQGXVWU\, Anna Casa DUH GHOLJKWHG WR EH PDQDJLQJ WKH Ă DJVKLS DPSURXGWRRYHUVHHWKHLUJURZWKDQGH[SDQVLRQKHUH VKRZURRPDQGZLOORIIHUFOLHQWVNQRZOHGJHVNLOOLQGHSWK LQ/RQGRQĹ&#x2DC;'DYLGVRQFRQWLQXHG DGYLFH DQG JXLGDQFH RQ Ă&#x20AC;QLVKHV DQG OHDWKHUV IRU DOO %D[WHUSURGXFWV )RUPRUHLQIRUPDWLRQDERXW%D[WHUYLVLW www.baxterlondon.net www.annacasa.net

EMOTIONS SHOULDNâ&#x20AC;&#x2122;T BE DESCRIBED, EEMOTIONS THEY SHOULDNâ&#x20AC;&#x2122;T SHOULD BE EXPERIENCED. | SHOULD www.baxter.it www.baxter.it MOTIONS SHOULDNâ&#x20AC;&#x2122;T BEDESCRIBED, DESCRIBED,THEY THEY SHOULD BE BE EXPERIENCED. EXPERIENCED. || www.baxter.it

design Paola Navone - ph. Andrea Ferrari design Paola Navone - ph. Andrea Ferrari

| 2 Hay Baxter Hill ¡Shop London London W1j6AS || 2+44 Hay(0) Hill 20 7629 ¡ London 0045 W1j6AS | www.baxterlondon.net | +44 (0) 20 7629 0045 | www.baxterlondon.net Baxter Shop London | 2 Hay Hill ¡ London W1j6AS | +44 (0) 20 7629 0045 | www.baxterlondon.net design Paola Navone - ph. Andrea Ferrari

Baxter Shop London


ROLLS-ROYCE MOTOR CARS CELEBRATES FIFTH SUCCESSIVE SALES RECORD Rolls-Royce Motor Cars has today revealed record sales results for a fifth consecutive year, with 4,063 cars sold globally during 2014. This exceptional result means that sales have more than quadrupled since 2009. Strong sales were repor ted worldwide, with double-digit growth in most regions, Nor th America (up 30%), the Middle East (up 20%) and Europe (up 40%). The United 7XEXIW VIQEMRIH XLI GSQTER]´W QSWX WMKRMJMGERX MRHMZMHYEP QEVOIX6SPPW6S]GI´WLSQIQEVOIXXLI9RMXIH/MRKHSQMW XLIGSQTER]´WJSYV XLPEVKIWXMRHMZMHYEPQEVOIX YT  Europe saw strong growth in a number of markets with Germany up by 30%, while in Asia Pacific, Australia grew F] .ETERF] ERH/SVIE -RXLI1MHHPI)EWX LMKLPMKLXWMRGPYHIH&ELVEMR YT /Y[EMX YT ERH Oman (up 27%). Emerging markets such as Azerbaijan, /E^EOLWXERERH:MIXREQEPPWLS[IHTVSQMWMRKKVS[XL The best-selling Rolls-Royce dealership in 2014 was Rolls6S]GI 1SXSV 'EVW %FY (LEFM %W TEV X SJ XLI QEVUYI´W commitment to long-term sustainable growth, six new dealerships were opened in 2014, including Mexico City, Calgary, Canada and Gold Coast, Australia. A total of 127 dealerships are now in operation and fur ther expansion is planned for 2015.

Torsten MĂźller-Ă&#x2013;tvĂśs, Chief Executive Officer, Rolls-Royce Motor Cars said, â&#x20AC;&#x153;This fifth consecutive record year saw Rolls-Royce Motor Cars break through the 4,000 car sales level for the first time in its 111-year history. The result confirms that our strategy of balanced, sustainable and profitable growth is delivering and that Rolls-Royce remains XLI[SVPH´WPIEHMRKPY\YV]KSSHWFVERH8LMWI\XVESVHMREV] success has been built on strong foundations: pinnacle products, dedicated people and a commitment to ensuring a balanced global sales picture.â&#x20AC;? Sales were driven by strong orders for Ghost Series II, launched in November, and Wraith, which enjoyed its first full year of sales, while the incomparable Phantom remains XLIGSQTER]´WTMRREGPITVSHYGX Bespoke Collections including Waterspeed, Pinnacle Travel and Metropolitan, and unique creations such as the Maharaja Phantom Drophead CoupĂŠ contributed to RollsRoyce sustaining its leadership of the industry in the area of individualisation. In 2014, Rolls-Royce once again sold more cars in the +Euros 200,000 net segment than any other manufacturer. 2014 also marked the first year in which every Phantom, and the great majority of Ghost and Wraith models, left

49

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


the Home of Rolls-Royce at Goodwood in West Sussex, England with significant Bespoke personalisation. A record number of customers spent personal one-on-one time [MXL 6SPPW6S]GI´W &IWTSOI HIWMKR GSRWYPXERXW commissioning their personalised vehicles. To meet such strong demand, par ticularly for Bespoke cars, the company has created over 200 new permanent jobs in the past 18 months. More than 1,500 people are now employed at the Home of Rolls-Royce. *YV XLIVIZMHIRGISJ6SPPW6S]GI´WGSQQMXQIRX to expansion in Great Britain came in September when the company announced plans for its new Technology and Logistics Centre at Bognor Regis, close to Goodwood. Construction of the new 30,000m2 facility, which is due to open in 2016, is well underway and around 200 new and existing staff in technical and logistics roles will be employed at the Centre.

The Art of the Carpet Inspired by the craftsmanship, creativity and time-honoured traditions of luxury carpet making, Craigie Stockwell offers exclusive handmade designs from the classical to the ultra contemporary. Made from the finest materials, a Craigie Stockwell carpet can be entirely bespoke, or adapted from a beguiling portfolio of original designs.

Tel: +44 (0)20 7224 8380 or +44 (0)77 7031 4191 | Email: craigiestockwell@aol.com

www.craigiestockwellcarpets.com 51

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


If you look the right way, you can see the whole world is a garden.

Whatever your view of luxury, call us and we will listen. We take the time to get

Frances Hodgson Burnett

to know what you want from your holiday. Our knowledgeable hand-picked team have sampled many of the destinations we feature, so we can promise to create

sublime

luxury travel

a seamless, professional, tailor-made holiday. +44 (0) 203 751 5555 sublimetravel.co.uk

sublime luxury travel

53

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


55

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


ROLLS-ROYCE PHANTOM DECLARED ;360(´7&)78794)609<96='%6

;LEX'EV#1EKE^MRI´WERRYEP'EVSJXLI=IEVMWWYILEWVIGSR½VQIH4LERXSQ´WTSWMXMSREWXLI[SVPH´W½RIWXPY\YV] QSXSVGEV3RE[EVHMRKMXÂł&IWX&Y]´MRXLIÂ&#x2020;GEXIKSV]XLIRSXIHEYXSQSXMZIGSRWYQIVKYMHIHIGPEVIH â&#x20AC;&#x153;It takes a special car to successfully fend off its rivals for eight years â&#x20AC;&#x201C; and the Rolls-Royce Phantom is just that car. =IXEKEMRMX´WXLIFIWXXSTIRHPY\YV]GEVQSRI]GERFY]²

57

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


A ROCCO FORTE HOTEL

D I S C O V E R T H E M AY FA I R A R T S C E N E W I T H B R O W N â&#x20AC;&#x2122; S H O T E L Located in the heart of fashionable Mayfair, Brownâ&#x20AC;&#x2122;s Hotel boasts one of the most prestigious addresses in the city DQGLVLGHDOO\SODFHGIRUORYHUVRI ERWKFXOWXUHDQGVKRSSLQJ7KHJXHVWURRPVLQFOXGLQJPDJQLĂ&#x20AC;FHQWVXLWHVDUH stylish while retaining their original, quintessentially English elegance. The soft colour schemes, natural materials and light fabrics blend perfectly with the contemporary artworks specially selected by Director of Design, Olga Polizzi, making each room unique and welcoming with homely touches.

MODERN BRITISH LUXURY THE PERFECT LONDON EXPERIENCE

Art is a key feature throughout the hotel; HIX Mayfair is home to an amazing collection of works by leading British artists, including Tracey Emin, Michael Landy and Bridget Riley, which alongside its beautiful wood panelling, vaulted ceiling and elegant green banquettes offers a truly glamorous and authentic British dining experience. Brownâ&#x20AC;&#x2122;s Hotel is hosting exclusive Saturday morning art tours introducing guests to the exhibitions taking place in Mayfairâ&#x20AC;&#x2122;s leading galleries. Every month a different participating gallery director will take guests on a personal tour of some of their favourite shows and galleries, helping international art lovers navigate their way through the hundreds of private shows that collectively make Mayfair one of the worldâ&#x20AC;&#x2122;s greatest art destinations. Guests who would like to stay at Brownâ&#x20AC;&#x2122;s can take advantage of the following package: â&#x20AC;&#x2DC;Mayfair Art Lovers Weekendâ&#x20AC;&#x2122; includes one night in a Classic King Room at Brownâ&#x20AC;&#x2122;s Hotel on a Friday or Saturday night with Full English Breakfast, 7KH0D\IDLU$UW7RXURQ6DWXUGD\PRUQLQJ:LĂ&#x20AC;/XQFKIRUWZRLQ+,;0D\IDLURQWKH6DWXUGD\DQGHDUO\DUULYDORUODWH departure. Rates from ÂŁ530 inc VAT.

Albemarle Street, London, W1S 4BP Tel: +44 20 7493 6020 Fax: +44 20 7493 9381 Email: reservations.browns@roccofortehotels.com roccofortehotels.com

Brownâ&#x20AC;&#x2122;s Hotel, Albemarle Street, London, W1S 4BP. www.roccofortehotels.com Telephone : +44 (0) 207 493 6020


“The renaissance of the marque, in the decade since production started at the new Home of Rolls-Royce in Goodwood, MWEVIQEVOEFPI&VMXMWLQERYJEGXYVMRKWYGGIWWWXSV]²WEMH8SVWXIR1‚PPIVhXZ}W'LMIJ)\IGYXMZI3J½GIV6SPPW6S]GI1SXSV 'EVW±7MRGIMXWPEYRGLMR4LERXSQ´WQEVVMEKISJI\UYMWMXIGVEJXWQERWLMTTIIVPIWWIRKMRIIVMRKERHXMQIPIWWHIWMKRLEW IRWYVIHMXWTSWMXMSREWXLI[SVPH´WTMRREGPIWYTIVPY\YV]KSSHWLS[GEWMRK&VMXMWLGVEJXWQERWLMTERHHIWMKRI\GIPPIRGISR the global stage.”

61

ROLLS-ROYCE PHANTOM DECLARED BEST SUPERCAR

8LMWLSRSYVJSPPS[WXLIERRSYRGIQIRXSJEJSYVXLGSRWIGYXMZIVIGSVH]IEVERHXLIVIEJ½VQEXMSRSJ6SPPW6S]GI1SXSV 'EVW´PIEHIVWLMTSJXLIºWYTIVPY\YV]WIKQIRX(IGIQFIVWE[XLIQEVUYIHIGSVEXIH[MXLE8ST+IEV%[EVHJSV ;VEMXLERHE;EPTSPI%[EVHJSV³&IWX&VMXMWL0Y\YV]&VERH´


ROLLS-ROYCE MOTOR CARS WATERSPEED Rolls-Royce Motor Cars is delighted to reveal an exclusive sketch of the Bespoke Waterspeed Collection, a series of 35 Phantom Drophead Coupés that seeks to celebrate a seminal act of British daring and endeavour.

The Freebody slipper launch, hand crafted in England, for life’s unforgettable moments.

TELEPHONE: 01628 824382

On the morning of 1 September 1937, at the height of the battle between the United States and Great Britain to be the fastest nation on water, Sir Malcolm Campbell headed out onto the calm blue waters of Lake Maggiore on the Swiss-Italian JVSRXMIV 3R XEOMRK XLI [LIIP SJ LMW &PYIFMVH / L]HVSTPERI FSEX TS[IVIH F] 6SPPW6S]GI´W 68]TI IRKMRI LI IWXEFPMWLIH his legend, setting a record of 126.32 mph. The following day he went one better, piloting his craft to 129.5 mph, in doing so

IQTLEXMGEPP] FVIEOMRK XLI 9RMXIH 7XEXIW´ ½ZI]IEV WXVERKPILSPH SR XLI [SVPH [EXIVWTIIH VIGSVH 'EQTFIPP´W QSQIRXSYW EGLMIZIQIRXGETXYVIHXLI[SVPH´WEXXIRXMSRERHVIEJ½VQIHXLI 6SPPW6S]GI 68]TI IRKMRIW´ VIGSVHFVIEOMRK WYTIVMSVMX] EJXIV triumphs on land and in the air. Echoing the cutting-edge technology employed in the GSRWXVYGXMSR SJ XLIWI GVEJX SRP] XLI ½RIWX GSRXIQTSVEV] materials never used before on a Rolls-Royce furnish the Waterspeed Collection. Brushed steel perfectly complements an exclusively developed Maggiore Blue colour scheme whilst hand-crafted wood inlays evoke the sense of a boat effortlessly gliding through water at pace.

WWW.PETERFREEBODY.COM

THAMES BOATHOUSES, MILL LANE, HURLEY, BERKSHIRE SL6 5ND

63

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Sikorsky S-76D helicopter The Gold Standard for VIP helicopter transportation.

If you think helicopter, think Sikorsky

Fly safe, travel well 4BGFUZt1FSGPSNBODFt3FMJBCJMJUZt$PNGPSU Contact Stephen Ayling - T:44 (0) 1276 855-340 www.PlaneSaylingAviation.com - sales@PlaneSaylingAviation.com

PL A N E S AY L I N G A V I A T I O N Â L I M I T E D


ROLLS-ROYCE MOTOR CARS TO BRING SERENITY TO THE 2015 GENEVA INTERNATIONAL MOTOR SHOW

8LI 6SPPW6S]GI 1SXSV 'EVW WXERH EX XLMW ]IEV´W +IRIZE International Motor Show will be a haven of tranquility as the celebrated marque brings Serenity to Switzerland. Celebrating the historical role played by silk as a symbol of regal and imperial power, the Rolls-Royce Motor Cars Bespoke (IWMKR XIEQ LEW GVIEXIH E QEKRM½GIRX SRISJJ QSXSV GEV which will set a new benchmark for luxury individualisation in XLIQSXSVMRHYWXV]ERHVIEJ½VQXLEX&IWTSOIMW6SPPW6S]GI Delivering authentic modern luxury, Serenity will reintroduce XLI½RIWXSJXI\XMPIWXSGVIEXIXLIQSWXSTYPIRXMRXIVMSVSJ any luxury car. This unique design demonstrates the levels of

craftsmanship, creativity and attention to detail only Rolls-Royce Motor Cars can offer. 8LI QEVUYI´W &IWTSOI (IWMKR XIEQ LEW XEOIR MRWTMVEXMSR from the opulent interiors of Rolls-Royces that have conveyed /MRKW ERH 5YIIRW )QTIVSVW ERH)QTVIWWIWERH[SVPHPIEHIVW throughout history, whilst using contemporary interpretations of )YVSTIERJYVRMXYVIGSQFMRIH[MXL.ETERIWI6S]EP/MQSRSHIWMKRW to deliver a truly innovative, modern and tranquil Rolls-Royce interior. The new benchmark in super-luxury motor cars will be unveiled at a press conference in Hall 6 of the Geneva International Motor Show at 13.30hrs on 3rd March.The car will be on the stand for visitors to admire from 5th to 15th March.

67

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


QUALITY CAR, QUALITY COVER. ENJOY THE DRIVE.

A hidden gem in Burgundy Tony McDonagh are working with specialist insurer Hiscox to provide cover for owners of prestige cars. For a quote or more information please call us. Garry Bell Dip CII Private Client Manager Tony McDonagh & Co. Ltd T: 01992 703 008 E: garry.bell@mcdonaghs.co.uk W: www.tmdinsurance.co.uk

Luxury, discretion and heritage perfectly characterize La Borde, a historical Boutique Hotel nestled in Leugny, at the heart of Burgundy. Less than two hours from Paris by car, or directly by helicopter, La Borde offers a great hub to discover the Burgundy region. The house dates from the fourteenth-and partly from the sixteenth century. Its five luxury suites open onto a peaceful, French-style garden housing some 50 species of trees. The magnificent glazed orangery, the wellness center, and outdoor pool add to the comfort and sense of tranquility. Take a book, a glass of wine out of the extensive cellar and admire the scenery, this is the La Borde approach to a romantic weekend in the countryside or an epicurean stay to discover the region.

La Borde | 89130 Leugny | France Tel: +33(0)3 86 47 69 01 E: contact@la-borde.eu

TMD Insurance Group is a trading style of Tony McDonagh & Co Ltd. Tony McDonagh & Co. Ltd and Hiscox Underwriting Ltd are both authorised and regulated by the Financial Conduct Authority (FCA). 14240 02/15

www.lbmh.fr


ROLLS-ROYCE MOTOR CARS PHANTOM DROPHEAD COUPÉ &)743/);%8)674))('300)'8-32 Rolls-Royce Motor Cars is delighted to reveal an exclusive sketch of the Bespoke Waterspeed Collection, a series of 35 Phantom Drophead Coupés that seeks to celebrate a seminal act of British daring and endeavour. On the morning of 1 September 1937, at the height of the battle between the United States and Great Britain to be the fastest nation on water, Sir Malcolm Campbell headed out onto the calm blue waters of Lake Maggiore on the Swiss-Italian frontier.

71

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


1

>QTTI*Ia^QM_ +Â&#x20AC;\MLÂź)b]Z

.QZMĂ&#x2020;a COLLECTION

I  am  delighted  to  present  the   )LUHĂ&#x20AC;\&ROOHFWLRQÂąWKHÂżQHVWFROOHFWLRQRI OX[XU\YLOODVDQGVNLFKDOHWVSHUVRQDOO\ VHOHFWHGIURPDURXQGWKHZRUOG   7KH)LUHĂ&#x20AC;\&ROOHFWLRQLVDOODERXWTXDOLW\ QRWTXDQWLW\DQGZHKDYHEHHQYHU\ VHOHFWLYHDERXWZKLFKYLOODVDQGVNL FKDOHWVDUHLQFOXGHGLQWKHSRUWIROLR

2

>QTTITÂź7KMIV +Â&#x20AC;\MLÂź)b]Z

2QO\WKRVHOX[XU\YLOODVDQGVNLFKDOHWV WKDWZHWKLQNDUHUHDOO\VSHFLDODUH LQYLWHGWREHSDUWRIWKHFROOHFWLRQ SURSHUWLHVWKDWZHORYHDQGKRSH\RX ZLOOWRR Â

3

Tim  Latimer Founder ZZZ)LUHĂ&#x20AC;\&ROOHFWLRQFRP

+PITM\/ZIKM BMZUI\\ C

M

Y

CM

4

MY

+PITM\4I*MZOMZQM +W]ZKPM^MT 

CY

CMY

K

7^MZWN \PM_WZTLÂź[Ă&#x2026;VM[\

Defined luxury

DrĂśm UK creates bespoke saunas, steam rooms, feature showers, wet rooms and all types of

4]`]Za>QTTI[;SQ+PITM\[

wellbeing rooms â&#x20AC;&#x201C; from concept to reality - combining shapes

5

and forms, colours and textures,

4I*MZOMZQM<MZZM*TIVKPM 8ZW^MVKM

___.QZMĂ&#x2020;a+WTTMK\QWVKWU

lighting and scents.

<MT" 

+44 (0)1932 355655 Drom House, Abbot Close Byfleet, Surrey, KT14 7JN www.dromuk.com


3RXEOMRKXLI[LIIPSJLMW&PYIFMVH/L]HVSTPERIFSEXTS[IVIH F]6SPPW6S]GI´W68]TIIRKMRILIIWXEFPMWLIHLMWPIKIRHWIXXMRK a record of 126.32 mph. The following day he went one better, piloting his craft to 129.5 mph, in doing so emphatically breaking XLI9RMXIH7XEXIW´½ZI]IEVWXVERKPILSPHSRXLI[SVPH[EXIVWTIIH VIGSVH 'EQTFIPP´W QSQIRXSYW EGLMIZIQIRX GETXYVIH XLI [SVPH´WEXXIRXMSRERHVIEJ½VQIHXLI6SPPW6S]GI68]TIIRKMRIW´ record-breaking superiority after triumphs on land and in the air. Echoing the cutting-edge technology employed in the GSRWXVYGXMSR SJ XLIWI GVEJX SRP] XLI ½RIWX GSRXIQTSVEV] materials never used before on a Rolls-Royce furnish the Waterspeed Collection. Brushed steel perfectly complements an exclusively developed Maggiore Blue colour scheme whilst handcrafted wood inlays evoke the sense of a boat effortlessly gliding through water at pace.

75

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


And the world stood still.

79

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


A T H I N G   O F   B E A U T Y

W W W. A L F R E D H O M E S . C O . U K Exceptional homes  in  unique  locations  

81

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


BRITISH SUPERCAR SHOW AT SALON PRIVÉ Salon Privé celebrates its 10th anniversary in 2015 with the ERRSYRGIQIRX XSHE] XLEX MX MW VIPSGEXMRK XS XLI QEKRM½GIRX &PIRLIMQ 4EPEGI JYVXLIV YRHIVPMRMRK MXW TSWMXMSR EW XLI 9/´W most prestigious automotive event. Building on the achievements of a remarkable decade, which MRGPYHIWIWXEFPMWLMRKMXW'SRGSYVWH´)PqKERGIEWSRISJXLIXST 3 most prestigious classic car events in the world, the move to Blenheim Palace delivers a destination venue perfectly aligned to the allure and reputation of Salon Privé. Salon Privé will continue to retain its well-established early 7ITXIQFIV HEXIPMRI LS[IZIV XLMW ]IEV ERH JSV XLI ½VWX XMQI the event will run from Thursday 3rd to Saturday 5th, a move which is sure to attract considerably more buyers, collectors and enthusiasts than ever before. The addition of the ‘public HE]´ XS XLI IZIRX [MPP EPWS JIEXYVI E³7TIIH  7X]PI´ WYTIVGEV competition from 1975 to-date, held in the Palace grounds, adding an innovative and exciting new component to the event. Alongside longstanding elements of the three-day event including XLI'LYFF-RWYVERGI'SRGSYVWH´)PqKERGIERH&SSHPIW0EHMIW´ (E]XLIVIEVIEPWSWSQII\GMXMRK½VWXWEXXLMW]IEV´W7EPSR4VMZq

including the opportunity for visitors to test drive many of the desirable cars present and even more spectacular cavalcades of the cars on show. A PALACE LOCATION FOR SALON PRIVÉ Built in the early 18th century, the world-famous Blenheim Palace, a jewel in the Oxfordshire countryside, was designed by Sir John Vanbrugh. Now residence to the 12th Duke and Duchess of Marlborough, it is also famed as the birthplace of Sir Winston Churchill. Commenting on the relocation, His Grace, the 12th Duke of Marlborough said: “It is an honour for us to be hosting Salon 4VMZq¯XLI0Y\YV]7YTIVGEV7LS[ 'SRGSYVWH´)PqKERGI ¯MRMXWXIRXL]IEVERHJSVXLI½VWXXMQILIVIEX&PIRLIMQ4EPEGI %W E 92)7'3 ERH;SVPH ,IVMXEKI WMXI &PIRLIMQ 4EPEGI´W reputation precedes it, and it is the perfect host for Salon Privé offering an extended reach beyond just London to other towns and cities such as Oxford, Birmingham, Reading and Cheltenham. There is excellent access by road, rail and air and a plethora of luxury local hotels in nearby Woodstock.

For more information or to book tickets for the 2015 Event please visit: www.salonpriveconcours.com For more information on Blenheim Palace or to arrange a visit or enquire about private events please call: (01993) 810530 or visit: www.blenheimpalace.com

83

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


ROLLS-ROYCE MOTOR CARS DEBUTS PHANTOM METROPOLITAN COLLECTION %84%6-7132(-%0()0´%98313&-0)

6SPPW6S]GI1SXSV'EVWMWHIPMKLXIHXSTVIWIRXXLIPEXIWXWLS[GEWISJXLIQEVUYI´WTMRREGPI&IWTSOISJJIVMRK 8LI4LERXSQ1IXVSTSPMXER'SPPIGXMSRYRZIMPIHEXXLI1SRHMEPHI0´%YXSQSFMPIMR4EVMWJIEXYVIWI\UYMWMXI hand-crafted design inspired by the modern metropolis. Just 20 of these beautifully crafted motor cars will be available to commission.

85

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


8LI 4LERXSQ 1IXVSTSPMXER 'SPPIGXMSR TE]W LSQEKI XS XLI [SVPH´W great metropolises through the meticulous application of marquetry – the art of inlaying small pieces of wood veneer to form decorative QSXMJW ;LIR STIR 4LERXSQ´W WMKREXYVI TMGRMG XEFPI TVIWIRXW occupants with an elevated view of the city, created through the expert application of 500 individual wood veneer pieces. Indeed,

the process of hand-cutting, colouring, shaping and applying is WS GSQTPI\ XLIWI YRMUYI SFNIGXW H´EVX XEOI ER I\TIVX [SSH craftsperson several days to complete. On closing the tables, a HMJJIVIRX TIVWTIGXMZI SJ XLI GMX]WGETI MW SJJIVIH ¯ VI¾IGXMRK XLI view one gets when effortlessly traveling in the rear of a Phantom.

89

±- GER XLMRO SJ RS QSVI ½XXMRK PSGEXMSR XLER 4EVMW XS HIFYX XLMW VIQEVOEFPIRI[QSXSVGEV8LMWMWEGMX]XLEXIGLSIW6SPPW6S]GI´W very special brand promise in perfectly combining the timeless and modern in a manner that celebrates the art of the master GVEJXWTIVWSR² WEMH8SVWXIR 1‚PPIVhXZ}W 'LMIJ )\IGYXMZI 3J½GIV Rolls-Royce Motor Cars. “Our customers across the globe delight in challenging our designers and craftspeople to create true, oneof-a-kind pieces of automotive art. This latest Collection serves to showcase the extraordinary scope for Bespoke personalisation afforded to every patron of the marque.”

THE PHANTOM METROPOLITAN COLLECTION

4LERXSQ´W PEYRGL MR  IQTLEXMGEPP] LIVEPHIH XLI VIREMWWERGI SJ 6SPPW6S]GI1SXSV'EVWF]EJJSVHMRKXLI[SVPH´WQSWXHMWGIVRMRKERH successful men and women the consummate super-luxury experience. Central to the allure of its unique promise is an interior furnished MR XLI ZIV] ½RIWX QEXIVMEPW I\TIVXP] LERHETTPMIH F] XLI QEWXIV craftspeople at the Home of Rolls-Royce in Goodwood, England. It presents a space that cossets occupants and provides the ultimate sanctuary in which to traverse and observe the city in supreme comfort.


Meticulous care is taken when selecting the individual wood veneers. Minute MQTIVJIGXMSRW WYGL EW ORSXW ERH ¾IGOW PIEH to instant rejection. Adjustments to the colour of each piece are made through the traditional hand-process of hot-sand shading FIJSVIE½REPMRWTIGXMSRYRHIVQEKRM½GEXMSR on a light box to ensure perfection. The cityscape theme extends beyond 4LERXSQ´W QER] [SSH WYVJEGIW % WTIGMEPP]

developed Aetherius Grey leather colour was created to echo the colour palette of the modern city whilst 6,800 two-tone WXMXGLIWXSXLIGIRXVEPVIEVWIEX¾YXIWHITMGX an abstract image of a skyscraper. A specially developed Bespoke clock extends the theme XSXLIJVSRXSJXLIGEV*SVXLI½VWXXMQIMRXLI QEVUYI´WLMWXSV] EVSXEXMRKFI^IPI\TVIWWMRK 24 of the great cities of the world and their time zones – Paris included – adorns the central console of a Rolls-Royce motor car.

93

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


7 G 6K :  7 D J I > F J : 8FMDPNFUPUIFXPSMEPG#3"7&#065*26&y A.JOJNBMJTUTNJHIUXBOUUPMPPLBXBZOPX 5IJTJTBSFBMNPGTFOTVBM TUSPLFBCMFUFYUVSFTBOEMVYVSJPVTDPMPVST

"$0--&$5*0/0'03*(*/"-"35803,#&"65*'6-'63/*4)*/(4 5IF#SBWF$PMMFDUJPOJTBGVTJPOPGDMBTTJDEFTJHOXJUIBCPMEDPOUFNQPSBSZUXJTU

7:7G6K: XXXCSBWFCPVUJRVFDPVL XX 

Marie  Antoinette by

(>PUKZVY,UK)LHJVUZÃ&#x201E;LSK)\JRPUNOHTZOPYL/7 11,UNSHUK [! L!PUMV'KLSHTLYPLJVT ^^^KLSHTLYPLJVT


An exterior hue, Darkest Tungsten, inspired by city skylines ½RMWLIWXLII\XIVMSVWYVJEGIWSJXLIQSXSVGEVSRHMWTPE]MR4EVMW However, as afforded to any Rolls-Royce customer, the full palette of 44,000 colours is available to those commissioning a Phantom Metropolitan Collection motor car. Should that not be enough, XLI QEVUYI´W &IWTSOI GVEJXWTISTPI [MPP GVIEXI E TIVJIGX QEXGL SJ any colour or object a customer may wish to replicate. The exterior is completed with a hand-applied coachline that depicts an abstract silhouette of modern skyscrapers.

This is the latest in a line of remarkable, individual Bespoke masterpieces. 2014 has seen such highlights as the Phantom Drophead Coupé Waterspeed Collection that paid tribute to 7MV 1EPGSPQ 'EQTFIPP´W VIGSVHFVIEOMRK EGLMIZIQIRXW ERH XLI Pinnacle Travel Phantom that made its debut at the Beijing Auto Show. These limited Collections serve to inspire customers, with record levels of Bespoke demand reported in September 2014. Nearly every Phantom across the globe, 90% of Wraith and 80% of Ghost family motor cars were commissioned by customers with some element of Bespoke design. Bespoke is Rolls-Royce.

97

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


ELEGANT ADDRESS Luxury Property Group Ltd

Independent Bespoke Luxury Property Consultants

Luxury Property

Luxury Property

Luxury Property

South of France

Barbados

Ski

Finding Our Clients The

Address

Luxury Villa Rental Specialists. Luxury Hotels Luxury Villa Sales www.elegant-足addresslpg.com Tel: 0044 (0)2037 57 66 09

E: enquiries@elegant-足address.com

99

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


UNCOMPROMISING QUALITY FOR PEOPLE WHO APPRECIATE THE FINER DETAILS

We are passionate about quality and design and take immense care in the finer details of our kitchens, bedrooms and studies to ensure they not only compliment the other beautiful areas of your home but also carry out the job they were designed to do with the minimum of fuss. All of our furniture is British built and cared for by us from design to installation and beyond.

Established in 2005, Jaga Designs is a family business run by husband and wife team, Jaga and Maxine Baughan. Over the past decade, from design to installation and beyond, Alresford based Jaga Designs has established a reputation for delivering beautiful, functional and durable living spaces of the finest quality. Why not drop by and see us at our Alresford showroom.

40 WEST STREET, ALRESFORD, HAMPSHIRE, SO24 9AU, OR CALL TO BOOK A CONSULTATION ON 01962 735135

THE BEGINNING Rolls-Royce Limited was created over a famous lunch in May 1904. Henry Royce, a successful engineer, struck a deal with Charles Rolls, owner of SRI SJ XLI ½VWX GEV HIEPIVWLMTW 8LI VIWX MW LMWXSV] The ensuing series of two, three, four

and six cylinder cars broke the mould for engineering and craftsmanship. The Silver Ghost, launched in 1907, was a car of legendary smoothness that completed a 14,371 mile virtually non-stop run, GVIEXMRK³XLIFIWXGEVMRXLI[SVPH´PIKIRH

WWW.JAGADESIGNS.CO.UK

101

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


AWA R D W I N N I N G

B AT H R O O M S H O W R O O M & T I L E G A L L E R Y

Over 50 Bathroom Displays

l

Exclusive Brands

Tel 01784 426900 193 London Road I Staines-upon-Thames I TW18 4HR Monday - Friday 9.00am-5.30pm

l

Large Car Park

l

Just off Junction 13 of the M25

THE FOUNDERS - CHARLES ROLLS 'LEVPIW6SPPWWXYHMIHQIGLERMGEPIRKMRIIVMRKEX'EQFVMHKI8LI½VWXYRHIVKVEHYEXIXSS[REGEV LIWSSR began racing. To fund his passion he set up a dealership, selling mostly foreign cars. His search for a supplier of VIPMEFPI)RKPMWLGEVWPIHXSLMWMRXVSHYGXMSRXS,IRV]6S]GI8LI½VWXEZMEXSVXSGSQTPIXIEHSYFPIGVSWWMRKSJ the English Channel, he was killed in a crash at an air show in July 1910.

Saturday 9.00am - 5.00pm

w w w. b a t h e a n d b e y o n d . c o m

103

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


WORKING WITH YOU, NOT JUST FOR YOU. We understand whatâ&#x20AC;&#x2122;s involved in protecting your assets, so leave the hard work to us and relax knowing that youâ&#x20AC;&#x2122;re fully covered.

SIR HENRY ROYCE London Office 2nd Floor, Berkeley Square House Berkeley Square Mayfair, London W1J 6BD +44 (0) 207 887 6304

Berkshire office Clock Tower Lodge Hurley, Berkshire SL6 5LW +44 (0) 1628 826 745

Penshurst INSURANCE SERVICES

/RS[R JSV LMW EXXIRXMSR XS HIXEMP ERH TYVWYMX SJ TIVJIGXMSR ,IRV] 6S]GI VIKMWXIVIH LMW ½VWX TEXIRX XLI FE]SRIXPEQTWSGOIX MR,MWGSQTER]TVSHYGIHH]REQSWIPIGXVMGEPQSXSVWERHGVERIW(MWWEXMW½IH[MXL his Decauville, Royce decided to improve on it and turned his attention to building the best cars in the world. &]LILEHHIWMKRIHERHFYMPXLMW½VWXIRKMRI,MW½VWXTVSXSX]TIWXSSOXSXLIVSEHMR

info@penshurstinsurance.com www.penshurstinsurance.com

105

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


107

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


MEET MINDS AS CURIOUS AS YOURS

For more information call Silversea on 0845 835 0064, visit us at Silversea.com/expeditions or contact your travel agent.

109

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


111

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


“We should think of Phantom design as a piece of popular classical music. Over time this has the possibility of different interpretations without losing the essential melody that we know so well.”

ROLLS-ROYCE PHANTOM SERIES II These beautiful cars are timeless in their appeal, but in the modern world technology moves rapidly and Rolls-Royce cannot afford to stand still. So we have embraced that famous maxim of our founding forefather Sir Henry Royce who, a century ago, encouraged his teams to take the best that exists and to make it better.

Ian Cameron – Rolls-Royce Motor Cars Director of Design

115 ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Today Rolls-Royce proudly presents Phantom Series II a family of ultra-luxurious cars that have been thoughtfully updated with the introduction of cutting-edge technologies, enhancements to an already TIIVPIWWHVMZIXVEMRERHMQTVSZIQIRXWMRGSRRIGXMZMX]XLEXVI¾IGXXLI RI[[SVPHMR[LMGL[IPMZI%WEGSRWIUYIRGI -EQGSR½HIRXXLEX Rolls-Royce will continue to present, with pride, the very best motor cars in the world for many years to come. Torsten Müller-Ötvös - Rolls-Royce Motor Cars CEO

117

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Keep Wellness close to home...

Award-winning wealth management to steer you in the right direction... W

e focus solely on providing face-to-face advice and offer a dedicated, personal wealth management service to build long-term, trusted relationships with our clients. Together, we would look to create a working plan, providing you with a clear direction towards meeting your financial goals. This includes clarifying your objectives and researching all of the options available to you. We have the experience to help you successfully secure and enhance your financial future by offering specialist advice in a wide range of areas including: sÂ&#x2021;,QYHVWPHQWSODQQLQJ )NVESTMENTS s 2ETIREMENT PLANNING s 4AX AND ESTATE PLANNING For further information, or to request your complimentary guide to wealth management, contact:

Ewers Wealth MICHAEL EDWARDS Management LLP WEALTH MANAGEMENT PartnerPartner Practice of St.ofJamesâ&#x20AC;&#x2122;s Place Wealth Senior Practice St. Jamesâ&#x20AC;&#x2122;s Place WealthManagement Management

Tel:0118 012349541842 567890 Tel: Mob: 07956925634 Email: michael.edwards@sjpp.co.uk Web: http://ewerswealth.co.uk www.michealedwards.co.uk

Performance Counts Hydropool high performance Hot Tubs and Swim Spas are available VAT FREE, exclusively for Sunningdale Rolls Royce owners only. For personal attention email simon@hydropool.co.uk. Tel: 01342 311000

0!24.%23 ). -!.!').' 9/52 7%!,4(

4HE 0ARTNER 0RACTICE REPRESENTS ONLY 3T *AMESS 0LACE7EALTH -ANAGEMENT PLC WHICH IS AUTHORISED AND REGULATED BY THE &INANCIAL &RQGXFW !UTHORITY FOR THE PURPOSE OF ADVISING SOLELY ON THE 'ROUPS WEALTH MANAGEMENT PRODUCTS AND SERVICES MORE DETAILS OF WHICH ARE SET OUT ON THE 'ROUPS WEBSITE WWWSJPCOUKPRODUCTS4HE TITLE @0ARTNER 0RACTICE IS THE MARKETING TERM USED TO DESCRIBE 3T *AMESS 0LACE REPRESENTATIVES

Hydropool UK Ltd. The Spa Showroom, London Road, Portsmouth, Hampshire, PO2 9RR

Hydropool UK Ltd. The Spa Showroom, London Road, East Grinstead, West Sussex, RH19 2RQ

www.hydropoolspas.co.uk


121

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Painting a colourful future...

Open Days 201 - March UG, June 1th, October UG and November 1th Notre Dame School, Cobham 01932 869990

123

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


7MQTPMGMX]SJHIWMKRERHXLIZIV]½RIWXQEXIVMEPWGSRXVMFYXI to the timeless architecture of any Phantom, where touch points are exclusively wood, chrome and leather and where feet can easily be lost in deep, lambswool rugs. %VKYEFP]XLIFIWXTPEGIXSI\TIVMIRGI4LERXSQ´WPY\YV]MW from the rear seat of Phantom Saloon where passengers elevated by 18 mm - are presented with an inspirational view down the long sweep of the bonnet and onto the 7TMVMXSJ)GWXEW]%VIHYGXMSRMRXLIRYQFIVSJWIEX¾YXIW MRJVSRXERHVIEVJVSQ½ZIXSXLVIIKMZIWEQSVIQSHIVR GSQTPIQIRXXSXLIGEV´WWYQTXYSYWREXYVEPKVEMRPIEXLIV ERH¾YXIWEVIEPWSEHHIHXS(VSTLIEH'SYTqERH'SYTq seats for Phantom Series II.

125

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


VENTURE ET ON

PHOTOGRAPH Y STUDIO OF THE YEAR WINNERS 2010, 2012, 20 13

127 ROLLS-ROYCE MOTOR CARS SUNNINGDALE


GHOST SERIES II – DESIGN EVOLVED

4VSXIGXMRKXLITSTYPEVMX]SJ+LSWX´WMGSRMGHIWMKR[LMPWXHIPMZIVMRKXLIPEXIWX6SPPW6S]GIXIGLRSPSK]XS its exacting customers, the subtle re-design of Ghost Series II begins from the front. Re-sculpted LED headlights encircled by daytime running lights lend Ghost Series II a more dynamic visual signature and blend perfectly with revised surface treatments to the front of the car. %XETIVIH³[EOIGLERRIP´SRXLIFSRRIXIQEREXMRKJVSQXLI7TMVMXSJ)GWXEW]IZSOIWXLIWMKLXSJENIX´W ZETSYVXVEMPSV[EOISJEJEWXPY\YV]]EGLXERHLMRXWEXXLIGEV´WH]REQMWQ7YFXPIVIWGYPTXMRKSJ+LSWX´W bumpers creates a stronger stance and a sense of extra width and height, whilst the contemporary aesthetic is further enhanced with the addition of chrome inserts to the front air intakes, which now feed more air cooling to the front brakes. In addition, the famous waft line has been re-designed on Ghost 7IVMIW--XSPIERJYVXLIVJSV[EVHWIQTLEWMWMRKXLIGEV´WIJJSVXPIWWH]REQMWQ

129

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


133

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


135

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


137

Are you worried about your dental health, experiencing problems with your teeth, or just want a beautiful smile? At Woodborough House we provideâ&#x20AC;Ś. WĂ&#x152;zĂ&#x152;Ă&#x2026;Ă&#x17D;@Ă&#x201A;Ă&#x152;bkÂ&#x161;Ă&#x17D;Â&#x160;Ă&#x2026;Ă&#x17D;Ă&#x201A;Ă WĂ&#x152;kÂ&#x161;Ă&#x17D;Â&#x160;Ă&#x2026;Ă&#x17D;Ă&#x2026;Ă&#x152;Ă&#x17D;Â&#x2021;@Ă&#x17D;Ă&#x152;Â&#x2018;Â&#x160;Ă&#x2026;Ă&#x17D;kÂ&#x161; WĂ&#x152;kÂ&#x161;Ă&#x17D;Â&#x160;Ă&#x2026;Ă&#x17D;Ă&#x2026;Ă&#x152;Ă&#x17D;Â&#x2021;@Ă&#x17D;Ă&#x152;X@Ă&#x201A;k WĂ&#x152;9Â&#x17E;Ă&#x201A;Â&#x2018;bĂ&#x152;XÂ&#x2018;@Ă&#x2026;Ă&#x2026;Ă&#x152;kĂ&#x;­kĂ&#x201A;Ă&#x17D;Â&#x160;Ă&#x2026;k WĂ&#x152;1Â&#x2021;kĂ&#x152;NkĂ&#x2026;Ă&#x17D;Ă&#x152;Ă&#x201A;kĂ&#x2026;Ă&#x2014;Â&#x2018;Ă&#x17D;Ă&#x2026; Voted Best Implant Practice in the UK in 2013, Woodborough House Dental Practice is an exclusive private dental practice situated in the heart of Berkshire, specialising in general, cosmetic and restorative dentistry. Our exceptional services include: WĂ&#x152; Â&#x17E;Ă&#x2026;Â&#x2022;kĂ&#x17D;Â&#x160;XĂ&#x152;bkÂ&#x161;Ă&#x17D;Â&#x160;Ă&#x2026;Ă&#x17D;Ă&#x201A;Ă  WĂ&#x152;Â&#x2022;­Â&#x2018;@Â&#x161;Ă&#x17D;Ă&#x2026; WĂ&#x152;/Â&#x2022;Â&#x160;Â&#x2018;kĂ&#x152;Â&#x2022;@Â?kÂ&#x17E;Ă?kĂ&#x201A;Ă&#x2026; WĂ&#x152;1Â&#x17E;Â&#x17E;Ă&#x17D;Â&#x2021;Ă&#x152;Ă&#x17E;Â&#x2021;Â&#x160;Ă&#x17D;kÂ&#x161;Â&#x160;Â&#x161; WĂ&#x152;Â&#x161;Ă?Â&#x160;Ă&#x2026;Â&#x160;NÂ&#x2018;kĂ&#x152;NĂ&#x201A;@XkĂ&#x2026; â&#x20AC;&#x153;I should have done it years ago â&#x20AC;&#x201C; fantastic â&#x20AC;&#x201C; well done!â&#x20AC;? â&#x20AC;&#x153;The Woodborough team showed nothing but kindness and patience during my treatment. I cannot thank them enough for their cooperation and understanding. For the first time I have a smile that I am proud of and happy with. â&#x20AC;&#x153; Woodborough House Dental Practice 21 Reading Road, Pangbourne Reading, Berks RG8 7LR

Inside, Ghost Series II delivers on its outward appearance. The ultimate contemporary combination of luxury, technology and connectivity available to the successful entrepreneur on the move today, Ghost 7IVMIW --´W SRFSEVH XIGLRSPSK] IRWYVIW MX MW an oasis of calm in a busy, connected world where he or she can do business in peace. 7RoQGRXWPRUHYLVLWRXUZHEVLWHZZZZRRGERURXJKKRXVHFRP RUFDOOXVRQIRUDIUHHLQIRUPDWLRQSDFNRUWRERRNDFRQVXOWDWLRQ

GHOST SERIES II

Tel: 0118 984 3108 Email: info@woodboroughhouse.com www.woodboroughhouse.com


8LI PEYRGL SJ +LSWX 7IVMIW -- GSRWSPMHEXIW +LSWX´W TSWMXMSR EW XLI QSWX TSTYPEV GEV MR XLI º GPEWW ERH EW E GSVRIVWXSRI SJ 6SPPW6S]GI´WGSRXMRYMRKWYGGIWW

139

3R YRZIMPMRK +LSWX 7IVMIW -- XS E TEGOIH LEPP MR +IRIZE´W 4EPI\TS 'LMIJ )\IGYXMZI 3J½GIV SJ 6SPPW6S]GI 1SXSV'EVW8SVWXIR 1Â&#x201A;PPIV Ă&#x2013;tvĂśs said,

GHOST SERIES II UNVEILED AT 2014 GENEVA MOTOR SHOW

Âą8LI 6SPPW6S]GI +LSWX 7IVMIW -- MW XLI YPXMQEXI IRXVITVIRIYV´W business tool. Following the worldwide success of its predecessor, I am GSR½HIRXXLEXXLMWVIHIWMKRIHERHYTHEXIH6SPPW6S]GI[MPPGSRXMRYI to attract increasing numbers of new customers to the marque, in particular business entrepreneurs seeking an oasis of calm in a frenetic business world.â&#x20AC;?


Photography from a previous CALA development

T HI S I S LUXURY T HI S I S CA L A

T H R E E I N D I V I D U A L P R I VAT E G AT E D 5 & 6 B E D R O O M H O M E S BROCKENHURST ROAD, ASCOT CALA.CO.UK 5 star customer service 6 years running

AP00FEB 5 stars awarded for customers’ willingness to ‘Recommend to a Friend’ in findings of the 2009, 2010, 2011, 2012, 2013 and 2014 surveys, undertaken by the Home Builders Federation (HBF).

CALA H O ME S

141

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


143

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


&5($7($81,48(3,(&(2)-(:(//(5< IN TIME FOR CHRISTMAS... KĂ&#x153;Ă&#x17D;Ĺ?ÂąÂ?ĂŚÂ?¾¾Â?Ă&#x17D;ĂŹĹ?Â&#x201C;Ă&#x17D;¨Ă&#x2014;Ă&#x2019;ÂťÂ?ÂźĹ?­ĂĽÂ?Ĺ?­Â&#x161;Ĺ?Ĺ?ĂŚĂ Ă&#x17D;ÂłĂ&#x2019;­à Ă&#x152;Ĺ?Ă ÂźĹ?Ă&#x2014;­Â?Ĺ?Ă&#x152;Ă&#x17D;Â?¯Ă&#x2019;Â?Ă&#x2019;Ĺ?¨à Ă&#x17D;Ĺ?Ă&#x2014;ĂŚÂ?ÂźĂ&#x2014;ĂŹĹ?¨¯üÂ?Ĺ?ĂŹÂ?Ă&#x17D;Ă&#x2019;ÄŽ pÂŻĂ&#x2014;­¯ŸĹ?Ă Ă&#x153;Ă&#x17D;Ĺ?Ă ÂźĹ?Ă&#x2019;ÂŻĂ&#x2014;Â?Ĺ?¨Ă&#x153;¾¾ÏĹ?¨¯Ă&#x2014;Ă&#x2014;Â?Â&#x161;Ĺ?ĂŚĂ Ă&#x17D;ÂłĂ&#x2019;­à Ă&#x152;Ĺ?ÂźÂ&#x161;Ĺ?Ă Ă&#x153;Ă&#x17D;Ĺ?Ă&#x2014;ĂŚĂ Ĺ?0Ă&#x2014;Ă&#x2014;Ă ÂźĹ?+Ă&#x17D;Â&#x161;Â?ÂźĹ?Ă&#x2014;Ă&#x17D;ÂŻÂźÂ?Â&#x161;Ĺ?ÂąÂ?ĂŚÂ?¾¾Â?Ă&#x17D;Ă&#x2019; ĂŚÂŻĂ&#x2014;­Ĺ?ÂťŸÏĹ?ĂŹÂ?Ă&#x17D;Ă&#x2019;Ĺ?Â?ĂŤĂ&#x152;Â?Ă&#x17D;ÂŻÂ?ÂźÂ&#x201C;Â?ÄŻĹ?ĂŚÂ?Ĺ?Â&#x201C;ÂźĹ?Â&#x201C;Ă&#x17D;Â?Ă&#x2014;Â?Ĺ?¾¾Ĺ?Ă&#x2014;ĂŹĂ&#x152;Â?Ă&#x2019;Ĺ?à ¨Ĺ?Ă&#x17D;¯ŸŠĂ&#x2019;Ĺ?ÂźÂ&#x161;Ĺ?ÂąÂ?ĂŚÂ?¾¾Â?Ă&#x17D;ĂŹÄŽ pÂ?Ĺ?ÂľĂ&#x2019;Ă Ĺ?Ă&#x17D;Â?Ă&#x152;ÂŻĂ&#x17D;Ĺ?ĂŚĂ&#x2014;Â&#x201C;­Â?Ă&#x2019;Ĺ?Ĺ ĂŚÂŻĂ&#x2014;­Ĺ?ŠĂ&#x153;Ă&#x17D;ÂźĂ&#x2014;Â?Â?Ĺ&#x201A;Ĺ?ÂźÂ&#x161;Ĺ?Ă&#x17D;Â?Ă&#x152;ÂŻĂ&#x17D;Ĺ?Ă Ă&#x17D;Ĺ?ÂľĂ&#x2014;Â?Ă&#x17D;Ĺ?ÂąÂ?ĂŚÂ?¾¾Â?Ă&#x17D;ĂŹĹ?Ă&#x2014;Ă Ĺ?ĂŹĂ Ă&#x153;Ă&#x17D;Ĺ?Ă ĂŚÂźĹ?Â&#x161;Â?Ă&#x2019;¯ŠŸĎ ÄŹĹ?pĂ Ă&#x17D;ÂłĂ&#x2019;­à Ă&#x152;Ĺ?Ă ÂźĹ?VĂ&#x17D;Â?¯Ă&#x2019;Â?Ă&#x2019;Ĺ?¨à Ă&#x17D;Ĺ?¾¾Ĺ?4Â?ĂŚÂ?¾¾Â?Ă&#x17D;ĂŹĹ?XÂ?Ă&#x152;ÂŻĂ&#x17D;Ă&#x2019; ÄŹĹ?4Â?ĂŚÂ?¾¾Â?Ă&#x17D;ĂŹĹ?Â?Ă&#x2019;¯ŠŸĹ?ÂźÂ&#x161;Ĺ?XÂ?à Â&#x161;Â?¾¾¯ŠĹ?\Â?Ă&#x17D;ĂĽÂŻÂ&#x201C;Â? ÄŹĹ?Â?Ă&#x2019;Ă&#x2014;Ĺ?VĂ&#x17D;ÂŻÂ&#x201C;Â?Ă&#x2019;Ĺ?VÂŻÂ&#x161;Ĺ?¨à Ă&#x17D;Ĺ?\Â&#x201C;Ă&#x17D;Ă&#x152;Ĺ?+Ă ÂľÂ&#x161;Ĺ?\¯¾üÂ?Ă&#x17D;Ĺ?ÂźÂ&#x161;Ĺ?VÂľĂ&#x2014;ÂŻÂźĂ&#x153;Âť ÄŹĹ?*Ă&#x17D;Â?Â?Ĺ?Ă&#x2019;Ă&#x2014;ÂŻÂťĂ&#x2014;Â?Ă&#x2019; ÄŹĹ?ŸŠŠÂ?ÂťÂ?ÂźĂ&#x2014;Ĺ?ÂźÂ&#x161;Ĺ?pÂ?Â&#x161;Â&#x161;¯ŸŠĹ?X¯ŸŠĂ&#x2019; ÄŹĹ?pĂ&#x2014;Â&#x201C;­Â?Ă&#x2019;ÄŻĹ?XÂ?Ă&#x152;ÂŻĂ&#x17D;Ă&#x2019;Ĺ?ÂźÂ&#x161;Ĺ?Ă&#x2014;Ă&#x2014;Â?Ă&#x17D;ÂŻÂ?Ă&#x2019; ÄŹĹ?ŸŠĂ&#x17D;ü¯ŸŠ ÄŹĹ?2ÂźÂ&#x161;Â?Ă&#x152;Â?ÂźÂ&#x161;Â?ÂźĂ&#x2014;Ĺ?oÂľĂ&#x153;Ă&#x2014;ÂŻĂ ÂźĂ&#x2019; ÄŹĹ?ÂŻà ŸÂ&#x161;Ĺ?Â?ÂľÂ?Ă&#x17D;Ă&#x2019; ÄŹĹ?VÂ?Ă&#x17D;ÂľĹ?\Ă&#x2014;Ă&#x17D;¯ŸŠ¯ŸŠ

2OG:RNLQJ5RDG:HVW%\Ă HHW6XUUH\.7/:7

Brooklands Jewllers HP V1.indd 1

12/02/2015 11:18

W: www.completesafes.co.uk Ascot Locks Ltd, 32 High Street, Sunninghill , Ascot Berkshire SL5 9NE

E: peter@ascotlocks.co.uk | T: 01344 626 791

Complete Safe

Jewellery Trays

Firearm

Watch Winders.

OUTSTANDING QUALITY Established for over 35 years, the Company will transform the interior of a high security safe from a metal box into an elegant, hand-made interior cabinet designed by you to store your valuable possessions. Our guiding principal is attention to detail. Every component from the size and security status of your safe to designing elegant storage spaces to cradle your treasures will be led by you then handcrafted with passion and care. We will install your safe and provide on-going support for your peace of mind.

TO REGISTER YOUR INTEREST, PLEASE E-MAIL OR CALL PETER ON 01344 626791

Complete Safes HP V1.indd 1

11/02/2015 11:05

145 ROLLS-ROYCE MOTOR CARS SUNNINGDALE


ROLLS-ROYCE UNVEILS THE SUHAIL COLLECTION Rolls-Royce Motor Cars is delighted to unveil its first ever Bespoke Collection that encompasses XLI QEVUYI´W IRXMVI JEQMP] SJ QSXSV GEVW8LI ERRSYRGIQIRX GLMQIW [MXL XLI GYPQMREXMSR SJ E remarkable year that saw the marque emphatically reaffirm the fact that Bespoke is Rolls-Royce. The Suhail Collection is the first Collection to be offered on Phantom, Ghost and Wraith models, and takes its inspiration from Suhail, one of the brightest star constellations in the sky. It celebrates the work of the Arabic scientist considered by many as the father of theoretical physics and a great influence on Western scientific thinking.

147

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


The unveiling of this very special Collection GSQTPIXIW E ]IEV XLEX LEW WIIR 6SPPW6S]GI´W Bespoke offer reach new heights of popularity, creating numerous beautiful and compelling Collection cars such as Year of the Horse, Pinnacle Travel, Waterspeed, Metropolitan and Maharajah.

THE SUHAIL COLLECTION Named after one of the brightest constellations in the sky, Suhail and its light is believed to have inspired the 10th Century Arabic mathematician, astronomer and physicist Ibn al-Haitham, whose FIWX ORS[R [SVO MW XLI &SSO SJ 3TXMGW /MXEF EP1ERE^MV  &VMXMWL-VEUM TL]WMGMWX .MQ %P/LEPMPM considers al-Haitham to be the "first true scientist" based on his pioneering work on the scientific method. Amongst other achievements, Al-Haitham was the first scientist to realise that light enters the eye rather than leaving it. A host of elegantly executed touches have been added to the Rolls-Royce Phantom, Phantom Coupé, Ghost and Wraith to bring the spirit of Suhail to life in this extraordinary collection. The exterior of these astronomy-inspired motor cars sparkle in a unique moonstone pearl colour evoking the colour of the stars at night, whilst a Suhail star emblem completes a Turchese Blue coachline inspired by the colour of the night sky when Suhail is visible. The interior continues the striking colour scheme by elegantly combining Crem é Light leather with Turchese accents, framed by a Navy Blue instrument panel top and carpets. Suhail star emblems are also worked into the marquetry on the Ash Burr wood fascia, whilst a Starlight Headliner in the Phantom and Wraith models allows the owner their own personal moment of stargazing. Finally the Bespoke clock, colour matched to the interior, depicts the Suhail Ursa Minor and Major constellation on the clock face.

A YEAR OF AMAZING &)743/)6300763=')7 In addition to the Suhail Collection, 2014 has seen several beautiful and compelling Collection cars such as Year of the Horse, Pinnacle Travel, Waterspeed, Metropolitan and Maharajah created by the Bespoke Design Studios at the Home of Rolls-Royce in Goodwood, England. The Bespoke year began with the announcement MR.ERYEV]XLEX6SPPW6S]GI´W&IWTSOIXIEQLEH designed a Majestic Horse Ghost to celebrate the Chinese Year of the Horse. Marrying the Chinese ar tistic tradition and appreciation of fine hand-craftsmanship to the ver y best in contemporary British automotive design,

149

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


NFU MUTUAL BESPOKE HOME INSURANCE

TAKING CARE OF THE FINER DETAILS

Take a closer look at NFU Mutual Bespoke – tailored home insurance rated 5 Star by independent financial research company Defaqto. Designed for those with higher value homes and contents worth over £100,000 including fine art and collections, our expert team work closely with you to tailor cover that meets your specific requirements. We are dedicated to providing you with a great service and peace of mind, every step of the way. To find out more and to arrange a meeting with one of our expert team, please contact us on 0118 373 2226 or email reading_agency@nfumutual.co.uk NFU Mutual Reading Office, 12 Brewery Court, Theale, Reading, Berkshire, RG7 5AJ NFU Mutual is The National Farmers Union Mutual Insurance Society limited (No.111982). Registered in England. Registered Office: Tiddington Road, Stratford upon Avon, Warwickshire CV37 7BJ. Authorised by the Prudential Regulation Authority and regulated by the Financial Conduct Authority and the Prudential Regulation Authority. For security and training purposes, telephone calls may be recorded and monitored.

ChessAd_190x135_0215.indd 1

19/02/2015 12:07

Majestic Horse offered unique interior and exterior features including stitched horses in the headrests and rear seat cushions as well as a painted horse logo on the side and one painted on the wooden dashboard. April saw the debut of the Pinnacle Travel Phantom at the 2014 Beijing Autoshow. This extraordinary motor car served to showcase the imaginative heights of craftsmanship and design that emanates from Goodwood, seen through the prism of modern luxury travel.

Baron Grey Solicitors has a long and successful history, providing high quality professional services for business and personal matters since 1922. We are committed to providing a service tailored to your legal needs and always strive for the most cost effective and efficient solution to your problem. We are located on the south side of Richmond Bridge. We look forward to hearing from you with a view to discussing any legal issue you may have and this initial telephone call to our Mr Hambleton-Grey, Principal of Baron Grey Solicitors, is without charge (0208 891 4311).

BUSINESS

PRIVATE

- Limited Companies Director / Shareholders Agreements - Sole Traders & Partnerships - Agreements & Disputes - Commercial Conveyancing - Property Disputes - Employment Contracts / Work Permits - Debt Recovery - Insolvency

- Divorce & Family Matters - Employment Disputes - Boundary Disputes - Conveyancing & Property Matters - Landlord & Tenant - Wills, Probate & Trusts - Debt Problems - Bankruptcy

The richness of its main two-tone exterior colour scheme hinted at the luxury awaiting the traveller inside, whilst a unique coach line with an abstract motif of a streamlined train traveling at speed, invited the passenger onboard for a journey of discovery. This opulent colour scheme continued inside with a sartorial Morello Red and Seashell leather combination JSVWIEXWVSS¾MRIVTMPPEVWERHHSSVGEVHWTPYWWTIGM½GEPP] HIZIPSTIH1SVIPPS6IHPEQFW[SSP¾SSVQEXW A further motif in Smoke Grey thread evoked luxury travel whilst the piece de la resistance was 230 individual pieces of marquetry were painstakingly hand-laid to create a striking motif of a cross-continental train speeding across a landscape with plumes of steam left in its wake. The same motif is echoed on the door cards through 24,633 individual stitches, emphasising the painstaking craftsmanship required to perfectly match the two details.

020 8891 4311 www.barongrey.co.uk Email: info@barongrey.co.uk Langtry House, 441 Richmond Road, East Twickenham TW1 2EF (Adj. Richmond Bridge) Baron Grey V1.indd 1

17/02/2015 10:56

151 ROLLS-ROYCE MOTOR CARS SUNNINGDALE


The most recent Bespoke Rolls-Royce, the one-of-a-kind Maharaja Phantom Drophead Coupé was unveiled this November. -RWTMVIHF]XLI+SPHIR%KISJXLI6ENEXLMWFIEYXMJYPQSHIP[EWGSRGITXYEPMWIHERHLERHGVEJXIHMRLSRSYVSJ-RHME´WEJ½RMX] with the superluxury marque.  ]IEVW EKS -RHME´W 4VMRGIW ERH 1ELEVENEW GSPPIGXMZIP] IRKEKIH MR [LEX MW HIWGVMFIH EW SRI SJ XLI [SVPH´W PSRKIWX VIPEXMSRWLMTW[MXLSRIEYXSQSFMPIQERYJEGXYVIV3ZIVETIVMSHSJ½ZIHIGEHIWXLI1ELEVENEWTYVGLEWIHSZIVYRMUYI 6SPPW6S]GIQSXSVGEVWTYWLMRKXLIQEOIVSJXLI³&IWX'EVMRXLI;SVPH´XSYRTVIGIHIRXIHPIZIPWSJHIWMKRIRKMRIIVMRKERH PY\YV]6SPPW6S]GI1SXSV'EVWMWVIGVIEXMRKXLEXKSPHIREKISJ-RHME´WQSXSVMRKLIVMXEKIXLSYKLEGSPPIGXMSRSJ&IWTSOI ZILMGPIWMRWTMVIHF]XLI1ELEVENEW´GEVW A host of subtle touches have been added to the Rolls-Royce Phantom Coupé to bring the Golden Age of the Raja alive. The exterior dazzles in a Carrara White colour, with a Peacock emblem, the national bird of India, completing an Emerald Green coachline. A Deep Green hood retracts to reveal a beautiful deck with a Peacock emblem integrated into the marquetry – a perfect complement to the Peacock detail on the exterior.The interior continues the striking colour theme by elegantly combining Crème Light leather with Emerald Green accents, which is complemented by marquetry inlay on the facia panel top and arm rests. More elaborate Peacock emblems can be found embroidered into the headrests in Emerald Green and Cobalto Blue, as well as a Peacock feather pattern in Seashell stitching on the side and central armrests. A Bespoke Maharaja Peacock clock complements the interior colours with Cobalto Blue and pure Jade elements. These limited Collections serve to inspire customers, with record levels of Bespoke demand reported in September 2014. Nearly every Phantom across the globe, 90% of Wraith and 80% of Ghost family motor cars were commissioned by customers with some element of Bespoke design. Bespoke is Rolls-Royce.

153

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Natalia Interior DesignRá&#x2039;˝HUV SURIHVVLRQDOLQWHULRUDQG DUFKLWHFWXUDOGHVLJQVHUYLFHV IRUSULYDWHFOLHQWVFRPPHUFLDO SURMHFWVSURSHUW\GHYHORSHUV DQGKRWHOV ([WHQGHGH[SHULHQFHZLWK SURSHUW\GHYHORSHUVDQGSULYDWH FOLHQWVDOORZV1DWDOLDWRPDNH HDFKSURMHFWXQLTXH 1DWDOLDVWXGLHGDUWLQ+HUPLWDJH 6W3HWHUVEXUJDQGFRPSOHWHGKHU HGXFDWLRQLQ/RQGRQ6RXWK%DQN 8QLYHUVLW\DQGZRUOGIDPRXV 6W0DUWLQVFROOHJH

Sauna, Hammam, jacuzzi and gym are essential elements in high end residential project for many Clients. As for Russian Clients in London Natalia is in process of designing VIP Russian Banya No 1.

&UHDWLYLW\DWWHQWLRQWRGHWDLO SHUVRQDODWWLWXGH

www.nataliainteriordesign.com Natalia Meleshkevich +44 7810521710 Natali.artdesign@gmail.com

* Collaboration with Bamax (a classical and contemporary IXUQLWXUHGHVLJQá&#x2021;?UP KHOSV1DWDOLDWRDFKLHYHDQDEVROXWH satisfaction for her clients.

Michel Roux Jr. Fine Dining With the Masterchef

David Galetti Hand Hand Picked Picked Selection Selection of of Fine Fine Wines Wines from from Le Le Gavroche Gavroche Cellar Cellar

Cactus Kitchens -- Home Home of of Michel Michel Roux Roux Jrâ&#x20AC;&#x2122;s Jrâ&#x20AC;&#x2122;s Cooking Cooking School School

Michel Test Drives the New Rolls Royce Wraith 5 Recipes from â&#x20AC;&#x153;The French Kitchenâ&#x20AC;? -- Michelâ&#x20AC;&#x2122;s Michelâ&#x20AC;&#x2122;s New New Book Book Exploring Exploring the the Heritage Heritage of of French French Cuisine Cuisine

Cobblers Cove, Michel Michel in in Residence Residence at at Cobblers Cobblers Cove,, Cove,, Barbados Barbados

MMC Media Ltd Bespoke contract publishers to luxury brands, venues and companies in the UK and Europe including: Michel Roux Jnr, Pied-A-Terre, Gary Rhodes, Rolls-Royce Motor Cars, Bentley, Aston Martin and Mercedes-Benz. If you wish to discuss any publishing requirements for special events, new developments or anniversaries, please contact us for further details on (01253) 319882/3. www.mmcmedia.com

157

ROLLS-ROYCE MOTOR CARS SUNNINGDALE


Contact

Rolls-Royce Motor Cars Sunningdale London Road, Sunningdale Berkshire SL5 0EX Telephone: (+44) 01344 871200 Fax: (+44) 01344 871222

Opening Hours Monday - Friday from 8:30 a.m. to 6:30 p.m. Saturday 9:30 a.m. to 4:00 p.m.


No ordinary possessions. No ordinary insurance broker

A Louis XV Lowboy, circa 1760. Elegantly designed and irreplaceable, it deserves a special kind of protection. That’s why we offer much more than standard insurance. Our experience tells us that ‘off the shelf’ solutions, in most circumstances, simply won’t do. That’s why we offer bespoke insurance services; it’s what makes us different. We don’t just insure your furniture and possessions; we can also provide cover for your home, yacht, plane and prestigious car collection too. For more information or to find out how our specialist services can help you, call:

01452 511439 or email

enquiries@thistlepersonalrisks.co.uk Thistle Personal Risks is a trading style of Thistle Insurance Services Limited. Authorised and Regulated by the Financial Conduct Authority. A JLT Group company. Registered Office: The St Botolph Building, 138 Houndsditch, London. EC3A 7AW. Registered in England No 00338645. VAT No 244 2321 96.

Rolls-Royce Motor Cars Sunningdale  

Customer Magazine 2015

Rolls-Royce Motor Cars Sunningdale  

Customer Magazine 2015

Advertisement