Page 1

The Southington

Cit itii zen Volume 7, Number 4

Southington’s Only Hometown Newspaper

Hours before quake, students made donation

Friday, Januar y 22, 2010

Photos by Jacquelyn Ford-Cooperman

Left: Books donated to Haitian schools by the Southington High School French Club line a shelf just hours before a deadly quake struck Port-auPrince, the country’s capital. The death toll is expected to exceed 100,000. Below: A student decorates the shipping tube that will bring the supplies to Haiti. The students practiced their French by writing messages.

Even before the disaster, books were ‘locked up;’ French Club sends books, school supplies. By Jacquelyn Ford-Cooperman Special to The Citizen

Inside Business .........................26 Calendar .........................24 Health..............................30 Marketplace ....................44 Obituaries........................20 Opinion............................22 Real Estate .....................43 Seniors............................28 Sports..............................33

Recently, the Southington High School French Club collected school supplies and money for the charity Le Salle de Lecture. The French Club did not work alone. They recruited all French students to help donate to the charity. Le Salle de Lecture is a non-profit organization that was started in South Windsor by Elizabeth and Paul Wicks. Le Salle De Lecture sends school supplies, vitamins and monetary donations to children in Haiti. “For a lot of the students in Haiti, their only meal is at school. It is the only way they remain focused. That is why it is so good to give them vitamins, of all things,” said Elizabeth Wicks. Twenty years ago, Elizabeth and Paul Wicks started traveling to Haiti to help the children. “It really hit me when I went for the first time and women would just throw their babies at me because I am white, and you need to be white to get into a hospital to treat the babies,” said Elizabeth Wicks. “It is incredibly humbling to work with the children. You realize what you have because these kids have so little. It’s heart breaking,” added Paul. Le Salle de Lecture was started four years ago when Elizabeth Wicks visited a Haitian school and saw that the books

had to be locked up. From this, Elizabeth Wicks, a teacher, started Le Salle de Lecture with her husband, “the businessman,” according to Elizabeth. Le Salle de Lecture is a literacy program whose goal is to share the joy of reading with Haitian children. “Unlike a lot of charities today, Le Salle de Lecture gives one hundred percent of donations to Haitian children,” said Elizabeth Wicks. “The French Club donated books, pens, pencils, and money to Le Salle de Lecture, just to name a few,” said Kristin Bellis, French Club president. The French Club was introduced to Le Salle de Lecture through the husband of Mary Perlot, a French teacher at SHS and French Club advisor. The French Club chose to donate to Le Salle de Lecture since Haitian children learn to speak French starting in the first grade. “I’ve been to Haiti and I want to help make the kids healthy because they are so poor,” said Diana Piotrowski, a sophomore and member of the French Club. “A lot of people helped donate. It was a very good turnout,” said Bellis. The club donated more than three boxes of supplies. To collect supplies, French Club members advocated to their French classes about the charity and before December break, the French Club held a Christmas party where students came, sang French

See Haiti, page 7


2

The Southington Citizen — Friday, January 22, 2010

A Growing Church...Growing In God. Our Love For Others & His Plan For Our Lives!

Rev. Christopher Caton, Pastor, & wife, Christen

Sunday Worship – 10:30 am – Holiday Inn – 120 Laning Street, Southington 1138872

Take the plunge! Photos by Stacey McCarthy and Deb Mikan

Voted 20 Years Specializing In Residential Systems Voted #1 #1

Heating & Air Conditioning SALES, SERVICE & INSTALLATION Oil or Gas Heating Systems

Automatic Humidifiers

1139207

Many brave Southington residents jump into Sloper Pond to raise scholarship money so children can attend YMCA Camp Sloper this summer.

Exit 32 off I-84 –– www.TodaysChurchCT.org –– 860-426-0446 Weekly Cox Channel 15 Program – Fridays, 7:00pm

Electric Conversions Need A New System?

Call Now for a FREE QUOTE

24-Hour Emergency Service

860-620-0687

Water Heaters Furnaces & Boilers Fully Insured & Licensed #388408 s r

r

TM

Mini Meditation Sponsored by Father Nadolny Good News Fund

If you knew when you would go to heaven, how would you spend your last days? Would you tidy up your room? Would you check your finances? Would you watch your last baseball or basketball game? You would probably say, of course not. They would not be important then. Why are they so important now? But, Jesus would be important then. Why isn’t He important now?

Reverend Edmond S. Nadolny 1143870

48 Cottage Street, East Berlin, CT 06023 (860) 828-0154 email: fngoodnews@aol.com Cell: (203) 213-3407


3

Friday, January 22, 2010 — The Southington Citizen

It Seems Like Only Yesterday... Still family owned and operated since 1937. Southington’s Only Local Hauler

1991

2010

Michael Sr. & Linda with Sons Mike and Mark and Grandson Mikey

When you do business with Waste Material Trucking Company, your hard earned dollars STAY in Southington. We do business with local companies and local banks and we support community projects. You don’t have to call an “800” telephone number or mail your payment out-of-town. We’re right around the corner!

19 years later with Grandson Cole.

2010 SIGN UP SPECIAL Pay now for 12 months and receive 14 months of service.

2 Months FREE! • Trash & Recycling Container included with service. • NO delivery fee • NO deposit required • Sign up special expires 3-1-2010 1143182

105 Dunham Place, Southington, CT 06489 860-747-6816 • wastematerialtrucking.com


4

The Southington Citizen — Friday, January 22, 2010

King celebration brings many into one crowd By Robin Lee Michel The Southington Citizen

For the past 14 years in Southington, First Baptist Church members have or-

ganized an event to recognize civil rights activist Martin Luther King Jr. and to promote his mission of equality, life, liberty and the

Same Day Service Boiler/Furnace Replacement - In Stock 29 Years Experience

See King, page 12

1142493

• Oil & Gas Systems • Central A/C • Installation • Personal Service • Oil Referrals • Free Estimates • 24 Hour Emergency Service • Financing Available

pursuit of happiness for all citizens. The community at large has been less than supportive of the event, noted several speakers at the Jan. 17 reception held at the Aqua Turf Club. “It would be nice to have more people for whom you voted to be at events like these,” said the Rev. David C. Strosahl, guest speaker. Patricia Johnson, member of the Southington Board of Education, was the sole town official present. “Eighty per-

#1 REASON TO CALL US ... Because We Only Do Bathrooms!

“Billy”

Ask about $1,500 Heat & Central A/C Tax Credit

Replace that old high tub with a 5’ Walk-in Interlocking water tight seal shower 1142515

Best Heating & A/C

For As Low As

$

2,950

ONE DAY INSTALLATION • SHEETROCK PATCHING, FAUCET & PLUMBING INCLUDED

SUMMA CONSTRUCTION FRstiEmEate E SERVICES L.L.C. Lic. #572608 Licensed & Insured

CT License #S1-386598

s r

217 Berlin Avenue, Southington 860-621-0556

r

Citizen photos by Robin Lee Michel

Tyler Bard, of Joseph A. Depaolo Middle School, left, and Michaela Gee, of John F. Kennedy Middle School, center, receive accolades from Cheryl Campbell-Hilton for winning the Martin Luther King Jr. student awards.

TM

Over 40 Yrs. Experience

CALL (860) 628-0073

Family Owned & Operated

www.billycarlsonct.com

DON’T MISS IT!

CC ENTRAL AFE

No Job Too Small!

Fundraiser to Benefit The Plainville Food Pantry Sunday, January 31st

Home Improvements & Remodeling Kitchen & Bathrooms

Must Register by January 29th for... Fully Insured

Mobile (860) 463-5637 HIC-602565

Kitchen and Bathroom Remodeling • Tile • Texture Ceiling • and more...

Wing Eating Contest Entry Fee $25 Winner Receives $250 Cash Prize

We De

2 PM Entry Fee $10 Winner Receives $150 Cash Prize

Raffle Prizes including a Flat Screen TV!!!

Giveaways

w/Purchase of Fries & Medium Beverage. Burgers are 1/3 lb. With this Coupon We Serve Breakfast • Angus Burgers • Veggie & Turkey Burgers • Grinders • Chili & More!

1144723

1144720

Stop in or checkout facebook for more details

24 Whiting St. Plainville CT 860.747.0405

• Party Rentals • Inflatables, Bouncers • Waterslides • Cotton Candy & Popcorn Machines

The Southington

BUY ONE liver! Cit it i zen iti GET ONE FREE CHEESEBURGERS

Central Cafe Chili Challenge

CC ENTRAL AFE

Bus. (860) 224-8525 Fax (860) 224-9833

Bounce Houses Starting at $150

1144620

1143069

King of the Wing

JON RUCH

SPACE WALKERS 860-518-1760

860-410-4304 81 Whiting St. Plainville Open 7 Days No Affilation with Scooters

ISSN 1559-0526 USPS 023-115 Published weekly by Record-Journal Publishing Co., d/b/a The Southington Citizen, 40 N. Main St., Southington, CT 06489. Periodicals Postage Paid at Southington, CT and additional mailing offices. POSTMASTER: Send address changes to The Southington Citizen, P.O. Box 246, Southington, CT 06489. 1143235


5

Friday, January 22, 2010 — The Southington Citizen Submitted photo

To celebrate Veterans Day, students at DePaolo Middle School heard from one of the teachers who served in Iraq with the U.S. Army. Joel-Patrick Leger, an eighth-grade U.S. history teacher at DePaolo who flew transport missions as a Black Hawk crew chief, wore his uniform and displayed items used during his time in Iraq.

SOUTH END HARDWARE 1164 Meriden-Waterbury Rd., Plantsville, CT 06479

(860) 628-2937 Hours: Mon.-Sat. 7:30 am to 5:30 pm

WE CAN DO IT! • Repair Your Screens • Cut Keys • Cut Window Glass • Cut Shades • Cut Plexi Glass • Fax • Computerized Paint Matching • Send Your Package UPS

IF YOU

1144712

break it, bend it, snap it, kink it, crush it, catch it...

BERKSHIRE OIL 25 Stafford Ave., Bristol, CT

589-0499 • 747-4334

WE FIX IT!

www.berkshireoil.com

For Same Day Service

For Automatic Delivery

$

2.59

9*100 gal.

*Prices subject to change without notice

min. s r

r

TM

(Excludes VATS)

26 N. Main St., Southington (860) 621-7666 FREE Ear Piercing

1142492

A FULL SERVICE COMPANY • Gift Certificates Available

FREE SINGLE CUT KEY

POLUMBO JEWELERS

Be Southington’s

BIGGEST LOSER! Join our 10-Week Fitness Challenge NOW!

HURRY! Challenge Begins: January 25, 2010. 2009 Challenge Winners, Peter Bowman and Diane Motowidlo.

Prizes awarded to winners with Best Overall Achievement. Ask about our affordable 10-Week Fitness Challenge program! Call today for more information or to register. Customized Payment Options Available!

Call (860) 628-7776

1144228

www.horizonpt.com CONVENIENTLY LOCATED: 1678 Meriden-Waterbury Tpke./Southington, CT 06489

1144813

New 4¢ Senior Discount

Coupon: Exp.: 1/30/10


6

The Southington Citizen — Friday, January 22, 2010

News in Brief Elks plan Valentine Dinner Dance

The Southington Elks Lodge 1669, 114 Main St., will host its annual Valentine Dinner Dance with the live band Rockin’ Heartbeats Saturday, Feb. 13. Cocktail hour begins at 6 p.m. and dinner starts at 7 p.m. The band will play 8 p.m. to midnight. The dance features a cash bar and raffles. Contact lodge for tickets in advance at (860) 628-6682.

Scholarship deadline nears Ronald McDonald House Charities of Connecticut and Western Massachusetts announced it will award $50,000 to 22 local high school seniors this academic year through its scholarship program. Students of all backgrounds are encouraged to apply, with $31,000 allocated to eligible Hispanic applicants. Scholarship applications are now available online at www.rmhcctma.org/programs or by calling (866) 851-3994. Stu-

HEATING & AIR CONDITIONING INC.

Heating & AC • Sheet Metal • Installation & Service Gas • Oil • A/C • Boiler • Water Heaters • Humidifiers

Clinic offers wellness lectures Wellness Clinic Offers Free Lecture Series The Raya Clinic, 200 Queen St., Southington, will host a workshop 6:30 p.m. Feb. 3 on spinal disc pain.

Call (860) 621-2225 for more information.

Zalaski calls on Rell to release town road aid State Rep. Zeke Zalaski, DSouthington, recently called on Gov. M. Jodi Rell to release millions in state aid that would fund badly needed paving projects and road repairs in Southington. “The governor’s decision to hold this funding is having a negative affect on local budgets and is making it difficult for local elected officials who have responsibility over local road paving and repairs,” Zalaski said. “Southington needs this grant money and it needs to be released soon.”

Due to the current budget deficit, the governor has held back $30 million in Town Aid Road Grants. In the previous fiscal year, Southington received $261,220. The governor’s office reportedly said the funds might be on the next state bond agenda. “I hope the governor puts the funding on the agenda for the next meeting of the state bond commission and hopefully that meeting will be scheduled soon,” Zalaski said. Towns usually receive TAR funding in January and July each year.

See News, page 31

DAY CARE • GROOMING • TRAINING

Sales of Energy Efficient Systems 29 MILLDALE AVE., PLANTSVILLE, CT • Phone (860) 621-5589

210 Queen St., Southington www.pawplay4dogs.com

621-0072

1144887

1138871

24-Hour Service Family Owned Since 1979 • Southington Resident

dents can also see their guidance counselor for applications. The deadline for submitting an application is Feb. 16. Applicants must be eligible to enroll in and attend a two-or four-year college with a full course study and reside in a participating area. Scholarship recipients will be selected on the basis of academic achievement, financial need and community involvement.

Established 2001

IT’S MY get healthy…

®

stay motivated AT THE SOUTHINGTON COMMUNITY YMCA!! Need supportive and certified staff to help you achieve your goals? • Need over 85 drop-in fitness classes available to you weekly? • Need fitness and recreational opportunities for your entire family? • Need access to any YMCA in Connecticut? 1142496

You BELONG at the YMCA! Southington Community YMCA, 29 High Street, Southington (860) 628-5597

The YMCA is a non-profit 501c (3) organization. Financial assistance to qualifying individuals and families is available.

And now for a limited time only...NO JOINER FEES!... Save up to $96 by Joining Now! Offer Ends January 31st! Visit us at www.southington-cheshireymca.org


7

Friday, January 22, 2010 — The Southington Citizen

Haiti Continued from page 1 carols, ate and brought donations. On Jan. 11, Elizabeth and Paul Wicks came to SHS to talk about Le Salle de Lecture. The members decorated the cylinder the supplies

would be sent in and wrote personal, French greetings. Perlot read the French Club a Haitian children’s book, followed by a presentation by the Wicks. “Haiti is the poorest country in the Western Hemisphere. Ninety-seven percent of the population is poor,” said Paul Wicks. The French Club helped impact count-

less Haitian students by their simple donations, but helping the Haitian children hasn’t stopped. The French Club is continuing to help by collecting gently used stuffed animals for Le Salle de Lecture. To donate to Le Salle de Lecture, contact Paul and Elizabeth Wicks at (860) 4321258.

Read us on the Web: www.southingtoncitizen.com

We Have Your Business Loan Ready!

Photo by Jacquelyn Ford-Cooperman

Paul Wicks, who founded Le Salle de Lecture with his wife, Elizabeth, talks to French students at Southington High School about the challenges faced by Haitian children. The French Club collected books and school supplies for the organization and donated them last week. Tragically, later that same day, an earthquake struck the Haitian capital, Port-au-Prince.

Klingner Family Oil Quality Heating Oil

Valley Bank and Apple Valley Bank - your local community banks want to help your business succeed.

1142971

CALL FOR LOWEST PRICE HOD#578

860-677-8334 PO Box 402, Farmington

s r

r

TM

Barry's Hallmark Voted Best Gift Store Four Years in a Row

Unlike some banks, we are well capitalized and have money available now for business loans of just about any size.

Hot New Item -

New 4 New Colors 7 New Styles

Please contact:

Do you need money to expand, purchase new equipment, consolidate debt or a business line of credit?

What ever your business needs, we’re ready to help.

Spring Collection “I Love You” Voice-Response Bear

Bristol Area Tony Mattioli - 860-585-2111 Cheshire, Meriden, Wallingford Area Dan DeRosa - 203-271-1268 Plainville, New Britain Area Byron Treado - 860-585-2113 Southington Area Vinnie Ruggiero - 860-621-3521

Divisions of

14.95

$

with each purchase of three Hallmark cards (Reg. $29.95) SKU: 1LPR1608

Bristol, Cheshire, Southington, Terryville, Wallingford 1143233

1144706

3 AREA LOCATIONS: 865 Queen St., Southington (Next to T.J. Maxx) 860.276.1287 850 N. Colony Rd., Wallingford 203.269.3102 2100 Dixwell Ave., Hamden 203.248.6316

Equal Housing Lender • Member FDIC

www.nebankct.com All the bank you’ll ever need.

TM


8

The Southington Citizen — Friday, January 22, 2010 Photo courtesy of DePaolo Middle School

DePaolo names top students

DePaolo Middle School has named the January Students of the Month. Pictured from left to right in the back row are: Assistant Principal Chris Palmieri, Kevin Byrnes, Damiaen Florian, JoAnna Gendreau, Jessica Bocek and Principal Frank Pepe. In the middle row are Vanessa Kleinhen, Emily Lippincott, Vedant Vyas, Alessandra Melluzzo and Adam Whitford. In the front row are Andrew Spitz, Emily Mankus and Tim Cocozza. 1144703

DePaolo Middle School has named the Students of the Month for January. In sixth grade, Tim Cocozza, Andrew Spitz and Emily Mankus were selected by their teams. Tim is the son of PJ DeBisschop and won the principal’s award in 2009 at Hatton Elementary School. Tim has made first honors at DePaolo and is a part of the leadership program. Outside of school, he plays Southington travel soccer and plays indoor soccer at FSA. Andrew is the son of Sue and John Spitz and also is an honor roll student. He

Are you looking for a Dependable Oil Company? WE FOUND ONE

• • • • • •

We offer Health Coverage for:

2.59

$

9* per gallon

™Individuals without Group Coverage ™Dependents and Students ™Self-Employed ™Independent Contractors ™COBRA/Alternative ™Medicare Supplements Solutions with choices are easy, just call

0*,AVORANTE 203-589-2187   

lll#]ZVai]XdkZgV\ZXi#Xdb™eVhfjVaZ#aVkdgVciZ5Vci]Zb#Xdb 1143488

Don’t trust your family’s warmth and comfort to just any heating oil dealer. We guarantee reliable oil delivery within 24 to 48 hours of your confirmed order or we will take $50 off your order. That’s Plainville Oil’s guarantee!

CURRENT PRICE

See DePaolo, page 19

(EALTH#OVERAGE-ADE%ASY

Friendly courteous staff answering your questions not an answering service Same Day Oil Delivery Never a Problem! (Additional fees apply) 24-Hour, 7 Days a Week Emergency Oil Delivery Service - Never a Problem Our Own licensed Service Technicians available 24/7 to handle your no heat emergency Free Estimates on Heating System installations • Tank Insurance, Removal and Installation We are the first local heating oil company to offer BIOHEAT, an environmentally friendly heating oil for the same low price as regular heating oil.

Anthem Blue Cross and Blue Shield is the trade name for Anthem Health Plans, Inc. Independent licensee of the Blue Cross and Blue Shield Association. ÂŽANTHEM is a registered trademark of Anthem Insurance Companies, Inc. The Blue Cross and Blue Shield names and symbols are registered marks of the Blue Cross and Blue Shield Association.

80 Townline Road, Plainville, CT 06062 • 860.793.1239

*Price subject to change without notice. Minimum delivery required.

volunteered his time at Alex’s Lemonade Stand at the Apple Harvest Festival and is in the school chorus. Andrew also plays football for the town as well as basketball and baseball. Emily is the daughter of Eileen and Richard Mankus and was recognized in elementary school with the Presidential Excellence Award. She has brought baked goods to the Southington soup kitchen and has helped with a fundraiser for the First Congregational Church. Emily also plays softball

Don’t Be Confused

New customers always welcome. Volume discounts available!

Order on-line at www.plainvilleoil.com 24 Hours A Day - 7 Days A Week or call

860.793.1239

GRAND OPENING!

Your CVS/Caremark Prescription Card is always accepted here

SHOP TODAY! Famous Brands Recycled

We Sell, Buy, Trade and Accept Consignments of Designer Fashions For Teens, Young Adults, Men & Women $5 $10

5 OFF

$

purchases over $25

One coupon per person per visit. Cannot be combined with any other offers. Excludes prior sales. Please present coupon. Expiration Date: 2/28/2010

$5

Citizen

10 OFF

$

JOHN A. DOE

purchases over $50

One coupon per person per visit. Cannot be combined with any other offers. Excludes prior sales. Please present coupon. Expiration Date: 2/28/2010 Citizen

1143772

Need Cash? We are Buying & Accepting Consignments!

xxxxxxxxxxxxxxxxx Group # xxxxx

Attention Retired Teachers!

$10

855 Queen St., Southington, CT (behind Outback Steakhouse) Next to Buffet 2000 and Dollar Tree • www.Wild2Go.com

Serafino Pharmacy 1142508

Now Paying Cash for Famous Brands & Designer Clothing! We are buying Name Brand Designer Fashions for Teens & Young Adults (Boys & Girls) Must be in perfect (gently used) near New Condition, Clean, Pressed and Ready to sell. All items must be current styles (2 years or less). Visit our website for details and a listing of the WANTED Hot Famous Brands.

Your Sterling and Sterling/CaremarkCVS Prescription Card will be accepted and welcome here!

36 North Main St., Southington 860-628-7979 (RxRx)


9

New Rotary member 1136122

Senior Discount Available

Submitted photo

Kate Terricciano, right, a new member of the Rotary Club of Southington, receives her pin from Carol Grant. James Earl is also a new member of the club.

1144714

TRUST THE OWL Owl Licensed Technicians

Oil Inc. Specializing in all your Heating & Cooling Needs

SAVE $25 Expires 2/28/10

860-829-5888

www.owloil.com Lic. #390236

$AVE • $AVE • $AVE • $AVE • $AVE

Barahk’s Tree Service Southington, ct

860-620-9667 FULLY INSURED

Licensed Arborist

TREE REMOVAL • FIREWOOD • SPLITTING CHIPPING • LAND CLEARING • CABLING BRACING • PRUNING • STUMP GRINDING

Saint Paul School Open House Thursday, January 28, 2010

6:00 PM - 8:00 PM

Consider Saint Paul School for your child!

461 Alling Street Kensington CT 06037 stpaul461@yahoo.com www.stpaulschoolkens.org

Pre-K to Grade 8

Can’t make the Open House? Call us at 860-828-4343 to schedule a tour.

1144087

ON YOUR NEXT HEATING SYSTEM SERVICE OR CHECK-UP

• $AVE • $AVE • $AVE • $AVE • $AVE •

• $AVE • $AVE • $AVE • $AVE • $AVE •

$AVE • $AVE • $AVE • $AVE • $AVE

Excellence in Catholic Education

Friday, January 22, 2010 — The Southington Citizen

Accredited by the New England Association of Schools & Colleges

GRAND OPENING!

FREE DELIVERY 1144707

17 Farmington Ave. Old Canal Square

155 School Street

860-583-0005

860-747-5144 Hours: Monday Closed; Sun. 11-8 pm; Tues. & Wed. 11-9 pm; Thurs.-Sat. 11-10 pm

DINE-IN SPECIALS

Large Cheese Pizza & 2L Soda

$

11.99

+ tx.

DINE-IN SPECIALS

Buy Any 2 Pasta Dinners, Salad & Garlic Bread w/Cheese

21.99

22 LARGE LARGE CHEESE CHEESE PIZZAS... PIZZAS... 15.99 15.99 ~~ 22 MEDIUM MEDIUM CHEESE CHEESE PIZZAS... PIZZAS... 13.99 13.99 $$$ 22 LARGE 15 BUFFALO 22.99 LARGE CHEESE CHEESE PIZZAS PIZZAS && 15 BUFFALO WINGS WINGS ... ...$$22.99 $$$ 22 MEDIUM MEDIUM CHEESE CHEESE PIZZAS PIZZAS && 10 BUFFALO WINGS WINGS ... ... $$18.99 10 BUFFALO 18.99 $$$$$$ 16.99 22 SMALL SMALL CHEESE CHEESE PIZZAS PIZZAS && 88 BUFFALO BUFFALO WINGS WINGS ... ... 16.99 $$$ 16.99 11 LARGE LARGE PIZZA PIZZA WITH WITH 11TOPPING TOPPING && 10 BUFFALO WINGS WINGS ... ...$$$16.99 10 BUFFALO SICILIAN CHEESE CHEESE PIZZA PIZZA && 12 BUFFALO WINGS 12 BUFFALO 17.99 11 SICILIAN WINGS ... ...$$$$$$17.99 $$$$$

Cannot be combined with any other offer. Mention this coupon. Plainville Only.

$

Grinders • Calzones • Dinners • Salad • Pasta Hot, Fresh and Delicious

LUNCH LUNCH SPECIALS: SPECIALS: + tx.

Cannot be combined with any other offer. Mention this coupon. Plainville Only.

OF SODA SODA ... ...$$$$$$3.99 3.99 22 SLICES SLICES CHEESE CHEESE PIZZA PIZZA && 11 CAN CAN OF $$$$$$ OF SODA SODA ... ... 5.99 5.99 ANY ANY GRINDER GRINDER WITH WITH 11 CAN CAN OF

Hours: Monday 11-8 pm; Tues. & Wed. 11-10 pm; Thurs.-Sat. 11-11 pm; Sun. 12 to 10 pm

$

$$$$$$

2 OFF

Any Purchase of $20 or More Cannot be combined with any other offer. Mention this coupon.

$

5 OFF

Any Purchase of $40 or More Cannot be combined with any other offer. Mention this coupon.

See Our Menu at www.ginospizzeriaplainville.webs.com


10

The Southington Citizen — Friday, January 22, 2010

Navy reservist granted probation

A Navy reservist from Stamford facing charges of threatening to burn down the Naval Reserve Center in Plainville was granted accelerated rehabilitation in Bristol Superior Court last week.

Helmut Stendbergh, 37, was granted the program on Jan. 4, according to the Bristol Superior Court clerk’s office. Accelerated rehabilitation allows someone with no criminal history the chance to be put on probation for two years; if there are no probation violations during

that time, the charges are dropped. Stendbergh was charged with first-degree threatening and second-degree breach of peace after being arrested Dec. 12 at the Holiday Inn on Laning Street. - Richie Rathsack

Read us on the Web: www.southingtoncitizen.com

Winter parking restrictions The following parking restrictions are currently in effect per the Town of Southington Code of Ordinances: From Nov. 15 to April 15, vehicles are not allowed to stand or park on any street in the town for more than one hour between the hours of midnight and 6 a.m. on any given day. (Sec. 12-72) The chief of police, or such other person as may be designated by him to act in his absence or incapacity,

Dinner For 2

of Southington

w/Bottle of Wine

$ 1144711

Annual Dinner

3990

Mon.-Sat. Includes soup or salad, vegetable, starch & coffee

“Fine dining in a casual atmosphere” OPEN FOR LUNCH M-F 11:30 AM-2 PM • DINNER SERVED M-S 5-9 PM 330 Main St. • Farmington, CT • 677-0149 www.silorestaurantct.com

to be held Tuesday, February 9, 2010 at the Aqua Turf

“Follow

may terminate street parking on any or all of the streets of the town during a snowstorm or other emergency. (Sec. 12-73) Any vehicle left parked upon the street which may be considered a detriment to snowplowing, snow removal or sanding, or any vehicle left parked upon the street in violation of any other provisions of this division may be removed by the police department at the expense of the owner of the vehicle for towing and storage. (Sec. 1274)

our Heart”

Kristi Josephson Licensed Insurance Agent 860.966.6169 kristi.josphson@insphereis.com www.insphereis.com/kristi.josephson

LIVE AUCTION ITEMS Autographed Jose Felicano Guitar

Call today for an appointment.

Boston Celtic Tickets

Biggest Savings of The Season on Carpet • Hardwood • Vinyl Laminate • Area Rugs Ceramic

ESPN Tour & Lunch Shopping Spree at Tops Supermarket 5 Course Dinner for Ten with Chef Patrick in your home

Buy with

For tickets, call the United Way Office

18 Months NO INTEREST**

860-628-4565

**Requires monthly payment. Details in Store. Offer ends soon.

♥ DINNER ♥ SERVICE AWARDS ♥ RAFFLES ♥ LIVE AUCTION ♥ SILENT AUCTION

1049 Queen St., Southington 747-0166 With You Every Step of the Way Serving the Area Since 1971

1144736

1141720

$55 PER PERSON

1144221

Myrtle Beach “Hootie & Blow Fish” Vacation

Affordable Life | Health | Retirement | Long-Term Care for Individuals and Families


11

Friday, January 22, 2010 — The Southington Citizen

REBATES & $ INCENTIVES FINANCING

CALL TOLL-FREE: 1-800-BUY-NISSAN

10,000! SAVE 10 000! 60 UP TO A TOTAL OF

$

OR

0

% UP TO

MONTHS!

APR WITH APPROVED CREDIT ON SELECT MODELS. $16.67 PER $1000 FINANCED

1 72 MONTHS! .9% FINANCING UP TO

APR WITH APPROVED CREDIT ON SELECT MODELS. $14.71 PER $1000 FINANCED

NO REASONABLE OFFER REFUSED! BRAND NEW 2010 DODGE

#210064

JOURNEY SE MSRP

,572 18 YOU SAVE 2593!

$

21,165

*

$

UP TO

ON SELECT MODELS WITH APPROVED CREDIT

ON REMAINING NEW 2009 NISSANS IN STOCK! OR

0

% FINANCING 72 MONTHS!

,992 19 YOU SAVE 1958!

$

BUY FOR

BUY FOR

19 MPG

BRAND NEW 2010 DODGE

EPA EST. HWY #210066

RAM 1500 QUAD CAB SLT*4X4 MSRP 27,715

$

BUY FOR

$

20 MPG

#210030

BRAND NEW 2010 CHRYSLER

TOWN & COUNTRY * MSRP

,696 25 YOU SAVE 4244!

$

29,940

MSRP: $22,830

17,950

EPA EST. HWY

155

$

LEASE PER MO. FOR 39 MOS.

NEW 2010 NISSAN

ROGUE AWD

24 MPG

EPA EST. HWY

$

MSRP: $22,780

19,350

BUY FOR

*

26 MPG

MODEL#22110 STK#N210032, N210031

BUY FOR

*

27 MPG

MODEL#13110 STK#N290259, N2906437

$

$

75

$

LEASE PER MO. FOR 39 MOS.

ALTIMA 2.5 S BUY FOR

EPA EST. HWY

EPA EST. HWY

NEW 2010 NISSAN

$

,

31 MPG

1143684

22 827 YOU SAVE 4888!

$

MSRP: $18,130

15,995

*

$

$13.89 PER $1000 FINANCED

MODEL#12210 STK#N21009, N210011

#210152

WRANGLER 4X4 $

UP TO

SENTRA

25 MPG EPAHWYEST.

BRAND NEW 2010 JEEP

MSRP $ 21,950

APR WITH APPROVED CREDIT ON SELECT MODELS

NEW 2010 NISSAN

BUY FOR

$

,

EPA EST. HWY

165

$

LEASE PER MO. FOR 39 MOS.

*

*Price includes all rebates and incentives to dealer. Does not include tax, tag or any other fees. 0% subject to GMAC financial approval. Cars subject to prior sale. Mileage claims based on EPA Highway estimates. Not responsible for typographical errors. Offersexpiredateofpublication.

*39 month lease with $2999 due at inception plus tax, tag and fees with approved credit. All leases Include $500 college rebate. 12k miles per year. 15¢ per mile therafter. Price plus tax, tag and title. Vehicles subject to lender approval thru Nissan Financial Services Co. All rebates and incentives assigned to dealer. Offers expire date of publication. Mileage claims based on EPA Highway estimates. Not responsible for typographical errors. #27616-CRAG

1461 FARMINGTON AVE.•ROUTE 6•BRISTOL

1451 FARMINGTON AVE.•ROUTE 6•BRISTOL

EXIT 38 OFF I-84, STRAIGHT AHEAD ON ROUTE 6 SALE HOURS MON-THURS 9AM-9PM•FRI & SAT 9AM-6PM•SUN 11AM-4PM CLICK ON, COME BUY AT

CALL TOLL FREE: 1-888-309-0536

EXIT 38 OFF I-84, STRAIGHT AHEAD ON ROUTE 6 SALE HOURS MON-THURS 9AM-9PM•FRI & SAT 9AM-6PM•SUN 11AM-4PM CLICK ON, COME BUY AT

CALL TOLL FREE: 1-888-310-3760


12

The Southington Citizen — Friday, January 22, 2010

King Continued from page 4 cent of success is just showing up,” Strosahl said, quoting Woody Allen. “Ask ‘if you are not with us, are you against us?’” “Fourteen years ago, I was on the town council. At that point there were about 3 percent non-whites in our community,” said the Rev. Victo-

ria Triano, one of the speakers. “It is about the same now,” she said, noting that demographics have not changed in town, nor has community involvement in the event. Strosahl addressed this year’s theme, “Chains bind us, ties free us.” King was one who broke the legal and social chains of society, Strosahl said. However, the chains of society still bind the country, he said. When

DR. HORNBECK, MD ACCEPTING

Barack Obama first came on the political scene, “It was said we are now a post-racial society,” Strosahl said, adding it is now evident that is not the case. He referred to the book of Genesis in the Bible where it is written that humankind was created in God’s image. “What image does God have?” Strosahl asked. “We are male/female; red, yellow, black and white; gay/straight.” The nation is

at its best as a collective people, he said. “If we live that out, that is our creed.” Also speaking at the event was Manmohan Singh Bharara, representing the Gurdwara Guru Nanak Dabar Sikh Congregation located on West Street. Musicians from the congregation played a selection explained as “musical worship.” Amarjeet Dargan translated it as See King, page 17

LIFETIME$ BRAKE PADS 99 69

W O NEW PATIENTS N

per axle

Install pad and resurface rotors. Semi-metallic pads extra. $89.99 Most cars. One coupon per customer. Expires 2/28/10.

Family Practice 945 Queen St. Southington, CT

CATALYTIC CONVERTERS

149

$

TIMING BELTS

1140428

˜ Se Habla Espanol

99

25 OFF

1144710

860-628-8054

39

$

99

Most vehicles. One coupon per customer. Exp. 2/28/10.

OIL CHANGE

$

Most Cars. With coupon only. Not valid with any other offer. Expires 2/28/10.

STOP IN TODAY!

COOLANT SERVICE ✔ Radiator Flush ✔ Free 15 Point Inspection

& 21 POINT INSPECTION

17

$

99 Exxon

Motor Oil

Up to 5 quarts oil, lube and filter, plus $1.99 environmental fee.

Most cars. One coupon per customer. Expires 2/28/10.

CV AXLES $

14999

Citizen photos by Robin Lee Michel

Musicians from the Gurdwara Guru Nanak Dabar Sikh Congregation perform a musical form of worship and prayer.

Installed

Engine Tune-Up $ & Emission 4999 ✓✓ Fuel New Spark Plugs $ Timing, Carb & Idle 5999 ✓ Set Speed $ 6999

Got sports?

4 cyl.

6 cyl.

8 cyl.

Diagnostics Additional

Most Cars. With coupon only. Expires 2/28/10.

For a Service appointment, call (860) 793-0505 1217 Queen St., Southington/Plainville

The Southington Citizen 40 N. Main St. Southington, CT 06489 sports@ thesouthingtoncitizen.com

Pagliacci’s Restaurant The sweetest valentines are at

Authentic Italian Home Style Cooking

Thompson Chocolate

Interior Painting

Factory Retail Store

• Water Damage Repair • Free E FREEstimates IMATES Estimates • All ESTWritten Matched or Beaten! • Veteran/Senior Citizen Discounts

80 South Vine Street, Meriden, CT 06451

(203) 235-2541, ext 153 Directions: South Vine Street is located between Hunter’s Ambulance and McDonald’s off of West Main Street

Homemade Italian Specialties & American Cuisine PARTY TRAYS TO GO

Lic. & Insured CT Lic. #574427

- All Work Guaranteed -

$AVE NOW! 1144191

860-793-9241

1138308

Open 11am - 10pm Mon-Sat Sunday 12-10pm

Reg. $6.50 Foiled Chocolate Hearts • Gifts for chocolate lovers Pecan Bark • Sugar Free Novelties Gifts & Much, Much More FRESH MADE FUDGE HOLIDAY FUDGE DIPPED MARSHMALLOW POPS

MAZZA PAINTING 860-416-2980

1144429

DAILY LUNCH & DINNER SPECIALS

We Ship Nationwide Business Hours: M, T, W & F 9 am - 5 pm; Thursday 9 am - 6 pm 02/08/2010 - 02/13/2010: 2/8 - 2/10: 9 am - 5 pm; 2/11 - 2/12: 9 am - 6 pm 2/13: 9 am - 5 pm Feature Item of the Month: Milk Chocolate Foiled Hearts $5.85 (1 lb) Bag

MIMS OIL

Senior Citizen Discount Everyday 10%

Call for Current Price

COUPON:

Fuel Assistance Available

5% OFF $25.00 or more purchases

333 EAST STREET • ROUTE 10 • PLAINVILLE

(Expires 02/13/2010)

View our Menu & Daily Specials at www.pagliaccisrestaurant.com

10% OFF $50.00 or more purchases (Expires 02/13/2010)

(203) 238-7512 1143768

~ Gift Certificates Available ~

H.O.D. 7

www.mimsoil.com


13

Friday, January 22, 2010 — The Southington Citizen

JOB LOT

Ocean State Ames True Temper Heavyduty Pooper Scooper

Vitamin® Shampoo & Conditioner

Long handled - unique raking arm for easy pick-up Durable steel construction

Hand Warmers 2 Pack or Single Body Warmer Comp. $2.97

No sulfates, paraben free

Comp. $ 7

Comp. $ 30

1

$

3

$

10

$

40% OFF

7

249

25 lbs Thistle Comp. $30 - $45

8

22

Single Tube Comp. $19.97

10

Comp. $2.50

Commercial Type II Work Platform

1

Two styles to choose from: All purpose sunflower/mixed seed or thistle seed finch feeder

Gazebo Feeder

All purpose sunflower or mixed seed feeder

5

$

3

16"x10"...12.99 20"x16"...14.99 24"x20"...19.99

1144149

20 12

Designed to reduce back strain

$

18” Poly Snow Shovel......

4 $ 16

Ice & Snow Melter 20 Lb Blend Melts up to -15ºF

50 Lb Calcium Chloride Ice Melter Melts up to -25ºF

B.

A.

C.

A. 54” Extendable Pivoting Snow Broom •Snowbrush, ice scraper & squeegee all in one tool! •Folds flat for storage B. 42” Extendable Snowbroom with Ice Chisel® Scraper

8

$

10

OR

C. 48” Extendable Snowbroom & Ice Scraper

Ice Scraper

2’ 3’ 4’ 5’ 6’ 9’

x x x x x x

1

$

Flannel Sheet Sets All sizes

59

$

Racing wheel; baseball bat; golf club; shooter gun; tennis racket

Your Choice:

5

$

WE RARELY LIMIT QUANTITIES!

15

$

Like Seen On

TV

Comp. $25

Irons

C.

Microfiber Sheet Set

Solid Color 300 Thread Count Sheet Sets

Twin........$10

Twin.........$15

Full..........$14

Full...........$18

Queen ....$16

Queen.....$20

King........$18

King.........$20

Twin/Full Comp. $50

Full................$7

25 $30

100% Synthetic

Coral Fleece Throws

4

$

Twin.............................$15 Full/Queen .................$18 King.............................$20

28”x28” Square Euro Pillow Comp. $8

4

$

Zippered 2 Pk Pillow Protectors Standard..................$4 Queen......................$5 King.........................$6

Comp. $300

70

$ 6 4 Hand Towels 139

Memory Foam Toppers That Actually Work!

Bath Towels 99

Finger Tips Our Reg. $1

75¢

Wash Cloths Our Reg. $1

75¢

Upholstery Fabrics

From America’s finest mills!

4 lb. Memory ⁄ ” Thick Foam 2 12

•Steam cleans with 1000 watts of power •No soap/chemicals required •Sanitizes all hard surfaces

Comp. $79

49

$

75

3 to 4 square yard cuts

80 Ct. 4 in 1 Disinfectant Wipes

2 in 1 Pack 32 oz Toilet Bowl Cleaner

399

219

6

Per cut

LOOK FOR MANAGER’S UNADVERTISED SPECIALS IN ALL OUR STORES EVERY WEEK!

Visit www.oceanstatejoblot.com for store locations & hours SIGN UP TO RECEIVE AN ADVANCED COPY OF OUR WEEKLY AD & INTERNET COUPONS

Lysol®

Lysol®

$

$

199

799

$

Full - 53"x75" ............... 100 $ Queen - 60"x80" ........ 125 $ King - 76"x80"............. 150

1 Gallon All Purpose Bleach

Complete 2 in 1 Pack 100 oz Concentrated Detergent

Most fabrics regularly $20 - $60 per yard

Twin 38"x75" An inch or two of low grade memory foam may be cheap - but it does not work!

SteamFast® Electric Steam Mop

Woolite®

All White Goose Down Comforters

Super soft plush microfiber

A. Sunbeam Steam Master.........................$20 B. Sunbeam Drip Free...................................$25 C. Black & Decker w/ Auto Clean.............$30

Coral Fleece Blankets

Queen/King Comp. $60

$

Queen .......$10

Bath Sheets 99

Standard Chindi

21”x34”.......Comp. $6......$3 27”x55”.......Comp. $10....$5 27”x48”.......Comp. $10....$5 27”x94”.......Comp. $18....$8 28”x78”.......Comp. $16....$8 55”x79”.......Comp. $30....$10

Luxurious Lambs Wool Blankets

Twin .............$5

King ..........$10

B. Heavyweight Chindi

Regal Collection - cotton rich, assorted colors

Set

Bath Towels

Wii Sports

Quick Fabric Steamer

Chindi Rug Closeout!

220 Thread Count Sheet Sets

15

6

2

Tobi®

Steamer For Clothes

A.

$

50

$

5

$

1 oz

Tobi®

$

6’ ....................Our Reg $7 ..........Now $5.25 5’ ....................Our Reg $12 ........Now $9.00 6’ ....................Our Reg $18 ......Now $13.50 8’ Area Rug ....Our Reg $30 ......Now $22.50 9’ Area Rug ....Our Reg $40 ......Now $30.00 12’ Area Rug ..Our Reg $80-$90 ....Now $60-$67.50

Your Choice

Snow Brush & Ice Scraper

18 oz

Comp. $10

10

• Type II 225 lb rating Comp. $70

$

Emergency Car Shovel •Extendable handle saves space

$

8

$

Skin Relief Body Wash

$

Lite Solutions® 2 Step Stool

20

Aveeno®

Night Anti-wrinkle Moisturizing Treatment Comp. $22

Choose from berber, residential, commercial and plush

$

18” Poly Snow Shovel with Built-in Wear-Strip

6

$

Roc®

All Cut & Bound Rugs 18” Snowdozer® Shovel

10

24

25% OFF Our Reg Price

Values to $59.99

Comp. $12

$

Simplicity 3 Step Folding $ Step Stool Comp. $45........

20

1.7 oz

Comp. $20

30

$

32"x28"...27.99 36"x32" 29.99

Nivea Visage®

Q 10 Advanced Wrinkle Reducer Night Creme

1.7 oz

$

• 200 lb capacity Comp. $35

28"x24"...26.99

Aveeno®

Positively Radiant Anti-wrinkle Cream

Comp. $70

Cosco® Big StepTM Folding Step Stool

Oval Faux Suede with Piping

299-499

• Top step brace for stability • 225 lb work load

40

$

Comp. $7.95 - $13.95

7

$

Your Choice

Choose from blush, concealers, wrinkle therapy, face makeup & more!

SimplicityTM 3 Step with Folding Utility Tray Step Stool

• 225 lb rating • 3 extra wide slip resistant steps • Folding utility tray with tool holder Comp. $107

Tube Feeders

30

Physicians Formula® Cosmetics

$

Save on Cosco Step Stools

$

$5

Real Chef’s Coat..........

Comp. $24 ea. pc. Your Choice

5

$

5

$

• 1/4 Zip Top • Pull on Pant • 100% polyester

$

7

SquirrelProof Bird Feeder

Comp. $ 20

Mens Microfleece Separates

Comp. $10 - $24 Your Choice

Heavyweight Basic Crews or Sweatpants Comp. $25

Slight irregulars

The irregularity in the pants won’t effect the quality of your cooking

4

100% cotton flannel or knit

10

$

Real Chef’s Pants

$

Mens & Ladies Dorm Pants

$

$

Your Choice 20 Lb Country Mix.....................$7

Finches cling to the woven nylon netting

4

$

Double ply hood Comp. $30

JUST ARRIVED!

tanks - crews pants & nite shirts Comp. $7-$9 Your Choice

Your Choice

Pull-over Hoods

(Contains 60% Sunflower)

Thistle Seed Sack Feeder

• Crew neck top pull-on pant • Mix, match & coordinate

Famous Maker Heavyweight Sweats

Comp. $35

Hanes® Organic Sleep Separates

Fruit of the Loom® Sweats

4

50 lbs Black Sunflower 40 lbs Signature Blend

7

$

7

$

Premium Quality Mens Full Zip Heavyweight Hooded Sweatshirt

100% polyester microfleece

$

Comp. $10 NEWLY ARRIVED!

99

2

Comp. $20 Your Choice

100% cotton Lots of colors!

If perfect $7 Wolverine 2 Pks

$

100% polyester - 1x-3x Comp. $15

National Retailer Ladies Thermal Ts

Browning Wool & Cotton Blends

Bird Feeder EZ Fill Scoop

Ladies WinterFleece Separates

$

Mens Heavyweight Thermal Socks

4

Ladies Fleece Tops Embellished 1/2 zip microfleece

Comp. $20

*Mfg. Suggested Retails

If perfect $12.99

Just My Size®

Super soft & comfortable cotton knit 3/4 & long sleeves

*

3

50

4.1 oz

Comp. $4.89

Famous Mall Store Closeout! Ladies Better Tops

2010 Flower & Vegetable Seeds

STORE HOURS! Mon-Sat 8am-9pm; Sun 9am-8pm Sale Dates: Thurs. Jan. 21 - Wed. Jan. 27, 2010

Crest Sensitivity Max Strength Whitening Mint Toothpaste

Insulated Roman Shades 27” to 38 ”x 64” Long

Available in ivory, navy, chocolate & khaki

1999

Meets all consumer product safety conditions We now accept Cash Benefit EBT Cards

R

We accept A M E R I C A N E X P R E S S ® CARDS


14

The Southington Citizen — Friday, January 22, 2010

FLOOR SAMPLE KIDS BED SALE! TAKE 20% OFF •BUNK BEDS •STUDENT DESK •TRUNDLE BED •6 DR. DRESSER

•BOOKCASE BED •PLATFORM BEDS •CAPTAINS BED •5 DR. TALL CHEST

ALL ARE ONE-OF-A-KIND FLOOR SAMPLES. SOLD STRICTLY FIRST COME - NO REORDERS. SALE LIMITED TO DESIGNATED FLOOR SAMPLES ONLY.

FINDERS KEEPERS

FURNITURE CONSIGNMENT

Grants support local groups The Community Foundation of Greater New Britain ended 2009 by awarding $146,225 in grants to nonprofits in Berlin, New Britain, Plainville and Southington. Funding traditionally supports a wide variety of programs and initiatives in arts and humanities, community and economic development, early childhood development, education and health and human services. Individuals, families, organizations and business groups can establish funds at the community foundation based on their philanthropic interests and goals. Discre-

1230 Queen St. (Rt. 10), Southington • 793-0676

Starting at $3,599.00

Armstrong Warm-Air Furnace Starting at $2,999.00

Call to Schedule Your Cleaning Today

C.F.

Family Owned and Operated

il Co.

Full Service Contracts

Inc.

1139282

1144718

Utica Boiler

A limited hours store - Closed Mon. & Tues. Open Wed.-Thurs.-Fri. 12-5, Sat. 10-5, Sun. 12-4

tionary funds are administered by the community foundation’s board of directors to meet the changing needs of our communities. Donor-advised funds support a donor’s current interests, with direct participation in the grantmaking process. Grants to Southington organizations include: — $2,000 for Southington Town Wide Effort to Promote Success, or STEPS, to hire a grant writer to renew its $125,000 annual federal Drug Free Community grant. — $10,000 for the creation of a mobile CT Center for Healthy Aging by Central Connecticut Senior Health Services. — $2,560 for the family re-

Heating Oil

Call For Lowest Price Price subject to change without notice 150 gal. minimum • C.O.D.

225-8545 Visit us at www.cfoilco.com

(CT Lic. - 391408) HOD #518

FREE ESTIMATES

source center at the Early Childhood Collaborative of Southington. — $1,500 for the Hospital of Central Connecticut for operating costs. This round of grants includes a special initiative of the community foundation in support of Foodshare and its affiliated local food pantries, which are experiencing significantly greater demand in this time of economic stress. In researching the need for such a grant, the community foundation learned that Foodshare is seeing a 30-percent increase in requests for food, with many new clients who are unemployed middleincome families. The Community Foundation will provide a total of $28,985 from the A.W. Stanley Discretionary Fund to Foodshare’s Helping Hand program. The grant will provide $20,000 for direct aid to the local food pantries and another $8,985 to support the administrative costs of expanding the Helping Hand program in the four towns. “Not surprisingly, the providers we spoke with uniSee Grants, page 27

NEW! FULL DAY PRE-K PROGRAM PRE-K THRU 5TH GRADE • • • • • • •

All Day Kindergarten Faith Based and Academically Rigorous Curriculum Smart Boards® In all classes P. E., Art, Music, Spanish Hot Lunch Program Before and After Care Programs Extracurricular Activities * Student Council * Chorus * Lego Club * Writing Club * Drama Club * Science Club * Intramural Sports • Summer Enrichment Program • Financial Aid Available for K-5 students

GO!

1144502

1144379

OPEN HOUSE SUNDAY, JANUARY 31, 2010 • 12:30 P.M. 1050 FLANDERS ROAD SOUTHINGTON, CT 06489 860-628-4678 www.saintdominicschoolct.org

Fully Accredited By The New England Association of Schools and Colleges


15

Friday, January 22, 2010 — The Southington Citizen

1141914

The Best In Child Care A Parent’s Guide for • Day Care • Nursery School • Before & After School Care School News SHS Wall of Honor

Two kindergarten informational sessions for parents of children entering kindergarten during the 2010-11 school year have been scheduled. The first session will be

Village Green registration Village Green Nursery School, 37 Main St., Southington, has scheduled registration for the 2010-11 school year Saturday, Jan. 23,

Over 20 Years Service

from 9 to 10 a.m., in the Memorial Hall of First Congregational Church. Snow date will be Monday, Jan. 25, from 6 to 7 p.m. Village Green offers morning and afternoon 3-year-old and 4-year-old programs. For more information about the program, visit the Web site www.firstchurch-

PENNY’S

PLAYGROUND

19 Pine Street Plainville, CT

1721 Meriden-Waterbury Tpke. Milldale, CT

860-747-0157

860-621-1252

www.pennysplayground.com We provide Superior Quality & Developmental Program Monday-Friday 6:30 A.M. to 6:00 P.M. State Licensed Childcare Center

Now Accepting Applications

See Schools, page 21

Infant/Toddler Program, Nursery and Preschool Program, Medication Administration Hot Lunch and Snacks Secured Buildings Ages 6 Weeks8 Years

EDUCATION WITH LOVE MON - FRI 6:30 AM - 6:00 PM Ages 6 Weeks - 6 Years Old

Secured Entrances - Programs Monitored by Cameras Developmentally Appropriate Curriculum

860-628-5524 1593 Meriden-Waterbury Tpke. Southington, CT www.cheshirecountrydayschool.org ccds@conversent.net

Can/bottle drive benefits team A can and bottle drive, sponsored by the Southington High School Swim and Dive Team, will be held Sat-

1144002

Kindergarten info sessions

urday, Feb. 13, from 8 a.m. to 2 p.m., in the high school auditorium. All proceeds benefit the team.

1142977

The Southington High School Wall of Honor selection committee is now taking nominations for the Wall. Nominees must be Southington High graduates who have done outstanding community service, received significant awards, done extraordinary humanitarian work or achieved noteworthy lifetime achievements. Forms can be obtained from the SHS Web site, from the main office of the high school, or by contacting Bob Brown at the high school, (860) 621-0416 or Chopin7777@aol.com. Nominations must be received by April 1.

held Wednesday, Jan. 27, from 6:30 to 7:30 p.m., for parents whose children will attend Flanders, Hatton, Plantsville, South End and Thalberg schools. The second will be held Monday, Feb. 1, from 6:30 to 7:30 p.m., for children who will attend Derynoski, Kelley and Strong schools. Both sessions will be held in the Derynoski School auditorium, 240 Main St. If unable to attend the designated school session, parents may attend the other session. Parents will receive a packet containing registration information and forms, and orientation information. In addition, Howard Thiery, assistant superintendent, school principals and teachers will be available to answer questions.

A fun and educational experience that prepares your child for SCHOOL AND BEYOND! Enrolling Now for All Programs

1143509

Some of the reasonS the YMCA is one of the best

15-17 Cooke St. 195 East St. www.greatbeginningsdaycarecenter.com Plainville

(860) 747-1679

Register at:

Plantsville Community Nurser y School

Creative Child Nursery School Half Day Pre-K Preschool Kinderpals After School Club Y (Middle School)

109 Church St., Plantsville, CT 06479 860-628-8878 Tuesday-Thursday morning

1143677

3 year old class:

• Professional Staff with college degrees in Early Ed, Child Development or related fields • State Licensed Program • Clean and Secure Facility • In line with CT Preschool Curriculum Framework • Creative Curriculum for Preschoolers • Building School Readiness Skills • Water Safety & Swimming for most 4-year-olds With more than 150 years of experience, the YMCA builds strong kids, strong families and strong communities

Free YMCA Family Membership for every M-F full-time Preschool and All Day Kinderpals enrollment Schedule Option! $1,00200 Value!

1144633

4 year old class:

If you have questions or would like to stop by for a tour, please call the YMCA Learning Center.

Mon.-Wed.-Fri. AM or PM classes

YMCA Learning Center - A program center of the Southington-Cheshire Community YMCAs 30 High Street • Southington CT 06489 860 621-8130 • www.southington-cheshireymca.org

$5 OFF With this Ad

Financial Assistance available to qualified individuals. The YMCA is a not for profit 501(c)3 organization.


16

The Southington Citizen — Friday, January 22, 2010

1144738

BRIDAL GUIDE 2 0 10

Engagement, wedding, baby, anniversary? Send us your celebrations!

Papayani-Szabo

U.S. mail: The Southington Citizen 40 N. Main St. Southington, CT 06489 E-mail: news @southingtoncitizen.com

Wedding Party Discounts Available Look Great on Your Wedding Day!

$10 OFF 20% OFF Any purchase of $50 or more Cannot be combined with any other offer. Exp. 2/28/10.

Tanning Packages Cannot be combined with any other offer. Exp. 2/28/10.

855 Queen Street, Southington, CT 06489 www.hottans.net

1143117

860-621-4422

7 KH )ORZHU *LUO :('',1*6+2:&$6( O

U

L

*

U

H

Z

R

O

)

H

K

UGDQQXDO

7

Spartan II

-DQXDU\ 

Restaurant & Lounge

DPSP

Italian-American Cuisine

)HDWXULQJDOOQHZGHVLJQV IRU

Having An Affair?

)

Weddings • Bridal Showers

H

D

W

X

U

L

Q

J

D

I

O

R

O

U

Q



H



Let Us Plan Your Special Occasion. We seat up to 80 people Great Food! Private Banquet Room Accommodating Small & Medium Size Events

Z



G

H

V

L

J

Q

%RXTXHWV &RUVDJHV %RXWRQQLHUHV &HQWHUSLHFHV PRUH

Full liquor license

6SHFLDO*XHVW ³'D\WR5HPHPEHU(YHQWV´ 3ODQQLQJ6HUYLFHV 6

Âł

'

D

\

W

3

1144608

860-276-0090

1144796

930 Meriden-Waterbury Rd., Rt. 322, Southington (Across from IGA)

V



S

R

O

H

F

5

D

Q

H

Q

L

P

D

O

H

L

Q

*

X

P

J

H

E

6

H

V

H

U

W

U

Y

(

L

F

Y

H

H

Q

W

V

´

V

/RFDWHGDW

7KH*DUGHQ3DWK)ORULVW

6KXWWOH0HDGRZ5G6RXWKLQJWRQ



Christine and Joseph Szabo, of Southington, announce the marriage of their son Christopher Joseph, to Kathryn Angela Papayani, daughter of Mr. and Mrs. John Papayani of Great River on Long Island, N.Y. The two were wed on Long Island on Sept. 7, 2009, with a reception at Port Jefferson Country Club. They met while getting their undergraduate degrees at Fairfield University. Szabo went on to University of Connecticut Medical School while Papayani got her doctorate from Simmons College. The bride is employed by Falcon Physical Therapy in Colorado Springs, Colo. The bridegroom’s employer is the United States Air Force. The couple was attended by sister of the bride, Connie Zelenka, Long Island; sister of the groom, Erika Simons, Southington; friend of the couple, Jennifer Talon, Southington; best man, Jeffrey Wu, Southington; cousin of the groom, Owen Szabo, California; and brother of the bride, John Papayani, Long Island. Niece of the groom, Monique Szabo, was a junior bridesmaid and nephew of the groom, Mason Simons, was the ringbearer. The two currently reside in Colorado Springs, Colo.


17

Friday, January 22, 2010 — The Southington Citizen 1144738

BRIDAL GUIDE 2 0 10

the daughter of Joseph and the time. Organizers felt Karen Gee. then and now the town needThey each received a ed a program to motivate and Continued from page 12 plaque and Obama’s memoir, keep King’s legacy and mis“Dreams from my Father: A sion alive. This year, about 75 “God is one, we are the chil- Story of Race and Inheri- people attended; in some predren of one God.” tance.” vious years, numbers have As is traditional at the The Martin Luther King been more than 100 people. King event, two middle Jr. community event was “This is not the time for school students were recog- started 14 years ago by our generation to be deaf but nized for their contributions Strosahl and other members time for our generation to to their schools and the com- of the First Baptist Church, heed the call,” Strosahl conmunity. This year’s recipi- where he was the pastor at cluded. ents were Michaela Gee from John F. Kennedy Middle School and Tyler Bard from Joseph A. DePaolo Middle School. Both students said they were caught by surprise when school administrators notified them several weeks ago about the award. They both have also won numerous academic awards from their respective schools. “Michaela possesses a deep respect for others and herself ... She is keenly aware of the world around her,” • Convenient personalized booking for your guests school officials wrote in a let- • Exclusive shuttle service available ALSO: ter. “Michaela also has a • Complimentary Express Start Breakfast Call our Sales Department for strong moral belief as to • Free High Speed Internet Access Special Group Rates what is clearly right and 860.276.0736 wrong. It is clear to see that 120 Laning Street, Southington, CT 06489 Michaela possesses many of www.hiexpress.com/southingtonct Rehearsal dinners and post wedding private breakfast up to 80 people! the character strengths that were part of Dr. King’s greatness.” Tyler, who has been active in his school’s leadership program and drama club as well as in the community, Celebrate with us and have the Party of a lifetime! said he likes helping others Great Food, Great Service at Affordable Prices and being a leader. He is the son of Jim and Debi Bard. • howers • ehearsal Dinners Michaela said, “I like to get • edding Receptions • ll Occasion Parties involved with the community and helping people out. Join Us For That’s just how I feel.” She is Banquet Facility Valentine’s Day Call for Available Reservations! ★ SINCE 1946 ★

King

Contact us at ... 40 N. Main St. Southington, CT 06489 phone (860) 620-5962 news@southingtoncitizen.com

The Southington

Citizen Your Town, Your News

Convenient Location Let Our Family Take Care of Yours!

1144697

For that Very Special Event S W

R A

Capri Ristorante

860-747-9500 www.Ireneslingerie.com

1144214

21 Whiting St.

Downtown Plainville

1144727

• Bras & Girdles • Bustieres • Bridal Peignoirs • Sexy Lingerie • Free Fittings • Plus Sizes

Express Lunch Daily $

750+ tax

161 Woodford Ave., Plainville

747-1778 Open Tues.-Sat. 11-10; Sun. 12-9 Serving Lunch & Dinner

1144793

FULL BAR

Treat your bridal party to a manicure, pedicure and nails design. Enjoy a complimentary photograph with your bridal party before your special day. Please call to book your party and receive a 10% off.

(860) 426-9446 2211 Meriden Waterbury Rd. Southington, CT


18

The Southington Citizen — Friday, January 22, 2010

1144738

BRIDAL GUIDE 2 0 10 Newcomers group crowns top pizza

1144621

Buy a $50 Gift Card, Get a $10 Gift Card

Free!!* *Valid thru 2/14/10. Cannot be combined with any other offer.

860-747-2777

27 West Main St., Plainville, CT

What’s the first thing you want to know when you move to a new neighborhood? Who has the best Pizza. On Saturday, Jan. 9, the Southington Newcomers and Neighbors social group decided they would try to answer that question for the town of Southington by holding a pizza delivery taste off. Families from all over Southington participated in the contest in-

Planning a Wedding Event? PLAINVILLE TAYLOR RENTAL HAS IT ALL ...

Do You Need? • Tents • Decorative Accessories • Plant Stands • Pillars • China, Flatware, Glassware • Linens • Chairs • Tables • Etc.

cluding children. As any parent knows: if the kids don’t like it, we aren’t ordering it. Families were asked to select their favorite pizza delivery restaurant prior to the actual event. Once selections were made families were given the rules for the competition: 1. Each family must order a pie. The pies must be ordered from and delivered to a designated address. 2. The family that orders the pie must tip $3. This amount must be added to the cost of the pie. 3. Everyone must call their restaurant at the same time from their cell phone. 4. You must order the largest cheese pizza the

Have You Considered a Tent for a Shower, Rehearsal Dinner, Wedding or After Party? Mon.-Sat. 7:30am-5:00pm Email: taylorrentalsw@aol.com www.tayler-rentals.com

See Pizza, page 32

They Do!

We’re more than just products at work • 346 EAST ST. (Rte. 10), PLAINVILLE, CT

Give your pets the honeymoon they deserve, at Paws Pet Resort & Spa!

1144806

YOU ARE CORDIALLY INVITED TO ATTEND OUR 4TH ANNUAL

312 E. Johnson Ave., Cheshire

203-250-PAWS (7297) www.pawspet.com

Luxury Suites s Overnight and Day Boarding s Play School sCattery sGrooming s And More!

22 Center Street Downtown Southington

ON SUNDAY, FEBRUARY 21, 2010 11:00 A.M. UNTIL 3:00 P.M.

1144926

Wedding Extravaganza

Phone: 860-621-4777 Email: brabis@evacationcenter.com

The Lily Lake

Every Couple is a Winner when using The Vacation Center

66 CENTRAL AVENUE WOLCOTT, CONNECTICUT (203) 879-7000 WWW.LILYLAKEINN.COM

• Free Personalized Service • Evening & Weekend Appointments • Free Registry Service • Destination Weddings • Memories to last a lifetime

Tahiti - Hawaii - Europe - Caribbean & More No Worries ...... Leave the Details to us

FEATURING A SELECT GROUP OF WEDDING VENDORS, DOOR PRIZES, HORS D’OEUVRES AND FREE ADMISSION JOIN US FOR WHAT WILL BE AN ENJOYABLE AFTERNOON IN OUR TWO ELEGANT BANQUET ROOMS! 1143189

SNOW DATE, MARCH 14, 2010

excluded from the final tally. 11. Each pie will be ranked in each category on a scale of 1 to 10. High score wins. The objective of the tasteoff was to see which restaurant delivered the best tasting hot pizza in the least amount of time. Restaurants were judged on cheese, sauce, crust, overall taste and overall value. When the final tally was calculated the overall winner was Townline Pizza. Here’s a list of all the other category winners: — Best Overall Pizza: Townline — Most Cheese and Tastiest Cheese: Townline

Who wants to be treated like royalty?

1144606

860-747-6073

restaurant has on the menu. Some restaurants will call this large or extra large. The key is to order the largest available. 5. No other toppings (including extra cheese) are permitted. 6. You cannot tell the restaurant you are in a contest. 7. Pies must be served upon arrival. 8. A delivery more than 1 hour after the order is placed results in disqualification. 9. At least one member of each family must participate in the judging. All family members are encouraged to participate. 10. Scores from judges that don’t taste every pie will be

Honeymoon & Anniversary Show

Date: Thursday, March 4 Time: 6 & 8 pm Place: Machiavelli’s Restaurant 75 Center Street Southington, CT RSVP (space is limited) call 860-621-4777


19

Friday, January 22, 2010 — The Southington Citizen 1144738

BRIDAL GUIDE 2 0 10

DePaolo Continued from page 8

ance. Adam is the son of Brian Whitford and Holly Whitford and also has done extremely well in his unified arts classes. His teachers have seen a tremendous change in classroom achievements from last year to this year. Adam is able to complete his assignments with greater ease and has really progressed well in class. He is always willing to participate in class discussions. Damiaen is the son of Lance and Patricia Florian and has exceptional keyboarding skills. He does very well on the computer, especially with Word, Excel and Powerpoint. Damiaen plays football and AAU basketball.

Full Service Catering Specializing in Custom Design Menus and Themes

Attention to Every Detail

Create Your Own Wedding Menu with Chef Paul Gregory 148 Center Street, Southington Ph. 860.621.9999 Fx. 860.621.9989

www.paulgregorys.com

1144809

Experience CT’s Leading One Stop

Complete Wedding Planners Let Us Take Care of All Your Wedding Day Needs

Full Service Bridal Source-

1143996

RESTAURANT & BANQUET FACILITIES 1636 Meriden-Wtby. Rd., Milldale ♼ 860.628.9877

www.ManorInnRestaurant.com

Featuring a Vast Rental Inventory, Personalized Wedding Gifts & Decor and a Full Service In-House Florist! t'SBNF5FOUT$BOPQJFT t-JOFOT/BQLJOT t5BCMFTBOE$IBJST t$IBĂśOH%JTIFT t4FSWJOH1JFDFT

t1VODI#PXMT'PVOUBJOT t$IPDPMBUF'PVOUBJOT t$IJOB(MBTTXBSF t%BODF'MPPST4UBHJOH t$PPLJOH&RVJQNFOU

t"SDIFT(B[FCPT t$FOUFSQJFDFT t8FEEJOH"DDFOUT t$BSE)PMEFST t*NQSJOUFE'BWPST

Mention This Ad and Receive 10% Off Your Order at Our In-House, Full Service Florist!*

Wedding Package Prices starting at

4395

$ FREE Professional On-Site Consultations Available at EVENTS!

A Dream Wedding for Every Budget! *Limited Time Offer. See Store for Details.

1144079

for the Southington Lightning travel team and plays flute in the DePaolo band. In seventh grade, Vedant Vyas, Emily Lippincott and Vanessa Kleinhen were selected by their teams. Vedant is the daughter of Hemant and Payal Vyas and has been an honor roll student in sixth and seventh grade. Vedant participated in the annual India Association of Greater Hartford Diwali Program. Vedant also plays soccer for the town and swims at the YMCA. Emily is the daughter of Anne and Thomas Lippincott and is a member of the National Junior Honor Society. She has volunteered at Bread for Life and is a Masonicare and Jerome Home visitor. At school, Emily is also a peer advocate and a part of the leadership program. Vanessa is the daughter of Sharon and Brian Kleinhen and made the honor roll throughout sixth and seventh grade. She has helped out with the school food drive and was on the school cross country team. Vanessa also sings in the school chorus. In eighth grade, Alessandra Melluzzo, JoAnna Gendreau and Jessica Bocek were selected by their teams. Alesandra is the daughter of JoAnn and Sal Melluzzo and is an honor roll student. She is going to visit a nursing home along with her dance team. Alesandra is in the leadership program and is interested in participating in the school talent show this year. JoAnna is the daughter of Pamela and David Gendreau and has consistently been an honor roll student in middle school. She is also in the leadership program and played on the school volleyball team. Outside of school, JoAnna takes dance class at Center Stage and plays softball for the town. Jessica is the daughter of Brian and

Filomena Bocek and is a high honors student. Jessica assisted with the field clean up at Panthorn Park and volunteered for Alex’s Lemonade Stand. She also plays soccer and softball. In Unified Arts, Kevin Byrnes, Adam Whitford and Damiaen Florian were selected. Kevin is the son of Eileen and Mark Byrnes and often helps out his peers in class if they are struggling with a topic. He does extremely well in unified arts classes and quickly understands his assignments and completes them above and beyond what is expected. He also is able to complete the more challenging aspects with little or no extra guid-

20 Putnam Place (Off Rte. 322, Southington) Cheshire, CT $BMM  rXXXEventsBySuperior.com

Per Person Includes: •Sit Down or Buffet •Custom Wedding Cake •Floral Arrangements •Assorted Cheese & Pepperoni •Asti or Champagne Toast •Premium Open Bar Prices •Wine at Dinner $ •Newly Decorated •Professional Guidance

Shower Package starting at

1695

Per Person

REHEARSALS • PRIVATE ROOMS


20

The Southington Citizen — Friday, January 22, 2010

Obituaries Gertrude Bissoni

Gertrude (Janswick) Bissoni, 92, of Dudley Street, New Britain, passed away Sunday, Jan. 10, 2010, at The Summit of Plantsville. She was the wife of the late Sistilio Bissoni. Born on Nov. 20, 1917, in New Haven , she was the daughter of the late Ralph and Philomena(Walbert) Janswick. Gertrude retired from Stanley Works in New Britain. She loved crocheting and cooking for her family. She is survived by a son, William Bissoni, and his wife, Diane, of Southington, and a daughter, Eileen Coombs, and her husband, Gerald, of New Britain, along with six grandchildren and seven great-grandchildren. She was predeceased by her son, Thomas Bissoni, a grandson, Michael Bissoni, and two sisters, Florence Kelpinski and Arlene Przytulski. The funeral was held

Wednesday, Jan. 13, at Mary Our Queen. Burial will be at St. Mary’s Cemetery in New Britain. Donations may be made in her memory to St. Jude Children’s Research Hospital, 501 St. Jude Place, Memphis, TN 38105.

Sophia P. Smedley Sophia P. Smedley, 87, of Vemont Avenue, Southington, died Saturday, Jan. 9, 2010, at The Hospital of Central Connecticut, Bradley Memorial Campus. She was the wife of the late Thomas Smedley. Born Nov. 26, 1922, in Southington to the late John and Josephine (Cutoska) Pernal, she had been a lifelong Southington resident. She was a lifelong member of Immaculate Conception Church, retired from Rex Forge and worked as a nurses aide at Ridgewood Convalescent Center. She is survived by her son, Robert Smedley, and his wife,

1139014

TONY’S OIL COMPANY, LLC “Owner Operated Since 1999” “Owner Operated Since 1999”

747-5412

r

TM

John Joseph Mancino, 61 of Berlin Avenue, Southington died Saturday, Jan. 9, 2010, at The Hospital of Central Connecticut, Bradley Memorial Campus. Born Jan. 19, 1948, in Meriden to Fern (Gagne) Mancino and the late Frederick Mancino, he lived in Southington. In addition to his mother, Fern, he is survived by his brother, Gary Mancino, and his wife, Erin, of Wolcott, and his sister, Joanna Champagne of Plantsville. A graveside service was held Friday, Jan. 15, in the State Veterans’ Cemetery, Middletown. Plantsville Funeral Home is handling the arrangements.

George M. Sacheck, 79, of Wilbur Street, Plantsville, died Monday, Jan. 11, 2010 at The Hospital of Central Connecticut, Bradley Memorial

4¢ per gal. SENIOR DISCOUNT A.C. & BURNER SERVICE AVAILABLE

Don Petit’s

John Mancino

George M. Sacheck

or visit

www.tonysoil.net for current price Low Prices • Dependable Service s r

Marcia, of Plantsville; her brother, Walter Pernal, and sister, Jean Hopko, both of Southington; and sisters, Anne McNamara of New Mexico and Rosie Guiliano of Meriden. She also leaves her two grandchildren, Nathan and Jonathan Smedley. Funeral services were held Friday, Jan. 15, at the Plantsville Funeral Home. Burial will be at the convenience of the family.

Honest Dependable Service

Campus. He was the husband of Julia (Luponio) Sacheck. Born in Hartford on March 1, 1930, the son of the late Michael and Mary (Gura) Sachack. He was a corporal in the U.S. Army during the Korean War. He was employed at Clark Brother’s Bolt Co. for 37 years and had retired from Ideal Forge Corp. where he had worked for seven years. He was a lifetime member of the American Legion Kiltonic Post 72. He enjoyed fishing, woodworking and was a NASCAR fan, but most of all he enjoyed spending time with his family. In addition to his wife, he is survived by his children, Rosemary DeFeo, and her husband, Bill, of Plantsville, and Lucille Cortezzo, of Massachusetts; three cherished grandchildren, Michael and Sarah Cortezzo and Noah DeFeo; and also several nieces and nephews. The funeral was held on Thursday, Jan. 14, from the DellaVecchia Funeral Home to St. Aloysius Church. Burial with military honors was at St. Thomas Cemetery.

Beatrice Filandro Beatrice (Grant) Filandro, 86, passed away on Thursday, Jan. 14, 2010 at The Hospital of Central Connecticut New Britain Cam-

OPEN YEAR ROUND Since 1780

Before you buy floor covering from the next day carpet services do yourself a favor

Then consider Don Petit’s Store of Floors. Always a clean, professional install with the best price for real!

New Hours: Mon. & Tues. 10-5:30; Sat. 10-3; Wed., Thurs., Fri. 10-7 907 Meriden-Wtby. Tpk. (Rt. 322) Plantsville, CT 06479 Volume & Contractor Discounts Available Across from McDonald’s

(860) 621-4295

Visit Our Country Store & Bakery “Southington’s Best Kept Secret!”

Over 20 Varieties of Fresh Baked Pies Free Donut with the purchase of any size Coffee Now Serving Breakfast Sandwiches

Now Open at 7 AM

The Southington

Citizen Send us your news! 40 N. Main St., Southington, CT 06489 news@southingtoncitizen.com

Ace Oil Oil

1140949

What kind of installers are available for next day installs? Novices, hacks and the ill trained. Most good installers are booked for at least a week.

LEWIS FARMS, 384 BELLEVIEW AVE., SOUTHINGTON, CT 06489

1142172

2. Ask these questions: Who is paying for those enormous advertising bills? You the customer by purchasing inferior goods at inflated prices.

1143681

1. Google their name - reviews, find out the real truth and horror stories those actors on TV don’t tell you!

pus. She was the wife of the late Peter Filandro. She was born April 17, 1923, in Unionville daughter of the late Edward and Margaret Agnes (Griffin) Grant. She was parishioner of St. Aloysius Church and had been a longtime resident of Southington. She is survived by a daughter, Patricia Backus, and her husband, George, of Plantsville; a brother, Edward Grant Jr., of Granby; and a sister, Irene Myers, of Unionville; four grandchildren, Andrea Easton of Farmington, Glen Backus of Mint Hill, N.C. , Heather Ferracchia of Harwinton and Alan Filandro of Southington; five great-grandchildren, Nicole, Caroline, Alana, Alexander and Logan; along with several nieces and nephews. She was predeceased by a son, Edward Filandro, two brothers, William and John Grant, and two sisters, Marjorie Mickissick and Ruth Ingvertsen. The funeral Mass was held on Tuesday, Jan. 19, at St. Aloysius Church, Plantsville. Burial was in St. Thomas Cemetery. Memorial donations may be made to The Salvation Army: Captain and Maria Stevenson 23 St. Casmir Drive, Meriden, CT. 06460-5729.

Company LLC

24 Hour Emergency Service

Cash, Senior & Volume Discounts Call Today

203-630-9141 CT Reg. #HOD 446

s r

r

TM


21

Friday, January 22, 2010 — The Southington Citizen

Ski/snowboard camp in February

Schools Continued from page 15 southington.org/education/village.html or call Nan Sheridan, director, at (860) 628-6958. Parents can also schedule appointments to visit the classroom and observe the program.

Nursery school open house Plantsville Nursery School, 109 Church St., has scheduled an open house, Sunday, Jan. 10, from 2 to 4 p.m. Registrations for the 201011 school year will be accepted for the 3-year-old classes (Tuesday and Thursday mornings) and the 4-year-old classes (Monday, Wednesday and Friday mornings or afternoons). For more information, call (860) 628-8878.

The Southington Community YMCA is offering a week of skiing or snowboarding in conjunction with Mount Southington Ski Area for children in third through eighth grade during the week of Feb. 15 to 19, from 9 a.m. to 4 p.m. Children will be chaperoned by YMCA staff members and do not need to be YMCA members to attend. Children can be dropped off at the YMCA and bus transportation will be provided to and from the ski area. There are options for before and after care at an additional price. Registration packets are available at the front desk of the YMCA, 29 High St. For more information, contact Pat Rosin, outdoor center program director, at YMCA Camp Sloper at (860) 621-8194, ext. 308 or e-mail prosin@southingtoncheshireymca.org.

Let’s party!

Submitted photo

DePaolo Middle School National Junior Honor Society students helped at The Arc of Southington’s annual holiday party held Dec. 4 at the Calendar House.

Obituaries Edward R. Trzcinski Edward R. “Ty” Trzcinski, 66, of New Britain, passed away suddenly Wednesday, Jan. 13, 2010, at the Hospital of Central Connecticut at New Britain General. He was a husband to his beloved wife, Teresa; a father to his son, Richard Trzcinski, and his wife, Kelly of Southington; a daughter, Tammy Pack, and her husband, Brett, of Terryville; a brother to Kenneth Trzcinski, and his wife, Elna, of Southington; a stepfather to sons, Artur and Christopher, and daughters, Dominika and Malgorzata. Edward was a grandfather to Justin and Jordan Trzcinski, of Southington, Brandon Pack, of Terryville, along with two beautiful stepgranddaughters, “princess” Edyta and Jennifer, along with grandson, Adam. He is also survived by his nephews, Chad and Keith Trzcinski, of Southington. His beloved wife, Teresa writes: “Edward was a very sensitive man who loved his family, life, people and especially his animals. He was very proud of his family’s accomplishments and would celebrate them often. He took the needs of those around him to heart. The heart that stopped on Jan. 13 was a heart that cared deeply for those around him.” As often said by his step-granddaughter, Edyta, “Ty was number one.” For Ty from Chris, his stepson: “We had our ups and we had our downs, but you were the one that never had

Interior Decorating Creative Affordable Solutions For Your Home or Business Call Nancy T rott for your Appointment

Thomas Joseph Sullivan Sr. 80, of D a rl i n g Street, died T h u r s d a y, Jan. 14, 2010 after a brief illness at The Hospital of Central Connecticut Bradley Memorial Campus. He was the husband of the late Theresa Claire (St. Marie) Sullivan. He was also predeceased by his longtime companion, Betty LaRoche. He was born on March 3, 1929, in Holyoke, Mass., the son of the late James F. and Mary Ellen (McSweeney) Sullivan. He was a graduate of Holyoke High School and was the store manager of

Serving the Community for over 25 years

Installation - Service - Repair • • • • • •

s r

r

TM

758 Main Street, Plantsville, CT 06479

Water heater replacements - Gas, Oil, Electric Up to High-efficiency tankless water heaters installed $1500 Tax Credit on Faucet and fixture replacement and repair Water Heaters Water filter installation Complete kitchen and bathroom remodel services available Gas pipe for - Fireplace log kits - Gas grills - Pool heaters

“One call for all your plumbing needs”

(860) 621-6987 1142491

1138696

1142734

,INC.

(860) 276-9932

Everybody’s Market for many years. He was an avid reader, enjoyed traveling to Florida, Las Vegas and playing poker. His greatest joy was the time spent with his grandchildren. He leaves sons, Thomas Sullivan and his wife, Kathryn, of Wolcott, Michael Sullivan and his wife, Doreen, of Clearwater, Fla.; daughters, Patricia Sullivan of Southington and Laurie Reilly and her husband, Jeffrey, of Waterbury. He also leaves his stepchildren, Debra LaRoche of Southington, Sharon LaRoche of Wallingford and Paul LaRoche of Southington; his grandchildren, Sean and Terrence Sullivan of Wolcott and Alyssa and Brendan Rocap of Southington; many nieces, nephews, cousins and friends. He was predeceased by siblings Elinor O’Connell, James Sullivan, Agnes Brooksbank and Mary Sullivan. A memorial Mass was held Monday, Jan. 18, at St. Thomas Church, Southington. Burial will be at the convenience of the family. Donations may be made in his memory to St. Paul School, 461 Alling St., Kensington, CT 06037 or the American Heart Association, 1 Union St. Suite 301, Robbinsville, NJ 08691.

Thomas Sullivan Sr.

C.O.D. Delivery • Automatic Delivery • Energy Assistance

CALL FOR CURRENT PRICE

Furniture & Interior Decorators 60 Chamberlain Hwy., Kensington (860) 828-4176

doubts. You showed me what was good and what was bad, you are a father that I never had.” Funeral rites were held Tuesday, Jan. 19, from the Paul A. Shaker/Farmingdale Funeral Home, to Sacred Heart Church, New Britain, with Monsignor Daniel J. Plocharczyk presiding. Burial with full military honors was in Sacred Heart Cemetery, New Britain. The American flag was presented to his wife, Teresa.

Licensed & Insured CT LIC # - P1 279241

- FREE ESTIMATES Fax # (860) 628-2358 Email - mirandoplumbing@cox.net s r

r

TM


22

CitizenOpinion Bob Dornfried

The Southington Citizen Friday, January 22, 2010

From the Editor

If it’s broke, fix it

Town Meetings

Monday, Jan. 25 Town council, town hall council chambers, 7 p.m. Tuesday, Jan. 26 Zoning board of appeals, town hall council chambers, 7 p.m. Housing authority, Lincoln Lewis Terrace, 43 Academy St., 7 p.m. Board of education facility advisory committee, Plantsville Elementary School, 70 Church St., 7 p.m.

Thursday, Jan. 28 Board of education, town hall council chambers, 7 p.m. Apple Harvest Festival Committee, town hall lower level conference room, 6 p.m. Tuesday, Feb. 2 Planning and zoning commission, town hall council chambers, 7 p.m. Wednesday, Feb. 3 Charter revision commission, town hall council chambers, 7 p.m.

Back in October, when I was interviewing candidates before the municipal election, I got the impression from the Janowski some planning and zoning commission members and candidates that members of the town staff had acted improperly when granting approval for V.I.P. to move onto Queen Street. However, other candidates had a very different view that staff acted properly and not only within the law, but as required by law. These two narratives clearly don’t line up. Perhaps, they were campaign bluster. Maybe clarity isn’t an option in the eyes of the commissioners right now because the case is ongoing and they must protect themselves — and the town. According to Town Attorney Mark Sciota, there are no comments relating to the V.I.P. application in the personnel files of the town planner or zoning enforcement officer. This question — whether town staff acted correctly or not — needs to be answered in order to protect the processes that protect Southington and its residents. If town staff, and this goes

for any department, can go renegade and ignore the town’s policies, those protections will lose their value and leave residents vulnerable to abuse. I am not so naive to think because I don’t like something it can’t happen, that there must be a law somewhere that will prevent it, or should have. However, I do believe it is important that rules are enforced consistently and predictably. If V.I.P. got special treatment out of fear of violating the applicant’s rights, isn’t that a violation of fairness for applicants in less seedy businesses that have not had to go to the courts to earn their legitimacy? Then there is the concern about categories. If a business can decide whether it is a sexually oriented business while applying for a permit, why would any business say it fell into that category? What is to stop a gas station from saying it is a retail store, a power plant from calling itself something else or a sexually-oriented business from saying it’s not? A business that is one thing or another should fall under the rules for that category. A business that says it is one thing, doesn’t become that just by saying it. I guess it depends on what the meaning of the word “is” is.

The Southington

Citizen 40 N. Main St., Southington, CT 06489 www.southingtoncitizen.com News ............................................(860) 620-5962 news@southingtoncitizen.com Advertising....................................(860) 620-5960 advertising@southingtoncitizen.com Marketplace..................................(860) 620-5964 Fax ...............................................(860) 621-3660 The Southington Citizen is published every Friday by the Record-Journal Publishing Co. and is delivered by mail to all homes and businesses in Southington, Plantsville, Milldale and Marion.

Robert Mayer, Managing Editor Robin Lee Michel, Assistant Managing Editor Zachary Janowski, Associate Editor Harry Kyle, Associate Editor Michael Guerrera, Sports Ken DiMauro, Bob Dornfried, Lynne Turdin Contributors Brian Monroe, Advertising Director Doug Riccio, Christine Nadeau Advertising Sales Michael F. Killian, General Manager

Letters Policy — E-mail letters to news@southingtoncitizen.com — The Citizen will print only one letter per person each month. — Letters should be 300 words or less. We will edit longer letters and their publication will be delayed. — We will only print signed letters. — Please include your phone number so we can contact you. — Submit letters by noon Monday for Friday publication.


23

Friday, January 22, 2010 — The Southington Citizen

Metric Olympics

Inquiring Photographer

Submitted photos

To celebrate, JFK Middle School held a daily contest. More than 100 students participated each day. The winners of the contest are, from left to right, Marissa Sisco, Ian Powell, Jacob Agli and Matthew Schmidt.

What do you consider to be Southington’s greatest asset? Compiled by Stacey McCarthy

The library. It’s the best deal you get for your tax dollar. Michael Berube Southington

We enjoy bringing the dogs to the dog park at the bottom of Mill Street. David Mailhot Southington

Seventh-graders on Team E held a Metric Olympics. Events included the righthanded centimeter cube grab, the lefthanded sponge squeeze, the paper plate discus, the yarn ball shot put and the plastic straw javelin throw. Pictured from left, with Principal Angelo Campagnano, are the winners: Anthony Roccasecca, squeezing 300 milliliters of water; Casey Natelli, throwing a straw javelin 5.37 meters; Alexa Luponio, grabbing 148.5 grams of centimeters; Michael Fazzino, throwing a paper plate discus 6.28 meters; and Kayla Michalic, shot-putting a yarn ball 6.90 meters.

Letters to the Editor Southington has many places to shop and great parks and it has convenient entrances to the highway. Seth Harris Southington

The downtown shopping area because it brings the community together. Kara Kujawski Southington

The education system is Southington’s greatest asset. The test scores and graduation rates are better than many surrounding towns. Kate Mortek Southington

Thanks for interacting To the Editor: Every year, the Interact Club of Southington High School cooks Christmas cookies and donates all the proceeds to charities. This year we were very successful. We would like to thank the local businesses and families who helped us to be successful. Price Chopper and Stop and Shop donated ingredients. The Zissis and LaRose families donated money to buy ingredients. Lewis Farms and Tops Market kindly donated their ovens. Also thank you to the Ali family, Betsy Tooker and John Salerno, you continue to be absolutely the kindest people we ever deal with. It is because of the kindnesses and selfless giving of all these people that we are able to help so many people in need, including Bread for Life and Southington Cares, locally. This continues to be a wonderful, compassionate community. Thank you all. Bob Brown Interact Advisor

Hidden handicap To the Editor: “DOESN’T LOOK LIKE YOU HAVE A HANDICAP!!!” This was the handwritten note I found on my car windshield Saturday at a local grocery store. So, what exactly does a handicap look like? My husband and I carried no crutches, cane or walker, and had no wheelchair. These must be requirements. We had just come from a funeral; handicapped people never dress up. We look too young; handicapped people are old. Dave, in his typical style, strode quickly and confidently from our car, on his mission to get something on the opposite side of the store. I walked more slowly and carefully, to the fresh vegetables on the near side. Handicapped people never need to shop. You don’t know me; don’t judge. I am the holder of the state-issued, doctor authorized, “Blue Badge of Courage” that was hanging from my mirror. You can’t see the mangled remains of five surgical procedures on my left foot, or

the metal plate and titanium screws that hold it together, or the additional scars on my right foot and knee from other procedures. You don’t see the near bone-on-bone x-ray that means imminent, though thankfully not immediate, knee replacement surgery. You don’t see my everyday orthotic-filled, unbending, ugly, black men’s work shoes. You aren’t aware of my limp. You don’t notice that I carefully watch every single step I take, every single day, as one wrong twist or turn could cause a fall. But that’s just me. You also don’t see the scars of someone recovering from chest-splitting heart surgery, who is enduring chemotherapy or is scarred from severe burns. You don’t see the carefully hidden prosthetic leg. You don’t see the suffering of those with emphysema, COPD, asthma, asbestosis, multiple sclerosis, schleroderma, arthritis or so many other difficulties. We cannot make our handicaps go away, though often we would love to. You, however, can overcome your ignorance. We hope you do. Susan J. Zoni Southington


24

CitizenCalendar

Jan. 22

Friday

Folk performance — The Twice Around Duo will perform at Jitters Coffeehouse, 1273 Queen St., Southington, 8 p.m. Friday, Jan. 22.

23

Saturday

Folk performance — Maggie Seligman will perform at Jitters Coffeehouse, 1273 Queen St., Southington, 8 p.m. Saturday, Jan. 23. Mystery play and dinner — Mary Our Queen Church, 248 Savage St., Plantsville, has scheduled the annual mystery play and dinner Saturday, Jan. 23. The event begins at 6:30 p.m., with dinner served at 7 p.m. The menu includes veggie and cheese platters, salad, roasted pork, potatoes, vegetable, rolls, dessert and beverage. Tickets will be on sale after all Masses on the weekends of Jan. 9 and 10 and Jan. 16 and 17, or call Vinnie at (860) 276-0654. Proceeds benefit the scholarship fund. Wildlife presentation — Wind Over Wings Inc. is a nonprofit, wildlife rehabilitation and education center that hopes to provide a personal connection with wildlife that will lead to responsible stewardship of the environment. Founder Hope Davis will visit the Southington Library, 255 Main St., Saturday, Jan. 23, at 10:30 a.m., along with 9-year-old Isis, a Peregrine falcon, and three other raptors and an eagle. For more information and to register for this free program, visit the online calendar at www.southingtonlibrary.org, click on the calendar, and search for the program, or call (860) 6280947, ext. 5.

Village Green registration — Village Green Nursery School, 37 Main St., Southington, has scheduled registration for the 2010-11 school year Saturday, Jan. 23, from 9 to 10 a.m., in the Memorial Hall of First Congregational Church. Snow date will be Monday, Jan. 25, from 6 to 7 p.m. For more information about the program, visit the Web site www.firstchurchsouthington.org /education/village.html or call Nan Sheridan, director, at (860) 628-6958. Parents can also schedule appointments to visit the classroom and observe the program. Outback night — The Southington Education Foundation is hosting a philanthropic fine-dining experience in support of its mission to instill a love of learning in the town’s children on Jan. 23. Tickets include a steak and chicken dinner with vegetable, dessert and beverage. Seatings are at 11:30 a.m. and 12:30 p.m. For tickets, contact Dr. George Costanzo at (860) 621-0131 or visit his office at 340 North Main St., Southington.

25

Monday

Gluten 101 — The Central Connecticut Celiac Support Group has scheduled Gluten 101 sessions for those who are new to celiac disease on the fourth Monday of each month at the Berlin Town Hall, 240 Kensington Road, lower level, at 7 p.m. Call Carm Kimmell at (860) 426-1980 or Ann Malafronte at (860) 378-2852 for more information.

26

Tuesday

Migratory songbirds program — The Orchard Valley Garden Club of Southington will meet 10 a.m. Tuesday, Jan. 26, at the Southington Public Library, 255 Main St., lower

level. Speaker Jayne Amico will present “Supporting Connecticut’s Migratory Songbirds” in a discussion on rehabilitation, reducing negative impacts and songbird scaping. Business meeting will follow. Reservations required. Contact ovgardenclub06489@att.net. Members need to pick up their yearbooks at this meeting. AARP Meeting — The Southington Apple Valley Chapter of AARP will meet 1 p.m. Tuesday, Jan. 26, at Mary Our Queen Hall, 248 Savage St. A bingo game and refreshments will follow the meeting. Members are reminded to bring non-perishable food to be donated to community services and comfort items for U.S. service personnel. The chapter is preparing for its 2010 trips, which are open to the public. Trips include: March 11, Dublin’s Irish Cabaret; April 18, Newport Playhouse and Cabaret’s Happy Birthday show; May 16, Warner Theater “The Producers;” June 2 to 4, a three-day trip to Cape May Diamonds and Atlantic City. For more information, call Esther at (860) 628-0063. DECA dinner — On Jan. 26 in the Southington High Cafeteria DECA and National Honor Society are hosting a pasta dinner with all proceeds going to the American Cancer Society. The dinner is from 6 to 8 p.m. There is a cost to attend. Genealogy group — The Southington Genealogical Society is a nonprofit organization that promotes the accurate recording, research and preservation of family history which meets on the fourth Tuesday of the month at 7:30 p.m., in the community room of the Southington Police Department, 69 Lazy Lane. Richard A Eppler will speak on “The Founding of New England - The Winthrop Fleet of 1630.” There is no admission charge, no obligation to become a member, and no reservations are necessary.

The Southington Citizen Friday, January 22, 2010

Ample parking is available and refreshments will be served.

28

Thursday

Networking Group — Job Seekers, a Southington unemployment/under employed group, meets every Thursday, at 10 a.m., at the First Congregational Church of Southington, 37 Main St. The group is open to any residents in Southington and the surrounding towns and meets for approximately two hours to network and discuss various job seeking issues. There is no charge to attend. For more information, contact the church office at (860) 628-6958.

29

Friday

Open House Party — Jitters Coffehouse, 1273 Queen St., Southington, will host an open house party from 8 p.m. to 11 p.m. to celebrate 10 years in business, featuring potluck food, desserts and beverages.

30

Saturday

Country and Americana performance — Lauren Agnelli & Ebin-Rose will perform at Jitters Coffeehouse, 1273 Queen St., Southington, 8 p.m. Saturday, Jan. 30. Pasta supper — The Youth Group of the First Congregational Church located at 37 Main St. across from the Town Green invite you to a pasta supper to support their February mission trip to Mississippi. While in Mississippi they will be helping with Hurricane Katrina clean-up. The pasta supper is to be held on Jan. 30 at 6 p.m. There is a cost to attend. Tickets available by calling the church office 860-628-6958.

Feb. 3

Wednesday

Newcomers and Neighbors Club — The Newcomers and Neighbors Club of Southington is a women’s social club open to both new and to life-long residents of Southington. The group will host Poker Night Wednesday, Feb. 3 at 7:30 p.m. in the dining room at the Southington Care Center. Contact Kathleen at (720) 281-5420 or Southington_Newcomers@yahoo.com for more information.

4

Thursday

SACA greeting cards workshop — To be hosted by Diane Sperry at 6:30 p.m. Participants will be making a Valentine’s Day card, a birthday card and a thank-you card. If there is time, Sperry will include a second valentine card. All paper supplies are included. Please bring a small pair of craft scissors. Registration is required by calling (860) 793-9501 or email at Deesper@aol.com. Held at Orchards Community Room, 34 Hobart St., Southington.

5

Friday

Winter Gala Dance and Auction — St. Thomas School will host the Winter Gala Dance and Auction on Friday, Feb. 5, from 6:30 to 11:30 p.m. A night of live entertainment will be provided by Vincent Ingala, with a dance, open bar, dinner stations and auction. It will be held at the Aqua Turf Club, Plantsville. There is a charge to attend. For tickets or more information, call Mann Marie Nazzaro, (860) 919-0093.


25

Friday, January 22, 2010 — The Southington Citizen

Valentine Letters Of Love Do you have someone special in your life?

Husband/Wife ❤ Boyfriend/Girlfriend ❤ Mom/Dad ❤ Grandparents ❤ Kids, even your lovable PETS!! Show them how much you care on Friday, February 12th in The Southington Citizen Valentine Letters of Love

Hurry! Deadline Friday, February 5th Only $5.00

Only $8.00

6 line ad

6 line ad w/ border & photo

BIG HEART VALUE Only $15.00

Includes: Larger Box Ad w/photo, Border & Choice Of Graphic Write your message below & pick artwork

JOHN 10 YEARS AGO TODAY, WE SAID “I DO” 3 AWESOME CHILDREN, AND A DOG LATER ... I STILL LOVE YOU!!

Julie

Abby Joy & Bobby Happy Valentine’s Day to our 2 sweethearts We love you!

Will you marry me? I love you!

Steve

Love, Mom & Dad

Total $15.00 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12.

Circle Artwork Add $2.00

❑ Each additional line.....$1.00 Name: Address:

❑ Check ❑ Credit Card #:

$

Phone: Exp. Date:

& Artwork $

Print Name:

Additional $

Signature:

Total

Lines

$

1144518

Mail or bring coupon to: The Southington Citizen Marketplace (South Colony Street Entrance), 11 Crown St., Meriden, CT 06450 or Place your ad over the phone by calling 203-238-1953 • 9 AM to 5 PM


26

CitizenBusiness

New energy business opens

Dave and Michelle Pestillo of Southington recently opened Emendee Technologies, an energy solutions company. Emendee offers businesses a competitive ad-

vantage by finding better ways of using and conserving energy. Emendee has partnered with other companies and provides free energy management assessments. Depending on the client’s interest in conservation and

Cynthia Enright PharmD

Congratulations Cynthia!

1144223

The family of Cynthia Enright of Southington, CT would like to congratulate her on the completion of her Doctor of Pharmacy degree in December 2009. The post baccalaureate PharmD pathway program from the Massachusetts College of Pharmacy and Health Sciences in Boston is a distance-learning program designed for licensed, practicing pharmacists to earn a PharmD degree while continuing to practice. Cynthia continues to practice pharmacy with Omnicare of CT and is an instructor at Lincoln College of New England (formerly Briarwood College) in Southington. Cynthia thanks her family for allowing her the precious time needed to complete this degree without complaint of hastily prepared meals (and take out) or absence from family activities. She knowes that her friends and family have probably listened to more ‘pharmacy talk’, including drug interactions and mechanism of actions, than they may have wanted to and have managed her enthusiasim with alternating ‘enough already’ looks and humor. Lastly, she thanks Rich for his unwavering technology support for this on-line program without which she could not have accomplished this degree.

1HZ<HDU1HZ&DUHHU

green energy solutions, Emendee performs audits and custom designs energy solutions. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s not just about saving money on energy bills. Itâ&#x20AC;&#x2122;s about conserving energy, and minimizing our dependence on fossil fuels,â&#x20AC;? Dave Pestillo said. â&#x20AC;&#x153;And, when companies invest in green energy solutions, they stand out as leaders in their industry, and can improve their market share by showing their customers the progress they are making towards improving the environment.â&#x20AC;? Pestillo said he is an entrepreneur at heart. As a young man, he owned his own lawn maintenance business through college. He graduated from Southington High School in 1988, and received a marketing degree from Central Connecticut State University in 1992. He received his MBA from the University of New Haven in 2001 and has worked for a large telecommunications company for more than 14 years. Michelle also graduated

from Southington High School in 1988 and received a communications degree from Central Connecticut State University in 1992, and has spent a number of years in the communications industry. The Pestillos have been interested in green energy for years, and are very passionate about conserving energy, saving energy dollars, and doing the right thing for the environment. Phonetically, â&#x20AC;&#x153;Emendeeâ&#x20AC;? is pronounced â&#x20AC;&#x153;M & Dâ&#x20AC;?, which stands for â&#x20AC;&#x153;Michelle and Dave.â&#x20AC;? For more information, visit www.EmendeeTechnologies.com.

Nominations sought for awards The Chamber of Commerce is seeking nominations for its annual awards to be presented at its 72nd annual dinner meeting scheduled for Saturday evening, April 17 at the Aqua Turf. Each year the chamber

Spend a day at CCS and learn the inâ&#x20AC;&#x2122;s and outâ&#x20AC;&#x2122;s of the new Windows 7. The class will include:

0DNHWKH6PDUW&DUHHU0RYHLQ

ͲWindows 7 User Interface

%UDQIRUG+DOOFRQWLQXHVWREHDOHDGHULQFDUHHUIRFXVHG HGXFDWLRQIRURYHUIRXUGHFDGHV$JURZLQJQXPEHURIPHQ DQGZRPHQDUHGLVFRYHULQJFDUHHUIRFXVHGHGXFDWLRQDV RQHRIWKHIDVWHVWDQGPRVWHIIHFWLYHZD\VWRVWDUWDQHZ KLJKJURZWKFDUHHU

*HW6WDUWHG12:2Q<RXU1HZ&DUHHU

ZZZEUDQIRUGKDOOHGX

6RXWKLQJWRQ 10DLQ6W_:LQGVRU 'D\+LOO5RDG_%UDQIRUG 2QH6XPPLW3ODFH

Feb. 26 ~ 9am-4pm Includes lunch

Woman starts food business

See Business, page 27

Mystique Oil LLC Jamie Laforge & Scott Gaski Over 25 years experience

Register Today! 860-276-1285 x214 or online www.ctctcomp.com 101 E. Summer St. Plantsville, CT (on the Rail Trail)

CALL FOR OUR EVERY DAY LOW PRICE

(860) 585-8710 www.mystiqueoil.com Boiler Installation Warm Air Furnaces Oil Tanks â&#x20AC;˘ Water Heaters Inground Tank Removal 1139036

1143508



$199!

ͲThe new Windows Explorer ͲWorking with XP Mode in Windows 7 ͲStorage in Windows 7 ͲWindows 7 Networking ͲWindows 7 Administrative Tools 1143206

+($/7+&/$,0663(&,$/,67 0$66$*(7+(5$3< &20387(51(7:25. 0$1$*(0(17

honors recipients of businessperson of the year, community spirit, employee of the year and numerous public service awards. The public may submit nominations for any category by composing a brief description of the nomineeâ&#x20AC;&#x2122;s accomplishments in the town. The annual dinner meeting will also include the installation of new chamber directors and officers. The event theme is â&#x20AC;&#x2DC;Good Vibrations,â&#x20AC;? with music from the 1960s, â&#x20AC;&#x2DC;70s and â&#x20AC;&#x2DC;80s. The Dave & Dave Show will provide the entertainment. The dinner will also feature solo singing acts from the finalists of the recent karaoke competition held at Machiavelliâ&#x20AC;&#x2122;s. The chamber is located at One Factory Square and information about the dinner and awards can be obtained by calling the chamber at (860) 628-8036.

Ana Panagiotou of Southington has become an independent consultant with Tastefully Simple, a national direct sales company featuring more than 60 easy-to-prepare foods. As an independent business owner, Panagiotou offers food samples at home taste-testing parties, along with easy ideas for everyday meals, recipes and serving suggestions. All of Tastefully Simpleâ&#x20AC;&#x2122;s products are openand-enjoy or can be prepared

Windows 7 has arrived! Attend our 1-day Windows 7 Desktop Essentials Class!

ZLWK

0(',&$/$66,67,1* 3$5$/(*$/ 352)(66,21$/),71(66 75$,1(5

The Southington Citizen Friday, January 22, 2010


27

Friday, January 22, 2010 — The Southington Citizen

Grants Continued from page 14 versally reported that demand is higher than ever and that this trend is likely to continue for some time,” said Jim Williamson, community foundation president, who cited some troubling statistics reported by local food pantries: — In Berlin, 40 plus families are served per month versus 10-12 households just 18 months ago; — The New Britain Food Collaborative served 200% more people than it projected it would serve last year; — Southington Community Services and Bread for Life in Southington say that the demand for services has literally doubled in the last few months and they are running out of food. “After meetings with representatives from the vari-

ous food pantries and the staff of Foodshare in Hartford, we felt it was prudent to move quickly to strengthen the organizations providing these services in Berlin, New Britain, Plainville and Southington,” added Williamson. Foodshare was selected to administer the grant because it serves as the region’s food bank and distributes more than 15 tons of food each day to a network of nearly 350 local partners that feed the hungry. It also has the ability to purchase food in the most cost efficient manner; every $30 it receives provides enough food for a hungry person for a month. The Community Foundation of Greater New Britain connects donors who care with causes that matter in Berlin, New Britain, Plainville and Southington. For more information, please visit www.cfgnb.org or call (860) 229-6018.

Business Continued from page 26 by adding only one or two ingredients. “In today’s world, ‘staying in’ has become the new ‘going out!’ You don’t have to leave home to enjoy wonderful food, fun and laughter with your family and friends,” says Jill Blashack Strahan, Tastefully Simple

Networking group meets weekly

employed group, meets every Thursday at 10 a.m. at the First Congregational Church of Southington, 37 Main St. The group is open to any residents in Southington and the surrounding towns and meets for approximately two hours to network and discuss various job seeking issues. There is no charge to attend. For more information, contact the church office at (860) 628-6958.

Job Seekers, a Southington unemployment/under

DID YOU KNOW THAT MOORELAND HILL IS MORE THAN A MIDDLE SCHOOL? Introducing our transitional multi-age program for grades four and five. Small classes, More attention - Life-altering experience.

Mooreland Hill School Open House Saturday, January 23 from 10:00 am - 12:00 pm Accepting applications now for grades four through nine. Admissions Test Date - Saturday, February 6th 1143883

RSVP 860.223.6428 Mooreland Hill School is an independent, co-educational day school serving central Connecticut students in grades four through nine.

WE MATCH ONLINE PRICING!*

166 Lincoln Street, Kensington, CT 06037

Telephone 860.223.6428

www.mooreland.org

Saddle Up & Learn To Ride!

BUY 1 GET 1 FREE!

Heated Indoor Arena and Barn for Year Round Lessons and Boarding Adults & Children Lessons Monday-Saturday

$29.99 after mail-in rebate debit card $129.99 2-year retail price $100 mail-in rebate debit card With new 2-yr activation.

Western-English-Hunt Seat Adult Group Fun Rides

- PRIVATE LESSONS 1144094

BlackBerry® Curve 8330

EAST WINDSOR SOFIA’S PLAZA 122 PROSPECT HILL RD 860-292-1817

SOUTHINGTON RIVERBEND PLAZA 1049 QUEEN STREET 860-793-1700

WESTBROOK Across Lenny’s & Joe’s 79B BOSTON POST ROAD 860-552-2533

CROMWELL CROSSROADS PLAZA 34 SHUNPIKE ROAD 860-635-8887

Coupon: $10 Off Accessory Purchase; Free Phonebook/ Picture Transfer $15 Value. Expires 1/31/10.

Horse Sales & Leasing Boarding - Training - Year Round Camps - Show Teams

Ride every day, fun and games, arts and crafts! Early drop off and late pick up options available!

February Vacation Camp 2/15-2/18 1144709

UNIONVILLE RIVERS EDGE PLAZA 45 South Main St. 860-675-0005

founder and CEO. “That’s why we’re proud to offer great experiences, easy-toprepare products and an exciting business opportunity for people who are looking for something more.” For more information, contact Ana Panagiotou at anatrifona@yahoo.com.

Authorized Retailer

* See sales representative for restrictions and limitations. Activation fee/line: $35 ($25 for secondary Family SharePlan lines w/2-yr Agmts). IMPORTANT CONSUMER INFORMATION: Subject to Customer Agmt, Calling Plan, rebate form & credit approval. Early termination fee: up to $175 ($350 for advanced devices) & other charges. Device capabilities: Add’l charges & conditions apply. Offers & coverage, varying by service, not available everywhere. Network details & coverage maps at verizonwireless.com. While supplies last. Shipping charges may apply. Limited time offer. In CA: Sales tax based on full retail price of phone. Rebate debit card takes up to 6 wks & expires in 12 months. All company names, trademarks, logos and copyrights not the property of Verizon Wireless are the property of their respective owners. © 2009 Verizon Wireless.

Help Build Your Child’s Confidence and Self Esteem as well as a Lifelong Love for Horses! Please Stop By or Call (860) 628-8044 107 Norton Street (Rt. 10) Plantsville, CT 06479 www.HayesEquestrian.com


28

CitizenSeniors

AARP Meeting

The Southington Apple Valley Chapter of AARP will meet 1 p.m. Tuesday, Jan. 26, at Mary Our Queen Hall, 248 Savage St. A bingo game and refreshments will follow the meeting. Members are reminded to bring non-perishable food to be donated to community services and comfort items for U.S. service personnel. The chapter is preparing for its 2010 trips, which are open to the public. Trips include: March 11, Dublin’s Irish Cabaret; April 18, Newport Playhouse and Cabaret’s Happy Birthday show; May 16, Warner Theater “The Producers;” June 2 to 4, a three-day trip to Cape May Diamonds and Atlantic City. For more information, call Esther at (860) 628-0063.

Band performs

The OTH Band plays musical favorites at the Calendar House, 388 Pleasant St., Southington, every Tuesday, from 12:30 to 2 p.m.

Musical variety show

The Rocky Hill Review presents “Senior Moments VI,” a musical variety show

featuring senior citizens performing for seniors, at the Calendar House, Thursday, Jan. 28, at 2:30 p.m. Light refreshments will be served. Admission is free for members. Monthly membership meeting association and installation of new officers will be held at 1 p.m. prior to the show. For more information, call (860) 621-3014.

Valentine’s Day dance The Valentine’s Day Dance Extravaganza is scheduled for Thursday, Feb. 11, from 4 to 6 p.m., at Kennedy Middle School, 1071 S. Main St., Plantsville. The event is being cosponsored by the school’s honor society and the Calendar House. Salads, sandwiches, ziti and desserts will be served. Entertainment will be provided by DJ Jerry Limmer. Tickets are available at the Calendar House until Monday, Feb. 8 or until sold out. For more information, call (860) 621-3014.

Computer class registration Registration for Senior-

HEARING AID SERVICE, INC.

1141910

ALL EARS

Net spring computer classes will be held Monday, Feb. 1, from 9 to 10:30 a.m., in the Perry Room at Calendar House. Doors open at 8:30 a.m. Early arrivals will be given applications for desired courses on a first-come, first-served basis until classes are filled. Second registration date is Monday, Feb. 8, at the same time and place, for any remaining open class seats. Courses being offered are: Basics for Computer Beginners: Tuesdays, from 9 to 11 a.m.; first session is Feb. 23, March 2, 23 and 30; second session is April 6, 13, 20 and 27. Course is free. Intro to computers: Tuesdays, from 1 to 3 p.m., Feb. 23 through April 13 Exploring the Internet: Thursdays, from 1 to 3 p.m., Feb. 25 through April 1 Using E-mail Effectively: Thursdays, from 9 to 11 a.m., Feb. 25 through April 1 The Many Faces of Google: Wednesdays, from 9 to 11 a.m., Feb. 25 through April 14 Photo Shop: Fridays, from 9 to 11 a.m., Feb. 25 through April 23 Managing Files and Folders: Thursdays, from 9 to 11 a.m., April 8, 15, and 21 Computer Tune Up:

Tuesdays, from 9 to 11 a.m., March 9 and 16. For more information, contact Peter Freeman at (860) 479-9064 or e-mail contact@southingtonseniornet.org.

Bingo caller needed The Calendar House, 388 Pleasant St., needs a backup bingo caller to volunteer for an hour and a half during Friday bingo at 1 p.m. to operate the cage and call the numbers. For more information or to volunteer, contact Bob Verderame at (860) 6213014.

Energy assistance Appointments are being scheduled for the Fuel Assistance Program for individuals who heat with oil, propane, wood, pellets, coal, electric or natural gas. Individuals who heat with oil, propane or kerosene should call their vendors before applying for this program to make sure the company is still participating. Call the Calendar House at (860) 621-3014 to schedule an appointment.

Put Your Best Smile Forward! NO NEED to be without Teeth!

225toto959989 DENTURES 199 $$

$$

Dentures availvable in 24 hours.

UPPER OR LOWER

• FREE Hearing Evaluation & Consultation • SERVICE It’s what makes us different • FREE In-Home Service for all area patients, “Let us come to you.” • We Fit Most Major Brands Serving Central CT Since 1985

Extractions and Dentures Relines and Repairs while you wait. at same appointment!

Memorial donations

The Calendar House has a Memorial Fund for people wishing to make a donation in memory of a friend or relative. Checks may be made payable to the Calendar House Senior Center and mailed to 388 Pleasant St., Southington, CT 06489. Memorial donations will be placed into the Membership Association General Fund. For more information, call (860) 621-3014.

Foot clinic

Hometown Visiting Nurses Assocation of Central Connecticut provides screening services at the Calendar House each month. A monthly foot clinic will be held by appointment only, for a nominal charge and is limited to basic foot care, trimming of toenails, etc. Call VNA nurse Sue Zdeblick at (860) 621-9779 to make a foot clinic appointment. The VNA of Central CT offers additional wellness and home care services. Call Donna Brouillette at (860) 826-4516.

Hearing Solutions Hearing evaluations. Hearing aid fittings, repairs and batteries. Medicare, HMO's, Medicaid Claims

Complete Affordable Family Dental Care! Payment Options • Fillings • Crowns Available • Cleanings • Bridges Most Insurance Plans • Teeth Whitening • Cosmetic Dentistry Are Accepted 139000

Call Now For A FREE Consultation!

10% Senior Discount NEW ENGLAND DENTAL 899

ORANGE

501 Boston Post Rd. Liberty, Sq. Plaza

MERIDEN

533 South Broad St. Townline Sq. Plaza

203.799.3311 203.238.7968

Offer expires 11/28/03 AllDenture Denture MaterialADA ADAApproved Approved Offer Material Approved Offerexpires expiresonon on9/30/06 2/15/10 AllAllDenture Material ADA

John Diakun, M.S. Audiologist

826-6450

1142829

78 Marlborough St., Portland (860) 342-4940 12 Curtis St., Meriden (203) 237-7546

The Southington Citizen Friday, January 22, 2010

Kensington Hearing Services 211 New Britain Rd. Kensington • (Next to McDonald's)


29

Friday, January 22, 2010 — The Southington Citizen

And the winner is...

Free swine flu vaccinations

Photo by Deb Mikan

Don Nichparenko of Southington smiles with his winning photo in the creative category at the Connecticut Community Care Senior Photo Contest. The photo, taken from his home on Academy Street, shows First Congregational Church with the moon, stars, cross and flag later added by Nichparenko.

The Southington Health Department, 93 Main St., second floor, will hold free H1N1 immunization clinics Wednesday, Jan. 27, Thursday, Jan. 28, Wednesday, Feb. 3 and Thursday, Feb. 4. The shots are offered from noon to 1:30 p.m. on Wednesdays and from 5:30 to 6:45 p.m. on Thursdays. To get a vaccination, residents must make an appoinment by calling (860) 276-6275 between 9 a.m. and 4 p.m., Monday through Friday. Times and nursing resources are limited, so first-call, first-served.

Contact us at ...

The Southington

40 N. Main St. Southington, CT 06489

Citizen

phone (860) 620-5962

Your Town, Your News

news@southingtoncitizen.com

1143214

Mandy J. (Bell) Ruggiero Senior Loan Officer/ Reverse Mortgage Specialist

Campbell Mortgage P.O. Box 624, Southington, CT 860.628.0058 mruggiero@campbellmortgage.com Cell: 860.919.0978 www.campbellmortgage.com Voicemail: 800.290.3521 ext. 502

Linda Vasile, Au.D., CCC/A, FAAA

Board Certified, Doctor of Audiology

• Hearing Evaluations • Hearing Aid Fittings • Hearing Aid Repairs • Hearing Aid Batteries 710 Main Street, Building 3, Plantsville at Clock Tower Square 1144265

“Serving the Hearing Needs of Central Connecticut”

1142480

(860) 426-9181


30

CitizenHealth

Free dental care

Southington dentists have decided to open their offices to provide free dental care to anyone who is in need on a rotating basis throughout the year. The initial goal is to get patients comfortable and pain free with the long-term goal to educate and provide preventive care to prevent the need for emergency care. The next pain-free day is scheduled for Monday, Jan. 25, from 9 a.m. to 1 p.m., at the office of dentist Lawrence Marini, 341 West St., Suite A, Southington. Patients will be seen on a first-

come first-served basis until the schedule is full.

Health programs MidState Medical has scheduled the following health programs: “Cholesterol and Blood Pressure Basics,” what the numbers mean and how to keep levels in check, will be presented by Christina Plantier, Thursday, March 18, from 6:30 to 7:30 p.m., at the Southington Public Library, 255 Main St. Registration is required by calling (860) 6280947.

Pet therapy training The Southington Care Center, 45 Meriden Ave., will be sponsoring Delta Society Pet Therapy classes beginning in March 2010, made possible through the Jane Haze Memorial Pet Therapy Committee. Classes will be held on Thursday evenings, from 6 to 7 p.m. Limited space is available. For more information or to obtain an application, visit www.southingtoncare.org or call Deb Brown at (860) 378-1286.

Parent support group A Circle of Parents support group is available free of charge to any parent looking to meet with other parents to exchange ideas, share information, develop new parenting skills, learn about community resources and find mutual support, thereby empowering parents to become role models for children and leaders in the community. Group meets bi-monthly on the second and fourth Thursday of each month at Plainville Congregational Church’s library room, 130 W. Main St., Plainville. The

Current concepts in the treatment of hip and knee arthritis

The Southington Citizen Friday, January 22, 2010 next meeting will be held Thursday, Jan. 28. Trained facilitators lead each group. Childcare is available. For more information, contact Cathy Sisco, program manager, at (800) CHILDREN (2-445-3736).

Support for suicide survivors Peer support meetings for those who have lost someone through suicide are held the first Sunday of every month at 3:30 p.m., at Mary Our Queen Church’s Educational Center, 291 Savage St., Plantsville. All are welcome. For more information, contact Barbara DeSapio at (203) 596-7916. Safeplace: For Survivors of Suicide meets at 7:30 p.m. on the third Monday of each month in the lower level of the First Congregational Church, 12 S. Main St., West Hartford. Use the lower level entrance from the parking lot off of Farmington Avenue. The support group is a nonprofit, nonaffiliated, selfsupporting group for adults who have lost a loved one to suicide. It does not offer counselors but instead features peers in a safe, nonjudgmental place to share feelings and thoughts. The

Arthritis in the knee or hip can cause pain and greatly affect your life and mobility. Join us as we explore some of the latest treatment options and how it can get you back on the move and back to living.

Sponsored by

The Center for Joint Care 1144283

1138914

100 Grand St., New Britain • www.thocc.org

VITAS Hospice needs volunteers

Volunteers with compassion and a little time are needed locally by VITAS Hospice Care of Connecticut. Hospice volunteers give their time to terminally ill patients and their families during a critical time. Volunteers are trained in listening skills, family dynamics and the right words to say to terminally ill patients and their loved ones. After completing the class, volunteers provide respite for caregivers, offer companionship for the patient, run errands and help in small but meaningful ways and work in private homes, nursing homes and hospital inpatient units staffed by VITAS. Assignments and schedules are made according to the volunteer’s preferences. There is a need for volunteers to work at nursing homes in Bristol, Middlebury, Naugatuck, Prospect, Southington and Waterbury areas. For more information or to attend an orientation class, call Karen Hale, volunteer services manager, at (203) 437-3127.

Lupus group

Presented by Orthopedic Physician Robert Carangelo, M.D. Thursday, January 28 6:30 p.m. Lecture Room 1, New Britain campus To register or for more information, call 860-224-5186.

The Hospital of Central Connecticut

group is sponsored in part by the Samaritans and offers an extensive lending library. For more information, to confirm attendance at the next meeting or for referrals for another survivor to talk with, call Maxine at (860) 6287161.

The Greater Hartford Lupus Support Group meets at 6:30 p.m. on the third Wednesday of the month, at 97 South St., Suite 110, West Hartford. The confidentiality of the group is always held in trust. Leading the meeting are Marilyn Sousa, founder, and Pauline Brignano, former chairwoman of the board of directors. Topics include breathing exercises and the first men’s support group. For more information, email ctlfa@sbcglobal.net or visit the Web site www.lupusct.org.


31

Friday, January 22, 2010 — The Southington Citizen

News Continued from page 6

Hip-hop program starts Center Stage is offering complimentary introduction to hip-hop classes for children ages 10 to 20. The three week program began Sunday, Jan. 17, and runs through Jan. 31. It consist of two 45minute classes: 12:15 to 1 p.m. for 10 to 13-year-olds, and 1 to 1:45 p.m. for ages 14and up. The program was originally organized to offer individuals of all ages who are in the foster care system an opportunity to take hip-hop. The classes will be taught by choreographer Rob Rivera of Center Stage Entertainment Dance Studios and held at 1049 Queen Street, inside the Riverbend Plaza. The class will be assisted by a student of Center Stage, Gary Costa, who is donating his time to do community work. Students may wear comfortable clothes such as a T-shirt and sweats with sneakers. Boys and girls are welcome.

The Summit seeks volunteers The Summit at Plantsville, a skilled nursing and rehabilitation center, has started a volunteer initiative for 2010. The Summit invites the community to enrich and enhance its recreation programs by volunteering. This is an opportunity for volunteers to share their talents and experiences and make a difference in their life and in the lives of the people that reside at the Summit. For more information, contact Barbara Blau, director or therapeutic recreation, at (860) 628-0364.

Aresimowicz joins commission

bring about the kind of structural change that can deliver benefits for years to come.” “I am pleased to be participating in this effort to find a better way for our cities and towns to work together,” Aresimowicz said. “As a former three term member of Berlin’s town council, I am well aware of the problems confronting our local communities and I applaud our leaders for taking up the fight because the times call for change that will hopefully benefit our constituents.” The MORE Commission will be comprised of 45 Democratic members of the House of Representatives and representatives of municipalities, regional organizations, education, business, unions and non-profits. The commission will look at: multi-town collaboratives, board of education functions, regionally-based

organizations, collective bargaining, mandates, revenue sources, health care and state grants. In each of these areas, commission subcommittees will investigate costs, benefits, resources, legal obstacles and opportunities, potential savings, consolidation and results-based

1996 - 2010

14

YEARS OF EXCELLENCE Assisted Living Services, Inc.

Your best choice for Independent Living. • Competent, reliable, caring, and trustworthy staff that come to your home. • We specialize in elder care services that promote independence and dignity. • Homemakers • Companions • 24-hour Live-in’s “They’ll be happy ... You’ll be happy” • Personal Care Attendants

Assisted Living Services, Inc. Serving Central Connecticut CT. Lic. 0000124

(203) 634-8668

Free in-home consultation available by RN. 1144284

Employees are bonded and insured and have had national criminal background checks.

accountability methods for tracking performance. Aresimowicz is an assistant majority leader, vice chairman of the government administration and elections committee and serves on the finance, revenue and bonding and commerce committees.

Read us on the Web: www.southingtoncitizen.com

1140056

State Rep. Joseph Aresimowicz, D-Berlin, who represents part of Southington, has been named by House Speaker Christopher G. Donovan, D-Meriden, and House Majority Leader Denise Merrill, D-Mansfield, to a new commission that will identify opportunities

for regional collaborations that save money for municipalities. The Blue Ribbon Commission on Municipal Opportunities and Regional Efficiencies (MORE) will begin its work Tuesday, Jan. 19, with the goal of recommending legislation during the 2010 session. “We can be doing more with less,” Donovan said. “Rep. Aresimowicz will help us find these new ways to help our cities and towns. I am confident we can bring about real property tax reform by regionalizing certain activities that can both save money and improve the economic competitiveness of our state.” “We’ve talked for a long time about restructuring government at all levels across the state,” said Merrill. “Now we’re going to take action. I’m excited about the chance to bring some relief to our cities and towns and to


32

The Southington Citizen — Friday, January 22, 2010

Police Blotter

The Southington

Cit itiz ize en

Jan. 5: Richard T. Hetzler, 30, 18 Canal St., third-degree assault, disorderly conduct, 1:49 a.m. Kate M. Kryszak, 22, 500 Darling St., breach of peace, 3:44 a.m. Kristen St. Pierre, 37, 157 Pavano Drive, Plainville, disorderly conduct, third-degree assault, violation of protective order, 2 p.m. Ryan J. Seier, 21, 48 Case Road, Burlington, possession of marijuana, 5:35 p.m. Mark St. Pierre, 39, 382 Dunham St., two counts violation of protective order, 8:05 p.m. Michael J. Scarfo, 33, 500 Darling St., disorderly conduct, third-degree assault, 10:10 p.m. Jan. 6: Todd C. Zagryn, 37, 28 Burning Tree, fifth-degree larceny, 11 a.m. Jan. 7: Jeffrey Olmstead, 31, 53 Maple St., Plainville, sixth-degree larceny, conspiracy to commit sixth-degree larceny, 2:40 a.m. Jan. 10: Kathleen B. Laramee, 54, 46 Garden Gate Road, third-degree assault, 8:15 p.m. Edward P. Laramee, 54, 46 Garden Gate Road, seconddegree breach of peace, 8:15 p.m.

Special Advance Screening Wednesday, January 27 at 7pm

Pizza

WhenInRome-TheMovie.com

OPENS NATIONWIDE JANUARY 29

© Touchtone Pictures

Continued from page 18

Complimentary Passes to the advance screening of “WHEN IN ROME”

Cit itiz ize en

Southington, CT 06489

246

1142484

1. Visit our Southington Office during business hours Monday from (9:00 am to 1:00 pm) to claim your passes. No phone calls. This film is rated PG-13. 2. Tickets are limited and are available on a first-come, first-served basis. Signature and identification required. The Southington 3. Limit 1 (admit-two) pass or 2 (admit-one) passes per family, per month. 4. Our office is located at 40 North Main Street, Southington, CT 06489. 5. Employees of The Southington Citizen and their immediate family are not eligible. 40 North Main Street, P.O. Box 6. NO PURCHASE NECESSARY.

— Best Sauce: Randy’s Wooster Street — Best Crust Taste: Hubbard Park — Best Crust Texture: Randy’s Wooster Street — Best Value: Townline — Best Taste: Townline — Quickest Delivery: Giovanni’s Overall Rankings: 1. Townline 2. Hubbard Park 3. Giovanni’s 4. Nico’s 5. Randy’s Wooster 6. Mack’s on West 7. People’s Choice For more information about the Newcomers and Neighbors Club, contact Kathleen Brock (860) 620-9479 or visit www.southingtonnewcomers.com.


The Southington Citizen Friday, January 22, 2010

INSIDE: Track competes at JV relays, page 38

CitizenSports

33

Crazy eight! Knights in tourney with win over Warriors By Michael Guerrera The Southington Citizen It’s Jan. 19th and one box has already been checked off on the boys basketball list of goals. That feat was reaching the state tournament when Southington picked up its eighth win of the season in its most recent win against Hall this past Tuesday, 54-44. Prior to that win, though, was a more precarious 36-28 victory against a defensiveminded Farmington squad that held the Knights well below their season average of 55 points, which they all but matched against Hall. Head coach Bob Lasbury said that no matter what, the win against Farmington was “absolutely” a good win. “This was number seven,” he said. “Unfortunately we didn’t get it the last time we got on the court (against Northwest Catholic), but we got it tonight. “Our goal is eight, that’s a big win for us.” They got that number eight behind 15 points from Nick Defeo against Hall. The senior guard also led the way with 16 against Farmington. More so in the Farmington game than against Hall, when the Indians defense was able to keep the rest of the Knights quiet, it was Defeo who continued to be the steady hand. “He’s a senior captain, a three-year varsity player, I think the only three-year varsity player we have, so his experience really helps out in these situations,” Lasbury said of Defeo’s calmness on the court. “He not only is a leader during games, but

in practice too,” Southington 36 Lasbury continued. Farmington 28 But what makes Defeo standout Southington 54 amongst a collecHall 44 tion of talent on Southington’s roster is his ability to not shy away from the pressure, continuing to get after it and make shots when there is seemingly a cover on the hoop. “I think he’s confident,” Lasbury said, explaining Defeo’s scoring ability. “He’s a good shooter and there’s a reason he’s a good shooter, he works on it in the offseason, works hard in practice too, so yeah, I think he’s a confident kid and shooters need that mentality.” And as if he had the power of foresight, Lasbury knew the importance of the Farmington win and the pending win that they eventually picked up this past Tuesday. “No. 8 is our first goal of our season and that’s to get back into the state tournament,” he said after the Farmington victory. Lasbury credited both the Farmington defense and a tough night offensively for the low scoring output, but against Hall, a team he called, “very similar team to Farmington,” Southington was able to score 17 more points. Some of that came from Tyler Dube, who had the best all-around night with 11 points, 10 rebounds, four steals and eights assists, as well as a big contribution inside from Sal Romano, who posted another double-double with 12 points and 14 rebounds.

“No. 8 is our first goal of our season and that’s to get back into the state tournament.”

Photo by Matt Leidemer

Sal Romano grabs a rebound in Southington’s seventh win of the season against Farmington.

See Tourney, page 35

Good showing at Farmington as swimmers continue improvement By Michael Guerrera The Southington Citizen Southington rode a wave of momentum and determination into the Miss. Porter’s pool for its meet against Farmington last Friday and almost came out the victor against an annual top 10 team in Class L. And even with the loss, there were a lot of smiles on the pool deck. “We swam a lot of best times to-

day and when you go against a good at Miss Porter’s in Farmington that team, that’s what you want to see,” was simply spectacular. “That’s why we wanted to come said head coach Jay Dubinsky after up here because it was originally the Farmington meet. “Even the kids that didn’t get best scheduled as a home meet,” Dubintimes, they were disappointed, so sky said of the less than five-yearyou know they’re going to work harder.” See Swim, page 34 Dubinsky was thrilled with his team’s performance and what may have lent itself to a good Photo courtesy of Jack Adie night for Southington could Bryan Adie is one of the many young have been the environment as they swam in a revamped pool swimmers making strides for SHS.


34

The Southington Citizen — Friday, January 22, 2010

Swim Continued from page 33 old pool. “But (changing it to here) gives our divers a chance to dive, and swimming in an eight-lane pool, it gives extra people a chance to swim too, so it was a perfect meet for us.” Now, with Windsor in the rearview mirror this past Wednesday, the Knights will continue to churn ahead and face a game East Hartford squad on the road later today. Returning to the Farmington meet, while a 93-88 final score doesn’t tell the whole story as the Indians went exhibition for the final two races, the meet and result had moments of doubt for the home team as the

e Tim r It’s Winte for riving p!! D k-u c Che

Knights kept it close. “Coming in we knew it was going to be tough to hang with them,” Dubinsky said of the matchup. “They basically had 70 kids try out for the team and cut it to 56 so they’re double the size that we have. Right then and there you know your numbers. I mean, we can take first place all day, but if they come back and do 2, 3, and 4, then it’s going to be a tough meet to win. Yet still, “I think we hung pretty good,” Dubinsky finished. On that night in Farmington, it was one through 26, or the entire roster making contributions, outside of continued good swims by standouts Michael Smigelski, Jesse Cooney and Colin Magaro. “Our depth has really

Mike’s Auto Services 320 Farmington Ave., Plainville 860-793-2811

OIL CHANGE $

1995

New Filter, Up to 5 Qts. Oil. Most Cars & Light Trucks.

per Axle

Brunetto

Most Cars & Light Trucks.

Construction, LLC Home Improvements & Remodeling Services

• Computer Diagnosis • Alignments • Tune-ups • Timing Belts • Batteries

Mention ad for a

15% Discount 860-518-1760 CT Lic. HIC 0617144

Offer Good Till 1/31/2010

1144619

1141404

10% Parts Discount

at the office and after a home meet this past Wednesday where she wasn’t able to dive, there is no doubt she is looking forward to the road tilt with East Hartford today. After finishing 12th last season at the Class L diving competition, she has come back this year with a resurgent attitude and expects perfection on the board time in and out. “In the meet today, she didn’t believe she took first place, she wasn’t happy with her dives,” head coach Jay Photo courtesy of Jack Adie

Kate Monbaron dives.

COMMERCIAL

Quality Oil at Discount Prices

1143893

AMERICAN OIL & HEATING, LLC

Tech-Net Professional Auto Service • Senior Discounts

PRIME

By Michael Guerrera The Southington Citizen

95

89

Same Price for Cash - Credit Card - Check

3-Cent Senior Discount • Volume Discounts 24-Hour Emergency Service • Automatic Delivery • New and Old Customers Are Always Welcome 1144683

Meriden - Enterprise Zone State incentives apply to this property zoned commercial C-1 for lease. Over 15,000 sq. ft. available. Valued at $8.00 sq. ft. Ideal for offices, Church w/ Day Care or light manufacturing.

For more details call R.E. Broker Harvey Criscuolo (203) 634-1864 (affiliated w/The Home Store R.E.) or email: criscuolah@bellsouth.net

self and maybe that will get him over the hump and you’ll see a lot more of him coming up,” he said. And even when a top guy like Magaro has an off day, Dubinsky knows that someone will be there to pick it up, which he describes as a “great thing to have.” The divers also continued their solid run as Kate Monbaron and Ryan Connors took one-two again. “This was the perfect meet at the perfect time,” Dubsinky said, hoping this meet would catapult his team through a strong rest of the season. Maybe, most importantly, Southington is on a slow march back to relevance when it comes to its state prowess as a swim program. “They want to get better,” Dubinsky said.

Mobaron continues to light up the sky For Kate Monbaron, last Friday was just another day

BRAKES $

“Shane Masters come togethSouthington 97 I think swam a er,” Dubinsky Hartford Pub. 76 best time in the explained of 100-yard freestyle, his roster. Farmington 93 Vlad Kiveliyk, he “Up front, Southington 88 came in as a butwhere we’re terflyer, he swims usually not the 200and 500-yard strongest up front, they came the through and then to have our freestyle and every meet so divers go 1-2 the second meet far, he has gotten a best time. Here’s a kid that’s a freshin a row, that was awesome.” Smigelski and Cooney set man, you know you’ve got personal bests in the 200- him for three more years and yard free and 200-yard IM, re- his potential is unlimited. spectively. Magaro had some Bryan Adie, coming in as a good swims, even though he breaststroker, swam the 200wasn’t as pleased with his IM last week. All these freshman coming in are going to times. Beyond this core group contribute for the next three were a second-tier of swim- years.” While the freshman are mers that Dubsinky highlighted, including senior the future, Dubsinky made Kyle Nitz, who put up his sure to realize the present in people like Nitz and Michael best time in the 500-free. “They’re all starting to Smigelski’s older brother. “Theo Smigelski swam the come up,” Dubinsky said of the team’s times across the breaststroke, best time of the year, really pushed himboard.

100-Gallon Minimum - COD We Honor M/C, Visa, Amex, Discover

860-517-8535 Plainville or 860-678-9992 Farmington Owner - Gary Antigiovanni

Former Owner of an oil company located in Plainville • Over 30 Years in the Oil Business

CALL TODAY FOR DISCOUNT PRICE & SAVE!!

Dubinsky said after the Farmington meet. But Monbaron did take first with a score of 161.1, almost 40 points better than

See Monbaron, next page


35

Friday, January 22, 2010 — The Southington Citizen

Tourney

FREE GIFT to First 100 People!

Continued from page 33 Romano on the year is averaging a shade under 11 rebounds and scoring just under nine a game to fall just shy of averaging a doubledouble, but his play inside has been a key for the Knights when they matchup against bigger opponents. “I think the second half Sal really stepped up, even though offensively he struggled a little bit, he got tougher and really limited that (big) guy on Farmington,” Lasbury said after the Farmington win. Now at 8-2 and only a single loss in the conference, Southington will easily get its toughest test of the year when they go on the road to face undefeated New Britain (10-0) who is tied at the No. 2 spot in the state according to the Connecticut Sports Writers’ Alliance poll. The Golden Hurricanes, also part of the CCC West, will come at Southington with a ménage of offensive weapons that includes Steven Glowiak, Tebucky Jones Jr. and Darius Watson, one of the more explosive trios in the state. That game tips off in New Britain tonight at 7 p.m.

Plenty of FREE Parking

Chili Chili Fest Ch ili Fest First Annual Chili Fest brings you the best local chili from the area’s leading restaurants and cooks. Sample and vote for your favorite ones. Trophies to be awarded to the Best Overall, Hottest and Best Display chili. All proceeds to benefit the United Way of Southington.

Featuring: ❑ The Groggy Frog ❑ Anthony Jacks ❑ Kess’ Cafe Restaurant ❑ Tops IGA ❑ El Sombrero ❑ Smokin With Chris ❑ TD Homers ❑ Machiavelli’s ❑ The Renegades ❑ The Wood-n-Tap ❑ Saints ❑ Senior Pancho’s ❑ Crossroads Cantina ❑ Jerzie Joe’s Sports Bar & Grill ❑ Paul Gregory’s

Monbaron Continued from page 34

Sat., Jan. 30, 2010 • Noon-3:00 PM 1144010

her diving counterpart, Ryan Connors. It’s also clear to everyone, except maybe Monbaron, that she is a force to be reckon with on the board meet in and out, as well as when the state tournament rolls around, both the class and open meets. “The officials when they come back, they remember her when she started compared to where she is now, her dives are really tight, she’s getting up off the board, execution is great,” Dubinsky relayed about Monbaron, “so we’re looking at states and saying, ‘this is her year so let’s see what she can pull off.’” She certainly will have that chance.

United Way of Southington

$

Elks Club, 114 Main Street, Southington, CT

★ SPONSORS ★

Eastern Bag & Paper Awards of Elegance The Southington

Title Sponsor

Cit itiz izeen

r e p 10 son per


36

The Southington Citizen — Friday, January 22, 2010

Blue Knights Scoreboard

Ice Hockey Hall-SHS 6, Fitch-East Lyme-Ledyard 4 The inter-conference win moved Hall-Southington to 44 on the season. Rockville-Manchester 5, Hall-SHS 2 Nick Mastroianni had a goal and an assist for the Warrior-Knights, but it was not enough to take down Rockville-Manchester. Kevin SanAngelo had the goal on the Mastroianni assist, Nick Carpenter assisted on Mastroianni’s tally. The inter-divisional loss dropped HallSouthington to 4-5. Outlook: See page 37 Boys Basketball SHS 36, Farmington 28 Nick Defeo had 16 points, including two threes, and Southington used a 14-1 run, after Farmington tied the

score at 20 at the beginning of the third quarter, to seal the win. Sal Romano had 15 rebounds. Southington moved to 7-2 overall, 4-1 in the CCC West. SHS 54, Hall 44 Tyler Dube had 11 points, 10 rebounds, eight assists and four steals and Defeo led the team with 15 points as Southington clinched a spot in the Class LL tournament, moving its record to 8-2 overall, 5-1 in the CCC West. Romano had a 12 point, 14 rebound double-double and Jordan Lamson added 10 points. Outlook: See page 33 Girls Basketball Farmington 39, SHS 29 Southington didn’t have a player with double-digit points as they fell to 6-5 on the year, 3-3 in the CCC West.

Since 1943 ... Quality and Service • Automotive • Marine • Truck • Industrial • Computers • Gel-Cell • Deep Cycle • Solar • Antique Cars • Wheelchairs • Diesel Engines • Lawn Mowers • Golf Carts • Bus & RV • Motorcycles • Battery Rebuilding • Scrubber & Sweeper • Battery Cables & Chargers

— WHOLESALE AND RETAIL BATTERIES — 51 Deming Road, P.O. Box 8005, Berlin, CT 06037 Phone (860) 828-6007 Fax (860) 828-4540 s r

r

Jordyn Nappi was the leader with eight points, Val Mazrek had six and Mariah Berry had five. Hall 37, SHS 35 Nappi had 11 points and Berry had six, but Southington fell on a late field goal that capped a 13-3 run to end the game for Hall after Southington went on a 15-2 run in the third quarter to take a six-point lead. The loss was the Lady Knights third straight, dropping them to 66 on the season, 3-4 in the CCC West. Outlook: See page 37 Wrestling SHS 40, Middletown 37 Nick Sforza (145), Nick Solomon (119), Doug Fontaine (130), Cory Seeger (140) and Travis Daly (285) all pinned their opponents in the win that made Southington 9-4 overall. Carmine Castiglione (189) and Ryan DuPuis (135) nabbed technical wins. Greater Hartford Open Southington took second place with 210 points, behind

a 250 point day from Plainville. Taking firsts were Fontaine (130-pounds) and Christian Bowles (112) by pinfall and Seeger (140) by decision. Finishing as runner-ups were Tyler Mirando (103) and Castiglone (189). Nabbing third place were Solomon (119) and Pat Hamel (125), by pinfall and DuPuis (135) by major decision. Daly (285) finished in fourth place. Outlook: Consistency has been the name of the game all year on the mat and while Southington has all but dominated its dual meet schedule, they will continue to get tested in the weekend tournaments. Boys Swimming and Diving SHS 97, Hartford Public 76 The Knights took the top three spots in the 200-yard free, individual medley, 100yard fly and 500-yard free as well as the top two spots in the 200-medley relay and diving as they cruised to the win. Taking firsts were

WINDOWS PLUS

TM

1143034

All Style Window NFRC CERTIFIED

Open to the Public Monday 2 pm-9 pm Tues. thru Fri. 10 am-9 pm Sat. 9:30 am-9 pm Sunday 9:30 am-5:30 pm

ON SALE

21 North Plains Ind. Rd., Wallingford, CT • Visit Us At www.windowplusinc.com• CT Reg # 574938 • fully Insured

HOGUE REPAIR Repairs & Towing • Family Owned & Operated

1406 Chamberlain Hwy., Kensington

• Gift Certificates • • Retail Gun Shop • Private Instruction • Firearm Rental • 15 Ports - 75’ Distance • Law Enforcement Rates • No Membership • Guard Card & Blue Card Courses

860-829-9700 10% SENIOR CITIZEN DISCOUNT

Courses include: Classroom Instruction Range Instruction Range Time Use of Guns & Ammo

1143891

860-585-0447

Remember ... Safety First. W W W . WO L F S R A N G E . C O M

10% OFF* 1144732

Call for Class Schedule

Best Prices Guaranteed! Tax Exempt “Energy Star” Fed. tax Credit Qualified

FREE ESTIMATES 1-877-567-5914•203-269-8723

597 Middle St. (Rt. 229), Bristol

NRA Pistol Permit Courses Only $125

ENERGY WE ENERGY ALSO OFFER: ENERGY ENERGY STAR STAR COMPLIANT “CASH &COMPLIANT CARRY” SALES STAR STAR COMPLIANT COMPLIANT Contractors & Do-ItYourselfers 1140982

Made in U.S.A.

Nationaly Rated Energy-Efficient Windows

any transmission service *Most cars. With coupon.

PHH Service Fleet Certified Service PHH Center

Oil Change

10% OFF*

15.95

any major engine repair

$

*

*Most cars. Plus taxes & fees. Up to 5 qts. Synthetic oil extra.

*Most cars. With coupon.

- Full Service - Free Towing with all Major Repairs MAJOR REPAIRS • FUEL • DIESEL • TRANSMISSION WORK • OPEN MON.-FRI. 9-5

Swim team bottle drive A can and bottle drive, sponsored by the Southington High School swim and dive team will be held Saturday, Feb. 13, from 8 a.m. to 2 p.m., in the high school auditorium. All proceeds benefit the team.

Michael Smigleski, Jesse Cooney, Jared Dubinsky, Kate Monbaron and Colin Magaro, amongst others. Southington moved to 3-0 on the year. Farmington 93, SHS 88 Smigelski was the only two-event winner as Southington was able to garner first place in a number of events, but could not match Farmington’s depth in the loss. Smigelski took first in the 200-yard free (1:57.01) and 100-yard fly (1:00.43). Dubinsky was first in the 100-yard IM (2:15.41), Cooney was tops in the 100-yard back (1:02.72) and Southington finished 1-2 in diving with Monbaron in the top spot (161.10) followed by Ryan Connors (122.75). Other winners were Theo Smigelski, 100-yard breast (1:15.66) and the 400-yard free relay team of Magaro, Michael Smigelski, Cooney and Kyle Nitz (3:51.36). The meet was the first in conference, making the Knights 0-1 in the CCC West, 3-1 overall. Outlook: See page 33 Gymnastics SHS 137.75, Farmington 111.00 Liv Morrell placed second in the all-around with a score of 34.7 as Southington eked out the win. Toni Penta finished fourth in the all-around at 33.85. Katelyn Hyde won the beam with a 9.0 and Morrell had a 9.0 to win the floor exercise. Outlook: Don’t look now but the pieces are all there and here comes Southington gymnastics as it tries to reassert itself as the state’s best team.


37

Friday, January 22, 2010 — The Southington Citizen

Hockey team’s inexperience plays a role Three game skid for girls By Sarah Gomes Special to The Citizen Youth will be the driving force behind the success of the HallSouthington hockey team this season after losing eight starters to graduation last season, only returning a pair and carrying 14 freshmen. “Youth is our strength and weakness, we’ll take some lumps (this year), but the next few seasons should have us back in the mix,” head coach Brian Cannon said. “Our biggest difficulty this year will be scoring, we have limited ability to generate offense and a very limited number of guys who can finish, (but) I think it will come along as the kids mature, get stronger and gain some savvy.” With the emerging leaders that this team has though,

west Catholic the team has col6 this Saturday lected 18 goals in 10 Hall-SHS who holds a 7-2games this season. Fitch-East 1 record at the “Kevin SanAn- Lyme-Ledyard 4 mid-point. Algelo and Andrew though the Green are our cap- Rockville5 game will be a tains and leaders,” Manchester 2 tough challenge Cannon said. Hall-SHS for Southing“Brett Schaefer and Tom Carr have been sol- ton, Cannon sees the potential this team possesses lookid at (defense).” Although goal-scoring ing towards the future. “We only graduate three might not be the Blue Knights’ strong suit, a seven- players and have a sophogoal opener over Windsor- more and two freshmen East Granby in the begin- goalies so the potential is ning of the season was a there.” For this first-year good way to start. “Steve Breault and Dan Southington coach it will O’Malley give us strong ef- only get better, as his surforts up front,” Cannon said. roundings have made the act “Nick Mastroianni and Greg of coaching one he enjoys Zmarlicki are both strong even more. “I see the commitment of juniors and Nick Carpenter (also junior) will need to parents who have to trudge shoulder responsibility and their ‘too young to drive provide some scoring to keep kids’ to West Hartford everyday and hang around, espeus competitive.” Halfway through the sea- cially for 5:00am practices son this team sits at 4-5 head- and realize that I have it preting into a match with North- ty easy,” Cannon said.

control. But Hall outscored Southington 15-7 in the fourth and made a lay-up The past with seconds left on the clock two weeks and Jordyn Nappi’s threer e p r e s e n t e d pointer looked good, but what is likely clanged off the rim, handing the toughest Southington the loss. While head coach Jim stretch of the season for the Southington DiNello doesn’t believe in girls basketball team and it is moral victories, this outcome was much better than rearing its evil head. The CCC West four-headed the first time these two teams monster started with the met. “We walked into the game state’s No. 1 team in Northwest Catholic, then followed and I said, ‘It’s the first time we’ve played a with maybe the team for the secsecond-best team Farmington 39 ond time all year in the CCC West, Southington 29 since Dec. 11, the Farmington. last time we Then followed Hall 37 played these Hall and tonight, Southington 35 guys and they New Britain beat us by 28 comes to town. But the most recent loss points, let’s see how far we’ve was the most bruising. After grown,’” he said. They have clearly come trailing at halftime, 20-13, Southington took the lead quite a ways. with a 15-2 third quarter and seemed to have the game in See ’Canes, page 38 By Michael Guerrera The Southington Citizen

Plug into Solar Power

SM

You can have solar power installed with NO up front costs through the CT Solar Lease Program. groSolar, a leading installer in CT and nationwide, will make it easy for you. Sign up for a free site evaluation at .476.7652). www.groSolar.com or call 866.GRO.SOLAR 800.GRO.SOLAR(866 (800.476.7652).

1138974

$0 DOWN, LOW, FIXED MONTHLY PAYMENTS FOR SOLAR ELECTRICITY, OPEN TO QUALIFIED CT HOMEOWNERS.


38

The Southington Citizen — Friday, January 22, 2010

’Canes Continued from page 37

“I was really proud of the way the kids battled and that’s the way I left them,” DiNello said quietly after his locker room talk with the team. “I would say that we grew, but it hurts when you grow to the point where you have a chance to win and you just don’t quite get over the hump.” Still, the sting from the loss was resonating throughout the Southington gym, even after it emptied out. “This one hurts,” DiNello said. It’s only Jan. 22 and the season is far from lost so DiNello hopes this can be a lesson for the girls. “I told the girls that I hope what it does is it inspires them to see how far they’ve come, but not only that, but to put it in perspective and see how far they can go,” he said.

SINGLES SATURDAY DANCE

IV

1144698

January 23rd • 8 p.m.-12:30 a.m. in the ballroom of

165 Brainard Rd., Hartford (Exit 27 off I-91) DJ/Top 40 & Soft Rock Coffee & Dessert • Cash Bar Dressy Attire • Adm. $14 - (at door)

Photos courtesy of Annie Groom

Top left: Girls 3 x 1000-meter relay, from left, Mel Reid, Hannah Chamis, Alyssa Lombardi. Bottom left: Boys 3 x 1000-meter relay, from left, Nate Petropolus, Miles Groom, Nick Garcia. Right: Miles Groom finishing and winning the 1000-meters.

R sina’s Restaurant & Pizza Authentic Italian Food

991 South Main St., Route 10, Plantsville, CT 06479

Call today to order your Super Bowl Party Platters!

Apizza & Pasta Restaurant

Eat-in or Takeout Closed Tuesday

(860) 426-2266 Pizza, Pasta & Grinders • Daily Specials

378 North Main Street•Southington, CT 06489

860-621-6005 CATERING SPECIAL

1142018

Roasted Chicken, Sausage & Peppers, Ziti, Salad, Bread & Butter

$ THE BLIND SIDE 100 645

PG–13

AVATAR 1245 405 725

PG–13

R

IT'S COMPLICATED 115 350 635 930 LEAP YEAR 400 935 THE BOOK OF ELI 1255 410 715 955

R PG

Sun.-Thurs.

THE SPY NEXT DOOR 1250 255 500 710 920 PG PG

EXTRAORDINARY MEASURES 130 420 655 945 PG LEGION 105 330 650 925

R

TIMES FOR 1/22/10 ONLY © 2010

1142173

TOOTH FAIRY 1235 300 520 740 1000

Best Pizza Other Choices Available

$20.10

R

THE LOVELY BONES 1240 340 640 940 PG–13

RENALDO’S APIZZA & PASTA

ONE LARGE PIZZA WITH MOZZARELLA

75 Center Street, Southington, CT

(860) 426-9920 Gift Certificates Available

Per Person

• Birthdays • Graduation Parties • Family Reunions • Anniversaries and more ...

2 Entrees 2 Salads Appetizer

SHERLOCK HOLMES 110 355 705 950 PG–13

6.75

No substitutions please - 15 Person Min.

2010 Dinner Special

ALVIN AND THE CHIPMUNKS: THE SQUEAKQUEL 1230 240 450 700 910 PG UP IN THE AIR 125 345 630 900

1141691

NEXT SAT., JAN. 30th, Meriden DANCE Sheraton Four Points Hotel

JV Relays at Glastonbury - Jan. 9

1144873

“for SINGLES only ...” dances Info: (860) 633-0600 • 1-800-824-3083 www.singlesdances.com (inc. map)

New Britain comes to town today and that will be another great test and even though the ’Canes lost state player of the year Symone Roberts, playing basketball at Providence College, and senior leader Sarah Sideranko, they are not “down.” “They’re not real down because Tyler Kimball’s back,” DiNello said of New Britain. “Sure you lose a Symone, but then when you pickup three really good players from Capital Prep, you’re not down.” The most important outcome from tonight’s New Britain game is maybe not the scoreboard at the end of the night, but how the team responds after two days of practice to sit and think about the Hall loss. “What I said to the girls on the way out is, ‘So maybe we fell a little bit because we didn’t come out on top on the scoreboard, but we talked at halftime and it’s not whether you fall, because everybody falls, it is how you get up.’ And we’re going to see how we get up.”

VALID TUES., WED. & THURS. ONLY!

SC

exp. 2/15/10

“w/ this coupon”

ONLY

1000

$

(cash only)

EXTRA ITEMS $2.00 EACH


39

Friday, January 22, 2010 — The Southington Citizen

Snow Views Photos courtesy of Dave Mongillo

Left: Bruce Sandstrum Right: A snowboarder takes advantage of an obstacle at Mount Southington. Bottom left: A skier flies through the course at Southington. Bottom right: Another young skier enjoying their time on the fresh powder. Below: Three young skiers take a ride on the new Thunderbolt Triple chairlift this past weekend.

1144281

Named best pizza in Southington for a third year in a row

Best Pizza in Southington

YellowFin’s SEAFOOD GRILLE

44 Center Street • Southington

Is a hidden gem in the heart of Cheshire! Serving Connecticut’s Freshest Seafood & Certified Angus Beef

One FREE Appetizer With purchase of 2 Entrées (Excluding Jumbo Lump Crab Cocktail) Valid thru Feb. 12, 2010

1027 S. Main Street, Cheshire • 203-250-9999 (in the Everybody’s Plaza)

www.yellowfinsseafoodgrille.com

1136072

860-620-1234

“The only thing warmer than the pizza is the atmosphere!”

Hours: • Mon.-Thurs. 4:00 PM-1:00 AM • Fri. 4:00 PM -2:00 AM • Sat. 11:30 AM-2:00 AM • Sun. 11:30 AM-1:00 AM Buy 4 Large Pizzas

Receive 1 Large Pizza Free To-go orders only. Cannot be combined with any other offer. Expires: 2/10/10

FREE Small Cheese Pizza With the purchase of any large specialty Pizza.

w s sho Let u r Wood u you o d Taste e r i F

Cannot be combined with any other offer. Expires: 2/10/10

www.thefireplacect.com


40

The Southington Citizen — Friday, January 22, 2010

Softball/Little league reg.

Town Sports Briefs Lax open house

The Southington Lacrosse Association will be holding an open house and 2010 spring registration for boys and girls grades one through eight on Jan. 31, from 12:30 to 3 p.m., at the Southington YMCA. All new and returning players welcome. There will also be the opportunity to meet the coaches, players and vendors. Register online at www.southingtonlacrosse.org or at the open house. Cost is $110 for grades five to eight (juniors/sen-

iors), $95 grades two to four (Bantam travel/equipment included), $40 grades one to three (in-town only), $55 equipment rental fee (boys grades five to eight only) and $20 family discount (Bantam travel, juniors, seniors). Medical insurance information is needed for registration. Major credit cards accepted for registration fee. Checks payable to “SLA.” Mail registration forms, checks and waiver forms to SLA, P.O. Box 345, Southington, CT 06489.

Blue Knights Week Ahead

A town-wide registration for all Southington Little Leagues and Girl’s Softball is scheduled for Saturdays, Feb. 6 and 13, from 9 a.m. to 1 p.m., in the Southington High School cafeteria, 720 Pleasant St. This is for Southington residents only; the minimum age is 5 years old as of April 30, 2010. Parents should bring the child’s birth certificate and the parent’s driver’s license for proof of residency. For more information, call the Parks and Recreation office at (860) 276-6219.

Wrestling 1/23 @ Timberlane Tournament 1/27 vs. Newington

Boys Basketball 1/22 @ New Britain 1/26 vs. Rocky Hill 1/29 @ Simsbury

Boys Swimming and Diving 1/22 @ East Hartford 1/26 @ Simsbury 1/29 @ Bristol Co-op

Girls Basketball 1/22 vs. New Britain 1/26 @ Rockville 1/29 vs. Simsbury

Indoor Track 1/29 2 SCC Coaches Invitational

Gymnastics 1/29 @ South Windsor 1143512

1142798

Gilbert’s Home Improvement 25 Years Windows, Doors, Decks, Siding, Kitchens, Baths, Roofing & Seamless Gutters. All Phases of Carpentry, incl. Drywall.

Family and Cosmetic Dentistry New Patients Always Welcome 779 Farmington Ave. West Hartford, CT 06119 860-523-7474

860-620-0246

1139064

CT Reg. #516786

ALLIANCE PLUMBING SERVICES LLC

20 Pine St. Plainville, CT 06062 860-793-2211

Over 20 Years of Experience Call Now for a Free Estimate

“SER “SERVICE “SERVICE VICE DONE DONE RIGHT” RIGHT”

Ceiling/Wall Repairs

1142547

WATER TER HEA WATER HEATERS, BATH W HEATERS, KITCHEN AND AND BA BATH REMODELING 24-HOUR SERVICE 24-HOUR EMERGENCY EMERGENCY SERVICE COMPLETE REPAIR COMPLETE FIXTURE FIXTURE REP REPAIR AIR

Painting (Interior & Exterior)

OWNER OPERA TED OPERATED SENIOR SENIOR DISC. DISC. 860-621-6993/203-407-1664 860-621-6003/203-407-1664 ALLIANCEPLUMBING@SBCGLOBAL.NET ALLIANCEPLUMBING@SBCGLOBAL.NET

1143053

B U S I N E S S

Ice Hockey 1/23 @ Northwest Catholic

860-877-5146

Taping

Check out my customer fpaquet@francispaquetpainting.com testimonials on www.francispaquetpainting.com

FULLY FULLY LIC. LIC. && INS. INS. P-1 P-1 279678 279678 CT CT

CT Reg. #611818

Plantsville, CT 06479

Treadmill Tune-up Special

CT Treadmill Repair 1144505

“Keeping You In Stride” House Calls John DiGirolamo Owner/Service Technician 860-384-3269

Target Your Market with Inserts!

ull’s

B

PO Box 163 Plantsville, CT 06479 www.cttreadmillrepair.com

ACE Appliance

Eye

SALES • SERVICE • PARTS 1142760

g ketin

Mar

(203) 317-2270 FAX (203) 630-2932 CT 1-800-228-6915, Ext. 2270

Ron Nagy Sales Representative

• • • • •

69 West Main St. Plantsville 860-621-5534

Gas Heating Stove Specialists Good Reconditioned Appliances Over 5000 sq. ft. of new and used parts in stock Residential & Commercial Appliances Serviced Daily! Bosch authorized service center

We Fix’ Em Fast/Emergency Service

Same Day Service

1144076

P A G E

1144815

C A R D


41

Friday, January 22, 2010 — The Southington Citizen gram members and new campers will be allowed to register beginning Feb. 1 at the Southington or Cheshire Community YMCAs at any time during regular business hours. Registration will also be available online at www.ymcacampsloper.org beginning at 9 a.m. on Feb. 1. All campers must have a current YMCA membership to register. YMCA Camp Sloper offers four consecutive, two-week sessions from July 5 to Aug. 27. There is also a one week preview that will be held June 28 to July 2. The Wanderers program, for 3- to 5-

Camp Sloper early registration Early Bird Registration for YMCA Camp Sloper will be held at the Southington Community YMCA on Jan. 31 beginning at 7:30 a.m. This event is a priority registration for 2009 campers and full members of the Southington and Cheshire Community YMCAs only. Families with campers who will be doing a specialty camp this summer are encouraged to attend as these programs tend to fill up the quickest. Registration for traditional camp is also available. Pro-

year-old campers will be offered in one-week sessions from 9 a.m. to 1 p.m. all summer including Preview Week. The day camp program for campers entering kindergarten thru tenth grade will run Monday through Friday from 9 a.m. to 3 p.m. with extended camp care available before and after camp if needed for an additional cost. Bus transportation is provided in Southington, Cheshire, Berlin/Kensington and New Britain. There is no bus service for Wanderers. Bus schedules will be posted on the website at www.ymcacampsloper.org.

Paint, Wallcovering & Home Repairs

Paul R. Mastrianni

Interior & Exterior Painting Wallpaper Installation and Removal Ceiling and Wall Repairs • Carpentry Interior and Exterior • Decks and Deck Repairs Rot • Termite • Ant • Water Repairs Free Estimates 860.793-8403 - Office 860.919.4260 - Mobile

YEAR ROUND MAINTENANCE & LANDSCAPING Snowplowing • Tree Cutting & Chipping • Junk Hauling • Roof Gutter Cleaning • Mulch

860-621-6332

1143902

Commercial & Residential Insured Service State Reg. #545796

Full Cord •

1

⁄2 Cord • 1⁄4 Cord

1140421

Firewood Delivered In-yard Pickup Available • 50 Mastrianni Place 20 pieces & up

Insured

License #0563344

A Sharp Edge

Paul’s Handyman Service

Knives & Shears Sharpened

Phone # 860-585-1514

A portion of the Proceeds Benefits Southington Community Services

Free Estimates / Friendly Service 1141281

1142974

Specializing in Small Jobs & Minor Repairs

Residential & Business Sharpening Knives, Scissors, Hairsyling Shears

96 Candlewood Lane, Southington

toolbox_in_ct@sbcglobal.net

Insured

operations in the country. To qualify for this status, YMCA Camp Sloper is required to meet nationally recognized standards focusing on program quality, healthy, and safety. This assures parents that their children will have a camp experience that is both fun and safe. For more information, visit the website at www.ymcacampsloper.org. or call YMCA Camp Sloper at (860) 621-8194. Online registration will also be available through the site beginning Feb. 1.

1142798

OVER 30 YEARS EXPERIENCE • I CAN SAVE YOU $$$$

Realizing that the economy has made times difficult for families, the YMCA has chosen not to increase any camp fees for the second year in a row. Financial assistance is also available for qualified families who live in Southington or Cheshire. Contact Lynn Palmieri at the Southington Community YMCA at (860) 426-9515 or Karen Thuerk at the Cheshire Community YMCA at (203) 272-3150 for more information. YMCA Camp Sloper is accredited by the American Camp Association, the only independent accrediting organization reviewing camp

860-919-8145

CT License #0619835

1143884

“Quality Service You Can Count On”

JR

Lic. #303265

Heating and Cooling, LLC. & Appliance Services, LLC.

860-793-2686

Now servicing all major brand appliances, central heating systems, boilers, central a/c systems & window units!!! 1140216

Call Today to Schedule & Save!!!

B U S I N E S S C A R D

www.jrheatandcool.com

Target Your Market with Inserts!

Eye

“All Pet Foods, Supplies & Accessories”

eting

Mark

Ron Nagy Sales Representative

Pets Always Welcome 1142511

(203) 317-2270 FAX (203) 630-2932 CT 1-800-228-6915, Ext. 2270

1656 Mer.-Wtby Rd., Milldale CT 06467 (860) 426-9640

1142760

B

ull’s

Pet Playhouse

All Natural Dog & Cat Foods Unique Toys Supplies Treats Bus. Hours: Mon.-Thurs. 10 AM to 6 PM: Fri. 11 AM to 6 PM: Sat. 10 AM to 4 PM

P A G E


42

The Southington Citizen — Friday, January 22, 2010

Entertainment Briefs Folk performance

The Twice Around Duo will perform at Jitters Cof-

feehouse, 1273 Queen St., Southington, 8 p.m. Friday, Jan. 22. Maggie Seligman will perform at Jitters 8 p.m.

SUDOKU ANSWER

CROSSWORD ANSWER

1144298

Saturday, Jan. 23. Seligman grew up in New York City and has listened to and been influenced by music and vocal styles of all types, ranging from standards and jazz to folk/traditional/roots. Though her sound and interpretation are entirely her own, they reflect a strong mix of styles and traditions, leading her to describe her music as “eclectic acoustic.” In performance, Maggie delivers powerful and passionate interpretations of her originals as well as fresh takes on American and

British traditional songs, folk, and standards. She possesses “a very interesting, unique sound which I was quite captivated by. Very lyrical, good sense of harmony, good pitch, and excellent vocal communication,” as one reviewer expressed to a booking agent at a Connecticut venue. Maggie can be heard regularly at the Towne Crier Café in Pawling, NY, where she has opened for singer/songwriter Christine Lavin and for Dave Cousins of the Strawbs as well as participating in Showcases and the

Open Mic Finals. She produced and performed in “Music for Four Voices” at Arts on the Lake in Lake Carmel, NY, and also appeared there in “An American Music Concert” and their “Open Mouth” events. She developed the concept for, wrote, and appeared with Steve Kirkman and Sylvia Brooks in “The Music of The Grapes of Wrath: Readings and Songs,” also at Arts on the Lake. She has performed at coffee houses in Connecticut and New York and at a variety of East Coast festivals and venues. Her first album, “Rubato,” was released in early 2009.

Pasta supper

“Using advertising in the Southington Citizen has allowed us to send the YMCAs message out to our members and prospective members.

The Youth Group of the First Congregational Church located at 37 Main Street across from the Town Green invite you to a pasta supper to support their February mission trip to Mississippi. While in Mississippi they will be helping with Hurricane Katrina clean-up. The pasta supper is to be held on Jan. 30 at 6 p.m. Ticket prices are $7.50 per person or $3 children under five. Tickets available by calling the church office (860) 6286958. After the supper you’ll want to enjoy the First Congregational Church Steeple Players teen production of Snow Angel, a drama told through journal entries and interactions among 15 students over the course of a single snow day. It will be at 7 p.m. in Peace Café. Other performances on Jan. 29 at 7 p.m., Jan. 30 at 1 p.m., Jan 31 at 1 p.m. Tickets are $10 per person. All proceeds will be donated to our February Youth Mission Trip. Tickets available by calling the church office at (860) 6286958.

The Record-Journal and the YMCA have developed a great relationship over the years and we appreciate that partnership.”

Tony Palmieri - Director of Operations Southington YMCA has been in business for over 81 years!

Southington YMCA 29 High Street Southington, CT 860-426-9508

Helping you stay connected to the community! Doug has been with the Record-Journal/ Southington Citizen since 1995, servicing the Business Communities of Southington and Waterbury. If you would like Doug to visit you, call 860-620-5960 ext. 3407 or email Doug at driccio@thesouthingtoncitizen.com.

1143626

POWER OF PRINT IT WORKS

Outback night

Support Southington school children simply by enjoying a hearty meal Jan. 23, at the Outback Steakhouse on Queen Street. The Southington Education

See Ent. brfs, page 44


The Southington Citizen Friday, January 22, 2010

CitizenReal Estate

Building Permits Roger Mellitt, 30 Commission St., fireplace insert, $3,000. Robert Desjardins, 13 Sycamore Road, siding, $3,000. Ed Snedeker, 67 Woodruff St., roof, $4,900. Deb Ploude, 566 Meriden Ave., roofing, $5,000. Calco Construction, 44 Applegate, deck, $2,000. Ronald DeJohn, 4 Beech-

43

Property Transfers

wood Drive, vent-free fireplace, $1,100. Stephanie Sinicrope, 79 Debbie Drive, pellet stove, $4,000. Southington Remediation Services, 323 Clark St., roof, $50,000. Matthew Lee, 259 Mulberry St., remodeling, $3,000. A and E Friends Realty, 15 N. Liberty St., remodeling, $1,000.

Frank C. LaRosa to Richard and Marjorie Garuti, 451 Mulberry St., $121,000. John E. and Carol W. Boyce to Peter and Jessica Dellaria, 16 Carrier Court, $279,000. Applegate Estates to John E. and Carol W. Boyce, unit 3, 90 Applegate, $380,000. Estate of Thomas J. DePaolo to Michael T. and Irene A. Najarian, 189 Summit St., $265,000.

Janice Faulkner and Carol Kaleta to Janet R. Clark, 18 Luty Drive, $248,500. Michael T. and Irene A. Najarian to Paul M. and Doris E. Hochstrate, 65 Maxwell Drive, $245,000. Mark D. Dellavecchia, Tony J. Dellavecchia, Pascal Dellavecchia, Eleanor Welch, Marie Binkowski, Diane McNicholas and Kathy Moss to AA Denorfia Building and Devel-

opment, 300 Mill St. and 159 Howard Ave., $200,000. Imperial Spring Holding Co. to 339 Clark LLC, property off Clark Street, $755,500. Brenda J. Volpe, Doreen A. Riera, David B. Mals, Kathleen M. Stockwell and Robert S. Mals to Thomas Mele and Kelly Champion, 102 Wonx Spring Road, $236,000.

Person of the Year, Chris Palmieri; Reaching Out Award, ESPN; Unsung Hero Award, Eldon Hafford; Character Champions, Dawn Garvey, Kathy Dupre, John

Phillips, Katie Totire, Justin Hubeny and Adam Dubois; Youth Leadership Award, Emily Socha and Mathue

YMCA Briefs Registration is now open for the Southington Community YMCA’s Jan. 27 and February Fun Days. Winter recess is February 15-19 for Southington schools. When there are scheduled days off from school, the YMCA offers a day of exciting activities from 6:30 a.m. to 5:30 p.m. Age appropriate Fun Day trips or “in-house” presenters are planned for children in grades kindergarten to 8. Please see the detailed Fun Day brochure at the YMCA Learning Center, at the Member Service desk or go online at www.southington-cheshireymca.org for more information and for registration information. Space in the program is limited. If you have questions, please call the YMCA Learn-

Indoor Triathlon The Southington Community YMCA is hosting an Indoor Triathlon Challenge Feb. 7. Non-members are also welcome to participate. This is a good test for the upcoming triathlon season for veterans or a chance for beginners to get a taste of the triathlon experience. All events will take place at the Southington Community YMCA utilizing the indoor pool for a 15-minute swim, the indoor group cycling studio for a 30-minute ride and the treadmills for a 15minute run. Start time is 7 a.m. Check-in is scheduled for Feb 5 at 6:30 p.m. Pre-registration is required no later than Feb. 3 and can be made at the Southington YMCA

Membership Services Desk or online at www.southington-cheshireymca.org. The fees are: $25 for YMCA members, $35 for non-members and $15 for students (ages 14 to 18). For more information, please contact Jen McAulife at (860) 426-1904.

See YMCA, page 44

WELCOME TO OUR NEW AGENTS

Annual meeting The SouthingtonCheshire Community YMCA has scheduled the 81st annual meeting for Wednesday, Jan. 27, at the Aqua Turf Club, with the theme Celebrating the Arts. Social hour begins at 5:30 p.m., with dinner to be served at 6:30 p.m. Board President Terry Lombardi will preside over the meeting which will also honor several individuals in the community, including:

501 Farmington Ave, Farmington 953 Farmington Ave, Berlin

Helena Drelichowski is back and ready to make your dreams come true. Dolores Dehm, and Liz Wicklund are teaming together to find you the best buy for your dollars. Joseph Morabito is eager to meet you and fulfill your real estate needs.

Dolores Dehm 860-543-0788

Helena Drelichowski 860-205-0918

Joe Morbabito 860-869-4245

Liz Wicklund 860-543-0488

www.cthomeseekers.com EQUAL HOUSING OPPORTUNITY

Meriden 203.634.1876 Southington 860.621.8378 All offices independently owned and operated

1144708

NOW SERVING RHODE ISLAND

Southington (860) 628-8180 Plainville

(860) 793-4000

Quality Service 2008

Lil-1 Associates, Inc. Go to c21lil1.com to view MLS area listings.

ING

N

EW

N

PR

N

EN

EN -3 OP N. 1 SU

EQUAL HOUSING

INDEPENDENTLY OWNED AND OPERATED

OPPORTUNITY

VISIT openhouse.com FOR OPEN HOUSES THIS WEEK.

ICE

IST

L EW

#1 Century 21 Office in CT Now Hiring!

SU

875 South Main St. #8 SOUTHINGTON $169,700 Reduced! All set & ready to move in. Absolutely gorgeous inside! Quaint complex near center of Plantsville. Full finished lower level. John Perriello MLS# G547115.

SOUTHINGTON $424,900 Reduced! Cape Cod on approx 1.25 acres w/easy access to I-691. Approx 2970 sq. ft. 5 BR, 1st flr. master suite, marble & granite. A must see! Agent/Owner Craig Fournier MLS# G548705.

SOUTHINGTON $99,900 Nicely updated Condo. New flooring, new appliances, updated kitchen & washer/dryer included. Convenient to shopping & highways. Dan Ross MLS# G542397.

SOUTHINGTON $205,000 Ranch w/generous sized rms. & great yard. On over an acre plus can be purchased w/lot next door for an addl. $105,000 (MLS G539909). Gary or Erin Mancino MLS# G539901.

SOUTHINGTON NEW CONSTRUCTION Open flr. plan, HW, master suite & generous allowances on 1 acre. Customize your plans! Starting at $455,900. Agent/Related Lisa Milo-DiTullio MLS# G538581.

SOUTHINGTON COMMERCIAL Lease $5.75 per sq. ft. up to 8500 sq. ft. with loading dock. Can be subdivided. 16 ft. ceilings with 3 phase 400 amps. Gary Mancino MLS# G512697.

1-3

OP

BRISTOL

SOUTHINGTON

MERIDEN

WATERBURY

Multi-Family... Property sold “as is”. 3 side-byside Townhouse style units with private entry. One (1) bedroom unit in lower level. Unit 29B has controlled heat thermostat installed. Fire Marshall approved. Newer roof. Convenient access to new Route 72. $269,900. Frank Mirmina x303. MLS# G549414. c21lil1@aol.com

City, Close, Country Quiet... Superb move-in town home with 2 bedrooms, 2.5 baths, hardwood floors, masonry fireplace and 1 car garage. Cats allowed. Just $181,500. Lil Polak x310. MLS# G527589. c21lil1@aol.com

Condo... Newer appliances, mechanicals, additional 117 sq. ft. in lower level. Great opportunity for 1st time homebuyer. Meets FHA/CHFA approval. $158,900. Joanne Alfieri x321. MLS# G546364. c21lil1@aol.com DIR: 691 to exit 7 left on Colony into N. Colony left to LaMirage. Straight to back and take a left. Unit 34.

Condo... Desirable Town Plot location. 2 bedroom, 1.5 baths, desirable town plot. 1st time Homebuyers qualify for $8000 tax credit. Easy Access to Route 8 or I84. $84,900. Ron Appelle x394. MLS# G543834. c21lil1@aol.com

Visit openhouse.com for houses open this week.

1144882

ing Center at (860) 621-8130.

1144213

Feb. fun days


44

The Southington Citizen — Friday, January 22, 2010

Ent. brfs Continued from page 42 Foundation is hosting a philanthropic fine-dining experience in support of its mission to instill a love of learning in the town’s children. Tickets are $25 each and include a steak and chicken dinner with vegetable, dessert and beverage. Seatings are at 11:30 a.m. and 12:30 p.m. One-hundred percent of the ticket proceeds are being donated to the Southington Education Foundation, a non-profit organization committed to enriching the minds and lives of the town’s most impressionable community members – its school students. For tickets, contact Dr. George Costanzo at (860) 6210131 or visit his office at 340 North Main St., Southington.

DECA dinner On Jan. 26 in the Southington High Cafeteria DECA and National Honor Society are hosting a pasta dinner with all proceeds going to the American Cancer Society. The dinner is from 6 to 8 p.m. and tickets are $8 for adults and $6 for children 10 and under.

Open house party Jitters Coffehouse, 1273 Queen St., Southington, will host an open house party from 8 p.m. to 11 p.m. to celebrate 10 years in business, featuring potluck food, desserts and beverages.

Comedy night Music and Mayhem night will be Feb. 20 with doors opening at 6:30 p.m., appetizers, salad and pizza stations from 7 to 9 p.m. and beer, wine, soft drinks, coffee and pastries all night. The cost is $55 per person. The night begins with the music of Loose Change and then two come-

YMCA Continued from page 43 Nowicky; Volunteer Service

dians, Tom McTiernan and Dan Wilson. It will be held at the Aqua Turf Club, Kayes Pier North to benefits Southington Social Services. For more information/tickets call Missy Slater (860) 621-9335, Diana Sheard (860) 793-2765, Kathy Kukowski (860) 276-1083, Dave Harrington (203) 8591366.

SACA February events Southington Arts and Crafts Association has announced its February events. The first will Greeting Cards Workshop by Diane Sperry. Feb. 4 at 6:30 p.m. Participants will be making a Valentines Day card, a birthday card and a thank-you card. If there is time, Sperry will include a second Valentine card. All paper supplies are included. Please bring a small pair of craft scissors. Registration is required by calling (860) 793-9501 or e-mail at Deesper@aol.com. Free Demonstration: Promoting the Arts and Crafts through Facebook given by Jenny Bannock. Feb. 24 7 p.m. Learn how to set up a Facebook Profile for yourself, download photos and arts and crafts information to share on Southington Arts and Crafts new Facebook Page. Demo follows a 6:30 p.m. members meeting. For more information call (860) 793-9929. All Events will be held at the Orchards Community Room, 34 Hobart Street, Southington. Demonstrations are open to the public free of charge. Workshops are free of charge for SACA Members; Non-members are welcome for a $5 class fee. There may be a supply charge or supply list - check with instructor during required registration. Space is limited so register early. When e-mailing instructors, please put SACA as a subject line. Visit the website for updated information at www.southingtonartsandcrafts.homestead.com. Award, Bonnie Misiorski and Holly Smith. The event is open to the public. To purchase tickets, visit the YMCA, 29 High St., before Jan. 20.

marketplace 203.238.1953

Build Your Own Ad @ southingtoncitizen.com

JOBS ■ TAG SALES ■ CARS ■ HOMES ■ PETS ■ RENTALS ■ ITEMS FOR SALE ■ SERVICE DIRECTORY

PUBLIC/ LEGAL NOTICES

SOUTHINGTON INLAND WETLANDS AGENCY LEGAL NOTICE At their regular meeting held on January 7, 2010 the Southington Inland Wetlands Agency voted to take the following actions: A. APPROVED WITH CONDITIONS - IW #1168, Application of 45 Newell Street Associates seeking to fill .15 acres of upland review area for the construction of a fueling station at 45 Newell Street. Dated this 11th day of January, 2010 David J. Lavallee Environmental Planner

TAG SALE DATE: TIME: AS ADVERTISED

IN THE

R

Tag Sale Signs Are

FREE! When you place and pay for your Tag Sale Ad at

PUBLIC/ LEGAL NOTICES

SOUTHINGTON Town of Southington LEGAL NOTICE PARTY-ENDORSED CANDIDATES FOR TOWN COMMITTEE AT-LARGE A certified list of 50 Democratic party-endorsed candidates for the town of Southington for election as Members of the Town Committee At-Large is on file in my office at 75 Main St. Southington, Connecticut and copies are available for public distribution. The number of Town Committee Members to be elected, under party rules, is 50. A Primary will be held March 2, 2010, if 13 candidacies (which is at least 25% of the number of town committee members to be elected by such party in the municipality) are filed in accordance with section 9382 to 9-450, inclusive, of the General Statutes, by persons other than partyendorsed candidates, not later than 4:00 p.m. of January 27, 2010, provided the number of such candidacies plus the number of endorsed candidates exceeds the number of town committee members to be elected. (If the number of opposing candidacies filed is reduced to less than such 25%, no primary will be held.) Petition forms, instructions and information concerning the procedure for filing opposing candidacies, may be obtained from Edward M. Malczyk, Democratic Registrar of Voters, 75 Main St. Southington, Connecticut.

R 11 Crown St., Meriden

Leslie G. Cotton Municipal Clerk of Southington

PUBLIC/ LEGAL NOTICES

SOUTHINGTON Town of Southington LEGAL NOTICE PARTY-ENDORSED CANDIDATES FOR TOWN COMMITTEE AT-LARGE A certified list of 75 Republican party-endorsed candidates for the town of Southington for election as Members of the Town Committee At-Large is on file in my office 75 Main St. Southington, Connecticut and copies are available for public distribution. The number of Town Committee Members to be elected, under party rules, is 75. A Primary will be held March 2, 2010, if 19 candidacies (which is at least 25% of the number of town committee members to be elected by such party in the municipality) are filed in accordance with section 9382 to 9-450, inclusive, of the General Statutes, by persons other than partyendorsed candidates, not later than 4:00 p.m. of January 27, 2010, provided the number of such candidacies plus the number of endorsed candidates exceeds the number of town committee members to be elected. (If the number of opposing candidacies filed is reduced to less than such 25%, no primary will be held.) Petition forms, instructions and information concerning the procedure for filing opposing candidacies, may be obtained from Robert L. Sherman, Republican Registrar of Voters, 75 Main St. Southington, Connecticut.

SPECIAL NOTICES

$500 REWARD For information leading to the arrest and conviction of persons responsible for the death of the swan goose at Hubbard park, Meriden. Call (203) 235-5356

AUTOMOBILES

AUDI Quattro A4 1.8T 2004 4x4. Automatic. 4 cyl. 79,749 mi. #1372 $13,990 (860) 344-9916

BMW 3 Series 328xi 2007 4 Door Sedan. Auto w/Overdrive 47,014 mi # 11580 $25,995 (203) 238-1100

Leslie G. Cotton Municipal Clerk of Southington

Sports

Entertainment Religion Technology

CADILLAC CTS DI 2009 6-Speed Auto, ABS and Driveline Traction Control, 26 MPG Hgwy 25,287 mi # 11583 $35,995 (203) 238-1100

Current Events and more...

All Rolled Into One

The Southington

Cititii zen

You”ll like the low cost of a Marketplace ad.


45

Friday, January 22, 2010 — The Southington Citizen AUTOMOBILES

AUTOMOBILES

AUTOMOBILES

FINANCE Buy Here Pay Here Financing! Down pymts as low as $588 plus tax & reg, low weekly pymts, no finance charge, or credit check cars under $3000. Call 203-5305905, Cheap Auto Rental LLC.

CADILLAC DTS Luxury III Level 2006 Excellent condition - like brand new. All the options. Green Mist w/cream interior. 57k miles. $18,400 or best offer. 203-988-7604 Ask for Leo

DODGE Neon SXT 2004

CHEVY CAMARO 1968 Call 203-915-9856

4door, AT, AC. Power window /locks. Sony AM/FM/CD. New drive belt. 13K. Wires/oil-116K Emiss. 9/09. Must sell. Son leaving for Air Force. $4200 or Best offer. (203) 500-5102

AUTOMOBILES HONDA Civic 2000, 68K, perfect, $4400. Dodge Intrepid 2002, 80K, excellent thru-out, $3450. (203) 213-1142 HONDA Civic LX, 1997, 4 dr, 5 spd manual, air, 152K. Dependable transportation. $2500. (203) 269-1635 ROBERTS CHRYSLER DODGE Quality Pre-Owned Vehicles. 120 So. Broad St, Meriden, CT 203-235-1111

AUTOMOBILES WANTED

CASH And/Or Tax deduction for your vehicle. Call

1-800-527-3863

Free Towing!

Convertible, 2 door. Manual. 35,219 mi # 11596 $18,995

SNOWMOBILES VOLKSWAGEN PASSAT GLS 2004 Auto, Moon Roof, Alloy Wheels. 82,759 mi. #1340 $9,990

(860) 344-9916 FORD TAURUS 2003

JAGUAR X-TYPE 2004

4 Speed Auto. All power, Cruise. 45,916 mi # A49128 $7,888 (203) 238-1100

3.0, 4 Door Sedan. Automatic. 51,844 mi # 11573 $13,995 (203) 238-1100

SPORTING GOODS & HEALTH

The Jewish Childrens Fund

203-631-0800 or 203-630-2510

(203) 238-1100

WOOD, FUEL & HEATING EQUIPMENT SEASONED firewood, pickup or local delivery. Cut & split. Approx 16-18in. $225/cord; $135/half cord. 203-294-1775.

Junk cars, trucks, motorcycles. Free Pickup. Free Removal. Running or not.

MINI COOPER S 2005

PETS & LIVESTOCK

2003 YAMAHA SX VIPER 700 cc. Red & black. Helmet and Communicator, Heated Grips, Runs great. Excellent condition. $3800. Call (203) 686-1354

CAMPER & TRAILERS

LAB Ret pups AKC & OFA, reg., vet. cert. healt guar. $800. Parents used in therapy RedRiverRetrievers.com Sire hunts. Call (860) 681-5402 PIT BULL PUPPIES 8 Weeks old. Male & females. Blue nose. Mother on premises. $450 each. Call Henry 203-440-3902 or Jay 203-317-0173. PIT BULL PUPPIES 8 Weeks old. Male & females. Blue nose. Mother on premises. $450 each. Call Henry 203-440-3902 or Jay 203-317-0173. SHIH TZU puppies, AKC, first shots, vet checked, non shedding, ideal for allergies, 3 Female, 2 black, 1 black/white. Ready to go. $850. Call 860329-9893 SHIH-TZU Puppies- Pure bred, Born 12/27/09. 3 weeks old, 2 black, 2 beige, 2 white. 2 female, 4 male. $500 each. For info call (203) 440-0217

PISTOL PERMIT CERTIFICATION CLASS. Mandory for CT applicants. 1 Session only, $100. Call 203-415-1144

ANTIQUES & COLLECTIBLES

SWORDS Helmets, Daggers, Fighting Knives, Flags, Medals, etc.

203-238-3308 JEWELRY DIAMOND RING .59 carat. Appraised $3,250. Pinky ring for man or woman. Size 7 or 71/2. Asking $2,500. Call ask for John 203-235-8687

WANTED TO BUY

CLASSIC & ANTIQUES SNOW BLOWERS/THROWERS SNOWBLOWER 5-HP 24-inch, TANK Tread Drive for Traction, Runs Great! $180. Call 860-5385593 between 10am - 6pm.

SUBARU LEGACY 2.5i 2007 4 door, AWD. 4 Spd Automatic. 52,789 mi. #1384 $14,990 (860) 344-9916

CHEVY CAMARO 1968 Call 203-915-9856 TRUCKS & VANS

INFINITI I30 Premium 2001

JAGUAR X-Type 3.0 2003

4 Speed Auto. Leather. Alloys. 87,092 mi # 11586 $8,995 (203) 238-1100

4 Door. AWD. Automatic. 52,201 mi. #1396 $11,990 (860) 344-9916 Ford Windstar 2000 White, automatic, clean. Good condition! Mechically in exc. condition! Call 203-376-4853

SUV’S

KEYSTONE ‘05 Cougar 290 EFS Mstr Queen bed, angled shwr w/skylight. Full slide w/dinette & pullout sofa, LG skylight in kitch. All STD amen. inc refrig/ freezer, microwave, surround sound system, heat & ducted A/C. Polar Cold Weather PKG. Death in family forces sale. $17,000/OBO Gerry at 860-620-3147

JEEP Wrangler Sahara 2007

3.0, 4 Door Sedan. Automatic. 51,844 mi # 11573 $13,995

Auto w/Overdrive, 28,031 mi # A11594 $23,995

(203) 238-1100

(203) 238-1100

Looking for a friend? Find litters of critters in Marketplace.

CHEVY Suburban LT 1999 4x4 Loaded, Rear Heat/AC, 3rd Row Seats, Remote Start, Leather, 155K miles, Good Cond, $5900 (203)927-4210

VOLKSWAGEN GOLF GLS 2006 2.0L, 3 door Hatchback, Auto. 58,728 mi. #1366 $10,990

(860) 344-9916

KIA Rio 2008 4DR Sedan, 4 cycle 17,500 miles. Like new! Bookvalue $10,200. Asking $8,500. 860-828-1848 or 860-930-4772

CUSTOM-MADE Sectional Couch. Dark floral print. Excellent condition. No rips, tears or stains. Overall Size, 9’6”x8’ Includes Ottoman 36”x30”x17”. $425/best offer. (860) 349-0701

REFRIGERATOR Hot Point Cream 20.7 cu ft Good Used Did remodel Pick Up Great second frig $75.00 Call Dory or Jeannine, 860-667-4861 REFRIGERATOR- white, 20cf, w/ice maker. $75 203-237-6977

(203) 238-1100

JAGUAR X-TYPE 2004

FURNITURE & APPLIANCES

Lincoln Navigator Premium 2007 4 door, 6 spd, auto. 4WD. Heated Seats. Navigation sys, DVD Player 39,336 mi # 11546 $39,995 (203) 238-1100

203-238-3499

$$$ CA$H $$$ ANTIQUES WANTED - 1 Item or an Estate. Estate sale service provided. Seeking: Meridenmade items, lamps, paintings. Call Todd Shamock 203-237-3025

Cash Paid For All Types of COSTUME JEWELRY Especially Napier 203-464-0477

PETS & LIVESTOCK 13 YEAR old male, neutered, declawed cat. Outdoor cat. Moving out of state, needs a good home. 860-747-5950

TOYOTA Camry Solara SE 2004 2 door, 4 Speed Automatic 130,208 mi # 11586 $6,995

SNOWBLOWER ARIENS ELEC. START, RUNS GOOD. HAVE 2ND MODEL FOR PARTS. $300. CALL 203-886-9638

1-2 ITEMS Silverware, China, Glass. Furniture. 50’s Items. Whole Estates.

Washers, Dryers, Refrigerators & Stoves BLACK lab puppies M/F. We are ready to go to a good home now! $500. Call Maryann 860829-1578

CLEAN Will Deliver (203) 284-8986

FISH TANK- 55 Gallon. Pumps, stand. $200 or best offer. Too big for my townhouse. Call (203) 440-1024

MISCELLANEOUS FOR SALE

GERMAN SHEPHERD PUPPIES Rare German working lines. Dad is large boned, 100+ lbs. 8 males, 4 females, AKC reg. 1st shots, dewormed, microchipped & tattooed. Nice take home puppy pack. Ready 1/26/10. Now Taking Deposits! Serious inquiries please. $1200. (860)655-0889 or ACH442403@yahoo.com HORSE LOVERS EXCEPTIONAL riding opportunity in exchange for 6-8 hours per week. AM and PM time needed. Call: 203272-6593 or 203-213-8833

FREE - Working 26” Sony color TV. Very good condition. Call (860) 628-7337 SPECIALTY Discounted Bldgs Some under $8k Call to Reserve; 1 per Buyer Can Construct IAS-AC 472 Mfg Cert www.utilityking.comSource#1FY 866-609-4321 USED Kenmore Heavy Duty Dryers (2), Fridge w/ice maker, Whirlpool Washer, all white $125 each. 3 HP, 10” Craftsmen Table Saw w/extactrip fence $125. Call (203) 440-2814

DEE’S ANTIQUES Buying Silverplate, Glass, Furn, music instruments, china, art, collectibles. 1 item to estate.

203-235-8431 OLD BICYCLES Don’t throw away that old bike. Hobbyman needs your help. Free pickup! Bikes will be recycled. Help save a bike! 203-494-9641

MUSICAL INSTRUMENT & INSTRUCTIONS

Professional Violin Lessons & String Instruments

Repaired! For Children & Adults $25 per 1/2 hour. First lesson FREE! 30 yrs exp. We repair: Violins ● Violas ● Cellos ● Bass Bow Rehairing 203-294-0888

Voice Lessons All Ages and Levels Welcome

Piano Lessons Beginner to Intermediate De Fiore Vocal & Piano Studio Roberta (203) 630-9295


46

The Southington Citizen — Friday, January 22, 2010 MUSICAL INSTRUMENT & INSTRUCTIONS GUITAR Player/collector will teach beginner guitar. $15 half hour; $25 hour lesson. Paul 860-463-1382; (860) 621-7852

HOUSES FOR RENT

HOME SWEET HOMES Offers Meriden- 5BR house $1450/mo. Available 1/15. 137 Willow St. (203) 938-3789

ATTIC & BASEMENTS CLEANED

HANDYPERSONS

ROOFING

Home Doctor

HEATING & COOLING HOUSE CLEAN Outs, Garages Basements, Attics, Yards Big or Small..... We Take It All Free Estimates. Call Ed.

ATTORNEYS

Empire Construction, LLC Your Professional Roofer New Roofs, Reroofs, Tearoffs We fix leaks too! 203-269-3559 CT Reg#565514 www.EmpireLLC.biz

Gonzalez Construction ★★★★★★★★

DON’T Freeze this WINTER! Call Duane Plumbing, heating & cooling. Annual furnace & boiler tune-ups & cleanings. Quality work. Major credit cards. Low rates. 203-3798944 #400335-S1

Roofing, siding, windows, decks, gutters & remodeling. ★★★★★★★★

203-639-0032 Fully license/insured. CT Reg# 577319

Bankruptcy Free Consultation Keep home, auto, 401k, etc. STOP FORECLOSURES IRS & “Repos” Atty F.W. Lewis 439 Main St, Yalesville 203-265-2829 “Debt Relief Agency” We help people file for relief under the bankruptcy code

DUMPSTERS Roll-Off Dumpsters 15 yard roll-off - $350 20 yard roll-off - $450 Empire Construction, LLC 203-537-0360 www.EmpireLLC.biz

ELDERLY CARE

HOMEMAKERS Companions, Personal Care Assistants /Home Health Aides Licensed, Bonded, Insured. IMPERIAL HOME HEALTH CARE, LLC 860-351-5298. www.imperialhhc.com

HOUSE CLEANING POLISH woman can clean your house, office with care. 2nd cleaning 15% off. Ins & bonded. Refs. Kasia 860-538-4885

MASONRY JACK Biafore, LLC Masonry Chimneys, brick, block, stone walls, patios. In business over 50 yrs. CT# 623849 (203) 537-3572

PAINTING/ WALLPAPERING MIRKEL PAINTING Popcorn ceilings. Interiors from $125. All work fully warrantied. CT Reg #569864. Ed 203-824-0446 L & E PAINTING Spruce Up Your Home or Business! Professional Quality & Affordable Rates. CT Reg #623250 www.landeprop.com Call Trevor (203) 938-3789

PLUMBING GUTTERS Fahey Plumbing & Heating

SIDING

Gonzalez Construction Roofing, siding, windows, decks, gutters & remodeling.

203-639-0032 Fully licensed/insured. CT Reg.# 577319

HANDYPERSONS

Shamock Roofing

ROOFING

All types of remod. 30+ yrs exp. No $$ Down. CT Reg 523804. Ins

203-237-4124 an LLC co.

Roofs R Us

ALBERT’S HOME REPAIR Roofs, decks, windows, doors siding, flrs, sheetrock. Ins & lic. # HIC-0623837 203-592-1148

Since 1949. Siding, roof repairs, windows. 203-6398389 CT #573358. Sr. discount. Credit card OK.

A-1 HANDYMAN PLUS

Shamock Roofing

CT Reg #606277. GIVE us a call, we do it ALL. Free est. 203-631-1325

All types of remod. 30+ yrs exp. No $$ Down. CT Reg 523804. Ins

203-237-4124 an LLC co

MERIDEN. 2 BR, 1 1/2 bath condo. $1200/mo. DW, w/d, fp, gar, open floor plan, storage. Amenities include pool & fitness center. No pets. (860) 716-7947 WALLINGFORD - Hillside, 1 bedroom, first floor, with heat, appliances include, no pets, $850. Call 203-804-0169 or 203430-0725.

APARTMENTS FOR RENT MERIDEN $900/mo. 5Rm 2BR 2nd fl. Renovated spacious apt on West Main, enc front porch, updtd EIK with W/D hookup, off st parking & more. 2mo sec, 1mo rent, EOH, no pets. Kathy 203-235-3300x690

BERLIN Lake Dr 2 BR Twnhse. Attached gar. On cul-de-sac. Access to Rt 15., I 84, I91. 1.5 baths, WD hookup, $1000 + sec. No pets. (203) 272-1263

203-294-9889 Expert De-Icers Commerical Specialists. Nicholas J Murano LLC, Member: Snow and Ice Management Assn

HOME SWEET HOMES Offers Meriden - Studio & 1BR apts From $650 + sec. Heat & HW incl. Avail. immed! 203-938-3789

Meriden 2 BR at Tracy Gardens $750 Heat & HW incl. Move in by 1/31 and receive a new flat screen 37” TV. 203-639-8751 MERIDEN 2 BR Private parking. Newly painted. Heat & HW incl. $900/mo + sec. Refs & background ck. 203 440-3777. MERIDEN 2BR, 2nd fl. 5 Rms. Remodeled. Heat & appls incl. No smoking/pets. 45 South Second St. Sec 8 approved. $850 + 1 mo sec. 203-841-7591 after 5pm. MERIDEN 2BR, formal living rm & dining rm. Spacious, nicely remodeled. Hdwd fls. Laundry room. Off street parking. Sherman Ave. Call 203-634-6550

Placing a Marketplace ad is an easy and affordable way to let your items take centerstage to hundreds of potential buyers. What are you waiting for? Contact us today and start turning the stuff you don’t want into something you do want:

cash! GET THINGS MOVING WITH THE MARKETPLACE!

You Found It! S a g e Po n d P l a c e

HOME SWEET HOMES Offers Meriden- 3BR, Recently renovated, Available immediately. $1125/mo. HEAT & HW incl!!! 203-938-3789 MER. FURNISHED apts: Incl Heat, Elec, HW. 3rd fl studio, $160/wk+sec. 1BR, 2nd fl, $210/wk+sec. 203-630-3823, 128pm www.meridenrooms.com MERIDEN - 1BR, Broad St, near monument, hardwood floors, skylite, sunk in dining room and kitchen, private and secure, garage, $725, Call Fred 203-634-1515 or 203-213-8833. MERIDEN - 3BR, 6 rms, 2nd flr. Off st. parking. Stove, w/d hookup. No pets. $950 + sec. Call 203-235-2703 MERIDEN - 5 room, 2 Bedroom, 3rd floor, newly remodeled, off street parking, no pets, $800 plus utilities, references. 203671-9644 MERIDEN 1 Bedroom, 1 bath. Charming, Cozy and quiet. All utilities & cable included. 1 year lease, $800 per month, $1200/sec. 203-634-0730

Nestled off the road in a quiet, wooded setting!

Brand New Beautiful 1 Bedroom Apartments in Berlin For Active Adults 55 and better

Only $950 Heat, Hot and Cold Water Included Central air! Intercom system! Fully applianced kitchens On-site laundry! with frost free refrigerator, Library with computer range with self cleaning oven, workstation! dishwasher, garbage disposal! Ample on-site parking! Community room with fireplace Picnic area with grill! and full service kitchen! 24-hr. maintenance! Secure three-story building with elevators!

MERIDEN 32 Cook Ave.

1 BR Apts & Studios $595 & Up Limited Time-1 mo free rent! Heat & HW incl. 203-886-7016

MERIDEN 3BR. New paint/carpet, Off street parking, 2nd fl. Washer/dryer 1 yr lease. $900 plus sec. Call 203-671-2672 MERIDEN 8 Jackson St. 2 1/2 BR, 5 rms. Newly renovated. Stove & refrig, Heat & HW incl. $850. 203-715-3647 or 917- 921-7469 MERIDEN Huge 5 BR Apartment Freshly painted. Ready to rent! Section 8 approved. $1350/mo + security. No pets. 203-650-0479 MERIDEN MOVE IN SPECIAL Studios, 1 BR & 2 BR Free Heat & HW incl. ACs. 24 hr maintenance. Sec. guard. Laundry Rm. Off st parking. 203-630-2841

Meriden Reduced Rent

MERCHANDISE MISSING THE SPOTLIGHT?

203-235-1383 DON’T Flush money down the drain, call Duane Plumbing, heating. Quality work, low rates Major credit cards accptd. 203379-8944 lic. #283401 P1

MERIDEN- Meetinghouse Village- 2BR townhouse, C/A, Garage. $1100. Quality Realty, LLC 203-949-1904

www.ICEFIGHTERS.org

Quality ● Clean/Neat ● Honest! A guaranteed job at a good price! Days, Nights, Wknds - Same Price Over 25 years experience. Call today for free estimates. Call 203-440-3535 Ct. Reg. #578887

MERIDEN- 1BR, Crown Village. New carpet & paint. $700/mo.heat incl, 2 mo. sec.+ credit ck. No pets/smoking. 860-828-0692

SNOW PLOWING L & E PROPERTY MANAGEMENT Snow Plowing Professional Quality & Affordable Rates. CT Reg. #623250 www.landeprop.com Call Trevor (203) 938-3789

MERIDEN 1 Bedroom. Excellent Condition. Private. H/HW included. Off-street parking. $675 per month. 1 month deposit. Call 203-238-9254. MERIDEN 1BR, 1st flr, lg rms Heat, HW, Elec incld. W. Side, Off-st park. $950/mo + sec. 203-630-3823 12pm-8pm. www.Meridenrooms.com MERIDEN 2 bdrm. $725 + sec & util. Cozy, bright, new floors, new paint, lrg bdrms. 860.834.2876

Looking for the perfect new home for your Mother, Father, Aunt, Friend or Yourself?…….

CONDOMINIUMS FOR RENT

Tiny repairs-Major renovations Custom Carpentry, plumbing, elec. Since 1949 203-639-8389 CT 573358. Credit Cards OK

APARTMENTS FOR RENT

Pay for a 1 Bedroom and Move into a 2 Bedroom. $750. Heat & HW incl. 203-639-8751 MERIDEN W. Side, on bus line. 5Rm apt, 2BR. Newly painted. New carpets. No pets. Off-stparking. W/D hookup. Section 8 approved. 203-237-6096

MERIDEN- 1023 Old Colony Rd.

2 BR - $750 & UP Heat & HW, Off st. parking. Limited Time - 1 mo free rent. Call 203-886-7016 MERIDEN- 1BR 1st flr apt w/ kit/LR combo, wall to wall carpet/linoleum. Off st. parking. Exc cond/location. $650. 1st, last & 1 mo. sec. 860-663-1229 MERIDEN- 1st flr, 3BR, 6 rms, w/d hookups. $900/mo. + security. Appls. No utilities. No pets. Call 203-605-8591

MERIDEN- 2BR apt, $725 + sec. & utils. Avail. immediately. L & E Property Management 203-938-3789

Call Now!

(860) 828-3958 also accepting applications for Affordable Units Income Restriction Apply Merit Properties, Inc. Financed by CHFA APARTMENTS FOR RENT MERIDEN- 2 BR, 1 1/2 bath townhouse, appliances, full basement, air conditioning, 89 Bronson Ave. $825/mo + utils. 1 1/2 mo. sec. No pets. 203-237-8801 MERIDEN- Freshly painted 1 & 2BR apts. $650-$800 per month. 60 Pleasant St. No pets. 203-668-6066. MERIDEN- Freshly painted 1 & 2BR apts. $650-$800 per month. 60 Pleasant St. No pets. 203-668-6066. MERIDEN- Hubbard Park 1-2 BR, CAIR/heat. 775 W. Main St. $850-$925 month. Sect 8 approved. Call Chino 203-907-9276 203-296-4975 MERIDEN- Nice, Spacious 1BR, appliances, parking, good location, no pets, 25 Griswold St. $795 + deposit and credit. 203238-1890 MERIDEN-1BR Apt 203-715-7500 & 2BR Apt 203-641-8483 Clean, quiet, newly remodeled. W/D hookup. Off st parking. MERIDEN-1BR, Huge rooms, walk-in closet, parking, w/d hookup, 1st class! $600/mo. Credit check + 2 mos. sec. req. No pets. 203-284-0597 MERIDEN-1BR, Huge rooms, walk-in closet, parking, w/d hookup, 1st class! $600/mo. Credit check + 2 mos. sec. req. No pets. 203-284-0597 MERIDEN-1BRS-All appliances & hot water incl 2 mo. sec.. No pets. Coin op laundry. 1095 Old Colony Rd. Showings 9-11 am. 203-581-3620 MERIDEN-East Side. Great 2 BR. Penthouse floor. Central air. All appls. On flr laundry. Credit + 2 mos. security. $800/mo. No pets. Call 203-284-0597 MERIDEN-East Side. Great 2 BR. Penthouse floor. Central air. All appls. On flr laundry. Credit + 2 mos. security. $800/mo. No pets. Call 203-284-0597

APARTMENTS FOR RENT MERIDEN 1BR- 1st flr avail. $650/mo Sect 8 appr’d. Leave message at (860) 426-0658 MERIDEN. 1 BR, 1st Floor, 1 BR, 2nd Floor & 3BR apartments available. No washer/dryer. No pets. Call Ricky 347-598-1170. MERIDEN/WALLINGFORD - 5 rms, 2nd fl Appl, priv porch, off St. pkg, w/w rugs, spotless, quiet. No Pets. 3/1. Call 203686-0818 PLAINVILLE - Newly renovated, 2BR, 1 1/2 bath, lg. kitchen, w/d hookups, available for immediate occupancy. $900/mo. 1 mo. sec. dep. & credit check req’d. For more info. please call 860798-2336. SOUTHINGTON 1BR $600/mo. 2 mos. sec. Call 860-538-5575 SOUTHINGTON 3BR 2nd flr, $1000/mo. 2 mos. sec Call 860-538-5575 SOUTHINGTON- 3BR Apt now avail. $900/mo. Easy access to 84 & 691. Security & Credit check required. For more details call Alex or Mat at 860-276-8208 SOUTHINGTON-3BR, Charming 1st flr of 2 family home, 1BA, SS appls, gar., prvt backyd, lg deck, conv. loc. No dogs $1275/mo+utils. 860-625-1411

SUMMER BROOK APTS Newly Remodeled 1BR - $700, 2 BR - $835 & $865, 3BR - $1025 Incl. heat, HW, off st parking Income Guidelines Apply Applications can be obtained at 35CC Darling St. Southington 860-621-1700 EHO Financed by CHFA Creative Management & Realty Co., Inc.


47

Friday, January 22, 2010 — The Southington Citizen APARTMENTS FOR RENT

*PET FRIENDLY Home Wanted*, for non-smoker and indoor cat. Can pay Approx. $175/week. Need parking space. Call Jen @ 860-424-1757

ĞĂƉĂƌƚŽĨ,ŝƐƚŽƌLJ͊

WW>zEKt͊

ZĞĐƌƵŝƟŶŐƐƐŝƐƚĂŶƚƐ͕ůĞƌŬƐ͕ ĞŶƐƵƐdĂŬĞƌƐEDKZ͊

STORES & OFFICES FOR RENT

Flexible hours & paid training DƵƐƚďĞh͘^͘ŝƟnjĞŶĂŶĚ ƉĂƐƐǁƌŝƩĞŶƚĞƐƚ͘

RETAIL Store/Office for rent. 2800 SF right on West Main St., Meriden. $1675/mo. incl. heat & hot water. Avail. Feb. 1. Call Home Sweet Homes 203-938-3789

Call TODAY

1-866-861-2010

COMMERCIAL & INDUSTRIAL RENTALS BERLIN-Four Rod Rd. IndustrialFlex Zoned space for rent, 1200 sq. ft. $900. 860-989-6971 MERIDEN COMMERCIAL 8600 SF, Loading Dock, Lobby with Offices, Showers. Lg Overhead Door & much more. $2500/mo or best offer. (860) 384-4205

&ŽƌŵŽƌĞŝŶĨŽĂŶĚƉƌĂĐƟĐĞƚĞƐƚ͕ ŐŽƚŽǁǁǁ͘ϮϬϭϬĐĞŶƐƵƐũŽďƐ͘ŐŽǀ 1143849

WALLINGFORD 1st fl. 2BR/5Rm. Good location. Fully Appl. W to W. No pets. Util not incl. Lease & sec req. $875mo. Call 203-435-6790 pm. WALLINGFORD 2 BR, 1st Fl. Dining Rm, Living Rm, Bathroom, Kitchen w/Big Pantry. Big closet in Master BR. Large front porch. Nice yard. $1100. 203 679-0032 or 203-952-5243 WALLINGFORD ROBIN HILL APARTMENTS Great location! 1BRs starting at $750. 2BRS starting at $850. Call 203-294-9110 for more info WALLINGFORD STUDIO Semi-furnished. Newly renovated. Hardwood floors. Private driveway & private yard. No pets. 203-284-2077 or 203-654-6190 WALLINGFORD-Desirable East Side newly remodeled, scenic, quiet, 2nd flr studio, appls, patio, yard. $675/mo + utils. Call (203) 269-9755 WALLINGFORD. Avail 3/1, No. Main St Victorian. 3 rm, 1 BR, 3rd flr, no smoking, no pets. $825 plus utils. 2 mos sec. Call 203-269-5973. WALLLINGFORD Charming Studios, 1 & 2 BR at 53 Parker Place. $650-$950. Feb 1st or sooner occupancy. Electric heat/CA. Spacious & sunny. No dogs. Sunday showing - Jan 17 10-am-2pm. (203) 284-3601 WLFD 1BR, off No. Main St, near library, Choate area. Off st. parking. $750 + sec. No smoking, no pets. 203-265-3092 WLFD- 2BR, central location, laundry, no pets. Credit check. $800 + 2 mos. sec. 203-235-1381

WANTED TO RENT

US Census Bureau is an Equal Opportunity Employer

HOUSES FOR SALE

HOUSES FOR SALE

Meadowstone Motel- Off I-91. Sat. TV, furn’d. Daily/Wkly On Bus Line. 203-239-5333

GARAGE & STORAGE SPACE FOR RENT

Wallingford/Durham 10’ x 20’ & 20’ X 45’ w/electricity. Available Now. 203-751-1977

CNA Masonicare Health Center in Wallingford, CT is seeking experienced C.N.As for 2nd and 3rd shifts. Candidates must have a valid CT state CNA certification, as well as LTC or Rehab experience (1 yr. minimum). Masonicare employees enjoy flexible scheduling, great benefits, weekly payroll and being part of a dynamic team. If interested, please apply online at www.masonicare.org; email your resume to careers@masonicare.org, or fax (203) 679-3052.

HELP WANTED

MERIDEN $197,900 Move right in! 3BR 3 full bath home. 12x21 MBR with full bath. All spacious rooms. Gleaming hardwood, 3 zone heat, updated, CAIR. Immaculate home. LInda Diana 203-235-3300

WALLINGFORD What a nice home! 3BR 2b Raised Ranch, corner lot. FP and walk-out & FR in LL, garage, nice deck off dining area. Come see, lovely curb appeal & more, many updates $309,900. Kathy 203-272-1234

WALLINGFORD $92,500-Fully furnished, brand new furnishings right to forks & spoons! Turn key. Very quiet floor, sec building. Ready to move in right now. This lovely one BR unit is clean and bright. Call Pat Lane 203-265-5618

HELP WANTED

City of Meriden Needs Water Distribution Maintainer

ROOMS FOR RENT

NORTH HAVEN

Certified Nurses Aide/CNA

WLFD The price is right! 3BR, 2bath Split w/CAIR, newer windows, wood flrs, freshly painted, fenced yard & gar, ready to move into $197,000. Sue 203-265-5618

WLFD-New Construction 2,000 sq ft, 2.5 bath to be built on private level 1/2 acre lot. Custom cabinets, Granite Counter tops, Master BR Suite. Ideal location very close to schools, park and major hgwy. $389,900.00. Contact builder direct @ 203/2653051. Visit us online at: www.fjcconstruction.com

CONDOMINIUMS FOR SALE

This is semi-skilled and skilled mechanical work in the maintenance, repair and construction of municipal water distribution systems and operation of complex specialized maintenance and construction equipment. HS graduate or equivalent/trade school. Considerable exp. in water maint. and construction work. Considerable exp. in the operation and maint. of trucks and other specialized automotive equip. Must possess a CDL Class B, Distribution Operator II cert. required. Salary $21.15 Applications are available in the Personnel Department, City Hall, 142 East Main Street, or www.cityofmeriden.org Last date to apply is Monday January 25, 2010. E.O.E

IT’S SO CONVENIENT! MERIDEN Well cared for Ranch. HDWD flrs, newly painted BR & BTH. Professional landscaped corner lot w/walkout basement, great rm w/vaulted ceilings. $269,900. Vicki 203-235-3300

CNA - Care Manager Hands on working position for expereinced CNA in retirement facility. Full & part time. 1st & 2nd shifts. Top pay. Opportunity for advancement.

Call 860-829-4500 Homemakers/Home Health Aides Home Health Agency, Keep Me Home, seeks certified and non-certified caregivers for flexible hours, local work. Immediate openings.

Call (860) 829-4500

Always a sale in Marketplace

EOE

WLFD- NORTHRIDGE Commons, spacious 1 & 2BR units. $725 - $875 & up 203-269-5770 WLFD-48 Allen Ave, 2nd flr, 4Rm, 2BR, off st parking, $850/ mo, 1-1/2 mo sec. Easy access I-91/Merrit Pkwy. 203 430 6896 //48allenave.yolasite.com

MERIDEN - Rooms For Rent $100 per week. All utilities & cable TV included. No drugs or alcohol, Please Call 203-213-2054 MERIDEN CLEAN SAFE ROOMS Heat, elec, HW incld. E.Side, kit privileges, off-st park. $130/wk. + sec or call 203-630-3823 128pm, www.Meridenrooms.com MERIDEN Room for Rent- Fully furnished, shared kitchen, LR, 1 1/2 baths. $150 per week. Clean home. All utilities included. Call 203-537-1772 Lisa MERIDEN Room for Rent- Fully furnished, shared kitchen, LR, 1 1/2 baths. $150 per week. Clean home. All utilities included. Call 203-537-1772 Lisa MERIDEN- Clean, safe, furn. room. Utilities included. Share kit. & bath. $110 weekly. Leave message 203-238-3369 MERIDEN. Room for rent, all util, share kit, bath & LR. Washer & dryer, off st parking. $150/week. 2 wks sec. (203) 605-8591

CONDOMINIUMS FOR SALE

MEDICAL CAREERS

CHESHIRE $169,900 2BR, 1.5 bath Townhouse w/garage. Remodeled EIK, newer windows, deck, full basement, pool & more. Private & quiet complex. Call Kathy 203-272-1234

Pay for your RecordJournal subscription with your credit card. For your convenience we accept MasterCard, Visa, Discover & American Express. Call (203) 634-3933 to order your Record-Journal subscription today.

CASHIERS- Mobil Mart has FT, PT morning & evening positions. Must be mature, dependable, & friendly. Duties may incl. maintaining coffee bar & ordering supplies. Exp. pref’d. Apply in person: 435 Main St, Farmington or 411 West Main St, Avon. CUSTOMER SERVICE AGENT: Full-time, must have computer experience, knowledge of Word/Excel and phone experience. Please contact Valerie 203.284.6040 Ext 112. CUSTOMER SERVICE-OPEN HOUSE 160 Broad St, Middletown. 1/20, 3 PM to 6 PM. Multiple openings, various shifts. Part and full time, $10/hr, Old Saybrook. Must have two to three recent business references, customer service experience, a pleasant & professional attitude, quick data entry & be able to pass criminal background check. Call (203) 949-4242 for info.

HELP WANTED DRIVER - Class A. Hazmat, medical, 401k. Apply at TuxisOhrs, 80 Britannia St, Meriden. ELECTRICAL MAINTENANCE TECHNICIAN Maintenance of heavy machinery drive systems. Troubleshoot, electronic process controls. Exp. with PLC’s req’d. Opportunities available on 2nd shift (3pm-11pm). Career opportunity, convenient location, friendly atmosphere. Send resume to: MAINTENANCE P.O. BOX 215 NORTH HAVEN, CT 06473 EOE HOMEMAKER/COMPANIONS F/T-P/T, to assist elderly in their homes. Transportation & phone essential. Bilingual applicants encouraged. Call Franciscan Home Care and Hospice Care 203-238-1441 INSURANCE-P/T PL CSR for Cheshire agency. EMail: ddrescher@drescherins.com

EXPERIENCED Cable Installation Technicians needed immediately in the CT area, pending criminal background check, DMV/MVR and drug screening. Company offers vacation, medical, dental and retirement plans for all full time employees. Company provides late model trucks/vans, all safety equipment & specialty tools. Expense reimbursement for phone & gas, competitive rates. Visit our website at www.cable-line.com email resume to psadler@cable-line.com or fax to 215-258-1388

Get Connected! Sign-on to Myrecordjournal.com for your window on the world

POLICE OFFICER The Wallingford Police Department is seeking qualified applicants for Police Officer. $1,021.60 weekly plus an excellent fringe benefit package. The initial exam phases consist of physical performance, written and oral exams. Other requirements for Police Officer can be obtained with the application materials at the following locations: Personnel Department, Town of Wallingford, 45 South Main Street, Wallingford, CT 06492; Wallingford Police Department, 135 North Main Street, Wallingford, CT 06492; South Central Criminal Justice Administration, 675 State Street, New Haven, CT 06511. C o m p le t e d a p p l i c a t i o n s a l o n g with a $40.00 application fee must be returned to the South Central Criminal Justice Administration by Wednesday, February 24, 2010 at 4:30 P.M.

The Town of Wallingford is an Equal Opportunity Employer

Office Position Medical/ Ophthalmology Practice Cheshire/Hamden/New Haven/Branford locations. Medical office exp preferred but will train exceptional applicant. Full-time position, Travel required. Telephone triage/ Check-in Check-out/Medical Records Reliable, energetic, team spirited, with a friendly disposition. Exc compensation & opportunities. Fax resume 203-281-2742 LOST Or Found. The RecordJournal will run your lost or found ad FREE in our Marketplace Section! Call 203238-1953 for details.

HELP WANTED National Filter Media Industrial sewing machine operator. Must have experience. 9.00/hr. M-F, 6:30am - 3:00pm, Benefits; 401K. Apply in person 9 Fairfield Blvd., Wallingford

News Writer Freelance opportunity for individuals interested in covering local events and meetings in Berlin on an assigned basis. Experience preferred. Photography a plus. Write for your local newspaper and get to know your community better. Please submit a resume and writing sample to : news@theberlincitizen.com PRODUCTION SUPERVISOR, MUST have experience working with COMPOSITES. 50K+ DOE. Send resumes to: mweiner@armazzotta.com

SALES POSITION WHOLESALE PAPER and JANITORIAL SUPPLIES Specializing in food service, Salary plus Bonus, Company Car, Health Insurance, 401(k), Pension Plan. Please fax, email, or mail resume to: The Russell Hall Co., P.O. Box 734, Meriden, Ct 06450 fax 203-237-4336 russellhallco@msn.com NO PHONE CALLS PLEASE SALESPERSON OVERHEAD GARAGE DOOR COMPANY Full time, outside, residential position with field or sales experience. Self-motivated, neat appearance, clean driving record and computer skills required. Salary plus commission with company car and benefits. Call (860) 347-1507 ext. 13. TELEPHONE Sales. Energetic people needed for educational police organization fundraiser. Year round. 2 part time shifts avail. 9am-12pm and 5:30pm8:30pm. Hourly plus bonus. Call 203-269-5138


48

The Southington Citizen â&#x20AC;&#x201D; Friday, January 22, 2010

1140503

1-22-2010SouthingtonCitizen  
1-22-2010SouthingtonCitizen  

Southington Newspaper

Advertisement