Page 1

Welcome from Head Coach Bob Stoops Many times I have been asked what I like most about being the head football coach at Oklahoma. Obviously it’s impossible to settle on just one thing, but I can tell you something that always comes quickly to mind ... the hunger this place has for championships.

2 0 0 5 S EAS ON

GAME DAY IN NORMAN

2005 OKLAHOMA FOOTBALL Looking back over OU’s history, you can see where some might be tempted to sit back and be satisfied. There have been seven national championships, 39 conference titles, 23 bowl victories and 141 All-Americans.

COACHING STAFF

Despite that, every time a game or honor is won here, the next thought, for our team and fans alike, turns to winning the next one. I really like that about Oklahoma ... there is always something else out there for us to attain. That attitude is reflected in what has happened here over the last five years. During that time, we’ve won more games (60) and had more national award winners (16) than any other program in college football. We’ve spent 22 weeks at No. 1 and been listed in 72 consecutive polls. There is no better feeling for a coach than to see his players pleased with their college experience. In both team and individual achievement, we see a lot of that here, and it drives our program.

THE SOONERS

Another year awaits and another championship opportunity is ahead of us. At Oklahoma, we wouldn’t have it any other way.

2005 Oklahoma Football Schedule SEPT. 10 - NORMAN

TULSA

SEPT. 17 - PASADENA

UCLA

OCT. 1 - NORMAN

KANSAS STATE

OCT. 8 - DALLAS

TEXAS

OCT. 15 - KANSAS CITY

KANSAS

OCT. 22 - NORMAN

BAYLOR

OCT. 29 - LINCOLN

NEBRASKA

NOV. 12 - NORMAN

TEXAS A&M

NOV. 19 - LUBBOCK

TEXAS TECH

NOV. 26 - NORMAN

OKLAHOMA STATE

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

TCU REVIEW & OPPONENTS

SEPT. 3 - NORMAN

1


OKLAHOMA FOOTBALL GUIDE 6 3 NAT IONAL AWARD WINNERS

2005 PROJECT COORDINATORS

Kenny Mossman, Jason Matheson, Debbie Copp

WRITERS

Kenny Mossman, Jason Matheson, Chris Freet, Jared Thompson

GUIDE DESIGN

Jason Matheson, Jared Thompson

COVER DESIGN Scott Matthews

141 ALL-A MERICANS

INTERIOR LAYOUT

Jason Matheson, Jared Thompson, Chris Freet, Jessica Summers

CONTRIBUTORS

Jessica Summers, Craig Moran, David Bassity, Matt Montgomery, Renata Hays, Kellen Coleman, Nicole Giglio, Brian Dude, Heather Maxwell, Jeff Salmon, Amy Murphy, Scott Matthews, Robert and Debbie Matheson.

RESEARCH ASSISTANCE

23 BOWL CHAMPIONSHIPS

Mike Brooks

PHOTOGRAPHY

BEST IN THE NATION

The 2004 OU football guide and post-season guide were judged No. 1 in the nation by the College Sports Information Directors of America (CoSIDA). The 2004 regular-season guide finished in the top spot for the first time since 1995, while the post-season guide, which competed in a contest against publications produced for all post-season competitions in all sports, won for a fourth consecutive year (2001-04). Oklahoma finished ahead of second-place Tennessee and third-place Notre Dame in the regular season guide competition. In post-season competition, the 2005 Oklahoma football bowl guide topped Virginia Tech football and Texas football which finished second and third, respectively.

UNIVERSITY OF OKLAHOMA ATHLETICS MEDIA RELATIONS Gaylord Family - Oklahoma Memorial Stadium 180 W Brooks St, Norman, OK 73019 (405) 325-8231 - Phone (405) 325-7623 - Fax

Lisa Hall, Icon Sports Media, Mark Kraus, Jackson Laizure, Jerry Laizure, Jason Matheson, Shevaun Williams & Associates, John Williamson, OU Athletics Media Relations Archives and OU Western History Collections.

PRINTING

39 C ON FERENCE CHAMPIONSHIPS

The 2005 Oklahoma Football Guide was printed by OU Printing Services of Norman, Okla., at no cost to the taxpayers of the state of Oklahoma. Special thanks to Bob Goodwin and Matt Cooper. Front cover by Superior Graphics of Addison, Texas. The guide was designed and produced by the OU Athletics Department using Adobe InDesign and Adobe Photoshop. The University of Oklahoma is an equal opportunity employer (2005).

OKLAHOMA FOOTBALL ONLINE AT SOONERSPORTS.COM

The University of Oklahoma Athletics Department presents the latest information on OU football to fans around the world at its official website, SoonerSports.com and the premium content O-Zone.

7 NATI ONAL CHAMPIONSHIPS

SoonerSports.com provides the most accurate and up-to-date football rosters, player bios with individual stats, interactive depth chart, schedule and team statistics available to Sooner fans and media representatives. Every Tuesday during the season, the O-Zone carries the weekly football press conference video live. SoonerSports.com also provides coach and player quotes, photo galleries, video and audio clips and the latest weekly notes from the Athletics Media Relations office in advance of the game. On game day, live statistics and live audio are available online with recaps, statistics, notes, quotes and photos following shortly after the game.

Nike is the official footwear, apparel supplier and sponsor of the Oklahoma football program.

2 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


CONTENTS

Media Information OU Athletics Media Relations. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Media Information & Policies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Maps & Directions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Stadium Information & Layout . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sooner Radio & Television . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

54 55 56 57 58

Season Outlook . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Rosters & Pronunciation Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Preseason Depth Chart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Preseason Notes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sooners at a Glance. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

60 64 66 67 68

Coaches & Staff 72 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89

Team Statistics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Individual Statistics. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Game Recaps. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2005 Opponent Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

128 132 134 138

Oklahoma History Individual Records . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Team Records . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Longest Plays. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Season Records. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Bowl History . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Award Winners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Heisman Trophy Winners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . All-Americans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . All-Americans Under Stoops . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . All-Conference Honors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . OU Letterwinners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sooners in the Pros . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sooner Football Seasons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Oklahoma Traditions. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Prentice Gautt Academic Center . . . . . . . . . . . . . . . . . . . . . . . . . . . . Academic Honors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . University President . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Director of Athletics. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Oklahoma Memorial Stadium . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

140 142 143 154 158 171 172 174 175 179 182 188 192 199 200 202 203 204 206

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

Bob Stoops. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Brent Venables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Bobby Jack Wright . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Chuck Long . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Cale Gundy. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Jackie Shipp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Kevin Sumlin. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Kevin Wilson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Darrell Wyatt. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Chris Wilson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Jerry Schmidt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Matt McMillen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Merv Johnson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Greg Tipton. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Scott Anderson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Support Staff. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Review & Opponents REVIEW & OPPONENTS

2005 Season

THE SOONERS

Ah You / Alexander . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 Ayodele / Baker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 Barresi / Bassey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 Bennett / Birdine. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 Bomar / Bowers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 96 Braxton / Bush . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 Cade / Carter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 Chaisson / Chaney . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99 Chester / Coleman . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 Davis / Dennison . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 Dotson / Dvoracek . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 Finley / Freeby . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 Grady / Gutierrez . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 Hartley / Hickson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 Holmes / Ingram . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106 Jones / Joseph . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 Latimer / Messner. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Millington / Moses. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 Nixon / Onyenegecha. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Pendleton / Peterson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 111 Pleasant / Poteat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 Quinn / Rankins . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 Rayl / Rice . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 114 Roberts / Robinson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 115 Ross / Runnels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 Schacht / Thibodeaux. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117 Thompson / Walker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 118 D. Williams / J. Williams . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 119 Wilson / Wolfe. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 Zaslaw / Chart Climbers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 121 Newcomers. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 122

COACHING STAFF

2005 Sooners

OU Football Quick Facts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 The Sooner Tradition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Booming Sooners. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 National Championships. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Conference Titles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 All-Americans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 National Award Winners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 Sooners in the NFL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 National Attention . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 Bowl Games . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 OU-Texas Weekend . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 Gameday in Norman . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 Football Facilities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 Sooner Power. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 Explosive Offense. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 Dominating Defense. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 Special Teams . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36 Head Coach Bob Stoops . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 OU Assistant Coaches . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 The Sooner Nation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42 University of Oklahoma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 Academic Success . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46 Community Service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 Norman & Oklahoma City. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 Big 12 Conference . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52

2 0 0 5 S EAS ON

Welcome to Oklahoma Football

3


141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

OU FOOTBALL QUICK FACTS University Information

Oklahoma Football History

Name of School . . . . . . . . . . . . . . . . . . . . . . . . . . University of Oklahoma Location . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Norman, Okla. Founded . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1890 Enrollment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31,400 Nickname . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sooners School Colors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Crimson & Cream Conference. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Big 12 (South Division) School President . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . David L. Boren Director of Athletics. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Joe Castiglione School Website. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . OU.edu Athletics Website . . . . . . . . . . . . . . . . . . . . . . . . . . . . SoonerSports.com Conference Website . . . . . . . . . . . . . . . . . . . . . . . . . . . . Big12sports.com

First Year of Football. . . . . . . . . . . . . . . . . . . 1895 (2005 is 111th season) All-Time Record . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 749-285-53 (.713) Record since WWII (1946-2004) . . . . . . . . . . . . . . . . . 505-153-13 (.762) All-Time Conference Record . . . . . . . . . . . . . . . . . . . . 404-129-22 (.747) All-Time in Big 12 Conference . . . . . . . . . . . . . . . . . . . . . . . . 49-23 (.680) All-Time Bowl Record . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23-14-1 (.618)

Stadium Information

23 BOWL CHAMPIONSHIPS

Stadium Name . . . . . . . . . . . . . . . . Gaylord Family - Oklahoma Memorial Field Name . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Owen Field Field . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Natural Grass OfďŹ cial Capacity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82,112 First Year . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1923 First Game at Site . . . . . . . . . Oct. 20, 1923 (OU 62, Washington, Mo. 7) Largest Crowd . . . . . . . . . 84,916 on Nov. 13, 2004 (OU 30, Nebraska 3) Record at Stadium . . . . . . . . . . . . . . . . . . . 320-79-14 (.792) (1923-2004) Most Consecutive Wins . . . . . . . . . . . . . . . . . . . . . . . . . . 25 (1947-1952)

Oklahoma Coaches & Staff Bob Stoops. . . . . . . . . . . . . . . . . . . . . . . Head Coach (Seventh Season) Overall Record at OU . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67-12 (.848)

39 C ON FERENCE CHAMPIONSHIPS

Brent Venables . . . . . . . . . Assoc. Head Coach/Defensive Coordinator/LB Bobby Jack Wright . . . . Asst. Head Coach/Co-Defensive Coordinator/DB Chuck Long . . . . . . . . . . . . . . . . . . . . . . . . . . . Offensive Coordinator/QB Cale Gundy. . . . . . . . . . . . . . . . . . . . . . . . . . . . Recruiting Coordinator/RB Jackie Shipp . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Assistant Coach/DL Kevin Sumlin . . . . . . . . . . . . . . . . . . . . . . Special Teams Coordinator/TE Kevin Wilson. . . . . . . . . . . . . . . . . . . . . . . . .Co-Offensive Coordinator/OL Darrell Wyatt . . . . . . . . . . . . . . . . . . . . . .Passing Game Coordinator/WR Chris Wilson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Assistant Coach/DE

2005 Oklahoma Football

7 NATI ONAL CHAMPIONSHIPS

Offensive Lettermen Returning. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 Defensive Lettermen Returning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Specialist Lettermen Returning . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Lettermen Lost . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 Players Redshirted in 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 Seniors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Juniors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Sophomores . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Redshirt Freshmen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . True Freshmen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

23 11 25 14 24

2004 Final Record . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12-1 Conference Record . . . . . . . . . . . . . . . . . . . . . . 8-0 (Big 12 Champions) Final Ranking . . . . . . . . . . . . . . . . . . . . . . No. 3 (AP & ESPN/USA Today)

4 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

National Championships. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 2000 1985 1975 1974 1956 1955 1950 Conference Titles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 2004 2002 2000 1987 1986 1985 1984 1980 1979 1978 1977 1976 1975 1974 1973 1972 1968 1967 1962 1959 1958 1957 1956 1955 1954 1953 1952 1951 1950 1949 1948 1947 1946 1944 1943 1938 1920 1918 1915 Big 12 Conference Titles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 2004 2002 2000 Bowl Appearances . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 2004 2003 2002 2001 2000 1999 1994 1993 1991 1988 1987 1986 1985 1984 1982 1981 1980 1979 1978 1977 1976 1975 1972 1971 1970 1968 1967 1964 1962 1958 1957 1955 1953 1950 1949 1948 1946 1938 Bowl Championships . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 2002 2001 2000 1993 1991 1986 1985 1981 1980 1979 1978 1976 1975 1972 1971 1967 1958 1957 1955 1953 1949 1948 1946 Undefeated Seasons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 2000 1974 1973 1956 1955 1954 1949 1920 1918 1915 1911 1898 1897 1896 10+ Win Seasons . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 (No. 1 in Nation) 2004 2003 2002 2001 2000 1987 1986 1985 1980 1979 1978 1977 1975 1974 1973 1972 1971 1967 1958 1957 1956 1955 1954 1950 1949 1948 1938 1915 Most Consecutive Wins . . . . . . . . . . . 47, 1953-1957 (NCAA D1 Record) All-Time Points Scored . . . . . . . . . . . . . . . . . . . . 28,433 (No. 1 in Nation) Weeks at No. 1 in AP Poll . . . . . . . . 95 (Tied for No. 1 with Notre Dame) Weeks in Top 5 AP Poll . . . . . . . . . . . . . . . . . . . . . . 342 (No. 1 in Nation) All-Americans . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 141 (63 Consensus) First-Team All-Conference Players . . . . . . . . . . . . . . . . . . . . . . . . . . . 411 Heisman Trophy Winners . . . . . . . . . . . . . . . . 4 (2003, 1978, 1969, 1952) Years with OU Player in Heisman Top 10. . . . . . . . . . . . . . . . . . . . . . . 23 National Award Winners . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 NFL Draft Picks . . . . . . . . . . . . . . . . . . . . . 316 (four overall No. 1 picks) 2005 NFL Draft . . . . . . . . . . . . . . . . 10 Players Selected (No. 1 in Nation) Sooners on Television . . . . . . . . . . . . . . . . . . . . . 223 Games (141-77-5) First TV Game . . . . . . . . . . . . . . . Nov. 8, 1952, on NBC vs. Notre Dame


COACH STOOPS

Oklahoma Head Coaches (1999-Present) . . . . . . . . . . 67-12 (.848) (1996-1998). . . . . . . . . . . . . 12-22 (.353) (1995) . . . . . . . . . . . . . . . . . 5-5-1 (.500) (1989-1994). . . . . . . . . . . 44-23-2 (.652) (1973-1988). . . . . . . . . . 157-29-4 (.837) (1967-1972). . . . . . . . . . . 52-15-1 (.772) (1966) . . . . . . . . . . . . . . . . . . . 6-4 (.600) (1964-1965). . . . . . . . . . . . 9-11-1 (.452) (1947-1963). . . . . . . . . . 145-29-4 (.826) (1946) . . . . . . . . . . . . . . . . . . . 8-3 (.727) (1941-1945). . . . . . . . . . . 27-18-3 (.594) (1937-1940). . . . . . . . . . . . 27-8-3 (.792) (1935-1936). . . . . . . . . . . . . 9-6-3 (.583) (1932-1934). . . . . . . . . . . 11-12-4 (.482) (1927-1931). . . . . . . . . . . 19-19-6 (.500) (1905-1926). . . . . . . . . 122-54-16 (.677) (1904) . . . . . . . . . . . . . . . . . 4-3-1 (.563) (1902-1903). . . . . . . . . . . . 11-7-3 (.595) (1901) . . . . . . . . . . . . . . . . . . . 3-2 (.600) (1897-1900). . . . . . . . . . . . . 9-2-1 (.792) (1896) . . . . . . . . . . . . . . . . . . . . . . . . 2-0 (1895) . . . . . . . . . . . . . . . . . . . 0-1 (.000)

COACHING STAFF

Modern Era of College Football*

95 95 73 70 68 66 59 41 34 31

Weeks Ranked Top 5 in AP Poll* 1. Oklahoma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2. Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3. Notre Dame . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4. Ohio State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5. Michigan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6. Alabama . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7. Southern Cal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8. Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9. Florida State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10. Miami (Fla.) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

342 294 272 269 260 239 224 214 202 198

OKLAHOM A HISTORY

1. Oklahoma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505-153-13 (.762) 2. Ohio State. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 462-157-20 (.738) 3. Penn State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 474-171-9 (.731) 4. Michigan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 463-167-15 (.729) 5. Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 476-190-10 (.711) 6. Alabama . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 476-189-20 (.709) 7. Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 468-190-11 (.707) 8. Notre Dame . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 448-186-14 (.702) 9. Tennessee . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 461-191-24 (.699) 10. Southern Cal. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 446-197-23 (.686) 11. Florida State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 428-200-17 (.676) 12. Miami (Ohio). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 404-199-19 (.664) 13. Arizona State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 422-217-10 (.657) 14. Miami (Fla.). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 424-221-7 (.655) 15. Georgia. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 427-221-22 (.653)

1. Oklahoma . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Notre Dame . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3. Ohio State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4. Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5. Miami (Fla.) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6. Southern Cal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7. Florida State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8. Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9. Michigan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10. Alabama . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

REVIEW & OPPONENTS

2000s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60-7-0 (.896) 1990s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61-51-3 (.543) 1980s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91-26-2 (.773) 1970s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102-13-3 (.877) 1960s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62-40-2 (.606) 1950s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93-10-2 (.895) 1940s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69-27-4 (.710) 1930s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49-33-12 (.585) 1920s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38-30-11 (.551) 1910s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65-20-6 (.747) 1900s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51-26-8 (.647) 1890s (First season in 1895) . . . . . . . . . . . . . . . . . . . . . . . . . 8-2-0 (.800) Overall 749-285-53 (.713)

THE SOONERS

Weeks Ranked No. 1 in AP Poll*

Oklahoma Football by Decade

* First full season after WWII to present (1946-2004)

2 0 0 5 S EAS ON

Bob Stoops . . . . . . . . . . . . . . . John Blake . . . . . . . . . . . . . . . . Howard Schnellenberger . . . . . Gary Gibbs . . . . . . . . . . . . . . . Barry Switzer . . . . . . . . . . . . . . Chuck Fairbanks . . . . . . . . . . . Jim Mackenzie . . . . . . . . . . . . . Gomer Jones . . . . . . . . . . . . . . Bud Wilkinson . . . . . . . . . . . . . Jim Tatum . . . . . . . . . . . . . . . . Dewey Luster . . . . . . . . . . . . . . Thomas Stidham . . . . . . . . . . . Lawrence Jones . . . . . . . . . . . . Lewie Hardage . . . . . . . . . . . . Adrian Lindsey . . . . . . . . . . . . . Bennie Owen . . . . . . . . . . . . . . Fred Ewing . . . . . . . . . . . . . . . Mark McMahon . . . . . . . . . . . . Fred Roberts . . . . . . . . . . . . . . Vernon Parrington . . . . . . . . . . No Coach . . . . . . . . . . . . . . . . . John Harts . . . . . . . . . . . . . . . .

* 922 Associated Press polls since service began in 1936

AP National Championships 1. Notre Dame . . . . . . . . 2. Oklahoma . . . . . . . . . . 3. Alabama . . . . . . . . . . . 4. Miami (Fla.) . . . . . . . . 4. Southern Cal . . . . . . .

8 7 6 5 5

. . . . . . (1988, ‘77, ‘73, ‘66, ‘49, ‘47, ‘46, ‘43) . . . . . . . . . (2000, ‘85, ‘75, ‘74, ‘56, ‘55, ‘50) . . . . . . . . . . . . .(1992, ‘79, ‘78, ‘65, ‘64, ‘61) . . . . . . . . . . . . . . . . (2001, ‘91, ‘89, ‘87, ‘83) . . . . . . . . . . . . . . . . (2004, ‘03, ‘72, ‘67, ‘62)

5 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


SOONER FOOTBALL TRADITION 6 3 NAT IONAL AWARD WINNERS

Great college football and the Oklahoma Sooners. For as long as anyone can remember the two have been one and the same. Unlike some schools where tradition represents ancient history, or others where it harkens back only a few years, Oklahoma’s tradition is a constant accomplishment unfettered by eras or time.

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

The Sooners were playing football before Oklahoma became a state and have achieved a legacy so successful, that more than contributing to the history of this great game, it defines it.

Most Successful Program of the Modern Era

7 NATI ONAL CHAMPIONSHIPS

Oklahoma is king in the modern era of college football. Since the end of World War II, the Sooners are the winningest program in the nation with more victories (505) than any other school and the best winning percentage (76 percent). Victories since 1946:

6 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


2 0 0 5 S EAS ON

Greatest Players in College Football Some of the greatest players in college football history have worn the Crimson and Cream. The University of Oklahoma has averaged more than one All-American per year since it began playing football in 1895. To date, OU players have been bestowed the prestigious honor 141 times.

COACHING STAFF

Four Sooners have been awarded the Heisman Trophy including quarterback Jason White in 2003, running back Billy Sims in 1978 and running back Steve Owens in 1969. Running back Billy Vessels was OU’s first Heisman winner in 1952.

THE SOONERS

7 National Championships 39 Conference Championships 23 Bowl Championships 4 Heisman Trophy Winners 63 National Award Winners 141 All-Americans

OKLAHOM A HISTORY

2004 BIG 12 CHAM PIONS

REVIEW & OPPONENTS 7 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


BOOMING SOONERS

ADRIAN PETERSON

6 3 NAT IONAL AWARD WINNERS

What have you done for me lately? In Oklahoma’s case, plenty. This is one of the hottest programs in all of sports. Oklahoma has played in three national championship games over the last five seasons, owns three Big 12 championships during that time and turned out a list of award winners and draft picks so long that it taxes even the best memory to name all of them.

141 ALL-A MERICANS

Greatness begets greatness and there has been plenty of that in Norman lately. Now, from all corners of the country, the best players come to join a program of traditional success that is riding one of its biggest waves.

23 BOWL CHAMPIONSHIPS

Wins Since 2000

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

Winning Percentage Since 2000

For the Record ... 169 Times Anyone with their sights set on attacking the Oklahoma record book had better bring the house. Seven national championships and 141 All-Americans have set most of the numbers somewhere in the stratosphere. That’s what makes Bob Stoops’ six-year run and the recent Sooner success all the more impressive.

8 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Since 1999 (the year of Stoops’ arrival), Oklahoma has set or tied 123 individual school records and 46 team marks for a total of 169 record book rewrites. That kind of production tends to draw a crowd, which would explain how during that same period the Sooners have also broken their single-game attendance record eight times and their season attendance standard twice.


RUFUS A LEXANDER

2004 Season

Orange Bowl, Big 12 Champions

2 0 0 5 S EAS ON

2003 Season

Sugar Bowl, Big 12 South Champions

2002 Season

Rose Bowl, Big 12 Champions

2001 Season

COACHING STAFF

12-1 12-2 12-2 11-2 13-0

Cotton Bowl

2000 Season

National Champions, Orange Bowl, Big 12 Champs

THE SOONERS

MEMORIAL STADIUM

REVIEW & OPPONENTS OKLAHOM A HISTORY 9 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SEVEN NATIONAL CHAMPIONSHIPS

QUENTIN GRIFFIN

Stoops Leads Oklahoma to Seventh Title In a season so richly laced with great moments, the one for the ages came in the national title game, a 13-2 victory over Florida State in the Orange Bowl. It has been called by some the greatest defensive effort ever in a championship game. The national title season came just two years into Bob Stoops’ tenure and just two years removed from a sub-.500 season. Along the way, the Sooners had thrilling wins over Nebraska, Texas, Texas A&M and Kansas State (twice), with only one of those contests played at Owen Field in Norman. Headliners included QB Josh Heupel, who finished second in the Heisman voting, and big-play linebacker Torrance Marshall. The mark at the end of the season was an unblemished 13-0.

10 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


2 0 0 5 S EAS ON

HEAD COACH BOB STOOPS

Oklahoma is Championship Football Nothing defines the competitive success of a college athletics program like a national championship. Oklahoma, with seven national titles sprinkled over four decades, is one of the very few programs that sets out each fall with the expectation and legitimate goal of pursuing the national crown. That pursuit rates as a lot more than just talk around here.

The Sooners under Bob Stoops earned the conference’s most recent title in 2000 with an Orange Bowl victory over Florida State to cap an undefeated, 13-0 season. OU’s other championships came under Barry Switzer in 1985, 1975 and 1974, and Bud Wilkinson in 1956, 1955 and 1950. Nebraska is second with five championships and Texas has three. Colorado and Texas A&M each have claimed one title.

COACHING STAFF

The aura is unmistakable, and it radiates from real and repeated success on college football’s biggest stage. Oklahoma has claimed more national championships than any other Big 12 program.

THE SOONERS

BAR RY SW ITZER

Barry Switzer led his Oklahoma teams to national championships in 1985, 1974 and 1975. He also won 12 Big Eight Conference championships and had eight bowl victories in 13 appearances. Switzer directed the Sooners on a 28-game win streak from 1973 (his first season as head coach) to 1975. When Oklahoma won the national championship in 1975, it marked the first time in history a team had won back-to-back titles more than once. In 1970, as an assistant, he convinced head coach Chuck Fairbanks to make the most significant and gutsy move in OU’s football history, a switch to the wishbone offense.

BUD WI LKINSON

Oklahoma’s 13th football coach produced teams that were 6-2 in postseason play, won the national championship in 1950, 1955 and 1956 and did not lose an astounding 74 straight conference games from 1946-1959 (72 wins, 2 ties). His teams still hold the modern record for wins by a Division IA school with 47 straight victories from 1953-1957. After the 1947 season, the Sooners won 12 straight conference championships. In 17 seasons at Oklahoma, Wilkinson fostered racial integration and graduated players at an 87.2 percentage rate while becoming the eighth-winningest coach in Division I-A history.

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

Head Coach Bud Wilkinson

REVIEW & OPPONENTS

1985 1975 1974 1956 1955 1950

Head Coach Barry Switzer

11


39 CONFERENCE CHAMPIONSHIPS 6 3 NAT IONAL AWARD WINNERS

Three Big 12 Crowns in Five Years Oklahoma won its first conference championship in 1915 and has since tacked on another 38. In other words, the Sooners average a conference title just about every two seasons. That same pace has carried through the Bob Stoops era with three league crowns in six years. That feat merits considerable respect. Under the Big 12 format, teams must first win a divisional crown over five opponents before advancing to meet the other divisional winner at a neutral site.

141 ALL-A MERICANS

Since the formation of the Big 12 Conference in 1996, no team has won as many league titles as Oklahoma.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

2004 BIG 12 CHAMPIONS

Three Big 12 Conference Championships Since the formation of the Big 12 Conference in 1996, no team has won as many league titles as Oklahoma. The Sooners defeated Colorado, 42-3, at Arrowhead Stadium in Kansas City for the 2004 crown. OU won the 2002 Big 12 title over Colorado, 29-7, at Reliant Stadium in Houston and captured its first Big 12 championship in 2000 with a 27-24 victory against Kansas State at Arrowhead Stadium.

12 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


2004

Sooners Roll Past Colorado, 42-3

Big 12 Champions

2002

Oklahoma Handles Buffaloes, 29-7

2000

OU Beats Kansas State for Title, 27-24

Nate Hybl threw two touchdown passes and Quentin Griffin ran for a championship game-record 188 yards and two touchdowns as the eighthranked Sooners beat the No. 12 Buffaloes, 29-7.

Big 12 Champions

2002 BIG 12 CH AMPIONS

Oklahoma’s 39 Conference Titles Coach Bob Stoops Bob Stoops Bob Stoops Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Barry Switzer Chuck Fairbanks Chuck Fairbanks Chuck Fairbanks Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Bud Wilkinson Jim Tatum Snorter Luster Snorter Luster Tom Stidham Bennie Owen Bennie Owen Bennie Owen

OKLAHOM A HISTORY

Overall 12-1 12-2 13-0 11-1 11-1 11-1 9-2-1 10-2 11-1 11-1 10-2 9-2-1 11-1 11-0 10-0-1 11-1 7-4 10-1 8-3 7-3 10-1 10-1 10-0 11-0 10-0 9-1-1 8-1-1 8-2 10-1 11-0 10-1 7-2-1 8-3 6-3-1 7-2 10-1 6-0-1 6-0 10-0

REVIEW & OPPONENTS

Record 8-0 6-2 8-0 7-0 7-0 7-0 6-1 7-0 7-0 6-1 7-0 5-2 6-1 7-0 7-0 5-1 6-1 7-0 7-0 5-1 6-0 6-0 6-0 6-0 6-0 6-0 5-0 6-0 6-0 5-0 5-0 4-0-1 4-1 4-0-1 5-0 5-0 4-0-1 2-0 3-0

THE SOONERS

Conference Big 12 Big 12 Big 12 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 8 Big 7 Big 7 Big 7 Big 7 Big 7 Big 7 Big 7 Big 7 Big 7 Big 7 Big 7 Big 7 Big 6 Big 6 Big 6 Big 6 Big 6 Missouri Valley Southwest Southwest

COACHING STAFF

A surprise option pitch on fourth-and-inches turned into a 22-yard gain by Quentin Griffin and set up Josh Heupel’s 17-yard go-ahead touchdown pass in No. 1 Oklahoma’s 27-24 victory over Kansas State.

Big 12 Champions Year 2004 2002 2000 1987 1986 1985 1984 1980 1979 1978 1977 1976 1975 1974 1973 1972 1968 1967 1962 1959 1958 1957 1956 1955 1954 1953 1952 1951 1950 1949 1948 1947 1946 1944 1943 1938 1920 1918 1915

2 0 0 5 S EAS ON

Oklahoma was nearly flawless in Kansas City, getting three touchdown passes from Jason White and three more on the ground from Adrian Peterson to dismantle Colorado at Arrowhead Stadium for the Big 12 title.

13


DAN CODY

If it’s a college football season, the likelihood is that more than one Sooner ranks among the best players in the land. That was true in 1913 when OU produced its first All-American and it’s true today when the rate of additions is so rapid that the total now outnumbers the age of the program itself. One of college football’s greatest programs has been built on some of college football’s finest players. That’s the natural result when talent meets coaching at a program with eye-popping facilities and great visibility.

JAMMAL BROWN

All-Americans Under Stoops Year 2004 2004 2004 2004 2004 2003 2003 2003 2003 2003 2003 2003 2002 2002 2002 2001 2001 2001 2000 2000 2000

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

141 ALL-AMERICANS

14 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Player Position Jammal Brown . . . . . . . . . . . . . . . . Offensive Tackle Vince Carter . . . . . . . . . . . . . . . . . . Center Mark Clayton . . . . . . . . . . . . . . . . . Wide Receiver Dan Cody . . . . . . . . . . . . . . . . . . . . Defensive End Adrian Peterson . . . . . . . . . . . . . . . Running Back Jammal Brown . . . . . . . . . . . . . . . . Offensive Tackle Mark Clayton . . . . . . . . . . . . . . . . . Wide Receiver Tommie Harris . . . . . . . . . . . . . . . . Defensive Tackle Teddy Lehman . . . . . . . . . . . . . . . . Linebacker Antonio Perkins . . . . . . . . . . . . . . . Return Specialist Derrick Strait . . . . . . . . . . . . . . . . . Defensive Back Jason White . . . . . . . . . . . . . . . . . . Quarterback Brandon Everage . . . . . . . . . . . . . . Defensive Back Tommie Harris . . . . . . . . . . . . . . . . Defensive Tackle Teddy Lehman . . . . . . . . . . . . . . . . Linebacker Rocky Calmus . . . . . . . . . . . . . . . . Linebacker Jeff Ferguson . . . . . . . . . . . . . . . . . Punter Roy Williams . . . . . . . . . . . . . . . . . Defensive Back Rocky Calmus . . . . . . . . . . . . . . . . Linebacker Josh Heupel . . . . . . . . . . . . . . . . . . Quarterback J.T. Thatcher . . . . . . . . . . . . . . . . . Defensive Back


ROY WILLIAMS

2 0 0 5 S EAS ON COACHING STAFF

110 Years of OU Football 141 All-Americans 63 Consensus All-Americans 21 All-Americans Under Stoops 12 All-Americans Last Two Years

THE SOONERS

University of Oklahoma players have earned consensus All-America honors 63 times in the program’s history. No other school in the Big 12 Conference has produced more consensus All-Americans.

REVIEW & OPPONENTS

ANTONIO PE RKINS

Consensus All-Americans in the Big 12

OKLAHOM A HISTORY 15 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS 16

Sixteen Winners in Last Five Seasons For many years, college football has paused at the end of each season to recognize its finest players. The award names like Heisman, Outland, Thorpe and Butkus are woven into the fabric of the game as a tribute to the past and a beacon for the present.

JAS ON WHIT E

6 3 NAT IONAL AWARD WINNERS

NATIONAL AWARD WINNERS The awards ceremonies attract the greatest names in the game, and of course, they attract and honor Oklahoma Sooners. The road to the bright lights, podium and acceptance speech starts with great talent and hard work, common staples at OU. The Sooner program then provides the national stage on which players can be seen. The result has been an impressive collection of hardware.

2003

Heisman Trophy Winner Jason White

1978

Heisman Trophy Winner Billy Sims

1969

Heisman Trophy Winner Steve Owens

1952

Heisman Trophy Winner Billy Vessels 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

National Award Winners Under Stoops Year 2004 2004 2004 2004 2003 2003 2003 2003 2003 2003 2003 2001 2001 2001 2000 2000

Player Position Award Jammal Brown . . . . . . . OT. . . . . . . . . . Outland Trophy Jason White . . . . . . . . . QB. . . . . . . . . . Davey O’ Brien Award Jason White . . . . . . . . . QB. . . . . . . . . . Unitas Award Jason White . . . . . . . . . QB. . . . . . . . . . Maxwell Award Tommie Harris. . . . . . . . DT. . . . . . . . . . Lombardi Award Jason White . . . . . . . . . QB. . . . . . . . . . Heisman Trophy Teddy Lehman . . . . . . . .LB . . . . . . . . . . Butkus Award Derrick Strait . . . . . . . . . DB. . . . . . . . . . Thorpe Award Teddy Lehman . . . . . . . .LB . . . . . . . . . . Bednarik Award Derrick Strait . . . . . . . . . DB. . . . . . . . . . Nagurski Award Jason White . . . . . . . . . QB. . . . . . . . . . Davey O’ Brien Award Roy Williams . . . . . . . . . DB. . . . . . . . . . Nagurski Award Rocky Calmus. . . . . . . . .LB . . . . . . . . . . Butkus Award Roy Williams . . . . . . . . . DB. . . . . . . . . . Thorpe Award Josh Heupel . . . . . . . . . QB. . . . . . . . . . Walter Camp Trophy J.T. Thatcher . . . . . . . . . RS. . . . . . . . . . Mosi Tatupu Award


LEE ROY SELMON

Outland Trophy Winners Under Stoops: Jammal Brown, 2004

2 0 0 5 S EAS ON

Heisman Trophy Winners Under Stoops: Jason White, 2003

Butkus Award Winners

Under Stoops: Teddy Lehman, 2003; Rocky Calmus, 2001

Lombardi Award Winners

COACHING STAFF

5 4 4 3 3

Under Stoops: Tommie Harris, 2003

Thorpe Award Winners

Under Stoops: Derrick Strait, 2003; Roy Williams, 2001

Only one school has produced the winner of the Nagurski Award (best defensive player) and Thorpe Award (best defensive back) in the same season. And Oklahoma has done it twice. Roy Williams was the ďŹ rst to pull off the double in 2001 and Derrick Strait followed in 2003.

THE SOONERS

OU Two for Two with Nagurski & Thorpe

OKLAHOM A HISTORY

DERRIC K STRAIT

REVIEW & OPPONENTS 17 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


JAMMAL BROWN

Elite Program Prepares Players for Next Level The league. Pro ball. The next level. It is the dream of every college football player. It is reality for many Oklahoma Sooners. Few programs in the country attract talent and prepare it to move on better than Oklahoma. Ten Sooners were tabbed in the 2005 NFL Draft alone, including two in the first round and five in the first two. OU plays pro schemes, has two coaches who had lengthy NFL careers and employs a rigorous strength and conditioning program that is so effective that many of those who have gone on to professional careers come back to Norman in the off-season to continue their training. Players with the ability and drive to make the NFL flourish at Oklahoma and leave here equipped to play football beyond their college days.

ROY WILLIAMS

Sooners Drafted Under Bob Stoops Player Jammal Brown Mark Clayton Brodney Pool Mark Bradley Dan Cody Brandon Jones Antonio Perkins Donte Nicholson Lance Mitchell Wes Sims Tommie Harris Teddy Lehman Derrick Strait Andre Woolfolk Quentin Griffin Jimmy Wilkerson Trent Smith Roy Williams Rocky Calmus Torrance Marshall Josh Heupel Stockar McDougle William Bartee

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

HEADER IN THE NFL SOONERS

18 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Position Offensive Line Wide Receiver Safety Wide Receiver Defensive End Wide Receiver Defensive Back Defensive Back Linebacker Offensive Line Defensive Tackle Linebacker Defensive Back Defensive Back Running Back Defensive End Tight End Defensive Back Linebacker Linebacker Quarterback Offensive Line Defensive Back

Year 2005 2005 2005 2005 2005 2005 2005 2005 2005 2005 2004 2004 2004 2003 2003 2003 2003 2002 2002 2001 2001 2000 2000

Team Saints Ravens Browns Bears Ravens Titans Browns Buccaneers Cardinals Chargers Bears Lions Jets Titans Broncos Chiefs Ravens Cowboys Titans Packers Dolphins Lions Chiefs


TOMMIE HARRIS

OU Most Popular Pick in 2005 Draft 2 0 0 5 S EAS ON

OU supplied the most selections of any school in the 2005 NFL Draft.

JAMMAL BROWN

First Round - New Orleans Saints

MARK CLAYTON

First Round - Baltimore Ravens

COACHING STAFF

BRODNEY POOL

Second Round - Cleveland Browns

MARK BRADLEY

Second Round - Chicago Bears

Second Round - Baltimore Ravens “They get quality athletes and give them a chance to make plays. Plus, they do a great job of coaching at Oklahoma. That program has a tremendous amount of pride. They’ve won a lot of big games. And that type of atmosphere usually rubs off on the players.”

THE SOONERS

DAN CODY

- Baltimore Ravens Director of College Scouting Eric DeCosta, May 2005

REVIEW & OPPONENTS

BRANDON JONES

Third Round - Tennessee Titans

ANTONIO PERKINS

Fourth Round - Cleveland Browns

LANCE MITCHELL Fifth Round - Arizona Cardinals

KELLY GREGG

Fifth Round - Tampa Bay Buccaneers

OKLAHOM A HISTORY

DONTE NICHOLSON

WES SIMS

Sixth Round - San Diego Chargers

19 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


Sooners at Center of College Football Oklahoma is a household name due to the overwhelming media attention that hovers around the Sooners. Writers and broadcasters representing the nation’s most recognized media outlets regularly interact with Sooner players and coaches and routinely spend time in Norman. And when they can’t come to campus, those same observers keep tabs on OU thanks to extensive television coverage. In 2004, all 13 Oklahoma games appeared on live television, including seven that were carried nationally or regionally on ABC. The Sooners are at the very center of college football and the entire world is watching.

MEDIA EXPOSURE

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

NATIONAL ATTENTION AT OU

20 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


MARCUS WALKER

Since 2000, Oklahoma players have appeared on the cover of Sports Illustrated eight times. Sooner football is one of the most popular subjects for SI with 29 cover appearances.

2 0 0 5 S EAS ON

Over the past five years, ESPN’s popular College Gameday production has broadcast on site from 15 of Oklahoma’s games. That’s an average of three games per season. 35 million people logged on to SoonerSports.com last year, making the official website of the Oklahoma Athletics Department one of the top five college sites in the nation. The Sooners have played in front of 37 consecutive sellout crowds at Oklahoma Memorial Stadium in Norman, including every home game of Coach Bob Stoops’ tenure.

COACHING STAFF

5 8 15 35 37 92

The popularity of the Sooners is evident in the immense amount of products and apparel purchased by fans. OU ranks fifth in the nation in sales of licensed merchandise.

Over the past four seasons, 92 percent of Oklahoma’s games were televised live (50 of 54 games). In fact, 31 consecutive OU games have been on TV.

THE SOONERS REVIEW & OPPONENTS OKLAHOM A HISTORY 21 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

Thirty-eight bowl appearances and 23 bowl victories have firmly entrenched Oklahoma among the most tradition-rich schools in America. The Sooners have become synonymous with post-season play at the highest level. At a school where the bowl history is laced with games of historical significance, the last few years have represented another fabulous roll for the Schooner. Three times in the last five seasons the Sooners have played for the national championship, four times they have been in BCS bowls and in all five seasons they played in January games. Oklahoma enjoys favored status among the bowl community, mostly for its tradition, but also for its fan following. Some 30,000 ventured to the Rose, Sugar and Orange Bowls over the last three seasons. Regardless of the location, Sooner fans flock to follow a bowl tradition that is as fresh as it is historic.

2005

ORANGE BOWL

O K L A H O M A V S. S O U T H ERN CAL

2004

SUGAR BOWL

O K L A H O M A V S. L O U I S I A NA STATE

2003

ROSE BOWL

O K L A H O M A V S. WA S H I N GTON STATE

2002

COTTON BOWL O K L A H O M A V S. A R K ANSAS

2001

ORANGE BOWL

O K L A H O M A V S. F L O R I DA STATE

22 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

NATE H YBL

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

23 BOWL CHAMPIONSHIPS


Bowls in Stoops’ Six Seasons

Perennial Bowl Contenders

2 0 0 5 S EAS ON

Oklahoma is one of just 11 schools with more than 35 bowl appearances. The Sooners rank third in bowl winning percentage among those teams.

BCS Bowl Games in Five Years BCS Title Games in Five Years

COACHING STAFF

6 4 3

THE SOONERS REVIEW & OPPONENTS OKLAHOM A HISTORY 23 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


The Oklahoma-Texas game, played each season at the Cotton Bowl in Dallas, a location approximately halfway between the two campuses, is one of the country’s most spectacular sporting events.

GOLDEN HAT TROP HY

Staged during the State Fair of Texas, the contest is witnessed by a crowd perfectly defined by color – half crimson, half burnt orange – in an atmosphere that is arguably more unique than that found at any other game. This rivalry is one that marks time and gives players and fans alike experiences for a lifetime.

7 NATI ONAL CHAMPIONSHIPS 24 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

KEJUAN JONES

Storied Rivalry at Cotton Bowl in October

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

OU-TEXAS WEEKEND


Sooners Power to Five Straight Over Horns 2 0 0 5 S EAS ON

Oklahoma has won the last five Red River Shootouts ... all by double digits. The combined score of those games was 189-54. Last season, OU handed Texas its first shutout in 24 years, 12-0. In 2003, the Sooners set series records for points and most lopsided victory in a 65-13 rout. In the 2002 game, Oklahoma rallied with 24 unanswered points to post a 35-24 win. 2001 saw “The Play” as Sooner Roy Williams leaped over the Texas offensive line and batted a Chris Sims’ pass to set up an interception by Teddy Lehman and the decisive score, 14-3. In the 2000 game, the Sooners scored on its first five drives to punish the Longhorns, 63-14, en route to Oklahoma’s seventh national title.

COACHING STAFF

2004

OU 12, Texas 0

OU 35, Texas 24

OU 14, Texas 3

2000

OKLAHOM A HISTORY

2001

REVIEW & OPPONENTS

2002

TRENT SMITH

OU 65, Texas 13

THE SOONERS

2003

OU 63, Texas 14 25 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

FOOTBALL TIME IN OKLAHOMA

Sooners Set to Perform in Norman To understand a football Saturday in Norman, one must first understand what the sport means to Oklahomans. The Sooners were competing on the gridiron before this grand land moved from territorial status to statehood. Few college programs are more engrained in their surroundings than the one at OU. Game day at Oklahoma is about more than 80,000 fans witnessing one of the most historic and vibrant programs in college football at one of the game’s truly great cathedrals. It is about pride for a great university. Indeed, it is about pride for an entire state. Game day here represents football and a whole lot more.

26 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

ERIC BASSEY


D.J. WOLFE

Although OU just completed a stadium expansion, the facility operated at 104 percent capacity in 2004 -- fourth best in the nation. That means no empty seats for games in Norman.

2 0 0 5 S EAS ON

The official capacity of Memorial Stadium is 82,112 but OU averaged 84,532 fans per game last season. That put the Sooners at No. 9 in the nation in average attendance. Since the stadium’s opening in 1923, the Sooners have 32 undefeated seasons at home, including five perfect home seasons under head coach Bob Stoops. The Sooners have played in front of 37 consecutive sellout crowds in Norman including every home game of Bob Stoops’ tenure.

COACHING STAFF

1 4 9 32 37 79

Oklahoma ranked No. 1 in the Big 12 Conference in average attendance with 84,532 per home game last season. 2004 marked the highest average in school history.

Oklahoma has won more than 79 percent of its home games at Memorial Stadium. Since the facility’s opening in 1923, the Sooners are 320-79-14 at home.

GAME DAY IN NORMAN THE SOONERS REVIEW & OPPONENTS OKLAHOM A HISTORY 27 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


Preparation Meets Opportunity It would be hard to imagine a football program doing more over the last five years to enhance its facilities than OU. The $70 million expansion and enhancement of Gaylord Family - Oklahoma Memorial Stadium is perhaps the most noticeable upgrade, but it is simply the lead project in a plan that has impacted every facet of Sooner football. A new locker room, a new indoor training facility, a new weight training facility, roughly 8,000 new seats and 60 new stadium suites are testaments to OU’s dedication to providing the best for its student-athletes. Preparation routinely meets opportunity at Oklahoma. It does so largely because the Sooners have what they need to succeed.

4 65 70 74

Four regulation-size practice fields are available to the Sooners right outside their locker room: Owen Field, two grass fields plus an artificial turf field with sand pit. The ceiling inside the Everest Training Facility hangs a full 65 feet above the SafePlay Synthetic Turf surface. This allows for all kicking and throwing drills during practice. Oklahoma recently completed a $70 million stadium expansion and enhancement project that added 8,000 seats. In 2004, OU led the Big 12 in average attendance at 84,532. On those rare days that the weather forces Oklahoma to practice indoors, the Sooners can move to the 74,000square-foot Everest Indoor Training Facility.

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

OU FOOTBALL FACILITIES

ALONZO DOTSON

7 NATI ONAL CHAMPIONSHIPS

OKLAHOMA LOCK ER ROOM

28 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


INDOOR FACILITY

2 0 0 5 S EAS ON COACHING STAFF THE SOONERS

THE SWITZER CENTER

REVIEW & OPPONENTS OKLAHOM A HISTORY 29

VIEW OU’S FACILITIES AT SOONERSPORTS.COM 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


Championship Strength & Conditioning The best testimony for the impact Jerry Schmidt and his staff have on Oklahoma football players comes from former Oklahoma players -- those in professional football. It’s not uncommon for members of that select fraternity to return to Norman for part of their off-season training regimen. During their time in the Sooner program, they learned the quality of the strength and conditioning program. Schmidt has been involved with three national football championships at three different schools. His success is no coincidence. Now in his seventh year at OU, he is recognized nationally as one of the best in the business, and the Athletics Department has surrounded him with facilities that give Sooner student-athletes the best opportunity to succeed.

3 4 10 22 31

Jerry Schmidt has coached with teams that played in five national championship games. He has three national title rings from Oklahoma, Notre Dame and Florida. Schmidt has worked with four Heisman winners, including Jason White (Oklahoma), Danny Wuerffel (Florida), Barry Sanders (Oklahoma State) and Tim Brown (Notre Dame). Coaches, scouts and personnel from every NFL team were on hand for the 2005 OU Pro Day. Ten Sooners were selected in the subsequent draft -- the most of any school. Schmidt has coached 22 NFL first-round picks including Oklahoma’s Jammal Brown, Mark Clayton, Tommie Harris, Andre Woolfolk and Roy Williams. No. 31 for the Dallas Cowboys and former Sooner standout, Roy Williams, donated $100,000 to establish a new weight room in Oklahoma’s Everest Training Facility.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONER POWER

30 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

COACH JERRY SCHMIDT


2 0 0 5 S EAS ON

2005 PRO DAY

COACHING STAFF THE SOONERS

THE MAKING OF A PRO FRESHMAN

SENIOR

Weight

160 lbs

193 lbs

Bench Press

120 lbs

275 lbs

Vertical Jump

28”

36.5”

40-Yard Dash

4.74 sec

REVIEW & OPPONENTS

WR MARK CLAYTON

4.42 sec

The Best in the Business OKLAHOM A HISTORY

“Jerry Schmidt is Oklahoma’s Director of Sports Enhancement. He worked under Tom Osborne at Nebraska, Lou Holtz at Notre Dame and Steve Spurrier at Florida, where he became buddies with the Gators’ then-defensive coordinator, Bob Stoops. “Schmidt made sure that Stoops’ players were big and fast. Insiders will tell you he’s probably the best in the business. The Sooners have played for three national titles since 2000... “Almost to a man, the Sooners looked like they were cut out of marble. There were no guts hanging over belts. There were no skinny arms or pear-shaped frames. They were as soft as petrified trees. These guys looked like well-conditioned athletes.”

MARK CLAYTON

- Ted Miller, Seattle Post-Intelligencer, April 23, 2005

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

31


6 3 NAT IONAL AWARD WINNERS

The Sooner offense is balanced, although its West Coast and pro influences are unmistakable. It is common to see the ball in the hands of 10-15 players during the course of a game. Many stay involved to the detriment of none.

Pass oriented? You could make that case. Numerous records for both passing and receiving have fallen over the last two years. Run oriented? Maybe. After all, the single season rushing mark was set in 2004. Well which is it, passing or running? At Oklahoma, the answer is both. After another blockbuster season in ’04, OU had two offensive players, a running back and a quarterback, among the five Heisman finalists. It also produced the Outland Trophy winner and saw three wide receivers selected in the 2005 NFL Draft.

Under Coach Stoops, the Oklahoma offense has produced:

One Heisman finalist, one All-American, two 1,000-yard rushers and Oklahoma’s single season rushing yards record holder. Two All-Americans, one Biletnikoff Award finalist and OU’s record holders in game, season and career receptions, receiving yards and touchdown receptions (tied). One Mackey Award and Oklahoma’s record holder in touchdown receptions in a game (tied). Three All-Americans, one Outland Trophy winner and two Rimington Award finalists.

32 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

ADRIAN PETERSON

QB RB WR TE OL

Two All-Americans, three Heisman finalists, one Heisman Trophy winner and OU’s record holders in game, season and career passing yards.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

Two OU Heisman Finalists in 2004

141 ALL-A MERICANS

EXPLOSIVE OFFENSE


TRAVIS WILSON

2 0 0 5 S EAS ON COACHING STAFF

Oklahoma has completed at least 61 percent of its passes in five of the six seasons since Coach Stoops’ arrival.

OU averages 37 points per game under Stoops.

OU spreads the wealth. Seventeen different players scored for the Sooners last season.

DAVIN JOSEPH

OKLAHOM A HISTORY

Last season, 18 different players caught passes in the Sooner offense.

REVIEW & OPPONENTS

OU has scored a touchdown in 81 consecutive games.

THE SOONERS

85 81 61 37 18 17

Under Bob Stoops, the Oklahoma offense has 85 scoring plays of 25 yards or longer. That’s stretching the field.

33 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


6 3 NAT IONAL AWARD WINNERS

Outstanding players have dominated the landscape. Twice in the last four years, a Sooner has been named the best defensive player in the nation.

CHIJIOKE ONYENEGECHA

Oklahoma’s defense suffers from a bit of an identity crisis, but nobody in Norman is about to say anything. With a takeaway in 70 of Bob Stoops’ 79 games and 14 interception or fumble returns for touchdowns during this coach’s tenure, the defense has a reputation of, well, being a little offensive in its approach. The Sooners’ attack-style defense, long appreciated for its speed and aggressive attitude, is perhaps best known for its consistency. OU has ranked among the top 13 teams in the nation in total defense for five consecutive years.

RUFUS ALEXANDER

With 45 sacks in 2003 and another 38 in 2004, the Oklahoma defense has amassed 83 sacks over the last two seasons.

Oklahoma has forced at least one turnover in 70 of 79 games (89 percent) over the last six seasons. The Sooner defense has had at least one interception in 51 of 67 games (76 percent) over the last five years.

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

Attacking Defense Built on Speed

141 ALL-A MERICANS

DOMINATING DEFENSE

Sooner defenders have scored 18 touchdowns, an average of three per year, since Bob Stoops took over at OU.

Since Bob Stoops arrived in 1999, the Oklahoma defense has surrendered an average of just 15 points per game.

7 NATI ONAL CHAMPIONSHIPS

Oklahoma has registered eight shutouts under Stoops, including a 12-0 blanking of Texas last season.

34 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

83 70 51 18 15 8


Oklahoma Defense Under Stoops

One Lombardi Award winner, two Lombardi Award finalists, one Nagurski Award finalist and two All-Americans.

2 0 0 5 S EAS ON

Two Butkus Award winners, four Butkus Award finalists, one Lombardi Award finalist, one Nagurski Award finalist, one ABC Defensive Player of the Year and four All-Americans. Two Nagurski Award winners, two Thorpe Award winners and four All-Americans.

Opponent Scoring Average Last Five Seasons Under Stoops

COACHING STAFF

DE DT LB DB

Three Hendricks Award finalists, one Lott Award finalist and one All-American.

15.08 Five Seasons Prior to Stoops

27.08 THE SOONERS

DUSTY DVORACEK

REVIEW & OPPONENTS

CLINT INGRAM

OKLAHOM A HISTORY 35 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


SPECIAL TEAMS

A strong case can be made that no program has played better on its special teams in recent years than Oklahoma. Time and again the Sooners have blown games wide open with electric and innovative special teams play. Bob Stoops’ commitment to special teams performance is evidenced by the number of first-team players who participate on those units. The wisdom of that move, and the program’s overall devotion to special teams play, is found in the staggering numbers that relate to every possible facet of the kicking and return games.

GARRETT HARTLEY

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONER SPECIAL TEAMS

OU Special Teams Under Stoops

K P RS

36 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

One Lou Groza Award finalist.

One All-American and one Ray Guy Award finalist.

Two All-Americans and one Mosi Tatupu Award winner.


JEJUAN RANKINS

2 0 0 5 S EAS ON

Oklahoma has blocked 18 kicks since head coach Bob Stoops arrived in Norman in 1999. Two-point conversion attempts by the Sooners during the Stoops era. The Sooners have converted seven. Antonio Perkins tied an NCAA record during his career at Oklahoma (2001-04) with eight punt returns for touchdowns. He had three against UCLA in 2003.

THE SOONERS

Oklahoma special teams have converted on four scoring plays (three touchdowns and one two-point conversion) off faked kicks since 1999.

COACHING STAFF

22 18 10 8 4

The Sooners have 22 special teams touchdowns under their current head coach. Thirteen of those came on punt returns by four different players.

RUSSELL DENNISON

REVIEW & OPPONENTS OKLAHOM A HISTORY 37 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


6 3 NAT IONAL AWARD WINNERS

Winningest Active Coach in College Football

141 ALL-A MERICANS

HEADER HEAD COACH BOB STOOPS

Winningest active coaches with at least five years as head coach:

The kind of admiration Bob Stoops has achieved is the best kind. It’s a byproduct of the success his program has enjoyed and the manner in which he has conducted himself. Football observers from coast to coast have witnessed the renaissance authored by Stoops at Oklahoma and often proclaim the Sooner coach among the very best in the land.

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

HEAD COACH BOB STO OP S

When Stoops arrived in Norman, OU had fallen on brief and uncharacteristic hard times. He has returned Oklahoma football to its rightful place among the elite, and there is no denying the person most responsible for the turnaround. The pride has been restored and a nation has noticed.

Quotes on Coach Stoops “In a sport in which icons are dropping annually from sight, and phenoms are forever heading to the NFL, Stoops is the closest thing to a budding legend in the NCAA.” - John Romano, St. Petersburg Times “He has brought us back to the pinnacle of college football. Bob is creating his own legend. He inherited a program with great tradition, and he’s added to it.” - Barry Switzer, Former OU Head Coach

7 NATI ONAL CHAMPIONSHIPS

“Only a handful of them meet the old expectation of coach-as-teacher and model for manly behavior anymore. Bob Stoops comes to mind.” - Sally Jenkins, Washington Post “This is a (Sooner) team that’s going to contend for the National Championship as long as Bob Stoops wants to.” - John Saunders, ABC Sports “Stoops’ philosophy is at the same time unbending and liberating. He presides over players who are competitive and aggressive, but also respectful and talkative.” - David Barron, Houston Chronicle

38 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


STOOPS ON SIDELINE

2 0 0 5 S EAS ON

Oklahoma has played in bowl games in all six seasons under Stoops. Four of the six have been BCS bowls and three of the six have been National Championship games. Stoops has produced 21 All-Americans in his six seasons in Norman including 13 consensus All-Americans. OU had a record seven All-Americans in 2003 and five in 2004. The Sooners have spent 22 weeks ranked No. 1 under Coach Stoops. OU is tied with Notre Dame in first place in college football history for most weeks (95) ranked No. 1.

COACHING STAFF

1 6 21 22 67

Bob Stoops ranks No. 1 as the all-time winningest head coach at Oklahoma. His winning percentage of .848 is just ahead of Barry Switzer (.837) and Bud Wilkinson (.826).

Bob Stoops has won 67 games and lost just 12 in his six seasons at Oklahoma. Stoops is the winningest active coach in college football with a winning percentage of .848.

THE SOONERS

GAME DAY IN NORMAN

REVIEW & OPPONENTS OKLAHOM A HISTORY 39 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

OU COACHING STAFF

40

167 Cumulative Years of Experience In Bob Stoops’ six seasons in Norman, three of his assistant coaches have gone on to become head coaches at other I-A programs. It’s not hard to gauge the quality of the Sooner staff or Stoops’ ability to hire good people. The beneficiaries are Oklahoma’s players. In record numbers they have been honored and drafted into the professional ranks. And that has been true regardless of what position they play. Identifying and recruiting talent, coaching talent to play at its peak and preparing players for life after college, whether it be in football or in the business world, nobody does it better than Oklahoma.

BRENT VENABLES

BRENT VENABLES

Assoc. Head Coach, Defensive Coord., Linebackers

BOBBY JACK WRIGHT

Asst. Head Coach, Co-Defensive Coord., Secondary

CHUCK LONG

Offensive Coordinator, Quarterbacks

CALE GUNDY

Recruiting Coordinator, Running Backs

JACKIE SHIPP

Assistant Coach, Defensive Line

KEVIN SUMLIN

Special Teams Coordinator, Tight Ends

KEVIN WILSON

Co-Offensive Coordinator, Offensive Line

DARRELL WYATT

Passing Game Coordinator, Wide Receivers

CHRIS WILSON

Assistant Coach, Defensive Ends

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

SOONER COACHING STAFF


BOBBY JACK WRIGHT

2 0 0 5 S EAS ON COACHING STAFF

OU’s coaches have a cumulative 54 years on the sidelines in Norman. Coaches Venables, Wright, Gundy and Shipp were on Bob Stoops’ first staff in 1999. The OU staff has been involved in 101 bowl games including coaching 81. The staff played in another 20 bowl games during their college careers. The Oklahoma coaching staff has a cumulative total of 167 years of coaching experience which averages to nearly 17 years per coach.

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

The Oklahoma staff has coached 53 players with National Football League experience, including 10 Sooners who were selected in the 2005 NFL Draft.

REVIEW & OPPONENTS

Three current assistants played for Oklahoma. Jackie Shipp (1980-83), Chris Wilson (1988-91) and Cale Gundy (1990-93) all wore the Crimson & Cream.

CHUCK LONG

THE SOONERS

3 3 53 54 101 167

Three former OU assistants under Stoops are now head coaches including Mike Leach at Texas Tech, Mark Mangino at Kansas and Mike Stoops at Arizona.

41


THE BEST COME TO NORMAN

The Sooner Nation

39 C ON FERENCE CHAMPIONSHIPS

Talk to Oklahoma’s players about the school they represent and the reasons for their contentment vary from the camaraderie of the team to academic offerings to the coaching staff. By addressing every element of life, OU has created an environment that works well for a wide range of students. It all contributes to an atmosphere that fosters a cohesive and happy team that knows how to win football games. Along the way, Oklahoma’s players are exposed to a career of great opportunities whether it be playing for a national championship, getting a degree or just enjoying the college experience.

7 NATI ONAL CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

GRAY INDICATES HOME STATES OF SOONERS UNDER STOOPS, PINS ARE 2005 P LAYERS

“Growing up only 20 minutes away, I was aware of the winning tradition, national championships and bowl success that they had and all of the great players they produced.”

Why Oklahoma? OU football players and their families share their reasons for choosing to come to the University of Oklahoma and play for the Sooners: “I didn’t know where I was going until I heard Coach Stoops’ voice on the other end of the phone. I knew right then and there that I wanted to go to Oklahoma. There was always a special place in my heart for OU.

- J.D. Runnels, senior fullback, Midwest City, Okla.

42 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


“The coaching staff impressed me more than any other we dealt with during the recruiting process. They really meant what they said. The best players really do get to play, no matter what. That’s how you win championships. And the fans here are great. They root for us, but they care about us as people, too.”

2 0 0 5 S EAS ON

Why Oklahoma?

- Dusty Dvoracek, senior defensive tackle, Lake Dallas, Texas

- Dan Cody, Baltimore Ravens “When I took my recruiting trip to Norman, I could sense the incredible atmosphere that surrounded the program. The coaches, the players and the fans are special.”

COACHING STAFF

“The camaraderie in the program is great. For the people who are going to be far from home for an extended period of time, I would think that would be very important. Everybody meshes so well there. You’re welcomed with open arms and then you’re part of a very close-knit group. I’m not sure I realized that fact about us as soon as I should have, but it’s a big thing to me now.”

- Donte Nicholson, Tampa Bay Buccaneers

THE SOONERS

Why Oklahoma?

“It was something that I didn’t feel at those other schools. I mean, all we did was sit there and play video games but it was great. We talked about everything and just had a good time doing nothing. “I found some really genuine people here that I didn’t find at those other schools. They were out to make something of themselves the right way.”

REVIEW & OPPONENTS

“When I came to visit Oklahoma, my hosts were Vince Carter and Tommie Harris. I just had so much fun just chilling at their house. We just really clicked. I started thinking about the guys I could really be around and be friends with for a long time.

- Davin Joseph, senior offensive tackle, Hallandale, Fla.

OKLAHOM A HISTORY

“He felt like it was a family to him and we both liked that aspect. Of course, I was more focused on the academics and what kind of education he would receive and we thought the University of Oklahoma was the best place for that as well.” - Barnette Jones, mother of Brandon Jones, Tennessee Titans

43 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


Flagship Educational Institution of the Sooner State The University of Oklahoma is experiencing a golden era in the history of a great institution. The quality of new student applications is soaring and donor confidence is at an all-time high. Over the last seven years, OU’s donor base has expanded at a staggering rate, moving from 17,000 to 73,000. President David L. Boren has spurred significant changes that have resulted in a learning environment of the highest order. As a result, the state of Oklahoma enjoys resources that impact everything from medical science to the arts for many years to come. The University of Oklahoma has long embraced the great tradition of Sooner athletics. With competitive facilities all located on the main campus, including several near the heart of the university, student-athletes and their classmates mingle comfortably in an environment that fosters an attitude of excellence, regardless of the endeavor.

1 5 10 19 31

The University of Oklahoma ranks number one among comprehensive public universities in the per capita number of freshman National Merit Scholars. The University of Oklahoma is in the top five in the nation among all comprehensive public universities in the graduation of Rhodes Scholars. OU is the only public university in Oklahoma to be included in the Fiske Guide to Colleges, which lists the top 10 percent of all universities in the United States. OU has 19 colleges offering 147 majors at the baccalaureate level and 152 majors at the master’s level. The university’s annual operating budget is more than $1 billion. OU boasts an enrollment of more than 31,000 students and more than 2,000 full-time faculty. The Norman campus maintains a student to instructor ratio of 20:1.

OU STUDENT UNION

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

UNIVERSITY OF OKLAHOMA

44 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

THE SEED SOWER


CAMPUS IN AUTUMN 2 0 0 5 S EAS ON COACHING STAFF

• OU has won awards for new initiatives to create a sense of family and community on campus. OU is one of the very few public universities to twice receive the Templeton Foundation Award as a “Character Building College” for stressing the value of community. • OU continues to break private fund-raising records, with more than $1 billion in gifts and pledges over the past decade, including the 1995-2000 Reach for Excellence Campaign, which raised $514 million and closed as the fourth-largest public university fund-raising campaign in U.S. history.

• A diverse student community is a priority at Oklahoma. OU ranks number one in the Big 12 in Native American enrollment and continues to be one of the leaders in enrollment of Latin American, Asian American and African American students.

OKLAHOM A HISTORY

• OU ranks first among the Big 12 universities in the growth of federal research funding. OU’s research and training programs have grown twice as fast as the national average over a 10-year period, according to a survey by the National Science Foundation.

REVIEW & OPPONENTS

• OU is one of a small number of Division I-A universities in the nation to receive the CHAMPS award for preparing student-athletes for life. The award is based on academic excellence, athletic excellence, personal development, community service and career development.

THE SOONERS

BIZZELL LIBRARY

What do you know about OU?

• For complete information on the University of Oklahoma and the Norman campus, please visit the official website at www.OU.edu.

45 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


McCLENDON CENTER

Preparing Leaders for Tomorrow The recent Gaylord Family - Oklahoma Memorial Stadium expansion and improvement included remodeled office space in the facility’s north end. The largest piece of that project was the Prentice Gautt Academic Center. Some 35,000 square feet are dedicated to the academic pursuits of Sooner student-athletes. Indeed, there is considerable emphasis on classroom performance at OU. The center staff has achievement as its focus, a fact that is reflected in a graduation rate that exceeds that of the general student body. In addition to its academic work, the staff assists in several life skills areas designed to enrich students in a broad range of tasks.

2 35 38 50 90

The Prentice Gautt Academic Center maintains two computer labs for OU student-athletes with more than 100 desktop units and over 40 laptops available to check out. Some 35,000 square feet are dedicated to the academic pursuits of Oklahoma student-athletes at the Prentice Gautt Academic Center in the stadium’s north end. Legendary running back Prentice Gautt wore No. 38 during his Sooner career from 1956-59. The first African-American player at OU, the academic center is named in his honor. More than 50 businesses attend the annual OU Athletics Department career fair. The event offers employers and job seekers time to meet one-on-one to discuss opportunities. The Prentice Gautt Academic Center is available more than 90 hours per week for OU student-athletes.

RUSSELL DENNISON

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

ACADEMIC SUCCESS

46 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


PRENTICE GAUTT

Oklahoma Remembers Prentice Gautt 2 0 0 5 S EAS ON

Prentice Gautt ushered in a new era for Oklahoma football when he landed a spot on the 1956 team. Former Sooner head coach Bud Wilkinson was pressured against giving Gautt a scholarship. A group of black doctors and pharmacists gave money for Gautt to attend the school. Within a year, Gautt was given a scholarship and the donated amounts were given to another black student. Gautt, considered Oklahoma’s best player in 1958, was a two-time All-Big Eight player and 1959 Orange Bowl MVP. During his senior year, Gautt was named to the academic All-America team and eventually earned master’s and doctorate degrees in psychology.

“His personal example of quiet courage, grace under pressure, and dedication to the university helped open the doors of opportunity for countless numbers of African-Americans and minority student-athletes who have followed him into collegiate athletics,’’ said University of Oklahoma president David Boren.

COACHING STAFF

The academic center for student-athletes at the University of Oklahoma was named in Gautt’s honor in 1999. A special assistant to the commissioner of the Big 12 Conference, Gautt passed away on March 17, 2005.

THE SOONERS

THE NORMAN CAMPUS

REVIEW & OPPONENTS OKLAHOM A HISTORY 47 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


SOONERS IN THE COMMUNITY

PAUL THOMPSON

Preparing Leaders for Tomorrow OU lives by a clear and strong motto as it interacts with its student-athletes ‌ Inspiring Champions for Today, Preparing Leaders for Tomorrow. As part of that promise, the Athletics Department and the football program take an active role in a number of community service projects. Individually, football players serve with numerous groups. Two of their largest projects include a free football clinic for underprivileged youths and the distribution of food that is donated by Oklahoma fans at a designated home game. Each year on the morning of the spring football game, the Sooners provide a complimentary football clinic for a select group of youth from throughout the central Oklahoma region.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

MARCUS WALKER

The team also plays an active role in a food drive that takes place near the Thanksgiving holiday. OU fans donate food at a game and players help in the distribution the following Monday. Oklahoma’s student-athletes recognize that wearing the Crimson and Cream means representing a popular sports program and themselves as individuals. They are encouraged to respond to a public that adores them, while learning important lessons about making a positive impact in the lives of others in and around the community in which they live.

48 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


Gutierrez Earns Youth Citizen Award

2 0 0 5 S EAS ON

JACOB GUTIERREZ

Each year the United Way of Norman and the Junior League of Norman honor volunteers in five categories for their unselfish service to the community. Among those five categories is the Youth Citizen Award, which goes to an individual who is 25 years of age or less.

Gutierrez volunteers at Madison Elementary School in Norman where he works with children in reading and music. He exceeded expectations in both time commitment and scope and reached out to mentor children with little or no male influence in their lives.

COACHING STAFF

The 2004-05 recipient was Sooner running back Jacob Gutierrez.

“He’s here with the kids every week and goes above and beyond,” said Madison teacher Regina Bell, who nominated Gutierrez for the honor. “Jacob does it from the heart. He doesn’t do it to look good in the coaches’ eyes. He does it because it’s the right thing to do.”

The United Way says he has.

THE SOONERS

“Football gives you a platform, puts you in a position to help people,” Gutierrez said. “A lot of young people look up to you, and it’s always great if you can make a difference in their lives. I hope I have.”

BOB STOOPS

REVIEW & OPPONENTS OKLAHOM A HISTORY 49 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


GAMEDAY IN NORMAN

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

NORMAN & OKLAHOMA CITY

Norman - Home of the Sooners Norman is an ever-changing city of nearly 100,000 residents. Located in the heart of the state, it has grown to become the third largest city in Oklahoma. Despite its continuous growth, it has maintained the spirit and serenity of a small, close-knit community. Since the Oklahoma Land Rush of 1889, Norman has grown into a popular and smart city. The spirit of Norman and its citizens is unwavering and uncompromising. While other towns were clamoring to become the state capital, Norman residents wanted to have the first state university. When the first OU president got off the train and saw a prairie, he saw opportunity. As home to the state’s premier educational institution, Norman boasts an excellent quality of life and is a city that thrives on and celebrates the diversity of its community. Legendary University of Oklahoma football coach Barry Switzer called Norman “a university town with a championship spirit.” Norman continually exhibits its love for sports by hosting numerous local and national athletic events.

50 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

1 18 70 100 175 196 o

The Oklahoma City metropolitan area has a population of more than one million people. OKC is the largest city in the state and the 29th largest city in the nation. Located just 18 miles north of Norman, the state’s capital, Oklahoma City, offers all the trappings of a large metropolitan area within an easy drive. The average annual temperature in Norman. The area enjoys a temperate climate with mild winters. Four distinct seasons with a warm spring and fall. Norman is the third largest city in the state with nearly 100,000 residents. Despite its growth, the city nurtures and maintains its small, college town atmosphere. Norman boasts more than 175 restaurants including barbecue, Mexican, Oriental, Greek, Indian, Italian, Thai, seafood, health and natural foods. Due to its central location, Norman is a quick 196-mile drive from Dallas. Roughly 20 percent of OU’s students are from Texas and choose to come north.


THE STATE CAPITAL

Oklahoma City 2 0 0 5 S EAS ON

Oklahoma City, the state’s capital, is located just 18 miles north of the Norman campus. It was the first city settled in the Land Run of 1889 because of its position at the center of the state. Oklahoma City offers a variety of attractions and activities different from any other place in the country. Oklahoma City sprawls across 625 square miles of America’s heartland. The city’s metro population numbers more than one million -- a third of the entire state’s population.

COACHING STAFF

Oklahoma City has become a haven for exciting sports action. It is home to three minor league teams and the host of the NCAA College Softball World Series. The Oklahoma RedHawks are the Triple-A baseball affiliate of the Texas Rangers. The team plays in the SBC Bricktown Ballpark, considered one of the finest venues in all of minor league sports. Located just southeast of downtown, Bricktown is Oklahoma City’s entertainment and dining district. Restaurants with a total capacity of more than 4,000 seats, shopping, and a generous helping of turn-of-the-century charm has turned Bricktown into a hotspot for Oklahoma City nights.

THE SOONERS

OKLAHOMA CITY SKYLINE

REVIEW & OPPONENTS OKLAHOM A HISTORY 51 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE BIG 12 CONFERENCE Prominence on a National Stage Just 10 years into its existence, the Big 12 has vaulted to the top of intercollegiate athletics. A regular player in the determination of national championships, the conference offers its more than 4,000 student-athletes that rare opportunity to compete in the national spotlight every season. Today’s student-athlete desires a conference that pushes each participant to excel, while opening the door for prominence on the national stage. Big 12 schools have combined for more than 800 NCAA crowns and have nearly 170 national team titles. No conference provides a more optimal environment for success than the Big 12.

BAYLOR

Oklahoma has won all 14 of its meetings with the Bears.

COLORADO

Sooners’ last two Big 12 titles have come against Buffs.

IOWA STATE

OU owns a commanding 65-5-2 series lead over Cyclones.

KANSAS

OU’s 65-27-6 series lead includes 18 shutouts of Kansas.

KANSAS STATE

Sooners once reeled off 32 straight wins over Wildcats.

MISSOURI

Oklahoma has won 62 of 69 games against Tigers.

NEBRASKA

The Sooners lead in the battle of the Big Reds, 41-37-3.

OKLAHOMA STATE

College football’s most lopsided, continuous in-state rivalry.

TEXAS

OU has won last five games by combined score of 189-54.

TEXAS A&M

Oklahoma has won four of last five for 12-10 advantage.

TEXAS TECH 52

Sooners own 10-2 series lead over Red Raiders.

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

WILLIE ROBERTS


CARL PENDLETON

2 0 0 5 S EAS ON

With a total of more than 340,000 students enrolled, the Big 12 Conference ranks No. 2 among the nation’s conferences. OU has a total enrollment of more than 31,000. Newspapers in the Big 12 region have a combined circulation of more than eight million. Markets include Dallas, Denver, Houston, Oklahoma City, San Antonio and St. Louis. The television households throughout the Big 12 Conference represent 18 million people. In the past four seasons, 50 of OU’s 54 games (92 percent) have been televised live.

COACHING STAFF

1.1 2 8 18 42

Big 12 Conference stadiums and arenas have a combined seating capacity of 1.1 million. The Sooners averaged 84,532 fans per game at home in Norman in 2004.

Stretching from the Gulf of Mexico to the upper Midwest, Big 12 Conference schools are located in seven different states with a total population of more than 42 million people.

THE SOONERS

CHRIS BUSH

The Big 12 led the nation with 28 non-conference wins in 2004. Its total of eight losses in non-conference tilts was the lowest in I-A, while the league’s .624 win percentage was the second highest in the country.

The Big 12 leads all conferences with four appearances in the BCS National Championship game and is the only conference to place two teams in the Top 6 of both the final Associated Press and Coaches polls each of the last four seasons. With a 4-3 record in the post-season, the Big 12 Conference registered the most wins and was one of three conferences to post a winning record in bowl games last season. For more conference information, please visit www.Big12sports.com.

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

The Big 12 led all conferences with eight teams ranked in the top 25 of Division I-A schedule strength, twice the number of the second-highest conference. Schedule strength was based on the cumulative winning percentage of each team’s opponents.

REVIEW & OPPONENTS

College Football at the Highest Level

53


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

OU ATHLETICS MEDIA RELATIONS KENNY MOSSMAN

JASON MATHESON

MIKE HOUCK

SCOTT MATTHEWS

CHRIS FREET

JESSICA SUMMERS

Associate Athletics Director for Communications Office: (405) 325-8231 Home: (405) 321-2220 kmossman@ou.edu Associate Media Relations Director Office: (405) 325-8231 Home: (405) 447-2731 mhouck@ou.edu Assistant Media Relations Director Office: (405) 325-8231 Home: (405) 249-6075 cfreet@ou.edu

Director of Internet Services Office: (405) 325-4274 Home: (918) 691-3886 jmatheson@ou.edu Director of Graphic Design Office: (405) 325-8223 Home: (405) 664-0844 smatthews@ou.edu Media Relations Intern Office: (405) 325-8231 jlsummers@ou.edu

CRAIG MORAN

JARED THOMPSON

DEBBIE COPP

DAVID BASSITY

DEBRA BISHOP

RENATA HAYS

Assistant Media Relations Director Office: (405) 325-8231 Home: (405) 249-8264 cmoran@ou.edu Coordinator of Publications Office: (405) 325-8231 Home: (405) 329-6799 dcopp@ou.edu Administrative Assistant Office: (405) 325-8314 dkbishop@ou.edu

OU Athletics Media Relations Media Relations Main Phone . . . . . . . . . . . . . . . . . . . . . (405) 325-8231 Media Relations Fax. . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-7623 University of Oklahoma Athletics Media Relations Gaylord Family - Oklahoma Memorial Stadium Suite 2525, 180 W. Brooks St, Norman, OK 73019 SoonerSports.com The latest, official information on 2005 Oklahoma football is available at SoonerSports.com. Log on for complete media services including statistics, rosters, bios, schedules, press conferences, quotes and more. SoonerSportsMedia.com New for 2005 - media credentials for Oklahoma football will be processed online at SoonerSportsMedia.com. Action photos, mugs and logos are available for download. Visit SoonerSportsMedia.com for details.

OU Athletics Department Administration Joe Castiglione, Director of Athletics . . . . . . . . . . . . . . . . . . . . 325-8208 Larry Naifeh, Executive Associate Athletics Director . . . . . . . . 325-8241 Stephanie Rempe, Associate AD/SWA. . . . . . . . . . . . . . . . . . . 325-8210 Gerald Gurney, Ph.D., Assoc. AD/Academic Programs . . . . . . 325-8265 Rick Hart, Associate AD/Marketing & Licensing . . . . . . . . . . . . 325-8346 Keith Gill, Associate AD/Administration . . . . . . . . . . . . . . . . . . 325-7718 Kenny Mossman, Associate AD/Communications . . . . . . . . . . .325-8231 Robert Smith, Assistant AD/Business Manager . . . . . . . . . . . . 325-8430 Matt Trantham, Assistant AD/Event Management . . . . . . . . . . 325-8203

54 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Home: (405) 831-6851

Media Relations Graduate Assistant Office: (405) 325-8368 Home: (405) 834-2984 jaredthompson@ou.edu Media Relations Student Assistant Office: (405) 325-8231 Home: (405) 274-1455 dbassity@ou.edu Media Relations Student Assistant Office: (405) 325-8231 Home: (405) 664-8753 renatahays@ou.edu

MATT MONTGOMERY

Media Relations Student Assistant Office: (405) 325-8231 Home: (405) 740-9570 mmonty@ou.edu

OU Athletics Department Heads Scott Anderson, Head Athletic Trainer . . . . . . . . . . . . . . . . . . . Dan Cavanaugh, Director of Broadcasting. . . . . . . . . . . . . . . . Debbie Copp, Coordinator of Publications . . . . . . . . . . . . . . . . Danny Davis, Director of Facilities . . . . . . . . . . . . . . . . . . . . . . Tim George, Director of Promotions. . . . . . . . . . . . . . . . . . . . . Billy Ray Johnson, Director of Ticket Operations . . . . . . . . . . . Beth Kelly, Manager of Financial Support Services . . . . . . . . . Brian Martin, Coordinator of Team Video . . . . . . . . . . . . . . . . . Jason Matheson, Director of Internet Services. . . . . . . . . . . . . Scott Matthews, Director of Graphic Design. . . . . . . . . . . . . . . Andy Paden, Director of Athletics Development. . . . . . . . . . . . Matt Roberts, Director of Marketing . . . . . . . . . . . . . . . . . . . . . Melanie Roberts, Director of Compliance. . . . . . . . . . . . . . . . . Jerry Schmidt, Director of Sports Enhancement . . . . . . . . . . . Greg Tipton, Director of Athletics Equipment . . . . . . . . . . . . . .

325-8332 325-8318 325-8367 325-8235 325-8232 325-8133 325-8452 325-8288 325-4274 325-8223 325-8237 325-8238 325-7719 325-8370 325-8379

Sooner Sports Properties Eric Barnhart, General Manager .. . . . . . . . . . . . . . . . . . . . . . . Phill Corkins, Associate General Manager . . . . . . . . . . . . . . . . Jason Booker, Account Executive . . . . . . . . . . . . . . . . . . . . . . Dennis Byers, Account Exectutive . . . . . . . . . . . . . . . . . . . . . . Sean Heusel, Account Executive . . . . . . . . . . . . . . . . . . . . . . . Brian Morris, Account Executive. . . . . . . . . . . . . . . . . . . . . . . .

325-2407 325-2417 325-2332 325-2420 325-2393 325-6467


MEDIA INFORMATION Credential Requests

Requests for media credentials to University of Oklahoma home games should be made online at SoonerSportsMedia.com. Only those requests submitted by the sports editor of a newspaper or the sports director for a radio or television station will be considered.

Credential requests for the 2005 Oklahoma football season will only be accepted online at SoonerSportsMedia.com. Please visit the website for complete instructions on submitting the online application form.

Priority is given to daily newspapers (by circulation), television stations and radio stations that program sports for more than half of their daily broadcast schedules. A credential does not guarantee a seat and access to the team bench area is prohibited at all times. Credentials include:

Sideline: Primary recipients are photographers. Only photographers on assignment for accredited publications (not websites) will be afforded credentials. Pass only gains access to the sideline (not the press box). Combination: These are only for those individuals who require access to the press box and the sideline. Few are issued.

Any media member who loses a season credential will automatically be moved to the single-game list for the following season. Media outlets who cannot provide names for passes for an entire season will be placed on the single-game list and should provide names on a weekly basis.

OU-Texas Credentials Those interested in covering the annual Oklahoma-Texas game at Dallas will need to make a separate request for credentials. Each school handles the requests from its regular pool of media. Aside from national media, only season credential holders are eligible.

Credential Pick-up Credentials may be picked up from the media relations office during the week or from media will call (Gate 2) at Gaylord Family - Oklahoma Memorial Stadium on game day (see map on page 57). Photo identification is required for pick up. Each media representative must claim his or her pass. No group pick ups are allowed.

Tuesday: Media Luncheon at 11:30 a.m., at the stadium. Coach Stoops’ comments, beginning at noon, available via telephone to media only (contact Athletics Media Relations for more information). A few players also are available. All coaches^ and players* who do not participate in the luncheon are available following practice. Practice is open to photographers for the first 15 minutes. Wednesday: Coaching staff available following practice. No player availability. Practice is open to photographers for the first 15 minutes. Thursday, Friday & Sunday: No availability. Saturday: Post-game availability only. Members of the OU Athletics Media Relations staff will escort media representatives to the appropriate locker room areas with five minutes remaining in the game. The Oklahoma locker room, home or away, is closed to the media at all times. Head coach Bob Stoops and several Sooner players will be brought to a designated interview area. At home games, that area is the Big Red Room, located in the Switzer Center (first floor). At the beginning of the fourth quarter, interview requests will be collected. For games in Norman, the opposing head coach will meet with the media inside the opponent interview room, the SoonerVision studio (southwest corner, under the stadium grandstands). A representative from the OU Media Relations Office will be on hand to assist the media in finding this area. Interviews with the head coach and players from the visiting team will be based on the post-game policy of that institution. * Some players have evening classes that could preclude them from postpractice interviews. ^ Bob Stoops’ weekly radio show takes place each Tuesday night during the season. Depending on the length of the workout, he may not be available for interviews after practice.

OKLAHOM A HISTORY

Texas will serve as the host school this year. Any media not based in the state of Oklahoma should contact the Texas Athletics Media Relations Office with credentials requests. OU-Texas credentials will be distributed to local media at the Tuesday media luncheon in Norman. Any credentials not claimed that day will be available the Friday before the game at a pickup location in Dallas (times and exact location TBA). No credentials will be mailed, but outlets willing to provide an overnight account number no later than Wednesday of game week may receive them in that manner.

Monday: Bob Stoops participates on the Big 12’s Weekly Teleconference at 10:10 a.m. All coaches and players* are available following practice. Practice is open to photographers for the first 15 minutes.

REVIEW & OPPONENTS

Single-Game Credentials Requests must be made at least one week in advance of the contest. Any organization that requests a single-game credential then does not use it will not be granted another pass for the remainder of the season. No credentials will be granted after Thursday of game week.

Daily Media Availability

THE SOONERS

Season Credentials Requests should be made at SoonerSportsMedia.com by August 10. Only those media who routinely cover OU games, practices and media conferences are eligible for season credentials.

Parking Passes Parking passes are in a limited supply and will be prioritized similar to the way credentials are issued. Most media parking is located in the Asp Ave. Parking Facility located immediately west of the stadium, one half block north of the intersection at Lindsey and Asp (see map on page 57).

COACHING STAFF

Press Box: Primary recipients are newspaper writers, television reporters and radio personnel. This pass gains access to the press box. Sideline access is only permitted for the last five minutes of the game.

Pertinent media information including forms, instructions and special media releases are available online 24 hours a day. Approved media outlets also have access to OU’s high-resolution image library for player and coaching staff action photos and mugs.

2 0 0 5 S EAS ON

Media Credentials

55 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


MAPS & DIRECTIONS

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

OKLAHOMA CITY

56

Directions from OKC Airport Follow directions from airport terminal to Interstate 44. Travel west on I-44 (towards Lawton). Merge to I-240 east. Take exit 4A south on Interstate 35. Norman is 17 miles south of the airport. Once in Norman, exit I-35 at Lindsey Street. Turn left (east) at the top of the ramp onto Lindsey. Oklahoma Memorial Stadium is located approximately three miles east of I-35 on the corner of Asp and Lindsey (circled on map to right).

Directions from Dallas/Ft. Worth Travel north on Interstate 35 to Norman. Once in Norman, exit at Lindsey Street. Turn right (east) at the top of the ramp onto Lindsey. Oklahoma Memorial Stadium is located approximately three miles east of I-35 on the corner of Asp and Lindsey (circled on map to right).

Return to OKC Airport Drive I-35 north from Norman to I-240 west. Follow I-240 west to I-44 (I-240 automatically merges with I-44 just west of May Avenue). Take Exit 116B, Airport Road, exit on the left. Follow Airport Road west to Meridian Ave. Take the Meridian Avenue southbound exit and follow Meridian south approximately one mile to the airport.

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

NORMAN


MEMORIAL STADIUM MEMORIAL STADIUM 2 0 0 5 S EAS ON COACHING STAFF THE SOONERS

MEDIA WILL CALL

Stadium Quick Facts

Gaylord Family - Oklahoma Memorial Stadium is one of America’s most recognized college football cathedrals. Situated on the east side of the Norman campus, this historical facility is the largest sports arena in the state and, following its recent expansion, now ranks among the 15 largest college football stadiums in the nation. With the expansion of Oklahoma Memorial Stadium to an official capacity of 82,112 and with every home game exceeding that capacity, Oklahoma set numerous attendance records in 2004. In fact, the 10 largest crowds in Memorial Stadium history have occured in the past two seasons.

The largest crowd ever to watch a game in the history of the state of Oklahoma jammed Memorial Stadium on November 13, 2004. The Sooners stormed past rival Nebraska, 30-3, in front of 84,916 fans. OU has compiled a 36-1 record at home (.972) under head coach Bob Stoops (1999-2004). Not coincidentally, those five seasons all rank at the top of the list for average home attendance

Stadium Capacity Through the Years 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1998* . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1980 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1949 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1929 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1925 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

82,112 81,207 72,765 75,004 71,187 61,836 55,000 32,000 16,000

* Capacity decreased to accomodate disability seating.

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

Oklahoma’s average attendance in 2004 for six home games was 84,532. OU ranked first in the Big 12 Conference and No. 9 in the nation in average attendance. Oklahoma ranked No. 4 in the nation in percent of stadium capacity filled for home games at 104 percent.

Stadium Name . . . . . . . . . . . . . . . Gaylord Family - Oklahoma Memorial Field Name . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Owen Field Field . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Natural Grass Official Capacity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82,112 First Year . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1923 First Game at Site . . . . . . . . Oct. 20, 1923 (OU 62, Washington, Mo. 7) Largest Crowd . . . . . . . . 84,916 on Nov. 13, 2004 (OU 30, Nebraska 3) Record at Stadium . . . . . . . . . . . . . . . . . . 320-79-14 (.792) (1923-2004) Most Consecutive Wins . . . . . . . . . . . . . . . . . . . . . . . . . . 25 (1947-1952)

REVIEW & OPPONENTS

Oklahoma Memorial Stadium

57


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONER RADIO & TELEVISION Sooner Sports Radio Network

Radio Network Affiliates

The Sooner Sports Radio Network with Bob Barry Sr., Mark Rodgers and Merv Johnson blankets the state of Oklahoma and also delivers Sooner football games to fans and alumni in neighboring states.

Ada . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KADA-FM (99.3) Altus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KRKZ-FM (93.5) Alva. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KALV-AM (1430) Ardmore . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KICM-FM (93.7) Bartlesville . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KYFM-FM (100.1) Blackwell. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KOKB-AM (1580) Clayton, N.M. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KLMX-AM (1450) Clinton . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KQMX-FM (95.5) Dallas, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KKGM-AM (1630) Durant. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KSEO-AM (750) Elk City . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KXOO-FM (94.3) Enid . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KGWA-AM (960) Fort Smith, Ark.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KRWA-FM (103.1) Frederick. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KYBE-FM (95.9) Guymon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KKBS-FM (92.7) Hobart. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KTJS-AM (1420) Houston, Texas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KCOH-AM (1430) Hugo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KITX-FM (95.5) Idabel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KBEL-FM (96.7) Lawton . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KJMZ-FM (98.1) Lindsay . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KBLP-FM (105.1) McAlester . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KNED-AM (1150) Muskogee. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KTFX-FM (102.1) Norman. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KREF-AM (1400) Oklahoma City . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KRXO-FM (107.7) Oklahoma City . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KOKC-AM (1520) Ponca City . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KLOR-FM (99.3) Poteau . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KPRV-FM (92.5) Shawnee. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KGFF-AM (1450) Tulsa. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KFAQ-AM (1170) Vinita. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KGND-FM (107.5) Wichita, Kan. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KMYR-AM (1410) Woodward . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KWOX-FM (101.1)

The flagship stations for the network are 50,000-watt KOKC, AM 1520 and KRXO, 107.7 FM in Oklahoma City. In Tulsa, the Sooner Sports Radio Network broadcasts may be heard on 50,000-watt KFAQ, AM 1170. These three stations, along with more than 35 regional affiliates, carry Sooner Sports Talk with Bob Stoops on Tuesday nights, the Coaches Corner with Sooner Coordinators on Thursday evenings and Sooner Sports Today, which airs twice daily, five days per week throughout the season. Game Broadcasts Network broadcasts for all Sooner football games will begin 90 minutes prior to kickoff with a call-in segment. The show includes interviews with coaches and players plus a pre-game conversation with Bob Stoops. After the game, the Sooner Wrap-up features game highlights, player comments and a post-game interview show with Stoops and his assistant coaches. Sooner Sports Talk with Bob Stoops Each Tuesday throughout the season, Sooner Sports Talk provides fans with the opportunity to talk to OU head coach Bob Stoops. The statewide broadcasts air from 7:05-8 p.m. Central. Call toll free (877) 600-6432. Coaches’ Corner Each Thursday throughout the season, Coaches Corner will feature OU assistant coaches on a statewide call-in show. The broadcast will air from 7:05-8 p.m. Central. Call toll free (877) 600-6432. Sooner Sports Today This is a three-minute program that airs twice daily (Monday through Friday) on network affiliates. It features timely information and comments from Sooner players and coaches.

Sooner Football Television

Sooner Football 2005 Sooner Sports Properties, in conjunction with SoonerVision, produces and syndicates the highly popular 60-minute replay/game highlight show. Broadcast each week following Sooner football games, Sooner Football 2005 features the dramatic plays and highlights of the game action with analysis and comments from Bob Stoops. Sooner Football 2005 airs on KAUT-TV UPN 43 in Oklahoma City, KWBTTV 19 in Tulsa, KSWO-TV 7 in Lawton and KOMI-TV 24 in Woodward. The show has additional airings during the week on cable affiliates around Oklahoma. Check local listings or log on to SoonerSports.com for a broadcast schedule. Inside Sooner Football with Bob Stoops This 30-minute video magazine gives an insider’s look at Sooner football. Inside Sooner Football with Bob Stoops airs on KWTV-9 in Oklahoma City, KWBT-TV 19 in Tulsa, KOMI-TV 24 in Woodward, KSWO-TV 7 in Lawton and Fox Sports Net Southwest. Each week throughout the season, Stoops previews the upcoming game and provides viewers a unique perspective with special features and profiles on Sooner football.

58 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Live Sooner Network broadcasts are available across the nation on Sirius Satellite Radio and around the world on SoonerSports.com via Yahoo!

SoonerVision Established in 1997, SoonerVision is an integral component of the OU Athletics Department. As Oklahoma’s in-house production studio, SoonerVision produces more than 75 television programs each year. SoonerVision is home to Sooner Football 2005, Inside Sooner Football with Bob Stoops, Sooner Hoops 2006, Inside Sooner Basketball with Kelvin Sampson, Sooner Women’s Basketball with Sherri Coale and Sooner Sports This Week. SoonerVision also produces the video displays that appear in Gaylord Family - Oklahoma Memorial Stadium and the Lloyd Noble Center. Additionally, SoonerVision shoots and produces video for the official OU Athletics Department website, SoonerSports.com, and the premiumcontent O-Zone.


3%!3/.     3 %!3 /.

58)86

!,%8!.$%2 #/!#().'34!&& 4(%3//.%23 2%6)%7 /00/.%.43 /+,!(/- !()34/29 

.!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

4(%3//.%2/&&%.3% 'UDIW GD\ ZDV D ³´ IRU 2NODKRPD DV LQ  6RRQHUVEHLQJVHOHFWHGE\1)/IUDQFKLVHV6R EULOOLDQW ZDV WKH DFFRPSOLVKPHQW XQPDWFKHG E\ DQ\ RWKHU VFKRRO WKDW LW RYHUVKDGRZHG DQ HYHQODUJHUQXPEHU 6HYHQWHHQLVWKHQXPEHURISOD\HUVZLWKVWDUW LQJH[SHULHQFHUHWXUQLQJIRU2NODKRPDLQ :KHQ%RE6WRRSVDQGKLVVWDIIVFDQWKH¿HOGLQ $XJXVWWKH\ZLOOVHHPRVWRIWKHSRVLWLRQV¿OOHG E\SOD\HUVZKRKDYH¿OOHGWKHPEHIRUH

42!6)37),3/.

0RUHRYHU UHFHQW UHFUXLWLQJ VXFFHVV SRLQWV WR WKH IDFW WKDW 2NODKRPD ZLOO DJDLQ EH VWRFNHG ZLWK D WDOHQWHG URVWHU $W D WLPH ZKHQ VRPH VFKRROV PLJKW ORRN DKHDG ZLWK D GHJUHH RI FRQFHUQ WKH 6RRQHUV DSSURDFK WKH FRPLQJ VHDVRQZLWKDQWLFLSDWLRQ 7KHTXHVWLRQORRPLQJQRZLVQ¶WVRPXFK³KRZ´ EXW³ZKR´ 7KHIDFWWKDW28FDQZLWKVWDQGWKHGHSDUWXUH RI D +HLVPDQ ZLQQHU DQ 2XWODQG ZLQQHU DQG VHYHUDORWKHUKRQRUHHVDQGVWLOOEHPHQWLRQHG DPRQJWKHQDWLRQ¶VHOLWHSURJUDPVXQGHUVFRUHV 6WRRSV¶ LPSDFW DQG EOXUV HYHQ PRUH WKH PHPRU\ RI KRZ WKLQJV ZHUH LQ WKH IHZ \HDUV EHIRUHKHDUULYHG ,W DOVR VHWV EHIRUH WKLV SURJUDP D FKDOOHQJH VRPHWKLQJWKDWKDVLQVSLUHGWKHEHVWIURPWKH 6RRQHUVLQWKHSDVW

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

3EASON0REVIEW :KHQ LW FRPHV WR VFKHPLQJ DQ RIIHQVH 2NODKRPD¶V VWDII NQRZV D WKLQJ RU WZR DERXW ÀH[LELOLW\7ZR\HDUVDJRWKH6RRQHUVRSHUDWHG SULPDULO\ IURP WKH VKRWJXQ ZLWK D TXDUWHUEDFN VRKLQGHUHGE\NQHHVXUJHULHVWKDWKHFRXOGQ¶W WDNH D VQDS XQGHU FHQWHU 2QH \HDU ODWHU WKH WHDPZDVRIWHQLQSRZHUVHWV 7KHUHFRXOGEHPRUHWZHDNLQJRQWKHKRUL]RQ 28 PXVW UHSODFH D TXDUWHUEDFN WKDW ZRQ WKH +HLVPDQ 7URSK\ WKHQ UHSHDWHG WKH IROORZLQJ \HDUDVD¿QDOLVW -DVRQ:KLWH  7KH 6RRQHUV PXVW DOVR UHSODFH DQ 2XWODQG 7URSK\ ZLQQHU -DPPDO %URZQ  D WZRWLPH 5LPLQJWRQ $ZDUG ¿QDOLVW 9LQFH &DUWHU  WKH VFKRRO¶V DOOWLPH OHDGLQJ UHFHLYHU 0DUN &OD\WRQ DQGDQRIIHQVLYHWDFNOHZKRKDGPRUH FDUHHUVWDUWVWKDQDQ\RWKHUSOD\HURQWKHWHDP :HV6LPV  7KH ZHOO LV IDU IURP GU\ KRZHYHU 2NODKRPD UHWXUQVDQXPEHURINH\FRPSRQHQWVLQSOD\HUV OLNH$GULDQ3HWHUVRQ7UDYLV:LOVRQDQG'DYLQ -RVHSKWRQDPHMXVWDIHZ 'HVSLWHWKHGHSDUWXUHRIVRPHRIWKHJUHDWHVW SOD\HUVLQVFKRROKLVWRU\WKHUHLVDJURXSUHDG\ WRGXSOLFDWHDQGSHUKDSVH[FHHGWKHDFKLHYH PHQWVRIWKHLUSUHGHFHVVRUV


3%!3/./54,//+ 1UARTERBACK )RUWKH¿UVWWLPHXQGHU6WRRSV2NODKRPDZLOO VWDUW D TXDUWHUEDFN ZKR ZDV QRW UHFUXLWHG VL[ \HDUV DJR )URP -RVK +HXSHO WR 1DWH +\EO WR -DVRQ :KLWH HYHU\ 28 VWDUWHU XQGHU WKLV FRDFKFDPHIURPWKHFODVVXQWLOQRZ )RUWKHVWDUWHUZLOOHPHUJHIURPDPRUH UHFHQWO\VLJQHGEXWMXVWDVKLJKO\WRXWHGFURS RISOD\HUV

7KHRWKHUWZRFDQGLGDWHVDUHFXWIURPDGLIIHU HQWFORWK

7KH DELOLW\ OHYHO LV VR KLJK DPRQJ WKH WKUHH WKDW DQ\ FRXOG OLNHO\ VWHS LQ DQG SOD\ ZHOO 7KH TXHVWLRQ PDUN OLHV LQ H[SHULHQFH DQG OHDGHUVKLS *UDG\ DQG 7KRPSVRQ KDYH VHHQ RQO\ ODWHJDPH GXW\ ZKLOH %RPDU RQH RI WKH QDWLRQ¶VWRSUDWHGSURVSHFWVLQKDV\HWWR WDNHDFROOHJHVQDS

-HMXDQ5DQNLQVUHPLQGVVRPHRIWKHGHSDUWHG &OD\WRQ LQ WHUPV RI HOXVLYHQHVV 7KH GRRU VWDQGVZLGHRSHQIRUKLPWRWDNHRQDIDUPRUH VLJQL¿FDQW UROH $QRWKHU LQWHUHVWLQJ GHYHORS PHQWLVWKHUHWXUQRI7ULVWHQ5RVVZKRZDVZLWK WKHWHDPWZR\HDUVDJR

+H LV MRLQHG E\ :LOOLH 5REHUWV ZKR DW  SURYLGHVWKHELJJHVWWDUJHWDQG-RH-RQ)LQOH\ WKH \RXQJHVW SOD\HU DQG SHUKDSV EHVW RYHUDOO DWKOHWH RI WKH WULR $QRWKHU WR ZDWFK LV &KULV &KHVWHUZKRGHVSLWHSOD\LQJPRUHH[WHQVLYHO\ LQWKHRIIHQVLYHOLQHFRXOGVWLOOVKRZXSDVDQ H[WUDWLJKWHQGLQVRPHVHWV :LWK OHVV H[SHULHQFHG ZLGH UHFHLYHUV D WLJKW HQGJURXSDOLWWOHORQJHULQWKHWRRWKZLOOEHD ZHOFRPHVLJKW

2WKHUZLVH WKH UHFHLYLQJ JURXS ZLOO EH \RXQJ 4XHQWLQ&KDQH\DQG/HQG\+ROPHVUHGVKLUWHG ODVW VHDVRQ DQG VKRZHG SURPLVH 7KH\ ZLOO OLNHO\ EH LQWHJUDWHG TXLFNO\ $OVR ORRN IRU D KLJKO\WRXWHGWUXHIUHVKPDQFURSWRJHWDVHUL RXVORRN

!$2)!.0%4%23/.

2UNNING"ACK 5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH .HMXDQ-RQHV$GULDQ3HWHUVRQ

/+,!(/-! ()34/29

$GULDQ 3HWHUVRQ EHFDPH SHUKDSV WKH PRVW GHFRUDWHG IUHVKPDQ EDFN LQ WKH KLVWRU\ RI FROOHJHIRRWEDOOODVWVHDVRQZKHQKHUXVKHGIRU \DUGVD¿JXUHWKDWHFOLSVHGERWKWKH28 DOO FODVVHV  DQG 1&$$ IUHVKPDQ PDUN +H¶OO ZRUNEHKLQGDUHWRROHGOLQHEXWKLVSUHVHQFH FDQQRWEHRYHUUDWHG

2%6)%7 /00/.%.43

7KH FRDFKHV ZLOO VSHQG WKH HDUO\ GD\V GHWHU PLQLQJZKLFKRQH¿WVEHVWZLWKWKHWHDPDQGLQ WKHYHU\EHVWFRDFKVSHDNJLYHVWKH6RRQHUV WKHEHVWRSSRUWXQLW\WRZLQ

8QVHDWLQJ 0DUN &OD\WRQ ZDV QR VPDOO FKRUH EXW WKDW¶V H[DFWO\ ZKDW 7UDYLV :LOVRQ GLG ODVW \HDUZKHQKHZUHVWOHGDZD\WKHWHDPOHDGLQ WRXFKGRZQUHFHSWLRQV+HIRXQGWKHHQG]RQH WLPHVDQGHVWDEOLVKHGKLPVHOIDVRQHRIWKH EHVWLQWKH%LJ+HZLOOEHD¿[WXUHDURXQG ZKLFK WKLV UHFHLYLQJ FRUSV ZKLFK ORVW IRXU VHQLRUVZLOOEXLOG

7KHWLJKWHQGVFDVWLVXQFKDQJHGIURPD\HDU DJR ZKLFK PHDQV 2NODKRPD UHPDLQV GHHS DQGYHUVDWLOH-DPHV³%XEED´0RVHVJRWPRVW RIWKHVQDSVDQGZDVWKHOHDGLQJSDVVFDWFKHU DPRQJ WKH JURXS ODVW VHDVRQ +H LV DQ DOO DURXQGSOD\HUZKRKDVSURYHGKLPVHOIDVRXQG UHFHLYHUDQGEORFNHU

4(%3//.%23

3DXO 7KRPSVRQ ZKR UHGVKLUWHG ODVW VHDVRQ DIWHUVHUYLQJDVWKHEDFNXSLQDQG5KHWW %RPDU ZKR UHGVKLUWHG ODVW VHDVRQ DV D WUXH IUHVKPDQEULQJWKHUXQWKURZRSWLRQ

5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH -HMXDQ5DQNLQV7UDYLV:LOVRQ

5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH -DPHV0RVHV

#/!#().'34!&&

7KH EDFNXS ODVW VHDVRQ ZDV 7RPP\ *UDG\ D  VRSKRPRUH ZKRVH DUP VWUHQJWK DQG DFFXUDF\ PDNH D IRUPLGDEOH SDFNDJH +H SOD\HG VSDULQJO\ EHKLQG :KLWH ODVW VHDVRQ EXW FRQQHFWHG RQ RI SDVVHV DQG QHYHU ORRNHGXQFRPIRUWDEOH

2ECEIVERS

4IGHT%NDS     3 %!3 /.

5HWXUQLQJ SOD\HUV ZLWK VWDUWLQJ H[SHULHQFH 1RQH

7KHIXOOEDFNVORWLVVROLGZLWKWKUHH\HDUUHWXUQ LQJVWDUWHU-'5XQQHOV/DUJHO\XQVXQJIRUKLV UROHDVDEORFNHUDQGUHFHLYHU5XQQHOVHDUQV FRQVWDQWSUDLVHIURPWKHFRDFKLQJVWDII%DFN XSVZLOOEHGHYHORSHGWKURXJKIDOOZRUNRXWV

+LVVWDEOHPDWHIURPD\HDUDJR.HMXDQ-RQHV DOVRUHWXUQV7KHVHQLRUKDVPRUHWKDQ FDUHHUUXVKLQJ\DUGVDQGLVDOVRDGDQJHURXV UHFHLYHU6HQLRU'RQWD+LFNVRQDQGVRSKRPRUH -DFRE*XWLHUUH]DUHDOVRLQWKHPL[

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

3%!3/./54,//+ /FFENSIVE,INE 5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH &* &KULV %XVK * .HOYLQ &KDLVVRQ * 'DYLQ -RVHSK7&KULV0HVVQHU

25&53!,%8!.$%2

2NODKRPDSURGXFHGWKH2XWODQG7URSK\ZLQQHU ODVW\HDULQ-DPPDO%URZQEXWFRXOGKDYHMXVW DV HDVLO\ SURPRWHG DQRWKHU RI LWV OLQHPHQ IRU WKDWDZDUG)URPWKHWLPH'DYLQ-RVHSKGUHZ KLV¿UVWVWDUWDW28LQWKH%LJWLWOHJDPH QROHVVKHKDVEHHQDPRQJWKHWHDP¶VEHVW $ JXDUG WKURXJKRXW KLV FDUHHU KH ZLOO QRZ VSHQGWLPHDWWDFNOHDSRVLWLRQKHWULHGEULHÀ\ ODVW$XJXVW5HJDUGOHVVRIZKHUHKHOLQHVXS WKH VHQLRU ZLOO EH D FDQGLGDWH IRU WKH KLJKHVW KRQRUV -RVHSKLVRQHRI¿YHVHQLRUVLQWKLV\HDU¶VPL[ DQGWKH\RXQJHVWRIWKHJURXS7KHRWKHUIRXU DUHDOO¿IWK\HDUSOD\HUV7KUHHKDYHH[WHQVLYH VWDUWLQJH[SHULHQFHDQGDQRWKHUKDVSOD\HGLQ VKRUW\DUGDJHVLWXDWLRQV $PRQJ WKDW JURXS DUH .HOYLQ &KDLVVRQ DQG &KULV%XVKZKRVSOLWWLPHDWJXDUGODVWVHDVRQ &KDLVVRQ LV OLNHO\ WR UHPDLQ DW WKDW SRVLWLRQ ZKLOH %XVK LV D FDQGLGDWH DW FHQWHU $QRWKHU ZKR ¿JXUHV VRPHZKHUH LQ WKDW FHQWHUJXDUG PL[LV&KULV&KHVWHUDFRQYHUWHGWLJKWHQGZKR ZDVIHDWXUHGLQ28¶VMXPERVHWVODVWVHDVRQ &KULV 0HVVQHU VWDUWHG DW OHIW WDFNOH LQ WKH  VHDVRQ RSHQHU DQG KDV VLQFH ZRUNHG LQDUHVHUYHUROH$NLP0LOOLQJWRQDSURPLVLQJ VRSKRPRUHZKREDFNHGXS-DPPDO%URZQODVW VHDVRQ LV DQRWKHU ZKR ZLOO EH FDOOHG XSRQ WR VWHSIRUZDUGDWWDFNOH%UHWW5D\OLVDWDOHQWHG ¿IWK\HDU VHQLRU ZKR ¿JXUHV WR JHW WKH PRVW H[WHQVLYHORRNRIKLVFDUHHU )URP WKH \RXQJHU UDQNV -' 4XLQQ DQG &DPHURQ 6FKDFKW ERWK RI ZKRP UHGVKLUWHG ODVW VHDVRQ DQG PLG\HDU DUULYDOV %UDQQGRQ %UD[WRQDQG%HQ%DUUHVLZLOOJHWDORRN 7KHORVVHVZHUHVLJQL¿FDQWZLWK%URZQFHQWHU 9LQFH&DUWHUDQG:HV6LPVEXWWKHSUHVHQFH RI¿YHVHQLRUVRIIHUVVRPHVRODFH

4(%3//.%2$%&%.3% 8S IURQW DQG LQ WKH OLQHEDFNHU FRUSV  ZLWQHVVHG WKH HPHUJHQFH RI D QXPEHU RI WDOHQWHG \RXQJ SOD\HUV ² D JRRG WKLQJ FRQ VLGHULQJVHYHQVWDUWHUVKDYHVLQFHEHHQORVWWR JUDGXDWLRQRUWKHSURIHVVLRQDOUDQNV

6HYHUDORIWKRVHQDPHVZHUHRIWKHKRXVHKROG YDULHW\EXWWKHUHDOVRZHUHWKHOLNHVRI5XIXV $OH[DQGHU /DUU\ %LUGLQH &OLQW ,QJUDP DQG 0DUFXV :DONHU ZKR ZHUH HOERZLQJ WKHLU ZD\ LQWRWKHVSRWOLJKW 0XFKRIWKHUHVSRQVLELOLW\ZLOOIDOORQWKRVHZKR PDGH WKHLU VSODVK ODVW VHDVRQ ZKLOH VRPH QHZFRPHUVDQGRWKHU\RXQJVWHUVJHWWKHLUVKRW DWJUHDWHUSURPLQHQFH

$EFENSIVE,INE 5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH '(/DUU\%LUGLQH'7'XVW\'YRUDFHN'7&DUO 3HQGOHWRQ 2NODKRPD KDG D JUHDW VHW RI ERRNHQGV ODVW VHDVRQZLWK'DQ&RG\DQG-RQDWKDQ-DFNVRQ $WKOHWLFDQGH[SHULHQFHGWKH\ZHUHDPRQJWKH EHVW WDQGHPV LQ WKH ODQG 7KH\¶UH JRQH QRZ EXWDOOLVQRWORVWDWHQG

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

3EASON0REVIEW /DUU\ %LUGLQH ZKR GUHZ RQH VWDUW LQ  ¿JXUHVWRVWHSLQWRRQHRIWKRVHMREV+HSOD\HG QHDUO\ WKH VDPH QXPEHU RI VQDSV DV ODVW VHDVRQ¶V VWDUWHUV DQG SRVVHVVHV D ORW RI WKH VDPH TXDOLWLHV WKDW PDGH &RG\ DQG -DFNVRQ VRHIIHFWLYH 7KH RWKHU HQG VSRW LV OHVV FHUWDLQ &DOYLQ 7KLERGHDX[ PLVVHG ODVW VHDVRQ ZLWK D NQHH LQMXU\EXWZLOOOLNHO\EHDFDQGLGDWH7KHVDPH FDQEHVDLGRIMXQLRU/HDQDU1L[RQVRSKRPRUHV $ORQ]R 'RWVRQ DQG -RKQ :LOOLDPV UHGVKLUW IUHVKPDQ$ODQ 'DYLV DQG PLG\HDU MXQLRU FRO OHJHWUDQVIHU&-$K<RXZKRVSHQWWKH VHDVRQSOD\LQJDW%<8 2Q WKH LQWHULRU 28 ORVW /\QQ 0F*UXGHU EXW UHWXUQVPRVWRIWKHUHVWRIODVWVHDVRQ¶VIRXU PDQ URWDWLRQ SOXV D IRUPHU$OO%LJ  SOD\HU 'XVW\ 'YRUDFHN PLVVHG PRVW RI ODVW VHDVRQ EXWZRUNHGKLVZD\EDFNDQGUHMRLQHGWKHWHDP IRUZLQWHUFRQGLWLRQLQJ+HZLOOEHDQDQFKRULQ WKHPLGGOH $QRWKHUUHWXUQLQJVWDUWHULV&DUO3HQGOHWRQZKR VWHSSHGLQIRU'YRUDFHNODVWVHDVRQ2WKHUVWR ZDWFKLQFOXGHVHQLRU5HPL$\RGHOHZKRGUHZ RQHVWDUWODVWVHDVRQVRSKRPRUH6WHYHQ&ROH PDQDQGUHGVKLUWIUHVKPDQ&RU\%HQQHWW


3%!3/./54,//+ ,INEBACKERS 2IWKHWKUHHZKRSOD\HGWKHPRVWWZRDUHEDFN LQ RXWVLGH EDFNHUV 5XIXV$OH[DQGHU DQG &OLQW ,QJUDP %RWK VDZ WKH ¿UVW H[WHQVLYH DFWLRQ RI WKHLU UHVSHFWLYH FDUHHUV ODVW VHDVRQ DQG VKRZHG WKHPVHOYHV WR EH IDVW DQG SK\VLFDO 1RZWKH\¶UHD\HDUVPDUWHUWRR

    3 %!3 /.

5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH 5XIXV$OH[DQGHU&OLQW,QJUDP

'!22%44(!24,%9

#/!#().'34!&&

/DQFH 0LWFKHOO LV JRQH IURP WKH PLGGOH DQG WKDW¶VDVLJQL¿FDQWORVV7KH6RRQHUVZLOOORRNDW DOLJQPHQWDQGFDQGLGDWHVWRVHHZKR¿WVEHVW ZKHUH 7ZR \RXQJHU SOD\HUV RQ WKH ULVH DUH =DFK/DWLPHUDQG'HPDUULR3OHDVDQW%RWKUXQ H[WUHPHO\ZHOODQGSDFNDSXQFK/DWLPHUZDV 0LWFKHOO¶VEDFNXSODVWVHDVRQDQGKHLVFDSDEOH RIPDNLQJDUXQDWWKHMRE 0XFK OLNH WKH UHFHLYLQJ FRUSV WKH IUHVKPDQ FODVVRIIHUVFDQGLGDWHVZKRPD\EHFDSDEOHRI SOD\LQJULJKWDZD\

5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH &%(ULF%DVVH\&%&KLMLRNH2Q\HQHJHFKD&% 0DUFXV:DONHU 7KHUH LV OLWWOH GHEDWH RYHU WKH IDFW WKDW WKH ELJJHVWTXHVWLRQVORRPLQWKHVHFRQGDU\2QO\ WUXH VRSKRPRUH 0DUFXV :DOONHU UHWXUQV IURP WKHIRXUVRPHWKDWVWDUWHGWKH¿QDOIRXUJDPHV RIODVWVHDVRQDQGKHPLVVHGVSULQJSUDFWLFH IROORZLQJVKRXOGHUVXUJHU\

$WIUHHVDIHW\'DULHQ:LOOLDPVDQG7RQ\&DGH DUHIURQWUXQQHUV

,WORRNHGDVWKRXJK2NODKRPDZRXOGLQWURGXFH D QHZ SODFHNLFNHU DQG SXQWHU LQ  7KHQ FDPHWKHJDPH1RWULSWR%D\ORU7KDWZDV WKH JDPH LQ ZKLFK *DUUHWW +DUWOH\¶V UHGVKLUW ZDVUHPRYHGDQGWKHWUXHIUHVKPDQWRRNRYHU DVWKHNLFNHU  +H ¿QLVKHG WKH VHDVRQ PDNLQJ DOO  RI KLV H[WUDSRLQWVDQGKLVORQH¿HOGJRDODWWHPSWDQG LVQRZFHPHQWHGLQWKHSRVLWLRQ'LPLQXWLYHLQ VWDWXUH+DUWOH\KDVDVWURQJOHJDQGDEDOOWKDW ULVHVTXLFNO\  7KH SXQWLQJ MRE ZLOO KDYH D QHZ QDPH DQG WKDW¶VVD\LQJVRPHWKLQJDW2NODKRPD)RUWKH SUHYLRXVVHYHQVHDVRQVRQHRIWKH)HUJXVRQ EURWKHUV -HII   DQG %ODNH   KDGWKHUHVSRQVLELOLW\

3EASON0REVIEW 0RVWRIWKRVHFKDUJHGZLWKUHWXUQLQJSXQWVDQG NLFNRIIVODVWVHDVRQPXVWEHUHSODFHG$QWRQLR 3HUNLQVKDGWKHSXQWUHWXUQUHVSRQVLELOLW\:KHQ KHZDVRXWGXHWRLQMXU\0DUN&OD\WRQZDVWKH UHSODFHPHQW2QNLFNRIIUHWXUQV0DUN%UDGOH\ DQG7UDYLV:LOVRQZHUHWKHGHHSUHFHLYHUV  2I WKRVH IRXU SOD\HUV RQO\ :LOVRQ UHWXUQV -HMXDQ5DQNLQVKDVH[SHULHQFHDVERWKDSXQW DQGNLFNRIIUHWXUQHUDQGZRXOGEHDORJLFDO¿W 7KHUHYLHZRIRWKHUVZLOOH[WHQGLQWR$XJXVW 7KHORQJVQDSSLQJMRELVVDIHLQWKHKDQGVRI VHQLRU-DFRE5LFH+HKDVEHHQDVUHOLDEOHLQ KLVUROHDVDQ\SOD\HURQWKHWHDP  $ QHZ KROGHU PXVW EH ORFDWHG ZLWK %UDGOH\¶V GHSDUWXUH$XGLWLRQV IRU WKDW SRVLWLRQ DOVR ZLOO FRQWLQXHDVWKHWHDPFRQYHQHVIRUIDOOGULOOV

:LWK %ODNH¶V JUDGXDWLRQ WKH ORQH UHWXUQHH LV VRSKRPRUH &RG\ )UHHE\ D OHIWIRRWHG NLFNHU ZKR LV \HW WR SHUIRUP XQGHU JDPH FRQGLWLRQV IRU280LNH.QDOODWUDQVIHUIURP6FRWWVGDOH $UL] &RPPXQLW\&ROOHJHZLOOPDNHDELGIRU WKHSRVLWLRQDVZHOO 

/+,!(/-! ()34/29

7KH VWURQJ VDIHW\ LV DQRWKHU VSRW WKDW ZLOO IHDWXUH D QHZ VWDUWHU 'RQWH 1LFKROVRQ KDG WKHMRERYHUWKHODVWWZRVHDVRQV&DQGLGDWHV LQFOXGHFRQYHUWHGOLQHEDFNHU/HZLV%DNHUDQG -DVRQ&DUWHU

5HWXUQLQJSOD\HUVZLWKVWDUWLQJH[SHULHQFH .*DUUHWW+DUWOH\56-HMXDQ5DQNLQV/6-DFRE 5LFH567UDYLV:LOVRQ

2%6)%7 /00/.%.43

$WFRUQHUEDFNZKHUH28PXVWUHSODFH$QWRQLR 3HUNLQV WKH 6RRQHUV¶ URVWHU LQFOXGHV :DONHU ZKRVWDUWHGWKHODVWWKUHHJDPHVODVWVHDVRQ DORQJZLWK(ULF%DVVH\DQG&KLMLRNH2Q\HQHJH FKD ERWK RI ZKRP KDG VWDUWV DW WKH SRVLWLRQ LQ  -RZDKQ 3RWHDW DQG '- :ROIH ZKR FRQYHUWHGWRWKHSRVLWLRQIURPUXQQLQJEDFNODVW VSULQJ

3//.%230%#)!,4%!-3

4(%3//.%23

$EFENSIVE"ACKS

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

/+,!(/-!2/34%23



.UMERICAL2OSTER

!LPHABETICAL2OSTER

1R                                                                                                                      

1R                                                                  

3OD\HU 3RV 6PLWK5HJJLH  '% .HOO\0DOFROP  :5 -DFNVRQ%ULDQ '% 5DQNLQV-HMXDQ :5 :LOVRQ7UDYLV :5 +DUULV1LF  '% 5RELQVRQ'DYLG :5 &DUWHU-DVRQ '% -RKQVRQ0DQXHO :5 %RPDU5KHWW  4% 5H\QROGV5\DQ/% %ODQNHQVKLS/HH 4% &OD\WRQ.HHQDQ  '% 5RVV7ULVWHQ  :5 $\HUV'DUU\O  '% +ROPHV/HQG\ :5 7KRPSVRQ3DXO 4% +DUGLVRQ-HUPDLQH :5 %DVVH\(ULF '% %RZHUV%UHWW6 *UDG\7RPP\  4% 0F(DFKHUQ+D\V 4% %DNHU/HZLV '% )UHHE\&RG\3 +XJJLQV(ULF :5 ,JOHVLDV-XDTXLQ  :5 &KDQH\4XHQWLQ  :5 -RQHV.HMXDQ  5% 3RWHDW-RZDKQ  '% *XWLHUUH]-DFRE 5% 2Q\HQHJHFKD&KLMLRNH '% 3DWULFN$OOHQ  '% +DJDQV0DUFXV '% :DONHU0DUFXV  '% :ROIH'- '% +DUULV5- '% /XQD-DFRE '% %RWKXQ*DUUHWW  :5 3HWHUVRQ$GULDQ  5% 6QHOO-HUPDLQH  5% 'L[RQ'DQ '% 5RELQVRQ/DPRQW/% &DGH7RQ\ '% 5DWFOLII0LFKDHO '% +DUWOH\*DUUHWW. &ODSS0DWW)% :H\DQG%HQ7( +LFNVRQ'RQWD 5% 'HQQLVRQ5XVVHOO /% 5XQQHOV-')% .QDOO0LNH3 /RIWRQ&XUWLV/% =DVODZ'DQH 5% :LOOLDPV'DULHQ6 $OH[DQGHU5XIXV/% ,QJUDP&OLQW/% *UHHQH-RUGDQ 7( /DWLPHU=DFK/% -RUGDQ-RQDWKDQ/%

3OD\HU /HWWHUV  $K<RX&- $OH[DQGHU5XIXV  $OOHQ-RKQ $\HUV'DUU\O $\RGHOH5HPL  %DNHU/HZLV  %DUUHVL%HQ %DVVH\(ULF  %HQQHWW&RU\ %LUGLQH/DUU\  %ODFNDUG%LOO\ %ODQNHQVKLS/HH %RPDU5KHWW %RWKXQ*DUUHWW %RZHUV%UHWW %UD[WRQ%UDQQGRQ %XVK&KULV  &DGH7RQ\  &DUWHU-DVRQ  &KDLVVRQ.HOYLQ  &KDQH\4XHQWLQ &KHVWHU&KULV  &KLOFRDW-XVWHQ &ODSS0DWW &OD\WRQ.HHQDQ &ROHPDQ6WHYHQ &RRSHU-RQ &XPPLQJV$DURQ 'DLOH\-RKQ 'DYLV$ODQ 'HQQLVRQ5XVVHOO  'L[RQ'DQ 'RWVRQ$ORQ]R 'YRUDFHN'XVW\  (GZDUGV(OOLRW (OGULGJH%URG\ (QJOLVK$XVWRQ (QJOLVK5XVVHOO )LQOH\-RH-RQ  )UHHE\&RG\  *UDG\7RPP\  *UDQJHU'H0DUFXV *UHHQH-RUGDQ *XWLHUUH]-DFRE  +DJDQV0DUFXV +DUGLVRQ-HUPDLQH +DUULV1LF +DUULV5- +DUWOH\*DUUHWW  +LFNVRQ'RQWD  +ROPHV/HQG\ +XJJLQV(ULF ,JOHVLDV-XDTXLQ ,QJUDP&OLQW  -DFNVRQ%ULDQ -RKQVRQ0DQXHO -RQHV.HMXDQ  -RUGDQ-RQDWKDQ -RVHSK'DYLQ 

/+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

3RV '( /% :5 '% '7 '% 2/ '% '7 '( '/ 4% 4% :5 6 2/ 2/ '% '% 2/ :5 2/ :5 )% '% '7 2/ 7( /% '( /% '% '( '/ :5 '( '( :5 7( 3 4% '7 7( 5% '% :5 '% '% . 5% :5 :5 :5 /% '% :5 5% /% 2/

+W                                                           

:W                                                           

<U +RPHWRZQ /DVW6FKRRO

-U +LJKODQG8WDK 6QRZ&ROOHJH  -U %DWRQ5RXJH/D &KULVWLDQ/LIH  )U 2NODKRPD&LW\2NOD &DSLWDO+LOO  -U &KDUORWWH1& 81&&KDUORWWH  6U *UDQG3UDLULH7H[DV 1(2NODKRPD$ 0  6R &DUUROOWRQ7H[DV +HEURQ  )U (GPRQG2NOD 1RUWK  6U *DUODQG7H[DV 1RUWK*DUODQG  5)U 6DQ$QWRQLR7H[DV 5RRVHYHOW  -U /DZWRQ2NOD (LVHQKRZHU  )U &ODUHPRUH2NOD &ODUHPRUH

)U 6SLUR2NOD 6SLUR  5)U *UDQG3UDLULH7H[DV *UDQG3UDLULH  6R 5RZOHWW7H[DV 5RZOHWW  5)U -DFNVRQYLOOH)OD 7ULQLW\&KULVWLDQ  )U <RXQJVWRZQ2KLR 8UVXOLQH  6U &KDQQHOYLHZ7H[DV &KDQQHOYLHZ  6R /HZLVYLOOH7H[DV /HZLVYLOOH  -U 7XOVD2NOD -HQNV  6U %HDXPRQW7H[DV 2]HQ  5)U 7XOVD2NOD %RRNHU7:DVKLQJWRQ  6U 7XVWLQ&DOLI 7XVWLQ  5)U 0LGZHVW&LW\2NOD 0LGZHVW&LW\  )U 3KRHQL[$UL] 3DUDGLVH9DOOH\

)U 6XOSKXU6SULQJV7H[DV 6XOSKXU6SULQJV

6R 'DOODV7H[DV 6N\OLQH  )U )RUW&ROOLQV&ROR )RUW&ROOLQV

)U 0DUORZ2NOD %UD\'R\OH

-U /DZWRQ2NOD /DZWRQ  5)U &ROOH\YLOOH7H[DV +HULWDJH  6U :HDWKHUIRUG2NOD :HDWKHUIRUG  -U 7XOVD2NOD &RUQHOO8QLYHUVLW\  6R $OLHI7H[DV +DVWLQJV  6U /DNH'DOODV7H[DV /DNH'DOODV  6R 1RUPDQ2NOD +RPH6FKRRO  )U /D&\JQH.DQ 3UDLULH9LHZ

)U &DQDGLDQ7H[DV &DQDGLDQ

5)U 'DOODV7H[DV +LJKODQG3DUN  6R $UOLQJWRQ7H[DV $UOLQJWRQ  6R )W:RUWK7H[DV )W:RUWK&KULVWLDQ  6R +XQWLQJWRQ%HDFK&DOLI (GLVRQ  )U 'DOODV7H[DV .LPEDOO

6R &ROOH\YLOOH7H[DV +HULWDJH  6R 6DQ$QWRQLR7H[DV 0DGLVRQ  )U 7XOVD2NOD (DVW&HQWUDO  6R 0LGZHVW&LW\2NOD 0LGZHVW&LW\  )U $OH[DQGULD/D $OH[DQGULD

6R $UOLQJWRQ7H[DV $UOLQJWRQ  6R 6RXWKODNH7H[DV 6RXWKODNH&DUUROO  6U 0F.LQQH\7H[DV 0F.LQQH\  5)U 'DOODV7H[DV 6RXWK2DN&OLII  )U &RQZD\6& &RQZD\

)U .LOOHHQ7H[DV .LOOHHQ

6U +DOOVYLOOH7H[DV +DOOVYLOOH  )U 'H6RWR7H[DV 'H6RWR

)U *LOPHU7H[DV *LOPHU

6U 7XOVD2NOD -HQNV  -U 2NODKRPD&LW\2NOD &HQWUDO2NODKRPD  6U +DOODQGDOH)OD +DOODQGDOH 


/+,!(/-!2/34%23 !LPHABETICAL2OSTER

.UMERICAL2OSTER

0RONUNCIATION'UIDE &-$K<RX ,\RX 5HPL$\RGHOH  5(0HH$$RKGHOO %HQ%DUUHVL %8+UHHVHH (ULF%DVVH\UK\PHVZLWKVDVV\ .HOYLQ&KDLVVRQ VKXKVKRQ 'RQWD+LFNVRQ '21WD\ .HMXDQ-RQHV .((ZDKQ $NLP0LOOLQJWRQ  $+NLP

1R                                                                                                

3OD\HU 3RV 'DLOH\-RKQ/% 3OHDVDQW,DQ /% &RRSHU-RQ2/ 3OHDVDQW'HPDUULR /% %XVK&KULV 2/ 3HWHUVHQ.\OH/% 0F*UDWK5\DQ/% .HLWK%UDQGRQ2/ 7KLERGHDX[&DOYLQ  '( 5D\O%UHWW 2/ 4XLQQ-'2/ &KHVWHU&KULV 2/ %DUUHVL%HQ2/ 5RWKHQEHUJ$DURQ2/ :KLWH-HVVH 2/ 3HQGOHWRQ&DUO '7 5LFH-DFRE  '6 0LOOLQJWRQ$NLP 2/ &KDLVVRQ.HOYLQ 2/ 6FKDFKW&DPHURQ2/ 5RELQVRQ*HRUJH2/ 6LPPRQV%ULDQ'7 %UD[WRQ%UDQQGRQ2/ -RVHSK'DYLQ 2/ %ODFNDUG%LOO\ 2/ 0HVVQHU&KULV2/ (QJOLVK5XVVHOO :5 (GZDUGV(OOLRWW  :5 &KLOFRDW-XVWHQ :5 1L[RQ/DHQDU '( (OGULGJH%URG\  '( (QJOLVK$XVWRQ  '( )LQOH\-RH-RQ7( 'DYLV$ODQ '( &XPPLQJV$DURQ 7( $OOHQ-RKQ :5 5REHUWV:LOOLH7( 0RRUH&RUGHUR'7 0RVHV-DPHV7( &ROHPDQ6WHYHQ'7 'RWVRQ$ORQ]R '( %LUGLQH/DUU\ '( $\RGHOH5HPL'7 'YRUDFHN'XVW\'/ *UDQJHU'H0DUFXV'7 %HQQHWW&RU\'7 :LOOLDPV-RKQ '( $K<RX&- '(

 /DHQDU1L[RQ/8+QDU &KLMLRNH2Q\HQHJHFKD  FKHH-2ND\21\XKQDKJHWFKDK 'HPDUULR3OHDVDQW'8+PDUHHRK -RZDKQ3RWHDW -8+ZDKQ -HMXDQ5DQNLQV -8+ZDKQ %UHWW5D\O 5$,/ &DPHURQ6FKDFKW 6+27 &DOYLQ7KLERGHDX[ 7,%XKGRK

.!4)/.!,#( !-0)/.3

/+,!(/-! ()34/29

<U +RPHWRZQ /DVW6FKRRO

-U 0F$OHVWHU2NOD 2NODKRPD$ 0-&

)U /RQJYLHZ7H[DV /RQJYLHZ

6R &KDSDUUDO$UL] 6FRWWVGDOH&&

-U 'HQYHU&ROR *DWHZD\  )U .LQJ¿VKHU2NOD .LQJ¿VKHU  -U *UDSHYLQH7H[DV *UDSHYLQH  5)U $XVWLQ7H[DV $XVWLQ  5)U 0XVNRJHH2NOD 0DF$UWKXU  -U )UHGHULFN2NOD )UHGHULFN  6R :KHDWRQ,OO :KHDWRQ1RUWK  )U 0HVTXLWH7H[DV +RUQ

6U +RXVWRQ7H[DV 1RUWK6KRUH  -U 0LDPL)OD &DURO&LW\  6U 5LFKPRQG&DOLI &&RI6DQ)UDQFLVFR  6R &RQZD\6& ,QGHSHQGHQFH&&

6R 6DSXOSD2NOD 6DSXOSD  5)U 3ODQR7H[DV 3ODQR:HVW  6R 3DOHVWLQH7H[DV 3DOHVWLQH  6R /HZLVYLOOH7H[DV /HZLVYLOOH  -U $OH[DQGULD9D :HVW+LOOV&&  6U $UGPRUH2NOD $UGPRUH  5)U *DUODQG7H[DV *DUODQG  6U :LQGVRU1& %HUWLH  5)U 6DOLQD.DQ 6DFUHG+HDUW  6U /HZLVYLOOH7H[DV /HZLVYLOOH  )U /DV9HJDV1HY %LVKRS*RUPDQ

6U 1RUPDQ2NOD 1RUPDQ  6U 0LDPL)OD 1RUWKHDVWHUQ$ 0&&  6R 'H6RWR7H[DV .LPEDOO  )U $WODQWD*D :DVKLQJWRQ

)U 6DOHP1- 6DOHP

6R 6KUHYHSRUW/D (YDQJHO&KULVWLDQ  6R 0DGLOO2NOD 0DGLOO  6U 0LGZHVW&LW\2NOD &DUO$OEHUW  5)U &RSSHOO7H[DV &RSSHOO  )U 5DOHLJK1& +DUJUDYH$FDGHP\

)U (GPRQG2NOD 6DQWH)H

6R 2NODKRPD&LW\2NOD &DSLWDO+LOO  6U +RXVWRQ7H[DV :HVWEXU\  -U /HDQGHU7H[DV /HDQGHU  6R :DFR7H[DV :DFR  5)U )ULVFR7H[DV )ULVFR  )U 'HQYHU&ROR 0XOOHQ

6R 0HVTXLWH7H[DV 10HVTXLWH  6R +RXVWRQ7H[DV /DPDU  6U &DUUROOWRQ7H[DV &UHHNYLHZ  6R /DZWRQ2NOD (LVHQKRZHU  6R (GPRQG2NOD 0HPRULDO 

2%6)%7 /00/.%.43

:W                                                

4(%3//.%23

+W                                                

#/!#().'34!&&

3OD\HU /HWWHUV  3RV .HLWK%UDQGRQ 2/ .HOO\0DOFROP :5 .QDOO0LNH 3 /DWLPHU=DFK  /% /RIWRQ&XUWLV /% /XQD-DFRE '% 0F(DFKHUQ+D\V 4% 0F*UDWK5\DQ /% 0HVVQHU&KULV  2/ 0LOOLQJWRQ$NLP  2/ 0RRUH&RUGHUR '7 0RVHV-DPHV  7( 1L[RQ/DHQDU '( 2Q\HQHJHFKD&KLMLRNH  '% 3DWULFN$OOHQ '% 3HQGOHWRQ&DUO  '7 3HWHUVHQ.\OH /% 3HWHUVRQ$GULDQ  5% 3OHDVDQW'HPDUULR  /% 3OHDVDQW,DQ /% 3RWHDW-RZDKQ  '% 4XLQQ-' 2/ 5DQNLQV-HMXDQ  :5 5DWFOLII0LFKDHO '% 5D\O%UHWW  2/ 5H\QROGV5\DQ /% 5LFH-DFRE  '6 5REHUWV:LOOLH  7( 5RELQVRQ'DYLG :5 5RELQVRQ*HRUJH 2/ 5RELQVRQ/DPRQW /% 5RVV7ULVWHQ :5 5RWKHQEHUJ$DURQ 2/ 5XQQHOV-'  )% 6FKDFKW&DPHURQ 2/ 6LPPRQV%ULDQ '7 6PLWK5HJJLH '% 6QHOO-HUPDLQH 5% 7KLERGHDX[&DOYLQ  '( 7KRPSVRQ3DXO  4% :DONHU0DUFXV  '% :H\DQG%HQ 7( :KLWH-HVVH 2/ :LOOLDPV'DULHQ  6 :LOOLDPV-RKQ '( :LOVRQ7UDYLV  :5 :ROIH'-  '% =DVODZ'DQH 5%

    3 %!3 /.

1R                                                       




.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

02%3%!3/.$%04(#(!24 /FFENSE

$EFENSE

72

  7UDYLV:LOVRQ   /HQG\+ROPHV

 

 

6U 5)U

$%

  /DUU\%LUGLQH   -RKQ:LOOLDPV

 

 

-U 6R

,4

  'DYLQ-RVHSK   %UDQQGRQ%UD[WRQ

 

 

6U )U

$4

  5HPL$\RGHOH   &DUO3HQGOHWRQ 

 

 

6U 6R

,'

 .HOYLQ&KDLVVRQ   %UHW5D\O 

 

 

6U 6U

$4

  'XVW\'YRUDFHN   6WHYHQ&ROHPDQ

 

 

6U 6R

 &KULV%XVK   -'4XLQQ

 

 

6U 5)U

$%

  &-$K<RX  &DOYLQ7KLERGHDX[ 

 

 

-U 6U

2'

 &KULV&KHVWHU   %HQ%DUHVVL

 

 

6U )U

3,"

  &OLQW,QJUDP   'HPDUULR3OHDVDQW 

 

 

6U 6R

24

 $NLP0LOOLQJWRQ   &KULV0HVVQHU 

 

 

6R -U

-,"

  =DFK/DWLPHU   &XUWLV/RIWRQ  5\DQ0F*UDWK

  

  

-U )U )U

RU

4%

 -DPHV0RVHV   -RH-RQ)LQOH\   :LOOLH5REHUWV 

  

  

6U 6R 6U

7,"

  5XIXV$OH[DQGHU    5\DQ5H\QROGV  ,DQ3OHDVDQW

  

  

-U )U -U

RU

72

  -HMXDQ5DQNLQV   4XHQWLQ&KDQH\

 

 

6U 5)U

#"

  (ULF%DVVH\   '-:ROIH 

 

 

6U 6R

1"

  5KHWW%RPDU  7RPP\*UDG\   3DXO7KRPSVRQ 

  

  

5)U 6R -U

&3

  'DULHQ:LOOLDPV   7RQ\&DGH 

 

 

6R 6R

2"

 $GULDQ3HWHUVRQ   .HMXDQ-RQHV 

 

 

6R 6U

33

  -DVRQ&DUWHU   /HZLV%DNHU 

 

 

-U 6R

&"

 -'5XQQHOV   5XVVHOO'HQQLVRQ 

 

 

6U 6U

#"

  0DUFXV:DONHU    &KLMLRNH2Q\HQHJHFKD  

 

6R 6U

+

 *DUUHWW+DUWOH\ 





6R

0

  &RG\)UHHE\   0LNH.QDOO

 

 

6R 6R

#

RU

RU RU

3PECIALISTS DVWHULVNVLQGLFDWHOHWWHUVHDUQHG %ROGIDFHLQGLFDWHVSURMHFWHGVWDUWHU

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-


02%3%!3/.!7!2$3(/./23 0RESEASON4EAM2ANKINGS

&-$K<RX 3UHVHDVRQ%LJ'HIHQVLYH1HZFRPHURIWKH<HDU7KH6SRUWLQJ1HZV

1RLQWKHQDWLRQ$WKORQ6SRUWV 1RLQWKHQDWLRQ1DWLRQDO&KDPSVQHW 1RLQWKHQDWLRQ%OXH5LEERQ&ROOHJH)RRWEDOO<HDUERRN 1RLQWKHQDWLRQ7KH6SRUWLQJ1HZV 1RLQWKH6RXWK7KH6SRUWLQJ1HZV 1RUXQQLQJEDFNVLQWKH%LJ$WKORQ6SRUWV 1RLQFRPLQJFODVVLQWKH%LJ $WKORQ6SRUWV 1RRIIHQVLYHOLQHLQWKH%LJ$WKORQ6SRUWV 1RGHIHQVLYHOLQHLQWKH%LJ$WKORQ6SRUWV 1RGHIHQVLYHEDFNVLQWKH%LJ $WKORQ6SRUWV

5XIXV$OH[DQGHU 3UHVHDVRQ¿UVWWHDP$OO%LJ7KH6SRUWLQJ1HZV 3UHVHDVRQ¿UVWWHDP$OO%LJ$WKORQ6SRUWV /DUU\%LUGLQH 1RGHIHQVLYHHQGLQWKHQDWLRQ7KH6SRUWLQJ1HZV 3UHVHDVRQ¿UVWWHDP$OO%LJ7KH6SRUWLQJ1HZV 3UHVHDVRQVHFRQGWHDP$OO%LJ$WKORQ6SRUWV

#/!#().'34!&&

'XVW\'YRUDFHN 1RGHIHQVLYHWDFNOHLQWKHQDWLRQ7KH6SRUWLQJ1HZV 3UHVHDVRQ¿UVWWHDP$OO%LJ$WKORQ6SRUWV %HVWUXQVWXI¿QJGHIHQVLYHWDFNOHLQWKH%LJ7KH6SRUWLQJ1HZV 'H0DUFXV*UDQJHU 1RLQFRPLQJIUHVKPDQLQWKH%LJ$WKORQ6SRUWV &OLQW,QJUDP 3UHVHDVRQVHFRQGWHDP$OO%LJ$WKORQ6SRUWV

    3 %!3 /.

0RESEASON!WARDS(ONORS

*$25..%,3

-'5XQQHOV 1RIXOOEDFNLQWKHQDWLRQ 7KH6SRUWLQJ1HZV %HVWEORFNLQJEDFNLQWKH%LJ7KH6SRUWLQJ1HZV

2%6)%7 /00/.%.43

$GULDQ3HWHUVRQ 1RUXQQLQJEDFNLQWKHQDWLRQ 6SRUWV,OOXVWUDWHG 1RUXQQLQJEDFNLQWKHQDWLRQ7KH6SRUWLQJ1HZV 3UHVHDVRQ¿UVWWHDP$OO$PHULFDQ 7KH6SRUWLQJ1HZV 3UHVHDVRQ¿UVWWHDP$OO$PHULFDQ  &ROOHJH)RRWEDOO1HZV 3UHVHDVRQ¿UVWWHDP$OO$PHULFDQ $WKORQ6SRUWV 3UHVHDVRQ$OO$PHULFDQ  1DWLRQDO&KDPSLRQVKLSVQHW 3UHVHDVRQ¿UVWWHDP$OO%LJ7KH6SRUWLQJ1HZV 3UHVHDVRQ¿UVWWHDP$OO%LJ &ROOHJH)RRWEDOO1HZV 3UHVHDVRQ¿UVWWHDP$OO%LJ$WKORQ6SRUWV

4(%3//.%23

'DYLQ-RVHSK 1RRIIHQVLYHWDFNOHLQWKHQDWLRQ7KH6SRUWLQJ1HZV 3UHVHDVRQ$OO$PHULFDQ  1DWLRQDO&KDPSLRQVKLSVQHW 3UHVHDVRQ¿UVWWHDP$OO%LJ7KH6SRUWLQJ1HZV 3UHVHDVRQ¿UVWWHDP$OO%LJ &ROOHJH)RRWEDOO1HZV 3UHVHDVRQ¿UVWWHDP$OO%LJ$WKORQ6SRUWV

0DUFXV:DONHU 3UHVHDVRQWKLUGWHDP$OO%LJ$WKORQ6SRUWV

%RE6WRRSV %HVWFRDFKLQWKH%LJ7KH6SRUWLQJ1HZV

/+,!(/-! ()34/29

7UDYLV:LOVRQ 1RUHFHLYHULQWKHQDWLRQ7KH6SRUWLQJ1HZV 3UHVHDVRQVHFRQGWHDP$OO%LJ7KH6SRUWLQJ1HZV 3UHVHDVRQVHFRQGWHDP$OO%LJ$WKORQ6SRUWV 0RVWSK\VLFDOUHFHLYHULQWKH%LJ7KH6SRUWLQJ1HZV

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

3//.%23!4!',!.#% /KLAHOMA#OACHES3TAFF

7HAT2ETURNS

%RE6WRRSV +HDG&RDFK 6HYHQWK6HDVRQ

%UHQW9HQDEOHV  $VVRF+HDG&RDFK'HIHQVLYH&RRUGLQDWRU/% %REE\-DFN:ULJKW$VVW+HDG&RDFK&R'HIHQVLYH&RRUGLQDWRU'% &KXFN/RQJ 2IIHQVLYH&RRUGLQDWRU4% &DOH*XQG\ 5HFUXLWLQJ&RRUGLQDWRU5% -DFNLH6KLSS $VVLVWDQW&RDFK'/ .HYLQ6XPOLQ 6SHFLDO7HDPV&RRUGLQDWRU7( .HYLQ:LOVRQ&R2IIHQVLYH&RRUGLQDWRU2/ 'DUUHOO:\DWW3DVVLQJ*DPH&RRUGLQDWRU:5 &KULV:LOVRQ  $VVLVWDQW&RDFK'(

%\SHUFHQWDJHZKDWUHWXUQVIURPODVWVHDVRQ 5XVKLQJ<DUGV 3DVVLQJ<DUGV 5HFHLYLQJ<DUGV 3XQW5HWXUQ<DUGV .LFNRII5HWXUQ<DUGV ,QWHUFHSWLRQV 6FRULQJ  7RWDO<DUGV $OO3XUSRVH<DUGV )LHOG*RDOV   3XQWLQJ<DUGV  7DFNOHV 7DFNOHV)RU/RVV 6DFNV )XPEOH5HFRYHULHV

-HUU\6FKPLGW 'LUHFWRURI6SRUWV(QKDQFHPHQW 0DWW0F0LOOHQ  $GPLQLVWUDWLYH&RRUGLQDWRU 0HUY-RKQVRQ 'LUHFWRURI)RRWEDOO2SHUDWLRQV *UHJ7LSWRQ 'LUHFWRURI$WKOHWLFV(TXLSPHQW 6FRWW$QGHUVRQ +HDG$WKOHWLFV7UDLQHU 6FRWW.RORN  $VVLVWDQW6WUHQJWK &RQGLWLRQLQJ&RDFK /DUU\-DFNVRQ  $VVLVWDQW6WUHQJWK &RQGLWLRQLQJ&RDFK &DVH\*OHQQ *UDGXDWH$VVLVWDQW&RDFK

,AST3EASONIN2EVIEW )LQDO5HFRUG &RQIHUHQFH5HFRUG  %LJ&KDPSLRQV

3RVWVHDVRQ )HG([2UDQJH%RZO %&6&KDPSLRQVKLS

5HVXOW 6RXWKHUQ&DO2NODKRPD )LQDO5DQNLQJ1R $3 (63186$7RGD\

/FFENSIVE,ETTERMEN2ETURNING 2/ &KULV %XVK 2/ .HOYLQ &KDLVVRQ 2/7( &KULV &KHVWHU )% 5XVVHOO 'HQQLVRQ7(-RH-RQ)LQOH\4%7RPP\*UDG\5%'RQWD+LFNVRQ5% .HMXDQ-RQHV2/'DYLQ-RVHSK2/&KULV0HVVQHU2/$NLP0LOOLQJWRQ 7( -DPHV 0RVHV 5% $GULDQ 3HWHUVRQ :5 -HMXDQ 5DQNLQV 2/ %UHWW 5D\O7(:LOOLH5REHUWV)%-'5XQQHOV4%3DXO7KRPSVRQ:57UDYLV :LOVRQ5%'-:ROIH VLQFHFRQYHUWHGWRGHIHQVH

$EFENSIVE,ETTERMEN2ETURNING /%5XIXV$OH[DQGHU'(5HPL$\RGHOH'%/HZLV%DNHU66(ULF%DVVH\ '(/DUU\%LUGLQH67RQ\&DGH'%-DVRQ&DUWHU'/'XVW\'YRUDFHN/% &OLQW,QJUDP/%=DFK/DWLPHU'%&KLMLRNH2Q\HQHJHFKD'7&DUO3HQ GHOWRQ/%'HPDUULR3OHDVDQW&%-RZDKQ3RWHDW'(&DOYLQ7KLERGHDX[ KDUGVKLSFDQGLDWH &%0DUFXV:DONHU'%'DULHQ:LOOLDPV

3PECIALIST,ETTERMEN2ETURNING .*DUUHWW+DUOH\/6-DFRE5LFH

#!,6).4()"/$%!58

,ETTERMEN,OST /%*D\URQ$OOHQ:50DUN%UDGOH\27-DPPDO%URZQ&9LQFH&DUWHU :50DUN&OD\WRQ'('DQ&RG\'7/DZUHQFH'DPSHHU.7UH\'L&DUOR 3 %ODNH )HUJXVRQ 2/ -RKQ )O\QQ :5$WDOHR )RUG '/ *UDQW +XOVH\ '( -RQDWKDQ -DFNVRQ :5 %UDQGRQ -RQHV '7 /\QQ 0F*UXGHU /% /DQFH 0LWFKHOO 66 'RQWH 1LFKROVRQ :5 :LOO 3HRSOHV &%56$QWRQLR 3HUNLQV)6%URGQH\3RRO'%%UDQGRQ6KHOE\27:HV6LPV'%'DUUHQ 6WHSKHQV'/9HUVKXQ6XEOHW)%'DQ7RZQVHQG4%-DVRQ:KLWH

0LAYERS7HO2EDSHIRTEDIN /%/HZLV%DNHU'/&RU\%HQQHWW4%/HH%ODQNHQVKLS4%5KHWW%RPDU '% %UHWW %RZHUV :5 4XHQWLQ &KDQH\ :5 -XVWHQ &KLOFRDW '( $ODQ 'DYLV '7 'XVW\ 'YRUDFHN KDUGVKLS  :5 5XVVHOO (QJOLVK :5 /HQG\ +ROPHV4%+D\V0F(DFKUHQ/%5\DQ0F*UDWK/%.\OH3HWHUVRQ2/ -'4XLQQ2/&DPHURQ6FKDFKW:5)UHG6WURQJ'(&DOYLQ7KLERGHDX[ KDUGVKLSFDQGLGDWH 4%3DXO7KRPSVRQ

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-


3//.%23!4!',!.#% 3TARTERS

3HUVRQQHOOLVWHGZLWKHOLJLELOLW\DVLWZLOOEHHQWHULQJWKHXSFRPLQJVHDVRQ

6WDUWHUVUHWXUQLQJDQGVWDUWHUVORVWIURPODVWVHDVRQ

6HQLRUV 

'75HPL$\RGHOH&%(ULF%DVVH\2/&KULV%XVK2/.HOYLQ&KDLVVRQ 2/7(&KULV&KHVWHU)%5XVVHOO'HQQLVRQ)%'DQ'L[RQ'7'XVW\'YR UDFHN5%'RQWD+LFNVRQ/%&OLQW,QJUDP5%.HMXDQ-RQHV2/'DYLQ -RVHSK'%-DFRE/XQD7(-DPHV0RVHV&%&KLMLRNH2Q\HQHJHFKD &%-RZDKQ3RWHDW:5-HMXDQ5DQNLQV2/%UHWW5D\O/6-DFRE5LFH 7(:LOOLH5REHUWV)%-'5XQQHOV'(&DOYLQ7KLERGHDX[:57UDYLV :LOVRQ

2IIHQVLYH6WDUWHUV5HWXUQLQJ   6WDUWV &*&KULV%XVK  2*.HOYLQ&KDLVVRQ   5%.HMXDQ-RQHV  2*'DYLQ-RVHSK   7(-DPHV0RVHV  5%$GULDQ3HWHUVRQ  )%-'5XQQHOV   :57UDYLV:LOVRQ  

6RSKRPRUHV 

/%/HZLV%DNHU:5*DUUHWW%RWKXQ'%7RQ\&DGH'/6WHYHQ&ROHPDQ '($ORQ]R'RWVRQ7(-RH-RQ)LQOH\3&RG\)UHHE\4%7RPP\*UDG\ 5%-DFRE*XWLHUUH].*DUUHWW+DUWOH\30LNH.QDOO2/$NLP0LOOLQJWRQ '%$OOHQ3DWULFN'/&DUO3HQGOHWRQ5%$GULDQ3HWHUVRQ/%'HPDUULR 3OHDVDQW:5'DYLG5RELQVRQ2/$DURQ5RWKHQEHUJ:57ULVWHQ5RVV &%0DUFXV:DONHU'%'DULHQ:LOOLDPV'(-RKQ:LOOLDPV5%'-:ROIH /%'DQH=DVODZ

2IIHQVLYH6WDUWHUV/RVW 

:50DUN%UDGOH\   27-DPPDO%URZQ  &9LQFH&DUWHU  :50DUN&OD\WRQ   :5%UDQGRQ-RQHV  :5:LOO3HRSOHV  27:HV6LPV   4%-DVRQ:KLWH 

'HIHQVLYH6WDUWHUV/RVW 

/%*D\URQ$OOHQ  '('DQ&RG\  '(-RQDWKDQ-DFNVRQ  /%/DQFH0LWFKHOO   66'RQWH1LFKROVRQ   &%$QWRQLR3HUNLQV  )6%URGQH\3RRO  6SHFLDOLVWV6WDUWHUV5HWXUQLQJ 

.*DUUHWW+DUWOH\  /6-DFRE5LFH 

#!2,0%.$,%4/.

/+,!(/-! ()34/29

6SHFLDOLVWV6WDUWHUV/RVW 

+0DUN%UDGOH\  .7UH\'L&DUOR  3%ODNH)HUJXVRQ   35$QWRQLR3HUNLQV 

2%6)%7 /00/.%.43

7UXH)UHVKPHQ 

2/%HQ%DUUHVL'7%LOO\%ODFNDUG2/%UDQQGRQ%UD[WRQ)%0DWW&ODSS '% .HHQDQ &OD\WRQ 2/ -RQ &RRSHU 7( $DURQ &XPPLQJV '( %URG\ (OGULGJH'($XVWRQ(QJOLVK'7'H0DUFXV*UDQJHU'%1LF+DUULV:5 (ULF +XJJLQV :5 -XDTXLQ ,JOHVLDV '% %ULDQ -DFNVRQ :5 0DQXHO -RKQVRQ :5 0DOFROP .HOO\ /% &XUWLV /RIWRQ '7 &RUGHUR 0RRUH /% 5\DQ 5H\QROGV 2/ *HRUJH 5RELQVRQ /% /DPRQW 5RELQVRQ '7 %ULDQ 6LPPRQV'%5HJJLH6PLWK2/-HVVH:KLWH

4(%3//.%23

5HGVKLUW)UHVKPHQ 

'/&RU\%HQQHWW4%/HH%ODQNHQVKLS4%5KHWW%RPDU6%UHWW%RZHUV :5 4XHQWLQ &KDQH\ :5 -XVWHQ &KLOFRDW '($ODQ 'DYLV :5 5XVVHOO (QJOLVK:5/HQG\+ROPHV4%+D\V0F(DFKUHQ/%5\DQ0F*UDWK/% .\OH3HWHUVHQ2/-'4XLQQ27&DPHURQ6FKDFKW

'HIHQVLYH6WDUWHUV5HWXUQLQJ 

/%5XIXV$OH[DQGHU  &%(ULF%DVVH\  '/'XVW\'YRUDFHN  /%&OLQW,QJUDP  &%&KLMLRNH2Q\HQHJHFKD   '7&DUO3HQGOHWRQ  &%0DUFXV:DONHU 

#/!#().'34!&&

-XQLRUV 

'(&-$K<RX/%5XIXV$OH[DQGHU'(/DUU\%LUGLQH'%-DVRQ&DUWHU '(-RUGDQ*UHHQH:5-HUPDLQH+DUGLVRQ2/%UDQGRQ.HLWK'(=DFK /DWLPHU2/&KULV0HVVQHU'(/DQHDU1L[RQ4%3DXO7KRPSVRQ

    3 %!3 /.

3OONERS"Y#LASS

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

3//.%23!4!',!.#% 2ETURNING3TATISTICAL,EADERS

'EOGRAPHICAL"REAKDOWN

5XVKLQJ$GULDQ3HWHUVRQ DWW\DUGV

3DVVLQJ7RPP\*UDG\ \DUGV7'

5HFHLYLQJ7UDYLV:LOVRQ UHF\DUGV7'

7RWDO2IIHQVH$GULDQ3HWHUVRQ SOD\V\DUGV

$OO3XUSRVH$GULDQ3HWHUVRQ \DUGV

3XQW5HWXUQV-HMXDQ5DQNLQV DWWHPSWV\SU

.LFNRII5HWXUQV 7UDYLV:LOVRQ DWWHPSWV\SU

)LHOG*RDOV *DUUHWW+DUWOH\ ;3

6FRULQJ $GULDQ3HWHUVRQ SRLQWV

7DFNOHV5XIXV$OH[DQGHU 

7)/ /DUU\%LUGLQH 

6DFNV/DUU\%LUGLQH 

,QWHUFHSWLRQV7ZRSOD\HUVZLWKRQH 3XQWLQJ$YJ 1RQH

&XUUHQW6RRQHUVE\KRPHVWDWH VWDWHV 

.ON 2ETURNING3TATISTICAL,EADERS 3DVVLQJ-DVRQ:KLWH 7'

5HFHLYLQJ0DUN&OD\WRQ \DUGV

3XQWLQJ %ODNH)HUJXVRQ 

)LHOG*RDOV 7UH\'L&DUOR 

3XQW5HWXUQV$QWRQLR3HUNLQV 

.LFNRII5HWXUQV 0DUN%UDGOH\ 

7DFNOHV%URGQH\3RRO 

7)/ 'DQ&RG\ 

6DFNV'DQ&RG\ 

,QWHUFHSWLRQV%URGQH\3RRO 

3IGNING#LASS 3OD\HU 3RV +W :W +RPHWRZQ &-$K<RX '(   +LJKODQG8WDK %HQ%DUUHVL2/   (GPRQG2NOD %LOO\%ODFNDUG '7  &ODUHPRUH2NOD %UDQQGRQ%UD[WRQ2/   <RXQJVWRZQ2KLR 0DWW&ODSS )%   3KRHQL[$UL] .HHQDQ&OD\WRQ6   6XOSKXU6SULQJV7H[DV -RQ&RRSHU2/  )RUW&ROOLQV&ROR $DURQ&XPPLQJV7(   0DUORZ2NOD %URG\(OGULGJH '(   /D&\JQH.DQ $XVWRQ(QJOLVK '(   &DQDGLDQ7H[DV 'H0DUFXV*UDQJHU '7  'DOODV7H[DV 1LF+DUULV '%   $OH[DQGULD/D (ULF+XJJLQV:5    &RQZD\6& -XDTXLQ,JOHVLDV:5    .LOOHHQ7H[DV %ULDQ-DFNVRQ6  'H6RWR7H[DV 0DQXHO-RKQVRQ:5   *LOPHU7H[DV %UDQGRQ.HLWK2/  0F$OHVWHU2NOD 0DOFROP.HOO\:5  /RQJYLHZ7H[DV 0LNH.QDOO3   &KDSDUUDO$UL] &XUWLV/RIWRQ/%  .LQJ¿VKHU2NOD &RUGHUR0RRUH '7   0HVTXLWH7H[DV $OOHQ3DWULFN '%   &RQZD\6& 5\DQ5H\QROGV/%   /DV9HJDV1HY *HRUJH5RELQVRQ2/   $WODQWD*D /DPRQW5RELQVRQ/%  6DOHP1- %ULDQ6LPPRQV '7  5DOHLJK1& 5HJJLH6PLWK '%   (GPRQG2NOD -HVVH:KLWH2/   'HQYHU&ROR

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

7H[DV 

5HPL $\RGHOH /HZLV %DNHU (ULF %DVVH\ &RU\ %HQQHWW 5KHWW %RPDU *DUUHWW %RWKXQ &KULV %XVK 7RQ\ &DGH .HOYLQ &KDLVVRQ .HHQDQ &OD\WRQ6WHYHQ&ROHPDQ$ODQ'DYLV$ORQ]R'RWVRQ'XVW\'YRUDFHN $XVWRQ(QJOLVK5XVVHOO(QJOLVK-RH-RQ)LQOH\&RG\)UHHE\'H0DUFXV *UDQJHU -RUGDQ *UHHQH -DFRE *XWLHUUH] 5- +DUULV *DUUHWW +DUWOH\ 'RQWD +LFNVRQ /HQG\ +ROPHV -XDTXLQ ,JOHVLDV &OLQW ,QJUDP %ULDQ -DFNVRQ0DQXHO-RKQVRQ0DOFROP.HOO\&RUGHUR0RRUH-DFRE/XQD +D\V0F(DFKHUQ-DPHV0RVHV$GULDQ3HWHUVRQ.\OH3HWHUVRQ'HPDU ULR3OHDVDQW-'4XLQQ%UHWW5D\O'DYLG5RELQVRQ&DPHURQ6FKDFKW &DOYLQ7KLERGHDX[3DXO7KRPSVRQ0DUFXV:DONHU%HQ:H\DQG'DULHQ :LOOLDPV-RKQ:LOOLDPV7UDYLV:LOVRQ 2NODKRPD 

-RKQ$OOHQ%HQ%DUUHVL/DUU\%LUGLQH%LOO\%ODFNDUG/HH%ODQNHQVKLS -DVRQ&DUWHU4XHQWLQ&KDQH\-XVWHQ&KLOFRDW$DURQ&XPPLQJV-RKQ 'DLOH\ 5XVVHOO 'HQQLVRQ 'DQ 'L[RQ (OOLRW (GZDUGV 0DUFXV +DJDQV -HUPDLQH+DUGLVRQ.HMXDQ-RQHV-RQDWKDQ-RUGDQ%UDQGRQ.HLWK&XU WLV/RIWRQ5\DQ0F*UDWK&KULV0HVVQHU&DUO3HQGOHWRQ-RZDKQ3RWHDW -DFRE 5LFH$DURQ 5RWKHQEHUJ -' 5XQQHOV 5HJJLH 6PLWK -HUPDLQH 6QHOO*DU\6WHSKHQVRQ'-:ROIH'DQH=DVODZ )ORULGD 

%UHWW%RZHUV'DYLQ-RVHSK/DHQDU1L[RQ:LOOLH5REHUWV &DOLIRUQLD 

&KULV&KHVWHU7RPP\*UDG\&KLMLRNH2Q\HQHJHFKD &RORUDGR 

-RQ&RRSHU=DFK/DWLPHU-HVVH:KLWH /RXLVLDQD 

5XIXV$OH[DQGHU1LF+DUULV7ULVWHQ5RVV 1RUWK&DUROLQD 

'DUUHO$\HUV-HMXDQ5DQNLQV%ULDQ6LPPRQV $UL]RQD 

0DWW&ODSS0LNH.QDOO .DQVDV 

%URG\(OGULGJH0LFKDHO5DWFOLII 6RXWK&DUROLQD 

(ULF+XJJLQV$OOHQ3DWULFN 6WDWHV  ZLWKRQHSOD\HUHDFK *HRUJLD*HRUJH5RELQVRQ ,OOLQRLV$NLP0LOOLQJWRQ 1HYDGD5\DQ5H\QROGV 1HZ-HUVH\/DPRQW5RELQVRQ 2KLR%UDQQGRQ%UD[WRQ 8WDK&-$K<RX 9LUJLQLD,DQ3OHDVDQW


#/!#(%3     3 %!3 /. #/!#().'34!&& 4(%3//.%23

25..%,3

2%6)%7 /00/.%.43

-'

/+,!(/-! ()34/29  .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

(%!$#/!#( "/"34//03

(EAD#OACH\3EVENTH3EASON\2ECORDAT/KLAHOMA 

4HE3TOOPS&ILE %LUWKGDWH 6HSWHPEHU +RPHWRZQ <RXQJVWRZQ2KLR +LJK6FKRRO &DUGLQDO0RRQH\ &ROOHJH ,RZD )DPLO\ ZLIH&DURO  GDXJKWHU0DFNHQ]LH  WZLQVRQV,VDDFDQG'UDNH

#OACHING(ISTORY 3UHVHQW2NODKRPD  +HDG&RDFK  )ORULGD $VVLVWDQW+HDG&RDFK'HIHQVLYH&RRUGLQDWRU .DQVDV6WDWH  &R'HIHQVLYH&RRUGLQDWRU .DQVDV6WDWH  'HIHQVLYH%DFNV  .HQW6WDWH  $VVLVWDQW&RDFK ,RZD  9ROXQWHHU&RDFK ,RZD  *UDGXDWH$VVLVWDQW&RDFK

+LVWRU\ LV RQH WRXJK FXVWRPHU DW 2NODKRPD 7KHWUDGLWLRQVRULFKDQGVRORQJVWDQGLQJLV DV GDXQWLQJ DV LW LV LPSUHVVLYH7R EH DPRQJ WKHEHVWDW2NODKRPDLVWREHDPRQJWKHEHVW LQFROOHJHIRRWEDOO  6XFK GUDPDWLFV DUH ORVW RQ %RE 6WRRSV 7KH 6RRQHU KHDG FRDFK EHIULHQGHG WKH ZRXOGEH DOEDWURVV RI 28¶V VXFFHVVIXO SDVW IURP KLV ¿UVW GD\ RQ FDPSXV DQG UHPDLQV VWHDGIDVWO\ IRFXVHGRQWRPRUURZDQGWKHFKDPSLRQVKLSLW KROGV  ,WIDOOVWKHQWRORQJWLPHREVHUYHUVDQGH[SHUWV RI WKH JDPH WR GH¿QH 6WRRSV¶ LPSDFW 5DUHO\ KDYHWKHSXQGLWVKDGLWVRHDV\  8QGHU6WRRSV2NODKRPDKDVZRQJDPHV VSHQW  FRQVHFXWLYH ZHHNV LQ WKH QDWLRQDO UDQNLQJV SOD\HG LQ VL[ ERZO JDPHV IRXU RI WKH %&6 YDULHW\ WDNHQ SDUW LQ WKUHH QDWLRQDO FKDPSLRQVKLS JDPHV DQG FDSWXUHG WKUHH %LJ FURZQV2QDSOD\LQJ¿HOGOHYHOHGE\VFKRO DUVKLSOLPLWVDQGSDULW\WKLVHUDVWDUHVGRZQWKH 2NODKRPDVWDQGDUGDQGGRHVQRWEOLQN  7KHDFKLHYHPHQWLVVREULOOLDQWWKDWLWGXOOVWKH PHPRU\ RI ZKDW 6WRRSV LQKHULWHG :KHQ KH DUULYHGLQ1RUPDQWKHSURXG6RRQHUSURJUDP ZDV¿YH\HDUVUHPRYHGIURPDZLQQLQJUHFRUG IRXU IURP D SRVWVHDVRQ DSSHDUDQFH 7KRVH DW\SLFDOGD\VRIDQJVWDUHVRIRUJRWWHQQRZWKDW WKH\PLJKWDVZHOOEHFDWHJRUL]HGZLWKWKH/DQG 5XVKDQG'XVW%RZO  6WRRSVKDVEHHQFKDUDFWHUL]HGDVDJURXQGHG IDPLO\PDQEULOOLDQWELJJDPHFRDFKUHOHQWOHVV UHFUXLWHU VWURQJ OHDGHU DQG D SHUVRQ ZLWK XQFRPPRQSHUVSHFWLYH+LVVXFFHVVHPDQDWHV IURPDGLVFLSOLQHGVW\OHWUXHWRKLVURRWVLQWKH 6WHHO9DOOH\RI2KLREXWKHLVIDUIURPLQÀH[LEOH 7KHSULQFLSOHVWRZKLFKKHKROGVDUHWKHWULHG DQG WUXH D[LRPV RI WKH VSRUW « PL[HG ZLWK FXWWLQJ HGJH VWUDWHJ\ DQG DQ DSSUHFLDWLRQ IRU WKHFDOFXODWHGULVN  'XULQJKLVWLPH28KDVSURGXFHGUHFRUG±VHW WLQJ SDVVHUV DQG UHFHLYHUV WZR \DUG UXVKHUVVXIIRFDWLQJGHIHQVHDQGVSHFLDOWHDPV XQLWVWKDWUDQNDPRQJWKHPRVWG\QDPLFLQWKH ODQG 7KH 6RRQHUV KDYH EHHQ QRWKLQJ LI QRW YHUVDWLOH 7KH VRQ RI D FRDFK 6WRRSV ZDV D IRXU\HDU VWDUWHUDW,RZD+HEHJDQKLVFRDFKLQJFDUHHU LQDVDYROXQWHHULQWKH+DZNH\HSURJUDP

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

XQGHU +D\GHQ )U\ ZRUNLQJ WKURXJK WKH UDQNV XQWLO KH EHFDPH FRGHIHQVLYH FRRUGLQDWRU DW .DQVDV6WDWH   :LWKWKH:LOGFDWVKHSOD\HGDNH\UROHLQWKHLU LPSUHVVLYH WXUQDURXQG 'XULQJ KLV ¿QDO IRXU VHDVRQV WKHUH .6WDWH ZDV  ZLWK WKUHH ERZODSSHDUDQFHV (YHQWXDOO\KHOHIWIRU)ORULGDDQGDWKUHH\HDU VWLQWDV6WHYH6SXUULHU¶VGHIHQVLYHFRRUGLQDWRU ,QKHZDVSDUWRIDQDWLRQDOFKDPSLRQVKLS WHDP,WZDVZLWKWKH*DWRUVWKDWWKHVSRWOLJKW IRXQG6WRRSVDQGPDGHKLPRQHRIWKHKRWWHVW QDPHVLQWKHSURIHVVLRQ+LVKLULQJDW2NODKRPD ZDVRQHIRUWKHDJHV

/5#OACHING!CCOMPLISHMENTS ‡6WRRSV LV  RYHUDOO  LQ ERZOV  LQ -DQXDU\ERZOVLQ%&6JDPHVYVWKH %LJYVWKH%LJ6RXWKYVWKH %LJ1RUWKLQWKH%LJWLWOHJDPH YVQRQFRQIHUHQFHRSSRQHQWVDWKRPH  RQ WKH URDG  RQ QHXWUDO ¿HOGV DQG YVUDQNHGRSSRQHQWV ‡28 KDV VHW RU WLHG PRUH WKDQ  VFKRRO UHFRUGVXQGHU6WRRSVQRWLQFOXGLQJERZOEHVWV DQGPDUNVVSHFL¿FWRDSDUWLFXODUSRVLWLRQ LH UHFHSWLRQV E\ D UXQQLQJ EDFN  $PRQJ WKRVH PDUNV XQGHU 6WRRSV DUH SDVVLQJ IRU D JDPH VHDVRQ DQG FDUHHU UHFHLYLQJ IRU D JDPH VHDVRQDQGFDUHHUDQGUXVKLQJIRUDVHDVRQ ‡6WRRSVKDVDXWKRUHGWZRRIWKHVHYHQORQJHVW ZLQQLQJVWUHDNVLQ2NODKRPDKLVWRU\+LV DQGWHDPVZRQVWUDLJKWZKLOHWKH DQGWHDPVUHHOHGRIILQDURZ7KRVH YLFWRULHVDOOFDPHDJDLQVW,$RSSRQHQWV ‡28 ZRQ WKH  QDWLRQDO FKDPSLRQVKLS SOD\HGIRUWZRPRUHDQGFDSWXUHGIRXU%LJ 6RXWKFURZQVDQGWKUHH%LJWLWOHV2NODKRPD KDVVSHQWZHHNVDW1R ‡$Q 28 SOD\HU KDV ¿QLVKHG DPRQJ WKH WRS VHYHQLQWKH+HLVPDQYRWLQJ¿YHWLPHV$GULDQ 3HWHUVRQ 1R  LQ   -DVRQ :KLWH 1R LQ -DVRQ:KLWH 1RLQ 5R\ :LOOLDPV 1RLQ DQG-RVK+HXSHO 1R LQ  ‡28 KDV KDG D GRXEOHGLJLW OHDG LQ  RI  JDPHV


(%!$#/!#( 2UDQJH2NODKRPD 6XJDU2NODKRPD 5RVH2NODKRPD &RWWRQ2NODKRPD 2UDQJH2NODKRPD ,QGHSHQGHQFH2NODKRPD 2UDQJH )ORULGD )ORULGD&LWUXV  )ORULGD 6XJDU )ORULGD +ROLGD\.DQVDV6WDWH $ORKD.DQVDV6WDWH &RSSHU.DQVDV6WDWH +ROLGD\,RZD +ROLGD\,RZD 5RVH,RZD )UHHGRP,RZD *DWRU,RZD

0REVIOUS#OACHING!CCOMPLISHMENTS ‡,Q  DQG  KLV )ORULGD GHIHQVH VFRUHG HLJKW WRXFKGRZQV 7KH *DWRUVZRQWKHQDWLRQDOFKDPSLRQVKLS ‡'XULQJKLV¿QDOIRXUVHDVRQVLQ0DQKDWWDQ.DQVDV6WDWHSRVWHGD UHFRUGDQGSOD\HGLQWKUHHERZOJDPHV

3HDFK,RZD 5RVH,RZD

!CCOMPLISHMENTSASA0LAYER ‡)RXU\HDUVWDUWHUDWGHIHQVLYHEDFN,RZD ‡+RQRUDEOH0HQWLRQ$OO$PHULFDQ ‡,RZDWHDP0RVW9DOXDEOH3OD\HU ‡7ZRWLPH$OO%LJ7HQVHOHFWLRQ ‡&DUHHUWRWDOVLQFOXGHGWDFNOHVDQGLQWHUFHSWLRQV

4(%3//.%23

‡+HDVVLVWHG.6WDWHWRLWV¿UVWZLQVHDVRQZLWKDGHIHQVHWKDWDOORZHG VHYHQRUIHZHUSRLQWVLQVL[JDPHVLQFOXGLQJWKUHHVKXWRXWV,QKLV XQLWOHGWKHQDWLRQLQWRWDOGHIHQVH \SJ ZLWKIRXUGHIHQVLYHEDFNV QDPHG$OO%LJ(LJKW

"OWL'AMESASA0LAYER

#/!#().'34!&&

‡8QGHU 6WRRSV 28 SURGXFHG $OO$PHULFDQV WZR$3 3OD\HUV RI WKH <HDU +HXSHO :KLWH  WZR 1DJXUVNL $ZDUG ZLQQHUV :LOOLDPV 'HUULFN 6WUDLW  WZR 7KRUSH$ZDUG ZLQQHUV :LOOLDPV 6WUDLW  WZR %XWNXV$ZDUG ZLQQHUV 5RFN\ &DOPXV 7HGG\ /HKPDQ  RQH %HGQDULN $ZDUG ZLQQHU /HKPDQ RQH/RPEDUGL$ZDUGZLQQHU 7RPPLH+DUULV RQH:DOWHU&DPS ZLQQHU -RVK+HXSHO WZR2¶%ULHQ$ZDUGZLQQHUV -DVRQ:KLWHWZLFH D 0D[ZHOO$ZDUGZLQQHU :KLWH D8QLWDV$ZDUGZLQQHU :KLWH DQ2XWODQG 7URSK\ZLQQHU -DPPDO%URZQ DQGRQH0RVL7DWXSX$ZDUGZLQQHU -7 7KDWFKHU 28KDVKDGD%XWNXV¿QDOLVWLQIRXURIWKHODVW¿YH\HDUVDQGD /RPEDUGL¿QDOLVWLQWKUHHRIWKHODVWIRXU7KH6RRQHUVDOVRKDG¿QDOLVWVIRU WKH%LOHWQLNRII*UR]D*X\+HQGULFNV0DFNH\DQG'RDN:DONHUDZDUGV

"OWL'AMESASA#OACH     3 %!3 /.

‡2NODKRPDKDVSOD\HGLQVL[ERZOJDPHV1HYHUKDGDQ28FRDFKWDNHQ HYHQKLV¿UVWWKUHHWHDPVWRERZOV3ULRUWR6WRRSV¶DUULYDO28KDGJRQH IRXUVWUDLJKW\HDUVZLWKRXWDERZODQGKDGQRWSOD\HGLQRQHRIZKDWLV QRZD%&6JDPHVLQFHWKH2UDQJH%RZO VHDVRQ 6WRRSVLQ KLVVHFRQGVHDVRQOHG28WRWKH2UDQJH%RZO VHDVRQ 

4(%34//03&!-),9

2%6)%7 /00/.%.43 /+,!(/-! ()34/29  .!4)/.!,#( !-0)/.3


0ROMINENT0UPILS ‡$GULDQ3HWHUVRQ 2NODKRPD &RQVHQVXV$OO$PHULFDQ ‡0DUN%UDGOH\ 2NODKRPD &KLFDJR%HDUV ‡-DPPDO%URZQ 2NODKRPD  1HZ2UOHDQV6DLQWV ‡0DUN&OD\WRQ 2NODKRPD %DOWLPRUH5DYHQV ‡'DQ&RG\ 2NODKRPD %DOWLPRUH5DYHQV ‡%UDQGRQ-RQHV 2NODKRPD  7HQQHVVHH7LWDQV ‡/DQFH0LWFKHOO 2NODKRPD $UL]RQD&DUGLQDOV ‡'RQWH1LFKROVRQ 2NODKRPD  7DPSD%D\%XFFDQHHUV ‡$QWRQLR3HUNLQV 2NODKRPD  &OHYHODQG%URZQV ‡%URGQH\3RRO 2NODKRPD  &OHYHODQG%URZQV ‡-DVRQ:KLWH 2NODKRPD  7HQQHVVHH7LWDQV ‡7RPPLH+DUULV 2NODKRPD &KLFDJR%HDUV ‡7HGG\/HKPDQ 2NODKRPD 'HWURLW/LRQV ‡'HUULFN6WUDLW 2NODKRPD  1HZ<RUN-HWV ‡4XHQWLQ*ULI¿Q 2NODKRPD  'HQYHU%URQFRV ‡7UHQW6PLWK 2NODKRPD %DOWLPRUH5DYHQV ‡-LPP\:LONHUVRQ 2NODKRPD .DQVDV&LW\&KLHIV ‡$QGUH:RROIRON 2NODKRPD  7HQQHVVHH7LWDQV ‡5RFN\&DOPXV 2NODKRPD  7HQQHVVHH7LWDQV ‡5R\:LOOLDPV 2NODKRPD  'DOODV&RZER\V ‡-HYRQ.HDUVH )ORULGD 3KLODGHOSKLD(DJOHV ‡-RKQQ\5XWOHGJH )ORULGD $UL]RQD&DUGLQDOV ‡0LNH3HWHUVRQ )ORULGD -DFNVRQYLOOH-DJXDUV ‡)UHG:HDU\ )ORULGD  1HZ2UOHDQV6DLQWV

"/"3 4//0 3

.!4)/.!, #(!-0)/.3( )03 #/.& %2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

(%!$#/!#(

3TOOPS#AREER#OACHING2ECORD <HDU

6FKRRO

7LWOH

5HFRUG

%RZO

2NODKRPD +HDG&RDFK  2UDQJH%RZOORVWWR86& 

2NODKRPD +HDG&RDFK  6XJDU%RZOORVWWR/68 

2NODKRPD +HDG&RDFK   5RVH%RZOGHI:DVKLQJWRQ6WDWH 

2NODKRPD +HDG&RDFK  &RWWRQ%RZOGHI$UNDQVDV 

2NODKRPD +HDG&RDFK   2UDQJH%RZOGHI)ORULGD6WDWH 

2NODKRPD +HDG&RDFK   ,QGHSHQGHQFH%RZOORVWWR2OH0LVV 

)ORULGD $VVW+HDG&RDFK'HI&RRU  2UDQJH%RZOGHI6\UDFXVH 

)ORULGD $VVW+HDG&RDFK'HI&RRU  )ORULGD&LWUXV%RZOGHI3HQQ6WDWH 

)ORULGD $VVW+HDG&RDFK'HI&RRU  6XJDU%RZOGHI)ORULGD6WDWH 

.DQVDV6WDWH &R'HIHQVLYH&RRUGLQDWRU   +ROLGD\%RZOGHI&RORUDGR6WDWH 

.DQVDV6WDWH &R'HIHQVLYH&RRUGLQDWRU   $ORKD%RZOORVWWR%RVWRQ&ROOHJH 

.DQVDV6WDWH &R'HIHQVLYH&RRUGLQDWRU    &RSSHU%RZOGHI:\RPLQJ 

.DQVDV6WDWH &R'HIHQVLYH&RRUGLQDWRU    1R%RZO*DPH .DQVDV6WDWH &R'HIHQVLYH&RRUGLQDWRU    1R%RZO*DPH .DQVDV6WDWH 'HIHQVLYH%DFNV&RDFK   1R%RZO*DPH .DQVDV6WDWH 'HIHQVLYH%DFNV&RDFK   1R%RZO*DPH .HQW6WDWH $VVLVWDQW&RDFK   1R%RZO*DPH ,RZD  9ROXQWHHU$VVLVWDQW  +ROLGD\%RZOGHI:\RPLQJ 

,RZD  9ROXQWHHU$VVLVWDQW  +ROLGD\%RZOGHI6DQ'LHJR6WDWH 

,RZD  9ROXQWHHU$VVLVWDQW   5RVH%RZOORVWWR8&/$ 

,RZD  *UDGXDWH$VVLVWDQW   )UHHGRP%RZOGHI7H[DV 

,RZD  *UDGXDWH$VVLVWDQW   *DWRU%RZOORVWWR)ORULGD 

7RWDOV $W28

\HDUVFRDFKLQJ 6L[\HDUV

 

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

     

%RZO&RDFKLQJ5HFRUG %RZO&RDFKLQJ5HFRUG


#/!#().'34!&& !SSOCIATE(EAD#OACH#O $EFENSIVE#OORDINATOR,INEBACKERS\3EVENTH3EASON

#OACHING!CCOMPLISHMENTS ‡&RRUGLQDWHGDXQLWWKDWOHGWKH%LJ&RQIHU HQFH LQ WRWDO GHIHQVH UXVKLQJ GHIHQVH DQG VFRULQJ GHIHQVH 7KH 6RRQHUV UDQNHG 1R  QDWLRQDOO\LQVFRULQJDQGUXVKLQJGHIHQVHDQG 1RLQWRWDOGHIHQVH

‡3URPRWHGWRDVVRFLDWHKHDGFRDFKIROORZLQJ VHDVRQ %LUWKGDWH  'HFHPEHU +RPHWRZQ 6DOLQD.DQ +LJK6FKRRO 6DOLQD6RXWK &ROOHJH  .DQVDV6WDWH )DPLO\ ZLIH-XOLH  VRQV-DNHDQG7\OHU

"OWL'AMESASA#OACH

‡,QWKH6RRQHUVUDQNHG1RQDWLRQDOO\ LQVFRULQJGHIHQVH1RLQWRWDOGHIHQVH1R LQSDVVHI¿FLHQF\GHIHQVH1RLQUXVKLQJ GHIHQVHDQG1RLQSDVVLQJGHIHQVH

!CCOMPLISHMENTSASA0LAYER ‡+RQRUDEOH0HQWLRQ$OO%LJ(LJKWLQDIWHU UHFRUGLQJWDFNOHV VHFRQGRQWHDP LQFOXG LQJDWHDPOHDGLQJXQDVVLVWHGWDFNOHV

‡,Q2NODKRPDUDQNHG1RQDWLRQDOO\LQ WXUQRYHUVJDLQHGDQGKDGWDNHDZD\VIRUD VHFRQGVWUDLJKWVHDVRQ

‡6WDQGRXW/%DW*DUGHQ&LW\ .DQ &RPPXQLW\ &ROOHJH ZKHUH KH ZDV DQ $OO$PHULFDQ DIWHU UHFRUGLQJWDFNOHV

‡2NODKRPD¶VOLQHEDFNLQJFRUSVLQFOXGHG 5RFN\&DOPXV ¿UVWWHDP$OO$PHULFDQDQG%LJ 'HIHQVLYH3OD\HURIWKH<HDU DQG7RUUDQFH 0DUVKDOO ¿UVWWHDP$OO%LJ 

‡.DQVDV&ODVV$'HIHQVLYH3OD\HURIWKH<HDU E\.DQVDV6SRUWV0DJD]LQH

/+,!(/-! ()34/29

2UDQJH 2NODKRPD 6XJDU 2NODKRPD  5RVH 2NODKRPD  &RWWRQ 2NODKRPD  2UDQJH  2NODKRPD  ,QGHSHQGHQFH 2NODKRPD  $ODPR  .DQVDV6WDWH  )LHVWD .DQVDV6WDWH  &RWWRQ .DQVDV6WDWH  +ROLGD\  .DQVDV6WDWH  $ORKD .DQVDV6WDWH  &RSSHU .DQVDV6WDWH

‡&RDFKHG WKH %LJ  'HIHQVLYH 1HZFRPHU RIWKH<HDULQ /DQFH0LWFKHOO DQG 7RUUDQFH0DUVKDOO 

2%6)%7 /00/.%.43

 2NODKRPD  $VVRFLDWH+HDG&RDFK&R'HIHQVLYH  &RRUGLQDWRU/LQHEDFNHUV SUHVHQW 2NODKRPD  &R'HIHQVLYH&RRUGLQDWRU/LQHEDFNHUV  .DQVDV6WDWH  'HIHQVLYH5XQ*DPH&RRUGLQDWRU  .DQVDV6WDWH  /LQHEDFNHUV  .DQVDV6WDWH  *UDGXDWH$VVLVWDQW

‡,Q28UDQNHG1RQDWLRQDOO\LQVFRULQJ GHIHQVH1RLQSDVVHI¿FLHQF\GHIHQVH1R LQSDVVLQJGHIHQVH1RLQWXUQRYHUPDUJLQ 1RLQWRWDOGHIHQVHDQG1RLQUXVKLQJ GHIHQVH

‡/DQFH0LWFKHOO 2NODKRPD &DUGLQDOV  $OO%LJ%XWNXV$ZDUG¿QDOLVW   %LJ'HIHQVLYH12< ‡7HGG\/HKPDQ 2NODKRPD /LRQV  %XWNXV$ZDUGZLQQHU%HGQDULN   $ZDUGZLQQHU¿UVWWHDP$OO$PHULFDQ ‡5RFN\&DOPXV 2NODKRPD 7LWDQV  %XWNXV$ZDUGZLQQHU  ¿UVWWHDP$OO$PHULFDQ ‡7RUUDQFH0DUVKDOO 2NODKRPD 3DFNHUV  )LUVWWHDP$OO$PHULFDQ  %LJ'HIHQVLYH12< ‡-HII.HOO\ .DQVDV6WDWH )DOFRQV ‡0DUN6LPRQHDX .DQVDV6WDWH )DOFRQV ‡3HUFHOO*DVNLQV .DQVDV6WDWH 3DQWKHUV

4(%3//.%23

#OACHING(ISTORY

‡ 7KH  6RRQHUV UDQNHG 1R  LQ WRWDO GHIHQVH DQG SDVVLQJ GHIHQVH 1R  LQ SDVV HI¿FLHQF\ GHIHQVH 1R  LQ VFRULQJ GHIHQVH 1RLQWXUQRYHUPDUJLQDQG1RLQUXVKLQJ GHIHQVH

0ROMINENT0UPILS

4( %6% .!",%3 &!-) ,9

4HE6ENABLES&ILE

‡$OO WKUHH PHPEHUV RI KLV  .6WDWH OLQH EDFNLQJ FRUSV HDUQHG DOOFRQIHUHQFH KRQRUV LQFOXGLQJ .HOO\ ¿UVW WHDP  0DUN 6LPRQHDX ¿UVWWHDP DQG7UDYLV2FKV VHFRQGWHDP 

#/!#().'34!&&

‡+HOGRILWVRSSRQHQWVLQEHORZWKHLU VHDVRQVFRULQJDQGWRWDORIIHQVHDYHUDJH

‡ &RDFKHG WZRWLPH$OO%LJ  DQG  ¿UVW WHDP$OO$PHULFDQ -HII .HOO\ ZKLOH DW .DQVDV 6WDWH .HOO\ DOVR ZDV D ¿QDOLVW IRU WKH %URQNR 1DJXUVNL$ZDUG

    3 %!3 /.

"2%.46%.!",%3

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

#/!#().'34!&& "/""9*!#+72)'(4

!SSISTANT(EAD#OACH#O $EFENSIVE#OORDINATOR3ECONDARY\3EVENTH3EASON

#OACHING!CCOMPLISHMENTS ‡:ULJKW¶VURWDWLRQRI'DQ&RG\-RQDWKDQ -DFNVRQDQG/DUU\%LUGLQHUDQNHG1RDQG UHVSHFWLYHO\LQVDFNVDPRQJ%LJSOD\HUV ‡$OVR WKH VSHFLDO WHDPV FRRUGLQDWRU :ULJKW VDZ 28 UDQN 1R  LQ WKH %LJ  LQ NLFNRII FRYHUDJH \SU ZKLOHJLYLQJRSSRQHQWVDQ DYHUDJHRIMXVW\DUGVRQDWWHPSWV ‡'('DQ&RG\ZDVDFRQVHQVXV$OO%LJVH OHFWLRQDQGD¿QDOLVWIRUWKH+HQGULFNV$ZDUG

4HE7RIGHT&ILE %LUWKGDWH 'HFHPEHU +RPHWRZQ0LVVLRQ7H[DV +LJK6FKRRO 0LVVLRQ &ROOHJH 6RXWKZHVW7H[DV6WDWH  7H[DV$ , )DPLO\ ZLIH%HH  GDXJKWHUV0F.HQQD0HOLDDQG0LFDHODQ

#OACHING(ISTORY SUHVHQW2NODKRPD  $VVLVWDQW+HDG&RDFK&R'HIHQVLYH&RRU  6HFRQGDU\ 2NODKRPD  5HFUXLWLQJ&RRUGLQDWRU'HIHQVLYH(QGV 7H[DV  $VVLVWDQW&RDFK 1RUWK7H[DV6WDWH  $VVLVWDQW&RDFK  7H[DV$ ,  $VVLVWDQW&RDFK  &RDFK  7H[DV+LJK6FKRROUDQNV

"OWL'AMESASA#OACH

‡7XWRUHGDVHWRIHQGVLQWKDWSLOHGXS WDFNOHVIRUORVVVDFNVDQGKXUULHV ‡28¶VGHIHQVLYHHQGVDFFRXQWHGIRUQHDUO\KDOI RIWKHWHDP¶VVDFNV ‡-LPP\:LONHUVRQHDUQHG$OO%LJKRQRUVIRU WKHVHFRQGVWUDLJKW\HDULQ ‡28KDVWDNHQXSDOPRVWSHUPDQHQWUHVLGHQFH DPRQJWKHQDWLRQ¶VWRSUHFUXLWLQJFODVVHV ‡28¶VHQGVFRPELQHGIRUWDFNOHVIRUORVVLQ  LQFOXGLQJ  E\ -LPP\ :LONHUVRQ %RWK :LONHUVRQDQG&RU\+HLQHFNHZHUH$OO%LJ ‡8QGHU:ULJKW¶VJXLGDQFH$OO%LJUHFHLYHU 0LNH$GDPVEURNHHYHU\87UHFRUGLQ ‡,Q  KLV VHFRQGDU\ UDQNHG 1R  LQ WKH QDWLRQLQSDVVHI¿FLHQF\GHIHQVH ‡ 'HYHORSHG IUHVKPDQ 7H[DV SODFHNLFNHU 3KLO 'DZVRQD¿UVWWHDP$OO6:&KRQRUHHLQWRWKH WRSUDQNHGNLFNHULQWKHQDWLRQ'DZVRQZDVD VHPL¿QDOLVWIRUWKH/RX*UR]D1DWLRQDO$ZDUG

2UDQJH2NODKRPD 6XJDU2NODKRPD  5RVH2NODKRPD  &RWWRQ2NODKRPD  2UDQJH 2NODKRPD  ,QGHSHQGHQFH2NODKRPD  )LHVWD7H[DV  6XJDU7H[DV  6XQ7H[DV  &RWWRQ7H[DV  %OXHERQQHW 7H[DV

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

‡+LV  UHFHLYLQJ XQLW ZDV WKH EHVW LQ WKH 6:& ZKHQ LW DYHUDJHG  \DUGV SHU FDWFK  FDWFKHV IRU  \DUGV DQG  WRXFK GRZQV ,WIHDWXUHG¿UVWWHDP$OO6:&SHUIRUPHU 0LNH$GDPVWKH6:&¶VOHDGLQJUHFHLYHU ‡+HOSHGOHDG1RUWK7H[DVWRDFRQIHUHQFH FURZQDQGWKH,$$SOD\RIIV ‡:DVRQWKHFRDFKLQJVWDIIWKDWOHG7H[DV$ , WRWKH'LYLVLRQ,,QDWLRQDOWLWOH

0ROMINENT0UPILS ‡'DQ&RG\ 2NODKRPD 5DYHQV  )LQDOLVWIRUWKH+HQGULFNV$ZDUGDQG  FRQVHQVXV$OO%LJVHOHFWLRQ 

‡-RQDWKDQ-DFNVRQ 2NODKRPD %HDUV  $OO%LJ ‡-LPP\:LONHUVRQ 2NODKRPD &KLHIV  +RQRUDEOHPHQWLRQ$OO%LJ ‡&RU\+HLQHFNH 2NODKRPD

 7ZRWLPHKRQRUDEOHPHQWLRQ$OO%LJ ‡&RUH\&DOOHQV 2NODKRPD

 +RQRUDEOHPHQWLRQ$OO%LJ ‡3ULHVW+ROPHV 7H[DV &KLHIV ‡0LNH$GDPV 7H[DV 6WHHOHUV ‡/DQFH'XQQ 7H[DV %HQJDOV  $OO$PHULFDQ ‡6WDQOH\5LFKDUGV 7H[DV &KDUJHUV  $OO$PHULFDQ ‡:LQIUHG7XEEV 7H[DV HUV  $OO$PHULFDQ ‡:DQH0F*DULW\ 7H[DV &RZER\V ‡%ULWW+DJHU 7H[DV %URQFRV  $OO$PHULFDQ ‡(ULF0HWFDOI 7H[DV )DOFRQV ‡'DUUHOO*UHHQ 7H[DV$ , 1)/$OO3UR

4(%72)'(4&!-),9


#/!#().'34!&& /FFENSIVE#OORDINATOR1UARTERBACKS\3IXTH3EASON

0ROMINENT0UPILS

‡¿QDOLVWIRUWKH%UR\OHV$ZDUGSUHVHQWHG DQQXDOO\WRWKHQDWLRQ¶VWRSDVVLVWDQWFRDFK

‡-DVRQ:KLWH 2NODKRPD 7LWDQV  +HLVPDQ7URSK\0D[ZHOO  2¶%ULHQDQG8QLWDV$ZDUGZLQQHU  7ZRWLPH%LJ2IIHQVLYH3OD\HURIWKH  <HDU&RQVHQVXV$OO$PHULFDQ$332< ‡1DWH+\EO 2NODKRPD -DJXDUV  5RVH%RZO093 ‡-RVK+HXSHO 2NODKRPD   $3%LJ2IIHQVLYHDQG:DOWHU&DPS  32<+HLVPDQ7URSK\UXQQHUXS ‡7RP.QLJKW ,RZD %XFFDQHHUV ‡'DPLHQ5RELQVRQ ,RZD 6HDKDZNV ‡0DWW%RZHQ ,RZD 5HGVNLQV

‡ &RRUGLQDWHG D XQLW WKDW OHG WKH %LJ  LQ SDVVLQJ HI¿LFLHQF\ 7KH 6RRQHUV UDQNHG 1R QDWLRQDOO\LQSDVVLQJHI¿FLHQF\DQG1RLQ WRWDORIIHQVH ‡ &RDFKHG WKH ¿UVW SOD\HU WDQGHP LQ 1&$$ KLVWRU\WRSRVWWRXFKGRZQSDVVHVDQG \DUGVUXVKLQJ

4HE,ONG&ILE

#OACHING(ISTORY

"OWL'AMESASA#OACH

‡7KH  6RRQHUV VHW D UHFRUG IRU PRVW SRLQWVLQVFKRROKLVWRU\28ZDV1RQDWLRQ DOO\ LQ VFRULQJ RIIHQVH DQG 1R  LQ SDVVLQJ HI¿FLHQF\ ‡7KH  6RRQHUV VHW LQGLYLGXDO UHFRUGV IRU 7'SDVVHVLQDVHDVRQ7'UHFHSWLRQVUHFHS WLRQVDQGUHFHLYLQJ\DUGV ‡28DYHUDJHG\DUGVSHUJDPHDQGDUH FRUGSRLQWVLQFRQIHUHQFHJDPHVLQ ‡7KH  RIIHQVH SURGXFHG WKH ¿UVW  \DUGUXVKHU4XHQWLQ*ULI¿QLQ%RE6WRRSV¶HUD *ULI¿QZDVWKHQDWLRQ¶V1RUXVKHU4%1DWH +\EO¿UHG7'VZLWKMXVWLQWHUFHSWLRQV ‡2NODKRPD¶VFRPSOHWLRQSHUFHQWDJH  OHG WKHQDWLRQLQ

!CCOMPLISHMENTSASA0LAYER ‡,QGXFWHGLQWRWKH&ROOHJH)RRWEDOO+DOORI  )DPHLQ ‡7DOOLHGFDUHHUSDVVLQJ\DUGVWREHFRPH ,RZD¶VDOOWLPHOHDGHUDQGWKH¿UVWSOD\HULQWKH %LJWRVXUSDVV\DUGV ‡6HW %LJ 7HQ UHFRUG ZLWK  7' SDVVHV DQG FRPSOHWLRQSHUFHQWDJH ‡*XLGHGWKH+DZNH\HVWRWKH%LJ7HQWLWOH DQGWKH5RVH%RZO ‡:RQ WKH  0D[ZHOO 7URSK\ DZDUGHG WR WKHQDWLRQ¶VWRSSOD\HUDQGWKH'DYH\2¶%ULHQ $ZDUGIRUWKHQDWLRQ¶VWRS4%&RQVHQVXV$OO $PHULFDQWKUHHWLPH$OO%LJ7HQ ‡5XQQHUXSIRUWKH+HLVPDQ7URSK\%R -DFNVRQZRQLQWKHFORVHVWYRWHLQKLVWRU\ ‡(LJKW1)/VHDVRQVZLWKWKH5DPVDQG/LRQV

4(%,/.'&!-),9 /+,!(/-! ()34/29

2UDQJH 2NODKRPD 6XJDU 2NODKRPD  5RVH 2NODKRPD  &RWWRQ 2NODKRPD  2UDQJH  2NODKRPD  ,QGHSHQGHQFH 2NODKRPD  6XQ ,RZD  $ODPR  ,RZD  6XQ ,RZD

‡28KDVKDGJDPHVZLWKQRWXUQRYHUVLQKLV WKUHHVHDVRQVDVFRRUGLQDWRU

2%6)%7 /00/.%.43

SUHVHQW 2NODKRPD  2IIHQVLYH&RRUGLQDWRU4XDUWHUEDFNV  2NODKRPD  3DVV*DPH&RRUGLQDWRU4XDUWHUEDFNV  ,RZD  4XDUWHUEDFNV  ,RZD  6HFRQGDU\

‡ +HOSHG $GULDQ 3HWHUVRQ DQG -DVRQ :KLWH ¿QLVK1RDQGLQWKH+HLVPDQEDOORWLQJ

4(%3//.%23

%LUWKGDWH  )HEUXDU\ +RPHWRZQ:KHDWRQ,OO +LJK6FKRRO1RUWK :KHDWRQ,OO  &ROOHJH  ,RZD )DPLO\ZLIH/LVD  GDXJKWHUV/LQGVD\6DPDQWKD .DWKHULQH  0DGLVRQVRQV1DWKDQ =DFKDU\

#/!#().'34!&&

#OACHING!CCOMPLISHMENTS

    3 %!3 /.

#(5#+,/.'

"OWL'AMESASA0LAYER  5RVH ,RZD  )UHHGRP ,RZD  *DWRU ,RZD  3HDFK  ,RZD  5RVH ,RZD

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

#/!#().'34!&& #!,%'5.$9

!SSISTANT#OACH2ECRUITING#OORDINATOR2UNNING"ACKS\3EVENTH3EASON

#OACHING!CCOMPLISHMENTS ‡&RDFKHGKLVVHFRQG\DUGUXVKHULQWKH ODVW WKUHH \HDUV LQ$GULDQ 3HWHUVRQ 3HWHUVRQ VHW D VFKRRO VHDVRQ UHFRUG DQG 1&$$ IUHVK PDQUXVKLQJUHFRUGZLWK\DUGV ‡$OVRKDVWXWRUHG.HMXDQ-RQHVZKRKDVPRUH WKDQ\DUGVGXULQJKLVFDUHHU

%LUWKGDWH $SULO +RPHWRZQ 0LGZHVW&LW\2NOD +LJK6FKRRO0LGZHVW&LW\ &ROOHJH  2NODKRPD )DPLO\ ZLIH.ULVWL  VRQ.HQQHG\&DOH  GDXJKWHU&DLWOLQ5DH

#OACHING(ISTORY SUHVHQW 2NODKRPD  5HFUXLWLQJ&RRUGLQDWRU5XQQLQJ%DFNV  8$%  5XQQLQJ%DFNV  8$%  4XDUWHUEDFNV  2NODKRPD  6WXGHQW$VVLVWDQW&RDFK

"OWL'AMESASA#OACH 2UDQJH 2NODKRPD 6XJDU 2NODKRPD 5RVH 2NODKRPD &RWWRQ 2NODKRPD 2UDQJH 2NODKRPD ,QGHSHQGHQFH 2NODKRPD &RSSHU 2NODKRPD

0ROMINENT0UPILS

‡&RDFKHG28EDFNVWR\DUGVDQG \DUGVSHUFDUU\7KH6RRQHUEDFN¿HOGDOVR KDXOHGLQSDVVHVIRUWKUHHWRXFKGRZQV

‡$GULDQ3HWHUVRQ 2NODKRPD   &RQVHQVXV$OO$PHULFDQ  KLJKHVW¿QLVKLQJIUHVKPDQ VHFRQG LQ  WKHKLVWRU\RIWKH+HLVPDQWURSK\ ‡4XHQWLQ*ULI¿Q 2NODKRPD %URQFRV  )LUVWWHDP$OO%LJ  6HFRQGWHDP$OO$PHULFDQ

‡ ,Q  2NODKRPD¶V UXQQLQJ EDFNV ZHUH FKDUJHGZLWKMXVWWZRIXPEOHVORVW

!CCOMPLISHMENTSASA0LAYER

‡$GHSWDWVHFXULQJWKHEDOO*XQG\¶VEDFNV ORJJHGUHFHSWLRQVIRU\DUGVDQGUDUHO\ ORVWDIXPEOH 28ORVWRQO\QLQHDVDWHDP 

4HE'UNDY&ILE

‡,Q  28 EDFNV SURGXFHG  UXVKLQJ WRXFKGRZQVXSIURPLQ)LUVWWHDP$OO %LJ4XHQWLQ*ULI¿QVFRUHGWRXFKGRZQV VHFRQGPRVWLQWKHFRQIHUHQFH+LVVL[WRXFK GRZQVDJDLQVW7H[DVRQ2FWZDVD6RRQHU VLQJOHJDPHUHFRUG

‡&RDFKHG 4XHQWLQ *ULI¿Q ZKR ¿QLVKHG KLV FDUHHUDVWKH1RUXVKHULQ6RRQHUKLVWRU\,Q KHJDLQHG\DUGVDQGUDQNHG1R LQWKHQDWLRQZLWK\DUGVSHUJDPH ‡*ULI¿QDFRQFHQVXV$OO%LJ¿UVWWHDPVHOHF WLRQEHFDPHWKH¿UVW6RRQHUWRVXUSDVV \DUGVVLQFHDQGDOVR¿QLVKHGKLVFDUHHU DVWKHVFKRRO¶VVHFRQGOHDGLQJUHFHLYHU

‡+HOGYLUWXDOO\DOORIWKH6RRQHUV¶VLQJOHJDPH VLQJOHVHDVRQDQGFDUHHUSDVVLQJUHFRUGVXQWLO WKH\ ZHUH UHZULWWHQ E\ -RVK +HXSHO   DQG-DVRQ:KLWH   ‡ 3DFHGWKH6RRQHUVWRDUHFRUGLQKLV IRXUVHDVRQV ‡2QHRIRQO\WKUHH28TXDUWHUEDFNVWRWKURZ IRUPRUHWKDQ\DUGV +HXSHO:KLWH 

‡1R28EDFNORVWDIXPEOHGXULQJLQ

‡$OOFRQIHUHQFHDVDVHQLRU

‡2NODKRPDEDFNVIXPEOHGMXVWWZLFHGXULQJWKH VHDVRQDOOLQWKH¿UVWWKUHHJDPHVRIWKH VHDVRQ ‡4XHQWLQ *ULI¿Q FDXJKW RQH SDVV LQ D VFKRRO UHFRUGFRQVHFXWLYHJDPHV

‡%LJ (LJKW 2IIHQVLYH 1HZFRPHU RI WKH <HDU DIWHU VHWWLQJ SDVVLQJ PDUNV IRU FRPSOHWLRQV  DWWHPSWV  DQG\DUGV  

"OWL'AMESASA0LAYER -RKQ+DQFRFN 2NODKRPD *DWRU 2NODKRPD

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

4(%'5.$9&!-),9


#/!#().'34!&& !SSISTANT#OACH$EFENSIVE,INE\3EVENTH3EASON

"OWL'AMESASA0LAYER )LHVWD 2NODKRPD 6XQ%RZO  2NODKRPD 2UDQJH 2NODKRPD

#OACHING!CCOMPLISHMENTS

%LUWKGDWH 0DUFK +RPHWRZQ 6WLOOZDWHU2NOD +LJK6FKRRO 'RQDUW &ROOHJH  2NODKRPD  /DQJVWRQ )DPLO\VRQ&KULVWRSKHUGDXJKWHU.DLWOLQ

2UDQJH 2NODKRPD 6XJDU 2NODKRPD 5RVH 2NODKRPD &RWWRQ 2NODKRPD 2UDQJH 2NODKRPD ,QGHSHQGHQFH 2NODKRPD 0XVLF&LW\$ODEDPD

‡7ZRRIKLVSOD\HUV7RPPLH+DUULVDQG.RU\ .OHLQHDUQHG$OO%LJKRQRUVLQ ‡ ,Q  KH KDG IRXU GHIHQVLYH OLQHPHQ VHOHFWHGWR$OO%LJWHDPVLQFOXGLQJ¿UVWWHDP VHOHFWLRQ5\DQ)LVKHU

!CCOMPLISHMENTSASA0LAYER ‡$¿UVWURXQGSLFN WKRYHUDOO RIWKH0LDPL 'ROSKLQV ZKHUH KH SOD\HG ¿YH VHDVRQV +H KHOSHGWKH'ROSKLQVSRVWDUHFRUGPDNH WZR SOD\RII DSSHDUDQFHV DQG DGYDQFH WR WKH  6XSHU %RZO 6KLSS ZDV WKH 'ROSKLQV¶ OHDGLQJ WDFNOHU   LQ  DQG ¿QLVKHG KLV FDUHHULQ0LDPLZLWKWDFNOHV ‡ 3OD\HG RQH VHDVRQ ZLWK WKH /RV $QJHOHV 5DLGHUV   ‡ $ VWDQGRXW OLQHEDFNHU DW WKH 8QLYHUVLW\ RI 2NODKRPD KH VWDUUHG RQ 6RRQHU VTXDGV WKDW SRVWHG D FRPELQHG  UHFRUG ZRQ WZR ERZOJDPHVDQGFDSWXUHGWKH%LJ(LJKW &KDPSLRQVKLS

/+,!(/-! ()34/29

"OWL'AMESASA#OACH

‡28¶VLQWHULRUOLQHPHQKDGWDFNOHVIRUORVV DQGVDFNVLQ

‡'XVW\'YRUDFHN 2NODKRPD

 $OO%LJ¿UVWWHDP ‡7RPPLH+DUULV 2NODKRPD

 /RPEDUGZLQQHU%HGQDULN  DQG1DJXUVNL¿QDOLVW/RPEDUGLDQG  1DJXUVNL¿QDOLVW¿UVWWHDP$OO%LJ  DQG ‡.RU\.OHLQ 2NODKRPD

 VHFRQGWHDP)UHVKPDQ$OO  $PHULFDQVHFRQGWHDP$OO%LJ ‡5\DQ)LVKHU 2NODKRPD

 $OO%LJ

2%6)%7 /00/.%.43

SUHVHQW 2NODKRPD  'HIHQVLYH/LQH $ODEDPD  'HIHQVLYH/LQH 1RUWKHDVW/RXLVLDQD  'HIHQVLYH/LQH 0LQQHVRWD9LNLQJV  &RDFKLQJ,QWHUQ *UHHQ%D\3DFNHUV  &RDFKLQJ,QWHUQ  6RXWKHUQ,OOLQRLV  'HIHQVLYH/LQH  7HQQHVVHH0DUWLQ  'HIHQVLYH/LQH  &HQWUDO0LVVRXUL6WDWH  'HIHQVLYH/LQH  /DQJVWRQ  /LQHEDFNHUV

‡ $OVR FRDFKHG $OO%LJ  SHUIRUPHU 'XVW\ 'YRUDFHNLQ

0ROMINENT0UPILS

4(%3//.%23

#OACHING(ISTORY

‡,QKHFRDFKHG7RPPLH+DUULVWKHZLQQHU RIWKH5RWDU\/RPEDUGL$ZDUGDQGDFRQVHQVXV $OO$PHULFDQ+DUULVDOVRZDVD¿QDOLVWIRUWKH 1DJXUVNLDQG%HGQDULN$ZDUGV

‡7RWDOHGWRWDOWDFNOHVLQKLVFDUHHUZKLFK VWDQGVVHFRQGRQWKH28OLVWIRUFDUHHUWDFNOHV $OVRRZQVWKHVLQJOHVHDVRQUHFRUGIRUWDFNOHV  GXULQJKLVVRSKRPRUHFDPSDLJQLQ

#/!#().'34!&&

4HE3HIPP&ILE

‡ 'HVSLWH ORVLQJ D SDLU RI $OO$PHULFDQV DQG IHDWXULQJ RQH WUDQVIHU DQG WZR IUHVKPHQ LQ WKH URWDWLRQ KH FUDIWHG D GHIHQVLYH LQWHULRU WKDW VKRZHG SHUKDSV PRUH LPSURYHPHQW WKDQ DQ\DUHDRQWKHWHDPGXULQJWKHFRXUVHRIWKH VHDVRQ

‡ ,Q WKH  ERUGHU FODVK ZLWK 7H[DV 6KLSS ZDVDRQHPDQZUHFNLQJFUHZZLWKWDFNOHV MXVW WKUHH VK\ RI WKH 28 VLQJOHJDPH WRWDO UHFRUG

    3 %!3 /.

*!#+)%3()00

‡(DUQHGDOOFRQIHUHQFHKRQRUVDVDMXQLRUDQG VHQLRUDQGZDVVHOHFWHGDVDQ$OO$PHULFDQE\ )RRWEDOO1HZVIROORZLQJKLVMXQLRUFDPSDLJQ

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

#/!#().'34!&& +%6).35-,).

!SSISTANT#OACH3PECIAL4EAMS#OORDINATOR4IGHT%NDS\4HIRD3EASON

4HE3UMLIN&ILE %LUWKGDWH $XJXVW +RPHWRZQ,QGLDQDSROLV,QG +LJK6FKRRO %UHEHXI3UHS ,QG

&ROOHJH  3XUGXH )DPLO\ZLIH&KDUOHQH  GDXJKWHUV&RXUWQH\DQG6KHOE\  VRQV-DFNVRQDQG-5

#OACHING(ISTORY SUHVHQW 2NODKRPD  6SHFLDO7HDPV&RRUGLQDWRU7LJKW(QGV  7H[DV$ 0  $VVW+HDG&RDFK2II&RRU5HFHLYHUV  3XUGXH  5HFHLYHUV  0LQQHVRWD  4XDUWHUEDFNV  0LQQHVRWD  5HFHLYHUV :\RPLQJ  5HFHLYHUV :DVKLQJWRQ6WDWH  *UDGXDWH$VVLVWDQW

#OACHING!CCOMPLISHMENTS

0ROMINENT0UPILS

‡28¶VWLJKWHQGVEHFDPHDPRUHLQWHJUDOSDUW RI WKH 6RRQHU RIIHQVLYH VFKHPH LQ 6XPOLQ¶V VHFRQGVHDVRQ  7KHJURXSZHQWIURP UHFHSWLRQVIRU\DUGVDQGWZRWRXFKGRZQVLQ JDPHVRIWKHVHDVRQWRFDWFKHVIRU \DUGVDQGIRXUWRXFKGRZQVLQJDPHV

‡&KULV'DQLHOV 3XUGXH %XFFDQHHUV ‡,NH-RQHV 3XUGXH &ROWV ‡&RU\6DXWHU 0LQQHVRWD &ROWV ‡9LQQLH6XWKHUODQG 3XUGXH HUV ‡5\DQ7KHOZHOO 0LQQHVRWD %URQFRV

‡&RDFKHGWLJKWHQGVWRUHFHSWLRQVDQG VDZ /DQFH 'RQOH\ PDNH WKH ¿UVW WRXFKGRZQ JUDEV  RIKLVFDUHHU

!CCOMPLISHMENTSASA0LAYER

‡ %HFDPH 7H[DV $ 0¶V RIIHQVLYH FRRUGLQDWRU DIWHUWKHWKLUGJDPHRIWKHVHDVRQ3ULRUWR WKHVZLWFKWKH$JJLHVKDGVFRUHGMXVWSRLQWV LQWKUHHJDPHV SHU EXWDIWHUZDUGV$ 0 SXWSRLQWVRQWKHERDUGRUSHUFRQWHVW 7KHRIIHQVHDYHUDJHG\DUGVSHUJDPHDIWHU MXVWQHWWLQJLQWKH¿UVWWKUHHFRQWHVWV ‡7KH3XUGXHUHFHLYHUVVHWVFKRROUHFRUGV ZLWK  UHFHSWLRQV IRU  \DUGV DQG  WRXFKGRZQV

‡)RXU\HDUOHWWHUPDQIRU3XUGXHDVDOLQHEDFNHU IURPDQGHQGHGKLVFDUHHUDPRQJWKH WRSLQWDFNOHVIRUWKH%RLOHUPDNHUV ‡1DPHG WR 6SRUWV ,OOXVWUDWHG¶V $OO$PHULFD ZDONRQOLVWDVDIUHVKPDQZKHQKHOHG3XUGXH ZLWKWDFNOHV ‡(DUQHGKRQRUDEOHPHQWLRQ$OO%LJ7HQKRQRUV LQ  /HG WKH WHDP ZLWK  VWRSV DQG KHOSHGWKHWHDPUHDFKWKH3HDFK%RZO$OVR HDUQHG KRQRUDEOH PHQWLRQ$OO%LJ 7HQ KRQRUV DV D VHQLRU UDQNLQJ 1R  LQ WKH OHDJXH ZLWK WDFNOHV

‡&KULV'DQLHOVVHWD%LJ7HQUHFRUGZLWK FDWFKHV DQG UHFRUGHG DQRWKHU %LJ7HQ UHFRUG ZLWKUHFHSWLRQVLQRQHJDPH

"OWL'AMESASA#OACH 2UDQJH 2NODKRPD 6XJDU 2NODKRPD *DOOHU\)XUQLWXUHFRP7H[DV$ 0 5RVH 3XUGXH 2XWEDFN  3XUGXH $ODPR 3XUGXH

"OWL'AMESASA0LAYER 3HDFK 3XUGXH

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

4(%35-,).&!-),9


#/!#().'34!&& #O /FFENSIVE#OORDINATOR/FFENSIVE,INE\&OURTH3EASON

"OWL'AMESASA0LAYER  3HDFK 1RUWK&DUROLQD  *DWRU1RUWK&DUROLQD  6XQ1RUWK&DUROLQD  %OXHERQQHW 1RUWK&DUROLQD

#OACHING(ISTORY

2UDQJH 2NODKRPD 6XJDU 2NODKRPD 5RVH 2NODKRPD &RWWRQ 2NODKRPD $ODPR 1RUWKZHVWHUQ $ORKD1RUWK&DUROLQD

‡ ,Q  WKH RIIHQVLYH OLQH SURGXFHG IRXU SRVWVHDVRQ KRQRUHHV DV 4XHQWLQ *ULI¿Q IHOO MXVW\DUGVVKRUWRIEUHDNLQJ%LOO\6LPVVFKRRO VHDVRQ UXVKLQJ PDUN ZKHQ KH JDLQHG  \DUGV +H DOVR UXVKHG IRU  RU PRUH \DUGV LQJDPHV ‡$VRIIHQVLYHFRRUGLQDWRUDW1RUWKZHVWHUQWKH  :LOGFDWV OHG WKH %LJ  LQ WRWDO RIIHQVH DQG TXDUWHUEDFN =DF .XVWRN ZDV FRQIHUHQFH OHDGHULQWKDWVDPHFDWHJRU\

‡9LQFH&DUWHU 2NODKRPD 5DLGHUV  $OO$PHULFDQDQG  5LPLQJWRQ$ZDUG¿QDOLVW ‡-DPPDO%URZQ 2NODKRPD 6DLQWV  7ZRWLPH$OO$PHULFDQ  2XWODQG7URSK\ZLQQHU ‡(ULF%HYHUO\ 0LDPL2KLR )DOFRQV ‡$OH[6XOIVWHG 0LDPL2KLR 5HGVNLQV ‡7UDYLV3UHQWLFH 0LDPL2KLR 9LNLQJV  1&$$DOOWLPHOHDGLQJVFRUHU  1R1&$$UXVKHU ‡'DPLDQ$QGHUVRQ 1RUWKZHVWHUQ

 $OO$PHULFDQ  1RUXVKHULQ%LJ7HQKLVWRU\ ‡=DF.XVWRN 1RUWKZHVWHUQ

 %LJ7HQWRWDORIIHQVHOHDGHU  8QLWDV$ZDUG¿QDOLVW



/+,!(/-! ()34/29

"OWL'AMESASA#OACH

‡ 7KH  2NODKRPD WHDP UDQNHG 1R  QDWLRQDOO\ ZLWK  SRLQWV SHU JDPH ZKLOH DYHUDJLQJ  \DUGV RI WRWDO RIIHQVH SHU JDPH 1RQDWLRQDOO\ 

0ROMINENT0UPILS

2%6)%7 /00/.%.43

SUHVHQW 2NODKRPD  &R2IIHQVLYH&RRUGLQDWRU2IIHQVLYH/LQH  1RUWKZHVWHUQ  $VVLVWDQW+HDG&RDFK2IIHQVLYH&RRU4%  1RUWKZHVWHUQ  2IIHQVLYH&RRUGLQDWRU4%  0LDPL 2KLR   2IIHQVLYH&RRUGLQDWRU4%  0LDPL 2KLR   2IIHQVLYH&RRU2IIHQVLYH/LQH  0LDPL 2KLR   2IIHQVLYH/LQH  )RDUG 1RUWK&DUROLQD +LJK6FKRRO  +HDG)RRWEDOO&RDFK$WKOHWLFV'LUHFWRU 1RUWK&DUROLQD$ 7  2IIHQVLYH&RRUGLQDWRU2IIHQVLYH/LQH  :LQVWRQ6DOHP6WDWH  2IIHQVLYH/LQH 1RUWK&DUROLQD  6WXGHQW*UDGXDWH$VVLVWDQW&RDFK

‡ 7KH  6RRQHUV ZKR DOVR IHDWXUHG :HV 6LPV D VL[WKURXQG GUDIW FKRLFH E\ WKH 6DQ 'LHJR &KDUJHUV DQG $OO%LJ  SLFN 'DYLQ -RVHSKUDQNHG1RQDWLRQDOO\LQWRWDORIIHQVH ZKLOHDYHUDJLQJSRLQWVSHUJDPH

4(%3//.%23

%LUWKGDWH  2FW +RPHWRZQ0DLGHQ1& +LJK6FKRRO 0DLGHQ &ROOHJH 1RUWK&DUROLQD )DPLO\ ZLIH$QJHOD  GDXJKWHUV(ODLQD0DNHQ]LH0DUOHH  VRQV7UH\DQG7RE\

‡ :LOVRQ KDV KHOSHG SURGXFH  \DUG UXVKHUV LQFOXGLQJ VL[ ZLWK PRUH WKDQ  \DUGV $W 2NODKRPD ERWK $GULDQ 3HWHUVRQ  \DUGV LQ   DQG 4XHQWLQ *ULI¿Q \DUGVLQ ZRUNHGXQGHU:LOVRQ$W 1RUWKZHVWHUQ 'DPLDQ$QGHUVRQ JDLQHG  \DUGV LQ  DQG DW 0LDPL 2KLR  7UDYLV 3UHQWLVVJDLQHG\DUGVLQDQG \DUGVLQZKLOH'HODQG0F&XOORXJKSLFNHG XSLQ

4( %7) ,3/. &!-) ,9

4HE7ILSON&ILE

‡ ,Q  :LOVRQ¶V RIIHQVLYH OLQH IHDWXULQJ 2XWODQG ZLQQHU DQG FRQVHQVXV $OO$PHULFDQ -DPPDO%URZQDQG:DOWHU&DPS$OO$PHULFDQ DQG 5LPLQJWRQ $ZDUG ¿QDOLVW 9LQFH &DUWHU FOHDUHGWKHZD\IRU+HLVPDQUXQQHUXS$GULDQ 3HWHUVRQ¶VUXVKLQJ\DUGVZKLOHDOORZLQJ D %LJ ORZ QLQH VDFNV %URZQ ZDV WKH ¿UVW OLQHPDQWDNHQLQWKHGUDIW

‡$OVRLQ:LOVRQZDVDFDQGLGDWHIRUWKH KLJKHVWDVVLVWDQWFRDFKKRQRUZKHQKHZDVD ¿QDOLVWIRUWKH)UDQN%UR\OHV$ZDUG

#/!#().'34!&&

#OACHING!CCOMPLISHMENTS

‡ ,Q  1RUWKZHVWHUQ VHW  VFKRRO PDUNV ZKLOHUDQNLQJ1RQDWLRQDOO\LQWRWDORIIHQVH 7KH FR%LJ 7HQ FKDPSLRQV ZHUH OHG E\ 5% 'DPLDQ$QGHUVRQ ZKR UXVKHG IRU D %LJ 7HQ UHFRUG\DUGVSHUJDPH

    3 %!3 /.

+%6).7),3/.

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

#/!#().'34!&& $!22%,,79!44

0ASSING'AME#OORDINTOR2ECEIVERS\&OURTH3EASON

#OACHING!CCOMPLISHMENTS ‡ ,Q  KH FRDFKHG RQH RI WKH QDWLRQ¶V GHHSHVW UHFHLYLQJ FRUSV ZKLFK SURYHG LWVHOI HTXDOO\VNLOOHGDWKLWWLQJWKHKRPHUXQ IRXURI KLVSOD\HUVKDGUHFHSWLRQVRIRUPRUH\DUGV  ZKLOHDOVRPDNLQJWKHGLI¿FXOWFDWFKDQGEORFN LQJ IRU D PXFKLPSURYHG UXQQLQJ JDPH 7KH GHSWKLVSHUKDSVEHVWLOOXVWUDWHGE\WKHIDFWWKDW 0DUN &OD\WRQ OHG WKH WHDP LQ UHFHSWLRQV DQG \DUGV  IRU   7UDYLV :LOVRQ ZDV ¿UVW LQ WRXFKGRZQUHFHSWLRQV  ZKLOH0DUN%UDGOH\ KDGWKHWRS\DUGVSHUFDWFK¿JXUH  

4HE7YATT&ILE %LUWKGDWH  -XQH +RPHWRZQ.LOOHHQ7H[DV +LJK6FKRRO .LOOHHQ 7H[DV +6 &ROOHJH  .DQVDV6WDWH )DPLO\ ZLIH&LQG\  VRQ'HVPRQG  GDXJKWHU&KDUHVH

#OACHING(ISTORY SUHVHQW 2NODKRPD  3DVVLQJ*DPH&RRUGLQDWRU5HFHLYHUV  2NODKRPD6WDWH  3DVVLQJ*DPH&RRUGLQDWRU5HFHLYHUV .DQVDV $VVRFLDWH+HDG&RDFK2IIHQVLYH&RRUGLQDWRU .DQVDV  $VVLVWDQW+HDG&RDFK5HFHLYHUV %D\ORU  5HFHLYHUV&RDFK :\RPLQJ  5HFHLYHUV&RDFK 6DP+RXVWRQ6WDWH  $VVLVWDQW&RDFK 7ULQLW\9DOOH\&& 7H[DV   $VVLVWDQW&RDFK

‡ 6DZ 0DUN &OD\WRQ EHFRPH 2NODKRPD¶V OHDGHU LQ ERWK UHFHSWLRQV DQG UHFHLYLQJ \DUGV E\H[FHHGLQJFDWFKHVDQG\DUGV ‡,Q&OD\WRQVHW28UHFRUGVIRUWRXFKGRZQ UHFHSWLRQV LQ D VHDVRQ DQG FDUHHU \DUG UHFHLYLQJ JDPHV LQ D FDUHHU UHFHSWLRQV LQ D VHDVRQ DQG UHFHLYLQJ \DUGV LQ D VHDVRQ DQG FDUHHU ‡ 7KH HOXVLYH 6RRQHU UHFHLYHUV JDLQHG  \DUGVDIWHUWKHFDWFKLQ ‡ 'HYHORSHG RQH RI WKH PRVW YHUVDWLOH UHFHLY LQJ XQLWV HYHU DW 28 'HVSLWH DQ RIIHQVH WKDW JDLQHGPRUHWKDQUXVKLQJ\DUGVLQ WKH 6RRQHUV KDG IRXU ZLGH UHFHLYHUV ZLWK DW OHDVWFDWFKHVDQGVL[ZLWKDWOHDVWRQH7' UHFHSWLRQ

4(%79!44&!-),9

"OWL'AMESASA#OACH 2UDQJH 2NODKRPD 6XJDU 2NODKRPD 5RVH 2NODKRPD

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

‡:DVSURPRWHGWRDVVRFLDWHKHDGFRDFKRIIHQ VLYHFRRUGLQDWRUVKRUWO\EHIRUHOHDYLQJ.DQVDV ‡7KH:\RPLQJWHDPKDGRQHRIWKHWRS UHFHLYLQJFRUSVLQWKHFRXQWU\ZLWKUHFHLY LQJ\DUGV \SJ DQGVFRUHGWRXFKGRZQV $OO$PHULFDQ0DUFXV+DUULVFDXJKWSDVVHV IRU\DUGVDQGWRXFKGRZQV ‡+HOSHG WKH  7ULQLW\ 9DOOH\ WHDP WR WKH 7H[DV-XQLRU&ROOHJH&RQIHUHQFHFKDP SLRQVKLS ‡6HUYHG WKUHH PLQRULW\ FRDFKLQJ IHOORZVKLSV LQWKH1)/+HZDVZLWKWKH7DPSD%D\%XF FDQHHUVLQWKHVXPPHURIDQGWKH'HQYHU %URQFRVIRUWKHVXPPHUVRIDQG

0ROMINENT0UPILS ‡0DUN&OD\WRQ 2NODKRPD 5DYHQV  $OO$PHULFDQDQGFRQVHQVXV$OO%LJ  $OO$PHULFDQDQGFRQVHQVXV  $OO%LJ¿QDOLVWIRUWKH%LOHWQLNRII  $ZDUGKROGHURIVHYHQUHFHLYLQJUHFRUGV ‡$QWZRQH6DYDJH 2NODKRPD

 $OO%LJVHFRQGWHDP ‡:LOO3HRSOHV 2NODKRPD

 $OO%LJKRQRUDEOHPHQWLRQ ‡5DVKDXQ:RRGV 2NODKRPD6WDWH HUV  $OO%LJ ‡+DUULVRQ+LOO .DQVDV 5HGVNLQV  1RDOOWLPHUHFHLYHUDW.8 ‡.DOLHI0RKDPPDG %D\ORU   1RDOOWLPHUHFHLYHUDW%8 ‡0DUFXV+DUULV :\RPLQJ

 $OO$PHULFDQ

!CCOMPLISHMENTSASA0LAYER ‡ /HWWHUHG WZR VHDVRQV DV D ZLGH UHFHLYHU DW .DQVDV6WDWH ‡2QHRIWKHWRSVSULQWHUVLQWKH%LJ(LJKW&RQ IHUHQFH+HZRQDOHDJXHWLWOHLQWKHPHWHU GDVKDQGDOVRJDUQHUHGDWRS¿YH¿QLVKLQWKH PHWHUGDVK


#/!#().'34!&& !SSISTANT#OACH$EFENSIVE%NDS\&IRST3EASON

#OACHING!CCOMPLISHMENTS ‡ &RORUDGR UDQNHG 1R  QDWLRQDOO\ DQG 1R LQWKH%LJZLWKVDFNVGXULQJWKH VHDVRQ ‡7KH%XIIDORHVZHUHWKH%LJ1RUWKFKDPSL RQVWKUHHWLPHVGXULQJKLVWHQXUH

%LUWKGDWH  -DQXDU\ +RPHWRZQ 'DOODV7H[DV +LJK6FKRRO5LFKDUGVRQ 7H[DV  &ROOHJH  2NODKRPD )DPLO\ZLIH7LQD  VRQ&DOHEGDXJKWHU&ROE\

‡ 'UDIWHG LQ WKH WK URXQG E\ WKH &KLFDJR %HDUVLQ

0ROMINENT0UPILS ‡-XVWLQ%DQQDQ &RORUDGR %LOOV  )LUVW7HDP$OO%LJ ‡7\OHU%UD\WRQ &RORUDGR 5DLGHUV  )LUVWURXQGGUDIWSLFNLQ ‡*DEH1\HQKXLV &RORUDGR %LOOV ‡&KDG3HJXHV ,OOLQRLV6WDWH %URZQV ‡'DPLDQ*UHJRU\ ,OOLQRLV6WDWH %XFFDQHHUV

‡1DPHGWRWKHSUHVHDVRQ%XWNXV$ZDUGZDWFK OLVWLQ ‡ 7KLUGWHDP$OO$PHULFD VHOHFWLRQ DV D MXQLRU E\7KH)RRWEDOO1HZV ‡+LVWKUHHIXPEOHUHFRYHULHVDVDVHQLRUWLHVIRU WKH28VLQJOHVHDVRQUHFRUGE\DOLQHEDFNHU

4(%7),3/.&!-),9 2%6)%7 /00/.%.43

SUHVHQW 2NODKRPD  'HIHQVLYH(QGV  &RORUDGR  'HIHQVLYH/LQH -DQ0D\ $UP\  'HIHQVLYH/LQH  ,OOLQRLV6WDWH  'HIHQVLYH/LQH ,QGLDQD6WDWH  /LQHEDFNHUV5HFUXLWLQJ&RRUGLQDWRU  1RUWKHDVWHUQ2NODKRPD$ 0  'HIHQVLYH&RRUGLQDWRU'HIHQVLYH/LQH 1RUWKHUQ,OOLQRLV  /LQHEDFNHUV ,QGLDQD6WDWH  /LQHEDFNHUV ,QGLDQD6WDWH  *UDGXDWH$VVLVWDQW

‡$IRXU\HDUOHWWHUPDQDWOLQHEDFNHUIRU2NOD KRPD EHWZHHQ  KH UHFRUGHG  WDFNOHVWKEHVWDOOWLPHDQGWKEHVWIRUDQ 28OLQHEDFNHU

‡7KUHHWLPH$OO%LJ (LJKW VHFRQG WHDP PHP EHU

4(%3//.%23

#OACHING(ISTORY

0LAYING!CCOMPLISHMENTS

‡/HGWKH6RRQHUVLQWDFNOHV HLJKW DWWKH *DWRU%RZO

#/!#().'34!&&

4HE7ILSON&ILE

‡ &RDFKHG RQ WKH ,OOLQRLV 6WDWH VTXDG WKDW FDSWXUHG WKH *DWHZD\ &RQIHUHQFH WLWOH DQG DGYDQFHGWRWKH1&$$'LYLVLRQ,$$VHPL¿QDOV LQ7KDWVHDVRQPDUNHGWKHRQO\WKDWWKH 5HGELUGVDFFRPSOLVKHGWKRVHIHDWV

‡+LVFDUHHUSDVVGHÀHFWLRQVUDQNVVHYHQWK DOOWLPHE\DOLQHEDFNHUDW28

    3 %!3 /.

#(2)37),3/.

/+,!(/-! ()34/29

"OWL'AMESASA#OACH +RXVWRQ  &RORUDGR $ODPR &RORUDGR )LHVWD &RORUDGR

"OWL'AMESASA0LAYER *DWRU 2NODKRPD &LWUXV  2NODKRPD 2UDQJH 2NODKRPD

 .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

3500/2434!&& *%2293#(-)$4

$IRECTOROF3PORTS%NHANCEMENT\3EVENTH3EASON

#OACHING(ISTORY

#OACHING!CCOMPLISHMENTS

SUHVHQW 2NODKRPD  'LUHFWRURI6SRUW(QKDQFHPHQW )ORULGD  &RRUGLQDWRU  1RWUH'DPH  &RRUGLQDWRU  2NODKRPD6WDWH  'LUHFWRU  1RWUH'DPH  $VVLVWDQW

‡ &ROOHJLDWH 6WUHQJWK &RDFK RI WKH <HDU E\86$)LWQHVV

‡&RDFKHG1)/¿UVWURXQGGUDIWSLFNV ‡ +DV FRDFKHG ZLWK WHDP WKDW SOD\HG LQ ¿YH QDWLRQDOFKDPSLRQVKLSJDPHVDQGKDVQDWLRQDO WLWOHULQJVIURP281RWUH'DPHDQG)ORULGD

4HE3CHMIDT&ILE %LUWKGDWH  6HSWHPEHU +RPHWRZQ +DUYDUG1HE +LJK6FKRRO+DUYDUG 

&ROOHJH  1HEUDVND 

 2NODKRPD 

)DPLO\ ZLIH5RELQ  GDXJKWHU$XEUH\  VRQ6DPXHO

‡:RUNHG ZLWK IRXU +HLVPDQ 7URSK\ ZLQQHUV LQFOXGLQJ -DVRQ :KLWH 2NODKRPD  'DQQ\ :XHUIIHO )ORULGD  %DUU\ 6DQGHUV 2NODKRPD 6WDWH DQG7LP%URZQ 1RWUH'DPH 

4(%3#(-)$4&!-),9

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-


3500/2434!&& !DMINISTRATIVE#OORDINATOR\3EVENTH3EASON

0ROFESSIONAL!CCOMPLISHMENTS

/52ESPONSIBILITIES

‡ 2YHUVDZDUHDVRIDOOLHGLQGXVWU\VSRQVRUVKLS DGYHUWLVLQJ DQG WUDGH VKRZV JHQHUDWLQJ PRUH WKDQPLOOLRQDQQXDOO\IRUWKH1DWLRQDO&DWWOH PHQ¶V%HHI$VVRFLDWLRQWKHWUDGHRUJDQL]DWLRQ UHSUHVHQWLQJRYHURQHPLOOLRQEHHISURGXFHUV

‡2YHUVHHV IRRWEDOO RSHUDWLRQV E\ ZRUNLQJ GLUHFWO\ ZLWK 28¶V VWUHQJWK VSRUWV PHGLFLQH IRRWEDOO YLGHR HTXLSPHQW ¿HOG PDLQWHQDQFH DQGVHFUHWDULDOVWDIIV

4HE-C-ILLEN&ILE %LUWKGDWH  'HFHPEHU +RPHWRZQ 6DOLQD.DQ +LJK6FKRRO6DOLQD&HQWUDO 

&ROOHJH  .DQVDV6WDWH 

)DPLO\ZLIH*LQD  VRQV$OH[DQG1DWKDQ

SUHVHQW 2NODKRPD  $GPLQLVWUDWLYH&RRUGLQDWRU  1DWLRQDO&DWWOHPHQ¶V%HHI  'LUHFWRURI0DUNHWLQJ  .DQVDV6WDWH  $VVRFLDWH$'IRU([WHUQDO$IIDLUV

‡&RRUGLQDWHVDOORI28¶VWUDYHODUUDQJHPHQWV LQFOXGLQJ %LJ  &KDPSLRQVKLS DQG ERZO JDPHV ‡:RUNV FORVHO\ ZLWK &RDFK 6WRRSV LQ FRRUGL QDWLQJ FRPPXQLW\ DIIDLUV LQFOXGLQJ WKH 28 )RRWEDOO)&$ +ROLGD\ )RRG 'ULYH DQG WKH 3DUWQHUVIRU<RXWK)RRWEDOO&OLQLF ‡&RFRRUGLQDWRURIWKH28)RRWEDOO&DPSDQG 28)RRWEDOO&RDFKHV&OLQLF ‡6HUYHV DV 3UHVLGHQW RI WKH %RE 6WRRSV &KDPSLRQV)RXQGDWLRQ

4(%3//.%23

0ROFESSIONAL%XPERIENCE

‡&RRUGLQDWHGWKHDQQXDOIXQGUDLVLQJSODQIRU WKH0LNH$KHDUQ6FKRODUVKLS)XQGLQFUHDVLQJ WKH QXPEHU RI &DWEDFNHU &OXEV IURP HLJKW WR DQGHVWDEOLVKHGDQGPDQDJHGWKH$KHDUQ )XQG %RDUG RI 'LUHFWRUV WKH .DQVDV 6WDWH 6SRUWV +DOO RI )DPH DQG WKH *ROGHQ &DWV IRRWEDOOVXSSRUWJURXS

‡6HUYHV DV OLDLVRQ ZLWK PHGLD UHODWLRQV DWK OHWLF DGPLQLVWUDWLRQ PDUNHWLQJ GHYHORSPHQW DFDGHPLF VWXGHQW OLIH JDPH GD\ RSHUDWLRQV DQG WKH EXVLQHVV RI¿FH DV ZHOO DV )&$ WKH 7RXFKGRZQ&OXEWKH28)RRWEDOO/HWWHUPHQ¶V $VVRFLDWLRQDQG6RRQHU6SRUWV3URSHUWLHV

#/!#().'34!&&

‡ &UHDWHG .DQVDV 6WDWH¶V &RUSRUDWH 3DUWQHU 3URJUDPDQGVHFXUHGPLOOLRQLQDGYHUWLV LQJUHYHQXHVWRLQVWDOOD6RQ\-XPER7URQDQG WKUHHRWKHUVFRUHERDUGVLQ.68VWDGLXP

    3 %!3 /.

-!44-C-),,%.

2%6)%7 /00/.%.43

4(%-C-),,%.&!-),9

/+,!(/- !()34/29  .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

3500/2434!&& -%26*/(.3/.

$IRECTOROF&OOTBALL/PERATIONS\TH3EASON

4HE*OHNSON&ILE %LUWKGDWH  0D\ +RPHWRZQ.LQJ&LW\0R +LJK6FKRRO.LQJ&LW\ &ROOHJH  0LVVRXUL )DPLO\ ZLIH&LQG\  WZRJURZQFKLOGUHQVHYHQJUDQGFKLOGUHQ

#OACHING(ISTORY

#OACHING!CCOMPLISHMENTS

SUHVHQW 2NODKRPD  'LUHFWRURI)RRWEDOO2SHUDWLRQV  6SHFLDO$VVLVWDQWWRWKH$WKOHWLF'LUHFWRU  2NODKRPD  $VVLVWDQW&RDFK  1RWUH'DPH  $VVLVWDQW&RDFK  $UNDQVDV  $VVLVWDQW&RDFK  0LVVRXUL  $VVLVWDQW&RDFK  $UNDQVDV  *UDGXDWH$VVLVWDQW

‡,Q KLV  \HDUV DV DQ 28 DVVLVWDQW FRDFK KH DPDVVHG D  UHFRUG D QDWLRQDO FKDPSLRQVKLS¿YH%LJ(LJKW&RQIHUHQFHWLWOHV DQGVHYHQERZOJDPHYLFWRULHV

0LAYER!CCOMPLISHMENTS ‡$Q $OO%LJ 6HYHQ WDFNOH IRU 0LVVRXUL ZKHUH KH ZDV DQ DFDGHPLF DOOFRQIHUHQFH VHOHFWLRQ DVZHOO ‡&RFDSWDLQHG DQG SOD\HG LQ WKH %OXH*UD\ $OO6WDUJDPH ‡$FDGHPLF $OO%LJ 6HYHQ VHOHFWLRQ DQG ZDV KRQRUHG DV WKH OHDJXH¶V PRVW 2XWVWDQGLQJ 6WXGHQW$WKOHWHRIWKH<HDU

4(%*/(.3/.&!-),9

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-

‡3URGXFHG$OO$PHULFDQV ‡&RDFKHGRQVWDIIVWKDWDPDVVHGIRXUQDWLRQDO FKDPSLRQVKLSV 2NODKRPD 1RWUH 'DPH DQG $UNDQVDV  ‡,QGXFWHG LQWR WKH 2NODKRPD &RDFKHV $V VRFLDWRQ+DOORI)DPHLQ ‡)LUVWUHFLSLHQWRIWKH1DWLRQDO)RRWEDOO)RXQ GDWLRQ,QWHJULW\$ZDUGLQ7KHDZDUGZDV VXEVHTXHQWO\QDPHGLQKLVKRQRU ‡5HFHLYHG WKH $OO$PHULFDQ )RRWEDOO )RXQ GDWLRQ¶V 0LNH &DPSEHOO /LIHWLPH$FKLHYHPHQW $ZDUGLQ

/52ESPONSIBILITIES ‡&RRUGLQDWHV WKH GD\WRGD\ DFWLYLWLHV RII WKH ¿HOG IRU 28 IRRWEDOO SOD\HUV DQG GHDOV ZLWK RQFDPSXVUHFUXLWLQJHIIRUWV ‡6HUYHVDVFRORUDQDO\VWRQWKH6RRQHU5DGLR 1HWZRUN


3500/2434!&& $IRECTOROF!THLETICS%QUIPMENT\3IXTH3EASON

0ROFESSIONAL%XPERIENCE 3UHVHQW 2NODKRPD  'LUHFWRURI$WKOHWLFV(TXLSPHQW  2NODKRPD  )RRWEDOO(TXLSPHQW&RRUGLQDWRU  2NODKRPD  6WXGHQW0DQDJHU

‡ &HUWL¿HG PHPEHU RI WKH $WKOHWLF (TXLSPHQW 0DQDJHUV$VVRFLDWLRQ

4HE4IPTON&ILE

‡&RRUGLQDWHVDOOERZOJLIWDQGDZDUGSXUFKDV LQJLVVXDQFHDQGWHDPHTXLSPHQWWUDYHO ‡,PSOHPHQWHG DQ LQYHQWRU\ FRQWURO V\VWHP IRU DFFRXQWDELOLW\ RI DWKOHWLF HTXLSPHQW DQG DSSDUHOIRUWKH8QLYHUVLW\RI2NODKRPDVSRUWV SURJUDPV

‡2YHUVHHVDOORUGHULQJFRQWUDFWSXUFKDVLQJLV VXLQJLQYHQWRU\DQGPDLQWHQDQFHRIDOODWKOHWLF HTXLSPHQWDQGDSSDUHO ‡6XSHUYLVHV D VWDII RI WKUHH $(0$ FHUWL¿HG DVVLVWDQWV RQH ODXQGU\ DWWHQGDQW DQG  VWXGHQWV ‡6HUYHV DV D OLDLVRQ EHWZHHQ DWKOHWLF HTXLS PHQWDQGDSSDUHOFRPSDQLHVDQG28¶V2O\PSLF 6SRUWV$GPLQLVWUDWLRQDQG6SRUWV0HGLFLQH ‡6XSHUYLVHVDOOIRRWEDOOWHDPHTXLSPHQWUHODWHG WUDYHODQGJDPHGD\RSHUDWLRQV

4(%4)04/.&!-),9

4(%3//.%23

%LUWKGDWH  1RYHPEHU +RPHWRZQ )DLUODQG2NOD +LJK6FKRRO)DLUODQG &ROOHJH  2NODKRPD  )DPLO\ ZLIH6KD\H  VRQ3DUNHU$QGUHZ  GDXJWKHU5DFKHO

‡0HPEHURIWKH2NODKRPDERZOSODQQLQJFRP PLWWHHIRUWKH,QGHSHQGHQFH%RZO 2UDQJH%RZODQG&RWWRQ%RZO

/52ESPONSIBILITIES

#/!#().'34!&&

0ROFESSIONAL!CCOMPLISHMENTS

‡6HUYHV RQ WKH DGYLVRU\ ERDUG RI VHYHUDO DWKOHWLFHTXLSPHQWDQGDSSDUHOFRPSDQLHV

    3 %!3 /.

'2%'4)04/.

2%6)%7 /00/.%.43 /+,!(/-! ()34/29  .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

3500/2434!&& 3#/44!.$%23/. (EAD!THLETICS4RAINER\.INTH3EASON

4HE!NDERSON&ILE %LUWKGDWH  0D\ +RPHWRZQ 6WHUOLQJ.DQ +LJK6FKRRO6WHUOLQJ &ROOHJH  2NODKRPD 

)DPLO\ZLIH.HUUL  WKUHHFKLOGUHQ&DOHE.DLWOLQDQG&RQQRU

0ROFESSIONAL%XPERIENCE 3UHVHQW 2NODKRPD  +HDG$WKOHWLF7UDLQHU  7XODQH  +HDG$WKOHWLF7UDLQHU  2NODKRPD  $VVLVWDQW$WKOHWLF7UDLQHU

0ROFESSIONAL!CCOMPLISHMENTS

/52ESPONSIBILITIES

‡,VDFHUWL¿HGPHPEHURIWKH1DWLRQDO$WKOHWLF 7UDLQHUV¶$VVRFLDWLRQ ‡,VOLFHQVHGE\WKH6WDWHRI2NODKRPD%RDUGRI 0HGLFDO/LFHQVXUH

‡ 6XSHUYLVHV D VWDII RI IRXU IXOOWLPH FHUWL¿HG DWKOHWLF WUDLQHUV RQH SK\VLFDO WKHUDSLVW VL[ JUDGXDWH DVVLVWDQWV DQG  XQGHUJUDGXDWHV ZKRSURYLGHWKHEXONRIWKHFDUHWRWKHVWXGHQW DWKOHWHV

‡$FWLYHPHPEHUDQGSDVWFKDLURIWKH%LJ 0HGLFDO$VSHFWVRI6SRUW&RPPLWWHH

‡ $Q DGMXQFW LQVWUXFWRU IRU WKH 'HSDUWPHQW RI +HDOWKDQG6SRUW6FLHQFHV

‡$OVRVHUYHGDVFKDLURI(GXFDWLRQDO3URJUDP VXEFRPPLWWHH

‡ &RQGXFWV D VXPPHU $WKOHWLF 7UDLQLQJ &OLQLF JHDUHGWRZDUGKLJKVFKRRODWKOHWLFWUDLQHUV

‡$FWLYHLQWKH0LG$PHULFDQ7UDLQHUV$VVRFLD WLRQ ‡$FWLYH LQ WKH &ROOHJH$WKOHWLF 7UDLQHUV 6RFL HW\ ‡$FWLYHLQWKH2NODKRPD$WKOHWLF7UDLQHUV$V VRFLDWLRQ ‡'HYHORSHGDFRPSUHKHQVLYHVSRUWVSURJUDP LQFRQMXQFWLRQZLWKWKH7XODQH8QLYHUVLW\+RVSL WDO'HSDUWPHQWRI2UWKRSHGLFV ‡ &RRUGLQDWHG 7XODQH¶V 6XEVWDQFH $EXVH 3URJUDP

4(%!.$%23/.&!-),9

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-


3500/2434!&& ,!229*!#+3/.

#!3%9',%..

$VVLVWDQW6WUHQJWK&RDFK

$VVLVWDQW6WUHQJWK&RDFK

*UDGXDWH$VVLVWDQW&RDFK

4HE+OLOK&ILE

4HE*ACKSON&ILE

4HE'LENN&ILE

%LUWKGDWH  $SULO +RPHWRZQ %\UDP&RQQ +LJK6FKRRO*UHHQZLFK+LJK6FKRRO &ROOHJH  7KH&LWDGHO  6SULQJ¿HOG 0DVV &ROOHJH )DPLO\ ZLIH&DUOD

%LUWKGDWH 2FW +RPHWRZQ 5RFNGDOH7H[DV +LJK6FKRRO 5RFNGDOH+LJK6FKRRO &ROOHJH  7H[DV$ 0

%LUWKGDWH  0DUFK +RPHWRZQ*UHHOH\&ROR +LJK6FKRRO *UHHOH\&HQWUDO &ROOHJH &DUUROO&ROOHJH )DPLO\ZLIH6KDQQRQ

0LAYING%XPERIENCE  %DUFHORQD'UDJRQV 1)/(XURSH

0LDPL'ROSKLQV  $UL]RQD&DUGLQDOV 'HQYHU%URQFRV

#OACHING(ISTORY 6RXWK'DNRWD 2QWHDPWKDWVHWVFKRRORIIHQVLYHUHFRUGVIRU ‡3RLQWVSHUJDPH 

‡7RWDORIIHQVLYH\DUGVSHUJDPH \DUGV

‡5XVKLQJ\DUGVSHUJDPH \DUGV

‡)LUVWGRZQVLQDVHDVRQ SHUJDPH

‡7RWDOWRXFKGRZQV SDVVLQJUXVKLQJ

‡5HG]RQHHI¿FLHQF\ SHUFHQW  ‡7KLUGGRZQHI¿FLHQF\ SHUFHQW

 ,GDKR6WDWH  2IIHQVLYH*UDGXDWH$VVLVWDQW&RDFK

0LAYING!CCOMPLISHMENTS ‡3OD\HGLQWKH+ROLGD\  DQG&RWWRQ %RZOV DQG

‡3OD\HGLQWKH%OXH*UD\$OO6WDU*DPH

4(%3//.%23

SUHVHQW 2NODKRPD  $VVWLVWDQW6WUHQJWK&RDFK 7XOVD  $VVWLVWDQW6WUHQJWK&RDFK 6XPPHU ,QWHUQ  ,QWHUQDWLRQDO3HUIRUPDQFH,QVWLWXWH -DQ0D\ 6SULQJ¿HOG&ROOHJH  ,QWHULP+HDG&RDFK  6SULQJ¿HOG&ROOHJH  *UDGXDWH$VVLVWDQW&RDFK  7KH&LWDGHO  $VVW8QGHUJUDG6WUHQJWK&RDFK

SUHVHQW 2NODKRPD  $VVLVWDQW6WUHQJWK&RDFK  7H[DV$ 0  $VVLVWDQW6WUHQJWK&RDFK

#/!#().'34!&&

0ROFESSIONAL%XPERIENCE

0ROFESSIONAL%XPERIENCE

    3 %!3 /.

3#/44+/,/+

2%6)%7 /00/.%.43 /+,!(/-! ()34/29  .!4)/.!,#( !-0)/.3


.!4) /.!,#(!-0)/.3()03 # /. &%2%.#%#(!-0)/.3()03"/7,#(!-0)/.3()03!,, ! -%2)#!.3   .!4 )/.!,!7!2$7)..%23

3500/2434!&& %2!.$9%)#(.%2 -$ ,QWHUQDO0HGLFLQH

*)-(),,)3 240 !4# 'LUHFWRURI5HKDELOLWDWLRQ

$/.-#')..)3 -$ &RRUGLQDWRURI2UWKRSHGLF&RYHUDJH

"2/#+3#(.%"%, 7HDP3K\VLFLDQ

-!24).4)00)% -$ 7HDP3K\VLFLDQ(PHULWXV

!..$%!,

/KLAHOMA!THLETICS3PORTS-EDICINE 7KH 8QLYHUVLW\ RI 2NODKRPD KDV D ULFK ¿YHGHFDGH KLVWRU\ RI VHWWLQJ D VWDQGDUGIRUVSRUWVPHGLFLQHFDUHDWUDGLWLRQWKDWFRQWLQXHVWRGD\ +HDG$WKOHWLF7UDLQHU6FRWW$QGHUVRQKLVVWDIIDQGWKHWHDPSK\VLFLDQV FRPSULVHWKHSURIHVVLRQDOVWDII$QGHUVRQZDVQDPHG7UDLQHURIWKH <HDUE\WKH$OO$PHULFDQ)RRWEDOO)RXQGDWLRQ %URFN6FKQHEHO0'+HDG7HDP3K\VLFLDQIRUWKH8QLWHG6WDWHV 2O\PSLF7HDPGLUHFWV28¶VSK\VLFLDQVWDII'RQ0F*LQQLV0'VHUYHV DQ 2O\PSLF7HDP DVVLJQPHQW LQ DGGLWLRQ WR KLV UHVSRQVLELOLWLHV ZLWK WKH 6RRQHUV(5DQG\(LFKQHU0'7HDP,QWHUQLVWLVLQWHUQDWLRQDOO\UHFRJ QL]HGIRUKLVH[SHUWLVHLQPHGLFLQHLVVXHVUHODWHGWRVSRUWV0DUWLQ7LSSLH 0'FRPSOHWHVWKH6RRQHUV¶SULPDU\SK\VLFLDQVWDII 7KHVWDWHRIWKHDUW+HQU\-)UHHGH6SRUWV0HGLFLQH&RPSOH[LQWKH%DUU\ 6ZLW]HU&HQWHUSURYLGHVDFRQYHQLHQWORFDWLRQIRUWKH6RRQHUVWRUHFHLYH WKHLU FDUH 7KH 6SRUWV 0HGLFLQH 6WDII SURYLGHV FRQVLVWHQW VHUYLFH RQ D GDLO\ EDVLV ZKLFK LQFOXGHV LQMXU\ SUHYHQWLRQ DQG DFXWH FDUH SRVWLQMXU\ UHKDELOLWDWLRQ [UD\ DQG SK\VLFLDQ DVVHVVPHQW -LP +LOOLV D 5HJLVWHUHG 3K\VLFDO7KHUDSLVWDQG&HUWL¿HG/LFHQVHG$WKOHWLF7UDLQHUFRRUGLQDWHVDOO UHKDELOLWDWLRQSURWRFROV 7KHFRPELQDWLRQRIWKHVWDIIDQGIDFLOLW\SURYLGHWKHFDUHWKDWLVYLWDOWR DFKDPSLRQVKLSSURJUDP28¶VIDFLOLW\LVHTXLSSHGZLWK6ZLP([DTXDWLF WKHUDS\ LVRNLQHWLF UHKDELOLWDWLRQ DQG WHVWLQJ HTXLSPHQW DORQJ ZLWK FDU GLRYDVFXODUDQGH[HUFLVHHTXLSPHQWWKDWRIIHUVWKHDELOLW\WRPDQDJHWKH PXOWLOHYHOQHHGVRI28¶VVWXGHQWDWKOHWHV

6HFUHWDU\IRU%RE6WRRSV

35%'2%%2

"!22%44!2'/

6HFUHWDU\IRU$VVLVWDQW&RDFKHV

$VVLVWDQW(TXLSPHQW0DQDJHU

*5,)%-#'%(%%

7%3%$7!2$3

5HFUXLWLQJ6HFUHWDU\

$VVRFLDWH'LUHFWRURI$WKOHWLFV(TXLSPHQW

"2)!.-!24).

#!2,!+/,/+

$WKOHWLFV9LGHR&RRUGLQDWRU

$VVRFLDWH'LUHFWRURI$WKOHWLFV(TXLSPHQW

-)+%./",%2

$!6)$,)44,%*/(.

9LGHR$VVLVWDQW

$VVLVWDQW(TXLSPHQW0DQDJHU

4)-/6%2-!.

34%6%'2%3(!-

$VVLVWDQW6WUHQJWK&RDFK

(TXLSPHQW5RRP

+%..9'!*%73+)

*/.$%.)/

7XUI0DQDJHU

(TXLSPHQW*UDGXDWH$VVLVWDQW

 /+,!(/-!&//4"!,,'5)$%\3//.%230/243#/-


THE SOONERS 2 0 0 5 S EAS ON COACHING STAFF THE SOONERS REVIEW & OPPONENTS

JOSEPH

OKLAHOM A HISTORY

DAVIN

91 1950 1955 1956 1974 1975 1985 2000 NATIONAL CHAMPIONS CH AMPIONS


C.J. AH YOU

RUFUS ALEXANDER

HIGHLAND, UTAH SNOW COLLEGE

BATON ROUGE, LA. CHRISTIAN LIFE ACADEM Y

DE

6-4

259

JR

Junior College: Enrolled at OU in January and participated in OU spring practice ... went to Snow Junior College in 2003 after transferring from BYU ... named Snow’s defensive player of the week four times ... sat out the 2002 season at BYU with a knee injury ... At BYU in 2001, he played three games for the Cougars recording 9 tackles and two sacks ... rated No. 40 JUCO player in the nation by CollegeFootballNews.com High School: Attended Lone Peak High School in Highland, Utah ... recorded 20 hurries and 12 sacks as a senior ... named team’s defensive line Most Valuable Player as a senior. The Wrapup: Born July 7, 1982 ... coached by Jeff Kilts ... son of Charles and Joyce Samalaualu Ah You ... father was a three-year football letterman at BYU ... pronounciation: I-uu ... sociology major.

LB

Year 2003 2004 Total

G-GS 1-0 12-10 13-10

UT 2 49 51

AT Total 0 2 25 74 25 76

6-1

219

JR

Loss Sacks INT FC FR PBU 0-0 0-0 0 1 0-0 0 7-26 2-17 1 3 3-0 4 7-26 2-17 1 4 3-0 4

2004: All-Big 12 second team as voted by the Associated Press ... Coaches’ All-Big 12 honorable mention ... tied for the team lead in fumbles recovered with three and second in fumbles forced with four ... tied the school record for fumble recoveries by a linebacker in one season ... third on the team with 74 tackles ... season-high 10 tackles, including eight unassisted, against Texas ... spread his seven tackles for loss over six games ... lone interception came against Kansas. 2003: Returned to game action at the midway point after off-season knee surgery ... credited with two tackles. 2002: Redshirted ... shared the Iron Man Award for top strength and conditioning by a freshman with Paul Thompson. High School: All-Stater ... ranked among nation’s top 20 linebackers by two recruiting services ... three-year starter ... also played tight end ... played in seven games as a senior and had team highs with 86 tackles, 14 tackles for loss and 12 sacks ... team won district titles as a junior (10-2) and senior (8-4) ... all-district in basketball ... coached by David Barham. The Wrapup: Son of David and Melissa Barham ... born April 12, 1983 ... sociology major.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

RUFUS ALEXANDER

92 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS LEWIS BAKER

GRAND PRAIRIE, TEXAS NORTHEASTERN OKLAHOMA A&M

CARROLLTON, TEXAS HEBRON HIGH SCHOOL

DT

Year 2004

G-GS 12-2

6-2

300

SR

DB

UT AT Total Loss Sacks INT FC FR PBU 3 8 11 3-21 3-21 1

Junior College: Helped junior college team to a 21-3 record in two seasons ... recorded 50 tackles, three sacks and recovered one fumble in 2003 ... helped lead team to its second straight conference championship, bowl title and No. 2 national ranking in 2003 ... team posted a 10-2 mark his sophomore year and an 11-1 record during his freshman season ... coached by Dale Patterson.

SO

UT AT Total Loss Sacks INT FC FR PBU 9 4 13 1-1 0-0 0 0 0 1 0 0 0 0-0 0-0 0 0 0 0 9 4 13 1-1 0-0 0 0 0 1

2004: Redshirted. 2003: Played in 10 games and had two tackles in four ... broke up a pass against UCLA ... one of only two true freshmen on the team to see action (the other was FB Dan Townsend). High School: Ranked the No. 21 player in Texas by SuperPrep and the No. 11 linebacker in the nation by Rivals.com ... U.S. Army All-American and a USA Today second team All-American ... three-year letterman and a three-year starter at linebacker and tight end ... 90 tackles, eight tackles for loss, one sack, one interception and one fumble recovery as a senior ... missed four games due to a minor injury ... caught three passes for 113 yards and two touchdowns ... team captain ... had 123 tackles as a junior ... coached by Brian Brazil ... competed in relay events on the track and field team ... varsity basketball player as a junior.

THE SOONERS

The Wrapup: Signed with Purdue out of high school ... has a brother, Akin, who plays for the Jacksonville Jaguars ... full first name is Remilekun ... born April 22, 1983 ... son of Jessica Ojomo ... sociology major.

G-GS 11-0 0-0 11-0

203

COACHING STAFF

2004: Had a tackle high of three versus both Houston and Nebraska ... two of his three sacks came in that Houston game ... played extensively as part of the rotation among OU’s defensive tackles.

Year 2003 2004 Total

6-3

2 0 0 5 S EAS ON

REMI AYODELE

The Wrapup: Converted to strong safety in the spring after spending the early portion of his college career at outside linebacker ... runs 4.5 in the 40 ... born Oct. 12, 1984, in Bremerhaven, Germany ... son of Linda and Joe Baker ... business major.

REVIEW & OPPONENTS

REMI AYODELE OKLAHOM A HISTORY 93 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS BEN BARRESI

ERIC BASSEY

EDMOND, OKLA. EDMOND NORTH HIGH SCHOOL

GARLAND, TEXAS NORTH GARLAND HIGH SCHOOL

OL

6-5

281

FR

High School: Rated the No. 19 offensive tackle in the nation (ESPN.com), No. 40 offensive tackle in the country (Rivals.com) and No. 8 player in the Postseason Oklahoma Top 15 (Rivals.com) ... named the outstanding lineman at the Nike Camp/Pal Alto ... second team Nike All-American ... three-year starter ... played offensive and defensive tackle. The Wrapup: Bench presses 365 pounds ... graduated with a 3.8 grade point average ... entered OU in January of 2005 and participated in spring drills ... named to Who’s Who Among American High School Students ... parents: John and Janet Barresi ... born June 16, 1986 ... coached by Bill Bays ... brother, Joe, plays for Mike Stoops at Arizona ... father lettered at Oklahoma on the defensive line in 1973 and 1974.

DB

Year 2002 2003 2004 Total

6-1

200

SR

G-GS UT AT Total Loss Sacks INT FC FR PBU 14-14 44 16 60 8-29 2-20 2-(-3) 2 1-45 13 14-0 7 5 12 0-0 0-0 1-34 1 0-0 0 10-9 19 6 25 0-0 0-0 0-0 0 0-0 2 38-23 70 27 97 8-29 2-20 3-31 3 1-45 15

2004: Started the first nine games at cornerback ... had a tackle high of five in three games – Oregon, Texas Tech and Kansas ... broke up passes against Oregon and Oklahoma State. 2003: Moved to corner and played in all 14 games ... also played on special teams ... had a 34-yard interception return for touchdown against UCLA ... tackle high of five versus the Bruins. 2002: Started every game at strong safety ... had the sixth-best season for tackles for loss by an Oklahoma defensive back with eight ... tackle best of eight versus South Florida ... recovered a fumble and ran 45 yards (eighth longest in Oklahoma history) for touchdown versus Alabama ... interceptions versus Missouri and Texas A&M ... forced fumbles versus Tulsa and Colorado. 2001: Redshirted. School: Played defensive back, wide receiver and kick returner ... High School had 37 tackles and 24 receptions for 276 yards as a senior ... had an 82yard kickoff return and a 51-yard punt return for touchdowns ... two-time all-district ... coach was Joe Allen ... district champ at 400 meters ... ran on 4x100 relay that was second at state ... ranked as the No. 29 corner by Rivals100.com ... No. 5 defensive back in the Midlands by PrepStar ... top 50 player in Texas. Wrapup: No. 3 among active Sooners with 23 career starts (Joseph The Wrapup 27, Chaisson 26) ... runs a 4.32 40 ... describes best moment at OU as returning a fumble to seal the win over Alabama in 2002 ... born Jan. 23, 1983 ... son of Ben and Joy Bassey ... enjoys writing poems and movie scripts ... communications major ... his cousin, J.J. Johnson, competed in the 200 meter dash in the 2004 Olympics.

ERIC BASSEY

94 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS LARRY BIRDINE

SAN ANTONIO, TEXAS ROOSEVELT HIGH SCHOOL

LAWTON, OKLA. EISENHOWER HIGH SCHOOL

DT

6-2

264

FR (RS)

2004: Redshirted.

The Wrapup: Runs a 4.9 in the 40-yard dash ... bench presses 285 pounds and squats 515 pounds ... coached by Glen Hill ... born Dec. 22, 1985 ... son of Felicia Bennett and Mike Parker ... undecided on a major.

Year 2003 2004 Total

G-GS 14-1 13-0 27-1

6-4

258

UT AT Total Loss Sacks INT 15 9 24 8-27 4-22 1-34 29 11 40 11-47 7-34 0-0 44 20 64 19-74 11-56 1-34

JR

FC 1 2 3

FR PBU 0-0 0 1-0 4 1-0 4

2004: Reserve defensive end who played extensively in a three-man rotation ... second on the team with 11 tackles for loss ... dominant at Baylor with a season-high six tackles along with three for loss and one fumble forced ... also had three sacks and a forced fumble at Texas A&M. 2003: Strong pass rusher who was in the rotation throughout his first season of eligibility ... played in all 14 games and started at Colorado ... four sacks were spread over four games ... forced a fumble against Baylor ... season-high five tackles against UCLA, including three tackles for loss.

High School: Consensus All-State ... No. 25 defensive end in nation by Rivals.com, No. 25 defensive lineman by SuperPrep ... had 81 tackles, 14 tackles for loss (-57) and four sacks as a senior ... three fumble recoveries, one he returned for a touchdown, and one blocked punt ... career totals were 147 tackles, eight sacks and 24 tackles for loss (-124) ... led team to 7-3 record and the 6A playoffs ... coach was Bill Whiteley.

REVIEW & OPPONENTS

The Wrapup: Runs a 4.7 40-yard dash ... bench presses 320 pounds, squats 400 pounds ... half-brother Jason Gildon plays for Jacksonville Jaguars ... cousin of former Sooner standout and current New Orleans Saint Jammal Brown ... son of Suerena Birdine ... born Oct. 6, 1983 ... sociology major.

THE SOONERS

2002: Redshirted.

LARRY BIRDINE

COACHING STAFF

High School: A three-year letterwinner and two-year starter ... competed at the defensive end, tight end and fullback positions ... had 82 tackles, 12 for loss, one fumble recovery, nine pass deflections, 33 hurries, nine sacks and three blocked kicks as a senior ... recorded 57 tackles as a junior, including 11 for loss ... seven of his tackles for loss were sacks ... also recovered two fumbles.

DE

2 0 0 5 S EAS ON

CORY BENNETT

OKLAHOM A HISTORY 95 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS RHETT BOMAR

BRETT BOWERS

GRAND PRAIRIE, TEXAS GRAND PRAIRIE HIGH SCHOOL

JACKSONVILLE, FLA. TRINITY CHRISTIAN ACADEMY

QB

6-4

215

FR (RS)

DB

5-11

194

FR (RS)

2004: Redshirted.

2004: Redshirted.

High School: Started three years ... threw for 6,097 yards and 58 TDs ... Rushed for 1,623 yards and 33 scores in 27 career games ... averaged 286 yards of total offense per game during his career ... posted a 62 percent completion rate over his three seasons ... set school records for career yardage and completions ... accounted for 27 touchdowns his senior year ... passed for 1,400 yards and 15 scores ... intercepted six times ... scored 12 touchdowns on the ground and totaled 542 rushing yards on 80 attempts ... completed 90-of-147 passing attempts for a 61.0 completion percentage ... missed the last two games of his senior season with a broken hand ... played in only seven games in his final season ... earned first-team academic all-district accolades in each of his final three years ... participated in the U.S. Army High School All-American Bowl with fellow Sooner signees Lendy Holmes, Chris Patterson, Adrian Peterson and Marcus Walker ... chosen as the starting quarterback for the West squad ... named the Outstanding Quarterback at the EA Sports Elite 11 Quarterback Camp ... played in 10 games in both his junior and sophomore campaigns ... racked up 2,860 yards and 25 touchdowns through the air as a junior ... connected on 163 of his 265 passing attempts with 11 interceptions that season ... rushed for 717 yards on 119 carries and 11 touchdowns as a junior ... passed for 1,837 yards and 18 touchdowns as a sophomore when he also rushed for 364 yards and 10 touchdowns ... started the last three games on the varsity squad as a freshman ... coached by his father, Jerry ... also an accomplished baseball player ... garnered first-team All-State and all-area and district MVP honors as a junior ... named to the all-area and all-district teams as a sophomore as well ... chosen as an All-American Scholar-Athlete at the U.S. Army High School All-American Game.

High School: Started and lettered for three years ... also played tight end and returned kickoffs ... team went 37-4 during his three years ... helped lead team to state, district and regional titles in 2002 and 2003 ... totaled 292 tackles (134 solo), 15 interceptions and 26 sacks during his career ... compiled 77 tackles, including 38 solo stops, three sacks and three interceptions as a senior ... amassed 350 yards on kick returns ... returned one of his picks 94 yards for a touchdown ... caught a 37-yard pass for a touchdown and intercepted a pass in the state championship game ... team ended the season with a 14-0 record ... team finished his junior year 13-1 and 10-3 during his sophomore campaign ... coached by Verlon Dorminey ... also played baseball his sophomore year. The Wrapup: runs a 4.5 in the 40-yard dash ... father graduated from Oklahoma and coached under Jimmy Johnson at Oklahoma State ... born Oct. 22, 1985 ... son of Joe and Julie Bowers.

The Wrapup:: Ranked No. 5 out of 575 students in his senior class ... born July 2, 1985 ... son of Jerry and Patty Bomar ... undecided on a major.

RHETT BOMAR

96 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS CHRIS BUSH

YOUNGSTOWN, OHIO URSULINE HIGH SCHOOL

CHANNELVIEW, TEXAS CHANNELVIEW HIGH SCHOOL

OL

6-6

328

FR

OL

The Wrapup: Signed with Oklahoma in 2004, but qualified late and did not attend ... enrolled at OU in spring 2005 ... clocked at 5.1 in the 40 ... coached by Don Murphy ... born Dec. 10, 1985 ... son of Eric Braxton and Tonya Harris.

305

SR

2004: Played center and guard, and specialized in the latter during the season ... started five games at left guard ... helped clear the way for an offense that ranked No. 8 nationally in total offense and No. 14 in scoring offense. 2003: Saw time at both guard and center ... started the opener (North Texas) at center then drew the nod at right guard in game No. 2 at Alabama ... played in the remaining 12 games as a reserve. 2002: Played extensively in the Baylor game after starting center Vince Carter went down with an injury ... made his first career start against Texas Tech.

COACHING STAFF

High School: Rated the No. 53 player in the nation by Rivals.com ... rated the No. 6 offensive lineman in the nation by PrepStar and No. 13 by SuperPrep ... PrepStar All-American ... first team All-State, All-Northeastern Ohio and All-Steel Valley his junior and senior seasons ... a three-year letterman and a two-year starter ... graded out at 87 percent on run blocking and 96 percent on pass blocking his senior year ... team posted a 5-5 mark ... recorded an 86 percent run blocking grade and 91 percent pass blocking grade as a junior ... helped team reach the state semifinals and record a mark of 8-6 in 2002 ... varsity letterman in basketball ... led his conference in scoring ... competed in shot put and discus on the track and field team.

6-3

2 0 0 5 S EAS ON

BRANNDON BRAXTON

2001: Redshirted.

THE SOONERS

High School: Played tight end ... led team in receptions (17) and yards (285) as a senior ... had a 90 percent blocking grade with 40 pancakes ... credited with 24 tackles and two sacks on defense... punted 17 times for a 30.1-yard average ... a shot putter on the track/field team ... coached by Harry McCluskey ... rated the No. 3 TE in Texas by Lone Star Recruiting and in the Midlands by Prep Star. The Wrapup: Oklahoma’s most versatile offensive lineman over the last three seasons ... has added 30 pounds since coming to OU ... one-quarter Indian ... born May 19, 1983 ... son of James and Sherry Bush ... his mother is a cancer survivor ... communications major.

REVIEW & OPPONENTS OKLAHOM A HISTORY

CHRIS BUSH

97 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


TONY CADE

JASON CARTER

LEWISVILLE, TEXAS LEWISVILLE HIGH SCHOOL

TULSA, OKLA. JENKS HIGH SCHOOL

DB

Year 2004

6-1

194

G-GS UT AT Total Loss Sacks INT FC 12-0 4 1 5 0 0-0 0 0

SO

FR PBU 1-0 0

2004: Had five tackles and one fumble forced (at Texas A&M) ... played mostly on special teams. 2003: Redshirted. High School: Was ranked the No. 48 player in the nation, the No. 6 player in Texas and the No. 1 defensive back in Texas by Rivals.com ... tabbed the No. 4 safety in the nation by The Sporting News ... Southwest Defensive Player of the Year by SuperPrep ... two-time All-Stater ... was a three-year starter ... played on special teams and saw action as a wide receiver ... totaled 54 tackles, two interceptions, eight PBU and forced four fumbles as a senior ... blocked two punts and four field goals in that season ... coached by Ronnie Gage ... played in the U.S. Army All-American game in San Antonio ... was a teammate of fellow Sooner Demarrio Pleasant. The Wrapup: Physical safety who was impressive in his redshirt season ... born June 19, 1984 ... son of Clifton Cade ... sociology major.

DB

Year 2003 2004 Total

G-GS 14-0 13-0 27-0

UT AT Total 6 1 7 5 1 6 11 2 13

5-10

202

JR

Loss Sacks INT FC FR PBU 0-0 0-0 0 0 0 0 0-0 0-0 0 0 0 0 0-0 0-0 0 0 0 0

2004: Played on special teams and as a reserve defensive back. 2003: Played in every game on special teams ... backup defensive back ... blocked an LSU punt in the Nokia Sugar Bowl. 2002: Redshirted. High School: Second team All-American by StudentSports.com ... No. 5 corner in the nation by Rivals.com ... No. 8 corner by Insiders.com ... No. 4 defensive back in the nation by SuperPrep ... consensus All-State ... three-year letterman ... played defensive back, wide receiver and running back and also returned kicks ... had 38 total tackles, three sacks, seven interceptions (two for TD) and two fumble recoveries during his final season ... averaged 20-plus yards on kickoff returns and 30.5 yards on punt returns ... carried 31 times for 305 yards and eight touchdowns ... 12 receptions for 196 yards and two TD ... won a state medal in the 100-meter dash ... coached by Allan Trimble. The Wrapup: Son of Rhonda Carter ... one brother plays basketball at Oregon State, another runs track at Coffeyville (Kan.) Community College ... born Sept. 9, 1983 ... sociology major.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

JASON CARTER

98 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS QUENTIN CHANEY

BEAUMONT, TEXAS OZEN HIGH SCHOOL

TULSA, OKLA. BOOKER T. WASHINGTON

OL

6-4

290

SR

WR

2004: Started eight games at left guard ... helped clear the way for an offense that ranked No. 8 nationally in total offense and No. 14 in scoring offense.

2002: Second team freshman All-America selection by Rivals.com ... was pressed into starting duty for the Baylor game after Brad Davis went down with a broken right fibula against Texas A&M ... had team’s highest grade in the Texas Tech game. 2001: Redshirted.

FR (RS)

2004: Redshirted. High School: Four-year starter and letterwinner ... also played at the free safety position ... posted a career 33-8 record and led team to a district championship all four years ... hauled in 24 catches for 570 yards and 12 touchdowns as a senior ... scored three more touchdowns on the defensive end off of interceptions ... totaled 41 tackles and seven interceptions in 2003 ... named a team captain as a senior ... selected to compete in the Oil Bowl ... caught 18 passes his junior year for 404 yards and eight scores ... made 22 stops on defenseintercepted five passes and returned one for a touchdown ... recorded 11 receptions for 155 yards and five scores in 2001 ... eight catches for 139 yards and two touchdowns as a freshman ... coached by Antwain Jimmerson. The Wrapup: Tallest receiver in OU history ... runs the 40-yard dash in 4.5 seconds ... four-year letterwinner in basketballl ... earned all-area honors ... born Nov. 25, 1985 ... son of Melvin Crawford and Regina ChaneyCrawford.

THE SOONERS

High School:: Graded 90 percent as a senior with an average of 11 knockdowns per game ... AP All-Stater as a senior ... two-year starter who helped his team post a record of 18-7 ... played for an offense that topped its district with 404 yards per game ... all-district as a soccer player ... coached by Arthur Louis ... named one of the top 100 players in Texas by the Waco Tribune-Herald.

211

COACHING STAFF

2003: Started all 14 games at left guard ... had a string of 19 consecutive starts at the position ... scored a season-high grade of 92 percent against Baylor ... top knockdown total was 13 against Oklahoma State.

6-6

2 0 0 5 S EAS ON

KELVIN CHAISSON

The Wrapup:: Has 26 starts in his career, second among current Sooners to Davin Joseph’s 27 ... born Oct. 3, 1982 ... son of Carl and Deborah Chaisson ... sociology-criminology major ... collects old coins and has two Buffalo Nickels from 1910 that were given to him by his grandfather.

REVIEW & OPPONENTS

KELVIN CHAISSON OKLAHOM A HISTORY 99 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS CHRIS CHESTER

STEVEN COLEMAN

TUSTIN, CALIF. TUSTIN HIGH SCHOOL

DALLAS, TEXAS SKYLINE HIGH SCHOOL

OL

Year 2002 2003 2004 Total

G-GS 7-0 9-0 2-0 18-0

Rec 2 0 0 2

Yds 25 0 0 25

6-4

Avg 12.5 0 0 12.5

295

TD 1 0 0 1

SR

Long 14 vs. Missouri NA NA 14 vs. Missouri

DT

Year 2004

G-GS 11-0

6-4

291

UT AT Total Loss Sacks INT 1 0 1 0-0 0-0 0

SO

FC FR PBU 0 0 0

2004: Lone tackle came versus Kansas, an unassisted stop. 2003: Redshirted.

2004: Used primarily as a third tight end in OU’s jumbo, short yardage package. 2003: Knee ailment sidelined him for five games, but he returned and played extensively in jumbo formations over the final six games ... had one tackle on special teams. 2002: Caught a fourth-quarter touchdown pass off a fake field goal at Missouri to give the Sooners a come-from-behind victory ... also had a catch against Texas Tech. 2001: Redshirted.

High School: Ranked the No. 17 defensive tackle in the nation by both Rivals.com and The Sporting News ... Rivals also slotted him as the No. 18 overall player in Texas ... named to the DFW Coca-Cola All-Star game and logged two sacks in that game ... had 38 tackles as a senior with two fumbles forced, two sacks, six deflections and four quarterback hurries ... helped team to the 5A playoffs as both a junior and senior ... also played on the offensive line during his high school career and had 72 pancakes as a sophomore (right guard) ... excellent high school student. The Wrapup: Born Feb. 8, 1985 ... son of Joseph and Shirley Coleman ... sociology major.

High School:: Had 815 yards receiving yards and 11 touchdowns as a senior ... rushed for 450 yards and five touchdowns ... league defensive player of the year ... also an accomplished basketball player and discus thrower ... No. 8 tight end in the nation by Rivals.com ... two-time Golden West All-League ... a first team All-Orange County selection by the Los Angeles Times. The Wrapup:: Born Jan. 12, 1983 ... son of Henry and Althia Chester ... political science major ... began taking snaps with the offensive line in spring of 2004 and will likely be used exclusively in that role in 2005.

CHRIS CHESTER

100 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS RUSSELL DENNISON

COLLEYVILLE, TEXAS HERITAGE HIGH SCHOOL

WEATHERFORD, OKLA. WEATHERFORD HIGH SCHOOL

DE

6-2

242

FR (RS)

2004: Redshirted.

The Wrapup: Clocked at 4.7 in the 40-yard dash ... coached by Chris Cunningham ... born May 22, 1986 ... son of Alan and Vernessa Davis.

Year 2002 2003 2004 Total

6-3

G-GS UT AT Total Loss Sacks 13-0 15 6 21 0-0 0-0 14-0 7 4 11 2-2 0-0 13-0 4 5 9 0-0 0-0 40-0 26 15 41 2-2 0-0

225

INT 0-0 0-0 0-0 0-0

SR

FC FR PBU 0 0 0 0 1 0 0 0 0 0 1 0

2004: Special teams stalwart ... played on five units (only other Sooner on that many was Mark Bradley) ... three tackles vs. Oregon. 2003: Outstanding special teams player ... sure tackler who had 11 stops on the season, including seven that were unassisted ... two tackles for two yards in losses ... recovered a fumble against Oklahoma State.

2001: Redshirted ... won the Iron Man Award for outstanding performance in the strength and conditioning area.

RUSSELL DENNISON

OKLAHOM A HISTORY

The Wrapup: Special teams standout who has 33 specials teams tackles during his career (18 in 2002, 7 in ‘03 and 8 in ‘04) ... also has a pair of kickoff returns (17 and 5 yards) and a fumble recovery in special teams play ... born Oct. 10, 1982 ... son of Fred and Gail Dennison ... history major ... collects vinyl record albums ... has climbed Wheeler Peak, the highest point in New Mexico (13,161 feet) ... has a goal to climb all the highest points in each state ... says the event that most shaped his life was, “playing catch with my dad.”

REVIEW & OPPONENTS

High School: Three-year starter who recorded the second highest tackles total at Weatherford with 104 in his senior season ... had two interceptions and two fumble recoveries in that same season ... also spent time at running back and receiver ... posted 1,370 all-purpose yards and 18 touchdowns in his final season ... helped his team to a state championship in Class 4A ... rushed 191 times for 1,292 yards and 20 touchdowns during his career as a tailback ... played strong safety as a junior ... had 101 tackles (28 solo), three for loss, five interceptions and two sacks ... was a starter for the basketball team and also ran track ... coached by Woody Roof ... named the No. 32 player in the Midlands by SuperPrep ... member of the Daily Oklahoman Red-Chip List ... state champion in the 400 meters and runner-up in the 200 meters.

THE SOONERS

2002: Saw snaps at linebacker ... emerged as a truly outstanding special teams player, particularly in kickoff coverage ... career-high seven tackles against UTEP ... had 22 yards while returning two short kickoffs.

COACHING STAFF

High School: Lettered his last two years ... shared time at defensive end and tight end during his career ... made 25 stops and recorded three sacks on defense as a senior ... hauled in 11 catches for 130 yards as a senior on offense ... also ran for 91 yards on seven carries ... served as a team captain his senior year ... played in the Coca-Cola All-Star Classic at defensive end ... selected to play in the Oil Bowl All-Star Game ... helped lead team to a 9-2 record during his junior season.

FB

2 0 0 5 S EAS ON

ALAN DAVIS

101 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


ALONZO DOTSON

DUSTY DVORACEK

ALIEF, TEXAS HASTINGS HIGH SCHOOL

LAKE DALLAS, TEXAS LAKE DALLAS HIGH SCHOOL

DE

6-3

239

7 NATI ONAL CHAMPIONSHIPS

SO

2004: Played in a backup role. 2003: Redshirted. High School: His senior team was 11-3 with a district championship ... that club advanced four rounds in the state playoffs ... recorded 114 tackles (89 assisted, 25 solo), 15 tackles for loss and 12 sacks in his final prep campaign ... also competed in the discus for the track and field team. The Wrapup: Born March 24, 1985 ... nephew of former Green Bay Packers star Santana Dotson and grandson of Alphonse Dotson, who played for the Oakland Raiders in 1970 ... son of James and Kenyatta Davis ... sociology major.

DT

Year 2001 2002 2003 2004 Total

G-GS UT AT Total 9-0 14 8 22 12-1 13 12 25 14-14 20 20 40 2-2 1 4 5 37-18 48 44 92

6-3

298

SR

Loss Sacks INT FC FR PBU 4-24 2-12 0 0 0 0 5-20 3-11 0 0 1 0 16-60 7-41 0 0 0 1 1-2 0-0 0 0 1 1 26-106 12-64 0 0 2 2

2004: Started in the first two games then was dismissed from the team for the remainder of the season ... received a hardship ruling from the NCAA to regain one year of eligibility. 2003: Consensus All-Big 12 first team selection ... No. 3 on the team, first among the interior linemen, with 16 tackles for loss (-60) ... Those 16 TFL ranked No. 18 in OU history, 10th best by a Sooner defensive lineman ... No. 2 on the team, first among the interior linemen, with seven sacks (-41) ... two sacks each against Iowa State and Missouri ... season-high six tackles versus. the Cyclones ... credited with 15 QB hurries on the season ... batted a pass against Texas that Jonathan Jackson intercepted and returned for a touchdown ... CoSIDA Academic All-District ... first-team All-Big 12 Academic. 2002: Verizon All-Academic District VI second team ... bothered early by a toe injury ... came on strong late ... recovered a fumble in the Rose Bowl ... had three sacks, including two against Texas Tech ... also had two quarterback hurries against the Red Raiders ... season-high three tackles in four games.

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

2001: Played in all 11 games as a true freshman ... had two sacks in the SBC Cotton Bowl Classic win over Arkansas ... season-best five tackles and three quarterback hurries in his first career game (at Air Force) ... finished the season with 20 tackles, two tackles for loss and five quarterback hurries ... named to the Big 12 Commissioner’s Honor Roll.

DUSTY DVORACEK

School: Member of the Houston Chronicle Top 100 list ... named to High School the Dallas Morning News’ Texas Top 100 ... had 79 tackles, 9.5 sacks, four fumble recoveries and 10 forced fumbles in seven games as a senior ... started at defensive tackle and offensive guard in each of his final three seasons ... graded out at 89 percent with 101 pancake blocks as an offensive guard ... qualified for state as a powerlifter ... best lift was 1,555 pounds ... was a shot putter ... recorded a career best of 56-9.5 ... coached by Ty Mayfield ... All-Region II 3A on offense and defense as a junior ... also captured first team all-district honors on offense and defense. Wrapup: Suffered a torn left bicep in the 2005 spring game ... No. The Wrapup 19 on OU’s career sack list with 12 ... last name is pronounced duh-VORcheck ... born March 3, 1981 ... son of Dennis and Sandra Dvoracek ... management major ... winner of the Pace (University College award for top one percent of freshmen on campus) and Jay Myers (Athletics Department award for combining excellence in scholarship and potential in athletics performance) awards ... shared awards with Vince Carter.

102 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS CODY FREEBY

ARLINGTON, TEXAS ARLINGTON HIGH SCHOOL

FORT WORTH, TEXAS FORT WORTH CHRISTIAN HIGH

TE

Year 2004

G-GS 12-0

Rec 7

Yds 94

6-6

Avg 13.4

228

TD 1

SO

P

Long 24 vs. Texas A&M

2003: Redshirted.

SO

2004: Backup to Blake Ferguson who handled all of the punting chores. 2003: Redshirted. High School: First team All-USA Today ... rated the No. 2 punter in the nation by Insiders.com ... No. 10 kicker by Rivals ... punted in the Army All-American High School Bowl ... named to Max Emfinger’s Texas AllState Super Team ... conference special teams player of the year ... Texas Top 100 by the Fort Worth Star-Telegram ... averaged 44.5 yards per punt with 4.2-second hang time as a senior ... also compiled 73 tackles and two interceptions as a defensive back ... averaged 42.0 yards as a junior when he was second team on the USA Today squad ... his 2000 team was state runner-up ... four-year member of the track and field team and also a participant in baseball and basketball. The Wrapup: Born Dec. 10, 1984 ... son of Clark and Peggy Freeby ... sociology major ... wore No. 18 in high school, but had to switch at OU since that number was assigned to Jason White.

The Wrapup:: Talented player who made a run at playing time in his first season of eligibility ... born Jan. 30, 1985 ... his brother, Matt, played defensive back at Nebraska and is now with the Kansas City Chiefs ... son of Mickey and Patty Finley ... sociology major.

THE SOONERS

High School: A top-35 athlete nationally by two recruiting services ... No. 24 quarterback in the nation by SuperPrep ... started at quarterback as a junior and senior and at tight end as a sophomore ... senior team was 12-2 with district and bi-district championships for a second consecutive year ... passed for 1,626 yards and rushed for 897 as a senior ... completed 82-of-168 passes and tossed 12 touchdowns in his final prep season ... also rushed for nine TDs and averaged 6.6 yards per carry ... coached by his father ... a hurdler on the track and field team ... qualified for the state meet in the 110 meter hurdles.

227

COACHING STAFF

2004: Four of his six catches came over the last four games ... had a 24yard touchdown reception at A&M ... season-high two catches at Baylor ... All-Big 12 Academic.

6-2

2 0 0 5 S EAS ON

JOE JON FINLEY

REVIEW & OPPONENTS OKLAHOM A HISTORY

JOE JON FINLEY

103 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS TOMMY GRADY

JACOB GUTIERREZ

HUNTINGTON BEACH, CALIF. EDISON HIGH SCHOOL

SAN ANTONIO, TEXAS MADISON HIGH SCHOOL

QB

Year 2004 Year 2004

G-GS 5-0 G-GS 5-0

Comp.-Att 12-14 Rush Att. 12-14

6-7

Pct. .923 Yds .923

Yds 63

221

SO

Avg 5.25

TD 1

Avg 5.25

TD 1

RB

INT 0 Long 0

2004: Saw action in five games ... completed 12-of-14 passes on the season, including 8-of-9 versus Houston ... had a nine-yard rush versus Houston. 2003: Redshirted. High School: Generally considered one of the top five prep quarterbacks in the country ... rated the No. 9 overall player in California and No. 55 nationally by Rivals.com ... led team to playoffs in 2002 and to a championship in 2001 ... passed for 2,474 yards and 15 touchdowns as a senior ... completed 177-of-320 passes and was intercepted nine times ... threw for 2,791 yards and 33 touchdowns as a junior ... completed 61 percent of his passes and was intercepted only three times as a junior ... was invited to the Elite 11 Quarterback Camp in Mission Viejo, Calif., following his junior year.

5-6

185

SO

2004: Worked in a reserve role. 2003: Redshirted. High School: Offensive Player of the Year in 2002 as named by the San Antonio Quarterback Club ... two-time all-district and all-city selection ... three-year starter ... finished career with 4,507 rushing yards and 52 touchdowns ... as a senior, he carried 189 times for 1,815 yards, caught 11 passes for 123 yards and scored 52 touchdowns ... as a junior, he had 1,626 yards on 213 carries and 18 touchdowns. The Wrapup: Received the Youth Citizen Award, recognizing volunteerism, from the United Way of Norman and Junior League of Norman in the spring of 2005 ... born March 13, 1984 ... son of Art and Linda Gutierrez ... majoring in sociology.

The Wrapup:: Born March 18, 1985 ... his brother, Jeff, played quarterback at Fresno State ... university studies major ... enjoys deep sea fishing (caught a 400-pound Marlin in the summer of 2004).

TOMMY GRADY

104 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS DONTA HICKSON

SOUTHLAKE, TEXAS CARROLL HIGH SCHOOL

McKINNEY, TEXAS McKINNEY HIGH SCHOOL

K

Year 2004

G 3

Att.-Made Pct. 1-1 1.000

5-9

Blk. 0

182

SO

Long PAT 29 vs. USC 12-12

Pct. 1.000

The Wrapup: Born May 16, 1986 ... son of Bill and Cookie Hartley ... majoring in marketing.

199

SR

Year 2002 2003 2004 Total

G-GS 3-0 12-0 5-0 20-0

Rush 6 78 10 94

Yds 0 306 61 357

Avg. 0.0 3.9 6.1 3.8

TD 0 2 1 3

Long 5 vs. ISU 27 vs. TAMU 25 vs. Oregon 27 vs. TAMU

Year 2002 2003 2004 Total

G-GS 3-0 12-0 5-0 20-0

Rec. 0 6 2 8

Yds 0 83 -3 80

Avg. 0 13.8 -1.5 10.0

TD 0 0 0 0

Long 55 vs. Texas 55 vs. Texas

2004: Split his 10 carries between appearances in the Oregon and Colorado games ... eight rushes for 33 yards versus. CU and a 25-yard TD burst against Oregon. 2003: Led team with 131 yards on 24 rushes versus. Texas A&M ... TD rushes versus. A&M and Iowa State ... 14 carries for 55 yards versus. Missouri ... 55-yard reception versus. Texas. 2002: Backup running back ... three carries each against Iowa State and Texas Tech.

THE SOONERS

High School: Rated No. 2 kicker in the national by Rivals.com ... No. 71 player in Texas (SuperPrep) ... named All-State by Dallas Morning News ... three-year starter and letterman ... set a national record for points in a career by a kicker ... established a state record for extra points in a career with 90 ... successful on 14 of his 26 field goal attempts in 2003 ... recorded a long of 52 yards ... 86 percent of kickoffs went for touchbacks ... also served as the team’s punter and averaged 44.3 yards per kick ... nailed 14 of his 17 field goal attempts as a junior ... hit on 11-of-13 tries in 2001 ... coached by Todd Dodge.

5-10

COACHING STAFF

2004: Took over as the starting kicker at Baylor, where he made all four of his PATs ... made all 12 of his PATs on the season ... his lone field goal attempt was a 29-yard make against Southern California in the Orange Bowl ... also had primary kickoff responsibilities after taking over the placements.

RB

2 0 0 5 S EAS ON

GARRETT HARTLEY

2001: Redshirted.

Wrapup: Born Feb. 17, 1982 ... son of Erwin and Zephia Hickson ... The Wrapup sociology major ... favorite class at OU was Wealth, Power and Prestige.

REVIEW & OPPONENTS

School: Set school records with 2,581 rushing yards and 31 TDs as High School a senior ... 30 carries, 329 yards and four TD in win over Lewisville ... had two 400-yard and three 300-yard outings ... had 421 rushing yards and six TD (school records) in a 44-20 win over The Colony.

DONTA HICKSON OKLAHOM A HISTORY 105 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


LENDY HOLMES

CLINT INGRAM

DALLAS, TEXAS SOUTH OAK CLIFF HIGH SCHOOL

HALLSVILLE, TEXAS HALLSVILLE HIGH SCHOOL

WR

6-2

191

FR (RS)

2004: Redshirted. High School: A three-year letterman ... competed at eight different positions during his career including punter, kicker, quarterback, running back, wide receiver and defensive back ... also returned punts and kickoffs ... posted an 8-1 record as a starting quarterback during his career ... caught 38 passes and scored 10 touchdowns his senior year ... tossed two touchdown strikes as well ... intercepted six passes on defense ... played in only two games as a senior due to a broken collarbone ... team posted a 6-5 mark ... participated in the U.S. Army High School All-American Bowl with fellow Sooner signees Rhett Bomar, Chris Patterson, Adrian Peterson and Marcus Walker ... caught six passes and scored two touchdowns during the Coca-Cola All-Star Game ... hauled in 38 catches for 505 yards as a junior ... also intercepted four passes on defense ... team went 3-7 in 2002 and 6-5 his sophomore year ... runs a 4.4 in the 40-yard dash ... coached by J.B. Wallace ... also a three-year letterman in basketball ... was first-team all-district ... averaged 11 points, six rebounds, 4.5 assists and 2.5 assists during his junior campaign ... selected to the Midland Oilman’s Classic all-tournament team as a sophomore and junior ... earned all-tournament honors at the Coca-Cola and Elite Eight tournaments in 2002. The Wrapup: Born Oct. 28, 1985 ... son of Lendy and Charlotte Holmes.

LB

Year 2002 2003 2004 Total

G-GS UT AT Total 8-0 8 3 11 13-0 4 1 5 13-11 30 20 50 34-11 42 24 66

6-1

236

Loss Sacks INT 0-0 0-0 0-0 0-0 0-0 0-0 4-17 2-9 0-0 4-17 2-9 0-0

SR

FC 0 0 2 2

FR PBU 0-0 0 0-0 0 2-0 3 2-0 3

2004: Physical and fast strong side linebacker ... tackle best of nine against Oregon ... one sack each against Oregon and Kansas ... recovered two fumbles versus Texas, including one that he forced. 2003: Season-high two tackles against Fresno State. 2002: Played on special teams and as a backup linebacker ... had three tackles at Baylor. 2001: Redshirted. High School: Had 100 tackles, three forced fumbles and one interception as a senior ... coached by Roger Adams ... No. 6 linebacker in the Midlands by PrepStar ... No. 25 player in Texas by LoneStarRecruiting. com ... first team all-district (Class 17-4A) as a senior. The Wrapup: Enjoyed perhaps the most productive 2005 spring of any player in the team ... born March 21, 1983 ... son of Leslie and Murline Ingram ... sociology-criminology major ... nephew of former Dallas Cowboys standout Robert Newhouse.

CLINT INGRAM

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

106 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS DAVIN JOSEPH

TULSA, OKLA. JENKS HIGH SCHOOL

HALLANDALE, FLA. HALLANDALE HIGH SCHOOL

RB

5-9

189

SR

OL

G-GS 14-0 14-4 12-5 40-9

Rush 159 225 129 513

Yds 607 925 513 2,045

Avg. 3.8 4.1 4.0 4.0

TD 14 13 5 32

Long 39 at Tulsa 42 vs. KSU 26 vs. Houston 66 vs. OSU

Year 2002 2003 2004 Total

G-GS 14-0 14-4 12-5 40-9

Rec. 1 18 22 41

Yds 3 189 196 388

Avg. 3.0 10.5 8.9 9.5

TD 0 1 0 1

Long 3 vs. USF 77 vs. TTU 25 vs. USC 77 vs. TTU

2003: Exceeded 50 yards in every game but one ... scampered for a career-high 120 on 24 carries against Texas A&M ... logged his longest career rush with a 42-yarder against Kansas State ... ran 77 yards for a touchdown with a swing pass against Texas Tech ... had at least one reception in 10 games.

2004: Second team All-Big 12 ... continued on a collision course with national acclaim ... started every game at right guard ... tied with Vince Carter for the fewest missed assignments on the line with three ... secondhighest season grade on the team at 82 percent ... helped clear the way for an offense that ranked No. 8 nationally in total offense and No. 14 in scoring offense. 2003: Started 12 games at right guard, including the last 11 in a row ... perhaps Oklahoma’s most athletic offensive lineman ... best grade was 78 percent against Iowa State ... had a season-high 15 knockdowns against Fresno State ... second team Academic All-Big 12. 2002: All-Big 12 Freshman by The Sporting News ... moved from the defensive line to offensive guard in preseason drills ... saw action in 12 of 13 games ... got his first OU career start versus Colorado in Big 12 title game ... also started in the Rose Bowl against Washington State. High School: No. 19 offensive guard in the nation by Rivals.com ... No. 10 player in Florida by SuperPrep ... a four-year starter ... All-State ... named the Broward County Defensive Player of the Year as a senior ... recorded 24 sacks and 100 tackles as a senior defensive lineman ... recruited to play defense at OU, but also played offense in high school and had 31 pancake blocks as a senior ... played a school-record 532 plays ... ranked No. 8 among the nation’s high school heavyweight wrestlers ... 2A state wrestling champion in Florida ... won one of the nation’s major wrestling tournaments during summer of 2001 ... coached by Ron Woods. The Wrapup: Has 27 career starts, which is tops among current Sooner players ... All-America candidate ... son of Minnie and Elie Joseph ... born Nov. 22, 1983 ... sociology major.

2001: Redshirted.

KEJUAN JONES

The Wrapup: No. 24 on OU’s career rushing list with 2,045 yards, and is one of 28 2,000-yard rushers in school history ... No. 12 in career rushing attempts with 513 ... born Oct. 22, 1982 ... son of Tracy Jones .. AfricanAmerican studies major ... wanted No. 20 at OU in honor of Billy Sims.

OKLAHOM A HISTORY

High School: Rushed for 1,725 yards and 29 touchdowns as a senior to help Jenks to the 6A state title ... No. 4 rusher in the state ... averaged 8.8 yards/carry ... scored five touchdowns and had 316 yards of total offense in a win over rival Tulsa Union ... caught an 80-yard game-winning TD pass in the final seconds of that game ... opened the season by scoring two touchdowns on the first five offensive plays ... also an outstanding track athlete ... eighth as a junior in the state 100 meters ... coached by Allan Trimble.

REVIEW & OPPONENTS

2002: Rushed 11 times for 74 yards versus. Tulsa in his Sooner debut ... had 86 yards versus. Iowa State and 82 versus. Colorado (regular season) ... gave OU the go-ahead TD with an eight-yard burst late in the Alabama game ... had at least one touchdown in nine games ... set then OU record for a freshman with 14 touchdowns ... co-winner of OU’s offensive newcomer/freshman of the year award (with J.D. Runnels).

SR

THE SOONERS

2004: Career bests with 32 rushes for 148 yards against Bowling Green ... his 22 receptions ranked No. 5 on the team and best by any player not listed as a WR ... season highs in catches and receiving yards with five for 46 yards at Baylor ... long reception went for 23 yards vs. Oregon ... missed the Texas Tech game with an injury.

306

COACHING STAFF

Year 2002 2003 2004 Total

6-3

2 0 0 5 S EAS ON

KEJUAN JONES

107 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


ZACH LATIMER

CHRIS MESSNER

DENVER, COLO. GATEWAY HIGH SCHOOL

FREDERICK, OKLA. FREDERICK H IGH SCHOOL

LB

Year 2003 2004 Total

G-GS 7-0 8-0 15-0

UT AT Total 8 4 12 8 4 12

Loss 3-4 3-4

6-2

220

SR

Sacks INT FC FR PBU 1-1 1-1 -

2004: Tied for team-high honors with four tackles versus Colorado ... also had four stops against Houston. 2003: Worked in a backup role and on special teams. 2002: Redshirted. High School: Parade All-American ... ranked among the top 100 players in the country by several services ... No. 14 linebacker in the nation by SuperPrep ... ranked among the top 100 players in the country by two recruiting services ... Colorado Defensive Player of the Year by the Denver Post and Rocky Mountain News ... Gatorade Colorado Player of the Year ... two-time All-State player ... 4A defensive player of the year in class 4A ... four-year starter ... had 93 tackles and 16 sacks as a senior ... also played H-back, receiver and tight end on offense ... led team to 9-3 record and second-place league finish ... helped team qualify for the state playoffs for the first time in 15 years ... led the state in sacks while piling up 108 tackles and eight fumble recoveries as a junior ... coached by Jeff Sweet ... also a four-year starter in basketball.

OL

6-6

280

JR

2004: Saw action in six games as a backup tackle. 2003: One of the top reserves along the offensive line ... started the opener at left tackle, then worked as a reserve in 11 of the last 12 games. 2002: Redshirted. High School: A three-year starter ... versatile player who started at six different positions during his high school career ... All-State by the Oklahoma Coaches Association ... accounted for 68 tackles and eight sacks during his senior season in addition to two interceptions and two blocked punts ... also played quarterback his senior season with 627 rushing yards, 754 passing yards and 12 touchdowns ... finished his junior year with 69 tackles, 11 sacks, two blocked punts and one blocked kick ... started in basketball and baseball and was a member of the golf team ... coached by Todd Hudson. The Wrapup: Son of Richard and Marcia Messner ... born Oct. 9, 1983 ... sociology major ... eats the same meal prior to each game -- mixture of lasagna and green beans followed by two bowls of Cinnamon Toast Crunch.

The Wrapup:: Born Oct. 21, 1983 ... son of Don and Cynthia Latimer ... father played for the Miami Hurricanes and Denver Broncos ... sociology major.

ZACH LATIMER

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

108 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS JAMES MOSES

WHEATON, ILL. WHEATON NORTH HIGH SCHOOL

HOUSTON, TEXAS NORTH SHORE HIGH SCHOOL

OL

6-5

306

SO

TE

2004: Backup OT who saw action in five games ... pronounced uh-kim. 2003: Redshirted.

Rec 2 5 17 24

Yds 27 62 151 240

Avg 13.5 12.4 8.9 10.0

TD 0 0 2 2

SR

Long 19 vs. Wash. State 28 vs. UCLA 40 vs. Texas A&M 40 vs. Texas A&M

2004: Led the OU tight ends with 17 receptions for 151 yards ... three catches against Kansas, Texas A&M and Baylor ... yardage best was 45 at A&M ... also had a career-long grab of 40 yards against the Aggies ... touchdowns versus Oregon and A&M ... also an effective blocker who is used in short yardage situations. 2003: Started the first two games and played in all 13 ... three grabs for 30 yards in the opener, both career highs ... had a career-best 28-yard catch against UCLA. 2002: Had two catches on the season, including a 19-yard grab against Washington State in the Rose Bowl ... credited with two tackles on special teams. 2001: Redshirted.

The Wrapup: Nickname is “Bubba,” given to him by his father after former NFL player Bubba McDowell ... born June 17, 1982 ... son of James and Dorothy Moses ... sociology/criminology major.

OKLAHOM A HISTORY

JAMES MOSES

REVIEW & OPPONENTS

High School: Gained more than 200 yards on just 10 catches in his final season ... recorded 28 catches for 406 yards and four touchdowns as a junior ... caught 17 passes for 266 yards as a sophomore ... a high school teammate of Sooner defensive end Jonathan Jackson ... coached by David Aymond ... named the No. 1 tight end in the Midlands by PrepStar ... No. 15 tight end nationally by Rivals.com ... one of Texas’ top 100 players by the Dallas Morning News and Houston Chronicle.

THE SOONERS

The Wrapup: Born Jan. 29, 1985 in Trinidad and Tobago ... moved to Miami at age 12 and then on to Wheaton, Ill., as an eighth-grader ... had no knowledge of American football when he began the game (freshman in high school) and learned by watching video games and reading “Football For Dummies” ... son of Valarie Peltio ... sociology major.

G-GS 13-0 14-2 13-11 40-13

237

COACHING STAFF

High School: Rated among the top 30 offensive linemen in the nation by three recruiting services ... first team all-state by the Chicago Tribune, Chicago Sun-Times and the Illinois Coaches Association ... Most Outstanding Lineman in the state by the ICA ... played in the Army All-American Bowl ... lettered and started his final two seasons ... played offensive tackle and defensive end as a senior ... did not give up a sack in either of his final two seasons ... graded at 90 percent for the season and recorded 86 pancakes ... broke his wrist in the second quarter of a game early in his junior season and missed seven contests ... coached by Matt Foster ... threw the discus on the track and field team ... attended same high school as OU offensive coordinator Chuck Long.

Year 2002 2003 2004 Total

6-3

2 0 0 5 S EAS ON

AKIM MILLINGTON

109 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


LAENAR NIXON

CHIJIOKE ONYENEGECHA

MIAMI, FLA. CAROL CITY HIGH SCHOOL

RICHMOND, CALIF. CITY COLLEGE OF SAN FRANCISCO

DE

Year G-GS 2003 0-0 2004 3-0 Total 3-0

6-3

UT AT Total Loss Sacks 2 2 -

218

INT FC -

JR

FR PBU -

2004: Had tackles against Houston and Oregon. 2003: Worked in a backup role. 2002: Redshirted. High School: No. 11 tight end by Insider.com ... ranked among the top 100 players in Florida ... limited to four games by an injury as a senior ... caught six passes and averaged 17 yards per catch ... totaled 315 yards on 28 receptions and eight touchdowns his junior year ... also played on special teams ... a three-year starter ... coached by Walt Frazier. The Wrapup: Son of Fred and Juanita Nixon ... born Oct. 16, 1983 ... communications major ... first name pronounced luh-NAR ... his father played at OU and lettered from 1976-79 ... cousin of former major leaguer Otis Nixon.

DB

Year G-GS 2004 13-4

6-1

202

UT AT Total Loss Sacks INT 19 8 27 1-8 1-8 0

FC 1

SR

FR PBU 0 6

2004: Career-high seven tackles and a key forced fumble at A&M ... a starter in four games. Junior College: Regarded as the finest junior college corner in the nation in 2002 ... No. 2 JUCO player by Rivals.com and the No. 8 JUCO player by SuperPrep ... first-team JC Gridwire All-American ... team won the national junior college championship during his freshman season ... coached at City College by George Rush. High School: Prepped at El Cerrito HS in the Bay area ... started for two seasons ... started at running back and defensive back ... second-team All-State as a defensive back his senior year ... named to the All-West first team by The Contra Costa Times ... a member of The Contra Costa Times “Cream of the Crop” listing as a senior ... a member of The San Francisco Chronicle’s Top 25 players ... all-conference at defensive back and running back in his final season ... an All-East Bay selection as a utility player ... team defensive MVP as a senior ... totaled better than 800 rushing yards and 300 receiving yards in his final season ... averaged nearly 7.8 yards per carry ... also averaged close to 35 yards per return as a kickoff and punt return specialist ... coached by Frank Milo ... lettered in track and field for two years ... team most valuable player in track as a senior ... qualified for the state track meet in the 100- and 200-meter events in his final year ... the 100-meter champion for the north coast section ... posted personal prep bests in the 100 meters at 10.66 and in the 200 meters at 21.60. Wrapup: Signed a financial aid agreement with Oklahoma in April The Wrapup 2003, but did not report to Norman as he worked out his eligibility ... graduated from City College of San Francisco at the completion of the 2003 fall term thus achieving eligibility at Oklahoma ... was out of college football for the 2003 season ... runs a 4.3 40-yard dash ... born March 15, 1983, in San Francisco, Calif. ... son of Lucy Onyenegecha ... brother, Etoagwara, played basketball at Cal State-Northridge and saw action against OU in Norman during the 2004-2005 season ... African-American studies major.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

CHIJIOKE ONYENEGECHA

110 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS ADRIAN PETERSON

SAPULPA, OKLA. SAPULPA HIGH SCHOOL

PALESTINE, TEXAS PALESTINE HIGH SCHOOL

DT

Year 2004

G-GS UT AT Total 13-11 5 12 17

6-5

277

SO

RB

Loss Sacks INT FC FR PBU 3-9 1-7 0 2 0 0

2003: Redshirted. High School: All-State and all-area selection ... nation’s No. 9 defensive tackle according to Rivals.com ... team MVP in 2002 ... selected for the National High School All-Star Game in San Antonio, Texas ... played as both an offensive and defensive tackle ... recorded six sacks as a senior.

Lg 80

Rec. Avg. TD Long 5-12 2.4 0 6

2004: Finished second in the Heisman balloting, the best finish ever by a freshman ... was No. 3 in voting for the Maxwell Award (player of the year) ... while playing against a schedule that included six ranked opponents, proved to be one of the greatest freshman rushers in the history of college football by being named a consensus All-American ... first player in Oklahoma’s illustrious football history to be named All-American as a freshman ... first freshman since Dre Bly in 1996 to be named an AP All-American ... first-ever freshman Doak Walker Award finalist ... totaled a nation-leading and NCAA freshman record 339 rushing attempts (thirdhighest total in OU history) ... No. 3 nationally with 1,925 rushing yards ... yards after contact were 1,365, or 71 percent of his net rushing yards ... broke the OU school single season rushing record set in 1978 by Billy Sims (1,896) and the NCAA freshman record set in 1996 by Wisconsin’s Ron Dayne (1,863) ... broke two other NCAA freshman rushing records -- most consecutive 100-yard rushing games (9) and most total 100-yard rushing games (11) ... His total of 11 100-yard games moved him to No. 7 on OU’s career list and was the second-highest single season total in school history (Quentin Griffin had 12 in 2002) ... tied the NCAA freshman record for reaching 1,000 yards in the fewest games (7) with Emmitt Smith (Florida, 1987) and Marshall Faulk (San Diego State, 1991) ... Greg Pruitt, who reached 1,000 yards in just six games of the 1971 season, is the only OU back to reach the coveted plateau faster than Peterson ... rushed for 100 yards in 11 of 13 games ... lone exceptions were game 10 when he did not start and played sparingly in a win over Nebraska (15-58) due to an injury suffered in the previous game and the Orange Bowl (25-82) ... ranked No. 6 nationally in rushing yards (148.1 per game) ... averaged 164.0 yards against the four highest-ranked opponents OU faced ... set an OU freshman all-purpose yardage record with 1,937 yards, the third-highest figure in school history ... ranked No. 15 nationally with 149.0 all-purpose yards per game ... had 44 runs of 10 or more yards and eight of 35 yards or longer ... just the second OU freshman to rush for 100 yards in his debut, and the first running back to do so.

Wrapup: Runs a 4.4 in the 40-yard dash ... posted bench press mark The Wrapup of 295 and a squat of 480 pounds ... coached by Jerry Harrell ... also competed in track and field and basketball ... born March 21, 1985 ... son of Nelson Peterson and Bonita Jackson.

OKLAHOM A HISTORY

School: Consensus player of the year in high school football ... High School rushed for 2,960 yards on 252 attempts, an average of 11.7 yards per carry, and 32 touchdowns as a senior ... finished his 2002 campaign with 2,051 yards on 246 carries, an average of 8.3 yards per carry, and 22 touchdowns ... announced he would become a Sooner after he scored two touchdowns in the U.S. Army High School All-American Game ... led the West squad with 95 yards on nine carries ... All-Star game rushing total included a 50-yard run in the fourth quarter ... participated in the game with fellow Sooner signees Rhett Bomar, Lendy Holmes and Marcus Walker.

REVIEW & OPPONENTS

ADRIAN PETERSON

TD 15

SO

THE SOONERS

The Wrapup: Serves as president of OU’s chapter of the Fellowship of Christian Athletes and speaks frequently to youth groups across the state ... served as an OU yell leader during 2003-2004 basketball season ... born Oct. 18, 1984 ... son of Carl and Nechia Pendleton ... lived in Georgia during his childhood ... father played football at the University of Tulsa and also wore No. 68 ... Sociology major.

G-GS Rushing Avg. 13-8 339-1,925 5.7

211

COACHING STAFF

2004: Started eight of the last nine games ... missed the Kansas game with an injury ... season-high four tackles and his lone sack versus` Texas ... All-Big 12 Academic.

Year 2002

6-2

2 0 0 5 S EAS ON

CARL PENDLETON

111 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


DEMARRIO PLEASANT

JOWAHN POTEAT

LEWISVILLE, TEXAS LEWISVILLE HIGH SCHOOL

ARDMORE, OKLA. ARDMORE HIGH SCHOOL

LB

Year 2004

G-GS 12-0

6-2

235

SO

UT AT Total Loss Sacks INT FC FR PBU 2 1 3 0-0 0-0 0-0 -

2004: Got two of his three tackles at Oklahoma State ... saw action in 13 games.

DB

5-11

Year G-GS UT AT Total Loss Sacks 2002 12-0 8 2 10 0-0 0-0 2003 14-0 2 3 5 0-0 0-0 2004 8-0 3 2 5 0-0 0-0 Total 34-0 13 7 20 0-0 0-0

196

SR

INT FC FR PBU 0-0 1 0 3 0-0 0 1 1 0-0 0 0 0 0-0 1 1 4

2003: Redshirted.

2004: Two tackles each against Colorado and Nebraska.

High School: Consensus top-10 linebacker in the nation by major recruiting services ... Top 100 Dream Team by PrepStar ... U.S. Army All-American ... District 7-5A Defensive Player of the Year ... twice named first team all-district ... lettered three years and was a starter for two and one-half seasons ... made 138 tackles, including 10 for loss, four sacks and two fumble recoveries during his senior campaign ... recorded 88 tackles, 12 for loss, and two interceptions as a junior ... teammate of fellow Sooner Tony Cade ... coached by Ronnie Gage ... competed on the basketball team.

2003: Played in every game ... had five total tackles with two against Fresno State.

The Wrapup: Born Oct. 11, 1984 ... son of Dwayne and Susan Pleasant ... sociology major ... his cousin Erwin Swiney played college ball at Nebraska before moving on to the Green Bay Packers.

2002: Saw action as a reserve and on special teams ... posted tackles in four games ... broke up three passes, including two at Baylor ... forced a fumble vs. Texas Tech. 2001: Redshirted ... named to the Big 12 Commissioner’s Honor Roll. High School: Played receiver and cornerback ... led Class 5A with 803 yards on 48 catches as a senior ... scored nine touchdowns ... recorded 60 tackles, including 41 unassisted, and two interceptions ... had 10 punt returns for 187 yards and one touchdown ... returned three kickoffs for 64 yards ... played baseball and ran track ... state champion in the 400 meters and long jump ... was on 1,600-meter relay team with former Sooner Ataleo Ford ... coached by Mike Lloyd ... named to Daily Oklahoman’s Blue-Chip List ... District 5A-1 Offensive Player of the Year. The Wrapup: Born May 9, 1983 ... son of Darnell and Cassandra Poteat ... sociology-criminology major.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

JOWAHN POTEAT

112 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS JEJUAN RANKINS

GARLAND, TEXAS GARLAND HIGH SCHOOL

WINDSOR, N.C. BERTIE HIGH SCHOOL

OL

6-3

305

FR (RS)

2004: Redshirted.

The Wrapup: Runs the 40-yard dash in 5.0 seconds ... born Feb. 23, 1986 ... father, Jim, played linebacker at TCU from 1973-77.

Year 2003 2004 Total

G-GS 13-13 11-0 24-13

Rec 33 6 39

Yds 406 48 454

5-11

Avg 12.3 8.0 11.6

182

SR

TD Long 6 35 vs. Fresno State 0 17 vs. BGSU, KU 6 35 vs. Fresno State

2004: Had a 56-yard KOR to set up OU’s first touchdown versus Houston ... season highs with two receptions and 21 receiving yards against Kansas.

2002: Returned a kickoff 17 yards vs. Baylor ... saw action on special teams.

Wrapup: His elusiveness reminds some of former Sooner receiver The Wrapup Mark Clayton ... born July 19, 1984 ... sociology major ... pronounced juh-WAN ... son of Randy and Frances Rankins.

REVIEW & OPPONENTS

School: Ranked among the nation’s top 10 receivers by two recruitHigh School ing services ... No. 38 player in the nation by ESPN.com ... caught 42 passes for 1,063 yards as a senior ... had 42 receptions for 922 yards and 12 touchdowns as a junior ... made 67 stops (60 solo) and intercepted 15 passes as a junior ... returned three interceptions for TD ... had more than 500 yards in punt returns with five touchdowns in 2000 ... started for the basketball team and ran track ... coached by Roy Bond.

THE SOONERS

2003: Ranked third on the team in receptions (33), yards (406) and TD catches (6) ... season-high four receptions in four different games ... top yardage total was 67 and season-long catch of 35 yards vs. Fresno State ... scored a touchdown on his first career reception with a three-yard grab against North Texas (the last OU player to score a touchdown on his first career pass reception was Arthur Guess in 1987 against Tulsa on a 21yard pass) ... came back later to catch a second TD pass in the game ... led the team with 12 kickoff returns ... longest was a 49-yarder against Texas A&M.

COACHING STAFF

High School: Lettered three years and started two at the tackle position ... missed three games his last year due to mononucleosis ... played in only six games last year ... team finished the year 8-4 and captured district and bi-district championships ... served as a team captain his senior year ... graded at 88 percent with 35 pancakes as a junior ... team posted a 10-1 record and won its district in 2002 ... coached by Jeff Jordan ... played baseball his sophomore year.

WR

2 0 0 5 S EAS ON

J.D. QUINN

JEJUAN RANKINS OKLAHOM A HISTORY 113 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


BRETT RAYL

JACOB RICE

LEWISVILLE, TEXAS LEWISVILLE HIGH SCHOOL

NORMAN, OKLA. NORMAN HIGH SCHOOL

OL

6-6

305

SR

2004: Reserve tackle who played in five games. 2003: Worked in a backup role. 2002: Worked in a backup role seeing action in two games. 2001: Redshirted ... named to the Big 12 Commissioner’s Honor Roll. High School: Had 110 tackles and 10 sacks as a senior ... three-year starter who helped his team to a 29-6 record ... blocked an extra point vs. Carrollton Creekview to hold the 7-6 lead and send his team to district playoffs ... averaged double digits in points and rebounds as a senior in basketball ... coached by Ronnie Gage ... No. 9 defensive lineman in the Midlands by PrepStar ... No. 12 player in Texas by SuperPrep ... top 100 players in Texas by the Dallas Morning News and Houston Chronicle. The Wrapup: Born Feb. 11, 1982 ... son of Paul and Lindy Rayl ... sociology major.

DS

6-2

216

SR

2004: Has not missed a play since becoming OU’s long-snapper in 2002 ... snaps for punts and placements. 2003: Started every game as the team’s deep snapper on placements and punts ... had no bad snaps for the season ... credited with two tackles in punt coverage. 2002: Started every game of his true freshman season as the team’s deep snapper on placements and punts ... had no bad snaps on the season. High School: Three-year starter ... played tight end, deep snapper, linebacker and defensive end ... was all-district and all-conference as a tight end as a senior ... finished his career as the school’s all-time leader in receptions ... lettered two seasons on the track and field team ... competed in the shot put and discus ... football coach was Butch Peters. The Wrapup: Has not had a bad snap in 423 tries ... son of Fred and Amy Rice ... born May 15, 1983 ... hospitalized for two weeks after a motorcycle accident during his senior year in high school ... sociology major.

BRETT RAYL

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

114 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS DAVID ROBINSON

MIAMI, FLA. NORTHEASTERN OKLAHOMA A&M

DESOTO, TEXAS DESOTO HIGH SCHOOL

TE

G-GS 8-0 13-0 21-0

Rec 0 1 1

Yds 0 13 13

Avg 13.0 13.0

244

TD 1 1

SR

Long 13 vs Nebraska 13 vs Nebraska

2004: Lone reception went for a 13-yard touchdown against Nebraska ... Oklahoma’s tallest receiving target. 2003: Saw action in eight games ... spent most of his time playing on special teams. Junior College: Played one year after redshirting upon his arrival at Northeastern Oklahoma A&M ... caught 38 passes for 521 yards and seven touchdowns in his only season ... averaged 13.7 yards per catch ... played in 12 games.

G-GS 1-0

Rec 1

5-6

138

Yds 5

Avg 5.0

TD 0

SO

Long 5 vs Houston

2004: Had one reception for five yards against Houston. 2003: Redshirted. High School: First team all-district selection as a senior at De Soto ... coach was Darryl Jordan ... played wide receiver while also returning kicks and punts ... played his sophomore and junior seasons at De Soto high school and set a school record with 13 punt returns for touchdowns ... all-district as a junior as well ... ran track at both schools and had a best of 10.35 in the 100-meter dash as a senior ... qualified for the state meet. The Wrapup: Son of George and Jocelyn Price ... born Sept. 10, 1984 ... communications major.

THE SOONERS

The Wrapup: Originally signed with the University of Miami out of high school ... born Feb. 10, 1981, in Miami, Fla. ... son of Lorraine Roberts and Willie Davis ... African-American studies major.

Season 2004

WR

COACHING STAFF

Year 2003 2004 Total

6-7

2 0 0 5 S EAS ON

WILLIE ROBERTS

REVIEW & OPPONENTS

WILLIE ROBERTS OKLAHOM A HISTORY 115 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


TRISTEN ROSS

J.D. RUNNELS

SHREVEPORT, LA. EVANGEL CHRISTIAN

MIDWEST CITY, OKLA. CARL ALBERT HIGH SCHOOL

WR

6-1

227

SO

High School: A two-year starter ... totaled 96 receptions, 1,482 yards and 12 TDs during his career ... caught 62 passes for 980 yards and eight touchdowns in 13 games his senior year ... recorded a season best 80yard catch in 2002 ... missed two games early in his senior season due to injury ... totaled 500 yards on 34 catches as a junior ... offensive MVP at the U.S. Army Combine in 2002 ... led team to 14-1 record, state titles and national rankings both years. The Wraup: Runs a 4.5 in the 40 ... coached by Dennis Dunn ... lettered two years in track and field ... his father, Alvin, lettered in football at OU in 1981 and 1983 ... mother graduated from OU ... born Feb. 14, 1985.

FB

Year 2002 2003 2004 Total

G-GS 14-0 14-6 13-6 41-12

Rush 1-2 0-0 0-0 1-2

Rec. 1-3 16-109 14-133 31-245

6-0

Avg 3.0 6.6 9.5 7.9

237

TD 1 2 1 4

SR

Long 3 vs. S. Florida 17 vs. Alabama 23 vs. K-State 23 vs. K-State

2004: Rock steady player who is assignment strong ... great blocker ... entered the season with 17 career receptions, but upped that total to 31 with 14 in ‘04 ... had a touchdown grab against Texas Tech ... career-long 28-yard reception at Kansas State ... career-high three receptions vs. Nebraska (21 yards). 2003: Honorable mention All-Big 12 by the Associated Press ... used 2003 primarily as a lead blocker ... also had 16 receptions for 109 yards and two touchdowns ... season-high three receptions against Fresno State. 2002: Led the way in short yardage as a blocker ... caught a three-yard 2002 touchdown pass against South Florida ... co-winner of OU’s offensive newcomer/freshman of the year award (with Kejuan Jones). School: Worked primarily at running back, but also played wide High School receiver, tight end and defensive end ... consensus all-state ... ranked among nation’s top 35 players at fullback and tight end ... led Carl Albert to four 5A state championships ... concluded senior season with 29 catches for 568 yards and eight touchdowns ... caught 34 passes for 747 yards and nine TDs as a junior ... made 99 stops, 6.5 sacks, two forced fumbles and one fumble recovery as a junior ... had 25 tackles ... recorded 192 total tackles, 11 sacks and one interception for his career ... set school records for career receiving yards (1,391), career catches (67) and career receiving touchdowns (17) ... coached by Gary Rose. Wrapup: Son of James and the late Kathie Runnels ... sociology The Wrapup major ... born June 19, 1984.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS

J.D. RUNNELS

116 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS CALVIN THIBODEAUX

COPPELL, TEXAS COPPELL HIGH SCHOOL

HOUSTON, TEXAS WESTBURY HIGH SCHOOL

OL

6-4

269

FR (RS)

2004: Redshirted.

The Wrapup: Clocked at 4.78 in the 40-yard dash ... bench presses 300 pounds and squats 435 pounds ... coached by Mike Fuller ... born Jan. 1, 1986 ... son of Carl and Karla Schacht.

Year 2002 2003 2004 Total

G-GS 2-0 12-0 5-0 19-0

UT AT Total 0 2 2 6 4 10 1 2 3 7 8 15

6-1

251

Loss Sacks INT 0-0 0-0 0-0 3-12 2-10 0-0 1-1 0-0 0-0 4-13 2-10 0-0

SR

FC FR PBU 0 0 0 0 0 0 0 0 0 0 0 0

2004: Suffered a season-ending knee injury at Kansas State. 2003: Season-high four tackles against Texas A&M ... four quarterback hurries at Colorado.

COACHING STAFF

High School: Started his last two years ... registered 67 pancakes in 11 games as a senior ... had an offensive line grade of 94 percent in 2003 ... averaged close to 12 knockdowns a game ... voted the team’s “Lineman of the Year” ... helped lead team to a 9-3 record and a regional semifinal berth ... played in the Coca-Cola All-Star Game ... selected to play in the Oil Bowl in June 2004 ... team posted an 8-4 record in 2002.

DE

2 0 0 5 S EAS ON

CAMERON SCHACHT

2002: Saw limited action in his first season ... appeared in two games ... assisted in two tackles.

OKLAHOM A HISTORY

CALVIN THIBODEAUX

REVIEW & OPPONENTS

The Wrapup: Son of Carolyn Thibodeaux ... born Sept. 26, 1983 ... public affairs and administration major.

THE SOONERS

High School: A top-10 lineman in Houston by the Houston Chronicle ... top-40 defensive end in the nation by two recruiting services ... top 100 player in Texas by the Dallas Morning News ... district defensive MVP ... teammate of former Sooner Brodney Pool ... finished his senior season with 78 tackles, 11 sacks, one interception and three fumble recoveries ... returned two of those for touchdowns ... caused two fumbles ... totaled 68 tackles and nine sacks as a junior ... played fullback on offense and caught three two-point conversions ... carried the ball once for a 15-yard gain ... competed in the shot put in track ... coached by George Campbell.

117 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS PAUL THOMPSON

MARCUS WALKER

LEANDER, TEXAS LEANDER HIGH SCHOOL

WACO, TEXAS WACO HIGH SCHOOL

QB

Year 2002 2003 2004 Total

G-GS 4-0 10-0 14-0

Comp.-Att 12-20 19-27 31-47

Pct. .600 .704 .660

Year 2002 2003 2004 Total

G-GS 4-0 10-0 14-0

Att. 4 25 29

Yds 2 183 185

6-4

Yds 95 224 319 Avg 0.5 7.3 6.4

210

JR

Avg 7.92 11.79 10.29

TD 2 2 4

DB

INT 1 1 2

TD Long 0 8 vs. UTEP 3 50 vs. FSU 3 50 vs. FSU

2004: Redshirted. 2003: Effective in a backup role to Jason White ... had a 50-yard rush against Fresno State ... was the second longest of the season by an OU player ... had a 29-yard TD run against Texas A&M, one of two touchdown rushes he had in that game ... tossed a 55-yard pass to Donta Hickson against Texas. 2002:: OU’s backup quarterback who came out of his redshirt in the Texas-El Paso game ... threw a touchdown pass in that game to fellow true freshman Travis Wilson ... also had a TD pass to Brandon Jones in the Texas Tech game ... shared the Iron Man Award for top strength and conditioning by a freshman with Rufus Alexander.

Year G-GS 2004 5-4

UT 10

5-10

197

SO

AT Total Loss Sacks INT FC FR PBU 4 14 - 1

2004: Came out of his redshirt in game nine at A&M ... five tackles in first start vs. Nebraska ... started the last four games of the season. High School: Rated the No. 35 player in the nation (Insiders.com) ... No. 9 player in Texas (SuperPrep) ... No. 3 corner in the nation (Insiders.com) ... three-year starter ... recorded 30 tackles and caused two fumbles as a senior ... allowed just one pass completion in 25 attempts ... returned two kickoffs for 67 yards ... participated in U.S. Army High School All-American Game with Sooner signees Rhett Bomar, Lendy Holmes and Adrian Peterson ... made 39 stops and returned one kickoff for 24 yards in 2002 when team posted an 11-1 record and reached the area finals ... coached by Johnny Tusa ... first-team academic all-district honors in 2003 and 2002 and second-team mention as a sophomore. The Wrapup: Clocked at 4.4 in the 40 ... born May 23, 1986 ... son of Marquitha Walker ... has collected all his shoe boxes since the sixth grade -- favorite pair is the Kevin Garnett style he got in the eighth grade.

High School:: No. 10 athlete in the nation by Rivals.com ... district MVP ... top 100 players in Texas by Dallas Morning News and SuperPrep ... started three years at QB and one at DB ... had 1,600 passing yards and 1,053 rushing yards as a senior and was team MVP ... completed 113-of182 passes ... recorded 12 touchdowns in the air and 14 rushing ... 2,060 offensive yards as a junior with 15 TDs ... played basketball and ran track ... all-district in hoops ... coached by Jim Skinner. The Wrapup:: Son of Marc and Felecia Thompson ... born Nov. 23, 1983 ... communication major.

PAUL THOMPSON

118 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS JOHN WILLIAMS

MESQUITE, TEXAS MESQUITE HIGH SCHOOL

HOUSTON, TEXAS LAMAR HIGH SCHOOL

DB

Year G-GS 2004 7-0

5-10

197

UT AT Total Loss Sacks INT 1 1 -

SO

DE

FC FR PBU 1

2003: Redshirted. High School: No. 10 safety in the country by Rivals.com ... first team all-district defensive back and running back ... selected to play in the DFW Coca-Cola All-Star Game ... recorded 49 tackles, caused one fumble, recovered one fumble and had one interception in 11 games as a senior ... scored six touchdowns on 20 carries and rushed for 411 yards as a senior ... coached by Steve Bragg.

SO

2004: Reserve defensive end. 2003: Redshirted. High School: Defensive Player of the Year by the Houston Chronicle ... twice named all-district ... three-year starter at defensive end ... considered one of the top 50 players at his position by several recruiting services ... team went 9-3 in his final season ... made 57 stops, including 20 for loss, and recovered a fumble and forced a fumble in 2002 ... led the team in sacks with 14. The Wrapup: Born April 20, 1985 ... son of John and Annie Williams ... communications major ... coached by Tom Knowlen ... cousin to Derrick Johnson (former Texas linebacker), Michael Johnson (world class sprinter), Dwight Johnson (San Francisco 49ers), Ben Emmanuel (former Atlanta Falcon) and Kevin Emmanuel (Dallas Cowboys).

THE SOONERS

The Wrapup:: Born Nov. 20, 1984 ... son of Leonard and Terri Williams ... sociology major ... incurred a broken jaw, but survived a serious car accident when he was eight -- car rolled eight times, “The only reason I lived was because I was wearing my seat belt.” ... wears No. 41 because his mother picked it for him in little league ... his uncle Carl Richardson played in the NFL for Miami and the Houston Oilers.

243

COACHING STAFF

2004: Played in a reserve role and logged one tackle against Houston ... broke up a pass against Kansas.

6-4

2 0 0 5 S EAS ON

DARIEN WILLIAMS

REVIEW & OPPONENTS

MARCUS WALKER

OKLAHOM A HISTORY 119 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

THE SOONERS TRAVIS WILSON

D.J. WOLFE

CARROLLTON, TEXAS CREEKVIEW HIGH SCHOOL

LAWTON, OKLA. EISENHOWER HIGH SCHOOL

WR

Year 2002 2003 2004 Total

G-GS 8-0 14-3 13-8 35-11

Rec 4 25 50 79

Yds 35 295 660 990

6-3

Avg 8.8 11.8 13.2 12.5

213

TD 1 4 11 16

SR

Long 11 vs. UTEP 28 vs. Texas Tech 41 vs. KSU, KU 41 vs. KSU, KU

2004: All-Big 12 honorable mention by coaches and Associated Press ... led the Sooners with 11 touchdown receptions, the second-highest total in school history ... second on the team in receptions (50) and receiving yards (660) ... best statistical game was against Nebraska when he had nine receptions (eighth best in OU history) for 135 yards ... two touchdown catches against Texas Tech and Kansas State ... five or more receptions in six games including a team-high seven in the Orange Bowl ... nine kickoff returns for 135 yards, including a long of 22 against Texas A&M. 2003: Had four receptions against North Texas and Baylor ... touchdown grabs against North Texas, UCLA, Texas A&M and Texas Tech ... drew starts against Colorado, Oklahoma State and Baylor ... best yardage day was 44 against A&M ... first team Academic All-Big 12 and CoSIDA AllDistrict Academic honoree. 2002: Caught an 11-yard touchdown pass against UTEP ... hauled in a 15-yard pass in the Rose Bowl ... played a valuable role on special teams throughout the season. High School: Top 25 receiver in the nation by two recruiting services ... played CB and WR ... ran back five kickoffs as a senior for 166 yards for a 33.2 yards per return average ... had an 87-yard kickoff return and a 77-yard punt return, both for TDs ... set school record with 42 catches for 1,098 (26.1/catch) yards as a senior ... had 14 touchdowns ... intercepted four passes and made 17 tackles ... also punted ... caught 27 passes for 400 yards and seven TDs as a junior ... team compiled a 15-6 record in his final two seasons ... played basketball and ran track as a junior ... coached by Gary Monty.

DB

5-11

196

SO

Year 2004

G-GS 13-0

Rush 25

Yds 109

Avg. 4.3

TD 0

Long 31 vs. Houston

Year 2004

G-GS 13-0

Rec. 3

Yds 29

Avg. 9.7

TD 0

Long 27 vs. Houston

2004: One of only four true freshmen to play during the season ... saw his most extensive action with 13 rushes for 63 yards against Houston -- ripped off a season-long run of 31 yards against the Cougars ... also had two of his three receptions for the season, and a season-long grab of 27 yards, in that game ... three tackles on special teams. High School: A four-year letterman and starter ... rushed for 2,974 yards on 357 carries for 39 touchdowns during his career ... caught 25 passes for 523 yards and 10 scores during his three seasons ... recorded 1,601 yards on 195 atttempts and 17 touchdowns on the ground as a senior ... also hauled in 14 catches for 268 yards and six touchdowns ... intercepted one pass on defense ... helped lead team to a 9-3 record ... Served as a team captain as a senior ... rushed for 1,334 yards on 158 carries for 22 touchdowns during his junior campaign ... dependable receiver who caught 11 passes for 255 yards and four scores ... also used in kickoff return situations where he totaled 413 yards on 15 returns for an average of 27.5 yards per return ... transferred from Colorado after his freshman year ... clocked at 4.4 in the 40-yard dash ... Coached by Bill Whiteley ... competed on the track and field team where he anchored the 4x100 relay team that placed second in the state ... also finished fourth in the state in the long jump in 2003. The Wrapup: Achieved honor roll status academically the last two years ... involved in summer Fellowship of Christian Athlete (F.C.A.) Camps ... born Jan. 20, 1986 ... son of Paul and Myrna Adams.

The Wrapup: No. 2 in OU history with 16 career touchdown catches ... son of Wendy Wilson ... born Feb. 11, 1984 ... sociology-criminology major.

TRAVIS WILSON

120 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM


THE SOONERS Chart Climbers

DANE ZASLAW FB

6-0

231

SO

2004: Was sidelined by injury most of the season. 2003: Redshirted.

D.J. WOLFE

OU Career 100-Yard Rushing Games 1. Steve Owens. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6. Greg Pruitt. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7. Adrian Peterson . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7. Steve Davis. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

1967-69 1970-72 20041973-75

23 13 11 11

OU Career 200-Yard Rushing Games 1. Billy Sims . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2. De’Mond Parker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3. Quentin Griffin. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3. Mike Gaddis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5. Adrian Peterson . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

1975-79 1996-98 1999-02 1988-91 2004-

OU Career Receptions 1. Mark Clayton. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221 11. P.J. Mills . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 12. Travis Wilson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79

2001-04 1992-95 2002-

OU Career Receiving Yards 1. Mark Clayton. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3,241 20. Jarrail Jackson . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,040 21. Travis Wilson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 990

2001-04 1996-99 2002-

OU Career Touchdown Receptions 1. Mark Clayton. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 2. Travis Wilson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16

2001-04 2002-

OU Career Tackles For Loss 1. Rocky Calmus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 30. Dusty Dvoracek. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26

1998-01 2001-

OU Career Sacks 1. Cedric Jones . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31.5 19. Dusty Dvoracek. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 25. Larry Birdine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11

1992-95 20012002-

Pronunciation Guide

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

C.J. Ah You. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .I-you Remi Ayodele . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . REM-ee AA-oh-dell Ben Barresi. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BUH-ree-see Eric Bassey. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . rhymes with sassy Kelvin Chaisson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . shuh-shon Donta Hickson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .DON-tay Kejuan Jones . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KEE-wahn Akim Millington . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AH-kim Laenar Nixon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LUH-nar Chijioke Onyenegecha . . . . . . . . . . . .chee-JO-kay ON-yuh-nah-get-chah Demarrio Pleasant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DUH-mar-ee-oh Jowahn Poteat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . JUH-wahn Jejuan Rankins. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . JUH-wahn Cameron Schacht. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .SHOT Calvin Thibodeaux . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .TIB-uh-doh

REVIEW & OPPONENTS

7 5 4 4 2

THE SOONERS

The Wrapup: Born Sept. 11, 1984 ... son of James and Candace Zaslaw ... management major.

1975-79 1985-89 1950-52 2004-

COACHING STAFF

High School: Ranked among the top 15 linebackers in the country ... No. 1 linebacker in Oklahoma and the No. 4 player in Oklahoma overall by Rivals.com ... three-year starter ... played linebacker, defensive end, fullback and punter ... started his last two years at middle linebacker ... had 250 tackles and 12 sacks in his final two seasons ... had 121 tackles (40 UT, 81 AT), six tackles for loss, two sacks, three fumble recoveries and three passes broken up as a senior... returned one fumble and one interception for a touchdown ... had 63 carries for 301 yards and three TDs as an I-Back ... averaged 37.5 yards on 40 punts ... had the No. 2 punting average in the state as a junior at 41.5.

OU Career Rushing 1. Billy Sims . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,118 26. Leon Perry . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2,016 27. Buck McPhail . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,985 28. Adrian Peterson . . . . . . . . . . . . . . . . . . . . . . . . . . 1,925

2 0 0 5 S EAS ON

EDMOND, OKLA. MEMORIAL HIGH SCHOOL

121


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

NEWCOMERS The Class of 2005 The national scope of Oklahoma’s football program was evident again as the Sooners incoming class of 2005 included 28 players hailing from 13 different states. Of the 28 players, eight were from Texas, six from Oklahoma, two from Arizona, Colorado and South Carolina and one each from Georgia, Kansas, Louisiana, Nevada, New Jersey, North Carolina, Ohio and Utah. The defense included three linebackers, five defensive backs, four linemen and three ends. The offense included six linemen, four receivers, one tight end and one fullback. DE C.J. Ah You, OL Branndon Braxton and OL Ben Barresi joined the program for spring workouts. The class was not only one of the most impressive in Sooner history, but also in the nation. All of the recruiting services ranked the class among the top 10 nationally. In all, OU took 17 players who were ranked among the state’s top 10 in 11 different states.

BILLY BLACKARD

MATT CLAPP

KEENAN CLAYTON

CLAREMORE, OKLA. CLAREMORE HIGH SCHOOL

PHOENIX, ARIZ. PARADISE VALLEY HIGH SCHOOL

SULPHUR SPRINGS, TEXAS SULPHUR SPRINGS HIGH SCHOOL

DT

6-3

292

FR

• No. 24 guard in the nation (ESPN.com) • No. 37 defensive tackle (Rivals.com) • No. 7 player in Postseason Oklahoma Top 15 (Rivals.com) • No. 17 player in the Midlands (Scout.com) • Tulsa World All-State • Daily Oklahoman All-State • Oklahoma Coaches Association All-State Also played offensive line … totaled 90 tackles with 14 sacks in 2004 … named 5A-4 District Defensive Player of the Year in 2004 … recorded 94 tackles with 10 sacks in 2003 … coached by Rex Trent … son of Jim and Liz Blackard … born June 6, 1986.

FB

6-2

235

FR

• No. 6 fullback in the nation (Rivals.com) • No. 3 in the Postseason Arizona Top 15 (Rivals.com) • Phoenix Metro and Arizona Player of the Year (Phoenix Metro FB Magazine) • No. 98 player in the Southwest (Scout.com) Played both fullback and linebacker … as a senior, gained 1,033 yards and 18 touchdowns … also totaled 71 solo tackles and 4 sacks in nine games before injuring leg… finished the 2003 campaign with 1, 602 yards and 18 touchdowns … rushed for 1,000 yards and 19 touchdowns as a sophomore … named super All-State first team as fullback and as a linebacker … awarded the Larry Gordon Award for state’s best linebacker and the “Whizzer” White Award given to the state’s best linebacker his senior year … coached by Donni Yantis … son of Greg and Shelley Clapp … born December 6, 1986.

122 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM

S

6-2

210

FR

• No. 12 safety in the country (ESPN.com) • No. 74 player in the nation (Rivals.com) • No. 3 safety in the nation (Rivals.com) • No. 8 player in Texas Postseason Top 100 (Rivals.com) • No. 63 player in the nation (Scout.com) • No. 4 safety in the nation (Scout.com) Compiled 120 tackles and intercepted four passes during his senior campaign … shared time at running back … clocked at 4.52 in the 40-yard dash … coach: Brad Turner … son of Quon Clayton … born June 19, 1987.


NEWCOMERS AARON CUMMINGS

BRODY ELDRIDGE

FORT COLLINS, COLO. FORT COLLINS HIGH SCHOOL

MARLOW, OKLA. BRAY-DOYLE HIGH SCHOOL

LA CYGNE, KAN. PRAIRIE VIEW HIGH SCHOOL

DT

6-3

278

FR

• No. 20 defensive tackle in the country (ESPN.com) • No. 6 center in the nation (Rivals.com) • No. 3 Postseason Colorado Top 15 (Rivals.com) • No. 20 player in the Midlands (Scout.com)

TE

6-4

245

FR

• Eight-man football All-State - 2003 and 2004 • 11- man football All-State - 2004

DE

6-5

230

FR

• No. 43 strongside defensive end in country (Rivals.com) • No. 16 player in the Midlands (Scout.com) • All-State Kansas - 2004

AUSTON ENGLISH

DEMARCUS GRANGER

NIC HARRIS

CANADIAN, TEXAS CANADIAN HIGH SCHOOL

DALLAS, TEXAS KIMBALL HIGH SCHOOL

ALEXANDRIA, LA. ALEXANDRIA HIGH SCHOOL

Three-year starter and letterman … named Offensive Player of the Year in the Front Range Conference … captured team MVP honors as a senior … also played defensive tackle … totaled 92 tackles, eight sacks and two interceptions … also forced six fumbles … bench presses 385 pounds … coached by Eric Rice … son of Tom and Chris Cooper …dad played at Missouri from 1972-1975 … born October 1, 1986.

6-2

220

FR

• No. 15 weakside linebacker (Rivals.com) • No. 58 player in the Southwest (Scout.com) • No. 49 player in Texas (Scout.com) • No. 53 Texas Top 100 • 7-AA All-District RB - 2003 and 2004 • 7-AA All District DE - 2003 and 2004 • Amarillo Globe Super Team defensive end

6-2

320

FR

• No. 11 player in the country (ESPN.com) • No. 1 DT in the country (ESPN.com) • No. 6 overall (CollegeFootballNews.com) • No. 2 DT overall (CollegeFootballNews.com) • No. 11 player in the country (Rivals.com) • No. 3 player in Texas (Rivals.com) • No. 9 player in the country (Scout.com) • No. 5 player in Texas (Scout.com) • Parade All-American • 2004 U.S. Army High School All-American • Dallas Morning News Defensive Player of the Year – 2003 and 2004 Totaled 79 tackles, including 25 for loss and 17 sacks as a senior … also forced 11 fumbles … recorded 68 tackles and 17 sacks his junior year … named Class 4A All-State and the Dallas area defensive player of the year as a junior … clocked at 5.2 seconds in the 40-yard dash … bench presses 405 pounds and squats 550 pounds … coached by Darryl Jordan … son of Debra Granger … born Sept. 4, 1986.

DB

6-3

210

FR

• No. 11 safety in the nation (ESPN.com) • No. 62 player in the Southeast (Scout.com) • No. 94 player in the nation (Rivals.com) • No. 5 safety in the nation (Rivals.com) • No. 7 safety in the nation (CollegeFootballNews.com) • Unanimous Defensive MVP Louisiana - 2004 • All Central Louisiana Honors - 2004 • All-State – 2004 Recorded 74 tackles and intercepted 11 passes, returning 4 for touchdowns his senior season … led school to consecutive state playoffs appearances … named All-CENLA defensive MVP his senior year … totaled 81 tackles and intercepted 10 passes as a junior … owns school record with 21 interceptions and 9 interceptions returned for touchdowns… also played wide receiver and returned punts … clocked at 4.5 in the 40-yard dash … honors student … coached by Butch Stoker … born October 6, 1986.

OKLAHOM A HISTORY

Three-year letterman at both running back and defensive end … amassed 1,285 yards rushing and scored 18 touchdowns during his senior year … recorded 33 solo tackles, 48 assists, and 11 sacks in 2004 … led team to state semifinals as a senior … rushed for 1,800 yards and 25 touchdowns as junior … totaled 53 tackles and seven sacks in four games his junior season … also participated on the track and field team … runs the 40-yard dash in 4.65 seconds … bench presses 315 pounds and squats 400 pounds … coached by Kyle Lynch … born March 10, 1987 … son of Dean and Kelly English.

DT

REVIEW & OPPONENTS

DE

THE SOONERS

Broke his foot in the second game of his senior year and did not play the rest of the season … totaled 130 tackles and eight sacks his junior year … also played tight end … recorded 35 receptions and four touchdowns in the same season … clocked at 4.7 seconds in the 40yard dash … coached by Sterling Hudson .. son of Walt and Janet Eldridge … born March 31, 1987.

COACHING STAFF

Played eight man football his junior and senior year … totaled 1,200 yards receiving and 12 touchdowns during his senior campaign … recorded 1,002 yards receiving and 13 touchdowns as a junior … owns school records for career and season yardage receiving and touchdowns (37) … also played basketball and baseball … averaged 19 points per game and shot .508 … coached by John Strickland … son of Brad and Scarlet Cummings … born August 27, 1986.

2 0 0 5 S EAS ON

JON COOPER

123 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATIONAL CHAMPIONSH IPS

39 CONF ERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

NEWCOMERS ERIC HUGGINS

JUAQUIN IGLESIAS

BRIAN JACKSON

CONWAY, S.C. CONWAY HIGH SCHOOL

KILLEEN, TEXAS KILLEEN HIGH SCHOOL

DE SOTO, TEXAS DE SOTO HIGH SCHOOL

WR

6-4

190

FR

WR

6-2

195

FR

S

6-2

207

FR

Earned all-area honors as a junior … recorded 42 catches for 886 and 10 touchdowns as a senior … threw two passes during his career, both for touchdowns … also returned kicks …named first team all-district as a senior in district 16-4A … runs a 4.4 40-yard dash … a starter on the basketball team where he averaged 17 points per game … ran the 400, 800, and 1,600 relays as well … coached by Sam Jones … son of Bobby and Bernita Iglesias … born August 22, 1987 … pronounced WAH-keen E-glay-C-us.

• No. 17 cornerback in the nation (ESPN.com) • No. 20 cornerback in the country (Rivals.com) • No. 34 player Postseason Texas Top 100 (Rivals.com) • No. 59 player in the state of Texas (Scout.com) • No. 61 player in the Southwest (Scout.com)

MANUEL JOHNSON

BRANDON KEITH

MALCOLM KELLY

GILMER, TEXAS GILMER HIGH SCHOOL

McALESTER, OKLA. NORTHEASTERN OKLAHOMA A&M

LONGVIEW, TEXAS LONGVIEW HIGH SCHOOL

• No. 8 WR in the nation (Rivals.com) • No. 10 WR in the nation (ESPN.com) • No. 11 WR in the nation (Scout.com) • No. 2 player in South Carolina (Rivals.com) • No. 2 player in South Carolina (Scout.com) • No. 2 player in South Carolina (ESPN.com) • Parade All-American - 2004 • U.S. Army High School All-American • AP All-State - 2003 and 2004 Played DB in 2002 and WR in 2003 and 2004 ... returned kicks in 2004 ... Conway was 35-6 in his three seasons on varsity … caught a teamhigh 15 TDs his junior year … posted a career high 150 receiving yards, while tying career best of eight catches in 2003 state championship … team appeared in two state championship games during his career … started 32 games in three years … bench presses 225 pounds and squats 305 pounds … runs the 40- yard dash in 4.5 seconds … also competed on the basketball and track and field teams … born July 29, 1986 … son of Eric and Patricia Huggins.

WR

6-0

170

FR

• No. 13 wide receiver in the nation (Rivals.com) • No. 16 player Postseason Texas Top 100 (Rivals.com) • No. 21 player in Texas (SuperPrep) • MVP District 13-AAA - 2004 • MVP All East Texas - 2004 • First Team All-State - 2004 • Dave Campbell Player of the Year - 2004 • First Team All-State - 2003 Played quarterback and wide receiver … in his career, he threw for 48 touchdowns, ran for 18 touchdowns, and caught 17 touchdowns … set school season passing record … runs a 4.4 40-yard dash … bench presses 285 pounds … also a member of the basketball and track and field teams … coached by Jeff Traylor … born October 14, 1986 … son of Manuel and Marylyn Anderson.

OL

6-6

320

JR

• First team All-Southwest League – 2004 • Second Team NJCAA All-American – 2004 • No. 2 player in Oklahoma (Rivals.com) -2002 • No. 20 offensive tackle (Rivles.com) – 2002 • All-State first team (Daily Oklahoman and Tulsa World) - 2002 Has two years of eligibility left after transferring from NE Oklahoma A&M … played at McAlester High School in McAlester, Okla … clocked at 5.1 in the 40-yard dash … exceeded 70 pancake blocks his senior year … junior team was 11-1 and reached the state semifinals … senior team was 8-4 and reached the second round of the playoffs … coached by Steve Patterson at NEO … born November 21, 1984.

124 2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM

Made 35 tackles and intercepted six passes as a senior … team posted a 9-2 mark in 2004 … totaled 30 tackles and four picks during his senior season … bench presses 305 pounds … clocked at 4.5 seconds in the 40-yard dash …competed on track and field team … honors student … coached by Dave Meadows … son of O.C. and Cathy Jackson … born May 4, 1987.

WR

6-4

204

FR

• No. 13 wide receiver (ESPN.com) • No. 93 player in the nation (ESPN.com) • No. 6 wide receiver in the country (Rivals.com and Scout.com) • No. 68 player in the nation (Rivals.com) • No. 7 Postseason Texas Top 100 (Rivals.com) • No. 1 wide receiver in Texas (Scout.com) • First Team All-East Texas Wide Receiver by Texas Sports Writers Caught 29 passes for 638 yards and 9 touchdowns as a senior … as a junior, had 27 catches for 826 yards and six touchdowns … three-time all-district first team selection at wide receiver … named first team All-State his final two years … has a 38-inch vertical jump … bench presses 300 pounds … coach: John King … born December 30, 1986 … son of Moses and Marva Kelly.


NEWCOMERS CURTIS LOFTON

CORDERO MOORE

CHAPPAREL, ARIZ. SCOTTSDALE COMMUNITY COLLEGE

KINGFISHER, OKLA. KINGFISHER HIGH SCHOOL

MESQUITE, TEXAS HORN HIGH SCHOOL

P

5-10

175

SO

LB

6-2

238

FR

DT

6-2

275

FR

• No. 23 strongside defensive end in nation (Rivals.com) • No. 36 player in Texas (SuperPrep) • All-District First Team 12 5A - 2004 • All-State Second Team - 2004 • All-District First Team 12 4A - 2003

ALLEN PATRICK

RYAN REYNOLDS

GEORGE ROBINSON

CONWAY, S.C. INDEPENDENCE (KAN.) COMM. COLLEGE

LAS VEGAS, NEV. BISHOP GORMAN HIGH SCHOOL

ATLANTA, GA. WASHINGTON HIGH SCHOOL

6-0

200

FR

• No. 14 player in the JC Top 25 (Rivals.com) • No. 23 JUCO player in the nation (CollegeFootballNews.com) • First team Jayhawk All-Conference - 2004 • Preseason JC All-American by J.C Gridwire - 2004 • First team All-State - 2003 • Participated in 2002 Shrine Bowl

6-2

230

FR

• No. 30 player in the nation (ESPN.com) • No. 2 linebacker in the nation (ESPN.com) • No. 7 player in the Northwest (Scout.com) • No. 2 outside LB in the nation (Rivals.com) • No. 26 player in the nation (Rivals.com) • No. 1 Postseason Nev. Top 10 (Rivals.com) • No. 24 overall (CollegeFootballNews.com) • No. 3 LB overall (CollegeFootballNews.com) • USA Today First Team All-American - 2004 • Nevada’s Gatorade Player of the Year - 2004 • U.S. Army All-American - 2004 Four-year letterman … played linebacker, defensive back, tight end, and fullback … had 94 tackles and six sacks as senior … recorded 96 tackles and six sacks as junior … ran for a career-best 393 yards as junior … clocked at 4.57 in the 40-yard dash … bench presses 395 pounds … honors student … state high school wrestling champion and five-time national judo champion … coached by David White … son of Craig and Barbara Reynolds … born September 20, 1986.

OL

6-6

330

FR

• No. 15 offensive tackle (Rivals.com) • No. 51 player in the nation (Rivals.com) • No. 60 OL in the nation (Scout.com) • No. 13 OT in the nation (ESPN.com) • No. 52 offensive lineman in the nation (CollegeFootballNews.com) • Atlanta Touchdown Club Offensive Lineman of the Year – 2004 • Prep Star first team All-American – 2004 • First team All-City and All-State - 2004 Three-year starter at offensive tackle … recorded 87 pancake blocks and graded 91 percent … named to the Super 11 by the Atlanta Journal Constitution in 2004 … played nose tackle in goal line situations … bench presses 325 pounds and squats 540 pounds … coached by Rodney Cofield … born October 10, 1986 … son of Wanda Bryant and George Robinson … guardians are Connie Bryant and Clifford Austin.

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

Attended Conway High School in Conway, S.C. … also played running back and was a kick returner … recorded 105 tackles and four sacks as a senior … rushed for 681 and seven touchdowns on 103 carries … averaged 33 yards a return including a 92-yard kick return for a touchdown … sat out most of his sophomore season at Independence (Kan.) Community College with a broken fibula … coach: David Ward … son of Veronica Bromell and Roland Patrick … born February 15, 1984.

LB

REVIEW & OPPONENTS

DB

Three-year letterman and starter … also played fullback … led team in tackles with 168 his senior year and 505 over his career … team won the 3A State Championship in 2003 and advanced to semifinals in 2004 … rushed for 12 touchdowns as a senior … nominated for the March of Dimes Oklahoma Headliners Banquet as one of the top scholar-athletes in the state of Oklahoma … runs a 4.6 40 … competed on the basketball and track teams … honors student … coached by Jeff Myers … son of Terrell and LaDona Lofton … born June 9, 1986.

Three-year starter and letterman … played tight end and defensive end … totaled 95 tackles and 6.5 sacks in 2004 … recorded 14 tackles for loss during his senior year … runs a 4.9 40-yard dash … bench presses 320 pounds and squats 400 pounds … also a standout basketball player … coached by Don Payne … born September 14, 1986 … son of Roderick and Bernadine Moore.

THE SOONERS

• No. 8 inside LB in the nation (ESPN.com) • No. 2 in the Midlands (SuperPrep and Scout.com) • No. 9 linebacker in the nation (Scout.com) • No. 2 player in Oklahoma (Scout.com) • No. 4 inside LB in the nation (Rivals.com) • No. 62 player in the Nation (Rivals.com) • Parade First Team All-American – 2004 • Daily Oklahoman All-State – 2004 • First Team Coaches All-State 2004

COACHING STAFF

Averaged 43.9 yards per punt as a freshman for the Fighting Artichokes of Scottsdale Community College … pupil of Mike McCabe at One on One Kicking Clinic in Florida … joins Sooner teammate Garrett Hartley who also worked at One on One … averaged 44 yards per punt at recent competition at One on One and was ranked as the top junior college prospect ... earned two varsity letters as a punter and tailback for Chaparrel High School in hometown of Scottsdale, Ariz. ... averaged 39.3 yards per punt as a senior ... also tallied 230 yards rushing on 26 carries and 208 yards receiving on six catches ... scored three TDs in his final prep season ... earned All-East Sky Region honors as a junior ... coached by Ron Estabrook ... son of Phil Knall and Debbie Bell ... born April 13, 1986.

2 0 0 5 S EAS ON

MIKE KNALL

125


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

NEWCOMERS

126

LAMONT ROBINSON

BRIAN SIMMONS

SALEM, N.J. SALEM HIGH SCHOOL

RALEIGH, N.C. HARGRAVE ACADEMY

LB

6-2

220

FR

• No.7 linebacker in the nation (ESPN.com) • No. 96 player in the country (CollegeFootballNews.com) • No. 10 OLB in nation (Rivals.com) • Preseason All-State - 2004 • Preseason All-American - Sportsline.com • Defensive POY in Salem County - 2003

DT

6-2

305

OL

6-2

295

FR

• No. 11 guard in the country (ESPN.com) • No. 3 center in the nation (Rivals.com) • No. 1 Player in CO (SuperPrep & Scout.com) • U.S. Army High School All-American • First team All-State (Denver Post and Rocky Mountain News) – 2004 • First team All-Centennial League in Colorado – 2002, 2003, 2004 Named Gatorade Player of the Year in Colorado his senior season … named first team All-State his final two years … gave up zero sacks during his career … graded at 96 percent as a senior and 93 percent during his junior season … one of the strongest prep players in the country with a 460-pound bench press, 650 squat, and a 32-inch vertical jump … son of two-time Colorado All-America offensive lineman Leon White, also known as Vader in professional wrestling circles … estimated to have more than 130 family members living in Oklahoma … coached by Dave Logan … son of Leon and Debe White … born April 19, 1986.

FR

Recorded 32 tackles, eight for loss, and three sacks in 2004 … saw limited action due to finger injury … played at Southeast Raleigh (N.C.) High School prior to Hargrave … coach: Robert Puntry … born March 16, 1985.

DB

6-1

190

FR

• No. 4 cornerback in the nation (ESPN.com) • No. 1 player in the Midlands (Scout.com) • No. 5 cornerback in the nation (Rivals.com) • No. 4 CB nation (CollegeFootballNews.com) • 2005 U.S. Army High School All-American • USA Today First Team All-American • Daily Oklahoman All-State - 2003 and 2004 • Daily Oklahoman Player of the Year - 2003 Four-year starter … played WR, RB and DB … made 63 tackles and intercepted six passes (two returned for touchdowns) as a senior … rushed the ball 122 times for 935 yards nine TDs … caught 47 passes for 607 yards and eight TDs his senior year … registered 73 tackles and 9 INTs in 2003 … scored 20 offensive TDs as a junior … led Edmond Santa Fe to 6A championship game as a junior … finished his career with 28 INTs … runs the 40 in 4.47 seconds … competed on the basketball and track & field teams … honors student … coached by Dan Cocannouer ... born Sept. 13, 1986.

2005 Signing Class

DENVER, COLO. MULLEN HIGH SCHOOL

EDMOND, OKLA. SANTA FE HIGH SCHOOL

• No. 2 in the Prep School Top 25 (Rivals.com)

Four-year letterman … recorded 34 tackles and one sack his senior year after recovering from an off-season automobile accident in which he suffered fractures to neck vertebrae … posted 95 tackles, six sacks, and eight caused fumbles as a junior … totaled 80 tackles and four sacks as a sophomore … started at defensive end his freshman year where he had 49 tackles and three sacks … honors student … coached by Dave Lindenmuth … runs a 4.6 40-yard dash … born February 8, 1987 … son of Myria Robinson and Craig Parsley.

JESSE WHITE

REGGIE SMITH

No. 99 65 78 76 34 9 50 87 83 84 96 5 17 18 3 6 56 2 39 40 89 23 8 72 30 74 1 66

Player Pos. Ht C.J. Ah You . . . . . . . . . . . . . . . .DE . . . . . . . 6-4 Ben Barresi . . . . . . . . . . . . . . . . OL . . . . . . . 6-5 Billy Blackard . . . . . . . . . . . . . .DT . . . . . . . 6-3 Branndon Braxton . . . . . . . . . . . OL . . . . . . . 6-6 Matt Clapp . . . . . . . . . . . . . . . . FB . . . . . . . 6-2 Keenan Clayton . . . . . . . . . . . . S . . . . . . . . 6-2 Jon Cooper . . . . . . . . . . . . . . . . OL . . . . . . . 6-3 Aaron Cummings . . . . . . . . . . . TE . . . . . . . 6-4 Brody Eldridge . . . . . . . . . . . . .DE . . . . . . . 6-5 Auston English . . . . . . . . . . . . .DE . . . . . . . 6-2 DeMarcus Granger . . . . . . . . . .DT . . . . . . . 6-2 Nic Harris . . . . . . . . . . . . . . . . .DB . . . . . . . 6-3 Eric Huggins . . . . . . . . . . . . . . WR . . . . . . . 6-4 Juaquin Iglesias . . . . . . . . . . . WR . . . . . . . 6-2 Brian Jackson . . . . . . . . . . . . . . S . . . . . . . . 6-2 Manuel Johnson . . . . . . . . . . . WR . . . . . . . 6-0 Brandon Keith . . . . . . . . . . . . . . OL . . . . . . . 6-6 Malcolm Kelly . . . . . . . . . . . . . WR . . . . . . . 6-4 Mike Knall . . . . . . . . . . . . . . . . . P . . . . . . . .5-10 Curtis Lofton . . . . . . . . . . . . . . . LB . . . . . . . 6-2 Cordero Moore . . . . . . . . . . . . .DT . . . . . . . 6-4 Allen Patrick . . . . . . . . . . . . . . .DB . . . . . . . 6-0 Ryan Reynolds . . . . . . . . . . . . . LB . . . . . . . 6-2 George Robinson . . . . . . . . . . . OL . . . . . . . 6-6 Lamont Robinson . . . . . . . . . . . LB . . . . . . . 6-2 Brian Simmons . . . . . . . . . . . . .DT . . . . . . . 6-5 Reggie Smith . . . . . . . . . . . . . .DB . . . . . . . 6-1 Jesse White . . . . . . . . . . . . . . . OL . . . . . . . 6-2

2005 OKLAHOMA FOOTBALL GUIDE | WWW.SOONERSPORTS.COM

Wt Hometown . . . . . .262 . . . . . . . . . . . . Highland, Utah . . . . . .282 . . . . . . . . . . . . Edmond, Okla. . . . . . .292 . . . . . . . . . . Claremore, Okla. . . . . . .300 . . . . . . . . . Youngstown, Ohio . . . . . .235 . . . . . . . . . . . . . Phoenix, Ariz. . . . . . .210 . . . . . .Sulphur Springs, Texas . . . . . .278 . . . . . . . . . .Fort Collins, Colo. . . . . . .245 . . . . . . . . . . . . . .Marlow, Okla . . . . . .230 . . . . . . . . . . . .La Cygne, Kan. . . . . . .220 . . . . . . . . . . .Canadian, Texas . . . . . .320 . . . . . . . . . . . . . Dallas, Texas . . . . . .210 . . . . . . . . . . . . Alexandria, La. . . . . . .190 . . . . . . . . . . . . . Conway, S.C. . . . . . .195 . . . . . . . . . . . . . Killeen, Texas . . . . . .207 . . . . . . . . . . . . DeSoto, Texas . . . . . .170 . . . . . . . . . . . . . Gilmer, Texas . . . . . .320 . . . . . . . . . . . McAlester, Okla. . . . . . .204 . . . . . . . . . . . Longview, Texas . . . . . .175 . . . . . . . . . . . . .Chaparral, Ariz. . . . . . .238 . . . . . . . . . . . Kingfisher, Okla. . . . . . .264 . . . . . . . . . . . Mesquite, Texas . . . . . .200 . . . . . . . . . . . . . Conway, S.C. . . . . . .230 . . . . . . . . . . . Las Vegas, Nev. . . . . . .330 . . . . . . . . . . . . . . Atlanta, Ga. . . . . . .220 . . . . . . . . . . . . . . .Salem, N.J. . . . . . .305 . . . . . . . . . . . . . Raleigh, N.C. . . . . . .190 . . . . . . . . . . . . Edmond, Okla. . . . . . .295 . . . . . . . . . . . . . Denver, Colo.


2004 REVIEW

2 0 0 5 S EAS ON

COACHING STAFF

THE SOONERS

PETERSON

OKLAHOMA OKLAHOM A HISTORY

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

REVIEW & OPPONENTS

ADRIAN

127


Schedule & Results Date Sept. 4 Sept. 11 Sept. 18 Oct. 2 Oct. 9 Oct. 16 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 20 Dec. 4 Jan. 4

Opponent Bowling Green Houston Oregon Texas Tech* vs. Texas* at Kansas State* Kansas* at Oklahoma State* at Texas A&M* Nebraska* at Baylor* vs. Colorado^ vs. USC#

Score 40-24 63-13 31-7 28-13 12-0 31-21 41-10 38-35 42-35 30-3 35-0 42-3 19-55

W W W W W W W W W W W W L

Attend. 84,319 84,280 84,574 84,580 79,587 52,310 84,520 48,837 81,125 84,916 32,182 62,130 77,912

* Conference game ^ Big 12 Championship - Kansas City, Mo. # BCS National Championship, Orange Bowl - Miami, Fla.

Score by Quarter

2nd 161 75

3rd 121 44

4th 83 51

Total 452 219

D EMARRIO PLEASANT

1st Sooners . . . . . . . . . . . . . . . . . . . . . 87 Opponents . . . . . . . . . . . . . . . . . . . 49

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

2004 SEASON REVIEW

128 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Team Statistics

OU Scoring . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 452 Points Per Game . . . . . . . . . . . . . . . . . . . . . . . 34.8 First Downs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 310 Rushing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .147 Passing. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .144 Penalty . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19 Rushing Yardage . . . . . . . . . . . . . . . . . . . . . . . . . 2,709 Yards Gained Rushing . . . . . . . . . . . . . . . . . . 2,993 Yards Lost Rushing . . . . . . . . . . . . . . . . . . . . . 284 Rushing Attempts . . . . . . . . . . . . . . . . . . . . . . . 565 Average Per Rush . . . . . . . . . . . . . . . . . . . . . . . 4.8 Average Per Game. . . . . . . . . . . . . . . . . . . . . 208.4 TDs Rushing. . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 Passing Yardage . . . . . . . . . . . . . . . . . . . . . . . . . 3,298 Att-Comp-Int. . . . . . . . . . . . . . . . . . . . . . 406-268-9 Average Per Pass. . . . . . . . . . . . . . . . . . . . . . . . 8.1 Average Per Catch . . . . . . . . . . . . . . . . . . . . . . 12.3 Average Per Game. . . . . . . . . . . . . . . . . . . . . 253.7 TDs Passing . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36 Total Offense . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6,007 Total Plays . . . . . . . . . . . . . . . . . . . . . . . . . . . . .971 Average Per Play . . . . . . . . . . . . . . . . . . . . . . . . 6.2 Average Per Game. . . . . . . . . . . . . . . . . . . . . 462.1 Kick Returns: No. - Yards . . . . . . . . . . . . . . . . . . 28-534 Punt Returns: No. - Yards. . . . . . . . . . . . . . . . . . 35-316 Int. Returns: No. - Yards . . . . . . . . . . . . . . . . . . . . 8-120 Kick Return Average. . . . . . . . . . . . . . . . . . . . . . . . 19.1 Punt Return Average . . . . . . . . . . . . . . . . . . . . . . . . 9.0 Int. Return Average. . . . . . . . . . . . . . . . . . . . . . . . . 15.0 Fumbles - Lost . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20-9 Penalties - Yards . . . . . . . . . . . . . . . . . . . . . . . . 85-733 Average Per Game. . . . . . . . . . . . . . . . . . . . . . 56.4 Punts-Yards . . . . . . . . . . . . . . . . . . . . . . . . . . 53-2,184 Average Per Punt . . . . . . . . . . . . . . . . . . . . . . . 40.9 Net Punt Average . . . . . . . . . . . . . . . . . . . . . . . 39.4 Time of Possession/Game . . . . . . . . . . . . . . . . . . 33:11 3rd-Down Conversions. . . . . . . . . . . . . . . . . . . 108/200 3rd-Down Pct.. . . . . . . . . . . . . . . . . . . . . . . . . . 54% 4th-Down Conversions . . . . . . . . . . . . . . . . . . . . . 12/17 4th-Down Pct.. . . . . . . . . . . . . . . . . . . . . . . . . . 71% Sacks By - Yards . . . . . . . . . . . . . . . . . . . . . . . . 39-258 Misc. Yards . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 Touchdowns Scored . . . . . . . . . . . . . . . . . . . . . . . . . 61 Fields Goals - Attempts . . . . . . . . . . . . . . . . . . . . . 9-17 PAT - Attempts . . . . . . . . . . . . . . . . . . . . . . . . . . . 57-60 Attendance . . . . . . . . . . . . . . . . . . . . . . . . . . . . 507,189 Games - Avg. Per Game . . . . . . . . . . . . 6 - 84,532 Neutral Site - Avg. Per Game . . . . . . . . . 3 - 73,210

Opp. 219 16.8 203 75 110 18 1,230 1,636 406 402 3.1 94.6 10 2,657 410-223-8 6.5 11.9 204.4 15 3,887 812 4.8 299.0 35-553 22-95 9-152 15.8 4.3 16.9 18-14 83-652 50.2 84-3,493 41.5 37.8 26:49 66/182 36% 8/17 47% 9-73 8 28 8-11 27-28 214,454 4 - 53,614


2004 SEASON REVIEW Rushing Statistics

Gain 2,040 531 100 73 109 61 19 9 0 46

Loss 115 18 0 0 2 9 8 0 30 102

Net 1,925 513 100 73 107 52 11 9 -30 -56

Avg 5.7 4.0 4.5 18.2 4.3 5.2 2.8 9.0 -4.3 -2.4

TD 15 5 0 1 0 1 0 0 0 0

Long 80 26 14 51 31 25 16 9 0 12

Avg/G 148.1 42.8 12.5 5.6 8.2 10.4 0.8 1.8 -5.0 -4.3

Sooners Opponent

565 402

2,993 1,636

284 406

2,709 1,230

4.8 3.1

22 10

80 48

208.4 94.6

13 13

Passing Statistics

EfďŹ c 159.42 147.09 0.00 352.00

Att-Cmp-Int 390-255-9 14-12-0 1-0-0 1-1-0

Pct 65.4 85.7 0.0 100.0

Yds 3205 63 0 30

TD 35 1 0 0

Lng 72 10 0 30

Avg/G 246.5 12.6 0.0 2.5

Sooners Opponents

159.07 117.00

406-268-9 410-223-8

66.0 54.4

3,298 2,657

36 15

72 78

253.7 204.4

13 13

Receiving Statistics

Yds 876 660 345 491 196 224 151 133 94 48 29 12 14 -3 13 7 5 3

Avg 13.3 13.2 12.8 21.3 8.9 11.2 8.9 9.5 13.4 8.0 9.7 2.4 7.0 -1.5 13.0 7.0 5.0 3.0

TD 8 11 3 7 0 2 2 1 1 0 0 0 0 0 1 0 0 0

Long 61 41 69 72 25 28 40 23 24 17 27 6 10 0 13 7 5 3

Avg/G 67.4 50.8 26.5 37.8 16.3 17.2 11.6 10.2 7.8 4.4 2.2 0.9 2.3 -0.6 1.0 0.9 5.0 0.4

Sooners Opponents

268 223

3,298 2,657

12.3 11.9

36 15

72 78

253.7 204.4

13 13

OKLAHOM A HISTORY

No. 66 50 27 23 22 20 17 14 7 6 3 5 2 2 1 1 1 1

REVIEW & OPPONENTS

GP Mark Clayton . . . . . . . . . . . . . . . . . . . . . . 13 Travis Wilson . . . . . . . . . . . . . . . . . . . . . . 13 Brandon Jones . . . . . . . . . . . . . . . . . . . . . 13 Mark Bradley . . . . . . . . . . . . . . . . . . . . . . 13 Kejuan Jones . . . . . . . . . . . . . . . . . . . . . . 12 Will Peoples . . . . . . . . . . . . . . . . . . . . . . . 13 James Moses . . . . . . . . . . . . . . . . . . . . . . 13 J.D. Runnels . . . . . . . . . . . . . . . . . . . . . . 13 Joe Jon Finley . . . . . . . . . . . . . . . . . . . . . 12 Jejuan Rankins . . . . . . . . . . . . . . . . . . . . .11 D.J. Wolfe . . . . . . . . . . . . . . . . . . . . . . . . 13 Adrian Peterson . . . . . . . . . . . . . . . . . . . . 13 Ataleo Ford. . . . . . . . . . . . . . . . . . . . . . . . . 6 Donta Hickson . . . . . . . . . . . . . . . . . . . . . . 5 Willie Roberts . . . . . . . . . . . . . . . . . . . . . . 13 Tashard Choice . . . . . . . . . . . . . . . . . . . . . 8 David Robinson . . . . . . . . . . . . . . . . . . . . . 1 Dan Townsend . . . . . . . . . . . . . . . . . . . . . . 7

THE SOONERS

GP Jason White . . . . . . . . . . . . . . . . . . . . . . . 13 Tommy Grady . . . . . . . . . . . . . . . . . . . . . . . 5 Team . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Mark Bradley . . . . . . . . . . . . . . . . . . . . . . 12

COACHING STAFF

Att 339 129 22 4 25 10 4 1 7 23

2 0 0 5 S EAS ON

GP Adrian Peterson . . . . . . . . . . . . . . . . . . . . 13 Kejuan Jones . . . . . . . . . . . . . . . . . . . . . . 12 Tashard Choice. . . . . . . . . . . . . . . . . . . . . . 8 Mark Bradley . . . . . . . . . . . . . . . . . . . . . . 13 D.J. Wolfe . . . . . . . . . . . . . . . . . . . . . . . . 13 Donta Hickson . . . . . . . . . . . . . . . . . . . . . . 5 Mark Clayton . . . . . . . . . . . . . . . . . . . . . . 13 Tommy Grady . . . . . . . . . . . . . . . . . . . . . . . 5 Team . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Jason White . . . . . . . . . . . . . . . . . . . . . . . 13

129 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

2004 SEASON REVIEW Punt Returns Antonio Perkins Jejuan Rankins Mark Clayton Chijioke Onyenegecha Mark Bradley Sooners Opponents

Kick Returns Mark Bradley Travis Wilson Jejuan Rankins Mark Clayton Brandon Jones Sooners Opponents

Interceptions Brodney Pool Gayron Allen Lawrence Dampeer Donte Nicholson Antonio Perkins Rufus Alexander Brandon Shelby Sooners Opponents

No. 17 9 7 1 1

Yds 156 57 101 -1 3

Avg 9.2 6.3 14.4 -1.0 3.0

TD 1 0 1 0 0

35 22

316 95

9.0 4.3

2 0

No. 12 9 3 3 1

Yds 236 135 78 67 18

Avg 19.7 15.0 26.0 22.3 18.0

TD 0 0 0 0 0

28 35

534 553

19.1 15.8

0 0

Sooners Opponents

50 18

Long 33 26 56 33 18 56 41

Punting Blake Ferguson Team Sooners Opponents

No. 52 1

Yds 2,183 1

Avg 42.0 1.0

Lg 58 1

TB 10 0

FC 9 0

I20 Blkd 25 1 0 0

53 84

2,184 3,493

41.2 41.6

58 67

10 7

9 22

25 25

Field Goals

DiCarlo FGM-FGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8-16 Percentage . . . . . . . . . . . . . . . . . . . . . . . . . . . 50.0 1-19 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0-0 20-29 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-6 30-39 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-5 40-49 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0-5 50-99 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 0-0

No. 2 1 1 1 1 1 1

Yds 42 10 31 32 0 5 0

Avg 21.0 10.0 31.0 32.0 0.0 5.0 0.0

TD 0 0 0 0 0 0 0

8 6

120 121

15.0 20.2

0 2

Long 42 10 31 32 0 5 0 42 34

Hartley . . . . . . . . . . . . . . 1-1 . . . . . . . . . . . . 100.0 . . . . . . . . . . . . . . 0-0 . . . . . . . . . . . . . . 1-1 . . . . . . . . . . . . . . 0-0 . . . . . . . . . . . . . . 0-0 . . . . . . . . . . . . . . 0-0

Bowling Green . . . . . . . . . . . . . . . . . . . Houston Cougars . . . . . . . . . . . . . . . . . University of Oregon . . . . . . . . . . . . . . Texas Tech . . . . . . . . . . . . . . . . . . . . . . Texas . . . . . . . . . . . . . . . . . . . . . . . . . . Kansas State . . . . . . . . . . . . . . . . . . . . Kansas Jayhawks . . . . . . . . . . . . . . . . Oklahoma State . . . . . . . . . . . . . . . . . . Texas A&M . . . . . . . . . . . . . . . . . . . . . . Nebraska . . . . . . . . . . . . . . . . . . . . . . . Baylor . . . . . . . . . . . . . . . . . . . . . . . . . . Colorado . . . . . . . . . . . . . . . . . . . . . . . USC . . . . . . . . . . . . . . . . . . . . . . . . . . .

Sooners (27), (24) 47 (35) 36 (22), (26) (26), 40 34, 43 (27) 42 (32), 34 42 (29)

Numbers in (parentheses) indicate ďŹ eld goal was made

No. 1

Yds 28

Avg 28.0

TD 1

1 1

28 8

28.0 8.0

1 1

Long 28 28 8

130 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

1 0

Long . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35. . . . . . . . . . . . . . . 29 Blocked. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . . . . . . . . . . . 0

Field Goal Sequence

Fumble Returns Lance Mitchell

Long 44 20 50 0 1

Opponents (47) 25 (32), (20) (43) 49 (39) 46 (34) (44), (42)


2004 SEASON REVIEW

316 95

IR Total Avg/G 0 1,937 149.0 0 1,055 81.2 0 803 61.8 0 800 61.5 0 709 59.1 0 363 27.9 0 224 17.2 0 183 16.6 0 156 14.2 0 151 11.6 0 136 10.5 0 133 10.2 0 107 13.4 0 94 7.8 0 49 9.8 42 42 3.2 32 32 2.5 31 31 3.9 0 14 2.3 0 13 1.0 10 10 0.8 0 9 1.8 0 5 5.0 5 5 0.4 0 3 0.5 0 5 5.0 0 -1 -0.1 0 -30 -5.0 0 -56 -4.3

534 120 6,977 553 152 4,687

536.7 360.5

Plays 413 339 129 25 5 22 15 10 4 8

Rush -56 1,925 513 107 73 100 9 52 11 -30

Pass 3,205 0 0 0 30 0 63 0 0 0

Total 3,149 1,925 513 107 103 100 72 52 11 -30

Avg/G 242.2 148.1 42.8 8.2 7.9 12.5 14.4 10.4 0.8 -5.0

Sooners Opponents

13 13

971 812

2,709 1,230

3,298 2,657

6,007 3,887

462.1 299.0

Sooners 61 Opponents 28

|------------- PATs ------------| FGs Kick Rush Rcv Pass DXP Saf Pts 0-0 0-0 0-0 0 0-0 0 0 90 8-16 45-48 0-0 0 0-0 0 0 69 0-0 0-0 0-0 0 0-0 0 0 66 0-0 0-0 0-0 0 0-0 0 0 54 0-0 0-0 0-0 0 0-0 0 0 48 0-0 0-0 0-0 0 0-0 0 0 30 0-0 0-0 0-0 0 0-0 0 0 18 1-1 12-12 0-0 0 0-0 0 0 15 0-0 0-0 0-0 0 0-0 0 0 12 0-0 0-0 0-0 0 0-0 0 0 12 0-0 0-0 0-0 0 0-0 0 0 6 0-0 0-0 0-0 0 0-0 0 0 6 0-0 0-0 0-0 0 0-0 0 0 6 0-0 0-0 0-0 0 0-0 0 0 6 0-0 0-0 0-0 0 0-0 0 0 6 0-0 0-0 0-0 0 0-0 0 0 6 0-0 0-0 0-0 0 0-1 0 0 0 9-17 57-60 8-11 27-28

0-0 0-0

0 0

0-1 0-0

0 0

1 0

452 219

OKLAHOM A HISTORY

G 13 13 12 13 13 8 5 5 13 6

Peterson DiCarlo Wilson Clayton Bradley Jones, K. Jones, B. Hartley Moses Peoples Roberts Hickson Finley Runnels Perkins Mitchell White

TD 15 0 11 9 8 5 3 0 2 2 1 1 1 1 1 1 0

REVIEW & OPPONENTS

White Peterson Jones, K. Wolfe Bradley Choice Grady Hickson Clayton Team

Scoring

THE SOONERS

13 2,709 3,928 13 1,230 2,657

PR KOR 0 0 101 67 3 236 0 135 0 0 0 18 0 0 57 78 156 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -1 0 0 0 0 0

COACHING STAFF

Sooners Opponents

Total Offense

Rec 12 876 491 660 196 345 224 48 0 151 29 133 7 94 -3 0 0 0 14 13 0 0 5 0 3 5 0 0 0

2 0 0 5 S EAS ON

Peterson Clayton Bradley Wilson Jones, K. Jones, B. Peoples Rankins Perkins Moses Wolfe Runnels Choice Finley Hickson Pool Nicholson Dampeer Ford Roberts Allen Grady Robinson Alexander Townsend Robinson Onyenegecha Team White

G Rush 13 1,925 13 11 13 73 13 5 12 513 13 0 13 0 11 0 11 0 13 0 13 107 13 0 8 100 12 0 5 52 13 0 13 0 8 0 6 0 13 0 13 0 5 9 1 0 13 0 7 0 1 0 13 0 6 -30 13 -56

TRAVIS WILSON

All-Purpose Yards

131 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

2004 SEASON REVIEW Rushing (Att.-Yds.-TD) Jones, K. Bowling Green 32-148-1 Houston 9-36-2 Oregon 11-41-0 Texas Tech dnp Texas 15-63-1 Kansas State 4-21-0 Kansas 7-14-0 Okla. State 8-49-0 Texas A&M 11-38-0 Nebraska 14-48-1 Baylor 7-30-0 Colorado 7-16-0 USC 4-9-0

Peterson 16-100-1 25-117-2 24-183-2 22-146-1 32-225-0 36-130-0 22-122-1 33-249-1 29-101-1 15-58-0 32-240-3 28-172-3 25-82-0

White 2-8-0 0-0-0 5-(-31)-0 2-4-0 2-16-0 1-(-2)-0 2-(-18)-0 2-(-7)-0 1-(-11)-0 2-(-8)-0 1-1-0 0-0-0 3-(-8)-0

Wolfe Choice 1-(-1)-0 dnp 13-63-0 dnp 3-3-0 dnp 0-0-0 16-71-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 0-0-0 1-2-0 6-29-0 0-0-0 0-0-0 7-40-0 dnp

Receiving (No.- Yds.-TD) Bradley Choice Clayton Finley Ford Hickson B. Jones K. Jones Moses Peoples Peterson Rankins Roberts Robinson Runnels Townsend T. Wilson Wolfe

BG 1-6-0 dnp 7-74-2 1-14-0 dnp 0-0-0 3-45-0 3-13-0 2-13-0 2-39-1 0-0-0 1-17-0 0-0-0 dnp 0-0-0 0-0-0 1-17-0 0-0-0

HOU 1-10-0 dnp 5-122-0 1-10-0 0-0-0 dnp 3-58-1 0-0-0 0-0-0 4-43-0 1-(-1)-0 0-0-0 0-0-0 1-5-0 0-0-0 1-3-0 2-16-2 2-31-0

ORE 1-17-0 dnp 6-91-0 dnp 0-0-0 2-(-3)-0 3-46-0 1-23-0 1-4-1 1-5-0 0-0-0 dnp 0-0-0 dnp 1-10-0 0-0-0 1-20-0 0-0-0

TT 0-0-0 0-0-0 4-33-0 0-0-0 dnp dnp 2-24-0 dnp 1-4-0 1-5-0 0-0-0 0-0-0 0-0-0 dnp 3-21-1 dnp 4-64-2 0-0-0

Grady dnp 8-9-0-50-1 dnp dnp dnp dnp dnp dnp dnp dnp 2-2-0-5-0 2-3-0-8-0 0-0-0-0-0

TEX 0-0-0 0-0-0 3-19-0 0-0-0 dnp dnp 1-12-0 2-4-0 1-2-0 2-24-0 0-0-0 0-0-0 0-0-0 dnp 2-18-0 dnp 3-34-0 0-0-0

DICARLO FG FG Seq Bowling Green 2 (27), (24) Houston . 47 Oregon 1 (35) Texas Tech . 36 Texas 2 (22), (26) Kansas State 1 (26), 40 Kansas . 34, 43 Oklahoma State 1 (27) Texas A&M . 42 Nebraska 1 (32), 34 Baylor . 42 Colorado . . USC . .

HARTLEY FG FG Seq . . . . . . . . . . . . . . . . . . . . . . . . 1 (29)

PAT 4-5 9-9 4-4 4-4 0-0 4-4 4-5 5-5 6-6 3-4 1-1 . .

PAT . . . . . . . . . . 4-4 6-6 2-2

Numbers in (parentheses) indicate ďŹ eld goal was made

Passing (Comp.-Att.-Int.-Yds.-TD)

White Bowling Green . . . . . . . . . . . . . . . . . . 21-31-1-238-3 Houston . . . . . . . . . . . . . . . . . . . . . . . 14-18-0-257-2 Oregon . . . . . . . . . . . . . . . . . . . . . . . . 17-23-0-213-1 Texas Tech . . . . . . . . . . . . . . . . . . . . . 15-24-0-151-3 Texas . . . . . . . . . . . . . . . . . . . . . . . . . .14-26-2-113-0 Kansas State . . . . . . . . . . . . . . . . . . . 20-31-1-256-4 Kansas . . . . . . . . . . . . . . . . . . . . . . . . 27-44-0-389-4 Oklahoma State . . . . . . . . . . . . . . . . . 14-26-0-221-3 Texas A&M . . . . . . . . . . . . . . . . . . . . . 19-35-0-292-5 Nebraska . . . . . . . . . . . . . . . . . . . . . . 29-35-0-383-3 Baylor . . . . . . . . . . . . . . . . . . . . . . . . . 19-32-0-194-2 Colorado. . . . . . . . . . . . . . . . . . . . . . . 22-29-2-254-3 USC . . . . . . . . . . . . . . . . . . . . . . . . . . 24-36-3-244-2

Kicking Statistics

KSU 2-46-0 0-0-0 5-52-2 0-0-0 dnp dnp 4-27-0 0-0-0 1-9-0 1-5-0 1-6-0 0-0-0 0-0-0 dnp 1-23-0 dnp 5-88-2 0-0-0

132 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

FERGUSON Bowling Green Houston Oregon Texas Tech Texas Kansas State Kansas Oklahoma State Texas A&M Nebraska Baylor Colorado USC

KU 2-21-1 0-0-0 5-112-1 0-0-0 dnp dnp 4-78-1 1-5-0 3-21-0 4-42-0 0-0-0 2-21-0 0-0-0 dnp 1-8-0 0-0-0 5-81-1 0-0-0

OSU 4-128-3 0-0-0 5-48-0 0-0-0 0-0-0 0-0-0 1-11-0 2-23-0 0-0-0 1-10-0 1-1-0 dnp 0-0-0 dnp 0-0-0 dnp 0-0-0 0-0-0

(No.-Avg./Long) 2-45.0/46 2-45.5/54 4-43.8/58 3-42.3/55 5-40.2/45 6-42.0/55 5-43.4/58 5-47.4/58 6-35.3/43 2-43.0/45 4-40.5/44 4-38.8/52 4-44.5/51

A&M 3-59-2 0-0-0 6-102-0 1-24-1 dnp dnp 1-11-0 0-0-0 3-45-1 0-0-0 0-0-0 0-0-0 0-0-0 dnp 0-0-0 dnp 5-51-1 0-0-0

NEB 3-92-1 0-0-0 5-61-0 0-0-0 1-4-0 0-0-0 1-4-1 3-40-0 1-5-0 2-28-0 0-0-0 1-10-0 1-13-1 dnp 3-21-0 0-0-0 9-135-0 0-0-0

50+ 0 1 1 1 0 1 2 3 0 0 0 1 1

BAY 0-0-0 1-7-0 3-35-1 2-21-0 0-0-0 0-0-0 1-10-0 5-46-0 3-40-0 0-0-0 0-0-0 0-0-0 0-0-0 dnp 2-19-0 0-0-0 3-23-1 1-(-2)-0

I-20 0 1 1 2 0 3 4 1 1 1 2 2 2

I-10 0 1 0 0 2 0 0 0 1 0 0 0 0

COL 4-46-0 dnp 8-106-2 1-2-0 0-0-0 0-0-0 1-6-0 3-12-0 0-0-0 1-5-1 0-0-0 dnp 0-0-0 dnp 1-13-0 0-0-0 5-72-0 0-0-0

I-5 0 0 0 1 0 0 0 1 1 0 0 0 0

USC 2-66-0 dnp 4-21-0 1-23-0 dnp 0-0-0 2-13-0 2-30-0 1-8-0 1-18-0 2-6-0 2-0-0 0-0-0 dnp 0-0-0 0-0-0 7-59-2 0-0-0


2004 SEASON REVIEW Defensive Statistics Sacks No-Yds . 2-12 2-17 2-19 2-9 10-66 8-55 7-34 3-12 1-7 . 1-8 . 1-2 1-7 . 1-1 3-21 . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Int-Yds 2-42 . 1-5 1-32 . . . . 1-0 1-0 1-10 . . . . . . . 1-31 . . . . . . . . . . . . . . . . . . . . . . . . . . .

Pass Def BrUp 9 5 4 6 3 2 3 4 5 1 . 6 2 2 . 1 . 1 3 . . . . 1 . . . . . . . . . . . . . . . . 1 . . . . .

QBH . 4 5 2 . 12 6 11 5 . 1 . . 1 2 . . 2 2 . . . . 1 . . . . . 1 . . . . . . . . . . . . . . . .

Fumbles Rcv-Yds 1-0 2-28 3-0 . 2-0 . 1-0 1-0 . 1-0 . . . . . . . . 1-0 . . . . 1-0 1-0 . . . . . . . . . . . . . . . . . . . . .

FF . 1 3 . 2 . 1 2 . 1 . 1 . . 2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Blkd Kick Saf 1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1

Sooners Opponents

GP 13 13

Solo 502 583

Ast 301 430

Tackles Total 803 1,013

TFL/Yds 99-385 83-228

Sacks No-Yds 39-258 9-73

Int-Yds 8-120 9-152

Pass Def BrUp 59 41

QBH 55 22

Fumbles Rcv-Yds FF 14-28 13 9-8 12

Blkd Kick Saf 1 1 4 .

OKLAHOM A HISTORY

TFL/Yds 5-6 10-29 7-26 3-25 4-17 17-83 10-60 11-47 6-17 1-7 2-3 1-8 . 6-8 3-9 . 3-4 3-21 5-12 . . . . 1-2 . . . . . 1-1 . . . . . . . . . . . . . . . .

REVIEW & OPPONENTS

Tackles Total 92 78 74 72 50 42 42 40 34 33 31 27 25 24 17 14 12 11 10 9 6 5 5 5 5 4 4 3 3 3 3 2 2 2 2 2 2 1 1 1 1 1 1 1 1 .

THE SOONERS

Ast 27 33 25 22 20 17 19 11 18 11 12 8 6 14 12 4 4 8 2 5 1 3 2 4 1 1 1 3 . 2 1 2 . . . . . . 1 1 . . . . . .

COACHING STAFF

Solo 65 45 49 50 30 25 23 29 16 22 19 19 19 10 5 10 8 3 8 4 5 2 3 1 4 3 3 . 3 1 2 . 2 2 2 2 2 1 . . 1 1 1 1 1 .

2 0 0 5 S EAS ON

Pool, Brodney Mitchell, Lance Alexander, Rufus Nicholson, Donte Ingram, Clint Cody, Dan Jackson, Jonathan Birdine, Larry Shelby, Brandon Perkins, Antonio Allen, Gayron Onyenegecha, C. Bassey, Eric McGruder, Lynn Pendleton, Carl Walker, Marcus Latimer, Zach Ayodele, Remi Dampeer, Lawrence Dennison, Russell Carter, Jason Jones, Brandon Poteat, Jowahn Dvoracek, Dusty Cade, Tony Peoples, Will Bradley, Mark Runnels, J.D. Wolfe, D.J. Thibodeaux, Calvin Pleasant, Demarrio Gutierrez, Jacob Moses, James Stephens, Darren Nixon, Laenar Jones, Kejuan Wilson, Travis Ferguson, Blake DiCarlo, Trey Hulsey, Grant Williams, Darien Chaisson, Kelvin Coleman, Steven Clayton, Mark Sims, Wes Team

GP 13 13 13 13 13 13 13 13 13 11 13 13 10 13 12 5 8 12 8 13 13 13 8 2 12 13 13 13 13 5 13 2 13 7 3 12 13 13 13 4 7 11 11 13 13 6

133 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


6 3 NAT IONAL AWARD WINNERS 141 ALL-A MERICANS 23 BOWL CHAMPIONSHIPS 39 C ON FERENCE CHAMPIONSHIPS 7 NATI ONAL CHAMPIONSHIPS 134

2004 SEASON REVIEW 1 2 BOWLING GREEN OKLAHOMA

24 40

HOUSTON OKLAHOMA

13 63

3

OREGON OKLAHOMA

7 31

Sept. 4, 2004 | Norman, Okla. | 84,319 Gaylord Family - Oklahoma Memorial Stadium

Sept. 11, 2004 | Norman, Okla. | 84,280 Gaylord Family - Oklahoma Memorial Stadium

Sept. 18, 2004 | Norman, Okla. | 84,574 Gaylord Family - Oklahoma Memorial Stadium

BG First Downs 15 Rushing Yards 19-51 Passing Yards 218 Att.-Comp.-Int. 41-24-0 Total Offense 60-269 Fumbles-Lost 2-1 Penalties-Yards 5-35 Punts-Average 6-36.3 Punt Returns 1-5 Interceptions-Yards 1-28 Time of Possession 21:01 Third Down Conversions 8-16 Fourth Down Conversions 0-1 Sacks By-Yards 0-0

OU 27 52-258 238 31-21-1 83-496 3-1 7-65 2-45.0 4-59 0-0 38:59 10-18 3-3 0-0

UH First Downs 14 Rushing Yards 37-61 Passing Yards 221 Att.-Comp.-Int. 22-15-0 Total Offense 59-282 Fumbles-Lost 2-1 Penalties-Yards 10-49 Punts-Average 8-40.9 Punt Returns 1-18 Interceptions-Yards 0-0 Time of Possession 27:13 Third Down Conversions 2-12 Fourth Down Conversions 0-1 Sacks By-Yards 0-0

OR First Downs 20 Rushing Yards 34-140 Passing Yards 181 Att.-Comp.-Int. 37-25-0 Total Offense 71-321 Fumbles-Lost 1-1 Penalties-Yards 11-100 Punts-Average 6-40.8 Punt Returns 2-7 Interceptions-Yards 0-0 Time of Possession 28:37 Third Down Conversions 4-14 Fourth Down Conversions 2-3 Sacks-By-Yards 2-14

SCORE BY QUARTER Bowling Green 7 Oklahoma 7

14 3

3 17

0 13

24 40

SCORING OU - Clayton 6 yd pass from White (DiCarlo kick) BG - Sharon 18 yd pass from Jacobs (Suisham kick) OU - K. Jones 11 yd run (DiCarlo kick) BG - Suisham 47 yd field goal OU - Clayton 9 yd pass from White (Dicarlo kick) OU - DiCarlo 27 yd field goal OU - Peoples 24 yd pass from White (Dicarlo kick) OU - Peterson 35 yd run (DiCarlo kick) BG - Sharon 16 yd pass from Jacobs (Suisham kick) BG - Newson 28 yd interception return (Suisham kick) OU - DiCarlo 24 yd field goal STAT LEADERS Rushing: OU - K. Jones, 32-148 BG - Pope, 8-29 Passing: OU - White, 21-31-1-238 BG - Jacobs, 24-41-0-218 Receiving: OU - Clayton, 7-74 BG - Pope, 6-46 Tackles: OU - Mitchell, 9 BG - Burkes, 12 GAME SUMMARY Kejuan Jones (148) and Adrian Peterson (100) both eclipsed the century mark and the Sooners over-matched their first-ever Mid-American Conference opponent, 40-24. Quarterback Jason White complemented the ground game by hitting 21-of-31 passes for 238 yards and three touchdowns, including two to Mark Clayton.

SCORE BY QUARTER Houston 7 Oklahoma 21

0 28

0 7

OU 24 49-276 307 27-22-0 76-583 1-1 7-48 2-45.5 3-42 0-0 32:47 13-16 0-0 5-37 6 7

13 63

SCORING UH - Battle 3 yd run (Bell kick) OU - K. Jones 1 yd run (DiCarlo kick) OU - K. Jones 1 yd run (DiCarlo kick) OU - Bradley 51 yd run (DiCarlo kick) OU - Wilson 7 yd pass from White (DiCarlo kick) OU - B. Jones 40 yd pass from White (DiCarlo kick) OU - Perkins 41 yd punt return (DiCarlo kick) OU - Peterson 7 yd run (DiCarlo kick) OU - Wilson 9 yd pass from Grady (DiCarlo kick) OU - Peterson 1 yd run (DiCarlo kick) UH - Gilbert 1 yd run (Bell kick failed) STAT LEADERS Rushing: OU - Peterson, 25-117 UH - Gilbert, 9-54 Passing: OU - White, 14-18-0-257 UH - Kolb, 15-22-0-221 Receiving: OU - Clayton, 5-122 UH - Briles, 4-85 Tackles: OU - Pool & Alexander, 7 UH - Everson, 16 GAME SUMMARY Houston scored on its initial drive then watched Oklahoma’s juggernaut reel off 63 unanswered points enroute to a convincing 63-13 victory. Jason White, who played just one series deep into the second half, completed 14-of-18 passes for 257 yards and two touchdowns. The running game was in high gear, too. Adrian Peterson picked up 117 yards and two touchdowns on 25 carries to key a team total of 276 rushing yards for the Sooners.

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

SCORE BY QUARTER Oregon 0 Oklahoma 0

0 10

OU 27 46-214 213 23-17-0 69-427 2-1 6-45 4-43.8 2-22 0-0 31:23 9-14 0-0 2-14

7 14

0 7

7 31

SCORING OU - DiCarlo 35 yd field goal OU - Moses 4 yd pass from White (DiCarlo kick) OU - Hickson 25 yd run (DiCarlo kick) OR - Rosario 30 yd pass from Clemens (Siegel kick) OU - Peterson 40 yd run (DiCarlo kick) OU - Peterson 18 yd run (DiCarlo kick) STAT LEADERS Rushing: OU - Peterson, 24-183 OR - Whitehead, 13-66 Passing: OU - White, 17-23-0-213 OR - Clemens, 24-35-0-179 Receiving: OU - Clayton, 6-91 OR - Rosario, 7-64 Tackles: OU - Nicholson, 11 OR - Matson, 12 GAME SUMMARY Balance? It rarely gets better than this. Oklahoma had 214 rushing yards and 213 passing yards. That, coupled with a defensive effort that kept Oregon’s high-powered offense out of the end zone most of the day, led to OU’s 31-7 victory over the Ducks. The win capped a fifth straight season in which the Sooners won all of their regular season non-conference games. Adrian Peterson ran for 183 yards and became the first OU freshman ever to gain 100 yards in his first three games. Jason White was steady, completing 17-of-23 passes for 213 yards and one touchdown. The defense, spearheaded by Donte Nicholson’s 11 tackles, shut down the Oregon offense.


13 28

Oct. 2, 2004 | Norman, Okla. | 84, 580 Gaylord Family - Oklahoma Memorial Stadium

SCORE BY QUARTER Texas Tech 0 Oklahoma 7

3 7

3 7

OU 18 40-221 151 24-15-0 64-372 1-0 7-60 3-42.3 1-3 3-42 27:37 10-16 2-2 3-18 7 7

13 28

UT 13 40-154 86 23-8-0 63-240 3-3 5-40 7-36.9 0-0 2-32 23:58 6-15 1-2 0-0

SCORE BY QUARTER Texas 0 Oklahoma 0

0 3

0 3

Oct. 16, 2004 | Manhattan, Kan. | 52,310 KSU Stadium

OU 24 52-301 113 27-14-2 79-414 3-1 5-29 5-40.2 3-19 0-0 36:02 4-14 1-1 3-20 0 6

0 12

SCORING OU - DiCarlo 22 yd field goal OU - DiCarlo 26 yd field goal OU - K. Jones 6 yd run (pass failed) STAT LEADERS Rushing: OU - Peterson, 32-225 UT - Benson, 23-92 Passing: OU - White, 14-26-2-113 UT - Young, 8-23-0-86 Receiving: OU - Wilson, 3-34 UT - Benson, 3-33 Tackles: OU - Alexander, 10 UT - Harris,Huff,Johnson, 11 GAME SUMMARY The scoreboard belied the dominance in OU’s 12-0 Red River Shootout victory. Adrian Peterson shredded Texas for 225 yards on 32 carries and the Sooner defense held the Longhorns, No. 6 in the nation in scoring before the game, to a goose egg. It marked the first shutout of UT in 282 games, and the first by OU over its rival since 1972. The win was Oklahoma’s fifth straight in the series, the second longest streak by OU over UT, and it gave Bob Stoops his 60th victory as the Sooners’ head coach. Trey DiCarlo started the scoring with a pair of short field goals, made more treacherous by wet conditions. The Sooners then removed all doubt with an 11-play, 80-yard march midway through the fourth quarter. Kejuan Jones covered the last six yards to give Oklahoma a lead that looked twice as big due to the way the team’s defense was playing.

OU First Downs 23 Rushing Yards 44-149 Passing Yards 256 Att.-Comp.-Int. 31-20-1 Total Offense 75-405 Fumbles-Lost 1-0 Penalties-Yards 10-100 Punts-Average 6-42.0 Punt Returns 3-30 Interceptions-Yards 0-0 Time of Possession 31:19 Third Down Conversions 8-17 Fourth Down Conversions 1-1 Sacks By-Yards 4-32 SCORE BY QUARTER Oklahoma 7 Kansas State 7

10 7

7 7

KSU 17 25-1 246 41-21-0 66-247 3-3 4-28 8-39.4 0-0 1-27 28:41 4-14 0-1 1-2 7 0

31 21

SCORING KS - Sproles 1 yd run (Rheem kick) OU - Wilson 17 yd pass from White (DiCarlo kick) KS - Figurs 38 yd pass from Meier (Rheem kick) OU - Wilson 14 yd pass from White (DiCarlo kick) OU - DiCarlo 26 yd field goal KS - Archer 27 yd interception return (Rheem kick) OU - Clayton 15 yd pass from White (DiCarlo kick) OU - Clayton 8 yd pass from White (DiCarlo kick) STAT LEADERS Rushing: OU - Peterson, 36-130 KS - Sproles, 13-34 Passing: OU - White, 20-31-1-256 KS - Meier, 20-38-0-242 Receiving: OU - Wilson, 5-88 KS - Moreira, 7-85 Tackles: OU - Alexander, 9 KS - Simmons, 13 GAME SUMMARY Oklahoma faced its first second-half deficit of the year, but rode a strong performance by Jason White to down a stubborn Kansas State team, 31-21, in a rematch of the previous season’s conference title game. White fired four touchdown strikes and a dominant Sooner defense logged five sacks, while limiting KSU running back Darren Sproles to just 34 yards on 13 carries. Oklahoma trailed twice in the game, but after falling behind 21-17 in the third period, the Sooners mounted a 10-play, 72-yard drive that yielded the go-ahead score. White engineered the march, hitting all five of his passing attempts, including a 15-yarder to Mark Clayton for the TD.

OKLAHOM A HISTORY

GAME SUMMARY As matter of fact victories go, this one was, well, typical. Oklahoma took care of business in its Big 12 opener, 28-13. Jason White was the picture of efficiency, completing 15-of-24 passes with three touchdowns and no interceptions. Running back Adrian Peterson, making his first start, ran 22 times for 146 yards and one score. On defense, OU did something it had not done all season -- intercept a pass. In fact, it intercepted three, including two by Brodney Pool. Tech piled up yards, but its normally high-scoring offense did not yield a touchdown until the 4:50 mark of the final period, and its point output was 25 below its season average.

First Downs Rushing Yards Passing Yards Att.-Comp.-Int. Total Offense Fumbles-Lost Penalties-Yards Punts-Average Punt Returns Interceptions-Yards Time of Possession Third Down Conversions Fourth Down Conversions Sacks By-Yards

31 21

REVIEW & OPPONENTS

STAT LEADERS Rushing: OU - Peterson, 22-146 TT - Henderson, 17-65 Passing: OU - White, 15-24-0-151 TT - Cumbie, 36-55-3-369 Receiving: OU - Wilson, 4-64 TT - Glover, 9-62 Tackles: OU - Pool, 13 TT - Smith, 11

Oct. 9, 2004 | Dallas, Texas | 79,587 Cotton Bowl

OKLAHOMA KANSAS STATE

THE SOONERS

SCORING OU - Peterson 1 yd run (DiCarlo kick) TT - Trlica 32 yd field goal OU - Wilson 10 yd pass from White (DiCarlo kick) TT - Trlica 20 yd field goal OU - Runnels 13 yd pass from White (DiCarlo kick) OU - Wilson 9 yd pass from White (DiCarlo kick) TT - Mack 8 yd run (Trlica kick)

0 12

COACHING STAFF

TT First Downs 27 Rushing Yards 24-56 Passing Yards 369 Att.-Comp.-Int. 55-36-3 Total Offense 79-425 Fumbles-Lost 1-1 Penalties-Yards 2-20 Punts-Average 1-44.0 Punt Returns 2-4 Interceptions-Yards 0-0 Time of Possession 32:23 Third Down Conversions 10-18 Fourth Down Conversions 1-3 Sacks-By-Yards 0-0

5

TEXAS OKLAHOMA

2 0 0 5 S EAS ON

4

TEXAS TECH OKLAHOMA

2004 SEASON REVIEW 6

135 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


6 3 NAT IONAL AWARD WINNERS 141 ALL-A MERICANS 23 BOWL CHAMPIONSHIPS 39 C ON FERENCE CHAMPIONSHIPS 7 NATI ONAL CHAMPIONSHIPS

2004 SEASON REVIEW 7 8 KANSAS OKLAHOMA

10 41

Oct. 23, 2004 | Norman, Okla. | 84,520 Gaylord Family - Oklahoma Memorial Stadium KU First Downs 11 Rushing Yards 34-72 Passing Yards 184 Att.-Comp.-Int. 35-17-2 Total Offense 69-256 Fumbles-Lost 1-1 Penalties-Yards 12-109 Punts-Average 10-45.3 Punt Returns 3-6 Interceptions-Yards 0-0 Time of Possession 30:48 Third Down Conversions 7-18 Fourth Down Conversions 0-0 Sacks By-Yards 2-17

OU 23 31-118 389 44-27-0 75-507 2-0 9-70 6-36.3 6-27 2-36 29:12 6-13 0-1 4-23

SCORE BY QUARTER Kansas 0 Oklahoma 0

0 13

10 14

0 14

10 41

SCORING OU - Clayton 61 yd pass from White (DiCarlo kick) KU - Rideau 78 yd pass from Barmann (Webb kick) OU - Wilson 41 yd pass from White (DiCarlo kick) KU - Beck 43 yd field goal OU - B. Jones 69 yd pass from White (DiCarlo kick) OU - Mitchell 28 yd fumble recovery (DiCarlo kick) OU - Peterson 11 yd run (DiCarlo kick) OU - Bradley 8 yd pass from White (kick blocked) STAT LEADERS Rushing: OU - Peterson, 22-122 KU - Randle, 11-35 Passing: OU - White, 27-44-0-389 KU - Barmann, 12-22-2-160 Receiving: OU - Clayton, 5-112 KU - Rideau, 4-96 Tackles: OU - Mitchell, 11 KU - Reid, 11 GAME SUMMARY Jason White feasted on a Kansas defense geared to stop the run and Oklahoma cruised past the Jayhawks, 41-10, in the annual homecoming game. White connected on 27-of-44 passes for 389 yards and four touchdowns with no interceptions. And by the end of the day, that running game that KU was trying to stop erupted anyway. Adrian Peterson tied Emmitt Smith and Marshall Faulk in reaching the 1,000-yard mark as quickly as any freshman in 1-A history -- 7 games. He had 22 rushes for 122 yards and one touchdown. In the meantime, the OU defense shut down Kansas. Seventy-eight of the Jayhawks’ 256 yards came on one play.

OKLAHOMA OKLAHOMA STATE

38 35

Oct. 30, 2004 | Stillwater, Okla. | 48,837 Boone Pickens Stadium OSU 17 41-150 207 20-8-0 61-357 0-0 2-15 7-45.7 1-5 0-0 28:09 5-13 0-0 1-9

SCORE BY QUARTER Oklahoma 7 Oklahoma State 0

3 7

14 14

38 35

SCORING OU - Bradley 4 yd pass from White (DiCarlo kick) OS - Don. Woods 3 yd run (Ricks kick) OS - G. Jones 0 yd fumble recovery (Ricks kick) OU - Bradley 72 yd pass from White (DiCarlo kick) OU - Bradley 23 yd pass from White (DiCarlo kick) OU - Clayton 50 yd punt return (DiCarlo kick) OS - Eilliot 39 yd pass from Don. Woods (Ricks kick) OU - Peterson 80 yd run (DiCarlo kick) OS - Morency 2 yd run (Ricks kick) OU - DiCarlo 27 yd field goal OS - Morency 4 yd run (Ricks kick) STAT LEADERS Rushing: OU,- Peterson, 33-249 OS - Morency, 17-93 Passing: OU - White,14-26-0-221 OS - D.Woods, 8-20-0-207 Receiving: OU - Clayton, 5-48 OS - D. Woods, 3-128 Tackles: OU - Mitchell, 8 OS - Thompson, 10 GAME SUMMARY OU gift wrapped Oklahoma State’s first two touchdowns, but rebounded to post a 38-35 win at Stillwater. Jason White tossed three first-half touchdown passes, all to Mark Bradley, and Adrian Peterson broke loose for a career-high 249 rushing yards to spearhead the offense. The OU defense held Cowboy running back Vernand Morency under 100 yards for the first time in the season. OSU had a chance to send the game to overtime, but Jason Ricks’ 49-yard field goal with 11 seconds remaining sailed left.

136 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

42 35

Nov. 6, 2004 | College Station, Texas | 81,125 Kyle Field

OU First Downs 20 Rushing Yards 45-267 Passing Yards 221 Att.-Comp.-Int. 26-14-0 Total Offense 71-488 Fumbles-Lost 2-2 Penalties-Yards 10-77 Punts-Average 5-47.4 Punt Returns 3-64 Interceptions-Yards 0-0 Time of Possession 31:51 Third Down Conversions 8-16 Fourth Down Conversions 1-2 Sacks By-Yards 2-16 14 14

9

OKLAHOMA TEXAS A&M

OU First Downs 26 Rushing Yards 42-141 Passing Yards 292 Att.-Comp.-Int. 35-19-0 Total Offense 77-433 Fumbles-Lost 0-0 Penalties-Yards 6-64 Punts-Average 6-35.3 Punt Returns 3-34 Interceptions-Yards 1-32 Time of Possession 32:07 Third Down Conversions 7-76 Fourth Down Conversions 0-1 Sacks By-Yards 5-25 SCORE BY QUARTER Oklahoma 7 Texas A&M 14

14 14

14 0

A&M 23 33-129 360 38-20-1 71-489 3-2 9-69 5-36.0 3-20 0-0 27:53 6-13 2-2 1-11 7 7

42 35

SCORING A&M - Murphy 18 yd pass from McNeal (Pegram kick) A&M - McNeal 1 yd run (Pegram kick) OU - Wilson 31 yd pass from White (DiCarlo kick) A&M - Schroeder 45 yd pass from McNeal (Pegram kick) OU - Peterson 4yd run (DiCarlo kick) A&M - Taylor 71 yd pass from Young (Pegram kick) OU - Finley 24 yd pass from White (DiCarlo kick) OU - Bradley 11 yd pass from White (DiCarlo kick) OU - Moses 2 yd pass from White (DiCarlo kick) A&M - Tomas 4 yd pass from Schroeder (Pegram kick) OU - Bradley 39 yd pass from White (DiCarlo kick) STAT LEADERS Rushing: OU - Peterson, 29-101 A&M - Lewis, 9-57 Passing: OU - White, 19-35-0-292 A&M - McNeal, 11-24-1-213 Receiving: OU - Clayton, 6-102 A&M - Carter, 4-68 Tackles: OU - Nicholson & Mitchell, 8 A&M - Appel & McDaniel, 12 GAME SUMMARY Oklahoma trailed by 14 points three times before rallying on the strength of five Jason White touchdown passes to claim a 42-35 victory at No. 22 Texas A&M. A pair of A&M turnovers early in the second half, both deep in its own territory, set the table for OU, which cashed in both for TDs. Texas A&M, which scored two touchdowns on faked kicks, tied the game at 35 with 10:08 remaining, before White answered with a 39-yard TD strike to Mark Bradley.


3 30

No. 13, 2004 | Norman, Okla. | 84, 916 Gaylord Family - Oklahoma Memorial Stadium

SCORE BY QUARTER Nebraska 0 Oklahoma 3

NU OU 13 24 40-201 31-98 73 413 13-8-1 36-30-0 53-274 67-511 0-0 1-0 7-60 4-45 6-39.3 2-43.0 0-0 0-0 0-0 1-10 27:19 32:41 4-11 6-12 0-1 1-2 0-0 1-2 0 20

0 7

3 0

3 30

SCORE BY QUARTER Oklahoma 7 Baylor 0

7 0

14 0

Dec. 4, 2004 | Kansas City, Mo. | 62,130 Big 12 Championship - Arrowhead Stadium

BU 11 31-26 130 22-14-0 53-156 1-1 1-15 7-47.3 3-14 0-0 27:10 4-12 0-0 0-0 7 0

35 0

SCORING OU - Clayton 19 yd pass from White (DiCarlo kick) OU - Wilson 10 yd pass from White (Hartley kick) OU - Peterson 1 yd run (Hartley kick) OU - Peterson 1 yd run (Hartley kick) OU - Peterson 2 yd run (Hartley kick) STAT LEADERS Rushing: OU - Peterson, 32-240 BU - Mosley, 15-57 Passing: OU - White, 19-32-0-194 BU - Parks, 14-22-0-130 Receiving: OU - K. Jones, 5-46 BU - Roberts, 5-80 Tackles: OU - Pool, 10 BU - Lane, 14 GAME SUMMARY Adrian Peterson tied an NCAA freshman record with his 10th, 100-yard rushing game of the season and OU steamrolled Baylor, 35-0, in the regular season finale for both teams. The Sooner offense was slow out of the gates, but went to the locker room with a 14-0 halftime lead on the strength of a late second-quarter touchdown that set the tone for the remainder of the game. Oklahoma’s defense was nearly flawless in racking up a season-high seven sacks. Larry Birdine had three of those sacks and also forced a fumble that set up the Sooners’ first touchdown of the game. Baylor managed just two pushes into OU territory, one each half, and the Bears got no deeper than the 44 in the second half. Garrett Hartley shed his redshirt during the second quarter and converted all four of his extra point attempts.

First Downs Rushing Yards Passing Yards Att.-Comp.-Int. Total Offense Fumbles-Lost Penalties-Yards Punts-Average Punt Returns Interceptions-Yards Time of Possession Third Down Conversions Fourth Down Conversions Sacks By-Yards SCORE BY QUARTER Colorado 0 Oklahoma 14

CU 3 16-(-4) 50 28-9-1 44-46 0-0 6-37 9-43.6 2-2 2-34 20:28 0-12 0-1 0-0 0 14

3 7

OU 26 46-236 262 32-24-2 78-498 1-1 9-90 4-38.8 4-16) 1-0 39:32 11-16 1-1 3-14 0 7

3 42

SCORING OU - Peoples 5 yd pass from White (Hartley kick) OU - Clayton 22 yd pass from White (Hartley kick) OU - Clayton 22 yd pass from White (Hartley kick) OU - Peterson 1 yd run (Hartley kick) OU - Peterson 3 yd run (Hartley kick) CU - Crosby 34 yd field goal OU - Peterson 32 yd run (Hartley kick) STAT LEADERS Rushing: OU - Peterson, 28-172 CU - Purify, 12-7 Passing: OU - White, 22-29-2-254-3 CU - Klatt, 8-26-1-52 Receiving: OU - Clayton, 8-106 CU - Mackey, 2-14 Tackles: OU - Latimer & Allen, 4 CU - Brooks, 9 GAME SUMMARY Thirty-eight times before Oklahoma had won a conference championship in football. But rarely had the Sooners been so dominating in sewing up a league crown as they were in securing No. 39. OU steamrolled Colorado 42-3 and thus secured an invitation to the BCS title game. The Sooner offense was its typically high-powered self, but this was a night when the defense simply broke an opponent’s will. Colorado had three first downs for the game and recorded 46 total yards, the fewest by any opponent during the Bob Stoops era. All the while, the OU offense was moving at will, especially early when it scored on four of its first five possessions.

OKLAHOM A HISTORY

GAME SUMMARY On a night when 23 Oklahoma players saw their final action on Owen Field, the Sooners systematically dismantled Nebraska, 30-3, before a record home crowd of 84,916. Both Jason White and the OU defense played nearly flawless football. White connected on 29-of-35 passes for 383 yards with three touchdowns and no interceptions. During one stretch, he completed 18 consecutive throws to break his own school record. Travis Wilson proved to be the favorite target. He established career highs with nine receptions and 135 receiving yards. The defense came within one snap of shutting out Nebraska and ending the Huskers’ 111game scoring streak but NU was able to boot a 39-yard field goal on the game’s final play.

OU First Downs 29 Rushing Yards 47-302 Passing Yards 199 Att.-Comp.-Int. 34-21-0 Total Offense 81-501 Fumbles-Lost 0-0 Penalties-Yards 2-10 Punts-Average 4-40.5 Punt Returns 2-(-3) Interceptions -Yards 0-0 Time of Possession 32:50 Third Down Conversions 8-15 Fourth Down Conversions 2-2 Sacks By-Yards 7-52

3 42

REVIEW & OPPONENTS

STAT LEADERS Rushing: OU - Peterson, 15-58 NU - Ross, 30-130 Passing: OU - White, 29-35-0-383 NU - Dailey, 8-12-1-73 Receiving: OU - Wilson, 9-135 NU - Fluellen, 3-22 Tackles: OU - Pool, 9 NU - Ruud, 10

Nov. 20, 2004 | Waco, Texas | 32,182 Floyd Casey Stadium

COLORADO OKLAHOMA

THE SOONERS

SCORING OU - DiCarlo 32 yd field goal OU - Roberts 13 yd pass from White (DiCarlo kick failed) OU - K. Jones 1 yd run (DiCarlo kick) OU - B. Jones 4 yd pass from White (DiCarlo kick) OU - Bradley 23 yd pass from White (DiCarlo kick) NU - Dyches 39 yd field goal

35 0

COACHING STAFF

First Downs Rushing Yards Passing Yards Att.-Comp.-Int. Total Offense Fumbles-Lost Penalties-Yards Punts-Average Punt Returns Interceptions-Yards Time of Possession Third Down Conversions Fourth Down Conversions Sacks By-Yards

11

OKLAHOMA BAYLOR

2 0 0 5 S EAS ON

10

NEBRASKA OKLAHOMA

2004 SEASON REVIEW 12

137 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


6 3 NAT IONAL AWARD WINNERS 141 ALL-A MERICANS 23 BOWL CHAMPIONSHIPS 39 C ON FERENCE CHAMPIONSHIPS 7 NATI ONAL CHAMPIONSHIPS 138

13

2005 OU OPPONENTS OKLAHOMA USC

19 55

Jan. 4, 2005 | Miami, Fla. | 77,912 National Championship - Pro Player Stadium OU First Downs 19 Rushing Yards 40-151 Passing Yards 244 Att.-Comp.-Int. 36-24-3 Total Offense 76-372 Fumbles-Lost 3-2 Penalties-Yards 3-30 Punts-Average 4-44.5 Punt Returns 1-3 Interceptions -Yards 0-0 Time of Possession 35:06 Third Down Conversions 8-17 Fourth Down Conversions 0-1 Sacks By-Yards 1-9 SCORE BY QUARTER Oklahoma 7 USC 14

3 24

0 10

SC 19 28-208 332 35-18-0 63-525 1-0 9-75 4-43.5 1-7 3-31 24:54 6-14 2-2 2-20 9 7

19 55

SCORING OU - Wilson 5 yd pass from White (Hartley kick) SC - Byrd 33 yd pass from Leinart (Killeen kick) SC - White 6 yd run (Killeen kick) SC - Jarrett 54 yd pass from Leinart (Killeen kick) SC - Smith 5 yd pass from Leinart (Killeen kick) OU - Hartley 29 yd field goal SC - Smith 33 yd pass from Leinart (Killeen kick) SC - Killeen 44 yd field goal SC - Smith 4 yd pass from Leinart (Killeen kick) SC - Killeen 42 yd field goal SC - White 8 yd run (Killeen kick) OU - Team safety OU - Wilson 9 yd pass from White (Hartley kick) STAT LEADERS Rushing: OU - Peterson, 25-82 SC - White, 15-118 Passing: OU - White, 24-36-3-244 SC - Leinart, 18-35-0-332 Receiving: OU - Wilson, 7-59 SC - Smith, 7-113 Tackles: OU - Pool, 7 SC - Tatupu, 12 GAME SUMMARY USC didn’t need any help, but Oklahoma was willing to oblige anyway. The Trojans played a nearly flawless game, made even more so by five OU turnovers, and cruised to the BCS title, 55-19. Oklahoma got on the board first after marching 92 yards in 12 plays. USC answered with a touchdown on its next possession before the teams traded punts. The game turned for good when OU’s Mark Bradley muffed the punt and Southern Cal scored on the next play. Oklahoma finished the season at 12-1.

Oklahoma’s 11-game schedule for 2005 includes six home games at Gaylord Family - Oklahoma Memorial Stadium. TCU, Tulsa, Kansas State, Baylor, Texas A&M and Oklahoma State highlight the schedule in Norman. The Sooners travel to the Rose Bowl to battle UCLA in their final non-conference game. Big 12 road highlights include the annual showdown with Texas at the Cotton Bowl in Dallas, KU at Arrowhead Stadium in Kansas City, Nebraska at Lincoln and Texas Tech in Lubbock. TCU Horned Frogs Game: Sept. 3 at Norman, Okla. Series: 6-3, OU | 2005 Record: 5-6 Last Meeting: 10-9, OU (9/12/98)

Media Relations Director: Steve Fink s.fink@tcu.edu GoFrogs.com | (817) 257-7969

Tulsa Golden Hurricane Game: Sept. 10 at Norman, Okla. Series: 13-7-1, OU | 2005 Record: 4-8 Last Meeting: 37-0, OU (8/30/02)

Media Relations Director: Don Tomkalski donald-tomkalski`@utulsa.edu TulsaHurricane.com | (918) 631-2395

UCLA Bruins Game: Sept. 17 at Pasadena, Calif. Series: 4-0, OU | 2005 Record: 6-6 Last Meeting: 59-24, OU (9/20/03)

Media Relations Director: Marc Dellins mdellins@athletics.ucla.edu UCLAbruins.com | (310) 206-6831

Kansas State Wildcats Game: Oct. 1 at Norman, Okla. Series: 67-17-4, OU | 2005 Record: 4-7 Last Meeting: 31-21, OU (10/16/04)

Media Relations Director: Gary Bowman gbowman@k-state.edu K-Statesports.com | (785) 532-7977

Texas Longhorns Game: Oct. 8 at Dallas, Texas Series: 39-55-5, UT | 2005 Record: 11-1 Last Meeting: 12-0, OU (10/09/04)

Media Relations Director: John Bianco jbianco@mail.utexas.edu TexasSports.com | (512) 471-1346

Kansas Jayhawks Game: Oct. 15 at Kansas City, Mo. Series: 65-27-6, OU | 2005 Record: 4-7 Last Meeting: 41-10, OU (10/23/04)

Media Relations Director: Chris Theisen theisen@ku.edu KUathletics.com | (785) 864-3474

Baylor Bears Game: Oct. 22 at Norman, Okla. Series: 14-0, OU | 2005 Record: 3-8 Last Meeting: 35-0, OU (11/20/04)

Media Relations Director: Heath Nielsen heath_nielsen@baylor.edu BaylorBears.com | (254) 710-3538

Nebraska Cornhuskers Game: Oct. 29 at Lincoln, Neb. Series: 41-37-3, OU | 2005 Record: 5-6 Last Meeting: 30-3, OU (11/13/04)

Media Relations Director: Keith Mann kmann@huskers.com Huskers.com | (402) 472-2263

Texas A&M Aggies Game: Nov. 12 at Norman, Okla. Series: 13-10, OU | 2005 Record: 7-5 Last Meeting: 42-35, OU (11/06/04)

Media Relations Director: Alan Cannon acannon@athletics.tamu.edu AggieAthletics.com | (979) 845-0563

Texas Tech Red Raiders Game: Nov. 19 at Lubbock, Texas Series: 10-2, OU | 2005 Record: 8-4 Last Meeting: 28-13, OU (10/02/04)

Media Relations Director: Chris Cook chris.cook@ttu.edu TexasTech.com | (806) 742-2770

Oklahoma State Cowboys Game: Nov. 26 at Norman, Okla. Series: 76-16-7, OU | 2005 Record: 7-5 Last Meeting: 38-35, OU (10/30/04)

Media Relations Director: Steve Buzzard buzzars@okstate.edu OKstate.com | (405) 744-7714

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


HISTORY 2 0 0 5 S EAS ON COACHING STAFF THE SOONERS

WILSON

OPPONENTS & REVIEW

TRAVIS

OKLAHOM A HISTORY 139 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

INDIVIDUAL RECORDS

140

Rushing

Passing

Most Rushes Game . . . . . . . . 55, Steve Owens vs. Oklahoma State, 1969 Season . . . . . . . 393, Steve Owens, 1968 Career. . . . . . . . 958, Steve Owens, 1967-69

Most Pass Attempts Game . . . . . . . . 58, Josh Heupel vs. Colorado, 1999 Season . . . . . . . 553, Josh Heupel, 1999 Career. . . . . . . . 1,025, Josh Heupel, 1999-2000

Rushing Yardage Game . . . . . . . . 294, Greg Pruitt vs. Kansas State, 1971 Season . . . . . . . 1,925, Adrian Peterson, 2004 Career. . . . . . . . 4,118, Billy Sims, 1975-79

Pass Completions Game . . . . . . . . 39, Josh Heupel vs. Mississippi, 1999 Season . . . . . . . 349, Josh Heupel, 1999 Career. . . . . . . . 654, Josh Heupel, 1999-2000

Yards Per Attempt Game . . . . . . . . 26.8 (6-161), Eric Mitchel vs. Kansas State, 1988 Season . . . . . . . 8.98, Greg Pruitt, 1971 (196 carries) Career. . . . . . . . 7.48, Darrell Shepard (166 carries), 1979-81

Completion Percentage Game . . . . . . . . 1.000 (8-8), Jack Jacobs vs. Kansas, 1941 Season . . . . . . . .653 (255-390), Jason White, 2004 Career. . . . . . . . .638 (654-1,025), Josh Heupel, 1999-2000

200-Yard Games Season . . . . . . . 4, Billy Sims, 1978 Career. . . . . . . . 7, Billy Sims, 1975-79

Lowest Interception Percentage Season . . . . . . . .000, Monte Deere, 1962 (71 attempts) . . . . . . . . . . . . . .022, Jason White, 2003 (451 attempts, 10 int.) Career. . . . . . . . .024 Jason White, 1999-2004 (900 attempts, 24 int.)

Rushing Yards by a Freshman Game . . . . . . . . 259, Earl Johnson vs. Colorado, 1983 (redshirt) 249, Adrian Peterson vs. Oklahoma State, 2004 (true) Season . . . . . . . 1,184, De’Mond Parker, 1996 (redshirt) 1,925, Adrian Peterson, 2005 (true) Rushing Yards by a Quarterback Game . . . . . . . . 195, Thomas Lott vs. Kansas State, 1976 Season . . . . . . . 1,289, Jack Mildren, 1971 Career. . . . . . . . 2,713, Jamelle Holieway, 1985-88 Rushing Touchdowns Game . . . . . . . . 6, Quentin Griffin vs. Texas, 2000 Season . . . . . . . 23, Steve Owens, 1969; Billy Sims, 1979 Career. . . . . . . . 57, Steve Owens, 1967-69 All-Purpose Running Yards Game . . . . . . . . 374, Greg Pruitt vs. Kansas State, 1971 (294 Rushing, 34 Receiving, 46 Return Yards) Season . . . . . . . 2,148, Quentin Griffin, 2002 (1,884 Rushing, 264 Receiving) Career. . . . . . . . 5,881, Joe Washington, 1972-75 (4,071 Rushing, 253 Receiving, 1,557 Return Yards)

Receiving Most Passes Caught Game . . . . . . . . 11, Josh Norman vs. Texas Tech, 2001 11, Trent Smith vs. Kansas, 2001 Season . . . . . . . 83, Mark Clayton, 2003 Career. . . . . . . . 221, Mark Clayton, 2001-04 Most Yards Gained Game . . . . . . . . 190, Mark Clayton vs. Texas, 2003 Season . . . . . . . 1,425, Mark Clayton, 2003 Career. . . . . . . . 3,241, Mark Clayton, 2001-04 Yards Per Reception Game . . . . . . . . 47.7, Virgil Boll vs. Colorado, 1962 (3-143) Season . . . . . . . 29.1, Jon Harrison, 1971 (17 rec.) Career. . . . . . . . 27.0, Jon Harrison, 1970-71 (30 rec.) Most Touchdown Receptions Game . . . . . . . . 4, Trent Smith vs. Kansas, 2001 Season . . . . . . . 15, Mark Clayton, 2003 Career. . . . . . . . 31, Mark Clayton, 2001-04

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Most Yards Passing Game . . . . . . . . 429, Josh Heupel vs. Louisville, 1999 Season . . . . . . . 3,850, Josh Heupel, 1999 Career. . . . . . . . 7,992, Jason White, 1999-2004 300-Yard Games Season . . . . . . . 8, Josh Heupel, 1999 Career. . . . . . . . 14, Josh Heupel, 1999-2000 Consecutive 300-Yard Games Season . . . . . . . 3, Josh Heupel, 1999 (twice); 2000 (twice) 400-Yard Games Season . . . . . . . 2, Josh Heupel, 1999 Career. . . . . . . . 2, Josh Heupel, 1999-2000 Touchdown Passes Game . . . . . . . . 5, five times; last by Jason White vs. Texas A&M, 2004 Season . . . . . . . 40, Jason White, 2003 Career. . . . . . . . 81, Jason White, 1999-2004 Consecutive Game With a Touchdown Pass Season . . . . . . . 13, Josh Heupel, 1999; 2000 Career. . . . . . . . 25, Josh Heupel, 1999-2000

Kickoff Returns Most Kickoff Returns Game . . . . . . . . 7, Jarrail Jackson vs. Nebraska, 1997 Season . . . . . . . 22, Chris Lewis, 1997 Career. . . . . . . . 55, Buster Rhymes, 1980-84 Most Kickoff Return Yards Game . . . . . . . . 229, Brandon Daniels vs. Notre Dame, 1999 Season . . . . . . . 508, Brandon Daniels, 1999 Career. . . . . . . . 1,237, Buster Rhymes, 1980-84 Best Kickoff Return Average Game . . . . . . . . 45.80, Brandon Daniels vs. Notre Dame, 1999 (5 ret.) 57.00, Antwone Savage vs. North Carolina, 2001 (2 ret.) 100.00, twice (1 ret.); most recently Mark Bradley vs. Iowa State, 2003 Season . . . . . . 31.75, Brandon Daniels, 1999 Career. . . . . . . . 25.67, Joe Wylie, 1970-72


INDIVIDUAL RECORDS Punt Returns

Most Total Offense Yards Game . . . . . . . . 410, Josh Heupel vs. Louisville, 1999 (429 Passing, -19 Rushing) Season . . . . . . . 3,773, Josh Heupel, 2000 (3,606 Passing, 167 Rushing) Career. . . . . . . . 7,877, Jason White, 1999-2004 (7,922 Passing, -45 Rushing)

Most Punt Returns Game . . . . . . . . 8, Jack Jacobs vs. Santa Clara, 1941; Larry Grigg vs. Nebraska, 1951; Curtis Fagan vs. N. Texas, 2001, & Kansas State, 2001 Season . . . . . . . 53, Antonio Perkins, 2003 Career. . . . . . . . 126, Jarrail Jackson, 1996-99

Most Points Game . . . . . . . . 36, Quentin Griffin vs. Texas, 2000 Season . . . . . . . 138, Billy Sims, 1979; Steve Owens, 1969 Career. . . . . . . . 342, Steve Owens, 1967-69

Best Punt Return Average Game . . . . . . . . 39.6, Antonio Perkins vs. UCLA (7-277) Season . . . . . . . 23.5, Jack Mitchell, 1948 (22 ret.) Career. . . . . . . . 23.8, Jack Mitchell, 1946-48 (39 ret.)

Most Touchdowns Game . . . . . . . . 6, Quentin Griffin vs. Texas, 2000 Season . . . . . . . 23, Steve Owens, 1969; Billy Sims, 1979 Career. . . . . . . . 57, Steve Owens, 1967-69

Defense

Total Tackles Game . . . . . . . . 23, Jackie Shipp vs. Missouri, 1981 Season . . . . . . . 189, Jackie Shipp, 1981 Career. . . . . . . . 530, Daryl Hunt, 1975-78 Tackles by a Lineman Game . . . . . . . . 21, Kevin Murphy vs. Missouri, 1983 Season . . . . . . . 144, Kevin Murphy, 1983 Career. . . . . . . . 365, Rick Bryan, 1980-83

Most Extra Points Attempted Game . . . . . . . . 11, Tim Lashar vs. Missouri, 1986 Trey DiCarlo vs. Texas A&M, 2003 Season . . . . . . . 76, Trey DiCarlo, 2003 Career. . . . . . . . 202, R.D. Lashar, 1987-90

Tackles by a Linebacker Game . . . . . . . . 23, Jackie Shipp vs. Missouri, 1981 Season . . . . . . . 189, Jackie Shipp, 1981 Career. . . . . . . . 530, Daryl Hunt, 1975-78

Most Consecutive Extra Points Season . . . . . . . 66, Tim Lashar, 1986 Career. . . . . . . . 140, Uwe von Schamann, 1976-78

Most Points by a Kicker Game . . . . . . . . 17, Trey DiCarlo vs. Texas, 2003 Season . . . . . . . 131, Trey DiCarlo, 2003 Career. . . . . . . . 328, R.D. Lashar, 1987-90

Punts

Best Punting Average Game . . . . . . . . 56.3, Michael Keeling vs. Kansas, 1981 (3 punts) Season . . . . . . . 47.84, Jack Jacobs, 1940 Career. . . . . . . . 42.48, Jeff Ferguson, 1998-2001

Interceptions Game . . . . . . . . 3, eight times; most recently by J.T. Thatcher vs. Kansas, 2000 Season . . . . . . . 9, Rickey Dixon, 1987 Career. . . . . . . . 18, Darrell Royal, 1946-49 Sacks Game . . . . . . . . 3 by several; last by Larry Birdine vs. Baylor, 2004 Season . . . . . . . 14, Martin Chase, 1997; Cedric Jones, 1994 Career. . . . . . . . 31.5, Cedric Jones, 1992-95

OKLAHOM A HISTORY

Most Punts Game . . . . . . . . 18, Jack Jacobs vs. Santa Clara, 1941 Season . . . . . . . 80, Jeff Ferguson, 2001, and Mike Winchester, 1984 Career. . . . . . . . 252, Jeff Ferguson, 1998-2001

Tackles for Loss Game . . . . . . . . 5, five times; most recently Teddy Lehman vs. Kansas State, 2003 Season . . . . . . . 24, Kelly Gregg, 1998 Career. . . . . . . . 59, Rocky Calmus, 1998-01

REVIEW & OPPONENTS

Most Field Goals Game . . . . . . . . 4, five times; most recently DiCarlo at Texas A&M, 2002 Season . . . . . . . 21, Tim Duncan, 2001 Career. . . . . . . . 48, Tim Duncan, 1999-01; Tim Lashar, 1983-86

Tackles by a Defensive Back Game . . . . . . . . 20, Rodney Rideau vs. Notre Dame, 1999 Season . . . . . . . 120, Rodney Rideau, 1999 Career. . . . . . . . 299, Zac Henderson, 1974-77

THE SOONERS

Most Extra Points Game . . . . . . . . 11, Tim Lashar vs. Missouri, 1986; Trey DiCarlo vs. Texas A&M, 2003 Season . . . . . . . 74, Trey DiCarlo, 2003 Career. . . . . . . . 196, R.D. Lashar, 1987-90

COACHING STAFF

Scoring

Most Punt Return Yards Game . . . . . . . . 277, Antonio Perkins vs. UCLA, 2003 Season . . . . . . . 643, Antonio Perkins, 2002 Career. . . . . . . . 1,441, Antonio Perkins, 2002-04

2 0 0 5 S EAS ON

Total Offense

141 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

TEAM RECORDS Most Rushing Attempts Game . . . . . . . . . 88 vs. Oklahoma State, 1972 Season . . . . . . . . 879, 1972 Per Game . . . . . . 73.9, 1974 Most Rushing Yards Game . . . . . . . . . 768 vs. Kansas State, 1988 Season . . . . . . . . 5,635, 1971 Rushing Yards Per Attempt Game . . . . . . . . . 10.6 (72-768) vs. Kan. St., 1988 Season . . . . . . . . 7.1, 1971 Most Passing Attempts Game . . . . . . . . . 58 vs. Colorado, 1999 Season . . . . . . . . 566, 1999 Per Game . . . . . . 47.17, 1999 Most Pass Completions Game . . . . . . . . . 39 vs. Mississippi, 1999 Independence Bowl Season . . . . . . . . 358, 1999 Per Game . . . . . . 28.83, 1999 Fewest Attempts Game . . . . . . . . . 1, several times Season . . . . . . . . 63, 1976 Per Game . . . . . . 5.25, 1976 Fewest Completions Game . . . . . . . . . 0, several; last vs. Arizona, 1989 Season . . . . . . . . 24, 1976 Per Game . . . . . . 2.0, 1976 Most Yards Passing Game . . . . . . . . . 429, vs. Louisville, Baylor, 1999 Season . . . . . . . . 4,109, 2003 Per Game . . . . . . 327.42, 1999 Completion Percentage Game . . . . . . . . . 1.000, several times Season . . . . . . . . .660, 2004 Most Yards Per Attempt Game . . . . . . . . . 25.7 vs. Colorado, 1962 Season . . . . . . . . 12.77, 1971 Most Yards Per Completion Game . . . . . . . . . 36.1 vs. Colorado, 1962 Season . . . . . . . . 26.85, 1971 Most Passes had Intercepted Game . . . . . . . . . 5 vs. Wisconsin, 1970; Kansas State, 1969 Season . . . . . . . . 18, 2000 Total Offense Game . . . . . . . . . 875 vs. Colorado, 1980 Season . . . . . . . . 6,682, 1971 Per Game . . . . . . 566.83, 1971 Most Plays Season . . . . . . . . 1,041, 1972 Per Game . . . . . . 86.8, 1972

Yards Per Play Game . . . . . . . . . 10.6 vs. Colorado, 1980 Season . . . . . . . . 7.6, 1971 Fewest Turnovers Game . . . . . . . . . 0, several; last vs. Baylor, 2003 Season . . . . . . . . 17, 2002 and 2003 Per Game . . . . . . 1.21, 2002 and 2003 Scoring Game . . . . . . . . . 82 vs. Colorado, 1980 Season . . . . . . . . 601, 2003 Per Game . . . . . . 46.6, 1956 Most Touchdowns Game . . . . . . . . . 12 vs. Colorado, 1980 Season . . . . . . . . 78, 2003 Per Game . . . . . . 7.0, 1956 Most Rushing Touchdowns Game . . . . . . . . . 12 vs. Colorado, 1980 Season . . . . . . . . 61, 1971 Per Game . . . . . . 5.10, 1956 Most Passing Touchdowns Game . . . . . . . . . 5 vs. Indiana State, 1999; Louisville, 1999; Iowa State, 2003; Texas A&M, 2003, 2004 Season . . . . . . . . 43, 2003 Per Game . . . . . . 3.07, 2003 Field Goals Game . . . . . . . . . 4 vs. Texas, 1966; vs. Penn State, 1986; vs. Oklahoma State, 1986; vs. Iowa State, 1995; at Texas A&M, 2002 Season . . . . . . . . 21, 2001 Per Game . . . . . . 1.62, 2001 Field Goal Percentage Game . . . . . . . . . 1.000, several times; last at Baylor, 2003, 2-2 Season . . . . . . . . .889, 1992 Most Extra Points Game . . . . . . . . . 11 vs. Missouri, 1986; Texas A&M, 2003 Season . . . . . . . . 74, 2003 Extra Point Percentage Game . . . . . . . . . 1.000, several times Season . . . . . . . . 1.000, several times last in 1993 (46-46) Most Punts Game . . . . . . . . . 18 vs. Santa Clara, 1941 Season . . . . . . . . 85, 2001 Punting Average Game . . . . . . . . . 56.3 vs. Kansas State, 1981 Season . . . . . . . . 42.15, 1966

142 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Most Punt Return Yards Game . . . . . . . . . 277 vs. UCLA, 2003 Season . . . . . . . . 949, 1948 Per Game . . . . . . 86.27, 1948 Most Kickoff Return Yards Game . . . . . . . . . 289 vs. Notre Dame, 1999 Season . . . . . . . . 898, 1997 Per Game . . . . . . 75.20, 1947 Fewest Rushing Yards Allowed Game . . . . . . . . . -52 vs. Kansas, 1986 Season . . . . . . . . 594, 1949 Per Game . . . . . . 54.00, 1949 Fewest Rushing Attempts Season . . . . . . . . 296, 1999 Per Game . . . . . . 26.9, 1999 Fewest Rushing Yards Per Attempt Season . . . . . . . . 1.58, 1986 Fewest Passing Yards Allowed Game . . . . . . . . . -2 vs. Oklahoma State, 1993 Season . . . . . . . . 555, 1956 Per Game . . . . . . 55.50, 1956 Fewest Passing Completions Season . . . . . . . . 47, 1960 Per Game . . . . . . 4.7, 1960 Most Sacks Game . . . . . . . . . 9 vs. Texas Tech, 1997 Season . . . . . . . . 48, 1986 Per Game . . . . . . 4.09, 1989 Fewest Points Allowed Game . . . . . . . . . 0, 249 times (117 since 1938); last vs. Baylor, 2004 Season . . . . . . . . 29, 1938 Per Game . . . . . . 2.64, 1938 Fewest Touchdowns Allowed Game . . . . . . . . . 0, several times; last vs. Colorado, 2004* Season . . . . . . . . 4, 1938 Per Game . . . . . . 0.36, 1938 *2004 Big 12 Championship Game Total Defense Game . . . . . . . . . 14 vs. Washington State, 1938 Season . . . . . . . . 1,226, 1938 Per Game . . . . . . 111.45, 1938


LONGEST PLAYS ALL PLAYS

Pos Yr TD Play WR Jr. Y KO Return RB Fr. Y KO Return DB Fr. Y Int. Return RB Fr. Y KO Return DB Jr. Y Int. Return DB Sr. N Int. Return RB Jr. Y Rush DB Jr. Y Int. Return RB Jr. N Rush QB Jr. Y Punt Return

Yds 96 96 91 90 90 89 88 86 86 86 86

Player Jeff Frazier Buck McPhail Jimmy Harris Mike Thomas George Thomas Darrell Shepard Keith Jackson De’Mond Parker Anthony Stafford Marcus Dupree Leon Heath

Yds 95 90 90 87 86 83 82 80 80

Receiver Ben Hart P.J. Mills Lance Rentzel Max Boydston Wahoo McDaniel Virgil Boll Arthur Guess Larry Grigg Ted Long

PUNT RETURNS Pos RB RB QB RB RB QB TE RB RB RB RB

Player Wahoo McDaniel Joe Wylie Brian Lewis Darrell Royal Jack Jacobs Brian Lewis Scott Blanton Todd Thomsen Michael Keeling Billy Pricer Darrell Royal

Pos TE RB P QB RB P P/K P K/P RB QB

Opponent North Texas, 1995 Kansas State, 1951 Kansas, 1954 Oregon, 1972 Oklahoma State, 1949 Colorado, 1980 Nebraska, 1985 San Diego State, 1996 Texas, 1988 Nebraska, 1982 LSU, 1950 TD Y Y Y Y Y Y Y Y Y

Opponent Florida State, 1965 Iowa State, 1995 Maryland, 1964 California, 1954 West Virginia, 1958 Colorado, 1962 Nebraska, 1989 Pittsburgh, 1953 Colorado, 1990

Yr So. Jr. Sr. Jr. Sr. So. Fr. Jr. So.

Opponent Kansas, 1973 Oklahoma State, 1977 Oklahoma State, 1975 Missouri, 1990 Missouri, 1978 Colorado, 1976 Tulsa, 1987 Florida State, 1980 Auburn, 1971

Yr Jr. So. So. Jr. Jr. Fr. Jr. So. Jr. Sr. So.

Opponent Iowa State, 1958 Kansas State, 1970 Oklahoma State, 1996 Oklahoma State, 1948 Nebraska, 1940 Missouri, 1995 Texas Tech, 1993 Iowa State, 1987 Kansas, 1981 North Carolina, 1956 Missouri, 1947

Yds 96 93 91 91 87 85 84 83 82 81 81

Player Darrell Royal Eddie Hinton Antonio Perkins Tommy McDonald Darrius Johnson Freddie Nixon Antonio Perkins Buddy Jones Antonio Perkins J.T. Thatcher Jakie Sandefer

INTERCEPTION RETURNS Yds 100 99 97 96 95 94 85 82 82 80

Player Al Needs Joe Golding Derrick Strait Randy Hughes Rickey Dixon David Baker J.T. Thatcher Carl Dodd Johnny West Scott Garl

FUMBLE RETURNS Yds 69 65 61 58 58 57 56 45 43 28 28

Player Cory Heinecke Marlon Wesley Claire Morford Dante Jones Aubrey Beavers Clyde Powers John Goodman Eric Bassey Max Boydston Rocky Calmus Adrian Cooper

TD Y Y Y Y Y Y N Y Y

Opponent Kansas State, 1980 Iowa State, 2003 Colorado, 1980 Oklahoma State, 1980 Boston College, 1949 Kansas State, 1937 Kansas State, 2000 Santa Clara, 1940 Notre Dame, 1999

Pos QB WR DB RB DB RB DB RB DB DB RB

Yr Jr. So. So. So. Jr. So. Jr. Jr. So. Jr. Jr.

TD Y Y Y Y Y Y Y Y Y Y Y

Opponent Kansas State, 1948 Colorado, 1966 Tulsa, 2002 Iowa State, 1955 Missouri, 1994 Iowa State, 1977 UCLA, 2003 Iowa State, 1949 South Florida, 2002 Oklahoma State, 1999 Iowa State, 1957

Pos DB DB DB DB DB QB DB QB RB DB

Yr Fr. Jr. Sr. Jr. Sr. Jr. Sr. So. So. Sr.

TD Y Y N Y Y Y Y Y Y Y

Opponent Kansas State, 1945 Texas, 1946 Texas Tech, 2003 Colorado, 1973 Oklahoma State, 1987 Duke, 1957 Texas Tech, 2000 Maryland, 1955 Kansas State, 1944 Kansas, 1988

Pos DL DB OL LB DL DB DL DB TE LB DL

Yr Sr. Sr. So. Sr. Jr. Jr. Jr. Fr. Sr. Jr. Fr.

TD Y Y Y Y Y Y Y Y Y N N

Opponent Air Force, 2001 San Diego State, 1995 Marquette, 1941 North Texas, 1987 Colorado, 1992 Clemson, 1972 Kansas, 1979 Alabama, 2002 Oklahoma State, 1953 Texas-El Paso, 2000 North Texas, 1987

OPPONENTS’ LONGEST PLAYS Yds 100 99 99 97 95 93 92 90 89 89

Player Mack Heron Eric Vann Wes Caswell Wayne McGarity Willie Jones Gale Sayers Charles Johnson Eric Williams Greg Washington Jarvis Redwine

Type of Play Kickoff Return Rush Troy DeGar Pass Major Applewhite Pass Kickoff Return Kickoff Return Koy Detmer Pass Todd Doxson Pass Carl Straw Pass Rush

Team Kansas State, 1968 Kansas, 1997 Tulsa, 1996 Texas, 1998 Iowa State, 1971 Kansas, 1964 Colorado, 1992 Iowa State, 1995 Kansas State, 1988 Nebraska, 1980

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

Yds 91 87 81 81 79 78 78 78 78 78 78

TD Y N Y Y Y Y Y Y Y Y Y

Yr Fr. Jr. Fr. Fr. Fr. Jr. Sr. Jr. Sr.

REVIEW & OPPONENTS

Player Tony DiRienzo Uwe von Schamann Tony DiRienzo R.D. Lashar Uwe von Schamaan Uwe von Schamaan R.D. Lashar Michael Keeling John Carrol

PUNTS

Yr Jr. Jr. So. So. Sr. Jr. So. Fr. Sr. Fr. Jr.

Passer Ronnie Fletcher Eric Moore John Hammond Buddy Leake Bobby Boyd Monte Deere Steve Collins Buddy Leake Cale Gundy

FIELD GOALS Yds 60 58 56 54 54 54 53 53 53

Yds Player Pos 100 Buster Rhymes RB 100* Mark Bradley DB 99* Jerome Ledbetter RB 95 Jerome Ledbetter RB 95 George Thomas RB 94 Otis Rogers RB 93 J.T. Thatcher DB 92 Orville Matthews RB 89 Brandon Daniels WR * First career kickoff return attempt

THE SOONERS

PASSING

KICKOFF RETURNS

COACHING STAFF

RUSHING

Opponent Iowa State, 2003 Kansas State, 1980 Kansas State, 1945 Colorado, 1980 Texas, 1946 Texas Tech, 2003 North Texas, 1995 Colorado, 1973 Kansas State, 1951 Kansas State, 1948

2 0 0 5 S EAS ON

Yds Player 100* Mark Bradley 100 Buster Rhymes 100 Al Needs 99* Jerome Ledbetter 99 Joe Golding 97 Derrick Strait 96 Jeff Frazier 96 Randy Hughes 96 Buck McPhail 96 Darrell Royal * First career return

143


6 3 NAT IONAL AWARD WINNERS

RUSHING * SEASON Yds Player 1,925 Adrian Peterson 1,896 Billy Sims 1,884 Quentin Griffin 1,760 Greg Pruitt 1,670 Billy Sims 1,649 Steve Owens 1,523 Steve Owens 1,344 Mike Gaddis 1,321 Joe Washington 1,289 Jack Mildren

Pos RB RB RB RB RB RB RB RB RB QB

Cl Fr. Jr. Sr. Jr. Sr. Jr. Sr. Sr. Jr. Sr.

RUSHING * CAREER Yds Player 4,118 Billy Sims 4,071 Joe Washington 4,041 Steve Owens 3,938 Quentin Griffin 3,403 De’Mond Parker 3,198 Stanley Wilson 3,122 Greg Pruitt 2,910 Lydell Carr 2,726 Mike Gaddis 2,713 Jamelle Holieway

Pos RB RB RB RB RB RB RB RB RB QB

Years 1975-79 1972-75 1967-69 1999-02 1996-98 1979-82 1970-72 1984-87 1988-91 1985-88

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

RUSHING * GAME Yds Player 294 Greg Pruitt 291 De’Mond Parker 282 Billy Sims 274 Mike Gaddis 261 Steve Owens 259 Earl Johnson 258 David Overstreet 249 Adrian Peterson 248 Quentin Griffin 248 Steve Owens

141 ALL-A MERICANS

RUSHING RECORDS Pos RB RB RB RB RB RB RB RB RB RB

RUSHING ATTEMPTS * GAME Att Player Pos 55 Steve Owens RB 53 Steve Owens RB 47 Steve Owens RB 46 Steve Owens RB 44 Steve Owens RB 41 Steve Owens RB 40 Steve Owens RB 39 Ron Shotts RB 38 Dewell Brewer RB 37 Spencer Tillman RB 37 Steve Owens RB 37 Steve Owens RB

Yr Jr. So. Sr. So. Sr. Fr. Sr. Fr. Sr. Sr.

Att 19 31 36 29 55 28 18 33 32 53 Yr 2004 1978 2002 1971 1979 1968 1969 1991 1974 1971

Yr Sr. Sr. Jr. Jr. Sr. Jr. Sr. Jr. Fr. Fr. Jr. Jr.

Opponent, Year Kansas State, 1971 Texas, 1997 Missouri, 1979 Oklahoma State, 1989 Oklahoma State, 1969 Colorado, 1983 Colorado, 1980 Oklahoma State, 2004 Texas, 2002 Iowa State, 1969 Car 339 256 287 196 248 393 358 241 194 223 Car 593 675 958 744 579 567 422 563 443 539

Avg 5.70 7.41 6.56 8.98 6.73 4.20 4.25 5.58 6.81 5.78

TD 15 22 15 18 23 21 23 17 12 20

Avg 6.94 6.03 4.22 5.29 5.88 5.64 7.40 5.17 6.15 5.03

TD 53 39 57 44 21 15 38 21 30 32

Opponent, Year Oklahoma State, 1969 Iowa State, 1969 Kansas State, 1968 Missouri, 1968 Kansas, 1968 Nebraska, 1968 Wisconsin, 1969 Oklahoma State, 1966 Kansas State, 1989 Hawaii, 1983 N.C. State, 1968 Kansas, 1968

144 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

RUSHING ATTEMPTS * SEASON Att Player Class Year 393 Steve Owens Jr. . . . . . . . . . . . . . . . . . . . . . . . . . . 1968 358 Steve Owens Sr. . . . . . . . . . . . . . . . . . . . . . . . . . 1969 339 Adrian Peterson Fr. . . . . . . . . . . . . . . . . . . . . . . . . . 2004 287 Quentin Griffin Sr. . . . . . . . . . . . . . . . . . . . . . . . . . 2002 256 Billy Sims Jr. . . . . . . . . . . . . . . . . . . . . . . . . . . 1978 248 Billy Sims Sr. . . . . . . . . . . . . . . . . . . . . . . . . . 1979 241 Mike Gaddis Sr. . . . . . . . . . . . . . . . . . . . . . . . . . 1991 225 Kejuan Jones So. . . . . . . . . . . . . . . . . . . . . . . . . . 2003 223 Jack Mildren Sr. . . . . . . . . . . . . . . . . . . . . . . . . . 1971 209 Waymon Clark Jr. . . . . . . . . . . . . . . . . . . . . . . . . . . 1973 RUSHING ATTEMPTS * CAREER Att Player 958 Steve Owens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 744 Quentin Griffin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 675 Joe Washington . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 593 Billy Sims . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 579 De’Mond Parker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 567 Stanley Wilson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 563 James Allen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 563 Lydell Carr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 541 Jack Mildren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 539 Jamelle Holieway . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Years 1967-69 1999-02 1972-75 1975-79 1996-98 1979-82 1993-96 1984-87 1969-71 1985-88

RUSHING TOUCHDOWNS * GAME TD Player Class Opponent, Year 6 Quentin Griffin So. Texas, 2000 5 Jerald Moore So. Oklahoma State, 1994 5 Steve Owens Jr. Nebraska, 1968 4 By 17 players; most recently by K. Jones vs. Texas Tech, 2003 RUSHING TOUCHDOWNS * SEASON TD Player Year 23 Billy Sims . . . . . . . . . . . . . . . . . . . . . . 1979 23 Steve Owens . . . . . . . . . . . . . . . . . . . 1969 22 Billy Sims . . . . . . . . . . . . . . . . . . . . . . 1978 21 Steve Owens . . . . . . . . . . . . . . . . . . . 1968 20 Jack Mildren . . . . . . . . . . . . . . . . . . . 1971 18 J.C. Watts . . . . . . . . . . . . . . . . . . . . . 1980 18 Steve Davis . . . . . . . . . . . . . . . . . . . . 1973 18 Greg Pruitt . . . . . . . . . . . . . . . . . . . . . 1971 18 George Thomas . . . . . . . . . . . . . . . . 1949 17 Quentin Griffin . . . . . . . . . . . . . . . . . . 2000 17 Mike Gaddis . . . . . . . . . . . . . . . . . . . 1991 17 Billy Vessels . . . . . . . . . . . . . . . . . . . 1952

Class . . . . . . . . . . . . . .Sr. . . . . . . . . . . . . . .Sr. . . . . . . . . . . . . . . Jr. . . . . . . . . . . . . . . Jr. . . . . . . . . . . . . . .Sr. . . . . . . . . . . . . . .Sr. . . . . . . . . . . . . . So. . . . . . . . . . . . . . . Jr. . . . . . . . . . . . . . .Sr. . . . . . . . . . . . . . So. . . . . . . . . . . . . . .Sr. . . . . . . . . . . . . . .Sr.

RUSHING TOUCHDOWNS * CAREER TD Player Seasons 57 Steve Owens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1967-69 53 Billy Sims . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975-79 44 Quentin Griffin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999-02 39 Joe Washington . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1972-75 38 Greg Pruitt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1970-72 35 J.C. Watts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1976-80 34 Steve Davis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1973-75 32 Jamelle Holieway . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1985-88 32 Kejuan Jones . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2002-04 32 Jack Mildren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969-71


RUSHING & PASSING RECORDS

Cl Jr. Jr. Sr. Jr. Sr. Sr. Sr. Sr. Jr. Jr. Jr. Jr.

Att 42 54 32 53 27 34 29 37 50 41 50 40

Com 29 37 22 39 44 26 35 29 31 32 32 28

Opponent, Season Louisville, 1999 Baylor, 1999 Texas Tech, 2003 Mississippi, 1999 Iowa State., 2004 Iowa State, 2003 Nebraska, 2004 Kansas St., 2000 Texas A&M, 1999 Indiana St., 1999 Texas Tech, 1999 North Texas, 2001

COMPLETIONS * SEASON Com Player 349 Josh Heupel 305 Josh Heupel 278 Jason White 246 Nate Hybl 235 Jason White 209 Nate Hybl 159 Cale Gundy 149 Garrick McGee 131 Cale Gundy 116 Cale Gundy 113 Bobby Warmack

Cl Jr. Jr. Jr. Jr. So. Jr. Jr. Jr. Jr. Sr. Sr. Sr. Jr.

Att 53 54 48 50 44 50 41 50 48 44 37 43 42 Yr 1999 2000 2003 2001 2004 2002 1993 1994 1992 1991 1968

Att 990 1,025 808 791 475 358 393 377 257 311 Yds 390 420 347 292 353 352 343 372 311 389 429 374 346 Cl Jr. Sr. Sr. Jr. Sr. Sr. Sr. Jr. Jr. So. Sr.

Com 349 278 305 390 209 246 159 131 149 113 Com 627 654 460 464 259 170 168 195 117 143

Int 16 10 15 9 8 13 7 15 13 7 Int 24 31 32 23 19 25 20 19 15 16

TD 33 40 20 35 24 14 17 9 8 10 TD 81 53 40 40 22 24 15 11 22 16

Opponent, Season Mississippi, 1999 Baylor, 1999 Tulsa, 2001 Texas Tech, 2001 Baylor, 2001 Texas Tech, 1999 Indiana State, 1999 Texas A&M, 1999 Texas, 1999 Kansas, 2004 Kansas State, 2000 Kansas, 2000 Louisville, 1999 Att 553 472 451 412 390 363 269 284 227 203 203

Yds 3,850 3,606 3,846 2,409 3,205 2,538 2,311 1,909 1,914 1,557 1,658

OKLAHOM A HISTORY

PASSING YARDS * GAME Yds Player 429 Josh Heupel 420 Josh Heupel 394 Jason White 390 Josh Heupel 389 Jason White 384 Jason White 383 Jason White 374 Josh Heupel 372 Josh Heupel 353 Josh Heupel 352 Josh Heupel 350 Nate Hybl

Yrs 1999-04 1999-00 1990-93 2000-02 1966-68 1969-71 1995-98 1994-95 1985-88 1981-84

Att 553 451 472 255 363 412 269 227 284 203

REVIEW & OPPONENTS

200-PLUS YARD GAMES * CAREER # Player Seasons 7 Billy Sims . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975-79 5 De’Mond Parker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1996-98 4 Quentin Griffin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999-02 4 Mike Gaddis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1988-91

COMPLETIONS * GAME Com Player 39 Josh Heupel 37 Josh Heupel 36 Nate Hybl 34 Nate Hybl 32 Jason White 32 Josh Heupel 32 Josh Heupel 31 Josh Heupel 31 Josh Heupel 29 Jason White 29 Josh Heupel 29 Josh Heupel 29 Josh Heupel

Yr 1999 2003 2000 2004 2002 2001 1993 1992 1994 1968

THE SOONERS

200-PLUS YARD GAMES * SEASON # Player Season Class 4 Billy Sims . . . . . . . . . . . . . . . . . . . . . 1978 . . . . . . . . . . . . . . Jr. 3 Adrian Peterson . . . . . . . . . . . . . . . . 2004. . . . . . . . . . . . . . . .Fr. 3 Quentin Griffin . . . . . . . . . . . . . . . . . 2002 . . . . . . . . . . . . . . Sr. 3 Billy Sims . . . . . . . . . . . . . . . . . . . . . 1979 . . . . . . . . . . . . . . Sr. 3 Greg Pruitt . . . . . . . . . . . . . . . . . . . . 1971 . . . . . . . . . . . . . . Jr. 3 Steve Owens . . . . . . . . . . . . . . . . . . 1969 . . . . . . . . . . . . . . Sr.

PASSING YARDS * CAREER Yds Player 7,922 Jason White 7,456 Josh Heupel 6,686 Cale Gundy 5,091 Nate Hybl 3,744 Bobby Warmack 3,092 Jack Mildren 2,675 Eric Moore 2,449 Garrick McGee 2,430 Jamelle Holieway 2,364 Danny Bradley

Cl Jr. Sr. Sr. Sr. Sr. Jr. Sr. Jr. Jr. Sr.

COACHING STAFF

100-PLUS YARD GAMES * CAREER # Player Season 23 Steve Owens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1967-69 20 Billy Sims . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975-79 19 Joe Washington . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1972-75 16 De’Mond Parker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1996-98 16 Quentin Griffin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999-02 13 Greg Pruitt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1970-72 11 Steve Davis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1973-75 11 Adrian Peterson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 200410 Jamelle Holieway . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1984-88 10 Billy Vessels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1950-52

PASSING YARDS * SEASON Yds Player 3,850 Josh Heupel 3,846 Jason White 3,606 Josh Heupel 3,205 Jason White 2,538 Nate Hybl 2,409 Nate Hybl 2,311 Cale Gundy 1,914 Cale Gundy 1,909 Garrick McGee 1,658 Bobby Warmack

2 0 0 5 S EAS ON

100-PLUS YARD GAMES * SEASON # Player Year Class 12 Quentin Griffin . . . . . . . . . . . . . . . . .2002 . . . . . . . . . . . . . . .Sr. 11 Adrian Peterson . . . . . . . . . . . . . . . .2004 . . . . . . . . . . . . . . . .Fr. 11 Billy Sims . . . . . . . . . . . . . . . . . . . . .1978 . . . . . . . . . . . . . . . Jr. 10 Steve Owens . . . . . . . . . . . . . . . . . .1968 . . . . . . . . . . . . . . . Jr. 9 Billy Sims . . . . . . . . . . . . . . . . . . . . .1979 . . . . . . . . . . . . . . .Sr. 9 Joe Washington . . . . . . . . . . . . . . .1973 . . . . . . . . . . . . . . So. 9 Steve Owens . . . . . . . . . . . . . . . . . .1969 . . . . . . . . . . . . . . .Sr. 8 Jack Mildren . . . . . . . . . . . . . . . . . .1971 . . . . . . . . . . . . . . .Sr. 7 Joe Washington . . . . . . . . . . . . . . .1974 . . . . . . . . . . . . . . . Jr. 7 Greg Pruitt . . . . . . . . . . . . . . . . . . . .1971 . . . . . . . . . . . . . . . Jr. 7 Billy Vessels . . . . . . . . . . . . . . . . . .1952 . . . . . . . . . . . . . . .Sr.

145 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


6 3 NAT IONAL AWARD WINNERS

COMPLETION PERCENTAGE * SEASON Minimum 50 attempts Pct Player Yr .654 Jason White 2004 .646 Josh Heupel 2000 .646 Jason White 2001 .631 Josh Heupel 1999 .616 Jason White 2003 .606 Beryl Clark 1939 .597 Nate Hybl 2001 .594 Hugh McCullough 1938 .591 Cale Gundy 1993 .578 Monte Deere 1962 .577 Cale Gundy 1992 .577 Eddie Crowder 1952

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

COMPLETIONS * CAREER Com Player 654 Josh Heupel 627 Jason White 464 Nate Hybl 460 Cale Gundy 259 Bobby Warmack 195 Garrick McGee 170 Jack Mildren 168 Eric Moore 160 Justin Fuente 143 Danny Bradley

141 ALL-A MERICANS

PASSING RECORDS Yrs 1999-00 1999-04 2000-02 1990-93 1966-68 1994-95 1969-71 1995-98 1996-97 1981-84

Att 1,025 990 791 808 475 377 358 393 325 311

Class Sr. Sr. So. Jr. Sr. Sr. Jr. Sr. Sr. Sr. Jr. Sr.

COMPLETION PERCENTAGE * CAREER Minimum 100 attempts Pct Player Yrs .638 Josh Heupel 1999-00 .633 Jason White 1999-04 .587 Nate Hybl 2000-02 .569 Cale Gundy 1990-93 .568 Hugh McCullough 1937-38 .545 Bobby Warmack 1966-68 .535 Eddie Crowder 1950-53 .519 Claude Arnold 1948-50 .517 Garrick McGee 1994-95 .508 Dave Robertson 1970-72 ATTEMPTS * GAME Att Player Class Com 58 Josh Heupel Jr. 26 54 Josh Heupel Jr. 37 53 Josh Heupel Jr. 39 51 Nate Hybl Jr. 34 50 Jason White Sr. 27 50 Josh Heupel Jr. 32 50 Josh Heupel Jr. 31 48 Nate Hybl Jr. 22 48 Nate Hybl Jr. 36 48 Josh Heupel Jr. 31 * Big 12 Championship Game

Att 390 472 113 553 451 66 412 128 269 71 227 52

Att 1,025 990 791 808 162 475 114 160 377 132 Yds 328 420 390 292 298 352 372 220 347 311

Yds 7,456 7,922 5,091 6,686 3,744 2,449 3,092 2,675 2,289 2,364

Com 255 305 73 349 278 40 246 76 159 41 131 30

Com 654 627 464 460 92 259 61 83 195 67

Opponent, Year Colorado, 1999 Baylor, 1999 Mississippi, 1999 Texas Tech, 2001 Kansas St., 2003* Texas Tech, 1999 Texas A&M, 1999 Oklahoma St., 2001 Tulsa, 2001 Texas, 1999

146 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

ATTEMPTS * SEASON Att Player 553 Josh Heupel 472 Josh Heupel 451 Jason White 412 Nate Hybl 390 Jason White 363 Nate Hybl 284 Garrick McGee 269 Cale Gundy 227 Cale Gundy 203 Cale Gundy 203 Bobby Warmack ATTEMPTS * CAREER Att Player 1,025 Josh Heupel 990 Jason White 808 Cale Gundy 791 Nate Hybl 475 Bobby Warmack 393 Eric Moore 377 Garrick McGee 358 Jack Mildren 325 Justin Fuente 311 Danny Bradley

Yr 1999 2000 2003 2001 2004 2002 1994 1993 1992 1991 1968

Cl Jr. Sr. Sr. Jr. Sr. Sr. Jr. Sr. Jr. So. Sr.

Yrs 1999-00 1999-04 1990-93 2000-02 1966-68 1995-98 1994-95 1969-71 1996-97 1981-84

Com 349 305 278 246 255 209 149 159 131 116 113

Yds 3,850 3,606 3,846 2,409 3,205 2,538 1,909 2,311 1,914 1,557 1,658

Int 16 15 10 13 9 8 13 7 15 7 7

TD 33 20 40 14 35 24 8 17 9 10 10

Com 654 622 460 464 259 168 195 170 160 143

Yds 7,456 7,922 6,686 5,091 3,744 2,675 2,449 3,092 2,289 2,364

Int 31 24 32 23 19 20 19 25 18 16

TD 53 81 40 40 22 15 11 24 10 16

TOUCHDOWN PASSES * GAME TD Player Cl Opponent, Year 5 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . . . Texas A&M, 2004 5 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . . . Texas A&M, 2003 5 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . . . Iowa State, 2003 5 Josh Heupel . . . . . . . . . . . . Jr. . . . . . . . . . . . . . Louisville, 1999 5* Josh Heupel . . . . . . . . . . . . Jr. . . . . . . . . . . Indiana State, 1999 4 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . . . . . . Kansas, 2004 4 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . Kansas State, 2004 4 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . . . Texas Tech, 2003 4 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . . . . . . . Baylor, 2003 4 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . . . . . . . Texas, 2003 4 Jason White . . . . . . . . . . . . Sr. . . . . . . . . . . Fresno State, 2003 4 Jason White . . . . . . . . . . . . So. . . . . . . . . . . . . . . . Kansas, 2001 4 Eric Moore . . . . . . . . . . . . . So. . . . . . . . . . . Kansas State, 1996 4 Eddie Crowder . . . . . . . . . . Jr. . . . . . . . . . . . . . Colorado, 1951 4 Claude Arnold. . . . . . . . . . . Sr. . . . . . . . . Oklahoma State, 1950 4 Claude Arnold. . . . . . . . . . . Sr. . . . . . . . . . . . . . . . Kansas, 1950 * First career start TOUCHDOWN PASSES * SEASON TD Player Yr Cl 40 Jason White . . . . . . . . . . . . . . . . 2003 . . . . . . . . . . . . . . . . . .Sr. 35 Jason White . . . . . . . . . . . . . . . .2004 . . . . . . . . . . . . . . . . . . .Sr. 33 Josh Heupel . . . . . . . . . . . . . . . . 1999 . . . . . . . . . . . . . . . . . . Jr. 24 Nate Hybl . . . . . . . . . . . . . . . . . . 2002 . . . . . . . . . . . . . . . . . .Sr. 20 Josh Heupel . . . . . . . . . . . . . . . . 2000 . . . . . . . . . . . . . . . . . .Sr. 17 Cale Gundy . . . . . . . . . . . . . . . . 1993 . . . . . . . . . . . . . . . . . .Sr. 14 Nate Hybl . . . . . . . . . . . . . . . . . . 2001 . . . . . . . . . . . . . . . . . . Jr. 13 Claude Arnold. . . . . . . . . . . . . . . 1950 . . . . . . . . . . . . . . . . . .Sr. 11 Steve Davis . . . . . . . . . . . . . . . . 1974 . . . . . . . . . . . . . . . . . . Jr.


PASSING RECORDS

Com Att 61 114 83 160 627 990 67 132 117 257 86 215 654 1,025 460 808 170 358 259 475

Yds 889 839 704 601 686 3,205 1,069 3,846 1,136 475 934

TD 10 9 6 11 5 35 13 40 10 5 9

I 2 0 3 4 3 9 1 10 4 1 6

Yds 1,189 1,593 7,922 1,313 2,430 2,036 7,456 6,686 3,092 3,744

TD 11 18 81 11 22 21 53 40 24 22

Int 4 6 24 7 15 17 31 32 25 19

300-YARD PASSING GAMES * SEASON Gms Player Year 8 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999 6 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000 4 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 2 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 2 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 2 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1993 2 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1992 1 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2002 1 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 1 Garrick McGee . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1994 1 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1991 300-YARD PASSING GAMES * CAREER Gms Player 14 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Garrick McGee . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Years 1999-00 1999-04 1990-93 2000-02 1994-95

400-YARD PASSING GAMES * SEASON Gms Player Year 2 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999 400-YARD PASSING GAMES * CAREER Gms Player Years 2 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999-00

OKLAHOM A HISTORY

PASSING EFFICIENCY * CAREER Minimum 100 attempts Eff Player Yrs 165.94 Eddie Crowder 1950-52 165.13 Claude Arnold 1948-50 152.70 Jason White 1999-04 151.21 Dave Robertson 1970-72 141.53 Jamelle Holieway 1985-88 135.96 Steve Davis 1973-75 135.92 Josh Heupel 1999-00 134.85 Cale Gundy 1990-93 128.19 Jack Mildren 1969-71 128.02 Bobby Warmack 1966-68

Att 68 71 30 63 65 390 119 451 116 57 91

Years 1999-04 1999-00 1990-93 2000-02 1994-95 1996-97 1995-98 1966-68

REVIEW & OPPONENTS

PASSING EFFICIENCY * SEASON Minimum 50 attempts Eff Player Yr Cl Com 199.52 Jack Mildren 1971 Sr. 32 198.84 Monte Deere 1962 Jr. 41 197.95 Eddie Crowder 1952 Sr. 52 166.32 Steve Davis 1974 Jr. 26 161.73 Jamelle Holieway 1988 Sr. 37 159.42 Jason White 2004 Sr. 255 159.41 Claude Arnold 1950 Sr. 59 158.11 Jason White 2003 Sr. 278 154.68 Dave Robertson 1972 Sr. 59 148.07 Eddie Crowder 1951 Jr. 30 147.42 Steve Davis 1973 So. 38

200-YARD PASSING GAMES * CAREER Gms Player 23 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Garrick McGee . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Justin Fuente . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Eric Moore . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Bobby Warmack. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

THE SOONERS

Yds TD I Opponent, Yr 263 5 0 Texas A&M, 2003 200 4 0 Kansas, 1950 290 4 0 Texas, 2003 257 2 0 Houston, 2004 194 2 0 Iowa St., 1995 384 5 0 Iowa St., 2003 324 3 0 Kansas, 1993 394 4 0 Texas Tech, 2003 383 3 0 Nebraska, 2004 341 2 1 Texas Tech, 1992 313 3 0 Baylor, 2000 278 2 0 UTEP, 2002 333 2 1 Iowa State, 1992 329 2 0 Virginia, 1991 137 3 0 Okla. State, 1962 175 2 1 Okla. State, 1993

200-YARD PASSING GAMES * SEASON Gms Player Year 12 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 12 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000 10 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 10 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999 6 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2002 5 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 5 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1992 4 Garrick McGee . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1994 4 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1993

COACHING STAFF

PASSING EFFICIENCY * GAME Minimum 15 attempts Eff Player Cl C-A 303.29 Jason White Sr. 16-18 260.00 Claude Arnold Sr. 9-15 259.81 Jason White Sr. 17-21 234.38 Jason White Sr. 14-18 225.97 Eric Moore Fr. 11-15 219.87 Jason White Sr. 26-34 215.83 Cale Gundy Sr. 19-26 213.43 Jason White Sr. 22-32 203.06 Jason White Sr. 29-35 197.30 Cale Gundy Jr. 22-28 197.21 Josh Heupel Sr. 21-29 195.24 Nate Hybl Sr. 13-22 191.33 Cale Gundy Jr. 21-28 191.08 Cale Gundy So. 25-31 189.39 Monte Deere Sr. 7-15 189.38 Cale Gundy Sr. 11-16

Yrs 1999-04 1999-00 2000-02 1990-93 1969-71 1985-88 1966-68 1973-75 1948-50 1981-84

2 0 0 5 S EAS ON

TOUCHDOWN PASSES * CAREER TD Player 81 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 Jack Mildren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 Jamelle Holieway . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 Bobby Warmack. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 Steve Davis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 Claude Arnold. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 Danny Bradley . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

147 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

PASSING & RECEIVING RECORDS CONSECUTIVE STARTS BY QUARTERBACKS Gms Player 34 Steve Davis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 Jack Mildren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 Bobby Warmack. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 J.C. Watts. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 Jimmy Harris . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 Eddie Crowder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 Danny Bradley . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Jamelle Holieway . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Thomas Lott . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Years 1973-75 1969-71 2003-04 1999-00 1966-68 1978-80 1954-56 1951-52 1983-84 1986-87 1977-78

CAREER STARTS BY QUARTERBACKS Gms Player 37 Cale Gundy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 Steve Davis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 Jack Mildren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 Jamelle Holieway . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 Jason White . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 Bobby Warmack. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 Thomas Lott . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 Josh Heupel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 J.C. Watts. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 Jimmy Harris . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 Danny Bradley . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 Nate Hybl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Years 1990-93 1973-75 1969-71 1985-88 1999-04 1966-68 1976-78 1999-00 1978-80 1954-56 1981-84 2000-02

CAREER VICTORIES BY QUARTERBACKS Wins Player Lost Tie 32 Steve Davis 1 1 30 Jamelle Holieway 3 0 27 Jason White 4 0 25 Jimmy Harris 0 0 24 Jack Mildren 9 1 23 Cale Gundy 12 2 23 Thomas Lott 5 1 22 J.C. Watts 3 0 21 Bobby Warmack 9 0 20 Nate Hybl 3 0 20 Josh Heupel 5 0

Pct .956 .909 .871 1.000 .721 .649 .810 .880 .700 .909 .800

Years 1973-75 1985-88 1999-04 1954-56 1969-71 1990-93 1976-78 1978-80 1966-68 2000-02 1999-00

CAREER WINNING PERCENTAGE BY QB Minimum 15 starts Pct Player Started W 1.000 Jimmy Harris 25 25 1.000 Gene Calame 15 15 .956 Steve Davis 34 32 .938 Darrell Royal 16 15 .909 Jamelle Holieway 33 30 .880 J.C. Watts 25 22 .871 Jason White 31 27 .870 Nate Hybl 23 20 .841 Jack Mitchell 22 18 .825 Eddie Crowder 20 16 .810 Thomas Lott 29 23 .800 Josh Heupel 25 20 .771 Danny Bradley 24 18 .721 Jack Mildren 34 24 .700 Bobby Warmack 30 21

L 0 0 1 1 3 3 4 3 3 3 5 5 5 9 9

T 0 0 1 0 0 0 0 0 1 1 1 0 1 1 0

Years 1954-56 1953-54 1973-75 1946-49 1985-88 1978-80 1999-04 2000-02 1946-48 1951-52 1976-78 1999-00 1981-84 1969-71 1966-68

148 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

SEASON WINNING PERCENTAGE BY QB Minimum 10 starts Pct Player W 1.000 Josh Heupel 13 1.000 Steve Davis 11 1.000 Jimmy Harris 10 1.000 Jimmy Harris 11 1.000 Darrell Royal 10 .955 Steve Davis 10 .923 Jason White 12 .917 J.C. Watts 11 .917 Steve Davis 11 .917 Dave Robertson 11 .917 Jack Mildren 11 .909 Nate Hybl 10 .909 Jamelle Holieway 10 .909 Thomas Lott 10 .909 Bobby Warmack 10 .909 Claude Arnold 10 RECEPTIONS * GAME Rec Player 11 Josh Norman 11 Trent Smith 10 Brandon Jones 10 Quentin Griffin 10 Jarrail Jackson 10 Eddie Hinton 10 Gordon Brown 9 Travis Wilson 9 Quentin Griffin 9 Trent Smith 9 Brandon Daniels 9 Corey Warren

Cl Sr. Jr. Jr. Jr. Sr. Sr. Sr. Jr. Jr. Jr. Sr. Jr.

RECEPTIONS * SEASON Rec Player 83 Mark Clayton 66 Mark Clayton 66 Trent Smith 64 Quentin Griffin 64 Eddie Hinton 56 Brandon Daniels 54 Jarrail Jackson 52 Josh Norman 51 Quentin Griffin 50 Travis Wilson 50 Antwone Savage

Pos WR WR TE RB WR WR WR WR RB WR WR

RECEPTIONS * CAREER Rec Player 221 Mark Clayton 169 Quentin Griffin 164 Trent Smith 157 Antwone Savage 135 Curtis Fagan 123 Eddie Hinton 106 Corey Warren 104 Stephen Alexander 103 Josh Norman

Pos WR RB TE WR WR WR WR TE WR

L 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1

Pos WR TE WR RB WR WR TE WR RB TE WR WR Cl Jr. Sr. Jr. Jr. Sr. Sr. Sr. Sr So. Jr. So.

T 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0

Year 2000 1974 1956 1955 1949 1973 2004 1979 1975 1972 1971 2001 1986 1978 1967 1950

Opponent, Year Texas Tech, 2001 Kansas, 2001 North Texas, 2003 North Texas, 2001 Mississippi, 1999 Oklahoma State, 1968 Oklahoma State, 1965 Nebraska, 2004 Arkansas, 2002 Tulsa, 2001 Texas Tech, 1999 Texas, 1992

Yr 2003 2004 2001 2001 1968 1999 1999 2001 2000 2004 2000

Yds 1,425 876 603 472 1,034 681 659 479 429 660 621

Avg 17.17 13.3 9.14 7.38 16.16 12.16 12.2 9.21 8.41 13.2 12.41

TD 15 8 6 2 6 4 7 2 0 11 3

Yr 2001-04 1999-02 1999-02 1999-02 1999-02 1966-68 1990-93 1994-97 1998-01

Yds 3,241 1,337 1,525 2,009 1,689 1,894 1,785 1,591 1,177

Avg TD 14.7 31 7.91 7 9.3 16 12.8 13 12.51 13 15.4 12 16.84 13 15.3 6 11.43 7


RECEIVING & TOTAL YARDS RECORDS

Rec 83 64 66 31 46 56 50 54 34 50 42 41

Avg 17.17 16.16 13.3 23.58 15.41 12.16 13.2 12.2 18.82 12.42 14.62 14.78

TD 15 6 8 3 8 4 11 7 3 3 5 7

Rec 221 157 123 106 135 70 68 104 164 87

Avg 14.7 12.8 15.4 16.84 12.51 23.13 23.66 15.30 9.30 17.47

TD 31 13 12 13 13 11 15 6 16 9

RECEIVING YARDS * CAREER Yds Player Pos 3,241 Mark Clayton WR 2,009 Antwone Savage WR 1,894 Eddie Hinton WR 1,785 Corey Warren WR 1,689 Curtis Fagan WR 1,619 Tinker Owens WR 1,609 Keith Jackson TE 1,591 Stephen Alexander TE 1,525 Trent Smith TE 1,520 P.J. Mills WR

Cl Jr. Sr. Sr. Jr. Jr. Sr. Jr. Sr. Jr. So. So. So.

Year 2003 1968 2004 1983 2003 1999 2004 1999 1992 2000 2000 2000 Year 2001-04 1999-02 1966-68 1990-03 1999-02 1972-75 1984-87 1994-97 1999-02 1992-95

TOUCHDOWN RECEPTIONS * GAME TD Player Cl Pos Rec Yds Opponent, Year 4 Trent Smith Jr. TE 11 70 Kansas, 2001 3 Mark Bradley Sr. WR 4 128 Okla. St., 2004 3 Curtis Fagan So. WR 3 88 Baylor, 2000 3 Jack Lockett Jr. WR 3 54 Okla. St., 1950 3 Mark Clayton Jr. WR 7 166 Texas A&M, 2003 2 44 times; most recently WR Travis Wilson vs. USC, 2004 Cl Jr. Jr. Sr. Jr. Sr. So. Sr. So. Jr. Sr. Sr. Sr.

Pos WR WR WR WR WR WR WR WR TE WR WR WR

100-YARD REC. GAME LEADERS * CAREER Gms Player 15 Mark Clayton . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Eddie Hinton. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Michael McDaniel. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Antwone Savage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Corey Warren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Ben Hart . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Jon Harrison. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Tinker Owens . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Stephen Alexander. . . . . . . . . . . . . . . . . . . . . . . . . . . . . TOTAL OFFENSE * GAME Yds. Name Cl 410 Josh Heupel Jr. 397 Josh Heupel Jr. 387 Josh Heupel Jr. 384 Jason White Sr. 377 Josh Heupel Jr. 375 Jason White Sr. 371 Jason White Sr. 368 Jason White Sr. 362 Nate Hybl Jr. 360 Nate Hybl Jr.

Pl Run Pass 47 -19 419 57 -23 420 60 -3 390 34 0 384 55 5 372 37 -8 383 46 -18 389 36 -26 394 44 12 350 53 13 347

TOTAL OFFENSE * SEASON Yds Player Cl 3,773 Josh Heupel Sr. 3,749 Josh Heupel Jr. 3,696 Jason White Sr. 3,149 Jason White Sr. 2,484 Nate Hybl Sr. 2,483 Cale Gundy Sr. 2,451 Nate Hybl Jr 2,178 Jack Mildren Sr. 2,014 Garrick McGee Jr. 1,992 Bobby Warmack Sr. 1,925 Adrian Peterson Fr. 1,896 Billy Sims Jr.

Yr Plays 2000 555 1999 607 2003 493 2004 413 2002 426 1993 399 2001 497 1971 291 1994 383 1968 315 2004 339 1978 256

Years 2001-04 1966-68 1994-96 1999-02 1990-93 1964-66 1970-71 1972-75 1994-97

TD Opponent, Year 6 Louisville, 1999 3 Baylor, 1999 3 Mississippi, 1999 5 Iowa St., 2003 6 Texas A&M, 1999 3 Nebraska, 2004 4 Kansas, 2004 4 Texas Tech, 2003 3 North Texas, 2001 2 Tulsa, 2001 Rush 167 -101 -150 -56 -54 172 42 1289 105 334 1,925 1896

Pass 3,606 3,850 3,846 3,205 2,538 2,311 2,409 889 1,909 1,658 0 0

TD 27 38 41 35 25 23 18 30 10 16 15 22

OKLAHOM A HISTORY

TOUCHDOWN RECEPTIONS * SEASON TD Player Yr 15 Mark Clayton 2003 11 Travis Wilson 2004 8 Mark Clayton 2004 8 Brandon Jones 2003 7 Mark Bradley 2004 7 Curtis Fagan 2000 7 Jarrail Jackson 1999 6 Jejuan Rankins 2003 6 Trent Smith 2001 6 Michael McDaniel 1996 6 Corey Warren 1993 6 Eddie Hinton 1968

100-YARD REC. GAME LEADERS * SEASON Gms Player Year Cl 8 Mark Clayton . . . . . . . . . . . . . . 2003 . . . . . . . . . . . . . . . . . . . Jr. 4 Mark Clayton . . . . . . . . . . . . . . 2004 . . . . . . . . . . . . . . . . . . .Sr. 3 Michael McDaniel. . . . . . . . . . . 1996 . . . . . . . . . . . . . . . . . . .Sr. 3 Eddie Hinton. . . . . . . . . . . . . . . 1968 . . . . . . . . . . . . . . . . . . .Sr. 2 8 times; most recently by Mark Clayton, 2001

REVIEW & OPPONENTS

RECEIVING YARDS * SEASON Yds Player Pos 1,425 Mark Clayton WR 1,035 Eddie Hinton WR 876 Mark Clayton WR 731 Buster Rhymes WR 709 Brandon Jones WR 681 Brandon Daniels WR 660 Travis Wilson WR 659 Jarrail Jackson WR 640 Corey Warren WR 621 Antwone Savage WR 614 Andre Woolfolk WR 606 Curtis Fagan WR

TOUCHDOWN RECEPTIONS * CAREER TD Player Years Pos 31 Mark Clayton . . . . . . . . . . . . . .2001-04 . . . . . . . . . . . . . . . . WR 16 Travis Wilson . . . . . . . . . . . . . .2002- . . . . . . . . . . . . . . . . . . WR 16 Trent Smith. . . . . . . . . . . . . . . .1999-02 . . . . . . . . . . . . . . . . .TE 15 Keith Jackson. . . . . . . . . . . . . .1984-87 . . . . . . . . . . . . . . . . .TE 14 Brandon Jones . . . . . . . . . . . . .2001-04 . . . . . . . . . . . . . . . . WR 13 Curtis Fagan. . . . . . . . . . . . . . .1999-02 . . . . . . . . . . . . . . . . WR 13 Antwone Savage . . . . . . . . . . .1999-02 . . . . . . . . . . . . . . . . WR 13 Corey Warren. . . . . . . . . . . . . .1990-93 . . . . . . . . . . . . . . . . WR 12 Eddie Hinton. . . . . . . . . . . . . . .1966-68 . . . . . . . . . . . . . . . . WR 11 Tinker Owens . . . . . . . . . . . . . .1972-75 . . . . . . . . . . . . . . . . WR

THE SOONERS

TD 16 6 15 8 6 5 2

COACHING STAFF

Avg. 9.3 15.3 23.66 13.83 14.26 13.59 13.33

2 0 0 5 S EAS ON

RECEPTIONS IN A CAREER * TIGHT ENDS Rec. Player Year Yards 164 Trent Smith 1999-02 1,525 104 Stephen Alexander 1994-97 1,591 68 Keith Jackson 1984-87 1,609 64 Steve Zabel 1967-69 885 54 Rickey Brady 1990-93 770 44 Jim Owens 1946-49 598 43 Gordon Brown 1963-65 573

149 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

TOTAL YARDS & RETURNS RECORDS TOTAL OFFENSE * CAREER Total Player Years 7,877 Jason White 1999-04 7,522 Josh Heupel 1999-00 6,923 Cale Gundy 1990-93 5,143 Jamelle Holieway 1985-88 5,117 Jack Mildren 1969-71 5,074 Nate Hybl 2000-02 4,713 Bobby Warmack 1966-68 4,160 Steve Davis 1973-75 4,118 Billy Sims 1975-79 4,111 Joe Washington 1972-75 4,109 Steve Owens 1967-69

Pl. 1,114 1,162 1,112 796 899 942 805 749 593 680 964

Rush -45 66 237 2,713 2,025 -17 969 2,124 4,118 4,071 4,041

Pass 7,922 7,456 6,686 2,430 3,092 5,091 3,744 2,036 0 40 68

TD 83 65 56 54 56 45 35 55 53 40 60

ALL-PURPOSE YARDS * GAME Yds Player Pl Rush Rec PR KR Opp., Year 374 Greg Pruitt 22 294 34 - 46 Kansas St., 1971 317 Mike Gaddis 30 27 43 Okla. St., 1989 307 De’Mond Parker 32 291 16 Texas, 1997 302 Billy Vessels 21 208 94 - 94 Nebraska, 1950 295 Steve Sewell 30 153 142 Kansas St., 1984 295 David Overstreet 19 258 37 Colorado, 1980 282 Billy Sims 36 282 0 Missouri, 1979 277 Antonio Perkins 7 0 277 277 UCLA, 2003 272 De’Mond Parker 20 244 28 - 19 SDSU, 1996 268 Brandon Daniels 8 39 229 - 229 Notre Dame, 1999 ALL-PURPOSE YARDS * SEASON Yds Player Yr Pl 2,148 Quentin Griffin 2002 322 2,066 Greg Pruitt 1971 210 1,937 Adrian Peterson 2004 339 1,931 Billy Sims 1978 257 1,904 Joe Washington 1974 228 1,884 Steve Owens 1968 412 1,744 Joe Washington 1973 218 1,712 Billy Sims 1979 249 1,604 Eddie Hinton 1968 121 1,599 Billy Vessels 1950 185 1,558 Steve Owens 1969 363 ALL-PURPOSE YARDS * CAREER Yds Player Years 5,881 Joe Washington 1972-75 5,275 Quentin Griffin 1999-02 4,431 Greg Pruitt 1970-72 4,362 Steve Owens 1967-69 4,249 Billy Sims 1975-79 4,129 De’Mond Parker 1996-98 4,000 Eddie Hinton 1966-68 3,782 Stanley Wilson 1979-82 3,800 Buster Rhymes 1980-84 3,544 Mark Clayton 2001-04 3,454 Dewell Brewer 1989-92

Rush Rec PR KR Int 1,884 264 1,760 108 1 197 1,925 12 1,896 35 1,321 71 332 180 1,649 123 - 112 1,173 89 26 222 1,670 42 109 1,035 52 376 32 938 250 60 322 29 1,523 32 - 23 -

Pl 820 913 499 987 597 632 326 603 300 249 543

Rush 4,071 3,938 3,122 4,041 4,118 3,403 633 3,198 1,158 82 2,298

Rec 253 1,337 491 168 77 504 1,894 155 1,118 3,241 311

PR 829 139 474 59 287 101 182

TD 18 18 15 22 14 21 10 23 6 15 23

KR Int 728 - 679 153 54 222 967 32 370 1237 120 663 -

150 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

PUNT RETURN YARDS * GAME Yds Player Cl Ret Avg TD Opp., Year 277 Antonio Perkins Jr. 7 39.57 3 UCLA, 2003 160 J.T. Thatcher Sr. 5 32.00 1 Arkansas St., 2000 150 Antonio Perkins So. 6 25.00 1 South Florida, 2002 150 Brandon Jones Fr. 7 21.43 0 Tulsa, 2001 146 Jarrail Jackson Sr. 6 24.33 1 Missouri, 1999 137 J.T. Thatcher Sr. 7 19.57 1 Baylor, 2000 127 Tommy McDonald Jr. 4 31.75 1 Iowa State, 1955 121 Antonio Perkins Jr. 5 24.20 1 Missouri, 2003 120 Dan Ruster Jr. 7 17.14 0 SMU, 1971 118 Larry Grigg So. 8 14.75 1 Nebraska, 1951 PUNT RETURN YARDS * SEASON Yds Player Cl 643 Antonio Perkins So. 642 Antonio Perkins Jr. 634 J.T. Thatcher Sr. 517 Jack Mitchell Sr. 410 Jarrail Jackson Jr. 357 Curtis Fagan Jr. 332 Joe Washington Jr. 323 Jarrail Jackson Sr. 319 Basil Banks So. PUNT RETURN YARDS * CAREER Yds Player Year 1,441 Antonio Perkins 2002-04 1,238 Jarrail Jackson 1996-99 927 Jack Mitchell 1946-48 829 Joe Washington 1972-75 780 J.T. Thatcher 1997-00 616 Darrius Jackson 1992-95 608 Derrick Shepard 1983-86 606 Freddie Nixon 1976-79 573 Buddy Jones 1947-50

Year 2002 2003 2000 1948 1998 2001 1974 1999 1979

Ret 43 53 43 22 37 52 24 33 18 Ret 113 126 39 93 47 79 74 59 56

Avg 14.95 12.11 14.74 23.50 11.08 6.87 13.83 9.73 17.72 Avg 12.8 9.83 23.77 8.91 16.6 7.80 8.22 10.27 10.23

PUNT RETURN AVERAGE * SEASON - Minimum 10 returns Avg Player Cl Year Ret 23.50 Jack Mitchell Sr. 1948 22 20.23 Tommy McDonald Jr. 1955 13 17.72 Basil Banks So. 1979 18 17.67 Clendon Thomas So. 1955 12 17.20 Dan Ruster Jr. 1971 10 16.29 Larry Shields Jr. 1964 14 15.17 Jakie Sandefer Jr. 1957 18 14.95 Antonio Perkins So. 2002 43 14.74 J.T. Thatcher Sr. 2000 43

Yds 517 263 319 212 172 228 273 643 634

PUNT RETURN AVERAGE * CAREER - Minimum 20 returns Avg Player Years Ret Yds 23.77 Jack Mitchell 1946-48 39 927 20.25 Clendon Thomas 1955-57 20 405 17.10 Larry Shields 1963-64 20 342 16.86 Orville Matthews 1939-41 22 371 16.60 J.T. Thatcher 1997-00 47 780 16.55 Tommy McDonald 1954-56 33 546 15.71 Darrell Royal 1946-49 35 550 14.61 Paul Lea 1960-62 23 336 14.48 Bobby Boyd 1957-59 27 391 13.52 Jakie Sandefer 1956-58 29 392

TD 3 4 2 3 0 0 1 1 0 TD 8 2 7 3 3 1 0 1 2 TD 3 1 0 1 0 1 1 3 2 TD 7 1 2 2 3 3 3 0 1 1


RETURNS & PUNTING RECORDS

PUNTING AVERAGE * GAME - Minimum 3 punts

Year 1999 2001 1970 1968 1990 1969 1998 1966 1987 1999

Ret 16 16 19 19 15 17 12 15 14 16

Avg 22.49 25.46 20.57 17.87 23.85 18.77 18.67 21.38 20.58 22.93 Yds 508 342 285 448 316 366 264 334 322 337

TD 1 0 1 1 0 0 0 0 0 0

Player Michael Keeling Wahoo McDaniel Jeff Ferguson Darrol Ray Lance Rentzel Jeff Ferguson Jack Jacobs Joe Washington Jack Jacobs Jack Jacobs

Cl Jr. Jr. Sr. So. Sr. Fr. Jr. Sr. Jr. Sr.

Att 3 3 5 3 3 3 9 3 5 3

Yds 169 167 271 162 161 159 471 156 260 153

Opponent, Year Kansas, 1981 Iowa State, 1958 Air Force, 2001 Vanderbilt, 1977 Missouri, 1964 Missouri, 1998 Nebraska, 1940 Oklahoma State, 1975 Kansas State, 1940 Kansas State, 1941

PUNTING AVERAGE * SEASON - Minimum 25 punts Avg 47.84 43.52 42.98 42.79 42.49 41.98 41.92 41.89 41.85 41.59 41.58 41.46 41.32 41.32 41.14 41.04

Player Jack Jacobs Jeff Ferguson Jeff Ferguson Michael Keeling Joe Don Looney Blake Ferguson Brad Reddell Blake Ferguson Jeff Ferguson Brad Reddell Brad Reddell Jeff Ferguson Michael Keeling Michael Keeling Michael Keeling Tom Stidham

Year 1940 2000 2001 1982 1962 2004 1992 2003 1999 1989 1990 1999 1981 1980 1979 1966

Cl Jr. Jr. Sr. Sr. Jr. Sr. Sr. Jr. So. Fr. So. So. Jr. So. Fr. Sr.

PUNTING AVERAGE * CAREER - Minimum 50 punts Avg 42.48 42.10 41.70 41.16 40.84 40.73 40.55 40.34 39.81 39.76 39.55 39.28 39.17 38.93 38.84

Player Jeff Ferguson Jack Jacobs Michael Keeling Brad Reddell Brian Lewis Joe Don Looney Blake Ferguson Todd Thomsen Darren Atyia Uwe von Schamann Gordon Wheeler Tim Daughtry Mike Winchester Tom Stidham Steve Zabel

Years 1998-01 1939-41 1979-82 1989-92 1995-96 1962 2002-04 1986-88 1983 1976-78 1966-67 1994-95 1984-86 1965-66 1967-69

Att 31 56 80 52 43 52 49 56 55 37 45 61 47 53 35 48 Att 252 111 187 188 112 52 182 146 64 50 58 67 156 85 68

Yds 1,483 2,437 3,439 2,225 1,827 2,183 2,054 2,346 2,302 1,539 1,871 2,529 1,942 2,190 1,440 1,970 Yards 10,706 4,673 7,797 7,738 4,574 2,118 7,380 5,889 2,548 1,988 2,294 2,632 6,110 3,309 2,641

OKLAHOM A HISTORY

KICK RETURN AVERAGE * SEASON - Minimum 10 returns Avg Player Cl Year Ret 31.75 Brandon Daniels Sr. 1999 16 28.50 Michael Thornton Jr. 1998 12 28.50 Joe Wylie Jr. 1971 10 28.00 Antwone Savage Jr. 2001 16 26.33 Antwone Savage Sr. 2002 12 24.40 Otis Taylor So. 1990 15 24.00 J.T. Thatcher Sr. 2000 11 23.86 Anthony Stafford Sr. 1987 14 23.00 Billy Vessels So. 1950 14 22.47 Eddie Hinton So. 1966 15

TD 1 1 0 0 1 0 0 0 0 0

Avg 56.33 55.67 54.20 54.00 53.67 53.00 52.33 52.00 52.00 51.00

REVIEW & OPPONENTS

Ret 55 39 47 53 33 39 39 34 33 29

Avg TD 31.75 1 28.00 1 20.84 0 19.79 0 24.40 0 21.12 0 28.50 0 22.47 0 23.86 0 20.69 0

TD 1 1 1 0 1 0 0 0 0 0 0

THE SOONERS

KICK RETURN YARDS * CAREER Yds Player Year 1,237 Buster Rhymes 1980-84 993 Antwone Savage 1999-02 967 Eddie Hinton 1966-68 947 Jarrail Jackson 1996-99 787 Brandon Daniels 1996-99 732 P.J. Mills 1992-95 728 Joe Washington 1972-75 727 Otis Taylor 1989-92 679 Greg Pruitt 1970-72 665 Jack Mitchell 1946-48

KICK RETURN AVERAGE * CAREER - Minimum 20 returns Avg Player Years Ret Yards 25.67 Joe Wylie 1970-72 21 539 25.46 Antwone Savage 1999-02 39 993 23.85 Brandon Daniels 1996-99 33 787 22.93 Jack Mitchell 1946-48 29 665 22.49 Buster Rhymes 1980-84 55 1,237 21.75 Anthony Stafford 1985-88 20 435 21.38 Otis Taylor 1989-92 34 727 20.72 Dewell Brewer 1989-92 32 663 20.58 Greg Pruitt 1970-72 33 679 20.57 Eddie Hinton 1966-68 47 967 20.04 Billy Vessels 1950-52 27 541

COACHING STAFF

KICK RETURN YARDS * SEASON Yds Player Cl 508 Brandon Daniels Sr. 448 Antwone Savage Jr. 396 Greg Pruitt So. 376 Eddie Hinton Sr. 366 Otis Taylor So. 359 Everett Marshall So. 342 Mike Thornton Jr. 337 Eddie Hinton So. 334 Anthony Stafford Jr. 331 Jarrail Jackson Sr.

TD Opp., Year 1 Notre Dame, 1999 0 Kansas St., 2000 0 Arizona, 1982 1 Santa Clara, 1940 0 Texas A&M, 1997 0 Texas, 2002 1 North Carolina, 2001 0 Mississippi, 1999 0 Texas, 1998 1 Iowa State, 2003 1 Kansas St., 1980

2 0 0 5 S EAS ON

KICK RETURN YARDS * GAME Yds Player Cl Ret Avg 229 Brandon Daniels Sr. 5 45.80 150 J.T. Thatcher Sr. 4 37.50 133 Stanley Wilson Sr. 5 26.60 127 Orville Matthews Jr. 2 63.40 120 Travian Smith Sr. 5 24.00 118 Antwone Savage Sr. 3 39.33 114 Antwone Savage Jr. 2 57.00 107 Jarrail Jackson Sr. 5 21.40 106 Michael Thornton Jr. 2 53.00 100 Mark Bradley* Jr. 1 100.00 100 Buster Rhymes Fr. 1 100.00 * First career return

151 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SCORING RECORDS POINTS SCORED * GAME Pts Player Pos Cl Opponent, Year 36 Quentin Griffin RB So. Texas, 2000 30 Kejuan Jones RB So. Texas Tech, 2003 30 Jerald Moore RB So. Okla. State, 1994 30 Steve Owens RB Jr. Nebraska, 1968 24 22 times; most recently by Q. Griffin vs. Baylor, 2002 POINTS SCORED * SEASON Pos Cl Pts Player 138 Billy Sims RB Sr. 138 Steve Owens RB Sr. 132 Billy Sims RB Jr. 131 Trey DiCarlo K So. 129 George Thomas RB Sr. 126 Steve Owens RB Jr. 124 Jack Mildren QB Sr. 115 Tim Duncan K Sr. 108 Quentin Griffin RB Sr. 108 J.C. Watts QB Sr. 108 Steve Davis QB So. 108 GregPruitt RB Jr. 108 Clendon Thomas RB Jr. 108 Billy Vessels RB Sr.

Yr 1979 1969 1978 2003 1949 1968 1971 2001 2002 1980 1973 1971 1956 1952

TD FG PAT 2PT 23 0 0 0 23 0 0 0 22 0 0 0 0 19 74 0 21 0 3 0 21 0 0 0 20 0 0 2 1 21 46 0 18 0 0 0 18 0 0 0 18 0 0 0 18 0 0 0 18 0 0 0 18 0 0 0

POINTS SCORED * CAREER Pos Years TD FG PAT 2P Pts Player 342 Steve Owens RB 1967-69 57 0 0 0 328 R.D. Lashar K 1987-90 0 44 196 0 321 Tim Lashar K 1983-86 0 48 177 0 318 Billy Sims RB 1975-79 53 0 1 0 313 Tim Duncan K 1999-01 2 48 157 0 306 Trey DiCarlo K 2002-04 0 43 177 0 306 Quentin Griffin RB 1999-01 51 0 0 0 262 Joe Washington RB 1972-75 43 0 0 2 250 Greg Pruitt RB 1970-72 41 0 0 2 TOUCHDOWNS * SEASON TD Player Pos 23 Billy Sims RB 23 Steve Owens RB 22 Billy Sims RB 21 Steve Owens RB 21 George Thomas RB 20 Jack Mildren QB 18 Quentin Griffin RB 18 J.C. Watts QB 18 Steve Davis RB 18 Greg Pruitt RB 18 Clendon Thomas RB 18 Billy Vessels RB TOUCHDOWNS * CAREER TD Player 57 Steve Owens 53 Billy Sims 51 Quentin Griffin 43 Joe Washington 41 Greg Pruitt 37 Clendon Thomas 37 George Thomas 36 Tommy McDonald 35 J.C. Watts 35 Billy Vessels

Pos RB RB RB RB RB RB RB RB QB RB

Cl Sr. Sr. Jr. Jr. Sr. Sr. Sr. Sr. So. Jr. Jr. Sr.

Year 1979 1969 1978 1968 1949 1971 2002 1980 1973 1971 1956 1952 Years 1967-69 1975-79 1999-02 1972-75 1970-72 1955-57 1946-49 1954-56 1978-80 1950-52

FIELD GOALS * SEASON Cl Year Att FG Player 21 Tim Duncan Sr. 2001 30 19 Trey DiCarlo So. 2003 22 19 Tim Lashar Jr. 1985 25 16 Trey DiCarlo Fr. 2002 22 16 Scott Blanton So. 1992 18 15 Tim Duncan Jr. 2000 24 15 R.D. Lashar Sr. 1990 24 14 Jeremy Alexander So. 1995 17 14 Uwe von Schamann Jr. 1977 23 13 Twice, most recently by R.D. Lashar, 1989 FIELD GOALS * CAREER FG Player 48 Tim Duncan 48 Tim Lashar 44 R.D. Lashar 43 Trey DiCarlo 41 Scott Blanton 35 Trey DiCarlo 33 Uwe von Schamann 31 Jeremy Alexander 22 Michael Keeling 20 Tony DiRienzo KICK SCORING * GAME Pts Player 17 Trey DiCarlo 16 Tim Duncan 15 Tim Duncan 15 Jeremy Alexander 15 Tim Lashar

Years 1999-01 1983-86 1987-90 2002-04 1991-94 2002-04 1976-78 1994-97 1979-82 1973-75

Att 72 70 63 59 63 44 51 46 37 34

Pct .700 .864 .760 .727 .889 .625 .625 .824 .609

Pct .667 .686 .698 .729 .651 .795 .647 .630 .595 .588

Cl FG PAT Opp., Year So. 3 8 Texas, 2003 Sr. 3 7 Tulsa, 2001 Texas A&M, 1999 So. 3 6 So. 4 3 Iowa St., 1995 Jr. 3 6 Missouri, 1985

KICK SCORING * SEASON Pts Player 131 Trey DiCarlo 109 Tim Duncan 106 Trey DiCarlo 105 Tim Duncan 102 Tim Lashar 101 Tim Lashar 95 R.D. Lashar 91 R.D. Lashar 89 Uwe von Schamann 87 Tim Duncan 87 Uwe von Schamann KICK SCORING * CAREER Pts Player 328 R.D. Lashar 321 Tim Lashar 306 Trey DiCarlo 301 Tim Duncan 248 Uwe von Schamann 247 Scott Blanton 216 Michael Keeling 166 Jeremy Alexander 134 Tony DiRienzo 134 Rick Fulcher

Cl So. Sr. Fr. Jr. Sr. Jr. Sr. Fr. Jr. So. Sr.

Year 2003 2001 2002 2000 1986 1985 1990 1987 1977 1999 1978

Years 1987-90 1983-86 2002-04 1999-01 1976-78 1991-94 1979-82 1994-97 1973-75 1972-73

FG 19 21 16 15 12 19 15 10 14 12 8 FG 44 48 43 48 33 41 22 31 20 15

PAT PERCENTAGE * SEASON - Minimum 25 made Player Year Cl Att Pct 1.000 Scott Blanton 1994 Sr. 41 1.000 Scott Blanton 1993 Jr. 46 1.000 R.D. Lashar 1990 Sr. 50 1.000 R.D. Lashar 1989 Jr. 45 1.000 Tim Lashar 1986 Sr. 66 1.000 Michael Keeling 1979 Fr. 35 1.000 Uwe von Schamann 1978 Sr. 63 1.000 Uwe von Schamann 1977 Jr. 47 1.000 Tony DiRienzo 1974 Jr. 39

152 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

PAT 74 46 58 60 66 44 50 61 47 51 63 PAT 196 177 177 157 149 124 150 73 74 89 Md 41 46 50 45 66 35 63 47 39

PAT PERCENTAGE * CAREER - Minimum 50 made Years Att PATs Player .993 Uwe von Schamann 1976-78 150 .983 Tim Lashar 1983-86 180 .970 R.D. Lashar 1987-90 202 .969 Tim Duncan 1999-01 162 .957 Trey DiCarlo 2002-04 132 .949 Tony DiRienzo 1973-75 78 .938 Michael Keeling 1979-82 160 .937 Rick Fulcher 1972-73 95 .925 Scott Blanton 1991-94 134 .921 Jeremy Alexander 1994-97 76

PAT 149 177 196 157 138 74 150 89 124 70

FG PERCENTAGE * SEASON - Minimum 10 attempts Cl Year Made Pct Player .889 Scott Blanton So. 1992 16 .864 Trey DiCarlo So. 2003 19 .824 Jeremy Alexander So. 1995 14 .813 R.D. Lashar Jr. 1989 13 .800 Tim Lashar Sr. 1986 12 .769 Matt Reeves Jr. 1998 10 .769 John Carroll So. 1971 10 .760 Tim Lashar Jr. 1985 19 .733 Tim Lashar So. 1984 11 .727 Trey DiCarlo Fr. 2002 16

Att 18 22 17 16 15 13 13 25 15 22

FG PERCENTAGE * CAREER - Minimum 20 attempts Years Made Pct Player .717 Trey DiCarlo 2002-04 43 .698 R.D. Lashar 1987-90 44 .686 Tim Lashar 1983-86 48 .667 Tim Duncan 1999-01 48 .651 Scott Blanton 1991-94 41 .647 Uwe von Schamann 1976-78 33 .630 Jeremy Alexander 1994-97 29 .595 Michael Keeling 1979-82 22 .588 Tony DiRienzo 1973-75 20 .577 Rick Fulcher 1972-73 15

Att 60 63 70 72 63 51 46 37 34 26

PAT * SEASON PAT Player 74 Trey DiCarlo 66 Tim Lashar 63 Uwe von Schamann 61 R.D. Lashar 60 Tim Duncan 58 Trey DiCarlo 54 John Carroll 51 Tim Duncan 50 R.D. Lashar PAT * CAREER PAT Player 196 R.D. Lashar 177 Trey DiCarlo 177 Tim Lashar 157 Tim Duncan 150 Michael Keeling 149 Uwe von Schamann 124 Scott Blanton 109 Bruce Derr 89 Rick Fulcher 82 John Carroll

Cl So. Sr. Sr. Fr. Jr. Fr. So. So. Sr.

Year 2003 1986 1978 1987 2000 2002 1971 1999 1990

Years 1987-90 2002-04 1983-86 1999-01 1979-82 1976-78 1991-94 1968-70 1972-73 1971-74

Att 76 66 63 65 61 62 65 53 50

Pct .974 1.000 1.000 .938 .984 .935 .831 .962 1.000

Att 202 186 180 162 160 150 134 120 95 97

Pct .970 .951 .983 .969 .938 .993 .925 .908 .937 .845


DEFENSIVE RECORDS Cl So. So. Jr. Jr. Sr. Sr. So. Jr. Sr. So. Jr.

Pos LB LB LB LB LB LB LB LB LB LB

Cl So. So. Jr. Sr. Jr. Sr. Sr. So. Jr. So. Pos LB LB LB LB LB LB LB DL DL DL

Year 1981 1976 1970 1979 1977 1978 1974 1977 1982 1972 Years 1975-78 1980-83 1975-79 1998-01 1972-74 1984-86 1993-96 1980-83 1981-85 1972-75

TACKLES FOR LOSS * CAREER # Player Pos 59 Rocky Calmus LB 53 Kelly Gregg DL 48.5 Teddy Lehman LB 48.5 Cedric Jones DL 44 Jimbo Elrod DL 41 Dan Cody DE 41 Scott Evans DL 40 Darrell Reed DL 40 Tony Casillas DL 40 Lee Roy Selmon DL 39 Brian Bosworth LB

Cl Sr. Sr. Jr. Jr. So. Sr. Sr. Jr. Jr. Jr.

Year 1998 1997 1994 1984 2001 1975 2003 2002 1999 1974 Year 1998-01 1995-98 2000-03 1992-95 1973-75 2000-04 1987-90 1984-87 1982-85 1972-75 1984-86

Yards 74 111 100 142 85 88 47 46 65 71 Yards 184 160 149 261 224 209 223 187 248 184 191

SACKS * CAREER Player # 31.5 Cedric Jones 25 Dan Cody 24 Scott Evans 23 Troy Johnson 20.5 Aubrey Beavers 20 Darrell Reed 19 Kelly Gregg 18 Reggie Barnes 18 James Goode 18 Tony Casillas

Pos DL DL DL DL DE DL DL DL DL DL DL DL Pos DL DE DL DL DL DL DL DL DL DL

Cl Sr. Jr. Jr. Sr. Sr. Jr. Jr. Jr. Sr. Sr. Jr. Sr. Yds 199 162 178 145 105 131 88 105 101 151

Year 1997 1994 1992 1995 2004 2003 1986 1984 1998 1993 1991 1990

Yds 91 85 57 77 66 65 64 84 51 48 49 75 Years 1992-95 2000-04 1987-90 1984-87 1990-93 1984-87 1995-98 1989-92 1987-90 1982-85

INTERCEPTIONS * GAME Player Pos Cl Yds Opp., Year # 3 J.T. Thatcher DB Sr. 9 Kansas, 2000 3 Darnell Walker DB Sr. 2 Colorado, 1992 3 Bud Hebert DB Sr. 25 Florida St., 1979 3 Randy Hughes DB Sr. 0 Nebraska, 1974 3 Steve Barrett DB Jr. 6 Nebraska, 1967 3 Jerry Tubbs LB Jr. 0 Texas, 1955 3 Darrell Royal DB So. 34 Okla. St., 1947 3 Jack Jacobs DB Sr. 45 Marquette, 1941 INTERCEPTIONS * SEASON Pos Cl # Player 9 Rickey Dixon DB Sr. 8 J.T. Thatcher DB Sr. 8 Scott Case DB Sr. 8 Darrol Ray DB Jr. 7 Brodney Pool DB So. 7 Sonny Brown DB So. 7 Zac Henderson DB Sr. 7 Steve Barrett DB Jr. 7 Darrell Royal DB So. 7 Dan Ruster DB Sr. 7 Huel Hamm DB Sr.

Year Yds Avg TD 1987 232 25.78 1 2000 162 20.25 1 1983 110 13.75 1 1978 135 16.88 0 2003 79 11.29 0 1985 111 15.86 0 1977 89 12.71 0 1967 32 4.57 0 1947 68 5.43 0 1972 64 10.67 0 1942 38 5.43 0

Years 1946-49 1984-87 1983-86 1976-79 1974-77 2000-03 1972-74 1992-95 1988-91 1966-68 1948-50

INTERCEPTIONS YARDS * GAME Yds Player Cl Int Avg 127 Derrick Strait Jr. 2 63.5 112 Al Needs Fr. 2 56.0 99 Joe Golding Jr. 1 99.0 97 Derrick Strait Sr. 1 97.0 96 Randy Hughes Jr. 1 96.0 95 Rickey Dixon Sr. 2 47.5 94 David Baker Jr. 1 94.0 85 J.T. Thatcher Sr. 1 85.0 82 Carl Dodd So. 1 82.0 82 Johnny West So. 1 82.0

TD 1 1 1 0 1 1 1 1 1 1

Yds 111 303 199 312 135 397 197 155 216 61 232

Avg TD 6.17 0 17.82 2 12.44 0 20.80 0 9.00 0 28.36 3 14.07 2 11.92 1 16.62 1 4.69 0 17.85 0

Game Baylor, 2002 Kansas St., 1945 Texas, 1946 Texas Tech, 2003 Colorado, 1973 Okla. St., 1987 Duke, 1957 Texas Tech, 2000 Maryland, 1955 Kansas St., 1944

INTERCEPTIONS YARDS * SEASON Yds Player Pos Cl Year Int Avg TD 232 Rickey Dixon DB Sr. 1987 9 25.78 1 177 Joe Golding DB Sr. 1946 3 59.00 1 175 Derrick Strait DB Jr. 2002 6 29.17 1 165 Randy Hughes DB Jr. 1973 5 33.00 1 162 J.T. Thatcher DB Sr. 2000 8 20.25 1 148 David Baker DB Jr. 1957 5 29.60 1 137 Ed Lisak DB Jr. 1949 5 27.40 0 136 Tommy McDonald DB Sr. 1956 6 22.67 1 135 Darrol Ray DB Jr. 1978 8 16.88 0 127 Derrick Strait DB Sr. 2003 3 42.33 0 INTERCEPTIONS YARDS * CAREER Yds Player Pos Years 397 Derrick Strait DB 2000-03 302 Darrol Ray DB 1976-79 303 Rickey Dixon DB 1984-87 232 Ed Lisak DB 1948-50 216 Jason Belser DB 1988-91 212 Joe Golding DB 1941-46 207 Darnell Walker DB 1990-92 204 Scott Garl DB 1985-88 199 Sonny Brown DB 1983-86 197 Randy Hughes DB 1972-74 PASS DEFLECTIONS * GAME # Player Pos 6 Jerry Parks DB 5 Derrick Strait DB 5 Larry Roach DB 4 Brandon Everage DB 4 Roy Williams DB 4 Michael Thompson DB 4 Michael Thompson DB 4 Corey T. Ivy DB 4 Steve Oâ&#x20AC;&#x2122;Shaughnessy DB 4 Kenith Pope DB * Big 12 Championship Game

Cl Fr. So. Jr. Jr. Jr. So. So. Sr. Jr. So.

Int 14 15 17 13 13 6 12 10 16 14

Avg TD 28.36 3 20.80 0 17.82 2 17.85 0 16.62 1 35.33 1 17.25 1 20.40 1 12.44 0 14.07 2

Opponent, Year USC, 1988 Okla. St., 2001 Penn State, 1972 Iowa State, 2002 North Texas, 2001 Kansas St., 2000* Texas A&M, 2000 Baylor, 1998 Auburn, 1971 Auburn, 1971

OKLAHOM A HISTORY

TACKLES FOR LOSS * SEASON # Player Pos 24 Kelly Gregg DL 21 Martin Chase DL 21 Cedric Jones DL 21 Tony Casillas DL 20 Jimmy Wilkerson DL 20 Jimbo Elrod DL 19 Teddy Lehman LB 19 Lance Mitchell LB 19 Torrance Marshall LB 18 Lee Roy Selmon DL

SACKS * SEASON Player # 14 Martin Chase 14 Cedric Jones 11.5 Aubrey Beavers 11 Cedric Jones 10 Dan Cody 10 Dan Cody 10 Troy Johnson 10 Tony Casillas 9 Kelly Gregg 9 Aubrey Beavers 9 Reggie Barnes 9 Scott Evans

INTERCEPTIONS * CAREER Player Pos # 18 Darrell Royal DB 17 Rickey Dixon DB 16 Sonny Brown DB 15 Darrol Ray DB 15 Zac Henderson DB 14 Derrick Strait DB 14 Randy Hughes DB 13 Darrius Johnson DB 13 Jason Belser DB 13 Steve Barrett DB 13 Ed Lisak DB

REVIEW & OPPONENTS

TACKLES FOR LOSS * GAME # Player Pos Cl Yds Opp., Year 5 Teddy Lehman LB Sr. 10 Kan. St., 2003* 5 Jimmy Wilkerson LB Fr. 13 Baylor, 2000 5 Brian Bosworth LB Jr. 19 Kansas, 1986 5 Tony Casillas DL Jr. 25 Iowa St., 1984 5 Keith Gary DL Sr. 33 Florida St., 1980 5 Greg Sellmeyer DL So. 16 Nebraska, 1976 4 21 times; last by Dan Cody vs. Kansas, 2004 * Big 12 Championship Game

SACKS * GAME Pos Cl Yds Opponent, Year # Player 3 Larry Birdine DE So. 14 Baylor, 2004 3 Dan Cody DL Jr. 23 Okla. St., 2003 3 Jimmy Wilkerson DL So. 13 Texas, 2001 3 Martin Chase DL Sr. 23 Syracuse, 1997 3 Roderick Manuel DL Sr. 14 TCU, 1996 3 Cedric Jones DL Sr. 21 SMU, 1995 3 Stacy Dillard DL Jr. 10 Iowa State, 1991 3 Troy Johnson DL Jr. 21 Arkansas, 1986 3 Brian Bosworth LB So. 17 Kansas St., 1985 3 Tony Casillas DL Jr. 20 Iowa State, 1984 3 Brian Bosworth LB Fr. 12 Iowa State, 1984 3 Thomas Benson LB Sr. 27 Hawaii, 1983 3 Kevin Murphy DL Jr. 31 Kansas St., 1983

THE SOONERS

TACKLES * CAREER # Player 530 Daryl Hunt 489 Jackie Shipp 437 George Cumby 431 Rocky Calmus 426 Rod Shoate 413 Brian Bosworth 380 Tyrell Peters 365 Rick Bryan 353 Kevin Murphy 335 Lee Roy Selmon

Opp., Year Missouri, 1981 Colorado, 1999 Missouri, 1983 Missouri, 1977 Texas, 1974 Notre Dame, 1999 Iowa St., 1976 Missouri, 2002 Kansas St., 1983 Missouri, 1977 Vanderbilt, 1977

COACHING STAFF

TACKLES * SEASON # Player 189 Jackie Shipp 177 Daryl Hunt 175 Steve Aycock 160 George Cumby 159 Daryl Hunt 157 Daryl Hunt 155 Rod Shoate 154 George Cumby 147 Jackie Shipp 145 Rod Shoate

Pos LB LB DL LB LB DB LB LB DL LB LB

2 0 0 5 S EAS ON

TACKLES * GAME # Player 23 Jackie Shipp 22 Rocky Calmus 21 Kevin Murphy 21 Daryl Hunt 21 Rod Shoate 20 Rodney Rideau 20 Daryl Hunt 19 Lance Mitchell 19 Rick Bryan 19 George Cumby 19 Daryl Hunt

153 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

DEFENSIVE & SEASON RECORDS PASS DEFLECTIONS * SEASON # Player Pos 22 Roy Williams DB 18 J.T. Thatcher DB 17 Mike Woods DB 15 Derrick Strait DB 15 Derrick Strait DB 14 Kenith Pope DB 14 John Shelly DB 13 Derrick Strait DB 13 Michael Thompson DB 13 Darnell Walker DB

Cl Jr. Sr. Sr. So. Fr. Sr. Sr. Jr. So. Jr.

PASS DEFLECTIONS * CAREER # Player Pos 55 Derrick Strait DB 44 Roy Williams DB 37 Mike Woods DB 30 Darrius Johnson DB 28 Brandon Everage DB 26 Rocky Calmus LB 25 Darnell Walker DB 23 Randy Hughes DB 23 Rickey Dixon DB 22 Zac Henderson DB 22 Terry Ray DB

Year 2001 2000 1999 2001 2000 1972 1971 2002 2000 1991 Years 2000-03 1999-01 1996-99 1992-95 2000-03 1998-01 1990-92 1972-74 1984-87 1974-77 1988-91

FUMBLE RECOVERIES * GAME Player Opponent, Year # 3 Rick McCurdy . . . . . . . . . . . . . . . . . Syracuse, 1962 FUMBLE RECOVERIES * SEASON Player Pos # 5 Derrick Strait DB 4 Kelly Gregg DL 4 Kevin Murphy DL 4 Phil Tabor DL 4 Lee Roy Selmon DL 4 Mike Phillips DL 4 Mike Struck DL 4 Derland Moore DL 4 Raymond Hamilton DL FUMBLE RECOVERIES * CAREER Player Pos # 8 Phil Tabor DL 8 Richard Murray DL 8 Lee Roy Selmon DL 8 Raymond Hamilton DL 7 Rocky Calmus LB 7 Kevin Murphy DL 7 Keith Stanberry DB 7 Mike Phillips DL 7 Jimbo Elrod DL 7 Derland Moore DL 6 Derrick Strait DB 6 Frank Blevins LB 6 Kevin Thompson DB 6 Daryl Hunt LB 6 Lucious Selmon DB

Cl Sr. Sr. So. So. Sr. Sr. Sr. Sr. Jr.

Year 2003 1998 1982 1976 1975 1975 1973 1972 1971

Years 1975-78 1974-77 1972-75 1970-72 1998-01 1981-85 1981-84 1973-76 1973-75 1970-72 2000-03 1987-90 1986-89 1975-78 1971-73

Yds 18 0 0 0 0 0 0 0 0 Yards 0 0 0 0 42 0 0 0 0 0 18 0 0 0 0

FIRST DOWNS * OFFENSE * GAME Total Opponent 38 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 37 Oregon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 36 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . 36 Virginia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 Iowa State . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 34 New Mexico St. . . . . . . . . . . . . . . . . . . . . . . . 33 Texas A&M . . . . . . . . . . . . . . . . . . . . . . . . . . 33 Oklahoma St. . . . . . . . . . . . . . . . . . . . . . . . . 33 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 33 Oregon . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Year 1988 1972 1972 1978 1991 2003 1980 1971 1989 2003 1956 1962 1975

RUSHING YARDS * OFFENSE * GAME Total Opponent 768 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 758 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 711 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 681 Missouri . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 629 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . 609 Oregon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 594 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 584 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . 566 Kansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 565 Kansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Year 1988 1980 1971 1986 1978 1972 1974 1971 1986 1987

PASSING YARDS * OFFENSE * GAME Total Opponent 429 Louisville . . . . . . . . . . . . . . . . . . . . . . . . . . . . 429 Baylor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 414 Iowa State . . . . . . . . . . . . . . . . . . . . . . . . . . . 413 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 394 Texas Tech . . . . . . . . . . . . . . . . . . . . . . . . . . 390 Mississippi . . . . . . . . . . . . . . . . . . . . . . . . . . . 389 Kansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 387 Baylor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 387 Texas A&M . . . . . . . . . . . . . . . . . . . . . . . . . . 374 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . .

Year 1999 1999 2003 2004 2003 1999 2004 2000 1999 2000

TOTAL YARDS * OFFENSE * GAME Total Opponent 875 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 829 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 785 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 750 Missouri . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 731 Oregon . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 696 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . 692 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . 679 Iowa State . . . . . . . . . . . . . . . . . . . . . . . . . . . 677 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 670 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Year 1980 1988 1971 1986 1972 1971 1978 1971 1972 1971

POINTS * OFFENSE * GAME Total Opponent 82 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 Texas A&M . . . . . . . . . . . . . . . . . . . . . . . . . . 77 Missouri . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 75 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 73 New Mexico State . . . . . . . . . . . . . . . . . . . . . 73 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . 72 Utah State . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 Kansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . .

Year 1980 2003 1986 1942 1971 1989 1946 1974 1987 1988

154 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

YARDS PER PLAY * OFFENSE * SEASON Year Yards 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.6 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.6 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.5 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.4 1979 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.4 1980 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.2 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.2 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.2 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.1 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.0 TOTAL YARDS * OFFENSE * SEASON Year Yards 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6,683 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6,152 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6,007 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,752 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,727 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,708 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,623 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,585 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,496 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,421 YARDS PER GAME * OFFENSE * SEASON Year Yards 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 556.8 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 507.7 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 481.7 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 479.3 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 477.3 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 475.7 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 468.6 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 462.1 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 453.3 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 439.4 1980 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 436.5 TOTAL POINTS * OFFENSE * SEASON Year Points 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 601 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 541 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 534 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 508 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 493 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 481 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 473 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 471 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 466 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 452 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 430 POINTS PER GAME * OFFENSE * SEASON Year Points 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46.6 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44.5 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43.0 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42.9 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42.3 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.1 1952 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40.7 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39.3 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38.6 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37.0 1990 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36.5


SEASON RECORDS

PLAYS PER GAME * OFFENSE * SEASON Year Plays 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86.8 1969 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81.8 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81.6 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81.4 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77.9 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77.7 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76.5 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76.2 1984 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75.7

PASS ATTEMPTS PER GAME * OFFENSE * SEASON Year Attempts 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47.2 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40.9 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37.6 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34.3 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31.2 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29.9 1996 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28.0 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26.6 1994 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26.5 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26.1 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23.0 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.2 PASSING YARDS * OFFENSE * SEASON Year Yards 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,109 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3,929 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3,750 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3,298 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3,142 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2,828 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2,328 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2,214 1994 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2,076 1996 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2,012 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,915 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,867

OKLAHOM A HISTORY

RUSHING YARDS * OFFENSE * SEASON Year Yards 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,635 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5,001 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,896 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,827 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,818 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,335 1979 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,278 1982 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,141 1980 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,117 1981 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4,101

TOTAL PLAYS * OFFENSE * SEASON Year Plays 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,041 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,018 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,010 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 971 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 954 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 935 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 918 1984 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 908 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 898 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 896 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 895

PASS ATTEMPTS * OFFENSE * SEASON Year Attempts 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 566 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 532 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 489 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 480 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 410 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 406 1996 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 308 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 293 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 287 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 276 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 233

REVIEW & OPPONENTS

RUSH ATTEMPTS PER GAME * OFFENSE * SEASON Year Attempts 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73.9 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73.3 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68.6 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67.7 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66.8 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66.4 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65.7 1975 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65.5 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65.3 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65.0

PASS COMPLETIONS * OFFENSE * SEASON Year Comp 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 358 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 323 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 314 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 298 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 268 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 242 1994 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 163 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 161 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 158 1996 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 136 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 136 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 127

COMPLETIONS PER GAME * OFFENSE * SEASON Year Comp 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29.8 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24.9 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24.2 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.4 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20.6 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17.3 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14.4 1994 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13.6 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13.4 1996 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12.4 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12.4 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11.6

THE SOONERS

RUSHING ATTEMPTS * OFFENSE * SEASON Year Attempts 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 879 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 813 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 801 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 797 1975 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 786 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 783 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 774 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 767 1982 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 759 1977 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 758

RUSHING YARDS PER GAME * OFFENSE * SEASON Year Yards 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 469.6 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 438.8 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 416.8 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 408.0 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 401.5 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 391.0 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 361.4 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 361.3 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 356.5 1982 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 345.1

PUNTING AVERAGE * OFFENSE * SEASON Year Yards 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42.1 1982 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42.0 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.9 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.7 1990 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.6 1989 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.6 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.5 1981 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.5 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.2 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41.1 1988 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40.7

COACHING STAFF

WINNING PERCENTAGE * SEASON Year Record Pct. 2000 . . . . . . . . . . . . . . . . 13-0-0 . . . . . . . . . . . . . . . 1.000 1974 . . . . . . . . . . . . . . . . 11-0-0 . . . . . . . . . . . . . . . 1.000 1955 . . . . . . . . . . . . . . . . 11-0-0 . . . . . . . . . . . . . . . 1.000 1949 . . . . . . . . . . . . . . . . 11-0-0 . . . . . . . . . . . . . . . 1.000 1956 . . . . . . . . . . . . . . . . 10-0-0 . . . . . . . . . . . . . . . 1.000 1954 . . . . . . . . . . . . . . . . 10-0-0 . . . . . . . . . . . . . . . 1.000 1915 . . . . . . . . . . . . . . . . 10-0-0 . . . . . . . . . . . . . . . 1.000 1911 . . . . . . . . . . . . . . . . . 8-0-0 . . . . . . . . . . . . . . . 1.000 1918 . . . . . . . . . . . . . . . . . 6-0-0 . . . . . . . . . . . . . . . 1.000 1898 . . . . . . . . . . . . . . . . . . . 2-0 . . . . . . . . . . . . . . . . 1.000 1897 . . . . . . . . . . . . . . . . . . . 2-0 . . . . . . . . . . . . . . . . 1.000 1896 . . . . . . . . . . . . . . . . . . . 2-0 . . . . . . . . . . . . . . . . 1.000

RUSHING YDS PER ATTEMPT * OFFENSE * SEASON Year Yards 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.07 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.46 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.28 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.25 1979 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.00 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.94 1981 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.82 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.78 1949 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.64 1980 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.52

2 0 0 5 S EAS ON

WINS * SEASON Year Record 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13-0-0 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12-1-0 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12-2-0 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12-2-0 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-0-0 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-0-0 1949 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-0-0 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 1979 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 1975 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-1-0 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11-2-0

155 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SEASON RECORDS PASSING YARDS PER GAME * OFFENSE * SEASON Year Yards 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 321.7 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 294.7 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 293.5 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 253.7 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 247.3 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 201.3 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 192.0 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 174.1 1994 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 173.9 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 143.0 1969 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 123.7 COMPLETION PERCENTAGE * OFFENSE * SEASON Year Percent 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .660 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .642 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .624 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .623 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .607 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .583 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .578 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .559 1992 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .551 1968 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .545 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .544 INTERCEPTION AVOIDANCE * OFFENSE * SEASON Year Percent 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .022 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .023 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .025 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .026 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .028 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .030 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .031 1950 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .033 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .034 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .034 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .037 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .037 PUNT RETURN AVERAGE * OFFENSE * SEASON Year Average 1948 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20.6 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19.2 1952 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16.9 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16.4 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16.2 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16.2 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16.1 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15.5 1979 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14.6 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14.5 KICKOFF RETURN AVERAGE * OFFENSE * SEASON Year Average 1980 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31.6 1939 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25.8 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25.6 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24.5 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24.3 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.9 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.7 1979 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.6 1990 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.4 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.1 1983 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21.1

FIRST DOWNS * OFFENSE * SEASON Year Downs 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 315 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 310 1971 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 307 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 299 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 290 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 276 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 271 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 269 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 265 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 264 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 264 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 261

OPPONENT PASSING YARDS * DEFENSE * GAME Total Opponent Year -2 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . . 1993 0 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 1937 0 Missouri . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1966 0 Kansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975 0 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1937 0 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . . 1974 2 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . . 1938 5 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1942 6 Iowa State . . . . . . . . . . . . . . . . . . . . . . . . . . . 1963 6 Missouri . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1945 8 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1956 8 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1986

FEWEST TURNOVERS * OFFENSE * SEASON Year Turnovers 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 1967 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 1990 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 1942 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24

OPPONENT TOTAL YARDS * DEFENSE * GAME Total Opponent 14 Washington State . . . . . . . . . . . . . . . . . . . . . 31 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . . 32 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 38 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 Tulsa . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 Arkansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 54 Texas A&M . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 Kansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 Iowa State . . . . . . . . . . . . . . . . . . . . . . . . . . .

TURNOVERS PER GAME * OFFENSE * SEASON Year Turnovers 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.2 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.2 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.3 1993 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.6 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.6 1967 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.8 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.9 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.0 1990 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.0 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.0 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.1 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.2

TOTAL PLAYS * DEFENSE * SEASON Year Yards 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 561 1960 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 606 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 607 1959 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .611

OPPONENT FIRST DOWNS * DEFENSE * GAME Total Opponent 1 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . . 1 Washington State . . . . . . . . . . . . . . . . . . . . . 1 Texas A&M . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 2 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 10 teams tied, last being Tulsa, 1987

Year 1993 1938 1946 1948 1951 1938

OPPONENT RUSHING YARDS * DEFENSE * GAME Total Opponent Year -52 Kansas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1986 -44 North Texas . . . . . . . . . . . . . . . . . . . . . . . . . . 1995 -33 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 1942 -17 Nebraska . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951 -8 Texas A&M . . . . . . . . . . . . . . . . . . . . . . . . . . . 1946 -7 Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000 -7 Texas Tech . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 -4 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 -4 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . . 1984 -3 Colorado . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1984 -3 Washington State . . . . . . . . . . . . . . . . . . . . . 1938 -1 Stanford . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1983 0 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 1943 1 Kansas State . . . . . . . . . . . . . . . . . . . . . . . . . 2004 2 Oklahoma State . . . . . . . . . . . . . . . . . . . . . . . 1970 2 North Texas . . . . . . . . . . . . . . . . . . . . . . . . . . 1991 2 Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1938

156 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Year 1938 1993 1943 1949 1951 1937 2004 1987 2001 1938 2003 1954 2002

PLAYS PER GAME * DEFENSE * SEASON Year Plays 1938 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47.4 1939 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52.8 1947 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54.8 YARDS PER PLAY * DEFENSE * SEASON Year Yards 1938 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.5 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3.1 1948 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3.2 YARDS PER GAME * DEFENSE * SEASON Year Yards 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 175.5 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 186.3 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 190.6 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 193.8 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 195.2 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 199.6 1958 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202.4 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 205.6 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 207.1 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 213.3 RUSHING ATTEMPTS * DEFENSE * SEASON Year Attempts 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 378 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 1984 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420 1964 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 423 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 424 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 429 1999 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 429 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 431 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 441 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 447 1990 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 449


SEASON RECORDS

Int 28 26 26 26 26 25 25 25 24 24 24

PASS COMPLETIONS * DEFENSE * SEASON Year Comp. 1960 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 1959 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 1950 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 PASS COMP PER GAME * DEFENSE * SEASON Year Passes 1960 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.7 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.8 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.9 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.6 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.2 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.6 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.7 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.9 1959 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.9 1975 & 1950 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7.0

PASS YARDS PER GAME * DEFENSE * SEASON Year Yards 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55.0 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62.8 1960 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64.0 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70.3 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70.4 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73.1 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74.3 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76.0 1958 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82.6 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87.3 COMPLETION PERCENTAGE * DEFENSE * SEASON Year Pct 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 324 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 377 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 380 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 390 1975 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 410 1950 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 430 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 431 1959 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 434 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 435 1965 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 436

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

MOST TURNOVERS * DEFENSE * SEASON Year Turnovers 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 1975 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 1977 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 1976 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46 1952 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46 1949 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42 1970 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42

YARDS PER RUSH * DEFENSE * SEASON Year Yards 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1.6 1984 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.2 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.3 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.3 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.5 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.5 1951 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.5 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.5 1983 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6

PASS YARDS * DEFENSE * SEASON Year Yards 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 555 1960 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 640 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 691 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 703 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 760 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 774 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 804 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 817 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 873 1959 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 893

REVIEW & OPPONENTS

POINTS PER GAME * DEFENSE * SEASON Year Points 1938 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6 1958 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.0 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.1 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.5 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.6 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.2 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.2 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.8 1948 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.0 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8.1

RUSHING YARDS PER GAME * DEFENSE * SEASON Year Yards 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59.7 1984 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78.4 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87.0 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90.9 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94.6 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95.1 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97.8 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.8 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.9 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.9 1951 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.9

PASS ATTEMPTS PER GAME * DEFENSE * SEASON Year Attempts 1960 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10.1 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12.6 1947 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14.3 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14.7 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14.8 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15.3 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15.6 1959 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15.9 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16.3 1950 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16.3

THE SOONERS

INTERCEPTIONS PER GAME * DEFENSE * SEASON Year Int 1952 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6 1951 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.6 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.5 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.3 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.3 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.2 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.2 1967 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.1 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2.1

RUSHING YARDS * DEFENSE * SEASON Year Yards 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 716 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 870 1984 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 941 1951 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,049 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,091 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,106 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,136 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,166 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,173 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,200

PASS ATTEMPTS * DEFENSE * SEASON Year Attempts 1960 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 1961 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 126 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 148 1963 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 156 1959 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 159 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162 1953 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 168 1966 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 171 1962 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 179

COACHING STAFF

INTERCEPTIONS * DEFENSE * SEASON Year 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1952 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1987 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1956 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1957 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1955 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2002 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

TURNOVERS PER GAME * DEFENSE * SEASON Year Turnovers 1975 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.0 1978 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6.0 1977 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.5 1974 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5.3 1979 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.9 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.8 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.8 1973 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4.7

2 0 0 5 S EAS ON

RUSHING ATT PER GAME * DEFENSE * SEASON Year Attempts 2004 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30.9 2003 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33.0 2001 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33.1 2000 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34.3 1984 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35.0 1964 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35.2 1995 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35.3 1954 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36.7 1985 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36.8 1986 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37.1 1991 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37.7 1972 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37.9

157


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

BOWL TRADITION 1939 * ORANGE BOWL

1947 * GATOR BOWL

Miami, Fla. (32,191)

Jacksonville, Fla. (10,034)

TENNESSEE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Tennessee 7 Oklahoma 0

17 0

OU 6 16-25 69 13-4-0 43-94 4-3 9-90 13-40 3 0

1949 * SUGAR BOWL

UT 15 51-197 63 27-10-1 64-260 2-1 16-130 12-36 0 0

7 0

17 0

SCORING UT - Foxx 12-yd run (Wyatt run), 7-0 UT - Wyatt 32-yd FG, 10-0 UT - Wood 22-yd run (Wyatt kick), 17-0 STAT LEADERS Rushing: OU - McCullough 9-9 UT - Coffman 12-56 Passing: OU - McCullough 19-7-1-37 UT - Wood 5-2-0-40 Receiving: OU - Clark 3-30 UT - Cifers 1-23 GAME SUMMARY This was the first Orange Bowl that featured two national powers as both teams were undefeated and untied. To lure the Sooners to Miami, the Orange Bowl director circled the Norman campus, leaving chalk messages that promoted the game. Tennessee’s powerful ground attack was too much for the Sooners, winners of 14 straight, as the Volunteers raced to a 17-0 victory in the fifth annual Orange Bowl. The victory was the 13th straight for the Vols, who were coached by Major Bob Neyland. The game was considered to be the roughest of all bowl games played that year as both teams combined for more than 200 yards in penalties.

N.C. STATE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average

OU 12 43-195 75 9-3-2 51-270 4-3 7-34 5-31.0

SCORE BY QUARTER N.C. State 7 Oklahoma 7

0 20

New Orleans, La. (80,383)

13 34 NCS 13 47-136 103 18-7-3 65-239 2-1 3-13 4-36.0 6 0

0 7

13 34

SCORING OU - Davis 1 yd run (Wallace kick), 0-7 NCSU - Phillips 63 yd pass from Turner (Byler kick) , 7-7 OU - Davis 7 yd run (Wallace kick), 7-14 OU - Golding 5 yd run (Wallace kick), 7-21 OU - Davis 5 yd run (kick failed), 7-27 NCSU - Palmer 8 yd run (kick failed), 13-27 OU - Owens 15 yd pass from Sarratt (Wallace kick), 13-34 STAT LEADERS Rushing: OU - Golding 12-91 NCSU - Palmer 10-70 GAME SUMMARY In a game that featured two of the marquee names in college football at the time, Oklahoma blasted North Carolina State 34-13 before an overflowing crowd of 10,000 in the second annual Gator Bowl. The Sooners did not take long to get on the scoreboard, two minutes to be exact, on an Eddie Davis one-yard plunge. N.C. State roared back to even the score, but OU put the game out of reach by scoring 20 second-quarter points and coasted from there. The marquee matchup was made possible because of the Tournament of Roses committee decision to match representatives of the Western Athletic Conference (now the Pac Ten) and the Big Nine, (now the Big 10). This agreement made it possible for teams not waiting for a possible Rose Bowl berth to be picked by the Gator Bowl committee.

158 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

NORTH CAROLINA OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER North Carolina 6 Oklahoma 7

OU 14 65-186 43 4-1-0 229 1-1 40 5-36.8 0 0

6 14 UNC 12 34-128 82 21-8-2 42-210 0-0 30 7-38.0

0 7

0 0

6 14

SCORING UNC - Rodgers 3 yd run (kick failed), 6-0 OU - Mitchell 1 yd run (Ming kick), 6-7 OU - Pearson 7 yd run (Ming kick), 6-14 STAT LEADERS Rushing: OU - Heath 12-58 UNC - Justice 16-84 Passing: OU - Royal 1-1-0-43 UNC - Justice 13-6-1-57 Receiving: OU - Anderson 1-43 UNC - Weiner 3-36 GAME SUMMARY It was legendary Coach Bud Wilkinson’s first bowl game as the fifth-ranked and underdog Sooners took on the third-ranked and unbeaten North Carolina Tar Heels accompanied by their All-America tailback Charlie “Choo Choo” Justice. Oklahoma upset the ‘Heels with the big play coming in the first quarter as linebacker Myrle Greathouse intercepted a pass and returned it 70 yards to set up Jack Mitchell’s one-yard run. The Sooners never trailed after that.


BOWL TRADITION 1950 * SUGAR BOWL

1951 * SUGAR BOWL

New Orleans, La. (82,000)

LSU 8 40-38 121 20-9-2 na-159 4-4 6-40 8-33.6

SCORE BY QUARTER LSU 0 Oklahoma 0

0 14

0 35 OU 10 55-286 74 11-2-4 na-360 4-4 8-40 7-37.4

0 7

0 14

0 35

STAT LEADERS Rushing: OU - Heath 15-170 LSU - West 5-26 Passing: OU - Pearson 7-2-na-74 LSU - Pevy 11-5-na-82 Receiving: OU - Goad 1-40 LSU - Baggett 4-50

SCORE BY QUARTER Kentucky 7 Oklahoma 0

UK 7 40-84 105 12-9-1 52-189 1-0 6-40 8-41.7 6 0

OU 18 59-189 38 8-3-1 67-227 7-5 2-30 6-33.4 0 0

0 7

13 7

SCORING UK - Jamerson 22 yd pass from Parilli (kick good), 7-0 UK - Jamerson 1 yd run (kick failed), 13-0 OU - Green 17 yd pass from Vessels (Weatherall kick), 13-7 STAT LEADERS Rushing: OU - Heath 20-121 UK - Jamerson 15-58 Passing: OU - Arnold 5-2-0-21 UK - Parilli 12-9-0-105 Receiving: OU - Vessels 2-21 UK - Bruno 3-57 GAME SUMMARY OU won its first national championship by going a perfect 10-0 in the regular season. However, Kentucky, coached by Paul “Bear” Bryant, upset the Sooners and broke a 31-game OU winning streak. OU lost a bowl-record five fumbles in falling behind 13-0. A fourth quarter 17-yard TD pass by Billy Vessels narrowed the margin but a come-from-behind effort was foiled by an interception in the final minute of play.

MARYLAND OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Maryland 0 Oklahoma 0

0 7

OU 10 47-208 22 6-4-0 53-230 2-2 7-45 7-31.3 0 7

UM 13 52-176 36 12-5-1 64-212 2-1 3-15 5-29.0 0 0

0 0

0 7

SCORING OU - Grigg 25 yd run (Leake kick), 0-7 STAT LEADERS Rushing: OU - Grigg 13-89 UM - Felton 10-51 Passing: OU - Calame 4-4-0-22 UM - Boxold 9-3-1-42 Receiving: OU - Burris 3-17 UM - Holan 2-31 GAME SUMMARY It was the first game of the contract that pitted the Big Seven champion against the Atlantic Coast Conference champ. Maryland came into the game as the regular season national champion with OU rated fourth. Twice, the Terrapins had first down with the ball inside the 10-yard line, and both times the Sooner defense refused to allow any points on the scoreboard. Sooner tailback Larry Grigg scored the only TD of the game with a 25-yard scamper in the second period. The 1954 bowl game was the first bowl game in which the players had to play both ways. Sooner hero Grigg also played defensive back.

REVIEW & OPPONENTS OKLAHOM A HISTORY

GAME SUMMARY Wilkinson’s team was rated second in the nation and it was the first one of his squads to post an undefeated record, 10-0. The game was one-sided and still stands as the largest margin of victory in OU bowl history. One of the many Sooner big plays was Leon Heath’s OU bowl record-breaking 86-yard TD run. The game was marred by an early-week incident where a former LSU player was caught spying on Sooner practices. It was the only time in Wilkinson’s career that he publicly blasted an opponent.

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average

13 7

THE SOONERS

SCORING OU - Heath 86 yd run (Tipps kick), 0-7 OU - Heath 34 yd run (Tipps kick), 0-14 OU - Thomas 34 yd pass from Pearson (Tipps kick), 0-21 OU - Thomas 5 yd run (Tipps kick), 0-28 OU - Royal 5 yd run (Tipps kick), 0-35

KENTUCKY OKLAHOMA

Miami, Fla. (68,640)

COACHING STAFF

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average

New Orleans, La. (80,206)

2 0 0 5 S EAS ON

LOUISIANA STATE OKLAHOMA

1954 * ORANGE BOWL

159 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

BOWL TRADITION 1956 * ORANGE BOWL

1958 * ORANGE BOWL

Miami, Fla. (75,561)

Miami, Fla. (76,561)

MARYLAND OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Maryland 0 Oklahoma 0

6 20

OU 16 64-202 53 10-4-1 74-255 1-1 3-35 8-34.5 6 0

0 14

1959 * ORANGE BOWL

UM 9 47-187 46 10-3-3 57-233 3-2 7-61 7-40.4 0 6

6 20

SCORING UM - Vereb 15 yd run (kick failed), 6-0 OU - McDonald 4 yd run (Pricer kick), 6-7 OU - O’Neal 1 yd run (Pricer kick), 6-14 OU - Dodd 82 yd interception return (kick failed), 6-20 STAT LEADERS Rushing: OU - Harris 9-50 UM - Vereb 8-108 Passing: OU - Harris 5-3-0-34 UM - Beightol 7-2-2-35 Receiving: OU - Burris 2-28 UM - Cooke 1-21 GAME SUMMARY This time it was OU that carried the number one ranking into the game with Maryland ranked third, having lost just one game during the regular season. The Sooners, a perfect 10-0 and in the midst of their 47-game winning streak, trailed 6-0 at the half. The Sooners went into their famous “fast break offense” in the second half and scored three times to post their second Orange Bowl victory. It was the second national championship for Oklahoma.

Miami, Fla. (75,281)

DUKE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Duke 0 Oklahoma 7

21 48

OU 11 44-165 114 18-9-3 62-279 2-1 12-150 7-34.7 7 7

Duke 16 69-231 97 13-8-2 82-328 3-2 3-25 10-28.1 7 7

7 27

21 48

SCORING OU - Baker 94 yd int. return (Dodd kick), 0-7 OU - Thomas 13 yd run (Dodd kick), 0-14 DU - McElhaney 1 yd run (Carlton kick), 7-14 OU - Dodd 1 yd run (Dodd kick), 7-21 DU - McElhaney 4 yd run (Carlton kick), 14-21 OU - Sandefer 4 yd run (Dodd kick), 14-28 OU - Baker 29 yd pass from Hobby (Boyd kick) , 14-35 DU - Dutrow 8 yd run (Carlton kick), 21-35 OU - Hobby 9 yd pass from Baker (McDaniel kick), 21-42 OU - Carpenter 73 yd int. of lateral (kick failed), 21-48 STAT LEADERS Rushing: OU - Thomas 13-62 Duke - Carlton 15-84 Passing: OU - Hobby 4-3-0-48 Duke - Brodhead 6-4-1-60 Receiving: OU - Baker 1-29 Duke - Latimore 3-33 GAME SUMMARY The 47-game winning streak had been broken earlier in the season, but the Sooners still came into the game ranked No. 4. Duke, the ACC winner, was unranked. Oklahoma got only six first downs, lost the total offense battle (328 yards to 279) and picked up an OU bowl-record 165 yards in penalties, but used two interception returns for TD, including an OU bowl record 94-yarder from David Baker, two fumble recoveries, a blocked punt and a bad snap from center to win going away. The 48 points marked an all-time OU bowl record that stood until matched by the ‘91 Gator Bowl team.

160 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

SYRACUSE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Syracuse 0 Oklahoma 14

6 21

OU 12 44-152 93 4-3-0 48-245 2-1 3-35 8-37.0 0 0

SU 18 56-239 72 25-10-2 81-311 2-2 4-20 8-31.2 0 7

6 0

6 21

SCORING OU - Gautt 42 yd run (PAT failed), 0-6 OU - Coyle 79 yd pass from Hobby (PAT pass), 0-14 OU - Hobby 40 yd punt return (Hobby kick), 0-21 SU - Weber 15 yd run (Weber kick), 6-21 STAT LEADERS Rushing: OU - Gautt 6-94 SU - Anderson 12-58 Passing: OU - Hobby 1-1-0-79 SU - Zimmerman 22-10-1-72 Receiving: OU - Coyle 1-79 SU - Stevens 5-43 GAME SUMMARY Waiving the “no repeat rule” because of a new bowl contract, the Sooners played in their second consecutive Orange Bowl, defeating the Orangemen from Syracuse, 21-6. The Sooners were led by Prentice Gautt who scored the game’s first TD on the second play of the game with a 42-yard run. Gautt averaged an OU bowl-record 15.7-yards every time he touched the ball. It was the Sooners’ fourth straight Orange Bowl victory. Oklahoma ended the season ranked fifth in the nation, its only loss a one-pointer to Texas.


BOWL TRADITION 1963 * ORANGE BOWL

1965 * GATOR BOWL

Miami, Fla. (73,380)

Jacksonville, Fla. (50,408)

OU 10 52-154 106 8-4-0 60-260 2-2 1-5 10-34.0 7 0

UA 15 50-174 86 17-9-1 67-260 1-1 1-12 8-40.5 3 0

0 0

17 0

SCORING UA - Williamson 25 yd pass from Namath (Davis kick), 7-0 UA - Clark 15 yd run (Davis kick), 14-0 UA - Davis 19 yd field goal, 17-0

SCORE BY QUARTER Florida State 6 Oklahoma 7

FSU 29 217 303 36-23-1 59-520 2-2 9-52 1-26.0 18 0

OU 13 71 209 22-10-4 52-280 1-1 7-35 6-38.0 6 6

6 6

36 19

SCORING FSU - Ehler 69 yd interception (PAT failed), 6-0 OU - Kennedy 1 yd run (Metcalf kick), 6-7 FSU - Biletnikoff 15 yd pass from Tensi (PAT failed), 12-7 FSU - Biletnikoff 14 yd pass from Tensi (PAT failed), 18-7 FSU - Biletnikoff 10 yd pass from Tensi (PAT failed), 24-7 OU - Pannell 2 yd pass from Page (PAT failed), 24-13 FSU - Floyd 13 yd pass from Tensi (PAT failed), 30-13 OU - Hart 95 yd pass from Fletcher (PAT failed), 30-19 FSU - Biletnikoff 6 yd pass from Tensi (PAT failed), 36-19 STAT LEADERS Rushing: OU - Ringer 7-41 FSU - Spooner 27-125 Passing: OU - Fletcher 7-3-0-117 FSU - Tensi 36-23-4-303 Receiving: OU - Hart 6-165 FSU - Biletnikoff 13-192

24 26

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average

OU 18 50-203 107 18-9-3 68-310 0-0 2-10 5-47

SCORE BY QUARTER Tennessee 0 Oklahoma 7

0 12

14 0

UT 18 44-172 160 na 68-332 1-1 4-27 2-32 10 7

24 26

SCORING OU - Warmack 7 yd run (Vashon kick), 0-7 OU - Hinton 20 yd pass from Warmack (kick failed), 0-13 OU - Owens 1 yd run (PAT failed), 0-19 UT - Glover 36 yd interception return (Kremser kick), 7-19 UT - Fulton 5 yd run (Kremser kick), 14-19 UT - Kremser 26 yd field goal, 17-19 OU - Stephenson 25 yd interception (Vashon kick), 17-26 UT - Warren 1 yd run (Kremser kick), 24-26 STAT LEADERS Rushing: OU - Warmack 17-81 UT - Chadwick 12-72 Passing: OU - Warmack 18-9-2-107 UT - Warren 23-12-2-160 Receiving: OU - Hinton 5-87 UT - Flowers 4-59 GAME SUMMARY Oklahoma had won the Big Eight title in Chuck Fairbank’s first year as head coach. Although a slight underdog to the Vols, OU broke out to a 19-0 halftime lead. Tennessee came back to narrow the Sooner lead to 19-17 before Oklahoma defensive back Bob Stephenson picked off a pass and raced 24 yards to give OU an all important insurance TD. The Sooners desperately needed the insurance when Dewey Warren plowed in from a yard out. The Volunteers then missed a potential game-winning field goal as the gun went off.

OKLAHOM A HISTORY

GAME SUMMARY Florida State used a sophisticated passing attack to win easily. To add insult to injury, four of the Seminoles’ TD passes were thrown on fourth-down plays. Four Oklahoma players had been found ineligible the night before the game because they had signed pro contracts which was in violation of NCAA rules. FSU wide receiver Fred Biletnikoff finished the game with 13 receptions for 192 yards and four TDs.

TENNESSEE OKLAHOMA

REVIEW & OPPONENTS

GAME SUMMARY It was Bud Wilkinson’s last bowl game. Paul “Bear” Bryant, coaching his alma mater, repeated his victory as the coach at Kentucky in the 1951 Sugar Bowl with a 17-0 triumph. LB Lee Roy Jordan, the MVP, and quarterback Joe Namath led the Crimson Tide to the victory. The Sooners had first and goal twice in the first half, but fumbles ended OU’s chances and the Sooners never really threatened again. The lone highlight for the Oklahoma team was a visit by President John F. Kennedy to the Sooners’ locker room. Although President Kennedy claimed neutrality, it was obvious by the grimace on his face he was backing the Oklahoma team.

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average

36 19

THE SOONERS

STAT LEADERS Rushing: OU - Grisham 28-107 UA - Versprille 14-52 Passing: OU - Fletcher 1-1-0-56 UA - Namath 17-9-1-86 Receiving: OU - Bumgardner 1-56 UA - Williamson 4-58

FLORIDA STATE OKLAHOMA

COACHING STAFF

SCORE BY QUARTER Alabama 7 Oklahoma 0

17 0

Miami, Fla. (77,993)

2 0 0 5 S EAS ON

ALABAMA OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average

1968 * ORANGE BOWL

161 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

BOWL TRADITION 1968 * BLUEBONNET BOWL

1970 * BLUEBONNET BOWL

Houston, Texas (53,543)

Houston, Texas (53,832)

SMU OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER SMU 0 Oklahoma 7

28 27

OU 23 53-176 294 37-18-3 90-479 1-1 6-55 6-38.2 0 0

6 14

SMU 22 33-72 281 43-22-2 76-353 2-2 4-34 7-41.0 22 6

1972 * SUGAR BOWL

28 27

SCORING OU - Warmack 8 yd run (Derr kick), 0-7 OU - Barr 21 yd pass from Owens (Derr kick), 0-14 SMU - Richardson 1 yd run (kick failed), 6-14 OU - Denton 22 yd pass from Ripley (Derr kick), 6-21 SMU - Richardson 18 yd run (Lesser kick), 13-21 SMU - Levias 11 yd pass from Hixson (Lesser kick), 20-21 SMU - Fleming 19 yd pass from Hixson (PAT good) , 28-21 OU - Barr 20 yd pass from Ripley (kick failed), 28-27 STAT LEADERS Rushing: OU - Owens 36-113 SMU - Richardson 18-76 Passing: OU - Ripley 22-10-2-153 SMU - Hixson 43-22-2-281 Receiving: OU - Barr 8-138 SMU - Levias 8-112 Tackles: OU - Casteel 12 SMU - Cormier 14 GAME SUMMARY OU led 20-6 entering the fourth but SMU’s Chuck Hixson, passing for 281 yards, led a comeback that produced a 28-21 lead. OU, without injured QB Bob Warmack, narrowed the margin to one on a pass from Mickey Ripley, but missed a two-point conversion for the lead. One last chance came after recovering an onside kick but a field goal attempt from inside the SMU 30-yard line went wide as time expired.

ALABAMA OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Alabama 7 Oklahoma 7

24 24

UA 21 43-229 199 27-14-0 70-428 2-1 7-50 4-37.0 7 14

New Orleans, La. (84,031)

OU 19 60-349 66 7-5-0 67-415 3-2 3-42 5-37.0 3 0

7 3

24 24

SCORING OU - Pruitt 58 yd run (Derr kick), 0-7 UA - Moore 4 yd pass from Hunter (Clemmy kick), 7-7 OU - Pruitt 25 yd run (Derr kick), 7-14 UA - Bailey 5 yd pass from Hunter (Clemmy kick), 14-14 OU - Wylie 2 yd run (Derr kick), 14-21 UA - Clemmy 21 yd field goal, 17-21 UA - Hunter 25 yd pass from Musso (Clemmy kick), 24-21 OU - Derr 42 yd field goal, 24-24 STAT LEADERS Rushing: OU - Crosswhite 20-111 UA - Musso 27-138 Passing: OU - Mildren 7-5-0-66 UA - Hunter 26-13-1-174 Receiving: OU - Harrison 2-45 UA - Bailey 4-86 GAME SUMMARY The emergence of the wishbone and Greg Pruitt were late-season developments that propelled OU to four wins in its last five games and a postseason invitation. The Sooners had switched to the wishbone and they were running it to perfection by the time the bowl game rolled around. The “bone” produced 349 yards rushing and touchdown runs of 58 and 25 yards by All-American Greg Pruitt, but the Sooners still needed a late field goal by Bruce Derr to forge the tie with the Crimson Tide.

162 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

AUBURN OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Fumbles-Lost Penalties-Yards Punts-Average

OU 28 439 11 4-1-0 1-1 2-12 5-35.4

SCORE BY QUARTER Auburn 0 Oklahoma 19

0 12

22 40 AU 15 40 250 45-20-2 2-2 0-0 5-48.6 7 3

15 6

22 40

SCORING OU - Crosswhite 4 yd run (kick failed), 0-6 OU - Mildren 5 yd run (Carroll kick), 0-13 OU - Mildren 4 yd run (kick failed), 0-19 OU - Mildren 7 yd run (kick failed), 0-25 OU - Wylie 71 yd punt return (kick failed), 0-31 AU - Unger 1 yd run (Jett kick), 7-31 OU - Carroll 53 yd field goal, 7-34 AU - Unger 1 yd run (Jett kick), 14-34 OU - Pruitt 2 yd run (kick failed), 14-40 AU - Cannon 11 yd pass from Sullivan (Beck run), 22-40 STAT LEADERS Rushing: OU - Mildren 30-149 AU - Unger 6-38 Passing: OU - Mildren 4-1-0-11 AU - Sullivan 44-20-1-250 Receiving: OU - Chandler 1-11 AU - Beasley 6-117 Tackles: OU - Selmon, Driscoll 7 AU - Yearout 16 GAME SUMMARY OU had lost only one game, the “Game of the Century” to Nebraska on Thanksgiving Day. Auburn featured Heisman Trophy winner Pat Sullivan. It was run versus pass, with OU’s runners prevailing. The Sooners roared to a 31-0 halftime lead and amassed 439 yards rushing by game’s end, a new Oklahoma and Sugar Bowl record. QB Jack Mildren, playing in the final game of his brilliant college career, scored a Sugar Bowl record three times. OU finished second in the polls to Nebraska with another Big Eight team, Colorado, finishing third.


BOWL TRADITION 1973 * SUGAR BOWL

1976 * ORANGE BOWL

New Orleans, La. (72,316)

SCORE BY QUARTER Penn State 0 Oklahoma 7

0 14

OU 20 76-278 175 12-7-0 88-453 8-5 3-55 8-32.7 0 0

PSU 11 28-50 147 31-12-1 59-197 6-4 3-15 10-42.9 0 7

0 0

0 14

Tucson, Ariz. (46,315)

MICHIGAN OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Michigan 0 Oklahoma 0

6 14

OU 16 65-282 63 5-3-0 70-345 4-1 9-40 9-34.9 0 7

UM 12 52-169 33 30-2-3 72-202 1-0 5-26 10-38.6 0 0

6 7

SCORING OU - Brooks 39 yd run (DiRienzo kick), 0-7 OU - Davis 9 yd run (DiRienzo kick), 0-14 UM - Bell 2 yd run (kick failed), 6-14

STAT LEADERS Rushing: OU - Pruitt 21-86 PSU - Nagle 10-22 Passing: OU - Robertson 6-3-0-88 PSU - Hufnagel 31-12-1-147 Receiving: OU - Owens 5-132 PSU - Scott 3-59 Tackles: OU - Lucious Selmon 7 PSU - Skorupan 13

STAT LEADERS Rushing: OU - Washington 17-73 UM - Leach 13-62 Passing: OU - Davis 5-3-0-63 UM - Leach 15-2-3-30 Receiving: OU - Owens 3-63 UM - Bell- 1-17

SCORE BY QUARTER Wyoming 0 Oklahoma 14

OU 24 74-415 23 5-3-0 79-438 6-3 2-20 0-0 32:18 11-20 0 6

UW 14 42-153 51 19-6-5 61-204 5-1 4-30 5-25.2 27:42 9-15 0 7

7 14

7 41

SCORING OU - Peacock 3 yd run (von Schamann kick), 0-7 OU - Ivory 4 yd run (von Schamann kick), 0-14 OU - von Schamann 32 yd field goal, 0-17 OU - von Schamann 50 yd field goal, 0-20 OU - Peacock 15 yd run (von Schamann kick), 0-27 OU - Cumby 4 yd run (von Schamann kick), 0-34 OU - Shepard 8 yd run (von Schamann kick), 0-41 UW - Jones 1 yd run (Christopulos kick), 7-41 STAT LEADERS Rushing: OU - Shepard 7-85 UW - Jones 14-68 Passing: OU - Blevins 3-2-0-14 UW - Clayton 14-5-4-54 Receiving: OU - Hatcher 2-14 UW - Howard 3-45 Tackles: OU - Reese 7 UW - Coleman 8

OKLAHOM A HISTORY

GAME SUMMARY This was a mismatch that was decided early on as Oklahoma rolled up almost 500 yards in total offense and cruised to an easy victory. The Sooners led 27-0 at the third quarter mark before the reserves added two more scores in the fourth period. OU did not punt the entire game, the only time in Sooner bowl history that had happened.

REVIEW & OPPONENTS

GAME SUMMARY Played for the first time on New Year’s Eve, the Sugar Bowl brought the Big Eight Champion Sooners to do battle with Joe Paterno’s fifthranked Nittany Lions. The Sooner defense posted a shutout while allowing only 11 first downs and 49 yards rushing the entire game. It was the first year that freshmen were eligible and Sooner wide receiver Tinker Owens celebrated with five catches, good for 132 yards and one touchdown. It was also the last game for Sooner head coach Chuck Fairbanks who left for the NFL the following spring.

GAME SUMMARY It was Oklahoma’s first bowl trip under legendary head coach Barry Switzer and a storybook setting. Ohio State, the No. 1-ranked team in the country, had lost in the Rose Bowl earlier in the afternoon. The upset gave the Sooners an opportunity to win the national championship if they could beat the Michigan Wolverines coached by Bo Schembechler. A 39-yard end around by Billy Brooks and a nine-yard keeper by Steve Davis were enough for a 14-6 victory and a fifth national championship.

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con.

7 41

THE SOONERS

SCORING OU - Crosswhite 1 yd run (Fulcher kick), 0-7 OU - Owens 27 yd pass from Robertson (Fulcher kick), 0-14

6 14

WYOMING OKLAHOMA

COACHING STAFF

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average

Miami, Fla. (80,307)

2 0 0 5 S EAS ON

PENN STATE OKLAHOMA

1976 * FIESTA BOWL

163 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

BOWL TRADITION

164

1978 * ORANGE BOWL

1979 * ORANGE BOWL

Miami, Fla. (69,500)

Miami, Fla. (66,635)

ARKANSAS OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average SCORE BY QUARTER Arkansas 14 Oklahoma 0

31 6

OU 14 49-230 80 14-7-0 63-310 4-3 5-25 5-44.4 0 0

10 0

1980 * ORANGE BOWL

ARK 15 60-317 90 12-7-1 72-407 2-1 7-50 4-40.5 7 6

31 6

SCORING ARK - Sales 1 yd run (Little kick), 7-0 ARK - Sales 4 yd run (Little kick), 14-0 ARK - Calcagni 1 yd run (Little kick), 21-0 ARK - Little 32 yd field goal, 24-0 OU - Hicks 8 yd pass from Blevins (kick failed), 24-6 ARK - White 20 yd run (Little kick), 31-6 STAT LEADERS Rushing: OU - Peacock 15-117 ARK - Sales 22-205 Passing: OU - Lott 7-4-0-42 ARK - Calgagni 11-7-1-90 Receiving: OU - Rhodes 3-46 ARK - Sales 4-52 Tackles: OU - Kinlaw 11 ARK - Jackson 7 GAME SUMMARY Called by Barry Switzer, “the most disappointing loss of my career,” OU was a victim of one of the biggest upsets in bowl history. When Notre Dame downed Texas in the Cotton Bowl, OU was in the running for a national championship. A big win over Arkansas might impress the voters and secure the crown for the Sooners. As a result, Switzer went against his own strategy by choosing to receive the opening kickoff rather than play defense. OU fumbled inside its own 10 on the third play of the game and Arkansas immediately scored for a lead it never relinquished.

Miami, Fla. (66,714)

NEBRASKA OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Third Down Con. Sacks By SCORE BY QUARTER Nebraska 7 Oklahoma 7

24 31

NU 27 54-217 220 31-18-2 85-437 0-0 8-96 2-37.5 8-18 1-1 0 7

3 17

OU 17 53-292 47 3-2-0 56-339 1-1 6-50 3-39.3 7-12 1-5 14 0

24 31

SCORING NU - Smith 21 yd pass from Sorley (Todd kick) , 7-0 OU - Sims 3 yd run (von Schamann kick), 7-7 OU - Lott 3 yd run (von Schamann kick), 7-14 OU - Sims 11 yd run (von Schamann kick), 7-21 OU - von Schamann 26 yd field goal, 7-24 NU - Todd 31 yd field goal, 10-24 OU - Lott 2 yd run (von Schamann kick), 10-31 NU - Berns 1 yd run (Todd kick), 17-31 NU - Miller 2 yd pass from Sorley (Todd kick) , 24-31 STAT LEADERS Rushing: OU - Sims 25-134 NU - Berns 19-99 Passing: OU - Lott 3-2-0-47 NU - Sorley 31-18-2-220 Receiving: OU - Rhodes 1-38 NU - Smith 3-62 Tackles: OU - Kinlaw 11 NU - Andrews 9 GAME SUMMARY A truly amazing turn of events produced a rematch after Nebraska’s victory in November. The Sooners, ranked No. 1 with one loss, had lost a heartbreaker to the Cornhuskers, 17-14, on a late fumble at the NU three-yard line. When the Huskers were upset the following week by Missouri, producing a Big Eight Championship tie, the Orange Bowl officials came up with the idea of a rematch, much to the Sooners’ joy and the Huskers’ shock. It went as predicted: an Oklahoma victory.

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

FLORIDA STATE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Third Down Con. Sacks By

FSU 11 35-82 100 27-8-3 62-182 1-0 4-20 9-42.2 6-15 0-0

SCORE BY QUARTER Florida State 7 Oklahoma 0

0 17

7 24 OU 22 59-411 36 4-2-0 63-447 5-4 3-28 4-25.0 9-15 1-4 0 0

0 7

7 24

SCORING FSU - Whitting 1 yd run (Chappelen kick), 7-0 OU - Watts 61 yd run (Keeling kick), 7-7 OU - Wilson 5 yd run (Keeling kick), 7-14 OU - Keeling 24 yd field goal, 7-17 OU - Sims 22 yd run (Keeling kick), 7-24 STAT LEADERS Rushing: OU - Sims 24-164 FSU - Lyles, Whiting 13-40 Passing: OU - Watts 4-2-0-36 FSU - Jordan 16-6-1-76 Receiving: OU - Nixon 2-36 FSU - King, Childers 2-24 Tackles: OU - Cumby 9 FSU - Herring 16 GAME SUMMARY The Big Eight Champion Sooners met an undefeated Florida State team on New Year’s night. After the Seminoles took a 7-0 first-quarter lead, OU unleashed 17 second-quarter points to take the lead for good. J.C. Watts was named Orange Bowl MVP on offense. He scored on a 61-yard option play and rushed for more than 100 yards. Bud Hebert, who recorded three interceptions, earned the award on defense. Billy Sims wrapped up his brilliant collegiate career scoring on a 22-yard pitch from Watts. Oklahoma finished third in the country and won the Orange Bowl for the third time in five tries under Switzer. The Seminoles crossed midfield only two times after the first quarter and never passed the 35-yard line.


BOWL TRADITION 1981 * ORANGE BOWL

1981 * SUN BOWL

Miami, Fla. (71,043)

El Paso, Texas (33,816)

OU 18 55-156 128 12-7-0 67-284 7-5 4-32 2-37.0 8-16 3 7

FSU 23 60-212 51 15-11-0 75-263 1-0 5-58 4-42.5 8-17 7 3

8 7

18 17

7 0

OU 15 54-409 2 5-1-1 59-407 2-1 7-48 5-38.6 3-11 0 3

7 30

14 40

SCORING OU - Shepard 34 yd run (Keeling kick), 0-7 UH - Wilson 1 yd run (Clendenen kick), 7-7 OU - Keeling 32 yd field goal, 7-10 OU - Shepard 1 yd run (Keeling kick), 7-17 OU - Keeling 49 yd field goal, 7-20 OU - Sims 30 yd run (Keeling kick), 7-27 UH - Jordan 6 yd run (Clendenen kick), 14-27 OU - Mills 2 yd run (kick failed), 14-33 OU - Truit 28 yd interception return (Keeling kick), 14-40 STAT LEADERS Rushing: OU - Sims 15-181 UH - Polk 19-74 Passing: OU - Shepard 5-1-1-2 UH - Wilson 28-11-1-216 Receiving: OU - Ross 1-2 UH - Durham 1-60 Tackles: OU - Benson 10 UH - Turner 13 GAME SUMMARY A season that produced four losses for Oklahoma ended on a bright note with an easier than anticipated 40-14 victory over Houston. MVP Darrell Shepard, who began his career at the UH, scored two touchdowns against his former team. The Sooners scored 30 fourthquarter points to turn a seat squirmer into a rout. Freshman Fred Sims rolled up 181 yards rushing in the game after rushing for just 179 in the regular season.

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Arizona State 0 Oklahoma 7

ASU 25 43-100 329 35-17-2 78-429 3-0 7-64 6-43.5 30:31 6-15 0-0 11 6

32 21 OU 19 63-417 40 10-4-1 73-457 6-4 8-68 4-29.5 29:29 9-19 4-6

7 8

14 0

32 21

SCORING OU - Wilson 1 yd run (Keeling kick), 0-7 ASU - Zendejas 32 yd field goal, 3-7 ASU - Phelps safety in end zone, 5-7 ASU - Zendejas 22 yd field goal, 8-7 OU - Wilson 1 yd run (rush PAT no good), 8-13 ASU - Zendejas 54 yd field goal, 11-13 ASU - Clark 15 yd run (Zendejas kick), 18-13 OU - Sims 19 yd run (Phelps to Fontenette), 18-21 ASU - Moore 1 yd run (Zendejas kick), 25-21 ASU - Brown 52 yd pass from Hons (Zendejas kick), 32-21 STAT LEADERS Rushing: OU - Dupree 17-242 ASU - Moore 20-64 Passing: OU - Phelps 10-4-1-40 ASU - Hons 35-17-2-329 Receiving: OU - Lewis 2-23 ASU - Moore 3-88 Tackles: OU - Sanders 11 ASU - Richardson 15 GAME SUMMARY The magic of Marcus Dupree ran out as the Sun Devils rallied for 14 fourth-quarter points to win the first meeting between the two. Dupree ran wild early, amassing 239 yards before recurrent leg injuries forced him out in the third quarter. The turning point came when Oklahoma punter Michael Keeling could not get his punt away and was forced to throw an illegal pass. The Devils took over at the OU 43 and later scored when Darryl Clack raced 15 yards for at TD.

OKLAHOM A HISTORY

GAME SUMMARY This contest featured a rematch with a great deal more excitement as OU turned to a foreign weapon, the pass, to notch its third straight Orange Bowl win. QB J.C. Watts was chosen MVP and with good reason. The Seminoles used a fourth-quarter TD to break a 10-10 tie and seemingly gain control. OU was forced to start deep in its own territory after the kickoff with little time left. Watts went to work and passed the Sooners to the 11-yard line where he hit Steve Rhodes with a TD strike to pull the Sooners to within one with less than a minute to go. Watts then proceeded to hit tight end Forrest Valora for the two-point conversion that gave the Sooners their ninth Orange Bowl victory, including three in the last four years. Oklahoma finished ranked No. 3 in the nation.

SCORE BY QUARTER Houston 0 Oklahoma 7

UH 26 59-157 228 29-18-1 88-385 4-3 2-27 6-37.0 7-16

ARIZONA STATE OKLAHOMA

REVIEW & OPPONENTS

STAT LEADERS Rushing: OU - Watts 25-48 FSU - Williams 19-99 Passing: OU - Watts 12-7-0-128 FSU - Stockstill 15-11-0-51 Receiving: OU - Rhodes 2-53 FSU - Williams 2-27 Tackles: OU - Coast 15 FSU - Piurowski 12

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Third Down Con.

14 40

THE SOONERS

SCORING FSU - Williams 10 yd run (Capece kick), 0-7 OU - Keeling 53 yd field goal, 3-7 OU - Overstreet 4 yd run (Keeling kick), 10-7 FSU - Capece 19 yd field goal, 10-10 FSU - Recovered fumble in OU end zone (Capece kick), 10-17 OU - Rhodes 11 yd pass from Watts (Valora pass from Watts), 18-17

HOUSTON OKLAHOMA

COACHING STAFF

SCORE BY QUARTER Oklahoma 0 Florida State 0

17 18

Tempe, Ariz. (70,553)

2 0 0 5 S EAS ON

FLORIDA STATE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Third Down Con.

1983 * FIESTA BOWL

165 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

BOWL TRADITION 1985 * ORANGE BOWL

1986 * ORANGE BOWL

Miami, Fla. (56,294)

Miami, Fla. (74,178)

WASHINGTON OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con.

UW 17 43-192 119 21-9-3 64-311 3-1 5-25 6-37.7 28:56 3-13

SCORE BY QUARTER Washington 14 Oklahoma 0

0 14

28 17 OU 17 54-162 124 21-6-1 75-286 6-2 8-60 7-34.6 31:04 6-18 0 0

1987 * ORANGE BOWL

14 3

28 17

SCORING UW - Greene 29 yd pass from Siruco (Jaeger kick), 7-0 UW - Robinson 1 yd run (Jaeger kick), 14-0 OU - Bradley 1 yd run (Lashar kick), 14-7 OU - Shepard 61 yd pass from Bradley (Lashar kick), 14-14 OU - Lashar 35 yd field goal, 14-17 UW - Pattison 12 yd pass from Millen (Jaeger kick), 21-17 UW - Fenney 6 yd run (Jaeger kick), 28-17

Miami, Fla. (57,291)

PENN STATE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Penn State 7 Oklahoma 0

10 25

PSU 14 36-103 164 34-18-4 70-267 2-1 6-49 6-46.3 31:23 7-15 0-0 3 16

OU 12 52-228 91 6-3-0 58-319 5-1 7-45 5-42.6 28:37 5-16 2-10 0 3

0 6

10 25

SCORING PSU - Manoa 1 yd run (Manca kick), 7-0 OU - Lashar 26 yd field goal, 7-3 OU - Jackson 71 yd pass from Holieway (Lashar kick), 7-10 OU - Lashar 31 yd field goal, 7-13 OU - Lashar 21 yd field goal, 7-16 PSU - Manca 27 yd field goal, 10-16 OU - Lashar 22 yd field goal, 10-19 OU - Carr 61 yd run (kick failed), 10-25

STAT LEADERS Rushing: OU - Carr 10-63 UW - Robinson 28-135 Passing: OU - Bradley 21-6-1-124 UW - Sircuro 17-7-3-78 Receiving: OU - Shepard 3-87 UW - Greene 4-97 Tackles: OU - Brown, Reed 6 UW - Kelly 11

STAT LEADERS Rushing: OU - Carr 19-148 PSU - Dozier 12-39 Passing: OU - Holieway 6-3-0-91 PSU - Knizner 11-8-1-90 Receiving: OU - Jackson 2-83 PSU - Dimidio 6-50 Tackles: OU - Bosworth 13 PSU - Alexander 9

GAME SUMMARY Brigham Young was No. 1 in the polls, but Sooner head coach Barry Switzer had argued that the Sooners should be No. 1 because of a tougher schedule. A win over a fine Husky team would solidify that claim. However, Washington refused to cooperate and turned a 17-14 fourthquarter deficit into a 28-17 triumph. The game was marked by a bizarre incident when, after an Oklahoma field goal, the Sooner Schooner raced onto the field as called for by tradition. The only problem was the drivers apparently had not received the proper permission for the trip. The team was penalized 15 yards and the loss of the three points.

GAME SUMMARY A swarming defense, a record field goal performance and two big plays helped the Oklahoma Sooners defeat Penn State to capture both the Orange Bowl and the program’s sixth national championship. Butkus Award winner Brian Bosworth had 13 solo tackles and the Oklahoma secondary picked off four Penn State passes to thwart any rallies. Tim Lashar booted an Orange Bowl record four field goals to give the Sooners an early lead. Lydell Carr and Keith Jackson then provided big plays, a 61-yard jaunt by Carr and a 71-yard pass play from Jamelle Holieway to Jackson.

166 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

ARKANSAS OKLAHOMA First Down Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Loss Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Arkansas 0 Oklahoma 0

8 42

ARK 17 45-48 192 33-16-5 81-240 2-0 3-25 9-41.1 35:29 8-18 7-51 0 14

0 14

OU 11 48-366 47 5-2-0 53-413 3-2 4-40 5-47.6 24:31 5-12 0-0 8 14

8 42

SCORING OU - Tillman 77 yd run (Lashar kick), 0-7 OU - Tillman 21 yd run (Lashar kick), 0-14 OU - Holieway 2 yd run (Lashar kick), 0-21 OU - Holieway 4 yd run (Lashar kick), 0-28 OU - Stafford 13 yd run (Lashar kick), 0-35 OU - Parham 49 yd run (Lashar kick), 0-42 ARK - Thomas 2 yd run (Shibest pass from Bland), 8-42 STAT LEADERS Rushing: OU - Tillman 7-109 ARK - Thomas 22-59 Passing: OU - Holieway 3-2-0-47 ARK - Thomas 26-13-4-129 Receiving: OU - Shepard 1-36 ARK - Shibest 4-83 Tackles: OU - Jones 9 ARK - Atwater 7 GAME SUMMARY After nine years, Barry Switzer avenged his most embarrassing loss, coaching Oklahoma to a 42-8 rout of Arkansas. LB Danté Jones, playing in place of All-American Brian Bosworth, led the defense which held the Hogs to just 48 rushing yards. Spencer Tillman gained 109 yards rushing on just seven carries. His totals included a 77-yard TD to give OU the early 7-0 lead. Todd Thomsen set an Orange Bowl record with five punts for a 47.6-yard average.


BOWL TRADITION 1988 * ORANGE BOWL

1989 * CITRUS BOWL

Miami, Fla. (74,760)

Orlando, Fla. (53,571)

OU 13 53-179 76 13-5-0 66-255 4-2 5-39 8-39.0 27:52 6-18 1-5 0 7

10 0

UM 15 38-72 209 30-18-1 68-281 0-0 8-85 6-44.7 32:08 9-18 1-5 3 7

20 14

0 6

OU 17 43-116 138 24-10-1 67-254 4-1 5-50 5-38.6 30:30 4-14 0-0 3 0

0 7

6 13

SCORING OU - Lashar 35 yd field goal, 3-0 CU - Gardocki 20 yd field goal, 3-3 CU - Gardocki 46 yd field goal, 3-6 OU - Lashar 30 yd field goal, 6-6 CU - Allen 4 yd run (Seyle kick), 6-13 STAT LEADERS Rushing: OU - Perry 12-52 CU - McFadden 9-55 Passing: OU - Holieway 24-10-1-138 CU - Williams 11-5-0-57 Receiving: OU - Cabbiness 3-78 CU - Allen 4-47 Tackles: OU - Dillon 11 CU - McDaniel 11 GAME SUMMARY After a dry three quarters and the score deadlocked at 6-6, Clemson held off a late Sooner rally to post a 13-6 victory and give the ACC its first victory over the Sooners in 16 tries. On the Sooners’ last possession, OU took the ball over on its own 20 with 2:59 left on the clock. QB Jamelle Holieway, playing in his final game, scampered 11 yards on a fourth down to keep the drive alive. Holieway then completed passes of five, seven, four, 12, seven, 12 and 13 yards, to get OU inside the Tiger 14 with 12 seconds remaining. Two desperation heaves by Holieway dropped incomplete to end all Oklahoma hopes.

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Oklahoma 7 Virginia 0

14 48

OU 36 51-261 357 36-27-0 87-618 1-1 12-128 3-40.3 37:54 8-14 1-9 27 7

14 0

UVA 13 26-101 142 29-12-1 55-243 4-1 6-48 8-34.8 22:06 2-12 0-0 0 7

48 14

SCORING OU - Mickey 10 yd pass from Gundy (Blanton kick), 7-0 OU - Gaddis 2 yd run (Blanton kick), 14-0 OU - Gaddis 8 yd run (Blanton kick), 21-0 OU - Jones 4 yd blocked punt (Blanton kick), 28-0 OU - Mickey 13 yd pass from Gundy (kick blocked), 34-0 UVA - Davis 22 yd pass from Blundin (Husted kick), 34-7 OU - Rasheed 7 yd run (Blanton kick), 41-7 OU - Gaddis 7 yd run (Blanton kick), 48-7 UVA - Tomlin 23 yd pass from Blundin (Husted kick), 48-14 STAT LEADERS Rushing: OU - Gaddis 20-104 UVA - Kirby 13-66 Passing: OU - Gundy 31-25-0-324 UVA - Blundin 26-12-1-142 Receiving: OU - Warren 5-110 UVA - Mundy 3-44 Tackles: OU - Wilson 8 UVA - Lewis 15 GAME SUMMARY Cale Gundy unleashed one of the greatest passing efforts in school history as Oklahoma crushed Virginia, 48-14. Gundy was 25-of-31, including 11 straight completions, for 329 yards and two TDs. The Sooners scored touchdowns on four of their first five possessions to put the game out of reach before halftime. The OU defense never allowed the Cavaliers inside the 20. The 48 points tied the OU bowl game record (48-21 over Duke in the ‘58 Orange Bowl).

OKLAHOM A HISTORY

GAME SUMMARY The Sooners’ hopes of winning their seventh national championship were put to rest by Miami, 20-14. The Hurricanes took the opening kickoff and moved 65 yards in eight plays for a 7-0 lead, then never looked back. The Sooner offense, which led the nation in six categories, was held to only 179 rushing yards and 255 overall. Late in the fourth quarter, the Sooners scored on a 29-yard fumblerooski which gave the Oklahoma faithful a flicker of hope. The Hurricane defenders blew it out when they sacked quarterback Charles Thompson and caused a fumble to ensure the victory.

SCORE BY QUARTER Oklahoma 3 Clemson 0

CU 12 48-187 57 11-5-0 59-244 1-0 7-76 7-44.3 29:30 6-15 0-0

VIRGINIA OKLAHOMA

REVIEW & OPPONENTS

STAT LEADERS Rushing: OU - Collins 10-50 UM - Williams 19-41 Passing: OU - Thompson 12-4-0-56 UM - Walsh 30-18-1-209 Receiving: OU - Jackson 3-45 UM - Bratton 9-102 Tackles: OU - Reed 9 UM - Clark 14

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By

13 6

THE SOONERS

SCORING UM - Bratton 30 yd pass from Walsh (Cox kick), 7-0 OU - Stafford 1 yd run (Lashar kick), 7-7 UM - Cox 56 yd field goal, 10-7 UM - Irvin 23 yd pass from Walsh (Cox kick), 17-7 UM - Cox 48 yd field goal, 20-7 OU - Hutson 29 yd run (Lashar kick), 20-14

CLEMSON OKLAHOMA

COACHING STAFF

SCORE BY QUARTER Miami 7 Oklahoma 0

20 14

Jacksonville, Fla. (62,003)

2 0 0 5 S EAS ON

MIAMI OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By

1991 * GATOR BOWL

167 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

BOWL TRADITION 1993 * JOHN HANCOCK BOWL

1994 * COPPER BOWL

El Paso, Texas (43,848)

TEXAS TECH OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Texas Tech 0 Oklahoma 14

3 14

Tucson, Ariz. (45,122)

10 41

OU 21 50-177 215 26-15-1 76-392 4-2 9-65 7-48.3 35:22 4-11 1-5

TTU 18 33-116 199 37-19-4 70-315 0-0 6-65 7-42.6 24:38 6-17 6-31 7 0

0 13

1999 * INDEPENDENCE BOWL

10 41

SCORING OU - Chandler 2 yd run (Blanton kick), 7-0 OU - Brady 9 yd pass from Gundy (Blanton kick), 14-0 TT - Davis 22 yd field goal, 14-3 OU - Warren 34 yd pass from Gundy (Blanton kick), 21-3 OU - Brady 15 yd pass from Gundy (Blanton kick), 28-3 TT - Morris 2 yd run (Davis kick), 28-10 OU - Moore 32 yd run (Blanton kick), 35-10 OU - Moore 6 yd run (no PAT attempt), 41-10 STAT LEADERS Rushing: OU - Moore 15-85 TT - Morris 27-95 Passing: OU - Gundy 26-15-1-215 TT - Hall 37-19-4-199 Receiving: OU - Warren 4-93 TT - Mitchell 6-87 Tackles: OU - Coats 8 TT - Wright, Banks 9 GAME SUMMARY QB Cale Gundy brilliantly guided Oklahoma’s offense and the Sooner defense slowed Doak Walker Award winner Bam Morris as OU claimed a 41-10 win. The Sooners scored the first two times they had the ball. Another Gundy TD pass boosted the lead to 21-3. Just over a minute later, the game MVP hit again and Oklahoma was cruising at halftime 28-3. Meanwhile, the nation’s second-leading rusher was held to just 95 yards by the Sooner defense.

Shreveport, La. (49,843)

BRIGHAM YOUNG OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER BYU 7 Oklahoma 0

BYU 28 33-71 485 46-32-0 79-556 0 6-48 4-37.0 35:16 8-14 1-13 10 0

31 6 OU 16 33-72 163 30-13-1 63-235 0 7-44 8-37.1 24:44 3-13 1-3

7 0

7 6

31 6

SCORING BYU - Doman 7 yd pass from Walsh (Lauder kick), 7-0 BYU - Lauder 22 yd field goal, 10-0 BYU - Johnston 25 yd pass from Walsh (Lauder kick), 17-0 BYU - Johnston 4 yd pass from Walsh (Lauder kick), 24-0 OU - Moore 2 yd run (PAT failed), 24-6 BYU - Doman 28 yd pass from Walsh (Lauder kick), 31-6 STAT LEADERS Rushing: OU - Moore 9-41 BYU - Willis 11-41 Passing: OU - Brown 30-13-1-163 BYU - Walsh 45-31-4-454 Receiving: OU - Hall 5-75 BYU - Willis 7-103 Tackles: OU - Simpson 13 BYU - Cook 8 GAME SUMMARY After completing its worst regular season in 30 years, and playing under a head coach who had resigned, Oklahoma ended its season with a dismal 31-6 loss. The Sooners started reserve QB Terence Brown, who had completed one of three passes on the season. Season starter Garrick McGee had contracted spinal meningitis and was unable to play. OU’s defense surrendered 485 yards and four touchdowns through the air. BYU’s John Walsh set Copper Bowl records for completions (31) and TD passes (4). Sooner linebacker Broderick Simpson was Defensive Player of the Game with 13 tackles, a sack and a broken up pass.

168 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

OLE MISS OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Ole Miss 7 Oklahoma 3

27 25

UM 19 33-159 202 29-18-2 62-361 1-0 3-13 5-39.4 29:24 5-11 3-16 14 0

0 15

OU 27 23-91 390 54-39-1 77-481 3-3 4-35 1-10.0 30:36 7-13 3-24 6 7

27 25

SCORING UM - McAllister 25 yd pass from Miller (Binkley kick), 7-0 OU - Duncan 34 yd field goal, 7-3 UM - Bettis 9 yd pass from Miller (Binkley kick), 14-3 UM - McAllister 80 yd run (Binkley kick), 21-3 OU - Jackson 3 yd pass from Heupel (Duncan kick), 21-10 OU - Daniels 41 yd pass from Heupel (Hammons pass), 21-18 UM - Binkley 29 yd field goal, 24-18 OU - Griffin 17 yd pass from Heupel (Duncan kick), 24-25 UM - Binkley 39 yd field goal, 27-25 STAT LEADERS Rushing: OU - Griffin 12-86 UM - McAllister 17-121 Passing: OU - Heupel 53-39-1-390 UM - Miller 28-18-2-202 Receiving: OU - Daniels 6-109 UM - McAllister 3-55 Tackles: OU - Rideau 7 UM - Taylor, Strong 8 GAME SUMMARY In the final college game of the 20th century, Ole Miss topped Oklahoma in a thriller, 27-25. OU quarterback and game offensive MVP Josh Heupel set school and Independence Bowl records for attempts, completions and yards, and tied the record for touchdowns. Jarrail Jackson tied the Independence Bowl record for receptions with 10. Ole Miss’ Les Binkley kicked a 39-yard field goal for the win on the last play of the game.


BOWL TRADITION 2001 * ORANGE BOWL

2002 * COTTON BOWL

Miami, Fla. (76,835)

Dallas, Texas (72,955)

FSU 14 17-27 274 52-25-2 69-301 3-1 6-38 10-44.7 23:27 1-15 2-13 0 0

OU 12 36-56 214 39-25-1 75-270 2-1 7-45 8-41.1 36:33 7-19 1-2 0 3

2 7

2 13

0 0

ARK 6 42-37 13 13-2-1 55-50 1-1 6-54 8-40.5 26:26 1-14 4-27 3 0

0 3

10 3

SCORING OU - Hybl 1 yd run (Duncan kick, 7-0 OU - Duncan 32 yd field goal, 10-0 ARK - O’Donohoe 32 yd field goal, 10-3 STAT LEADERS Rushing: OU - Griffin 19-56 ARK - Holmes 8-27 Passing: OU - Hybl 32-24-0-175 ARK - Clark 12-2-1-13 Receiving: OU - Norman 7-74 ARK - Wilson 1-7 Tackles: OU - Calmus 10 ARK - Petty, Bua 7.5 GAME SUMMARY Arkansas’ defense played well, but few will remember. Oklahoma’s defense was that much better. The final statistics were as chilling and stark as the weather. The Razorbacks, who reached OU territory just two times the entire game, could muster only 13 passing yards on two completions while their rushing attempts (42) outnumbered their rushing yards (37). Sooner defenders tied a school and Cotton Bowl record with a whopping nine sacks. Late in the first quarter, Oklahoma set sail on a 13-play, 63-yard scoring drive that culminated in a oneyard sneak by quarterback Nate Hybl. Along the way, the Sooners converted two third downs and one fourth. The resulting touchdown and PAT made the rest of the afternoon academic. OU added a 32-yard field goal by Tim Duncan in the third frame to build a 10-0 advantage that felt like twice that given the play of the defense. Arkansas, aided by penalties, finally scratched out a field goal, but no serious threat to the outcome was ever mounted.

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Oklahoma 3 Wash. State 0

OU 19 46-146 240 29-19-0 75-386 2-1 4-28 5-29.0 37:14 9-20 6-59 14 0

14 34

WSU 11 21-4 239 34-17-2 55-243 3-1 9-52 6-46.0 22:46 2-11 3-27 3 0

14 14

34 14

SCORING OU - DiCarlo 45 yd field goal, 3-0 OU - Savage 12 yd pass from Hybl (DiCarlo kick), 10-0 OU - Perkins 51 yd punt return (DiCarlo kick), 17-0 OU - DiCarlo 30 yd field goal, 20-0 OU - Fagan 9 yd pass from Hybl (DiCarlo kick), 27-0 WSU - Riley 37 yd pass from Gesser (Dunning kick), 27-7 OU - Griffin 19 yd run (DiCarlo kick), 34-7 WSU - Moore 89 yd kickoff return (Dunning kick), 34-14 STAT LEADERS Rushing: OU - Griffin 30-162 WSU - Green 8-45 Passing: OU - Hybl 29-19-0-240 WSU - Gesser 34-17-2-239 Receiving: OU - Peoples 3-80 WSU - Riley 9-139 Tackles: OU - Lehman 6 WSU - Coleman 10 GAME SUMMARY Oklahoma dominated the Pac 10 champs in the Sooners’ first trip to the Rose Bowl. OU’s defense logged six sacks and two interceptions to set the tone. Rose Bowl MVP Nate Hybl tossed two TD passes and Quentin Griffin rushed for 144 yards as the OU offense wore down the Cougars. Oklahoma became just the fourth school in college football history to win the four BCS games and the Cotton Bowl.

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

GAME SUMMARY Top-ranked Oklahoma used a smothering defense to shut down the third-ranked Seminoles and Josh Heupel generated enough offense to lead OU to a perfect season. As the nation’s only unbeaten team, the Sooners were the unanimous winners of the AP media poll. They were automatically crowned national champions in the coaches’ poll under the Bowl Championship Series format. Led by Orange Bowl MVP Torrance Marshall, the Sooners time and again forced Florida State’s Chris Weinke into bad decisions. Tim Duncan kicked two field goals and Quentin Griffin scored the clinching touchdown on a 10-yard run up the middle with 8:30 to play. Florida State avoided its first shutout in 12 seasons when Stanford Samuels tackled OU punter Jeff Ferguson in the end zone for a safety with 55 seconds remaining.

SCORE BY QUARTER Oklahoma 7 Arkansas 0

OU 11 34-56 175 32-24-0 66-231 2-1 9-76 9-34.9 33:34 6-18 9-55

WASHINGTON STATE OKLAHOMA

REVIEW & OPPONENTS

STAT LEADERS Rushing: OU - Griffin 11-40 FSU - Minor 13-20 Passing: OU - Heupel 39-25-1-214 FSU - Weinke 51-25-2-274 Receiving: OU - Norman 3-49 FSU - Bell 7-137 Tackles: OU - Thompson 7 FSU - Allen 12

First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By

3 10

THE SOONERS

SCORING OU - Duncan 27 yd field goal, 0-3 OU - Duncan 42 yd field goal, 0-6 OU - Griffin 10 yd run (Duncan kick), 0-13 FSU - Team safety, 2-13

ARKANSAS OKLAHOMA

COACHING STAFF

SCORE BY QUARTER Florida State 0 Oklahoma 3

2 13

Pasadena, Calif. (86,848)

2 0 0 5 S EAS ON

FLORIDA STATE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By

2003 * ROSE BOWL

169


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

BOWL TRADITION

170

2004 * SUGAR BOWL

2005 * ORANGE BOWL

New Orleans, La. (79,342)

LOUISIANA STATE OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER LSU 7 Oklahoma 0

LSU 13 40-159 153 24-14-2 64-312 1-1 8-65 8-34.0 31:19 6-17 5-46 7 7

21 14 OU 12 33-52 102 37-13-2 70-154 2-0 11-70 8-45.9 28:41 4-15 5-12

7 0

0 7

OU Bowl Quick Facts

Miami, Fla. (77,912)

21 14

SCORING LSU - Green 24 yd run (Gaudet kick), 7-0 OU - K. Jones 1 yd run (DiCarlo kick), 7-7 LSU - Vincent 18 yd run (Gaudet kick), 14-7 LSU - Spears 20 yd interception return (Gaudet kick), 21-7 OU - K. Jones 1 yd run (DiCarlo kick), 21-14 STAT LEADERS Rushing: LSU - Vincent16-117 OU - K. Jones 20-59 Passing: LSU - Mauck 22-13-2-124-0 OU - White 37-13-2-102-0 Receiving: LSU - Clayton 4-38 OU - Clayton 4-32 Tackles: LSU - Turner 9 OU - Strait 11 GAME SUMMARY Riding its defense, LSU won the BCS title, 2114. Oklahoma entered the game as the naton’s top scoring offense, but struggled against the Tigers. The OU defense gave a good account too, surrendering 64 of LSU’s 312 total yards on a non-scoring run on the Tigers’ first snap. Still, it was the LSU defenders who stole the show. DE Marcus Spears returned an interception 20 yards for a TD on the first series of the second half and seemingly opened the floodgates. But OU stiffened and got its running game untracked. After pulling within seven at 21-14, the Sooners made another push to the LSU 12, but missed on four straight pass attempts, the last one with just 2:46 left. The crowd was the largest ever to see a sporting event in the Louisiana Superdome.

SOUTHERN CAL OKLAHOMA First Downs Rushes-Yardage Passing yardage Passes-Comp-Int Plays-Yards Fumbles-Lost Penalties-Yards Punts-Average Time of Possession Third Down Con. Sacks By SCORE BY QUARTER Oklahoma 7 USC 14

OU 19 40-151 244 36-24-3 76-372 3-2 3-30 4-44.5 35:06 8-17 1-9 3 24

55 19 USC 19 28-208 332 35-18-0 63-525 1-0 9-75 4-43.5 24:54 6-14 2-20

0 10

9 7

19 55

SCORING OU - Wilson five yd pass from White (Hartley kick), 7-0 USC - Byrd 33 yd pass from Leinart (Killeen kick), 7-7 USC - White 6 yd run (Killeen kick), 7-14 USC - Jarrett 54 yd pass from Leinart (Killeen kick), 7-21 USC - Smith 5 yd pass from Leinart (Killeen kick), 7-28 OU - Hartley 29 yd field goal, 10-28 USC - Smith 33 yd pass from Leinart (Killeen kick), 10-35 USC - Killeen 44 yd field goal, 10-38 USC - Smith 4 yd pass from Leinart (Killeen kick), 10-45 USC - Killeen 42 yd field goal), 10-48 USC - White 8 yd run (Killeen kick), 10-55 OU - Team safety, 12-55 OU - Wilson 9 yd pass from White (Hartley kick), 19-55 STAT LEADERS Rushing: OU - Peterson 25-82 USC - White 15-118 Passing: OU - White 36-24-3-244-2 USC - Leinart 35-18-0-332-5 Receiving: OU - Wilson 7-59 USC - Smith 7-113 Tackles: OU - Pool 7 USC - Tatupu 12 GAME SUMMARY USC didn’t need any help, but Oklahoma obliged anyway. The Trojans played a nearly flawless game, made even more so by five OU turnovers, and cruised to the BCS National Championship, 55-19.

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

All-Time Bowl Appearances . . . . . . . . . . . . . 38 Bowl Championships . . . . . . . . . . . . . . . . . 23 Overall Bowl Record. . . . . . . . . 23-14-1 (.618) Bowl Records W Orange . . . . . . . . . . . . . . . . . . . .12 Sugar . . . . . . . . . . . . . . . . . . . . . 4 Gator. . . . . . . . . . . . . . . . . . . . . . 2 Sun . . . . . . . . . . . . . . . . . . . . . . . 2 Fiesta . . . . . . . . . . . . . . . . . . . . . 1 Cotton. . . . . . . . . . . . . . . . . . . . . 1 Rose . . . . . . . . . . . . . . . . . . . . . . 1 Bluebonnet . . . . . . . . . . . . . . . . . 0 Citrus . . . . . . . . . . . . . . . . . . . . . 0 Copper . . . . . . . . . . . . . . . . . . . . 0 Independence. . . . . . . . . . . . . . . 0

L 6 2 1 0 1 0 0 1 1 1 1

T 0 0 0 0 0 0 0 1 0 0 0

Bowl Timeline 01/02/39 (Orange) . . . . . Tennessee 17, OU 0 01/01/47 (Gator) . . . . . . . OU 34, N.C. State 13 01/01/49 (Sugar). . . . . . . OU 14, N. Carolina 6 01/01/50 (Sugar). . . . . . . . . . . . .OU 35, LSU 0 01/01/51 (Sugar). . . . . . . . . Kentucky 13, OU 7 01/01/54 (Orange) . . . . . . . . OU 7, Maryland 0 01/01/56 (Orange) . . . . . . . OU 20, Maryland 6 01/01/58 (Orange) . . . . . . . . . OU 48, Duke 21 01/01/59 (Orange) . . . . . . .OU 21, Syracuse 6 01/01/63 (Orange) . . . . . . . Alabama 17, OU 0 01/02/65 (Gator) . . . . . . Florida St. 36, OU 19 01/01/68 (Orange) . . . . OU 26, Tennessee 24 12/31/68 (Bluebonnet) . . . . . . SMU 28, OU 27 12/31/70 (Bluebonnet) . . . OU 24, Alabama 24 01/01/72 (Sugar). . . . . . . . . OU 40, Auburn 22 12/31/73 (Sugar). . . . . . . OU 14, Penn State 0 01/01/76 (Orange) . . . . . . . OU 14, Michigan 6 12/25/76 (Fiesta) . . . . . . . .OU 41, Wyoming 7 01/02/78 (Orange) . . . . . . .Arkansas 31, OU 6 01/01/79 (Orange) . . . . . OU 31, Nebraska 24 01/01/80 (Orange) . . . . . . OU 24, Florida St. 7 01/01/81 (Orange) . . . . . OU 18, Florida St. 17 12/26/81 (Sun) . . . . . . . . . OU 40, Houston 14 01/01/83 (Fiesta) . . . . . Arizona St. 32, OU 21 01/01/85 (Orange) . . . .Washington 28, OU 17 01/01/86 (Orange) . . . . OU 25, Penn State 10 01/01/87 (Orange) . . . . . . . OU 42, Arkansas 8 01/01/88 (Orange) . . . . . . . . Miami 20, OU 14 01/02/89 (Citrus). . . . . . . . . Clemson 13, OU 6 12/29/91 (Gator) . . . . . . . . . OU 48, Virginia 14 12/24/93 (Hancock) . . . OU 41, Texas Tech 10 12/29/94 (Copper) . . . . . . . . . . BYU 31, OU 6 12/31/99 (Independence) . . . . Miss. 27, OU 25 01/03/01 (Orange) . . . . . . OU 13, Florida St. 2 01/01/02 (Cotton) . . . . . . . . OU 10, Arkansas 3 01/01/03 (Rose) . . . . . . . OU 34, Wash. St. 14 01/04/04 (Sugar). . . . . . . . . . . .LSU 21, OU 14 01/04/05 (Orange) . . . . . . . . . USC 55, OU 19


AWARD WINNERS

DETAILED INFORMATION AT SOONERSPORTS.CO M

MAXWELL MEMORIAL AWARD College Player of the Year awarded by Maxwell Football Club Jason White, Quarterback, Tuttle, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 Tommy McDonald, Halfback, Albuquerque, N.M. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1952

CHUCK BEDNARIK AWARD Defensive Player of the Year awarded by Maxwell Football Club Teddy Lehman, Linebacker, Fort Gibson, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 BRONKO NAGURSKI AWARD Defensive Player of the Year awarded by Charlotte Touchdown Club Derrick Strait, Cornerback, Austin, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 Roy Williams, Safety, Union City, Calif. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 DAVEY O’BRIEN AWARD Outstanding Quarterback awarded by Davey O’ Brien Foundation Jason White, Quarterback, Tuttle, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 Jason White, Quarterback, Tuttle, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003

VINCE LOMBARDI AWARD Outstanding Lineman awarded by Rotary Club of Houston Tommie Harris, Defensive Tackle, Killeen, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 Tony Casillas, Noseguard, Tulsa, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1985 Lee Roy Selmon, Defensive Tackle, Eufaula, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975

OUTLAND TROPHY Outstanding Interior Lineman awarded by Football Writers Association Jammal Brown, Offensive Tackle, Lawton, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 Greg Roberts, Offensive Guard, Nacogdoches, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1978 Lee Roy Selmon, Tackle, Eufaula, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975 J.D. Roberts, Guard, Dallas, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1953 Jim Weatherall, Tackle, White Deer, Texas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951

UNITAS AWARD Outstanding Senior Quarterback awarded by Johnny Unitas Foundation Jason White, Quarterback, Tuttle, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 ASSOCIATED PRESS PLAYER OF THE YEAR Jason White, Quarterback, Tuttle, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 Josh Heupel, Quarterback, Aberdeen, S.D. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000

OUTSTANDING LINEMAN OF THE YEAR Tony Casillas, Noseguard, Tulsa, Okla. (UPI) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1985 Granville Liggins, Noseguard, Tulsa, Okla. (UPI) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1967 Bob Harrison, Center, Samford, Texas (UPI) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1958 Jerry Tubbs, Center, Breckenridge, Texas (UPI) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1956 Max Boydston, End, Muskogee, Okla. (Washington TD Club) . . . . . . . . . . . . . . . . . . . . . . . 1954 Kurt Burris, Center, Muskogee, Okla. (Philadelphia Sports Writers) . . . . . . . . . . . . . . . . . . 1954 J.D. Roberts, Guard, Dallas, Texas (AP, UPI, Fox Movietime News) . . . . . . . . . . . . . . . . . . 1953 NCAA TOP SIX AWARD Anthony Phillips, Offensive Guard, Tulsa, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1988 Keith Jackson, Tight End, Little Rock, Ark.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1987 CHEVROLET ABC OFFENSIVE PLAYER OF THE YEAR Jack Mildren, Quarterback, Abilene, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1971 CHEVROLET ABC DEFENSIVE PLAYER OF THE YEAR Teddy Lehman, Linebacker, Fort Gibson, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2002 Lucious Selmon, Noseguard, Eufaula, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1973 HELMS & CITIZENS SAVINGS ATHLETIC FOUND. (PLAYER OF THE YEAR) Billy Sims, Halfback, Hooks, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1978 Steve Owens, Tailback, Miami, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969 Kurt Burris, Center, Muskogee, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1954 HELMS & CITIZENS SAVINGS ATHLETIC FOUNDATION HALL OF FAME Greg Pruitt, Halfback, Houston, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975 Jim Weatherall, Tackle, White Deer, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975 Buddy Burris, Guard, Muskogee, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969 HELMS & CITIZENS SAVINGS ATHLETIC COACHES HALL OF FAME Bennie Owen, Head Coach (1905-26) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969 Bud Wilkinson, Head Coach (1947-63) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969 NEW YORK ATHLETIC CLUB DEFENSIVE BACK OF THE YEAR Zac Henderson, Free Safety, Burkburnett, Texas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1977 WASHINGTON, D.C., PLAYER OF THE YEAR Joe Washington, Halfback, Port Arthur, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1974 Greg Pruitt, Halfback, Houston, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1972

OKLAHOM A HISTORY

JIM THORPE AWARD Outstanding Defensive Back awarded by Jim Thorpe Association Derrick Strait, Cornerback, Austin, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 Roy Williams, Safety, Union City, Calif. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 Rickey Dixon, Safety, Dallas, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1987

NATIONAL FOOTBALL FOUNDATION & COLLEGE HALL OF FAME Joe Washington, Running Back, Port Arthur, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2005 Tony Casillas, Noseguard, Tulsa, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2004 Keith Jackson, Tight End, Little Rock, Ark.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 Barry Switzer, Head Coach (1973-88) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 Kurt Burris, Center-Linebacker, Muskogee, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000 Greg Pruitt, Halfback, Houston, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1999 Jerry Tubbs, Center, Breckenridge, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1996 Billy Sims, Halfback, Hooks, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1995 J.D. Roberts, Guard, Dallas, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1993 Jim Weatherall, Tackle, White Deer, Texas. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1992 Steve Owens, Tailback, Miami, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1991 Lee Roy Selmon, Defensive Tackle, Eufaula, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1988 Roland “Waddy” Young, End, Ponca City, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1986 Tommy McDonald, Halfback, Albuquerque, N.M. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1985 Jim Owens, End, Oklahoma City, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1982 Billy Vessels, Halfback, Cleveland, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1974 Forest “Spot” Geyer, Fullback, Norman, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1973 Bud Wilkinson, Head Coach (1947-63) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969 Claude Reeds, Fullback, Norman, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1961 Bennie Owen, Head Coach (1905-26) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951

REVIEW & OPPONENTS

MOSI TATUPU AWARD Outstanding Special Teams Player awarded by Maui Quarterback Club J.T. Thatcher, Free Safety, Norman, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000

FOOTBALL NEWS FRESHMAN OF THE YEAR Marcus Dupree, Tailback, Philadelphia, Miss. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1982

THE SOONERS

DICK BUTKUS AWARD Outstanding Linebacker awarded by Downtown Athletic Club of Orlando Teddy Lehman, Fort Gibson, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 Rocky Calmus, Jenks, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2001 Brian Bosworth, Irving, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1986 Brian Bosworth, Irving, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1985

CBS PLAYER OF THE YEAR Josh Heupel, Quarterback, Aberdeen, S.D. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000

COACHING STAFF

WALTER CAMP TROPHY College Player of the Year awarded by Walter Camp Football Foundation Josh Heupel, Quarterback, Aberdeen, S.D. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000 Billy Sims, Halfback, Hooks, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1978 Steve Owens, Tailback, Miami, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969 Jerry Tubbs, Center, Breckenridge, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1956

THE SPORTING NEWS PLAYER OF THE YEAR Jason White, Quarterback, Tuttle, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 Josh Heupel, Quarterback, Aberdeen, S.D. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000 Tommy McDonald, Halfback, Albuquerque, N.M. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1956

2 0 0 5 S EAS ON

HEISMAN MEMORIAL TROPHY College Player of the Year awarded by Downtown Athletic Club of New York City Jason White, Quarterback, Tuttle, Okla.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003 Billy Sims, Halfback, Hooks, Texas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1978 Steve Owens, Tailback, Miami, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1969 Billy Vessels, Halfback, Cleveland, Okla. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1952

171 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

HEISMAN TROPHY WINNERS

172

1952* HEISMAN TROPHY WINNER * BILLY VESSELS

1969* HEISMAN TROPHY WINNER * STEVE OWENS

Billy “Curly” Vessels was the man who started it all. The first Sooner to win college football’s most prestigious individual achievement award, Vessels led the Sooners to a 26-4-1 record during his tenure.

Oklahoma’s Steve Owens was a 6-2, 215-pound powerhouse from Miami, Okla., who ravaged defenses from 1967-69, setting four conference records of the day.

The 1950 Sooners, under the direction of head coach Bud Wilkinson, went 10-1 to give the Sooners their first of seven national championships. As a sophomore, Vessels started on the 1950 squad, scoring 15 touchdowns.

OU’s workhorse carried the ball 358 times in 1969 for 1,523 yards while scoring 23 touchdowns (another school record). Playing on a 1969 squad that had been hurt badly by graduation in 1968, Owens carried the load for the Sooner offense.

But Vessels’ most successful individual season came during his senior campaign when he won the Heisman Trophy. Vessels rushed for 1,072 yards on 167 carries and scored 17 touchdowns. Creating a new meaning for the word “versatile,” the Cleveland, Okla., slasher was part of every phase of the Sooner offensive attack. Vessels was even a threat from above. “Curly” connected on seven passes for two touchdowns in 1952. The 1952 Sooners went 8-1-1, finishing fourth in the nation, and won Oklahoma’s ninth conference title. OU opened with a 21-21 tie with Colorado and then reeled off five straight wins, averaging 46 points a game. OU dropped a 27-21 decision to Notre Dame and then finished strong by sweeping the last three games. In 1953, Vessels turned pro for the Edmonton Eskimos and won the Schenley Award as the top player in Canada. Vessels then served as an officer in the U.S. Army. Vessels was elected to the National Football Foundation and College Hall of Fame in 1974. CAREER STATISTICS Year Att Yds 1950 152 938 1951 27 143 1952 167 1,072 Totals 346 2,153

Avg 6.1 5.3 6.4 6.3

TD 13 1 17 31

Rec 13 3 7 23

Yds 250 -3 165 412

TD 2 1 1 4

Owens had two 200-plus yard games while leading the Sooners to a 6-4 season. Spurred by Owens’ effort, Oklahoma averaged 28.5 points a game in 1969. The great career of Steve Owens left a mark on the OU record book. Owens holds five Sooner records. He is the school’s all-time leading scorer with 57 touchdowns during his career. Owens holds the record for the most carries in a game (55) and career (958). He finished his career with 4,041 yards on the ground, the third most in school history. Detroit drafted Owens in the first round. He was the first Lion to gain over 1,000 yards in a season and was an All-Pro selection in 1971 and 1972. In 1991, Owens was named to the Oklahoma Sports Hall of Fame and was the Walter Camp Foundation Alumnus of the Year. Owens was inducted into the Orange Bowl Hall of Honor in 1992. CAREER STATISTICS Year Att Yds 1967 207 869 1968 393 1,649 1969 358 1,523 Totals 958 4,041

Avg 4.2 4.3 4.3 4.3

TD 13 21 23 57

Rec 3 12 4 19

Yds 13 123 32 168

TD 0 0 0 0

1952 HEISMAN TROPHY VOTING TOTALS 1. Billy Vessels, Sr., RB, Oklahoma . . . . . . . . . . . . . . . . . . . . . 525 Points (98 first-place votes, 91 second-place, 49 third-place votes)

1969 HEISMAN TROPHY VOTING TOTALS 1. Steve Owens, Sr., RB, Oklahoma . . . . . . . . . . . . . . . . . . . 1,488 Points (294 first-place, 218 second-place, 170 third-place votes)

2. Jack Scarbaugh, Sr., QB, Maryland . . . . . . . . . . . . . . . . . . . . . . . . . 367 3. Paul Giel, Jr., TB, Minnesota . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 329 4. Don Moomaw, Sr., LB, UCLA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 257 5. John Lattner, Jr. HB, Notre Dame. . . . . . . . . . . . . . . . . . . . . . . . . . . 253 6. Paul Cameron, Jr., HB, UCLA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 218 7. Jim Sears, Sr., B, Southern Cal . . . . . . . . . . . . . . . . . . . . . . . . . . . 173 8. Don McAuliffe, Sr., HB, Michigan State . . . . . . . . . . . . . . . . . . . . . 164 9. Don Heinrich, Sr. QB, Washington . . . . . . . . . . . . . . . . . . . . . . . . . 153 10. Tom Catlin, Sr., C, Oklahoma . . . . . . . . . . . . . . . . . . . . . . . . . . . . 150

2. Mike Phipps, Sr., QB, Purdue. . . . . . . . . . . . . . . . . . . . . . . . . . . . 1,334 3. Rex Kearn, Jr., QB, Ohio State. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 857 4. Archie Manning, Jr. QB, Ole Miss. . . . . . . . . . . . . . . . . . . . . . . . . . . 582 5. Mike Reid, Sr., DT, Penn State. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 297 6. Mike McCoy, Sr., DT, Notre Dame . . . . . . . . . . . . . . . . . . . . . . . . . 290 7. Jim Otis, Sr. FB, Ohio State . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 121 8. Jim Plunkett, Jr., QB, Stanford . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120 9. Steve Kiner, Sr., LB, Tennessee . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 10. Jack Tatum, Jr., DB, Ohio State . . . . . . . . . . . . . . . . . . . . . . . . . . 105

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


HEISMAN TROPHY WINNERS 2 0 0 5 S EAS ON

2003 * HEISMAN TROPHY WINNER * JASON WHITE

Billy Sims, a 6-0, 205-pound running back from Hooks, Texas, swept through defenses like a tornado flying across the Oklahoma landscape.

OU quarterback Jason White became the trigger man for the country’s most potent offensive attack. At a school where the points have flowed like an Oklahoma gusher, White led the OU team that outscored all of its predecessors (601 total points).

He set a Big Eight single-season rushing record in 1978 with 1,896 yards on 256 carries. Sims led the nation in rushing, averaging more than 7.0 yards per carry. He topped the 200-yard mark in four different games (a school best) during the 1978 season. Sims led the Sooners to an 11-1 record, Orange Bowl championship and third-place finish in the final poll. OU opened with a 35-29 win over Stanford and then crushed West Virginia and Rice by a combined score of 118-17.

OU responded by clubbing Oklahoma State, 62-7, and then was rematched with the Cornhuskers in the Orange Bowl. OU edged Nebraska 31-24 in the second meeting between the top-10 schools.

CAREER STATISTICS Year Att Yds Avg TD 1975 15 95 6.3 2 1976* 3 44 14.6 0 1977 71 413 5.8 6 1978 256 1,896 7.4 22 1979 248 1,670 6.7 23 Totals 593 4,118 6.9 53 * injured and granted additional year of eligibility

Rec 0 0 0 1 1 2

Yds 0 0 0 35 42 77

TD 0 0 0 0 0 0

The outpouring of recognition was impressive. White captured player of the year honors from the Associated Press, Sports Illustrated, The Sporting News and CNNSI.com. He also won the Davey O’Brien Award and the Jim Thorpe Courage Award. White returned for another season after his Heisman campaign and finished third in the voting. It was an unprecedented finish by one school when his teammate Adrian Peterson finished second. CAREER STATISTICS Year Comp Att Yds Int 1999* 1 2 9 0 2000 0 0 0 0 2001 73 113 681 3 2002* 20 34 181 2 2003 278 451 3,846 10 2004 255 390 3,205 9 Totals 627 990 7,922 24 * injured and granted additional year of eligibility

Pct .500 0 .646 .588 .616 .654 .633

TD 0 0 5 1 40 35 81

2003 HEISMAN TROPHY VOTING TOTALS 1. Jason White, Sr., QB, Oklahoma . . . . . . . . . . . . . . . . . . . . 1,481 Points (319 first-place, 204 second-place, 116 third-place votes)

2. Chuck Fusina, Sr., QB, Penn State . . . . . . . . . . . . . . . . . . . . . . . . . 750 3. Rick Leach, Sr., QB, Michigan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 435 4. Charles White, Jr., TB, Southern California . . . . . . . . . . . . . . . . . . . 354 5. Charles Alexander, Sr., TB, Louisiana State. . . . . . . . . . . . . . . . . . . 282 6. Ted Brown, Sr., RB, North Carolina State. . . . . . . . . . . . . . . . . . . . . 82 7. Steve Fuller, Sr., QB, Clemson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82 8. Eddie Lee Ivery, Sr. RB, Georgia Tech . . . . . . . . . . . . . . . . . . . . . . . 81 9. Jack Thompson, Sr., QB, Washington State . . . . . . . . . . . . . . . . . . 72 10. Jerry Robinson, Sr., LB, UCLA. . . . . . . . . . . . . . . . . . . . . . . . . . . . 70

2. Larry Fitzgerald, Sr., WR, Pittsburgh . . . . . . . . . . . . . . . . . . . . . . 1,353 3. Eli Manning, Sr., QB, Mississippi . . . . . . . . . . . . . . . . . . . . . . . . . . . 710 4. Chris Perry, Sr., RB, Michigan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 341 5. Darren Sproles, Sr., RB, Kansas State. . . . . . . . . . . . . . . . . . . . . . . 134 6. Matt Leinart, So., QB, Southern Cal. . . . . . . . . . . . . . . . . . . . . . . . 127 7. Philip Rivers, Sr., QB, North Carolina State . . . . . . . . . . . . . . . . . . 118 8. Mike Williams, Sr., WR, Southern Cal . . . . . . . . . . . . . . . . . . . . . . . 78 9. Ben Rothlisberger, Jr., QB, Miami (Ohio) . . . . . . . . . . . . . . . . . . . . . 47 10. B.J. Symons, Jr., QB, Texas Tech . . . . . . . . . . . . . . . . . . . . . . . . . 38

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

1978 HEISMAN TROPHY VOTING TOTALS 1. Billy Sims, Jr., RB, Oklahoma. . . . . . . . . . . . . . . . . . . . . . . . 827 Points (151 first-place, 152 second-place, 70 third-place votes)

REVIEW & OPPONENTS

Sims is second in the OU record books for rushing yards in a season (1,896), most 200-yard games in a season (4) and a career (7). He finished his career with 4,118 yards and stands first on the all-time rushing list.

White set school records for touchdown passes in a season (40) and game (5, twice). His season passing total ranked No. 2 at OU. He was No. 4 nationally in touchdown percentage (8.87), No. 7 in passing efficiency (158.11), No. 18 in interception percentage (2.22) and No. 22 in total offense (264.0).

THE SOONERS

The Sooners rolled over Texas and the first five games of the conference schedule heading into the Nebraska game. Sims ran for 153 yards, but it was not enough as the Sooners fell, 17-14.

He did so with uncanny accuracy, especially on deep throws, and a touchdown to interception ratio (four to one), so gaudy that it read like a typographical error.

COACHING STAFF

1978* HEISMAN TROPHY WINNER * BILLY SIMS

173


6 3 NAT IONAL AWARD WINNERS

2001

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

2004

141 ALL-A MERICANS

SOONER ALL-AMERICANS

174

2003

2002

2000 1995 1991 1988 1987

1986

1985 1984 1983 1982 1981 1980 1979 1978

1977

1976 1975

1974

Jammal Brown* . . . . . .OT . . . . . . . Lawton, Okla. Vince Carter . . . . . . . . . C . . . . . . . . . Waco, Texas Dan Cody . . . . . . . . . . .DE . . . . . . . . . . Ada, Okla. Mark Clayton . . . . . . . WR . . . . . .Arlington, Texas Adrian Peterson* . . . . .RB . . . . . Palestine, Texas Jammal Brown . . . . . . .OT . . . . . . . Lawton, Okla. Mark Clayton . . . . . . . WR . . . . . .Arlington, Texas Tommie Harris* . . . . . .DT. . . . . . . . Killeen, Texas Teddy Lehman* . . . . . .LB. . . . . Fort Gibson, Okla. Antonio Perkins* . . . . .RS . . . . . . . Lawton, Okla. Derrick Strait*. . . . . . . .CB . . . . . . . Austin, Texas Jason White* . . . . . . . .QB . . . . . . . . . Tuttle, Okla. Brandon Everage . . . . .FS. . . . . . . Granger, Texas Tommie Harris* . . . . . .DT. . . . . . . . Killeen, Texas Teddy Lehman* . . . . . .LB. . . . . Fort Gibson, Okla. Rocky Calmus* . . . . . .LB. . . . . . . . . .Jenks, Okla. Jeff Ferguson . . . . . . . . P . . . . . . . . . . Tulsa, Okla. Roy Williams*. . . . . . . . S . . . . . . Union City, Calif. Rocky Calmus* . . . . . .LB. . . . . . . . . .Jenks, Okla. Josh Heupel* . . . . . . . .QB . . . . . . Aberdeen, S.D. J.T. Thatcher*. . . . . . . .FS. . . . . . . . Norman, Okla. Cedric Jones . . . . . . . .DE . . . . . . Houston, Texas Joe Bowden . . . . . . . . .LB. . . . . . Mesquite, Texas Anthony Phillips* . . . . OG . . . . . . . . . Tulsa, Okla. Mark Hutson* . . . . . . . OG . . . . . . Fort Smith, Ark. Keith Jackson* . . . . . . .TE. . . . . . . Little Rock, Ark. Rickey Dixon*. . . . . . . .DB . . . . . . . . Dallas, Texas Danté Jones* . . . . . . . .LB. . . . . . . . . Dallas, Texas Darrell Reed. . . . . . . . .DE . . . . . . Cypress, Texas Brian Bosworth* . . . . . .LB. . . . . . . . . Irving, Texas Mark Hutson. . . . . . . . OG . . . . . . Fort Smith, Ark. Keith Jackson* . . . . . . .TE. . . . . . . Little Rock, Ark. Anthony Phillips . . . . . OG . . . . . . . . . Tulsa, Okla. Brian Bosworth* . . . . . .LB. . . . . . . . . Irving, Texas Tony Casillas* . . . . . . NG . . . . . . . . . Tulsa, Okla. Kevin Murphy . . . . . . . .DE . . . .Richardson, Texas Tony Casillas* . . . . . . NG . . . . . . . . . Tulsa, Okla. Rick Bryan* . . . . . . . . .DT. . . . . . . . Coweta, Okla. Rick Bryan* . . . . . . . . .DT. . . . . . . . Coweta, Okla. Terry Crouch* . . . . . . . . G . . . . . . . . . Dallas, Texas Terry Crouch . . . . . . . . G . . . . . . . . . Dallas, Texas Louis Oubre* . . . . . . . . T . . . . . .New Orleans, La. George Cumby* . . . . . .LB. . . . . . . . . . Tyler, Texas Billy Sims* . . . . . . . . . .HB . . . . . . . .Hooks, Texas Billy Sims* . . . . . . . . . .HB . . . . . . . .Hooks, Texas Reggie Kinlaw . . . . . . NG . . . . . . . . . .Miami, Fla. Daryl Hunt . . . . . . . . . .LB. . . . . . . .Odessa, Texas Greg Roberts* . . . . . . . G . . . Nacogdoches, Texas Zac Henderson* . . . . . .DB . . . Burkburnett, Texas Daryl Hunt . . . . . . . . . .LB. . . . . . . .Odessa, Texas George Cumby. . . . . . .LB. . . . . . . . . . Tyler, Texas Greg Roberts . . . . . . . . G . . . Nacogdoches, Texas Reggie Kinlaw . . . . . . NG . . . . . . . . . .Miami, Fla. Mike Vaughan*. . . . . . . T . . . . . . . . . . . Ada, Okla. Zac Henderson . . . . . .DB . . . Burkburnett, Texas Lee Roy Selmon* . . . . .DT. . . . . . . . Eufaula, Okla. Dewey Selmon* . . . . . NG . . . . . . . Eufaula, Okla. Terry Webb. . . . . . . . . . G . . . . . . Muskogee, Okla. Mike Vaughan . . . . . . . T . . . . . . . . . . . Ada, Okla. Billy Brooks . . . . . . . . .SE . . . . . . . . Austin, Texas Jimbo Elrod*. . . . . . . . .DE . . . . . . . . . Tulsa, Okla. Tinker Owens. . . . . . . .SE . . . . . . . . Miami, Okla. Joe Washington . . . . . .HB . . . . Port Arthur, Texas Joe Washington* . . . . .HB . . . . Port Arthur, Texas Rod Shoate*. . . . . . . . .LB. . . . . . . . . . Spiro, Okla. Lee Roy Selmon* . . . . .DT. . . . . . . . Eufaula, Okla. Dewey Selmon* . . . . . NG . . . . . . . Eufaula, Okla. Tinker Owens. . . . . . . .SE . . . . . . . . Miami, Okla. John Roush* . . . . . . . . G . . . . . . . . .Arvada, Colo. Randy Hughes . . . . . . .DB . . . . . . . . . Tulsa, Okla. Kyle Davis . . . . . . . . . . C . . . . . . . . . . Altus, Okla.

1973 1972

1971 1969 1968 1967 1966 1965 1964 1963 1962 1959 1958 1957 1956

1955 1954 1953 1952

1951 1950

1949

1948 1947 1946 1939 1938 1937 1935 1934 1927 1920 1915 1913

Rod Shoate . . . . . . . . .LB. . . . . . . . . . Spiro, Okla. Eddie Foster. . . . . . . . . T . . . . . Monahans, Texas Lucious Selmon* . . . . NG . . . . . . . Eufaula, Okla. Tom Brahaney* . . . . . . C . . . . . . . Midland, Texas Rod Shoate . . . . . . . . .LB. . . . . . . . . . Spiro, Okla. Greg Pruitt* . . . . . . . . .HB . . . . . . Houston, Texas Derland Moore . . . . . . . T . . . . . . Poplar Bluff, Mo. Jack Mildren. . . . . . . . .QB . . . . . . . Abilene, Texas Tom Brahaney* . . . . . . C . . . . . . . Midland, Texas Greg Pruitt* . . . . . . . . .HB . . . . . . Houston, Texas Steve Zabel . . . . . . . . .TE. . . . . . . Thornton, Colo. Steve Owens* . . . . . . .HB . . . . . . . . Miami, Okla. Ken Mendenhall . . . . . . C . . . . . . . . . . .Enid, Okla. Steve Owens* . . . . . . .HB . . . . . . . . Miami, Okla. Granville Liggins* . . . . NG . . . . . . . . . Tulsa, Okla. Bob Kalsu. . . . . . . . . . . T . . . . . . . . Del City, Okla. Granville Liggins . . . . NG . . . . . . . . . Tulsa, Okla. Carl McAdams* . . . . . .LB. . . . . White Deer, Texas Carl McAdams . . . . . . .LB. . . . . White Deer, Texas Ralph Neely* . . . . . . . . T . . . . . .Farmington, N.M. Jim Grisham* . . . . . . . .FB. . . . . . . . . Olney, Texas Ralph Neely . . . . . . . . . T . . . . . .Farmington, N.M. Leon Cross. . . . . . . . . . G . . . . . . . . . Hobbs, N.M. Wayne Lee. . . . . . . . . . C . . . . . . . . . . . Ada, Okla. Joe Don Looney. . . . . .HB . . . . Fort Worth, Texas Jerry Thompson . . . . . . G . . . . . . . . . . . Ada, Okla. Bob Harrison . . . . . . . . C . . . . . . Stamford, Texas Clendon Thomas* . . . .HB . .Oklahoma City, Okla. Bill Krisher* . . . . . . . . . G . . . . Midwest City, Okla. Jerry Tubbs*. . . . . . . . . C . . . Breckenridge, Texas Bill Krisher . . . . . . . . . . G . . . . Midwest City, Okla. Tommy McDonald . . . .HB . . . Albuquerque, N.M. Ed Gray . . . . . . . . . . . . G . . . . . . . .Odessa, Texas Bo Bolinger* . . . . . . . . . G . . . . . . Muskogee, Okla. Tommy McDonald . . . .HB . . . Albuquerque, N.M. Kurt Burris*. . . . . . . . . . C . . . . . . Muskogee, Okla. Max Boydston*. . . . . . . E . . . . . . Muskogee, Okla. J.D. Roberts* . . . . . . . . G . . . . . . . . . Dallas, Texas Tom Catlin . . . . . . . . . . C . . . . . .Ponca City, Okla. Eddie Crowder . . . . . . .QB . . . . . Muskogee, Okla. Billy Vessels* . . . . . . . .HB . . . . . Cleveland, Okla. Buck McPhaiL . . . . . . .FB. . .Oklahoma City, Okla. Jim Weatherall* . . . . . . T . . . . . White Deer, Texas Tom Catlin . . . . . . . . . . C . . . . . .Ponca City, Okla. Leon Heath* . . . . . . . . .FB. . . . . . . . . . Hollis, Okla. Jim Weatherall* . . . . . . T . . . . . White Deer, Texas Buddy Jones . . . . . . . . S . . . . . Holdenville, Okla. Frankie Anderson. . . . . E . . .Oklahoma City, Okla. Wade Walker . . . . . . . . T . . . . . . . .Gastonia, N.C. Stanley West . . . . . . . . G . . . . . . . . . . .Enid, Okla. Darrell Royal . . . . . . . .QB . . . . . . . . . Hollis, Okla. Jim Owens . . . . . . . . . . E . . .Oklahoma City, Okla. George Thomas . . . . . .HB . . . . . . .Fairland, Okla. Buddy Burris* . . . . . . . . G . . . . . . Muskogee, Okla. Jack Mitchell . . . . . . . .QB . . . Arkansas City, Kan. Buddy Burris . . . . . . . . G . . . . . . Muskogee, Okla. Buddy Burris . . . . . . . . G . . . . . . Muskogee, Okla. Plato Andros. . . . . . . . . G . . .Oklahoma City, Okla. John Rapacz . . . . . . . . C . . . . . Kalamazoo, Mich. Frank “Pop” Ivy . . . . . . E . . . . . . . Skiatook, Okla. Gilford Duggan. . . . . . . T . . . . . . .Bentonville, Ark. Roland “Waddy” Young* E . . . . . .Ponca City, Okla. Pete Smith . . . . . . . . . . E . . . . . . Muskogee, Okla. J.W. “Dub” Wheeler . . . T . . . . . . . . . .Davis, Okla. Cassius Gentry . . . . . . T . . . . . . . . Lawton, Okla. Granville Norris . . . . . . T . . . . . . . .Laverne, Okla. Phil White. . . . . . . . . . .HB . .Oklahoma City, Okla. Roy “Soupy” Smoot . . . T . . . . . . . . Lawton, Okla. Forest “Spot” Geyer . . .FB. . . . . . . . Norman, Okla. Claude Reeds . . . . . . .FB. . . . . . . . Norman, Okla.

* Asterisks denote consensus All-Americans

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

THREE-TIME ALL-AMERICANS Rod Shoate. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1972-74 Buddy Burris. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1946-48 TWO-TIME ALL-AMERICANS Jammal Brown . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003-04 Mark Clayton . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2003-04 Tommie Harris . . . . . . . . . . . . . . . . . . . . . . . . . . . 2002-03 Teddy Lehman . . . . . . . . . . . . . . . . . . . . . . . . . . . 2002-03 Rocky Calmus . . . . . . . . . . . . . . . . . . . . . . . . . . . 2000-01 Anthony Phillips . . . . . . . . . . . . . . . . . . . . . . . . 1986, 1988 Keith Jackson . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1986-87 Mark Hutson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1986-87 Brian Bosworth . . . . . . . . . . . . . . . . . . . . . . . . . . . 1985-86 Tony Casillas . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1984-85 Rick Bryan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1982-83 Terry Crouch. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1980-81 Billy Sims . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1978-79 George Cumby . . . . . . . . . . . . . . . . . . . . . . . . . 1977, 1979 Reggie Kinlaw. . . . . . . . . . . . . . . . . . . . . . . . . . . . 1977-78 Daryl Hunt. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1977-78 Greg Roberts . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1977-78 Zac Henderson. . . . . . . . . . . . . . . . . . . . . . . . . . . 1976-77 Mike Vaughan. . . . . . . . . . . . . . . . . . . . . . . . . . . . 1975-76 Joe Washington . . . . . . . . . . . . . . . . . . . . . . . . . . . 1974-75 Dewey Selmon . . . . . . . . . . . . . . . . . . . . . . . . . . . 1974-75 Lee Roy Selmon. . . . . . . . . . . . . . . . . . . . . . . . . . 1974-75 Tinker Owens . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1974-75 Tom Brahaney . . . . . . . . . . . . . . . . . . . . . . . . . . . 1971-72 Greg Pruitt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1971-72 Steve Owens . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1968-69 Granville Liggins. . . . . . . . . . . . . . . . . . . . . . . . . . 1966-67 Carl McAdams . . . . . . . . . . . . . . . . . . . . . . . . . . . 1964-65 Ralph Neely . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1963-64 Bill Krisher . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1956-57 Tommy McDonald. . . . . . . . . . . . . . . . . . . . . . . . . 1955-56 Tom Catlin. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1951-52 Jim Weatherall . . . . . . . . . . . . . . . . . . . . . . . . . . . 1950-51


ALL-AMERICANS UNDER STOOPS A two-time finalist for the Rimington Award as the nation’s top center, Vince Carter was a four-year fixture at Oklahoma. He was rewarded as a senior when he was named to the presitgious Walter Camp All-America team.

Dan Cody was so destructive as a senior that OU coaches devised a special position for him. Cody, at times, stood up from his defensive end spot to play a spinner role. In that capacity, he roamed the defensive front and menaced opposing offenses. At season’s end, he had the top sack total in the Big 12 with 10 and a spot on the FWAA’s All-America team. Cody was a two-time finalist for the Hendricks Award who was noted for his all-out effort. At Texas A&M, he blacked out while exhorting teammates, then returned to the game.

The Waco, Texas, native stepped in as a freshman when Josh Smith went out with an injury in 2001 and went on to start at center for the Sooners for four seasons. He earned first team All-Big 12 Conference honors in 2003 and 2004. As a senior in 2004, Carter helped pave the way for running back Adrian Peterson and protected quarterback Jason White -- both Heisman Trophy finalists -- as the Sooners completed a second consecutive undefeated regular season and won the 2004 Big 12 Conference Championship. As a junior in 2003, Carter finished with 118 knockdowns and one sack allowed. He did not start the first game of the season due to an injury, but then started the last 13.

Cody also led the team in sacks in 2003 with 10 including three in Oklahoma’s 52-9 rout of in-state rival Oklahoma State. The Ada, Okla., native led the team in tackles for loss with 17 (-93 yards) and was No. 3 on the team in quarterback hurries with 17. He earned second team Academic All-Big 12.

2004 & 2003 * ALL-AMERICAN * JAMMAL BROWN * OT

The best season ever by a freshman? The argument could be made. Adrian Peterson set an NCAA freshman rushing record for most rushing yards with the third-highest figure in the nation for the season. He also eclipsed the OU standard for most rushing yards in a season.

A dominating senior season led to Jammal Brown earning Oklahoma’s fourth Outland Trophy. He followed that up as a first-round pick (No. 13) by the New Orleans Saints. He did not allow a sack or hurry during the regular season while logging a team-best 130 knockdown blocks. At season’s end Brown was a consensus All-American.

Peterson broke three NCAA freshman rushing records: most consecutive 100-yard rushing games (9), most total 100-yard rushing games (11) and most rushing attempts by a freshman with 314. Year 2004

Rushes 339

Yards 1,925

Avg 5.7

TD 15

Year 2004

Receptions 5

Yards 12

TD 0

Long 6

Long 80

As a junior, Brown had the highest line grade in a year when the offense had one of the most productive seasons in school history. The performance landed the Lawton native on the American Football Coaches Association’s first team All-America squad. Brown had 127 knockdowns and ran his string of consecutive starts to 28 during the season. The Sooners posted their highest scoring total ever with 601 points. By allowing just one sack, Brown also proved a key protector for Heisman winner Jason White. As a junior in 2003, Brown had the highest season grade among Oklahoma’s offensive linemen and finished with a team-high 127 knockdown blocks and just one sack allowed. Brown’s athleticism and speed for a 313-pounder were on display in OU’s win over UCLA when he ran down Bruin linebacker Spencer Havner to make a touchdown-saving tackle at the end of a 72-yard interception return.

OKLAHOM A HISTORY

Peterson’s durability was surprising for a freshman. He led the nation with 339 rushing attempts and went over 100 yards in 11 of 13 games, including his debut. A thundering power back, he also had eight bursts of 35 yards or longer and 44 of 10 or more.

INT FC-FR PBU 0-0 0-1 0 0-0 0-0 1 0-0 0-1 2 0-0 2-0 0 0-0 0-2 0 0-0 2-2 5

REVIEW & OPPONENTS

2004 * ALL-AMERICAN * ADRIAN PETERSON * RB

On the awards circuit, Peterson had the highest finish ever by a freshman in the Heisman voting (second) and was the first freshman to be named a finalist for the Doak Walker Award. He was a consensus All-American.

Sacks 2-13 0-0 3-18 10-65 10-66 25-162

THE SOONERS

As a sophomore in 2002, Carter helped open holes for OU’s first 1,000yard rusher (Quentin Griffin) since Bob Stoops became the head coach. As a freshman in 2001, Carter started the last nine regular season games and the Cotton Bowl at center. He was named to The Sporting News AllAmerica second team.

Year UT AT Total TFL 2000 3 8 11 2-13 2001* 1 4 5 0-0 2002 8 8 16 5-20 2003 24 39 63 17-93 2004 25 17 42 17-83 Totals 61 76 137 41-209 * Medical redshirt after first game

COACHING STAFF

2004 * ALL-AMERICAN * DAN CODY * DE

2 0 0 5 S EAS ON

2004 * ALL-AMERICAN * VINCE CARTER * C

175 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

ALL-AMERICANS UNDER STOOPS

176

2004 & 2003 * ALL-AMERICAN * MARK CLAYTON * WR

2003 * ALL-AMERICAN * ANTONIO PERKINS * RS

Noted as one of the great stories of progress in OU history, Mark Clayton went from struggling to bench press 135 pounds in his first workout to twice being named an All-American. By the time his career was over, he held virtually every Sooner receiving record and was widely regarded as the best to ever play the position at the school.

Antonio Perkins became the nation’s most feared punt returner by re-writing the NCAA record book during his junior season. He set an NCAA mark with four returns for touchdowns on the season, including an NCAA record three against UCLA.

After a wildly successful junior season, Clayton’s numbers dipped somewhat as a senior, but that was attributable to an improved runnin`g game and a deeper receiving corps. He still led OU in receptions and yards and was named the the AFCA All-America team. Moreover, when punt returner Antonio Perkins was injured, Clayton added that role and took back one for a touchdown at OSU. As a junior, Clayton built a reputation as perhaps the most elusive receiver in the nation with 533 yards after catch (YAC). He set OU standards with 83 receptions for 1,425 yards and broke the school mark for receiving yards in a game with 190 against Texas. Year 2001 2002 2003 2004 Total

Rec 46 26 83 66 221

Yards 524 416 1,425 876 3,241

TD 3 5 15 8 31

Avg 11.4 16.0 17.2 13.3 14.7

Long 48 54 59 61 61

He also set an NCAA mark with 277 punt return yards against the Bruins. His other touchdown return, which tied the NCAA career mark at seven, came against Missouri. The returns were spectacular too, with lengths of 84, 74 and 65 against UCLA and 65 against Missouri. Perkins, who also started every game at cornerback and had two interceptions on the season, finished No. 20 in the nation in return average, but that figure was diluted by the fact that his 53 attempts out-distanced the rest of the country’s returners by at least eight. Year 2002 2003 2004 Totals

PR 43 53 17 113

Yds 643 642 156 1,441

Avg 15.0 12.1 9.2 12.8

TD 3 4 1 8

2003 * ALL-AMERICAN * DERRICK STRAIT * CB

2003 * ALL-AMERICAN * JASON WHITE * QB

Derrick Strait duplicated former OU great Roy Williams by winning the Nagurski (best defensive player) and Thorpe (best defensive back) Awards in 2003. Strait earned consensus All-American and All-Big 12 honors as a senior. He was named AP Big 12 Defensive Player of the Year.

From two reconstructive knee surgeries in successive years to consensus All-American. That was the out-of-the-blue story for Jason White, who wasn’t even announced as the team’s starter until the summer before the 2003 season. He posted mind-boggling numbers, the most impressive of which were the 40 touchdowns and just 10 interceptions.

Strait set school records for starts (53), career interception return yards (397) and passes broken up (53). The Austin native ignited Oklahoma’s 65-13 win over Texas in 2003 with a season-high 11 tackles, an interception, a 30-yard return, two fumble recoveries and three pass deflections against the Longhorns. Strait was a Thorpe Award semifinalist and consensus first team All-Big 12 selection in 2002. He started every game at corner and tied for the OU lead with six interceptions. He contributed immediately as a redshirt freshman and was named Big 12 Conference Defensive Newcomer of the Year in Oklahoma’s 2000 National Championship season. Year 2000 2001 2002 2003 Totals

UT na na 50 58 na

AT na na 18 22 na

TOT 65 57 68 80 270

TFL 5-27 3-4 1-2 7-19 16-52

INT 2-32 3-63 6-175 3-127 14-397

PBU 15 15 13 12 55

FC-FR 2-0 0-0 3-1 2-5 7-6

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

White proved particularly adept at completing the long ball and set a school season record with 17 hookups of 40 or more yards. He completed 50 percent or more of his passes in all but two games and was over 60 percent nine times, including 16-of-21 against Texas and 16-of-18 vs. Texas A&M. He fired five TD strikes against both Iowa State and A&M and had a career-high 394 passing yards against Texas Tech. Year 1999* 2000 2001 2002* 2003 2004 Totals

Comp. 1 0 73 20 278 255 627

Att. 2 0 113 34 451 390 990

Yards 9 0 681 181 3,846 3,205 7,922

TD 0 0 5 1 40 35 81

* Granted extra year of eligibility after early season injury

Int. 0 0 3 2 10 9 24

Pct. .500 0 .646 .588 .616 .654 .628


ALL-AMERICANS UNDER STOOPS Tommie Harris rose to the pinnacle of his position in his junior season, which would be his last at OU. He departed for the NFL after just three years in Norman. As a junior, he continued to rocket into opposing backfields with his uncanny quickness. Harris had 10 tackles for loss and 19 quarterback hurries.

Determining the greatest linebacker in OU history is a tough chore. With Teddy Lehman in the mix, determining the fastest is much easier. That speed, which made him an outstanding high school sprinter, set the Sooner backer apart from his peers. He capped a brilliant career by winning the Butkus and Bednarik Awards after finishing as a finalist for each just one year earlier. His ability to get from sideline to sideline caught a lot of attention ... and ball carriers. As a senior, he had 117 tackles, including 19 for 47 yards in losses.

After finishing as a finalist for the Lombardi Award one year earlier, he won the coveted piece of hardware in his final Sooner season. He also was one of four finalists for the Nagurski Award, which went to teammate Derrick Strait. Harris’ sophomore season was impressive despite an injury. Slowed all by a groin pull suffered in August, Harris still faced regular double teams. He was named to three All-America squads and was named a finalist for the Bednarik Award. He was the 14th overall selection in the 2004 draft by the Chicago Bears. UT 19 13 19 51

AT 15 12 18 45

TOT 34 25 37 96

TFL 18-47 6-11 10-39 34-97

Sacks 2-15 2-8 5-24 9-47

PBU 1 2 1 4

FC-FR 0-0 0-1 1-1 1-2

Year UT 2000 7 2001 59 2002 85 2003 63 Totals 214

AT 4 30 27 54 115

TOT 11 89 112 117 329

TFL 3-10 13-41 17-47 19-47 52-145

Sacks 0-0 3-17 2-17 2-6 7-40

INT PBU FC-FR 0 0 0-0 1-2 4 0-3 2-51 7 1-2 1-0 6 1-0 4-53 17 2-5

Free safety Brandon Everage earned All-America honors after a stellar junior campaign in 2002.

Most punters are known for the length and/or the accuracy of their kicks. Jeff Ferguson was outstanding in both areas. But Ferguson separated himself with athletic ability and intelligent play that made him the complete player at his position. He ended his career as the school record holder for punting average in a career and became just the second player in school history to average more than 40 yards in each of his four seasons. The length of the kicks did not come at the expense of accuracy. Twenty-one of his 71 senior season punts were downed inside the 20-yard line. The thunderous punts and the balls that trickled dead deep in enemy territory will be secondary as time remembers Ferguson’s career, though. In his junior season, he made a brilliant play in the national championship game against Florida State, turning a bad snap into a safety rather than an opportunity for the Seminoles to get back into the game.

Six interceptions, with 107 yards in returns, would indicate that Everage understood the centerfield nature of his position. The 94 tackles, thirdhighest on the team, speak to the linebacker-like mentality with which the Oklahoma free safety played. It was that combination of abilities that landed Everage on the All-America rolls. Everage recorded 60 tackles in 2003 (44 solo) including four for loss and one sack. He also nabbed one interception with four passes broken up. Year 2000 2001 2002 2003 Totals

UT 27 54 65 44 190

AT 28 22 29 16 95

TOT 55 76 94 60 285

TFL 3-3 3-9 4-32 4-5 14-49

Sacks 0-0 1-6 3-29 1-1 5-36

INT 2-0 1-0 6-107 1-11 10-118

PBU FC-FR 9 1-1 4 3-0 11 1-0 4 0-0 28 5-1

Year 1998 1999 2000 2001 Totals

No. 61 55 56 80 252

Yds 2,529 2,302 2,437 3,438 10,706

Avg 41.5 41.9 43.5 42.9 42.5

Long 72 73 66 71 73

TB 5 18 8 8 39

FC 6 8 2 2 18

I20 17 19 14 21 71

50+ 10 11 12 20 53

OKLAHOM A HISTORY

2001 * ALL-AMERICAN * JEFF FERGUSON * P

REVIEW & OPPONENTS

2002 * ALL-AMERICAN * BRANDON EVERAGE * FS

THE SOONERS

Year 2001 2002 2003 Totals

As a junior, Lehman logged 112 tackles, including 17 for loss. He also had two interceptions, which went for 51 yards in returns, including one that set up the go-ahead touchdown against Texas. His one-yard return against Texas as a sophomore, the one that came on the back end of a play that saw Roy Williams leap a blocker to disrupt Longhorn QB Chris Simms, is one of the most memorable plays in school history. He was picked in the second round of the 2004 draft by the Detroit Lions.

COACHING STAFF

2003 & 2002 * ALL-AMERICAN * TEDDY LEHMAN * LB

2 0 0 5 S EAS ON

2003 & 2002 * ALL-AMERICAN * TOMMIE HARRIS * DT

177 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

ALL-AMERICANS UNDER STOOPS 2001 * ALL-AMERICAN * ROY WILLIAMS * SS

2001 & 2000 * ALL-AMERICAN * ROCKY CALMUS * LB

By the time his career was over, Roy Williams was more feared by offensive opponents and more respected by his defensive peers than any player in the country.

Only a few players define their position, but that is precisely what Rocky Calmus meant to college football. As a senior, he won the Dick Butkus Award as the nation’s top linebacker, but also was a finalist for the Nagurski and Bednarik Awards as the nation’s best defender and the Lombardi Award as the country’s top interior player. His senior year total of 117 tackles vaulted him into Oklahoma’s top five career tacklers and capped an incredible career.

In his final season at Oklahoma, he won the Nagurski Award as the nation’s top defender and the Thorpe Award as the nation’s top defensive back. He was No. 7 in the Heisman Trophy voting, the highest finish of the year by a non-quarterback. Williams bypassed his senior season of eligibility to enter the NFL draft, but still left his mark on the OU record book. He was drafted in the first round (No. 8 pick overall) in the 2002 NFL Draft by the Dallas Cowboys. Year 1999 2000 2001 Totals

UT 57 58 73 188

AT 18 35 28 81

TOT 81 99 107 287

T-Loss 7-25 13-47 14-57 34-129

INT 2 2 5 9

FC-FR 1-0 0-2 0-3 1-5

PBU 12 10 22 44

As a junior, he was named the toughest player in college football by The Sporting News during the Sooners’ 2000 national championship season. OU’s all-time leader in tackles for a loss by a linebacker, Calmus was named Big 12 Defensive Player of the Year by the Associated Press and was a finalist for the Butkus Award. A first-team All-Big 12 selection in each of his last three seasons, Calmus led the squad in tackles in each of those years. He was drafted in the third round of the 2002 draft by the Tennessee Titans. Year 1998 1999 2000 2001 Totals

UT 30 76 64 72 242

AT 25 38 61 45 169

TOT 55 120 128 128 431

TFL 11-38 14-29 17-61 15-48 57-176

INT 0 1 1 1 3

FC-FR 2-0 0-1 2-3 0-3 4-6

2000 * ALL-AMERICAN * JOSH HEUPEL * QB

2000 * ALL-AMERICAN * J.T. THATCHER * FS/PR/KR

The runner-up for the 2000 Heisman Trophy, Josh Heupel became Oklahoma ’s first consensus All-America quarterback and the first Sooner QB to earn All-America honors since Jack Mildren in 1971.

A standout on both defense and special teams, J.T. Thatcher was named an All-American as both a defensive back and returner. The Mosi Tatupu Special Teams Player of the Year Award winner, Thatcher was one of only seven players to return two or more punts for a touchdown in 2000 and ranked ninth nationally in punt return average. A four-time Big 12 Special Teams Player of the Week selection, Thatcher set OU’s single-game (160) and single-season (599) records for punt return yards. He also posted the second-highest single-game kickoff return yard total with 150, including a 93-yard return to set up OU’s go-ahead touchdown against second-ranked Kansas State. Thatcher was a semifinalist for the Jim Thorpe Award and tied school records for interceptions in a game (3) and season (8).

As team captain his two years with the Sooners, Heupel is largely credited with turning an offense that statistically ranked as one of the worst in the nation before his arrival into one of the most explosive in the country. Heupel was named Associated Press Player of the Year, Walter Camp Player of the Year, The Sporting News Player of the Year, CBS Sports Player of the Year, Big 12 Player of the Year and Big 12 Offensive Player of the Year in 2000. The first-team all-conference selection guided OU to a school-record 13 wins and its seventh national championship. Heupel left with virtually every OU and numerous Big 12 passing records. Year 1999 2000 Totals

Att 47 70 117

Yds -98 144 46

Avg -2.8 2.1 0.4

TD 5 7 12

Att 553 472 1,025

Comp 349 305 654

Int Yds TD 16 3,850 33 15 3,606 20 31 7,456 53

178 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Year 1997 1999 2000 Totals

UT 0 5 39 44

AT 0 1 21 22

TOT 1 7 66 74

TFL 0-0 0-0 3-6 3-6

Year 1997 1999 2000 Totals

PR 0 4 43 47

Yds 0 146 634 780

Avg 0 36.5 14.7 16.6

TD 0 1 2 3

INT FC-FR 0 0-0 0 0-0 8 1-0 8 1-0 KR 1 0 11 11

Yds 16 0 264 264

Avg TD 16 0 0 0 20.1 0 20.1 0


ALL-CONFERENCE HONORS

2003

Rocky Calmus. . . . . . . . . . . . Linebacker Jeff Ferguson . . . . . . . . . . . . . . . Punter Tommie Harris. . . . . . . Defensive Tackle Frank Romero . . . . . . . Offensive Tackle Jimmy Wilkerson. . . . . . . Defensive End Roy Williams . . . . . . . . . . .Strong Safety

2000

Rocky Calmus. . . . . . . . . . . . Linebacker Jeff Ferguson . . . . . . . . . . . . . . . Punter Ryan Fisher. . . . . . . . . Defensive Tackle Quentin Griffin. . . . . . . . . Running Back Josh Heupel . . . . . . . . . . . .Quarterback Torrance Marshall . . . . . . . . . Linebacker Frank Romero . . . . . . . Offensive Tackle J.T. Thatcher . . . . . . . . . . . . Free Safety Roy Williams . . . . . . . . . . .Strong Safety

1999

Rocky Calmus. . . . . . . . . . . . Linebacker Stockar McDougle. . . . . . . . . Off. Tackle Kelly Gregg . . . . . . . . . Defensive Tackle

1997

Kelly Gregg . . . . . . . . . Defensive Tackle

1996

Tyrell Peters . . . . . . . . . . . . . Linebacker

BIG EIGHT CONFERENCE 1995 Stephen Alexander . . . . . . . . . Tight End Jeremy Alexander . . . . . . . . . . . . Kicker Cedric Jones . . . . . . . . . Defensive End 1994

Cedric Jones . . . . . . . . . Defensive End Darrius Johnson . . . . . . Defensive Back Scott Blanton. . . . . . . . . . . . . . . . Kicker

1992

Darnell Walker. . . . . . . . Defensive Back

1991

Reggie Barnes . . . . . . . . Defensive End Jason Belser . . . . . . . . . Defensive Back Joe Bowden . . . . . . . . . . . . Linebacker Brian Brauninger . . . . . Offensive Tackle Mike Gaddis . . . . . . . . . . Running Back

1982

Steve Williams . . . . . . Offensive Guard Paul Parker . . . . . . . . . Offensive Guard Marcus Dupree . . . . . . . . Running Back Kevin Murphy . . . . . . . . Defensive End Rick Bryan. . . . . . . . . Defensive Tackle Jackie Shipp . . . . . . . . . . . . Linebacker

1990

Adrian Cooper. . . . . . . . . . . . . Tight End Mike Sawatzky . . . . . . Offensive Guard Scott Evans. . . . . . . . . Defensive Tackle Joe Bowden . . . . . . . . . . . . . Linebacker Jason Belser . . . . . . . . . Defensive Back

1981

Lyndle Byford . . . . . . . Offensive Tackle Terry Crouch . . . . . . . . Offensive Guard Don Key . . . . . . . . . . . . . . . . .Off.Guard Stanley Wilson . . . . . . . . Running Back Rick Bryan. . . . . . . . . . . . . . . Def.Tackle

1989

Frank Blevins . . . . . . . . . . . Linebacker Scott Evans. . . . . . . . Defensive Tackle Dante Williams . . . . . . . . . . . Noseguard

1980

1988

Anthony Phillips . . . . . Offensive Guard Charles Thompson . . . . . . .Quarterback Scott Evans. . . . . . . . Defensive Tackle Scott Garl . . . . . . . . . . . Defensive Back Curtice Williams . . . . Defensive Tackle Tony Woods . . . . . . . . . . . . Noseguard

Forrest Valora . . . . . . . . . . . . Tight End Louis Oubre . . . . . . . . Offensive Tackle Terry Crouch . . . . . . . . Offensive Guard Richard Turner . . . . . Defensive Tackle

1979

1987

Mark Hutson . . . . . . . . Offensive Guard Keith Jackson . . . . . . . . . . . . Tight End Greg Johnson . . . . . . . Offensive Tackle Bob Latham. . . . . . . . . . . . . . . . . Center Anthony Phillips . . . . . Offensive Guard Rickey Dixon . . . . . . . . . Defensive Back Danté Jones . . . . . . . . . . . . Linebacker Darrell Reed . . . . . . . . . Defensive End David Vickers . . . . . . . . Defensive Back

Louis Oubre . . . . . . . . Offensive Tackle Paul Tabor. . . . . . . . . . . . . . . . . . Center Billy Sims . . . . . . . . . . . . Running Back John Goodman . . . . . Defensive Tackle George Cumby . . . . . . . . . . . Linebacker Darrol Ray. . . . . . . . . . . Defensive Back

1978

1986

Jamelle Holieway . . . . . . . Quarterback Anthony Phillips . . . . . Offensive Tackle Mark Hutson . . . . . . . . Offensive Guard Keith Jackson . . . . . . . . . . . . Tight End Tim Lashar . . . . . . . . . . . . . . . . . Kicker Brian Bosworth . . . . . . . . . . Linebacker Darrell Reed . . . . . . . . . Defensive End David Vickers . . . . . . . . Defensive Back Steve Bryan . . . . . . . Defensive Tackle Rickey Dixon . . . . . . . . . Defensive Back

Greg Roberts . . . . . . . Offensive Guard Thomas Lott . . . . . . . . . . . Quarterback Billy Sims . . . . . . . . . . . . Running Back Uwe von Schamann . . . . . . . . . . Kicker Reggie Mathis . . . . . . . . Defensive End Phil Tabor . . . . . . . . . Defensive Tackle Reggie Kinlaw . . . . . . . . . . . Noseguard Daryl Hunt . . . . . . . . . . . . . . Linebacker George Cumby . . . . . . . . . . Linebacker Darrol Ray. . . . . . . . . Defensive Tackle

1977

Karl Baldischwiler . . . . Offensive Tackle Greg Roberts . . . . . . . Offensive Guard Thomas Lott . . . . . . . . . . . Quarterback Reggie Kinlaw . . . . . . . . . . . Noseguard George Cumby . . . . . . . . . . Linebacker Daryl Hunt . . . . . . . . . . . . . . Linebacker Zac Henderson . . . . . . . Defensive Back

1976

Mike Vaughan . . . . . . . Offensive Tackle Daryl Hunt . . . . . . . . . . . . . . Linebacker Zac Henderson . . . . . . . Defensive Back Scott Hill . . . . . . . . . . . . Defensive Back

1975

Mike Vaughan . . . . . . . Offensive Tackle Terry Webb . . . . . . . . . Offensive Guard Joe Washington . . . . . . . Running Back Tony DiRienzo. . . . . . . . . . . . . . . Kicker Jimbo Elrod . . . . . . . . . . Defensive End Dewey Selmon . . . . . . . . Middle Guard Zac Henderson . . . . . . . Defensive Back Lee Roy Selmon . . . . . Defensive Tackle

1985

1984

Jamelle Holieway . . . . . . . Quarterback Anthony Phillips . . . . . Offensive Tackle Mark Hutson . . . . . . . . Offensive Guard Keith Jackson . . . . . . . . . . . . Tight End Darrell Reed . . . . . . . . . Defensive End Kevin Murphy . . . . . . . . Defensive End Tony Casillas. . . . . . . . . . . . Noseguard Brian Bosworth . . . . . . . . . . Linebacker Danny Bradley . . . . . . . . . Quarterback Darrell Reed . . . . . . . . . Defensive End Tony Casillas. . . . . . . . . . . . Noseguard Brian Bosworth . . . . . . . . . . Linebacker

OKLAHOM A HISTORY

1998

Chuck Thomas . . . . . . . . . . . . . . Center Kevin Murphy . . . . . . . . . Defensive End Rick Bryan. . . . . . . . . Defensive Tackle Jackie Shipp . . . . . . . . . . . . Linebacker Scott Case . . . . . . . . . . Defensive Back

REVIEW & OPPONENTS

2001

1983

THE SOONERS

Jammal Brown . . . . . . Offensive Tackle Brandon Everage . . . . . . . . Free Safety Quentin Griffin. . . . . . . . . Running Back Tommie Harris. . . . . . . Defensive Tackle Teddy Lehman . . . . . . . . . . . Linebacker Trent Smith . . . . . . . . . . . . . . . Tight End Derrick Strait . . . . . . . . . . . . Cornerback

Aubrey Beavers . . . . . . . . . Linebacker Rickey Brady. . . . . . . . . . . . . . Tight End Mario Freeman . . . . . . . . . . Linebacker Cale Gundy . . . . . . . . . . . . Quarterback

COACHING STAFF

2002

Jammal Brown . . . . . . Offensive Tackle Vince Carter . . . . . . . . . . . . . . . . Center Mark Clayton. . . . . . . . . . Wide Receiver Dan Cody . . . . . . . . . . . . Defensive End Trey DiCarlo . . . . . . . . . . . . . . . . .Kicker Dusty Dvoracek. . . . . . Defensive Tackle Tommie Harris. . . . . . . Defensive Tackle Teddy Lehman . . . . . . . . . . . Linebacker Antonio Perkins. . . . . . Return Specialist Derrick Strait . . . . . . . . . . . . Cornerback Jason White . . . . . . . . . . . .Quarterback

1993

2 0 0 5 S EAS ON

BIG 12 CONFERENCE 2004 Jammal Brown . . . . . . Offensive Tackle Vince Carter . . . . . . . . . . . . . . . . Center Mark Clayton. . . . . . . . . . Wide Receiver Dan Cody . . . . . . . . . . . . Defensive End Jonthan Jackson . . . . . . . Defensive End Lance Mitchell . . . . . . . . . . . Linebacker Donte Nicholson . . . . . . . . . . . . . Safety Adrian Peterson . . . . . . . Running Back Brodney Pool . . . . . . . . . . . . . . . Safety Jason White . . . . . . . . . . . .Quarterback

179 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

ALL-CONFERENCE HONORS 1974

1973

1972

1971

1970

1969

Wayne Hoffman . . . . . . . . . . Tight End Tinker Owens . . . . . . . . . . . . . Split End Jerry Arnold. . . . . . . . . Offensive Tackle John Roush. . . . . . . . . Offensive Guard Terry Webb . . . . . . . . . Offensive Guard Joe Washington . . . . . . . Running Back Jimbo Elrod . . . . . . . . . . Defensive End Dewey Selmon . . . . . . . . . . Def. Tackle Lee Roy Selmon . . . . . . . . . Def. Tackle Rod Shoate . . . . . . . . . . . . . Linebacker Randy Hughes . . . . . . . Defensive Back Ed Foster . . . . . . . . . . . . . Right Tackle John Roush. . . . . . . . . Offensive Guard Joe Washington . . . . . . . Running Back Gary Baccus . . . . . . . . . Defensive End Lucious Selmon . . . . . . . . . Def. Tackle Rod Shoate . . . . . . . . . . . . . Linebacker Randy Hughes . . . . . . . Defensive Back Dean Unruh. . . . . . . . . Offensive Tackle Tom Brahaney. . . . . . . . . . . . . . . Center Greg Pruitt. . . . . . . . . . . . Running Back Leon Crosswhite . . . . . . . . . . . Fullback Derland Moore . . . . . . . . . . Def. Tackle Lucious Selmon . . . . . . . . . .Def. Tackle Raymond Hamilton . . . . . . . Def. Tackle Rod Shoate . . . . . . . . . . . . . Linebacker Albert Chandler . . . . . . . . . . . Tight End Ken Jones . . . . . . . . . . Offensive Guard Tom Brahaney. . . . . . . . . . . . . . . Center Jack Mildren . . . . . . . . . . . Quarterback Greg Pruitt. . . . . . . . . . . . Running Back Raymond Hamilton . . . . . . . . . Def. End Derland Moore . . . . . . . . . . Def. Tackle Steve Aycock . . . . . . . . . . . Linebacker John Shelley . . . . . . . . . Defensive Back Joe Wylie . . . . . . . . . . . . Running Back Steve Aycock . . . . . . . . . . . Linebacker Monty Johnson . . . . . . . Defensive Back Steve Zabel. . . . . . . . . . . . . . Tight End Ken Mendenhall . . . . . . . . . . Off. Guard Bill Elfstrom . . . . . . . . . Offensive Guard Steve Owens. . . . . . . . . . Running Back

1968

Steve Zabel. . . . . . . . . . . . . . Tight End Ken Mendenhall . . . . . . . . . . Off. Guard Steve Owens. . . . . . . . . . Running Back Eddie Hinton . . . . . . . . . . . . . Wingback Steve Barrett . . . . . . . . . Defensive Back

1967

Bob Kalsu . . . . . . . . . . Offensive Tackle Steve Owens. . . . . . . . . . Running Back Bob Warmack . . . . . . . . . . Quarterback John Koller . . . . . . . . . . Defensive End Granville Liggins . . . . . . . . . Noseguard

1966

1965

Ben Hart . . . . . . . . . . . . . . . . . Split End Ed Hall . . . . . . . . . . . . Offensive Tackle Eugene Ross . . . . . . . . . . . Linebacker Carl McAdams . . . . . . . . . . Linebacker

1964

Ralph Neely . . . . . . . . . . . . . . . . Tackle Newt Burton . . . . . . . . . . . . . . . . .Guard Jim Grisham . . . . . . . . . . . . . . . . . Back Carl McAdams . . . . . . . . . . . Linebacker

1963

John Flynn . . . . . . . . . . . . . . . . . . . End Ralph Neely . . . . . . . . . . . . . . . . Tackle Newt Burton . . . . . . . . . . . . . . . . Guard Jim Grisham . . . . . . . . . . . . . . . . . Back

1962

Leon Cross . . . . . . . . . . . . . . . . . .Guard Dennis Ward . . . . . . . . . . . . . . . . Tackle Wayne Lee . . . . . . . . . . . . . . . . . Center Jim Grisham . . . . . . . . . . . . . . . . . .Back Joe Don Looney . . . . . . . . . . . . . . Back

1961

Billy White . . . . . . . . . . . . . . . . . . Tackle

1960

Billy White . . . . . . . . . . . . . . . . . . Tackle

1959

Jerry Thompson . . . . . . . . . . . . . .Guard Bobby Boyd. . . . . . . . . . . . . . . . . . .Back Prentice Gautt . . . . . . . . . . . . . . . . .Back

1958

Ross Coyle . . . . . . . . . . . . . . . . . . . End Steve Jennings . . . . . . . . . . . . . . Tackle Gilmer Lewis . . . . . . . . . . . . . . . . Tackle Dick Corbitt . . . . . . . . . . . . . . . . . .Guard Bob Harrison . . . . . . . . . . . . . . . . Center Prentice Gautt . . . . . . . . . . . . . . . . .Back

BIG SEVEN CONFERENCE 1957 Don Stiller . . . . . . . . . . . . . . . . . . . . End Ross Coyle . . . . . . . . . . . . . . . . . . . End Bob Harrison . . . . . . . . . . . . . . . . Tackle Bill Krisher. . . . . . . . . . . . . . . . . . .Guard Clendon Thomas. . . . . . . . . . . . . . .Back 1956

1955

1954

1953

John Bell . . . . . . . . . . . . . . . . . . . . . End Ed Gray. . . . . . . . . . . . . . . . . . . . Tackle Tom Emerson . . . . . . . . . . . . . . . Tackle Bill Krisher. . . . . . . . . . . . . . . . . . .Guard Jerry Tubbs . . . . . . . . . . . . . . . . . Center Tommy McDonald . . . . . . . . . . . . . .Back Clendon Thomas. . . . . . . . . . . . . . .Back Ed Gray. . . . . . . . . . . . . . . . . . . . Tackle Cal Woodworth . . . . . . . . . . . . . . Tackle Bo Bolinger . . . . . . . . . . . . . . . . . .Guard Cecil Morris . . . . . . . . . . . . . . . . . .Guard Jerry Tubbs . . . . . . . . . . . . . . . . . Center Tommy McDonald . . . . . . . . . . . . . .Back Bob Burris . . . . . . . . . . . . . . . . . . . .Back Max Boydston . . . . . . . . . . . . . . . . . End Carl Allison . . . . . . . . . . . . . . . . . . . End Bo Bolinger . . . . . . . . . . . . . . . . . .Guard Kurt Burris . . . . . . . . . . . . . . . . . . Center Buddy Leake . . . . . . . . . . . . . . . . . .Back Gene Calame . . . . . . . . . . . . . . . . .Back Max Boydston . . . . . . . . . . . . . . . . . End Roger Nelson . . . . . . . . . . . . . . . Tackle J.D. Roberts . . . . . . . . . . . . . . . . .Guard Kurt Burris . . . . . . . . . . . . . . . . . . Center Gene Calame . . . . . . . . . . . . . . . . .Back Larry Grigg . . . . . . . . . . . . . . . . . . .Back

180 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

1952

Max Boydston . . . . . . . . . . . . . . . . . End Ed Rowland. . . . . . . . . . . . . . . . . Tackle Jim Davis . . . . . . . . . . . . . . . . . . Tackle J.D. Roberts . . . . . . . . . . . . . . . . .Guard Tom Catlin . . . . . . . . . . . . . . . . . . Center Eddie Crowder . . . . . . . . . . . . . . . .Back Billy Vessels . . . . . . . . . . . . . . . . . .Back Buck McPhail . . . . . . . . . . . . . . . . Back

1951

Art James . . . . . . . . . . . . . . . . . . Tackle Jim Weatherall . . . . . . . . . . . . . . Tackle Roger Nelson . . . . . . . . . . . . . . . .Guard Bert Clark . . . . . . . . . . . . . . . . . . .Guard Fred Smith . . . . . . . . . . . . . . . . . .Guard Tom Catlin . . . . . . . . . . . . . . . . . . Center Eddie Crowder . . . . . . . . . . . . . . . .Back Larry Grigg . . . . . . . . . . . . . . . . . . .Back Buck McPhail . . . . . . . . . . . . . . . . .Back

1950

Frankie Anderson . . . . . . . . . . . . . . End Jim Weatherall . . . . . . . . . . . . . . Tackle Norman McNabb. . . . . . . . . . . . . .Guard Harry Moore . . . . . . . . . . . . . . . . Center Tom Catlin . . . . . . . . . . . . . . . . . . Center Claude Arnold . . . . . . . . . . . . . . . . .Back Billy Vessels . . . . . . . . . . . . . . . . . .Back Leon Heath . . . . . . . . . . . . . . . . . . .Back

1949

Jim Owens . . . . . . . . . . . . . . . . . . . End Wade Walker. . . . . . . . . . . . . . . . Tackle Stan West . . . . . . . . . . . . . . . . . . .Guard Darrell Royal . . . . . . . . . . . . . . . . . .Back George Thomas . . . . . . . . . . . . . . .Back

1948

Jim Owens . . . . . . . . . . . . . . . . . . . End Wade Walker. . . . . . . . . . . . . . . . Tackle Homer Paine . . . . . . . . . . . . . . . . Tackle Buddy Burris . . . . . . . . . . . . . . . . .Guard Jack Mitchell . . . . . . . . . . . . . . . . . .Back George Thomas . . . . . . . . . . . . . . .Back

BIG SIX CONFERENCE 1947 Jim Tyree . . . . . . . . . . . . . . . . . . . . End Wade Walker. . . . . . . . . . . . . . . . Tackle Buddy Burris . . . . . . . . . . . . . . . . .Guard John Rapacz . . . . . . . . . . . . . . . . Center Jack Mitchell . . . . . . . . . . . . . . . . . .Back 1946

Warren Geise . . . . . . . . . . . . . . . . . End Homer Paine . . . . . . . . . . . . . . . . Tackle Wade Walker. . . . . . . . . . . . . . . . Tackle Buddy Burris . . . . . . . . . . . . . . . . .Guard Plato Andros . . . . . . . . . . . . . . . . .Guard John Rapacz . . . . . . . . . . . . . . . . Center Joe Golding. . . . . . . . . . . . . . . . . . .Back

1945

Omer Burgert . . . . . . . . . . . . . . . . . End Thomas Tallchief . . . . . . . . . . . . . Tackle Lester Jensen . . . . . . . . . . . . . . . .Guard John West . . . . . . . . . . . . . . . . . . . .Back Jack Venable. . . . . . . . . . . . . . . . . .Back

1944

W.G. Wooten. . . . . . . . . . . . . . . . . . End John Harley. . . . . . . . . . . . . . . . . Tackle Bob MayďŹ eld . . . . . . . . . . . . . . . . Center Merle Dinkins . . . . . . . . . . . . . . . . . End


ALL-CONFERENCE HONORS 1943

1926

Roy LeCrone. . . . . . . . . . . . . . . . . . End Pollack Wallace. . . . . . . . . . . . . . Center Frank Potts . . . . . . . . . . . . . . . . . . .Back

W.G. Lamb . . . . . . . . . . . . . . . . . . . End Homer Simmons . . . . . . . . . . . . . Tackle Clare Morford . . . . . . . . . . . . . . . .Guard Jack Marsee . . . . . . . . . . . . . . . . Center William Campbell . . . . . . . . . . . . . .Back Huel Hamm . . . . . . . . . . . . . . . . . . .Back

1924

Obie Briston . . . . . . . . . . . . . . . . . .Back

1923

King Price . . . . . . . . . . . . . . . . . . . . End

1922

Howard Marsh. . . . . . . . . . . . . . . . . End

1921

Howard Marsh. . . . . . . . . . . . . . . . . End

1920

Howard Marsh. . . . . . . . . . . . . . . . . End Roy Smoot . . . . . . . . . . . . . . . . . Tackle Bill McKinley . . . . . . . . . . . . . . . . .Guard Harry Hill . . . . . . . . . . . . . . . . . . . . .Back Sol Swatek . . . . . . . . . . . . . . . . . . .Back

Roger Eason . . . . . . . . . . . . . . . . Tackle Jack Jacobs . . . . . . . . . . . . . . . . . .Back

1940

Bill Jennings . . . . . . . . . . . . . . . . . . End Roger Eason . . . . . . . . . . . . . . . . Tackle Harold Lahar . . . . . . . . . . . . . . . . .Guard John Martin . . . . . . . . . . . . . . . . . . .Back

1939

Frank Ivy . . . . . . . . . . . . . . . . . . . . . End Gilford Duggan . . . . . . . . . . . . . . Tackle Justin Bowers . . . . . . . . . . . . . . . Tackle Beryl Clark . . . . . . . . . . . . . . . . . . .Back Robert Seymour . . . . . . . . . . . . . . .Back

1938

Waddy Young . . . . . . . . . . . . . . . . . End Gilford Duggan . . . . . . . . . . . . . . Tackle Hugh McCullough . . . . . . . . . . . . . .Back Earl Crowder . . . . . . . . . . . . . . . . . .Back

1937

Pete Smith . . . . . . . . . . . . . . . . . . . End Waddy Young . . . . . . . . . . . . . . . . . End Mickey Parks. . . . . . . . . . . . . . . . Center Jack Baer . . . . . . . . . . . . . . . . . . . Back

1935

Dub Wheeler . . . . . . . . . . . . . . . . Tackle Ralph Brown . . . . . . . . . . . . . . . . Tackle Nick Robertson . . . . . . . . . . . . . . . .Back Bill Breedon. . . . . . . . . . . . . . . . . . .Back

1934

Dub Wheeler . . . . . . . . . . . . . . . . Tackle Cassius Gentry . . . . . . . . . . . . . . Tackle James Stacy . . . . . . . . . . . . . . . . .Guard Ben Poyner . . . . . . . . . . . . . . . . . . .Back

1933

Cassius Gentry . . . . . . . . . . . . . . Tackle Ellis Bashara . . . . . . . . . . . . . . . . .Guard James Stacy . . . . . . . . . . . . . . . . .Guard Robert Dunlap. . . . . . . . . . . . . . . . .Back

1932

Ellis Bashara . . . . . . . . . . . . . . . . .Guard Bob Dunlap . . . . . . . . . . . . . . . . . . .Back

1931

Charles Teel . . . . . . . . . . . . . . . . .Guard

1930

Hilary Lee . . . . . . . . . . . . . . . . . . .Guard Buster Mills . . . . . . . . . . . . . . . . . . .Back

1929

Frank Crider . . . . . . . . . . . . . . . . . .Back

1928

Tom Churchill . . . . . . . . . . . . . . . . . End

W.E. Durant. . . . . . . . . . . . . . . . . . . End Walt Abbott . . . . . . . . . . . . . . . . . . .Back

1916

Willis Hott . . . . . . . . . . . . . . . . . . .Guard

FOUR-TIME ALL-CONFERENCE Anthony Phillips . . . . . . . . . . . . . . . . . . . . 1985-88 Darrell Reed . . . . . . . . . . . . . . . . . . . . . . . 1984-87 Wade Walker . . . . . . . . . . . . . . . . . . . . . . 1946-49 THREE-TIME ALL-CONFERENCE Jammal Brown . . . . . . . . . . . . . . . . . . . . . 2002-04 Tommie Harris . . . . . . . . . . . . . . . . . . . . . 2001-03 Rocky Calmus . . . . . . . . . . . . . . . . . . . . . 1999-01 Scott Evans . . . . . . . . . . . . . . . . . . . . . . . 1988-90 Keith Jackson . . . . . . . . . . . . . . . . . . . . . . 1985-87 Brian Bosworth . . . . . . . . . . . . . . . . . . . . . 1984-86 Kevin Murphy . . . . . . . . . . . . . . . . . 1982-83, 1985 Rick Bryan . . . . . . . . . . . . . . . . . . . . . . . . 1981-83 George Cumby . . . . . . . . . . . . . . . . . . . . . 1977-79 Daryl Hunt. . . . . . . . . . . . . . . . . . . . . . . . . 1976-78 Zac Henderson. . . . . . . . . . . . . . . . . . . . . 1975-77 Joe Washington . . . . . . . . . . . . . . . . . . . . 1973-75 Rod Shoate. . . . . . . . . . . . . . . . . . . . . . . . 1972-74 Steve Owens . . . . . . . . . . . . . . . . . . . . . . 1967-69 Jim Grisham . . . . . . . . . . . . . . . . . . . . . . . 1962-64 Max Boydston. . . . . . . . . . . . . . . . . . . . . . 1952-54 Tom Catlin. . . . . . . . . . . . . . . . . . . . . . . . . 1950-52 Buddy Burris. . . . . . . . . . . . . . . . . . . . . . . 1946-48 Howard Marsh . . . . . . . . . . . . . . . . . . . . . 1920-22 TWO-TIME ALL-CONFERENCE 81 Sooners have been named All-conference twice

ANTONIO PERKINS

OKLAHOM A HISTORY

Ralph Brown . . . . . . . . . . . . . . . . Tackle Red Conkwright . . . . . . . . . . . . . Center

1917

MISSOURI VALLEY CONFERENCE 1907 Owen Acton. . . . . . . . . . . . . . . . . . .Back

REVIEW & OPPONENTS

1936

SOUTHWEST CONFERENCE 1919 Paul Johnston . . . . . . . . . . . . . . . Tackle Claude Tyler . . . . . . . . . . . . . . . . .Guard Sol Swatek . . . . . . . . . . . . . . . . . . .Back Hugh McDermott. . . . . . . . . . . . . . .Back

Homer Montgomery . . . . . . . . . . . . End Oliver Hot . . . . . . . . . . . . . . . . . . Tackle Willis Hott . . . . . . . . . . . . . . . . . . .Guard Hap Johnson. . . . . . . . . . . . . . . . . .Back Elmer Capshaw. . . . . . . . . . . . . . . .Back Forest Geyer . . . . . . . . . . . . . . . . . .Back

THE SOONERS

1941

1915

COACHING STAFF

MISSOURI VALLEY CONFERENCE 1927 Roy LeCrone. . . . . . . . . . . . . . . . . . End

2 0 0 5 S EAS ON

1942

W.G. Lamb . . . . . . . . . . . . . . . . . . . End Lee Kennon. . . . . . . . . . . . . . . . . Tackle Gale Fulgham . . . . . . . . . . . . . . . .Guard Bob MayďŹ eld . . . . . . . . . . . . . . . . Center Bob Brumley . . . . . . . . . . . . . . . . . .Back Derald Lebow . . . . . . . . . . . . . . . . .Back

181 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

LETTERWINNERS

182

According to intercollegiate athletics records, the following lettered at the University of Oklahoma. Jersey numbers in parentheses. (M) - Manager; (T) - Trainer; (*) - no date

A Abbott, George C.. . . . . . . . . . . . . . . . . . 1916 Abbott, Wallace . . . . . . . . . . . . . . . . . . . 1917 Acker, Mark. . . . . . . . . . . . . . . . . . . . . . . . (T)* Acker, Neal W. (63). . . . . . . . . . . . . . . . . 1972 Acree, Jim. . . . . . . . . . . . . . . . . . . 1949,52,53 Acton, Owen E.. . . . . . . . . . . . . . . 1905,06,07 Adkins, David . . . . . . . . . . . . . . . . . . 1975 (M) Adkins, Kevin (57) . . . . . . . . . . . . 1983,84,85 Ahrens, Conrad (84). . . . . . . . . . . 1934,35,36 Aikman, Troy (18) . . . . . . . . . . . . . . . 1984,85 Alexander, Jeremy (15) . . . . . . . . 1995,96,97 Alexander, Rufus (42). . . . . . . . . . . . . . . 2004 Alexander, Stephen (80). . . . . 1994,95,96,97 Alfieri, Jerry (95) . . . . . . . . . . . 1963,64,65,66 Alfred, Joey (18) . . . . . . . . . . . . . . . . . . . 1994 Aljoe, Mike (61). . . . . . . . . . . . . . . 1983,84,85 Allen, Dale (84). . . . . . . . . . . . . . . 1996,97,98 Allen, Fred . . . . . . . . . . . . . . . . . . . . . . . 1907 Allen, Gayron (48) . . . . . . . . . 2001,02,03,04 Allen, James (25) . . . . . . . . . . 1993,94,95,96 Allen, Keith . . . . . . . . . . . . . . . . . . . . 1995 (M) Allen, Robert L., II (72) . . . . . . . . . 1992,94,95 Allen, Russell (95) . . . . . . . . . 1990,91,92,94 Allen, Ryan (68,74). . . . . . . . . 1996,97,98,99 Allen, Sam . . . . . . . . . . . . . . . . . . . . 1951,52 Allford, V. Larry (69) . . . . . . . . . . . 1963,64,65 Allison, Carl (83). . . . . . . . . . . 1951,52,53,54 Allsup, John V... . . . . . . . . . . . . . . . . 1946,47 Allton, Joe. . . . . . . . . . . . . . . . . . . . . 1940,41 Ambrister, Hubert . . . . . . . . . . .1910,11,12,13 Andarakes, Drake (65,73) . . . . . . . . 1973,74 Anderegg, Dan . . . . . . . . . . . . . . . . . . . . 1947 Anderson, Bruce. . . . . . . . . . . . . . . . 1972 (T) Anderson, Frank G. . . . . . . . . . . . . . . . . 1947 Anderson, George. . . . . . . . . . . . . . 1914,15 Anderson, Jerry O. (17) . . . . . . . . . . 1975,76 Anderson, John (39 . . . . . . . . 1991,92,93,94 Anderson, Matt (90) . . . . . . . . 1996,97,98,00 Anderson, Rotnei (28) . . . . . . 1985,86,87,88 Anderson, Vickey Ray (19,43) . . . . . 1977,78 Andros, Dee G.. . . . . . . . . . . . 1946,47,48,49 Andros, Plato . . . . . . . . . . . . . . . . . . 1941,46 Angel, Keith F. (67,93) . . . . . . . . . . . . . . . 980 Antone, Tony (8) . . . . . . . . . . . . . . . . 1977,78 Arbuckle, Dale . . . . . . . . . . . . 1923,24,25,26 Armstrong, Charles. . . . . . . . . . . . 1907,08,09 Armstrong, Tyrone (63). . . . . . . . . . . . . . 1973 Arnold, Claude . . . . . . . . . . . . . . . 1948,49,50 Arnold, Gerald K. (74). . . . . . . . . . 1972,73,74 Arnold, Lee . . . . . . . . . . . . . . . . . . . . . . . 1900 Aston, Roscoe . . . . . . . . . . . . . . . . . . . . 1901 Atkins, Arthur (96). . . . . . . . . . . . . . . 1994,95 Atyia, Darren (26). . . . . . . . . . . . . . . . . . 1983 Austman, George . . . . . . . . . . . . . . . . . . 1967 Austin, John . . . . . . . . . . . . . . . . . . . . . . 1944 Avent, Bob . . . . . . . . . . . . . . . . . . . . . . . 1945 Aycock, Steven (43) . . . . . . . . . . . 1969,70,71 Ayodele, Remi (93). . . . . . . . . . . . . . . . . 2004

B Babb, Brandon (37) . . . . . . . . . . . . . . . . 2000 Babb, Mike (14,18) . . . . . . . . 1976,77,78,79 Baccus, Duane (88) . . . . . . . . . . . 1974,75,76 Baccus, Gary (51,88) . . . . . . . . . . 1970,72,73 Backes, Tom (85) . . . . . . . . . . 1987,88,89,90 Baer, Jack (00) . . . . . . . . . . . . . . . 1935,36,37 Bagby, Boots (27) . . . . . . . . . . . . . . . . . . 1966 Bagwell, Paul W. (54) . . . . . . . . . . . . . . . 1966 Bailey, Calvin (34). . . . . . . . . . . . . . . . . . 1988 Bailey, Manley . . . . . . . . . . . . . . . . . . . . 1912 Bailey, Warren . . . . . . . . . . . . . . . . . . . . 1921 Baily, Gary (61). . . . . . . . . . . . . . . . . . . . 1974 Baker, Boone (26). . . . . . . . . . . . . . . 1942,43 Baker, Charles . . . . . . . . . . . . . . . . . . . . 1967 Baker, C.B. (74) . . . . . . . . . . . . . . . . 1997,98 Baker, David (31) . . . . . . . . . . . . . . . 1957,58

Baker, Frank. . . . . . . . . . . . . . . . . . . . . . 1916 Baker, Lewis (16) . . . . . . . . . . . . . . . . . . 2003 Balcer, Frank . . . . . . . . . . . . . . . . . . . . . 1916 Baldischwiler, Karl (67). . . . . . . . . 1975,76,77 Baldridge, Richard D. (42) . . . . . . 1967,68,69 Baldwin, James (56). . . . . . . . . . . . . 1989,92 Ball, Fred S., Jr. (47). . . . . . . . . . . 1935,36,37 Ballard, Hugh C. (82) . . . . . . . . . . 1951,55,56 Balous, Johnnie (9,27) . . . . . . . . . . . 1998,99 Banks, Angelo (91) . . . . . . . . . . . . . . . . . 1998 Banks, Basil M. (17) . . . . . . . . 1977,78,79,80 Barber, John (2) . . . . . . . . . . . . . . . . . . . 1996 Barclay, Jarrod (66) . . . . . . . . . . . . . 2001,02 Barkett, Woody . . . . . . . . . . . . . . . . . . . . 1945 Barnes, Reggie (40) . . . . . . . . 1989,90,91,92 Barnes, Todd (83) . . . . . . . . . . . . . . . . . . 1996 Barnoskie, Gary . . . . . . . . . . . . . . . . . . . 1974 Barr, Johnny (31,87). . . . . . . . . . . . . 1968,69 Barresi, John (95). . . . . . . . . . . . . . . 1973,74 Barrett, J. Rodney. . . . . . . . . . . . . . . 1986 (T) Barrett, Steve J. (35) . . . . . . . . . . 1966,67,68 Barrow, Edwin. . . . . . . . . . . . . . . . . . 1896,97 Bartee, William (28) . . . . . . . . . . . . . 1998,99 Base, Michael (74) . . . . . . . . . 1963,64,65,66 Basham, Jim. . . . . . . . . . . . . . . . . . . . . . 1945 Bashara, Ellis (32,36) . . . . . . . . . . 1931,32,33 Bass, Maurice. . . . . . . . . . . . . . . . . . . . . 1918 Bassey, Eric (13) . . . . . . . . . . . . . 2002,03,04 Baublit, Randy . . . . . . . . . . . . . . . . . 1994 (M) Bayles, Marion (54) . . . . . . . . . . . . . . . . 1963 Baysinger, Al (76) . . . . . . . . . . . . . 1998,99,00 Beattie, Richard L. (41). . . . . . . . . . . . . . 1961 Beavers, Aubrey (56,72,99) . . . . . 1992,93,94 Bechtold, Earl . . . . . . . . . . . . . . . . . . 1917,19 Bechtold, William B. (51) . . . . . . . 1979,80,81 Beck, Wesley W. (39) . . . . . . . . . . . . 1933,35 Becker, Max . . . . . . . . . . . . . . . . . . . . . . 1902 Beckman, William. . . . . . . . . . . . . . . . . . 1950 Beisiegel, Dan (32). . . . . . . . . . . . . . . . . 1996 Belcher, Page . . . . . . . . . . . . . . . . . . . . . 1918 Bell, Curry. . . . . . . . . . . . . . . . . . . 1913,14,15 Bell, Glenn (20). . . . . . . . . . . . . . . . . . . . 1988 Bell, John . . . . . . . . . . . . . . . . . . . . . . . . 1914 Bell, John H. (61,83). . . . . . . . . . . 1954,55,56 Bell, Roy Lemount (35) . . . . . . . . 1969,70,71 Belser, Jason (27,29) . . . . . . . 1988,89,90,91 Bene, Fred . . . . . . . . . . . . . . . . . . . . . . . 1895 Benien Jr., Paul F. (80) . . . . . . . . . 1959,60,61 Benien, John David (81). . . . . . . . . . . . . 1961 Bennett, W. Gary, Jr. (74,76) . . . . 1985,86,87 Benson, Thomas (38) . . . . . . . 1980,81,82,83 Bentley, David P. (99) . . . . . . . . . . . . . . . 1975 Berg, Robert P. (20) . . . . . . . . . . . . . 1973,74 Bergman, Deroy . . . . . . . . . . . . . . . . . . 1945 Berry, Curtis (30) . . . . . . . . . . 1928,29,30,31 Berry, Harry L. . . . . . . . . . . . . . . . 1926,27,28 Berry, John . . . . . . . . . . . . . . . . . . . . . . 1901 Berry, Mike (44,80) . . . . . . . . . . . . . . . . . 1978 Berry, Roger E. . . . . . . . . . . . . . . . 1910,11,12 Berryhill, Darin (85). . . . . . . . . 1981,83,84,85 Bibb, Boyd . . . . . . . . . . . . . . . . . . . . 1946,47 Bigby, Byron (59,73) . . . . . . . . . . . 1966,67,68 Birge, Laddie V. . . . . . . . . . . . . . . . . 1940,41 Birdine, Larry (92) . . . . . . . . . . . . . . 2003,04 Birks, Mike (15). . . . . . . . . . . . . . . 1974,75,76 Bishop, Bobby (10) . . . . . . . . . . . . . 1979,81 Bishop, Gary (64) . . . . . . . . . . . . . . . . . . 1975 Blake, John (36,90) . . . . . . . . 1979,80,81,82 Blanton, Scott (16) . . . . . . . . . 1991,92,93,94 Blevins, Dean (2) . . . . . . . . . . 1974,75,76,77 Blevins, Frank (35) . . . . . . . . . 1987,88,89,90 Blocker, Chris (24) . . . . . . . . . 1995,96,97,98 Blodgett, Mark (63). . . . . . . . . . . . 1988,89,91 Blubaugh, Tom . . . . . . . . . . . . . . . . . 1984 (M) Boatright, Lloyd. . . . . . . . . . . . . . . . . . . . 1922 Bobo, Robert . . . . . . . . . . . . . . . . . 1987 (M) Bodenhamer, Bob. . . . . . . . . . 1945,47,48,49 Bodin, Jeffrey R . . . . . . . . . . . . . . . . 1974,75 Bodine, Hugh . . . . . . . . . . . . . . . . . . . . . 1904 Bogle, Clyde . . . . . . . . . . 1899,1900,01,02,03 Bohannon, Craig (37) . . . . . . . . . . . . . . . 1994 Bolinger, Bo (79). . . . . . . . . . . . . . 1953,54,55 Boll, Virgil Lloyd (39). . . . . . . . . . . 1961,62,63 Bolton, Jerry (50) . . . . . . . . . . . . . 1937,38,39 Bookout, Billy . . . . . . . . . . . . . . . . . . . . . 1951 Borah, Orin (10,19). . . . . . . . . . . . . . 1930,31

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Bosworth, Brian K. (89,44) . . . . . . 1984,85,86 Boudreau, George . . . . . . . . . . . . . . . . . 1941 Boudreau, Raphael (35,37) . . 1935,36,37,38 Boudreaux, Richard . . . . . . . . . . . . . . . . 1963 Bourland, Joe . . . . . . . . . . . . . . . . . . 1991 (T) Bowden, Joe (45) . . . . . . . . . . . . . 1989,90,91 Bowen, Jim. . . . . . . . . . . . . . . . . . . . 1957 (M) Bowers, Justin (19,56) . . . . . . . . . . . 1938,39 Bowles, R.C.. . . . . . . . . . . . . . . . . 1921,22,23 Bowman, Charles “Chuck” (52) . . . . . . . 1957 Bowman, Dick. . . . . . . . . . . . . . . . 1951,52,53 Boyd, Bobby (25) . . . . . . . . . . . . . 1957,58,59 Boyd, James (57,60) . . . . . . . . . . . . . . . 1989 Boydston, Max (41) . . . . . . . . 1951,52,53,54 Boyle, Dorsey . . . . . . . . . . . . . . . . . . 1917,19 Braden, Kent. . . . . . . . . . . . . . . . 1951,52 (M) Bradford, Kent (68). . . . . . . . . . . . . . 1977,78 Bradley, Danny L. (1) . . . . . . . 1981,82,83,84 Bradley, John (42,60) . . . . . . . . . . . . 1988,91 Bradley, Lester E. (77) . . . . . . . . . . . . . . 1959 Bradley, Mark (1) . . . . . . . . . . . . . . . 2003, 04 Brady, Barry (97) . . . . . . . . . . . . . . . . . . 1974 Brady, Rickey (86) . . . . . . . . . 1990,91,92,93 Brahaney, Tom (54) . . . . . . . . . . . 1970,71,72 Brauninger, Brian (66) . . . . . . . . . . . 1990,91 Breathett, Sherdeill H. (47). . . . . . . . 1980,81 Brecht, Martin B. (49) . . . . . . . . . . . . . . . 1974 Breeden, Charles . . . . . . . . . . . . . . . . . . 1943 Breeden Joe, Jr. . . . . . . . . . . . . . . . . . . . 1943 Breeden, J.W. (33) . . . . . . . . . . . . . . 1935,36 Brewer, Bart (46) . . . . . . . . . . . . . . . . . . 1998 Brewer, Dewell (6,23) . . . . . . . 1989,90,91,92 Brewer, George W., Jr. . . . . . 1946,47,48,49 Brewer, Otto . . . . . . . . . . . . . . . . . . . . . . 1916 Brewington, Carl. . . . . . . . . . . . . . . . . . . 1941 Bridges, John (38) . . . . . . . . . . . . . . . . . 1935 Bridges, Richard. . . . . . . . . . . . . . . . . . . 1984 Briggs, Larry (22) . . . . . . . . . . . . . . . . . . 1975 Bright, Darryl “Rocky” (95) . . . 1997,98,99,00 Brindley, Bob . . . . . . . . . . . . . . . . . . . . . 1945 Briscoe, Albert . . . . . . . . . . . . . . . . . 1916,19 Brinkman, Wade . . . . . . . . . . . . . . . . 1988 (M) Brinkman, Wade . . . . . . . . . . . . . . 1922,23,24 Britt, Jodie Dean (95) . . . . . . . . . . . . . . . 1985 Brockman, Ed. . . . . . . . . . . . . . . . 1923,24,25 Bronson, Jason (63) . . . . . . . . . . . . . 1997,98 Brooks, Bill (82) . . . . . . . . . . . . . . 1973,74,75 Bross, Eric B. (36) . . . . . . . . . 1986,87,88,89 Bross, Larry A. (69,75) . . . . . . . . . . . . . . 1968 Brown, Sidney, Jr. (21) . . . . . . . . . 1974,75,76 Brown, C.D. “Sonny” (8) . . . . . 1983,84,85,86 Brown, Don K. . . . . . . . . . . . . . . . 1952,53,54 Brown, Gordon (87) . . . . . . . . . . . 1963,64,65 Brown, Jammal (55) . . . . . . . . 2001,02,03,04 Brown, Jim . . . . . . . . . . . . . . . . . . . . . . . 1905 Brown, Joe A. . . . . . . . . . . . . . . . . . . . . . 1917 Brown, Joe (6,12) . . . . . . . . . . . . . . 1994,95 Brown, Larry (33,45). . . . . . . . . . . 1963,64,65 Brown, Mart . . . . . . . . . . . . . . . . . 1925,26,27 Brown, Melvin. . . . . . . . . . . . . . . . 1950,52,53 Brown, Ralph (78). . . . . . . . . . . . . 1934,35,36 Brown, Shaq (96) . . . . . . . . . . . . . . . 1996,97 Brown, Terence (3) . . . . . . . . . 1993,94,95,96 Brown, Victor Larue (92). . . . . . . . . . 1975,76 Brown, William H. . . . . . . . . . . . . . . . 1955,56 Browne, Howard. . . . . . . . . . . . . . . . . . . 1907 Broyles, J. Henry, Jr. (56) . . . . . . . . . 1955,56 Brumley, Bob . . . . . . . . . . . . . . . . . . . . . 1943 Bryan, Mitch W. (97). . . . . . . . . . . . . 1982,83 Bryan, Rick D. (80) . . . . . . . . . 1980,81,82,83 Bryan, Steven R. (86). . . . . . . . . . 1983,84,85 Bryant, Anthony (71). . . . . . . . 1973,74,75,76 Bryce, C.F. (67). . . . . . . . . . . . . . . . . . . . 1942 Buchanan, Dennis (55). . . . . . . . . 1972,73,75 Buchanan, James N. . . . . . . . . . . . . . . . 1909 Bullard, David (50,69). . . . . . . . . . 1994,95,96 Bumgardner, Allen W. (85) . . . . . . 1962,63,64 Bunge, Paul (56). . . . . . . . . . . . . . . . . . . 1972 Burch, Wyatt . . . . . . . . . . . . . . 1901,02,03,06 Burcham, S. “Bubba” (59). . . . 1997,98,99,00 Burgar, Jim (14) . . . . . . . . . . . . . . . . 1966,67 Burgert, Eran Omer, Jr. . . . . . . . . 1943,44,45 Burgess, Rickey T. (54) . . . . . . . . . . . . . 1966 Burget, Barry (26). . . . . . . . . . 1976,77,78,79 Burget, Grant (25). . . . . . . . . . . . . 1972,73,74 Burkett, Vernon D. (62,97) . . . . . . 1964,65,66

Burkhart, Jon . . . . . . . . . . . . . . . . . . 1992 (T) Burks, Brent (69,94) . . . . . . . . . . . 1982,83,84 Burns, Artis (29) . . . . . . . . . . . . . . . . 1993,94 Burns, Greg (86). . . . . . . . . . . . . . . . . . . 1964 Burns, Mike (51,71,82) . . . . . . . . . . . . . . 1965 Burris, Kurt (51) . . . . . . . . . . . 1951,52,53,54 Burris, Lynn (55) . . . . . . . . . . . . . . . . . . . 1956 Burris, Paul “Buddy” . . . . . . . . . . . 1946,47,48 Burris, Robert R. (40) . . . . . . . . . . 1953,54,55 Burroughs, Ramon (21) . . . . . . . . . . . . . 1996 Burson, H.T. . . . . . . . . . . . . . . . . . . . . . . 1896 Burton, Cornelius (87) . . . . . . 1996,97,98,99 Burton, Newton (65) . . . . . . . . . . . 1962,63,64 Burton, Sam . . . . . . . . . . . . . . . . . . . 1910,12 Bush, Chris (52) . . . . . . . . . . . . . . 2002,03,04 Bush, Larry (31) . . . . . . . . . . . 1992,93,94,95 Butts, Wes (61,75) . . . . . . . . . . . . 1965,66,67 Buxton, C.C. (15) . . . . . . . . . . . . . . . . . . 1930 Byerly, Jim (54) . . . . . . . . . . . . . . . . . . . 1959 Byford, Lyndle (79) . . . . . . . . . . . . 1979,80,81 Bynum, Chester L. . . . . . . . . . . . . . . 1951,52

C Cabbiness, Carl (83). . . . . . . . 1985,86,87,88 Cabbiness, Chris (16) . . . . . . . . . 1988,89,90 Cade, Tony (31) . . . . . . . . . . . . . . . . . . . 2004 Cagle, Gene (11,12) . . . . . . . . . . . 1965,66,67 Calame, Gene (31). . . . . . . . . 1951,52,53,54 Callens, Corey (92). . . . . . . . . 1997,98,99,00 Calmus, Rocky (20) . . . . . . . . 1998,99,00,01 Calonkey, Steve . . . . . . . . . . . . . . . . . . . 1973 Campbell, Bill (53) . . . . . . . . . . . . 1940,41,42 Campbell, Chris (66). . . . . . . . . . . 1993,94,95 Campbell, David (57,59). . . . . . . . 1992,93,94 Campbell, Ralph. . . . . . . . . . . . . . . . 1907,08 Campbell, Roy . . . . . . . . . . . . . . . . . . . . 1908 Cantrell, Marshall . . . . . . . . . . . . . . . . . . 1973 Capshaw, Elmer . . . . . . . . . . . 1912,13,14,15 Capshaw, Fred . . . . . . . . . . . . .1908,09,10,11 Carey, Orville J. . . . . . . . . . . . . . . 1931,32,33 Cargill, Brett (77) . . . . . . . . . . . . . . . 1976,77 Carlyle, Bill (53) . . . . . . . . . . . . . . . . 1964,65 Carman, Jack P. . . . . . . . . . . . . . . . . . . . 1927 Carnahan, Sam D. . . . . . . . . . . . . . . . . . 1950 Carner, James (69). . . . . . . . . . . . 1978,79,80 Carollo, Joe (68). . . . . . . . . . . . . . . . 1993,95 Carpenter, Adam (68 . . . . . . . . . . . . 1997,98 Carpenter, Dick (33. . . . . . . . . . . . 1957,58,59 Carpenter, E.J. (22) . . . . . . . . . . . 1958,60,61 Carr, Lydell (44,45) . . . . . . . . . 1984,85,86,87 Carroll, Hugh . . . . . . . . . . . . . . . . . . . . . 1904 Carroll, John (10) . . . . . . . . . . . . . 1971,72,74 Carroll, Tom M. (38) . . . . . . . . . . . . . 1953,54 Carter, Bobby . . . . . . . . . . . . . . . . . . . . . 1984 Carter, David (89) . . . . . . . . . . . . . . 1981,82 Carter, Gary (27). . . . . . . . . . . . . . . . . . . 1972 Carter, Jason (6). . . . . . . . . . . . . . . . 2003,04 Carter, Melvin (14) . . . . . . . . . . . . 1989,90,92 Carter, Vince (50) . . . . . . . . . . 2001,02,03,04 Cartwright, Roy (52) . . . . . . . . . . . . . . . . 1954 Case, Scott (10) . . . . . . . . . . . . . . . . 1982,83 Casey, Clay . . . . . . . . . . . . . . . . . . . . . . 1936 Casillas, Tony (92) . . . . . . . . . 1982,83,84,85 Cason, Owen T. (83). . . . . . . . . . . . . . . . 1933 Casteel, Steve (44). . . . . . . . . . . . 1968,69,70 Catlin, Tom A. . . . . . . . . . . . . . . . . 1950,51,52 Cavil, Ben (63,91). . . . . . . . . . 1991,92,93,94 Cawthon, Pete W., Jr. (52) . . . . . . . . 1941,42 Chaisson, Kelvin (70) . . . . . . . . . 2002,03,04 Chambers, Evans E. (8,18) . . . . . . . . . . 1931 Chambers, Wayne (15,44) . . . . . . 2002,03,04 Chandler, Albert M. (82) . . . . . . . . 1970,71,72 Chandler, Dwayne (32). . . . . . 1992,93,94,96 Chase, Martin (93) . . . . . . . . . 1994,95,96,97 Cherry, Fred (13,14,22) . . . . . . . . 1930,31,32 Chester, Chris (84) . . . . . . . . . . . . 2002,03,04 Chiles, Clay . . . . . . . . . . . . . . . . . . . . . . 1933 Chilless, Bill . . . . . . . . . . . . . . . . . 1947,48,49 Choate, Phillip . . . . . . . . . . . . . . . . . 1988 (T) Choice, Tashard (2) . . . . . . . . . . . . . . . . 2004 Chretien, Marcus (87). . . . . . . . . . . . 2000, 01 Chrisman, Gary (46). . . . . . . . . . . 1968,69,70 Christian, Brian. . . . . . . . . . . . . . . . . 1995 (M) Christian, Moe . . . . . . . . . . . . . . . . . 1992 (M)


LETTERWINNERS Crowder, Eddie. . . . . . . . . . . . . . . 1950,51,52 Crowder, Stan (20) . . . . . . . . . . . . . . 1965,66 Crudup, Derrick (15). . . . . . . . . . . 1985,86,87 Crutchmer, Larry (55,77,81) . . . . . 1965,66,67 Culbreath, James C., Jr. (41) . . . . . . 1975,76 Cullen, Ronald J. . . . . . . . . . . . . . 1920,21,22 Culley, Blair (93) . . . . . . . . . . . . . . . . . . . 1992 Culver, David (28,87) . . . . . . . . . . . . . . . 1982 Culver, Ed (61) . . . . . . . . . . . . 1978,79,80,81 Culver, Max. . . . . . . . . . . . . . . . . . . . . . . 1944 Cumby, George (28) . . . . . . . 1976,77,78,79 Cummings, Jim. . . . . . . . . . . . . . . . . 1979 (M) Cummings, Millard . . . . . . . . . . . . . . . . . 1944 Cunningham, Glenn (83) . . . . . . . . . . . . 1959 Cunningham, Joe . . . . . . . . . . . . . . . . . . 1950 Curnett, E. Lee (14,27). . . . . . . . . . . 1931,32 Curtis, Joe (55). . . . . . . . . . . . . . . . . 1976,77 Cutchall, Dean B. (93) . . . . . . . . . . . . . . 1935 Cuva, Pete (80) . . . . . . . . . . . . . . . . . . . 2002

E

Fagan, Curtis (12). . . . . . . . . . 1999,00,01,02 Farley, Gerald (18) . . . . . . . . . . . . . . . . . 1992 Farria, Shawn . . . . . . . . . . . . . . . . . . . . . 2003 Farthing, Jody (53) . . . . . . . . . . . . 1976,77,78 Fauble, Don (00). . . . . . . . . . . . . . . . . . . 1942 Favor, Richard E. (53) . . . . . . . . . . . 1938,39 Fazande, Jermaine (30) . . . . . 1995,96,97,98 Feagan, Jimmy (85) . . . . . . . . . . . . . . . . 1958 Ferguson, Blake (87) . . . . . . . . . 2002,03,04 Ferguson, Jeff (17,83) . . . . . . 1998,99,00,01 Ferguson, Glenn (74. . . . . . . . . . . . . . . . 1981 Ferguson, Milton. . . . . . . . . . . . . . . . . . . 1899

Gaddis, Mike (22,32) . . . . . . . . . . 1988,89,91 Gaines, Ryan . . . . . . . . . . . . . . . . . . 1994 (T) Gambill, Jess . . . . . . . . . . . . . . . . . . . . . 1898 Gambrell, Bob. . . . . . . . . . . . . . . . . . . . . 1944 Gambrell, Rick E. (89) . . . . . . 1971,72,73,74 Gammil, Floyd . . . . . . . . . . . . . . . . . . . . 1916 Garl, Michael Scott (49) . . . . . 1985,86,87,88 Garrett, John C. (50,67) . . . . . . . . 1962,63,64 Gary, Keith (92) . . . . . . . . . . . . . . . . 1979,80 Gassoway, Jim . . . . . . . . . . . . . . . . . . . 1943 Gatewood, Evan (54) . . . . . . . . . . 1983,84,85 Gaut, Robert N. . . . . . . . . . . . . . . . . 1951,52 Gautt, Prentice (38) . . . . . . . . . . . 1957,58,59 Gaynor, Joe . . . . . . . . . . . . . . . . . . . . . . 1951 Geerts, Greg. . . . . . . . . . . . . . . . . . . 1985 (M) Gentry, Cash. . . . . . . . . . . . . . . . . . . 1933,34 Gentry, Malcomb . . . . . . . . . . . . . . . . . . 1914 Gentry, Weldon C. . . . . . . . . . . . . . . 1928,29 Geren, David R. (87,90) . . . . . . . . . . . . . 1971 Geyer, Forest . . . . . . . . . . . . . . . . 1913,14,15 Gibbons, George (32). . . . . . . . . . . . 1941,42 Gibbs, Gary L. (41,55) . . . . . . . . . 1972,73,74 Giese, Warren . . . . . . . . . . . . . . . . . . . . 1946 Giles, Barry (70) . . . . . . . . . . . . . . . . 1994,95 Giller, Tre (72) . . . . . . . . . . . . . . . . . 1987,88 Gilstrap, Jimmy R. (60). . . . . . . . . 1961,62,63 Ging, Jack. . . . . . . . . . . . . . . . . . . 1951,52,53 Glenn, Ledell (7). . . . . . . . . . . . . . . . . . . 1985 Goad, Robert W.. . . . . . . . . . . 1946,47,48,49 Goff, Duane (84). . . . . . . . . . . . . . 1953,54,55 Golding, Joe . . . . . . . . . . . . . . . . . . . 1941,46 Goldsby, Jerry (73,77) . . . . . . . . . . . 1963,64

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

F

G

REVIEW & OPPONENTS

Earnest, Rick . . . . . . . . . . . . . . . . . . 1988 (M) Earthman, Bill (94) . . . . . . . . . . . . 1982,83,84 Eason, Roger . . . . . . . . . . . . . . . . 1939,40,41 Eck, Robert (54) . . . . . . . . . . . . . . . . . . . 1988 Ederer, John . . . . . . . . . . . . . . . . . 1955,56,57 Edgeman, Harold C. (60) . . . . . . . . . . . . 1938 Edmonson, Charles Van. . . . . . . . 1920,21,22 Elam, Willis. . . . . . . . . . . . . . . . . . . . . . . 1954 Elfstrom, W.W. “Bill” (60) . . . . . . . 1967,68,69 Ellington, Sidney. . . . . . . . . . . . . . . . 1983 (M) Ellis, Harry H. (96) . . . . . . . . . . . . 1933,34,35 Ellis, Richard F.. . . . . . . . . . . . . . . . . 1951,52 Ellstrom, Marvin (48) . . . . . . . . . . . . . . . 1931 Ellsworth, Fred (66) . . . . . . . . . . . 1933,35,36 Elrod, James W. (54) . . . . . . . . . . 1973,74,75 Emel, Thomas Jeffrey (78) . . . . . . . . . . . 1974 Emerson, Thomas E. (69) . . . . . . 1954,55,56 Emerson, John . . . . . . . . . . . . . . . . . . . 1978 Emmert, Darryl L. (73) . . . . . . . . . 1969,70,71 English, Porter. . . . . . . . . . . . . . . . . . 1908,09 Ervin, Greg (5) . . . . . . . . . . . . . . . . . 1990,91 Erwin, Bill . . . . . . . . . . . . . . . . . . . . . . . . 1945 Estep, Robert . . . . . . . . . . . . . . . . . . 1943,44 Estes, H.O. (62. . . . . . . . . . . . . . . . . . . . 1960 Estrada, Abner (78) . . . . . . . . . . . . . . . . 2002 Estus, Jerad (33) . . . . . . . . . . . . . . . . . . 2002 Evans, Chez (75) . . . . . . . . . . 1973,74,75,76 Evans, J.C. . . . . . . . . . . . . . . . . . . . . . . . 1895 Evans, Richard (86) . . . . . . . . . . . . . . . . 1958 Evans, Richard W. . . . . . . . . . . . . . . . . . 1974 Evans, Scott (55,78). . . . . . . . 1987,88,89,90 Evans, Tommy . . . . . . . . . . . . . . . . . 1994 (M) Everage, Brandon (7) . . . . . . . 2000,01,02,03 Ewbank, James B. . . . . . . . . . . . . . . 1948,52 Ewing, Darrell L. . . . . . . . . . . . . . . . 1929,30

THE SOONERS

Dainty, Chad . . . . . . . . . . . . . . . . . . . . . . 1996 Dalke, Bill (40) . . . . . . . . . . . . . . . . . 1975,76 Dambro, Guntar . . . . . . . . . . . . . . . . 1972 (M) Dampeer, Lawrence (74) . . . . . . . . . . . . 2004 Daniel, Ryan (82,83). . . . . . . . . . . . . . . . 2001 Daniels, Brandon (8) . . . . . . . 1996,97,98,99 Darnell, Bobby J. (54). . . . . . . 1952,53,54,55 Daughtry, Tim (88) . . . . . . . . . . . . . . 1994,95 Davis, Anthony (41,42) . . . . . . . . . . . . . . 1999 Davis, Brad (69) . . . . . . . . . . . . . . . . 2001,02 Davis, Cornelius (14) . . . . . . . . . . 1995,96,97 Davis, Danny . . . . . . . . . . . . . . . . . . 1979 (M) Davis, Don W. (42,57) . . . . . . . . . . . . . . 1966 Davis, Ernest . . . . . . . . . . . . . . . . . . . . . 1945 Davis, George (90) . . . . . . . . . . . . . . . . . 1975 Davis, Heath. . . . . . . . . . . . . . . . . . . 1995 (T) Davis, James W. (53) . . . . . . . . . . 1957,58,59 Davis, Jim (53) . . . . . . . . . . . . . . . . . 1951,52 Davis, Kyle (50) . . . . . . . . . . . . . . 1972,73,74 Davis, Sam A. (69,97). . . . . . . . . . . . . . . 1961 Davis, Skivey A.R. . . . . . . . . . . . . 1917,19,20 Davis, Steve (5) . . . . . . . . . . . . . . 1973,74,75 Davis, Thomas “Eddy” (66). . . 1941,42,46,47 Davis, Wendell (28) . . . . . . . . . . . . . 1994,95 Dawson, Chris (48,49) . . . . . . . . . 1993,94,95 Dawson, Russell Scott (78) . . 1977,79,80,81 Day, Ernest B. (20) . . . . . . . . . . . . . . 1955,56 Day, Lionell (66) . . . . . . . . . . . . . . 1968,69,70 Dayton, Max (23) . . . . . . . . . . . . . . . . . . 1971 Deacon, Erl E. . . . . . . . . . . . . 1917,18,19,20 Deere, Monte M. (12,32) . . . . . . . 1960,61,62 DeLoney, Bruce Edward (88) . . . . 1969,70,71 Delozier, Brown (5,29) . . . . . . . . . . . 1980,82 Dempsey, Jackie L. (43) . . . . . . . . . . . . . 1962 Dennison, Russell (36) . . . . . . . . . 2002,03,04 Denton, Sammy L. “Bo” (79,80) . . . . 1967,68 Denton, Tim (23). . . . . . . . . . . . . . . . 1994,95 Depue, L. Dale (20) . . . . . . . . . . . . . 1956,57 DeQuasie, Brent (47) . . . . . . . 1992,93,94,95 DeQuasie, Greg (16,48) . . . . . 1988,89,90,91 Derr, Bruce J. (20) . . . . . . . . . . . . 1968,69,70 Derrick, Robert (28) . . . . . . . . . . . 1954,55,56 Desmond, Jim. . . . . . . . . . . . . . . . . . . . . 1943 Dewberry, Glenn (53) . . . . . . . . . . . . 1969,71 DiCarlo, Trey (83) . . . . . . . . . . . . 2002,03,04 Dickey, Donald F. (38) . . . . . . . . . . . . . . 1960 Dickson, Wayne (34,38,52) . . . . . 1987,88,89 Dillard, Stacey (77). . . . . . . . . 1988,89,90,91 Dillingham, David (59) . . . . . . . . . . . 1983,84 Dillingham, W. David (34). . . . . . . . . . . . 1969 Dillon, Richard (41). . . . . . . . . 1984,86,87,88 Dinkins, Merle L.. . . . . . . . . . . 1943,44,46,47 DiRienzo, Tony (3) . . . . . . . . . . . . 1973,74,75 Dittman, Barry Robert (38,50) 1975,77,78,79 Dixon, Greg (69). . . . . . . . . . . . . . . . 1987,89 Dixon, Rickey (29) . . . . . . . . . 1984,85,86,87 Dobbs, James Mark . . . . . . . . . . . . . 1982 (M) Dodd, Carl (22). . . . . . . . . . . . . . . 1955,56,57 Dodd, Gary Steve (40,87). . . . . . . 1971,72,73 Dodd, Sidney (65,97) . . . . . . . . . . . . 1982,83 Dodds, James Lawrence (72). . . . 1974,75,76 Dodson, Ted E. (63) . . . . . . . . . . . . . . . . 1963 Dollarhide, Louis. . . . . . . . . . . . . . . . . . . 1944

Ferrer, Paul G. (55 . . . . . . . . . 1981,82,84,85 Fields III, Carson (32). . . . . . . . . . . . . . . 1998 Fields, Jerod (71) . . . . . . . . . . . . . . . 2001,02 Fields, Jess. . . . . . . . . . . . . . . . . . . . 1914,16 Fields, Mike (34). . . . . . . . . . . . . . . . 1991,92 Fields, Robert D. (26) . . . . . . . . . . 1928,29,30 Fields, Troy (72) . . . . . . . . . . . . . . . . . . . 1984 Files, Jim (84). . . . . . . . . . . . . . . . 1967,68,69 Finch, Lonnie (9). . . . . . . . . . . . . . 1985,86,87 Finley, Joe Jon (85) . . . . . . . . . . . . . . . . 2004 Fischer, Max . . . . . . . . . . . . . . . . . 1941,46,47 Fisher, Rod (7) . . . . . . . . . . . . . . . 1988,89,91 Fisher, Ryan (75,94) . . . . . . . 1997,98,99,00 Fitch, Ken . . . . . . . . . . . . . . . . . . . . . . . . 1943 Flanagan, Orlando (53) . . . . . . . . . . 1980,81 Flanagan, Robert (40,87). . . . . . . . . . . . 1965 Fleetwood, Harold E. (20). . . . . . . . . 1932,33 Fleming, L.B. . . . . . . . . . . . . . . . . . . . . . 1923 Flemons, Tommy (39,93,98). . . . . 1980,82,83 Fletcher, Patrick (16) . . . . . . . . . . 1998,99,00 Fletcher, Ron (11,28) . . . . . . . . . . . . . . . 1964 Flint, Earl . . . . . . . . . . . . . . . . . . . . . 1928,29 Flood, Alger W. (77) . . . . . . . . . . . . . . . . 1969 Flynn, John (84) . . . . . . . . . . . . . . . . 1962,63 Flynn, John (73) . . . . . . . . . . . . . . . . 2003,04 Fogle, Anthony (9) . . . . . . . . . 1993,94,95,96 Foley, Mark J. . . . . . . . . . . . . . . . . . . . . . 1980 Fontenette, Johnny (44,83) . . . . . 1980,82,83 Ford, Ataleo . . . . . . . . . . . . . . . . . . . . . . 2004 Ford, Harry . . . . . . . . . . . . . . . . . . 1896,97,98 Forrest, Dugan (72,91) . . . . . . . . . . . . . . 1987 Foster, Ed (77) . . . . . . . . . . . . . . . 1971,72,73 Foster, Jerr . . . . . . . . . . . . . . . . . . . . . . . 1975 Foster, Raybourne . . . . . . . . . . . . . . . . . 1915 Fox, Dave . . . . . . . . . . . . . . . . . . . . . . . 1908 Francis, William Raleigh (71) . . . . 1933,34,35 Franklin, Willie (80). . . . . . . . . . . . . . 1970,71 Franks, Charles (15). . . . . . . . 1988,89,90,91 Frazer, David P. (83,94) . . . . . . . . . . . . . 1968 Frazier, Jeff (19) . . . . . . . . . . . . . . . . 1994,95 Freeman, Jason (86) . . . . . . . 1995,96,97,98 Freeman, Mario (44). . . . . . . . . . . 1992,93,94 Friday, Elmer . . . . . . . . . . . . . . . . . . . . . 1945 Friedrichs, L.G. (14) . . . . . . . . . . . . . . . . 1939 Fuente, Justin (12) . . . . . . . . . . . . . . 1996,97 Fulcher, Rick (8) . . . . . . . . . . . . . . . . 1972,73 Fulghum, Gale . . . . . . . . . . . . . . . . . . . 1943 Fultz, Eric (79) . . . . . . . . . . . . . . . 1988,90,91 Funk, John H. (45) . . . . . . . . . . . . . . . . 1941 Fuqua, Karey A. (74) . . . . . . . . . . 1933,34,35

COACHING STAFF

D

Donaghey, Jerry . . . . . . . . . . . . . . . . . . . 1953 Donley, Lance (86) . . . . . . . . . 2000,01,02,03 Dotson, Alonzo (91) . . . . . . . . . . . . . . . . 2004 Douglas, Alfred G. . . . . . . . . . . . . . . 1917,18 Douglas, Willard . . . . . . . . . . . . . . . . 1906,09 Dowell, Charles . . . . . . . . . . . . . . 1947,48,49 Downing, Dewayne (29) . . . . . . . . . . 1979,82 Downs, Albert (73) . . . . . . . . . . . . . . . . . 1942 Drake, Bruce . . . . . . . . . . . . . . . . . . 1927,28 Drane, Dwight (33) . . . . . . . . . 1980,81,82,83 Driscoll, Mark W. (59) . . . . . . . . . . . 1970,71 Dubler, Rick . . . . . . . . . . . . . . . . . . . . . . 1984 Duggan, Gilford (69). . . . . . . . . . . 1937,38,39 Duke, Richard Lawrence (65). . . . . . . . . 1975 Dulaney, Michael (55). . . . . . . . . . . . . . . 1998 Duncan, Howard (68) . . . . . . . . . . . . 2000,01 Duncan, Terry (26) . . . . . . . . . . . . . . . . . 1990 Duncan, Tim (15,40). . . . . . . . . . . 1999,00,01 Dunkleberger, Scott . . . . . . . . . . . . . 1994 (T) Dunlap, Robert L. (9,39). . . . . . . . 1931,32,33 Dunn, Bert . . . . . . . . . . . . . . . . . . . . . . . 1895 Dunn, Lewis . . . . . . . . . . . . . . . . . . . . . . 1943 Duong, Holly. . . . . . . . . . . . . . . . . . . 1994 (T) Dupree, Marcus (22). . . . . . . . . . . . . . . . 1982 Durant, W.E. . . . . . . . . . . . . . . . . . . . 1916,17 Durham, Jere (83) . . . . . . . . . . . . . . 1957,58 Dutton, Richard L. . . . . . . . . . . . . . . . . 1974 Dutton, Todd (64) . . . . . . . . . . . . . . . . . . 1975 Dvoracek, Dusty (94) . . . . . . . 2001,02,03,04 Dye, Alan . . . . . . . . . . . . . . . . . . . . . . . . 1973 Dykes, Billy (86) . . . . . . . . . . . . . . . . 1988,91

2 0 0 5 S EAS ON

Christmon, Drew (24) . . . . . . . . . . 1990,91,92 Churchill, Tom, Sr. . . . . . . . . . . . . 1927,28,29 Clammer, Sam . . . . . . . . . . . . . . . . . . . . 1927 Clapham, Jasper . . . . . . . . 1895,96,97,98,99 Claphan, Sam (63) . . . . . . . . . . . . 1976,77,78 Clark, Bert. . . . . . . . . . . . . . . . . . . 1949,50,51 Clark, Beryl (25) . . . . . . . . . . . . . . . . 1938,39 Clark, Carl. . . . . . . . . . . . . . . . . . . . . . . . 1919 Clark, Glenn C.. . . . . . . . . . . . .1909,10,11,12 Clark, Ricky (62). . . . . . . . . . . . . . . . . . . 1996 Clark, Waymon (33) . . . . . . . . . . . . . . . . 1973 Clark, William . . . . . . . . . . . . . . . . 1912,13,14 Clark, William, N. . . . . . . . . . . . . . . . . . . 1905 Clay, Nigel (63,97) . . . . . . . . . . . . . . . . . 1988 Clayton, Mark (9) . . . . . . . . . . 2001,02,03,04 Clearman, David. . . . . . . . . . . . . . . . 1970 (M) Clements, Alex . . . . . . . . . . . . . . . . . 1902,03 Clewis, Paul (82) . . . . . . . . . . . . . 1981,82,83 Clopton, Mike (15) . . . . . . . . . . . . . . . . . 1983 Coast, Mike (48,54) . . . . . . . . . . . 1978,79,80 Coats, Michael (41) . . . . . . . . 1990,91,92,93 Cobbs, John (81) . . . . . . . . . . . . . . . . . . 1978 Cockrell, Gene (72) . . . . . . . . . . . . . . . . 1954 Cody, Dan (80) . . . . . . . . . . . . 2000,02,03,04 Coffman, Randy . . . . . . . . . . . . . . . . . . . 1972 Cohane, Tim . . . . . . . . . . . . . . . . . . . . . . 1967 Coker, Jeff . . . . . . . . . . . . . . . . . . . . 1933,34 Cole, J.W. . . . . . . . . . . . . . . . . . . . . . 1949,50 Coleman, Royce (30) . . . . . . . . . . . . . . . 1979 Coleman, Steven (90). . . . . . . . . . . . . . . 2004 Collier, Perry (26,29). . . . . . . . . . . . . 1993,94 Collier, Terry (30,33) . . . . . . . . . . . 1992,93,94 Collins, Egean (56). . . . . . . . . . . . . . . . . 1983 Collins, Harve T. . . . . . . . . . . . . . . . . . . . 1914 Collins, Patrick (33) . . . . . . . . 1984,85,86,87 Collins, Steve (10) . . . . . . . . . 1989,90,91,92 Collins, Tink (9). . . . . . . . . . . . 1989,90,91,92 Comeaux, Glenn (56) . . . . . . . . . . 1973,74,75 Comer, Jason (65) . . . . . . . . . 1992,93,94,95 Condren, Glen P. (78,88) . . . . . . . 1962,63,64 Conkright, William (55) . . . . . . . . . 1934,35,36 Conley, Tim (79) . . . . . . . . . . . . . . . . . . . 1997 Connor, John (14,41) . . . . . . . . . . . . . . . 2002 Conrad, J. R. (78). . . . . . . . . . 1992,93,94,95 Conrad, Rich (67) . . . . . . . . . . . . . . . . . . 1988 Coody, Reed (68) . . . . . . . . . . . . . . . . . . 1972 Cook, Edward. . . . . . . . . . . . . . . . . . . . . 1904 Cook, James Duane (60,72). . . . . 1960,61,62 Cook, Paul (95). . . . . . . . . . . . . . . . . . . . 1987 Cookman, Jeff (36,43) . . . . . . . . . . . 1986 (T) Cooper, Adrian . . . . . . . . . . . . 1987,88,89,90 Coots, Earl . . . . . . . . . . . . . . . . . . . . . . . 1910 Copher, Brian . . . . . . . . . . . . . . . . . . 1985 (M) Coppage, Alton (54) . . . . . . . . . . . 1937,38,39 Corbitt, Dick (74). . . . . . . . . . . . . . . . 1957,58 Corbitt, Tom R. . . . . . . . . . . . . . . . . . 1964 (M) Corey, Orville J. (33,50) . . . . . . . . 1931,32,33 Cornelius, George R. . . . . . . . . . . 1950,51,52 Cornell, Bob (14) . . . . . . . . . . . . . 1958,59,60 Correia, Joe (98,99) . . . . . . . . . . . . . 1992,94 Corrotto, Albert (41) . . . . . . . . . . . 1935,36,37 Corrotto, Eugene F. (31). . . . . . . . 1936,37,38 Coshow, Larry (71) . . . . . . . . . . . . . . . . . 1980 Couch, Jeffrey A. (98). . . . . . . . . . . . . . . 1979 Counter, Ron (32). . . . . . . . . . . . . . . . . . 1987 Courtright, Raymond . . . . . . . .1911,12,13,14 Covin, Bill . . . . . . . . . . . . . . . . . . . . . . . . 1951 Cowan, Jackie R. (32) . . . . . . . . . . . 1961,63 Cowling, L.A. . . . . . . . . . . . . . . . . . . . . . 1941 Cox, R.A. (86) . . . . . . . . . . . . . . . . . . . . 1934 Cox, Thomas S. (68,74) . . . . . . . . 1959,60,61 Coyle, Ross (84). . . . . . . . . . . . . . 1956,57,58 Crafts, Jerry (55). . . . . . . . . . . . . . . . . . . 1988 Craig, Kevin (32). . . . . . . . . . . . . . . . . . . 1976 Craig, Robert Edward (50) . . . . . . 1965,66,67 Crider, Frank. . . . . . . . . . . . . . . . . 1927,28,29 Crook, Justin. . . . . . . . . . . . . . . . . . . 1988 (M) Cross, D. Leon (61,71) . . . . . . . . . 1960,61,62 Cross, Jerry L. . . . . . . . . . . . . . . . . . . . . 1953 Cross, Rick D. (71,86) . . . . . . . . . . . . . . 1980 Cross, W.J. . . . . . . . . . . . . . . . 1904,05,06,07 Crosswhite, Kenneth (17). . . . . . . . . . . . 1975 Crosswhite, Leon M. (17) . . . . . . . 1970,71,72 Crosswhite, Rodney (17) . . . . . . . 1964,65,66 Crouch, Terry (75). . . . . . . . . . . . . 1979,80,81 Crowder, Earl F. (21). . . . . . . . . . . 1936,37,38

183


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

LETTERWINNERS

184

Goodall, Buddy (56) . . . . . . . . . . . . . . . . 1942 Goode, James (39). . . . . . . . . . . . 1988,89,90 Goodlow, Daryl (46) . . . . . . . . . . . 1980,82,83 Goodman, John (72). . . . . . . . 1976,77,78,79 Goodwin, Rick (52,61,68). . . . . . . 1965,66,67 Gordon, Murray . . . . . . . . . . . . . . . . . . 1927 Gordon, Tracy (47,52) . . . . . . . . . 1988,89,90 Gorka, Bryan (48,49) . . . . . . . . . . 1991,92,94 Gortmaker, Steven (4,5) . . . . . . . . . . . . . 1998 Graalman, Gordon . . . . . . . . . . . . . . . . 1931 Grace, George . . . . . . . . . . . . . . . . . 1936,37 Grady, Tommy (15) . . . . . . . . . . . . . . . . . 2004 Graham, Bobbye . . . . . . . . . . . . . . . 1994 (M) Graham, Elbert (77) . . . . . . . . . . . 1979,80,81 Graham, Hershel A. . . . . . . . . . . . 1918,19,22 Graham, Thomas . . . . . . . . . . . . . . . 1916,17 Gravitt, Bert W. (17) . . . . . . . . . . . . . . . . 1962 Gray, Edmund (73) . . . . . . . . . . . . 1954,55,56 Gray, Tom . . . . . . . . . . . . . . . . . . . 1948,49,50 Grayson, Bobby (12) . . . . . . . . . . 1979,80,81 Grayson, Joseph P. (32) . . . . . . . . . . . . . 1967 Greathouse, Myrle (61). . . . . . 1942,46,47,48 Green, Fred . . . . . . . . . . . . . . . . . . . 1901,03 Green, John (3) . . . . . . . . . . . . . . . . . . 1987 Green, Karl . . . . . . . . . . . . . . . . . . . . . . . 1973 Green, Merrill . . . . . . . . . . . . . . . . 1950,52,53 Green, Stanley (70) . . . . . . . . . . . . . . . . 1942 Green, Tremayne (43,46) . . . . . . . . . 1992,94 Greenberg, Alan . . . . . . . . . . . . . . . . . . 1945 Greene, Emmitt “Mickey” (58,98) . . . . . . 1986 Greenlee, C. Wayne (71) . . . . . . . . . 1954,55 Gregg, Kelly (97) . . . . . . . . . . 1995,96,97,98 Griffin, Bennett . . . . . . . . . . . . . . . . . . . . 1916 Griffin, Quentin (22) . . . . . . . . 1999,00,01,02 Griffis, Russell D. (90) . . . . . . . . . . . 1977,78 Grigg, Larry. . . . . . . . . . . . . . . . . . 1951,52,53 Grimmett, Tom (49). . . . . . . . . . . . . . . . . 1931 Grisham, Jim C. (45) . . . . . . . . . . 1962,63,64 Guess, Arthur (18,26)1 . . . . . . . 987,88,89,90 Guffey, Roy. . . . . . . . . . . . . . . . . . 1923,24,25 Gundy, Cale (12) . . . . . . . . . . 1990,91,92,93 Gutierrez, Jacob (21) . . . . . . . . . . . . . . . 2004 Gwinn, Richard L. (70) . . . . . . . . . 1956,57,58 Gwinn, Robert, . . . . . . . . . . . . . . . . . 1989 (M)

H Haag, Heinie W. (34) . . . . . . . . . . . . . . . 1931 Haberlein, Jack. . . . . . . . . . . . . . . . . 1940,41 Haddad, David . . . . . . . . . . . . . . . . . . . . 1979 Hake, Jeff (47) . . . . . . . . . . . . . . . 1983,84,85 Hale, David. . . . . . . . . . . . . . . . . . . . . . . 1984 Hale, Earl P. . . . . . . . . . . . . . . . . . 1946,47,48 Hale, Joe Cliff . . . . . . . . . . . . . . . . . . . . . 1974 Halfman, Peter F. (36) . . . . . . . . . . . 1970,72 Hall, Albert (1). . . . . . . . . . . . . 1991,92,93,94 Hall, Bernard (17,89) . . . . . . . . . . . . . . . 1987 Hall, Brian (21) . . . . . . . . . . . . 1980,82,83,84 Hall, Charles E. “Ed” (72) . . . . . . . 1964,65,66 Hall, Larry . . . . . . . . . . . . . . . . . . . . . 1963 (T) Haller, W.C. . . . . . . . . . . . . . . . . . 1925,26,27 Hallett, Bill D. . . . . . . . . . . . . . . . . . . 1944,45 Hallum, Ken (67). . . . . . . . . . . . . . . . . . . 1955 Hamilton, Raymond L. (96) . . . . . 1970,71,72 Hamilton, William . . . . . . . . . . . . . 1926,27,28 Hamm, Huel (71) . . . . . . . . . . . . . 1940,41,42 Hamm, W. Dow . . . . . . . . . . . . . . 1918,19,21 Hammert, Pete, Jr. . . . . . . . . . . . . . . 1922,23 Hammond, John (12) . . . . . . . . . . 1963,64,65 Hammons, Chris (81) . . . . . . . . . . 1998,99,00 Hamon, Claude L. (64,77). . . . . . . . . 1960,61 Han, Tony (53) . . . . . . . . . . . . . . . . . . . . 1990 Hancock, Roy . . . . . . . . . . . . . . . . . . . . . 1916 Harbuck, Jennifer . . . . . . . . . . . . . . . 1992 (T) Hardin, Lawrence (18) . . . . . . . . . . . . . . 1981 Hardin, Robert W.. . . . . . . . . . . . . . . . . . 1979 Hardy, Russell . . . . . . . . . . . . . . . . . 1918,19 Harley, John, Jr. . . . . . . . . . . . . . . . . 1943,44 Harley, John, Sr. . . . . . . . . . . . . . . . . . . . 1910 Harmon, Jason (86) . . . . . . . . . . . . . . . . 1994 Harmon, Ronald E. (83) . . . . . . . . . . 1962,63 Harold, James . . . . . . . . . . . . . . . . . . . . 1921 Harp, Laddie J. . . . . . . . . . . . . . . . . . . . . 1947 Harper, Gary (45) . . . . . . . . . . . . . 1966,67,68 Harper, Mike (40) . . . . . . . . . . . . . 1967,68,69

Harper, Scotty (3,43) . . . . . . . . . . . . . . . 1992 Harrell, Joe . . . . . . . . . . . . . . . . . . . . . . . 1945 Harris, Bill (87) . . . . . . . . . . . . . . . . . . . . 1956 Harris, Calvin Roy (6) . . . . . . . . . . . . . . . 1974 Harris, Jack (54) . . . . . . . . . . . . . . 1933,34,35 Harris, Jerome (91,93) . . . . . . . . . . . . . . 1976 Harris, Jim (15). . . . . . . . . . . . . . . 1954,55,56 Harris, Ralph (60) . . . . . . . . . . . . . 1939,40,41 Harris, Tommie (97) . . . . . . . . . . . 2001,02,03 Harrison, Bob (54) . . . . . . . . . . . . 1956,57,58 Harrison, Jon (12). . . . . . . . . . . . . . . 1970,71 Hart, Ben (37,88) . . . . . . . . . . . . . 1964,65,66 Hartford, Glen. . . . . . . . . . . . . . . . 1922,23,24 Hartley, Garrett (32) . . . . . . . . . . . . . . . . 2004 Hartline, Ronnie (45) . . . . . . . . . . 1958,59,60 Harts, John A.. . . . . . . . . . . . . . . . . . . . . 1895 Harvel, Everett . . . . . . . . . . . . . . . . . . . . 1945 Haskell, Lawrence . . . . . . . . . 1918,19,20,21 Haskins, A. Lynwood . . . . . . . . . . . . 1926,28 Hatcher, Mickey (82). . . . . . . . . . . . . . . 1976 Haught, Richard . . . . . . . . . . . . . . . . . . . 1960 Hawkins, Howard . . . . . . . . . . . . . . . . . . 1945 Haworth, Steve (6) . . . . . . . . . 1979,80,81,82 Hawpe, Mike (57) . . . . . . . . . . . . . . . 1969,72 Haycraft, Hugh . . . . . . . . . . . . . . . . . . . . 1896 Hayden, Jerry (66) . . . . . . . . . . . . . . . . . 1963 Hayes, Jim . . . . . . . . . . . . . . . . . . . . 1983 (M) Haynes, Ray (80,90). . . . . . . . . . . 1964,65,66 Heape, Gene G. . . . . . . . . . . . . . . . . 1946,49 Heard, Charles . . . . . . . . . . . . . . . . . 1943,44 Hearon, Darlon N. “Doc”. . . . . . . . 1951,52,53 Heath, Leon . . . . . . . . . . . . . . . . . 1948,49,50 Heatly, Dick. . . . . . . . . . . . . . . . . . 1949,50,51 Hebert, Bud (33). . . . . . . . . . . . . . 1976,77,79 Heinecke, Cory (89) . . . . . . . . . . . 1999,00,01 Hefley, John . . . . . . . . . . . . . . 1896,97,98,99 Helms, Randy. . . . . . . . . . . . . . . . . . 1985 (T) Henderson, Joseph S. (46,60) . . . . . . . . 1965 Henderson, R. Alan (46,83) . . . . . 1964,65,66 Henderson, Rod (17,50). . . . . 1993,94,95,96 Henderson, Zac R. (19) . . . . . 1974,75,76,77 Hendricks, Earl . . . . . . . . . . . . 1920,21,23,24 Hendricks, Viene . . . . . . . . . . . . . 1921,23,24 Herndon, Bob D. (36) . . . . . . . . . . . . 1953,54 Hess, Jeremy (73,85) . . . . . . . . . . . . 2000,01 Hetherington, Jerry (26,27). . . . . . . . . . . 1969 Hetherington, Rickey (32,37) . . . . 1966,68,69 Hettmannsperger, Harry (56,65). . . . . . . 1966 Heupel, Josh (14) . . . . . . . . . . . . . . . 1999,00 Hewes, Elmo “Bo” (68) . . . . . . . . . 1934,35,36 Hicks, Victor (80) . . . . . . . . . . . . . 1975,76,77 Hickson, Donta (35) . . . . . . . . . . . . . 2003,04 Higginbotham, John (59) . . . . . . . . . . . . 1977 Hilaire, Eric (90) . . . . . . . . . . . . . . . . . . . 2002 Hill, Harry F. . . . . . . . . . . . . . . 1918,19,20,21 Hill, Houston “Bus” . . . . . . . . . . . . . . . . 1925 Hill, Howard W. “Bill” (70) . . . . . . . 1962,63,64 Hill, James . . . . . . . . . . . . . . . . . . . . . . . 1945 Hill, Kyle (13). . . . . . . . . . . . . . . . . . . 1991,93 Hill, Scott (7). . . . . . . . . . . . . . 1973,74,75,76 Hillis, James H.. . . . . . . . . . . . . . . . . 1982 (T) Hines, Percy (32) . . . . . . . . . . . . . . . 1983,84 Hinton, Eddie (33). . . . . . . . . . . . . 1966,67,68 Hobby, Brewster (32) . . . . . . . . . . . . 1959,60 Hoffman, Wayne (41,81). . . . . . . . 1972,73,74 Hogan, Patrick (27). . . . . . . . . . . . . . . . . 1963 Hoge, John (9) . . . . . . . . . . . . . . . . . . . . 1979 Holieway, Jamelle (4) . . . . . . . 1985,86,87,88 Holland, J.D.. . . . . . . . . . . . . . . . . . . . . . 1912 Holland, Lonnie (14) . . . . . . . . . . . . . . . . 1956 Holland, Weaver . . . . . . . . . . . . . . . . . . . 1910 Holleyman, Bary (93,99). . . . . 1998,99,00,01 Holloway, Don. . . . . . . . . . . . . . . . . . 1983 (M) Holman, Jay (63) . . . . . . . . . . . . . . . . . . 1975 Holt, Jack D. (34) . . . . . . . . . . . . . . . 1958,59 Hood, Fred . . . . . . . . . . . . . . . . . . . . . . . 1955 Horkey, Joe R. . . . . . . . . . . . . . . . 1948,49,50 Hotchkiss, Lewis (45) . . . . . . . . . . . . . . . 1938 Hott, Oliver . . . . . . . . . . . . . . . 1913,14,15,16 Hott, Sabert . . . . . . . . . . . . . . .1910,11,12,13 Hott, Willis. . . . . . . . . . . . . . . . 1913,14,15,16 Houston, Brandon (70) . . . . . . . . . 1989,90,91 Houtman, Jay (37) . . . . . . . . . . . . . . . . 1992 Hover, Lee (9). . . . . . . . . . . . . . . . 1975,76,77 Howard, James. . . . . . . . . . . . . . . . . . . . 1979 Hubbard, Edward (32) . . . . . . . . . . . . . 1934

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Hubble, Rocky (67). . . . . . . . . . . . . . 1981,82 Huddleston, Woody (82). . . . . . . . 1935,36,37 Hudgens, David (70). . . . . . . . . . . . . 1976,77 Huffman, Bill . . . . . . . . . . . . . . . . . . . . . . 1945 Huffman, Eric . . . . . . . . . . . . . . . . . . 1990 (M) Hughes, Harry . . . . . . . . . . . . . . . 1904,05,06 Hughes, Randy (19) . . . . . . . . . . . 1972,73,74 Hull, Ronn (70,84,89) . . . . . . . . . . . . . . 1994 Hulsey, Grant (95) . . . . . . . . . . . . . . . . . 2004 Hunt, Daryl (85) . . . . . . . . . . . 1975,76,77,78 Hunt, Jay (21). . . . . . . . . . . . . . . . . . . . . 2000 Hurst, Derrick (57) . . . . . . . . . . . . . . 2001,02 Husack, John E. . . . . . . . . . . . . . . 1946,47,48 Hussey, Pat (23) . . . . . . . . . . . . . . 1972,73,74 Hutson, Mark (79). . . . . . . . . . 1984,85,86,87 Hybl, Nate (8) . . . . . . . . . . . 2000, 2001, 2002

I Ingram, Austin. . . . . . . . . . . . . . . . . . . . . 1952 Ingram, Clint (37,44). . . . . . . . . . . 2002,03,04 Ingram, Jerry . . . . . . . . . . . . . . . . 1950,51,52 Inman, Richard Walton (92) . . . . . . . . . . 1961 Irmscher, Chris . . . . . . . . . . . . . . . . . 1987 (M) Irvin, Darrell (59,92) . . . . . . . . . . . . . 1978,79 Irvin, Kyle (16) . . . . . . . . . . . . . . . . . . . . 1984 Irvin, Oliver . . . . . . . . . . . . . . . . . . . . . . 1906 Ivory, Horace (29,32) . . . . . . . . . . . . 1975,76 Ivy, Corey L. (43) . . . . . . . . . . . . . 1995,96,97 Ivy, Corey T. (9) . . . . . . . . . . . . . . . . 1997,98 Ivy, Frank “Pop” (68). . . . . . . . . . . 1937,38,39

J Jackson, Alvin. . . . . . . . . . . . . . . . . . 1921,22 Jackson, Brent (27,43) . . . . . . . . . . . 1998,00 Jackson, Elvin E. . . . . . . . . . . . . . . . 1943,44 Jackson, Grady (38) . . . . . . . . . . . . . . . . 1931 Jackson, James Ray (28). . . . . . . . . . . 1966 Jackson, Jarrail (1,2,19) . . . . . 1996,97,98,99 Jackson, Jonathan (49) . . . . . 2001,02,03,04 Jackson, Keith (88) . . . . . . . . 1984,85,86,87 Jackson, Kerry (14_ . . . . . . . . . . . . . 1972,74 Jackson, Michael (14) . . . . . . . . . . . . . . 1999 Jackson, Mickey (87) . . . . . . . . . . . . 1957,59 Jackson, Pasha (8,53) . . . . . . . . . . . 2002,03 Jacobs, Jack (27) . . . . . . . . . . . . . 1939,40,41 Jacobs, Jay. . . . . . . . . . . . . . . . . . . . . . . 1982 Jamar, Gary (37). . . . . . . . . . . . . . . . . . . 1968 James, Harold L. . . . . . . . . . . . . . . . . . . 1921 Janes, Charles Art . . . . . . . . . . . . . . 1949,50 Jarman, George W. (66). . . . . . . . . . 1961,63 Jenkins, Delbert . . . . . . . . . . . . . . . . . . . 1899 Jenkins, William . . . . . . . . . . . . . . . . . . . 1899 Jenkinson, Steve (2). . . . . . . . . . . . . . . 1974 Jennings, Bill (66). . . . . . . . . . . . . 1938,39,40 Jennings, Doyle D. (61) . . . . . . . . 1955,56,57 Jennings, Steve (90) . . . . . . . . . . 1956,57,58 Jensen, Chris (67) . . . . . . . . . . . . . . . . . 1991 Jensen, Lester . . . . . . . . . . . . . . . . . . . . 1945 Jensen, Robert M. (67,79) . . . . . . . . 1971,72 Jimerson, Brian (50) . . . . . . . . . . . . . . . . 2000 Jimerson, Jay (15) . . . . . . . . . 1977,78,79,80 Johnson, Andre (6) . . . . . . . . . . . . . . . . 1984 Johnson, Corey (27). . . . . . . . . . . . . 1990,91 Johnson, Darrius (42). . . . . . . 1992,93,94,95 Johnson, E.B. . . . . . . . . . . . . 1921,22,23,24 Johnson, Earl (5) . . . . . . . . . . . . . 1983,84,86 Johnson, Graham B.. . . . . . . . . . . . . 1916,17 Johnson, Greg (75). . . . . . . . . 1984,85,86,87 Johnson, Keith . . . . . . . . . . . . . . . . . 1978 (M) Johnson, Mark D. . . . . . . . . . . . . . . . 1980 (M) Johnson, Mickey R. (56). . . . . 1955,56,57,58 Johnson, Montford . . . . . . . . . . . . 1914,15,16 Johnson, Montford T. III (25) . . . . . . 1969,70 Johnson, Neil R. . . . . . . . . . . . . . . . 1913,14 Johnson, Oscar . . . . . . . . . . . . . . . . 1900,01 Johnson, Troy (80,88). . . . . . . 1984,85,86,87 Johnson, Wallace (46) . . . . . . . . . . . . . . 1961 Johnson, Wally . . . . . . . . . . . . . . . . . . . 1982 Johnston, Paul X. . . . . . . . . . . . . . 1918,19,20 Johnston, Ross. . . . . . . . . . . . . . . 1916,17,18 Johnston, W.R. . . . . . . . . . . . . . . . 1916,17,19 Jones, Brandon (81). . . . . . . . 2001,02,03,04

Jones, Cedric (57) . . . . . . . . . 1992,93,94,95 Jones, Danté (50). . . . . . . . . . 1984,85,86,87 Jones, Harold (71,92). . . . . . . . . . . . . . . 1989 Jones, Jim (62,88) . . . . . . . . . . . . 1979,80,81 Jones, Kejuan (20) . . . . . . . . . . . . 2002,03,04 Jones, Ken (72,98) . . . . . . . . . . . . 1970,71,72 Jones, Ontei (11,38,42) . . . . . 1997,98,99,00 Jones, Russell (6,25) . . . . . . . . . . . . 1991,92 Jones, Sedric (48) . . . . . . . . . 1996,97,98,99 Jones, W.D. “Buddy”. . . . . . . . 1947,48,49,50 Jordan, Phil. . . . . . . . . . . . . . . . . . 1969,70,71 Joseph, Davin (77) . . . . . . . . . . . . 2002,03,04 Joseph, Gana (29,38). . . . . . . . . . 1996,97,98 Joseph, Jason (18). . . . . . . . . . . . . . 1998,99 Joyce, Micheal R. (83) . . . . . . . . . . . . . 1980 Joyner, Barry (42). . . . . . . . . . . . . 1978,79,80 Judkins, John F. . . . . . . . . . . . . . . . . . . . 1986 Justice, Chris (40,46) . . . . . . . . . . . . . . . 1996

K Kabba, Ahmed (5) . . . . . . . . . . . . . . 1997,98 Kaighan, Mike (43,54) . . . . . . . . . . . . . 1994 Kalsu, Bob (77,94) . . . . . . . . . . . . 1965,66,67 Kaltenbacher, Jim. . . . . . . . . . . . . . . . . 1984 Kaspar, Kert (46) . . . . . . . . . . . . . 1984,87,88 Keadle, Robert D. (33,42). . . . . . . . . . . 1960 Kearney, Vic (31) . . . . . . . . . . . . . 1970,71,72 Keeling, Mike (99). . . . . . . . . . 1979,80,81,82 Keeton, Durwood (21) . . . . . . . . . . . 1972,73 Keith, Jason (58) . . . . . . . . . . . . . 1990,91,92 Keith, Olin (37) . . . . . . . . . . . . . . . . . 1939,40 Keller, Troy Kay . . . . . . . . . . . . . . 1950,52,53 Kempenich, Scott (72) . . . . . . 1997,98,99,00 Kennedy, Jon R. (48) . . . . . . . . . . 1964,65,66 Kennon, Doug. . . . . . . . . . . . . . . . . . 1986 (T) Kennon, Lee V. (60) . . . . . . . . . . . . . . . . 1943 Key, Don (60) . . . . . . . . . . . . . 1979,80,81,82 Kidd, Summie . . . . . . . . . . . . . . . . . . 1926,27 Killingsworth, Joe (83) . . . . . . . . . 1967,68,69 Killingsworth, T.K. . . . . . . . . . . . . . . . 1974 (M) Killion, Kirk (83) . . . . . . . . . . . . . . . . 1973,74 Kilpatrick, Darren (90). . . . . . . 1984,85,86,87 Kimball, Robert L. (21) . . . . . . . . . . . 1977,78 Kindley, Don L., Jr. (52) . . . . . . . . . . 1965,66 King, Aubrey (87,97) . . . . . . . . . . . . 1985,86 King, David W. (57) . . . . . . . . . . . . . . . 1967 King, Glenn (21) . . . . . . . . . . . . . . 1969,70,71 King, Kenny (30). . . . . . . . . . . . . . 1976,77,78 Kinlaw, Reggie (62) . . . . . . . . 1975,76,77,78 Kirby, Darrell (78,96,97) . . . . . . . . . . . . . 1990 Kirby, Monty . . . . . . . . . . . . . . . . . . . . . . 1976 Kircher, Omer* . . . . . . . . . . . . . . . . . . . . . (M) Kirk, Clyde (16). . . . . . . . . . . . . . . 1928,29,30 Kitchell, Charles Abe . . . . . . . . . . . . . . 1928 Kitchens, Gus (18) . . . . . . . . . . . . . . 1938,39 Klein, Kory (93) . . . . . . . . . . . 2000,01,02,03 Klitzman, Robert (54) . . . . . . . . . . . . . . 1969 Knapp, Jim . . . . . . . . . . . . . . . . . . . . . . . 1961 Knight, Alford Eugene (38) . . . . . . . . . . . 1965 Koller, John (81) . . . . . . . . . . . . . . 1965,66,67 Koontz, Brent (52,91) . . . . . . . 1990,91,92,94 Kosmos, Mark (69,90) . . . . . . . . . . . 1965,66 Kramer, Forrest. . . . . . . . . . . . . . . . . . . . 1916 Kramer, Kyle (82) . . . . . . . . . . . . . . . . . . 1994 Kreick, Edward . . . . . . . . . . . . . . . . . 1946,47 Krisher, Bill (65) . . . . . . . . . . . . . . 1955,56,57 Krivanek, Louis. . . . . . . . . . . . . . . . . 1994 (M) Kuhn, Buster (38,39) . . . . . . . . . . . . 1997-99 Kulbeth, Ralph L. (51,69) . . . . . . . . . . . 1975 Kunkle, Steve (58) . . . . . . . . . . . . . . . . 1975 Kusiak, Joe (68) . . . . . . . . . . . . . . . . 1968,69

L LaCrosse, Clane (50,54) . . . . . . . . . . . 1993 La Rosa, Vince (52) . . . . . . . . . . . . . 1969,70 Ladd, Benton (75) . . . . . . . . . . . . 1955,56,57 Lahar, Harold W. (32) . . . . . . . . . . 1938,39,40 Lamb, Roy . . . . . . . . . . . . . . . . . . . . 1923,24 Lamb, W.G. (68) . . . . . . . . . . . . . . 1940,41,42 Lambert, Chris P., Sr. (43) . . . . . . . . . . . 1942 Lancaster, Eddie (62,63,76) . . . . . . . 1967,68 Land, Proctor (34,97) . . . . . . . . . . 1989,90,91


LETTERWINNERS N Nairn, James . . . . . . . . . . . . . .1908,09,10,11 Needs, Al . . . . . . . . . . . . . . . . . . . 1945,48,50 Neely, Ralph E. (77) . . . . . . . . . . . 1962,63,64 Neher, Leroy (35) . . . . . . . . . . 1941,42,46,47 Nelson, Derrick (67) . . . . . . . . . . . . . . . 1996 Nelson, Don . . . . . . . . . . . . . . . . . . . . . . 1957 Nelson, F. Wayne (18,28) . . . . . . . . . . . . 1967 Nelson, George N. (50) . . . . . . . . . . . . . 1954 Nelson, John (83) . . . . . . . . . . . . . . . . . . 1994 Nelson, Roger D. . . . . . . . . . . . . . 1951,52,53 Nelson, Roy . . . . . . . . . . . . . . . . . . . . . 1929 Nemecek, Vivian (95) . . . . . . . . . . . . 1934,35 Newland, Scott (81) . . . . . . . . . . . 1982,83,84 Newton, Charles E. (98) . . . . . . . . . . . . 1968 Nicholson, Donte (8) . . . . . . . . . . . . 2003,04 Nicholson, John (99) . . . . . . . . . . . . . . 1970 Nixon, Fred (11) . . . . . . . . . . . 1976,77,78,79 Nixon, Laenar (82) . . . . . . . . . . . . . . . . . 2004 Noles, Dan M. (48,53) . . . . . . . . . . . . . . 1969 Nolte, David . . . . . . . . . . . . . . . . . . . 1982 (M) Nordgren, Geoffrey E. (19) . . . . . . 1969,70,71 Norman, Josh (3,30,31) . . . . . 1998,99,00,01 Norris, Granville T. . . . . . . . . . . . . 1925,26,27 Northcutt, Ken (62) . . . . . . . . . . . 1954,55,57 Norvell, J.C. . . . . . . . . . . . . . . . . . . . 1992 (M) Norwood, Pete (17) . . . . . . . . . . . . . . . . 1992

O

P

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

Paaso, Dick (79). . . . . . . . . . . . . . 1966,67,68 Pace, Bobby W. . . . . . . . . . . . . . . 1962,63,64 Pace, Harrison W. . . . . . . . . . . . . . . . . 1950 Page, Bobby (18) . . . . . . . . . . . . . 1962,63,64 Page, G. Robert (17) . . . . . . . 1957,58,59,61 Page, Harland. . . . . . . . . . . . . . . . . . . . . 1934 Paine, Charles W. . . . . . . . . . . . . . . . . . 1949 Paine, Homer . . . . . . . . . . . . . . . . 1946,47,48 Pair, Gaylengburn, Sam L. . . . . . . . . . . . 1926 Pannell, Larry (66,69,94) . . . . . . . . . . . . 1962 Pannell, Tommy (19). . . . . . . . . . . 1963,64,65 Pannell, William (56). . . . . . . . . . . . . . . . 1962 Pansze, Art (3) . . . . . . . . . . . . . . 1932,33,34 Pansze, William N. (2,11) . . . . . . 1931,32,33 Panter, Adam (64). . . . . . . . . . . . . . . . . 2003 Panter, Ben (67) . . . . . . . . . . 1998,99,00,01 Parham, Duncan (82) . . . . . . . . . . . 1986,87 Parker, De’Mond (33,48) . . . . . . . 1996,97,98 Parker, James (42,87) . . . . . . . . . . . 1960,62 Parker, Kenneth W. . . . . . . . . . . . 1947,48,49 Parker, Paul (62,63,96) . . . . . . . . 1981,82,83 Parks, Edward Mickey (98) . . . . . . . 1934,37 Parks, Jerry (58). . . . . . . . . . . . . . . . . . . 1988

REVIEW & OPPONENTS

O’Gara, Bill (54,64,68) . . . . . . . . . . . 1977,78 O’Grady, Kevin . . . . . . . . . . . . . . . . . 1969,70 O’Neal, Benton (19) . . . . . . . . . . . . . . . . 1958 O’Neal, Jay (17) . . . . . . . . . . . . . . 1954,55,56 O’Neal, Matt (60) . . . . . . . . . . . . . . . 1998,99 O’Neal, Pat (35) . . . . . . . . . . . 1951,52,53,54 O’Neal, Preston, Jr. . . . . . . . . . . . . . 1953,54 O’Neal, Robert (36) . . . . . . . . . . . . . . . . 1992 O’Shaughnessy, Steve (18) . . . . . 1969,70,71 Oatts, Paul (55) . . . . . . . . . . . . . . . . . . 1993 Odom, Brian (24) . . . . . . . . . . . . . . . . . 2001 Ogilive, Frank A. . . . . . . . . . . . . . . . . . . . 1920 Onyenegecha, Chijioke (22). . . . . . . . . . 2004 Orendorff, Bill (64) . . . . . . . . . . . . . . . . 1972 Orr, Charles . . . . . . . . . . . . . . . . . . . . . . 1912 Orr, Ellis . . . . . . . . . . . . . . . . . . . . . . 1928,29 Oubre, Louis (66) . . . . . . . . . . . . . 1978,79,80 Oujesky, Joseph B. (68) . . . . . 1954,55,56,57 Ousley, Scott (44) . . . . . . . . . . . . . . . 1997,98 Overstreet, David (22 . . . . . . . 1977,78,79,80 Overton, Milton (63,74,94) . . . 1992,93,94,95 Owens, Jim. . . . . . . . . . . . . . . 1946,47,48,49 Owens, Roger Ray (36) . . . . . . . . . . . . . 1976 Owens, Roy (11). . . . . . . . . . . . . . . . . . 1983 Owens, Steve (36) . . . . . . . . . . . . 1967,68,69 Owens, Tinker (11. . . . . . . . . . 1972,73,74,75 Ozumba, Chike (62) . . . . . . . . . . . 2000,01,02

THE SOONERS

Mabry, Jeffrey C. (6) . . . . . . . . . . . . . . . . 1974 MacDuff, Larry (92). . . . . . . . . . . . . . 1968,69 Macias, Tim (53,77) . . . . . . . . . . . 1996,97,98 Mackey, Damian (13,36). . . . . . . . 1999,00,01 Mackey, Paul . . . . . . . . . . . . . . . . 1896,97,98 Malone, Fred R. (85) . . . . . . . . . . . . 1966,68

McQuarters, Ed L. (64). . . . . . . . . 1962,63,64 McReynolds, Edwin C. . . . . . . . . . . . . . 1910 McReynolds, Joe (1). . . . . . . . . . . . . 1973,75 Meacham, Bill (19) . . . . . . . . . . . . . . . . . 1960 Meacham, Edgar . . . . . . . . . . . . . 1911,12,13 Meacham, Randy (86,89). . . . . . . 1966,67,68 Mears, Gene (55) . . . . . . . . . . . . . 1952,53,54 Medice, Larry (62,67) . . . . . . . . . . 1988,89,90 Medlock, Newt . . . . . . . . . . . . . . . . . . . . 1895 Meinhert, Lloyd. . . . . . . . . . . . . . . . . . . 1943 Melendez, Jaime H. (60) . . . . 1973,75,76,77 Melson, Chris (8,17) . . . . . . . 1988,89,90,91 Mendenhall, Ken (50,69) . . . . . . . 1967,68,69 Merkle, Fred . . . . . . . . . . . . . . 1896,97,98,99 Merkle, Joe . . . . . . . . . . . . . . 1896,97,98,99 Merrell, Webber (77) . . . . . . . . . . . . 1936,37 Messner, Chris (79) . . . . . . . . . . . . . 2003,04 Metcalf, L.A. “Butch” (75) . . . . . . . 1962,63,64 Meyer, Clifford . . . . . . . . . . . . . . . . . . . . 1915 Mickey, Joey (82) . . . . . . . . . . 1989,90,91,92 Migliazzo, Paul (42) . . . . . . . . 1983,84,85,86 Milburn, Glyn (5). . . . . . . . . . . . . . . . . . . 1988 Mildren, Jack (11) . . . . . . . . . . . . . 1969,70,71 Mildren, Richard (48) . . . . . . . . . . . . . . . 1973 Miles, Mitch. . . . . . . . . . . . . . . . . . . . 1990 (M) Miller, Jeff (57) . . . . . . . . . . . . . . . . . 1989,90 Miller, T.B. . . . . . . . . . . . . . . . . . . . . . 1933,34 Millington, Akim (69) . . . . . . . . . . . . . . . . 2004 Mills, Bus (21) . . . . . . . . . . . . . . . 1928,29,30 Mills, P.J. (4,17) . . . . . . . . . . . . . . . . . . . . . . ? Mills, Ron (36) . . . . . . . . . . . . . . . . . . . . 1981 Milstead, Jon (49). . . . . . . . . . . . . 1970,71,72 Milstead, Karl (63) . . . . . . . . . . . . 1959,60,61 Ming, Leslie L. . . . . . . . . . . . . . . . . . . . . 1948 Miskovsky, John (75) . . . . . . . . . . 1933,34,35 Mitchel, Eric (1). . . . . . . . . . . . 1985,86,87,88 Mitchell, Jack . . . . . . . . . . . . . . . . 1946,47,48 Mitchell, Lance (10) . . . . . . . . . . . 2002,03,04 Mobra, Joe (16) . . . . . . . . . . . . . . 1953,54,55 Monnett, Jim. . . . . . . . . . . . 1902,03,04,05,06 Montgomery, Homer . . . . . . . . . . . 1914,15,16 Montgomery, Sam . . . . . . . . . . . . . . . . . 1916 Mooney, Prentiss. . . . . . . . . . . . . . . . 1926,27 Moore, Billy Jack (64). . . . . . . . . . 1957,58,59 Moore, Brandon (46) . . . . . . . 1997,98,99,01 Moore, Derland (97) . . . . . . . . . . . . 1971,72 Moore, Dewayne . . . . . . . . . . . . . . . 1987 (M) Moore, Eric (1,2,3) . . . . . . . . . 1995,96,97,98 Moore, Frank (97) . . . . . . . . . . . . . . . . . 1979 Moore, Grant . . . . . . . . . . . . . . . . . . 1994 (T) Moore, Harry. . . . . . . . . . . . . . . . . 1948,49,50 Moore, Jerald (7,30) . . . . . . . . . . . 1993,94,95 Moore, John . . . . . . . . . . . . . . . . . . . 1925,26 Moore, Kirk (23) . . . . . . . . . . . . . . . . . . . 1988 Moore, Obie (57) . . . . . . . . . . 1973,75,76,77 Moreno, Dennis . . . . . . . . . . . . . . . . 1986 (M) Morford, Clare E. (65). . . . . . . . . . . . 1941,42 Morford, Robert B. (67). . . . . . . . . 1957,58,59 Morford, R. Brent (94) . . . . . . . . . . . . . . 1960 Moriarty, Paul (64) . . . . . . . . . . . . . . 1991,92 Morris, Lee A., Jr. (84) . . . . . . . . . . . . . . 1985 Morris, Bill (63) . . . . . . . . . . . 1941,42,46,47 Morris, Cecil (74) . . . . . . . . . . . . . 1953,54,55 Morris, Dennit E. (51) . . . . . . . . . . 1955,56,57 Morris, Max (75,95) . . . . . . . . . . . . . 1958,60 Morrison, C.E., “Ram”. . . . . . . 1920,21,22,24 Morter, Ray A. . . . . . . . . . . . . . . . . . 1909,10 Morton, Don . . . . . . . . . . . . . . . . . . . . . 1975 Moseley, Donald G. . . . . . . . . 1976,77,78 (T) Moses, James (89). . . . . . . . . . . . 2002,03,04 Moss, William B.. . . . . . . . . . . . . . . . . . . 1911 Moyer, Greg (54,94) . . . . . . . . . . . . . . . . 1996 Mozee, Jamar (43) . . . . . . . . . . . . . . 2000,01 Muhammad, Greg (50,69) . . . . . . . . 1998,99 Mulac, John (64). . . . . . . . . . . . . . . . 1996,97 Muldrow, Alvin. . . . . . . . . . . . . . . . . . . . . 1928 Muldrow, Hal. . . . . . . . . . . . . . . . . 1925,26,27 Mullen, John Daniel (58). . . . . . . . 1970,71,72 Mullen, Michael L. (62) . . . . . . . . . . . . . . 1969 Mullen, Ray R. (45) . . . . . . . . . . . . . 1941,42 Munn, Jeff. . . . . . . . . . . . . . . . . . . . . . . . . . . . Munsey, J.S. (34) . . . . . . . . . . . . . 1939,40,41 Murphy, Kevin (39) . . . . . . . . . 1981,82,83,85 Murray, Richard (76). . . . . . . . . . . . . . . . . . . .

COACHING STAFF

M

Malone, Terrance (49,81) . . . . . . . 1995,96,97 Maloney, Don J. (22,23) . . . . . . . . . . . . . 1985 Maloney, Pete (44) . . . . . . . . . . . . . . . . . 1931 Manley, Leon . . . . . . . . . . . . . . . . 1947,48,49 Manly, J.R. (22) . . . . . . . . . . . . . . 1937,38,39 Manning, Terran (64). . . . . . . . 1987,88,89,90 Mantle, Mike (60) . . . . . . . . . . . . . 1983,84,85 Manuel, Rod (73,85). . . . . . . . 1993,94,95,96 Marcum, Delton . . . . . . . . . . . . . . . . . . 1949 Marks, Richard W. (70,87) . . . . . . 1985,86,87 Marsee, Jack (64). . . . . . . . . . . . . 1939,41,42 Marsh, James H. . . . . . . . . 1918,19,20,21,22 Marsh, Victor . . . . . . . . . . . . . . . . 1927,28,29 Marshall, Everett (24,80) . . . . . . . 1969,70,71 Marshall, Torrance (10). . . . . . . . . 1999,2000 Martin, Bob (86) . . . . . . . . . . . . . . . . . . . 1956 Martin, Fred . . . . . . . . . . . . . . . . . . . . . . 1918 Martin, Howard C. . . . . . . . . . . . . . . 1925,26 Martin, Jason . . . . . . . . . . . . . . . . . . 1995 (M) Martin, John (43) . . . . . . . . . . . . . . . 1938,40 Martin, Leo (78,80) . . . . . . . . . . . . 1974,75,76 Martin, Randy (84) . . . . . . . . . . . . . . . . . 1984 Martin, Robert. . . . . . . . . . . . . . . . . . . . . 1911 Martin, William A. . . . . . . . . . . 1938,39,40,41 Mason, Rick (55) . . . . . . . . . . . . . . . 1969,70 Massad, Ernest L. (24,42) . . . . . . 1929,30,31 Mathes, Donald E. . . . . . . . . . . . . . . . . . 1922 Mathews, Orville (35) . . . . . . . . . . 1939,40,41 Mathis, Reggie (58,86) . . . . . . . . . 1976,77,78 Mathis, Will (65) . . . . . . . . . . . . . . 1999,00,01 Mattox, William (25) . . . . . . . . . . . 1940,41,42 Maxfield, Ralph (18,92) . . . . . . . . . . 1960,61 Mayes, Clair S. . . . . . . . . . . . . . . . 1948,49,50 Mayfield, Corey (46,52) . . . . . . . . 1989,90,91 Mayfield, R.C. “Bob” . . . . . . . . . . . . . 1943,44 Mayhew, J.A. “Al” . . . . . . . . . . . . . 1927,28,29 Mayhew, Matt (6,30,84) . . . . . . . . . . 1999,00 Mayhue, Charles D. (14) . . . . . . . 1962,63,64 Mays, Ed B. . . . . . . . . . . . . . . 1946,47,48,49 McAdams, Carl (51) . . . . . . . . . . . 1963,64,65 McBride, Brad (48) . . . . . . . . . 1984,85,86,87 McCain, Frank . . . . . . . . . . . . . . . 1915,16,17 McCall, Aubrey . . . . . . . . . . . . . . . . . . . . 1945 McCampbell, Richard (32) . . . . . . . . . . . 1976 McCartney, John . . . . . . . . . . . . . . . . . . 1900 McCarty, Howard W. (34) . . . . . . . . . 1937,38 McCasland, T. Howard . . . . . . . . . . . 1914,15 McClellan, Mike (31). . . . . . . . . . . 1959,60,61 McCloud, Marc Dwight (78) . . . . . . . . . . 1974 McClure, Bruce (73) . . . . . . . . 1994,95,96,97 McClure, Daniel Edwin II (32). . . . . . . . . 1974 McCoy, James P. (70) . . . . . . . . . . . . . . 1961 McCoy, Matt (34) . . . . . . . . . . 2000,01,02,03 McCreary, Byrom . . . . . . . . . . 1902,03,04,05 McCullough, Hugh (26). . . . . . . . . . . 1937,38 McCurdy, Rick (80). . . . . . . . . . . . 1962,63,64 McCutcheon, Bill. . . . . . . . . . . . . . . . 1896,97 McDade, Billy (23,25) . . . . . . . . . . . . . . . 1991 McDade, Laddie Burl . . . . . . . . . . . . . . . 1949 McDaniel, Wahoo (40) . . . . . . . . . 1957,58,59 McDaniel, Mike (6,10,14) . . . . . . . 1994,95,96 McDannald, Morris R. (69) . . . . . . 1933,34,35 McDermott, Hugh V. . . . . . . . . . . . 1916,17,19 McDonald, Chris. . . . . . . . . . . . . . . . 1991 (T) McDonald, Don (49) . . . . . . . . . . . . . . . 1942 McDonald, Jeff . . . . . . . . . . . . . . . . . . . 1981 McDonald, Tommy (25) . . . . . . . . 1954,55,56 McDonough, Kevin (89) . . . . . . . . . . . . . 1979 McDougle, Stockar (78) . . . . . . . . . . 1998,99 McFadden, Alfred . . . . . . . . . . . . . . . 1922,23 McFerron, George . . . . . . . . . . . . . . . . . 1916 McGee, Garrick (8). . . . . . . . . . . . . . 1994,95 McGee, Reece . . . . . . . . . . . . . . . . . . . 1948 McGehee, Perry E. (51) . . . . . . . . . . . . . 1969 McGlothlin, Claude . . . . . . . . . . . . . . 1916,17 McGraw, Joseph. . . . . . . . . . . . . . . . . . . 1898 McGruder, Lynn (96). . . . . . . . . . . 2002,03,04 McKim, Jay D. (35). . . . . . . . . . . . 1978,79,80 McKinley, Mike (31) . . . . . . . . 1987,89,90,91 McKinley, William . . . . . . . . . . . . . . . 1920,21 McLaughlin, John (69) . . . . . . . . . . . 1971,72 McLaughlim, Mike (85) . . . . . . . . . . . 1971,72 McMichel, Ken (12,17) . . . . . . 1986,87,88,89 McNabb, Norman . . . . . . . . . . 1946,48,49,50 McPhail, Buck. . . . . . . . . . . . . . . . 1950,51,52 McPhail, Gerald . . . . . . . . . . . . . . . . 1954,55

2 0 0 5 S EAS ON

Lane, Lester . . . . . . . . . . . . . . . . . . . . . 1952 Lang, Noland W., Jr. . . . . . . . . . . . . . . . . 1949 Lang, Vernon (68) . . . . . . . . . . . . 1958,59,60 Langston, Chuck (75) . . . . . . . 1992,93,94,95 Larghe, Steve (37) . . . . . . . . . . . . . . . . . 1976 Larue, William (33) . . . . . . . . . . . . . . 1938,39 Lashar, R.D. (13) . . . . . . . . . . 1987,88,89,90 Lashar, Tim (31) . . . . . . . . . . . 1983,84,85,86 Latham, Bob, Jr. (56,57). . . . . 1985,86,87,88 Latimer, Zach (46). . . . . . . . . . . . . . . 2003,04 Laurita, Al (62,64) . . . . . . . . . . 1984,85,86,87 Lawrence, J. Adair . . . . . . . . . . . . . . . . . 1918 Lawrence, Jim (92). . . . . . . . . . . . 1956,57,58 Lea, Paul (36). . . . . . . . . . . . . . . . . . 1961,62 Leake, John “Buddy,” Jr. (22) . 1951,52,53,54 Lear, Alvin (48) . . . . . . . . . . . . . . . . . . . . 1962 Leavell, Ron . . . . . . . . . . . . . . . . .1959,60 (T) Lebow, Derald . . . . . . . . . . . . . . . . . 1943,44 Lecrone, Leroy . . . . . . . . . . . . . . . 1925,26,27 Lecrone, Ray . . . . . . . . . . . . . . . . 1925,26,27 Ledbetter, Jerome (20) . . . . . . . . . 1980,83,84 Ledbetter, Weldon (43) . . . . . . . . . 1979,80,82 Lee, Frank . . . . . . . . . . . . . . . . . . . . . . . 1930 Lee, Hilary (34). . . . . . . . . . . . . . . . . 1929,30 Lee, John . . . . . . . . . . . . . . . . . . . . . 1928,29 Lee, Steve (81). . . . . . . . . . . . . . . . . . . . 1988 Lee, William Wayne (50,51,75) . . 1960,61,62 Legg, Jerry A.. . . . . . . . . . . . . . . . . . . . 1980 Leggett, Scott (70) . . . . . . . . . . . . . . . . . 1983 Lehman, Teddy (11,54). . . . . . 2000,01,02,03 Lemon, William. . . . . . . . . . . . . . . . . . . 1907 Lester, Chuck.. . . . . . . . . . . . . . . . . . 1977 (M) Levonitis, Bill (37). . . . . . . . . . . . . . . . . . 1959 Levy, Tony (22) . . . . . . . . . . . . . . . . . 1990,91 Lewis, Brian (82). . . . . . . . . . . . . . . . 1995,96 Lewis, Chris (82). . . . . . . . . . . . . . . . . . 1997 Lewis, Fred (95) . . . . . . . . . . . . . . . . 1994,95 Lewis, Gilmer A., Jr. (73) . . . . . . . 1957,58,59 Lewis, Hardie (20,23) . . . . . . . . . . . . 1930,31 Lewis, Ike (1,29) . . . . . . . . . . . . . . . . 1989,90 Lewis, Johnny (95) . . . . . . . . . 1978,79,80,81 Liggins, Granville (66,93) . . . . . . . 1965,66,67 Light, Earl . . . . . . . . . . . . . . . . . . . . . . . 1917 Link, Donald . . . . . . . . . . . . . . . . . . . . . . 1943 Link, Emery A. (68). . . . . . . . . . . . . . . . . 1953 Linn, Jim (18,33,84) . . . . . . . . . . . . . . . . 1968 Linzy, Marceline Chavez (47) . . . . . . . . . 1974 Lisak, Edward J. . . . . . . . . . . . . . . 1948,49,50 Little, Kenneth (89) . . . . . . . . . . . . 1933,34,35 Little, Mo (18) . . . . . . . . . . . . . . . . . . 1996,97 Littlejohn, Wray (85) . . . . . . . . 1951,52,53,54 Littrell, Jim (42). . . . . . . . . . . . . . . 1973,74,75 Littrell, Seth (35) . . . . . . . . . . . 1997,98,99,00 Lively, William Prentice. . . . . . . . . . . . . . 1915 Locke, Norval (51) . . . . . . . . . . . . 1936,38,39 Lockett, David M. . . . . . . . . . . . . . 1949,50,51 Lohmann, Phil Jay (46,53,81). . . . 1959,60,61 Loman, Brad. . . . . . . . . . . . . . . . . . . 1980 (M) Luna, Jacob (27). . . . . . . . . . . . . . . . . . . 2004 Long, Beede . . . . . . . . . . . . . . . . . . . 1933,34 Long, Bert. . . . . . . . . . . . . . . . . . . . . . . . 1895 Long, Charles . . . . . . . . . . . . . . . . . . . . . 1899 Long, Delbert (27). . . . . . . . . . . . . 1954,55,56 Long, Frank . . . . . . . . . . . . 1904,05,06,07,08 Long, Ted (3,26) . . . . . . . . . . . 1988,89,90,91 Looney, Joe Don. . . . . . . . . . . . . . . . . . . 1962 Lott, Thomas (6) . . . . . . . . . . . . . . 1976,77,78 Loughridge, Robert E. (78 . . . . . . 1953,54,55 Lovall, Gerald . . . . . . . . . . . . . . . . . . . . . 1945 Lowe, Marcus (92) . . . . . . . . . . . . . . . . . 1987 Lowell, Gary (25). . . . . . . . . . . 1978,80,81,82 Luckey, Stirling (56,97) . . . . . . . . . . . . . . 1994 Lucky, Mark (52) . . . . . . . . . . . 1977,78,79,80 Ludwig, Stephen Lee (59) . . . . . . . . . . . 1974 Lund, Craig M. (84) . . . . . . . . . . . . . . . 1975 Luster, Dewey. . . . . . . . . . . . . 1917,18,19,20

185


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

LETTERWINNERS

186

Parrish, George . . . . . . . . . . . . . . . . 1933,34 Parsons, Hillard, Jr. . . . . . . . . . . . . . . . . 1943 Pasque, Dan. . . . . . . . . . . . . . . . . . . 1985 (M) Patterson, Mark . . . . . . . . . . . . . . . . 1990 (M) Patterson, William A.. . . . . . . . . . . . 1922,24 Paul, Byron (27) . . . . . . . . . . . . . . 1978,79,80 Paul, Harold (71) . . . . . . . . . . . . . . . . . 1971 Payne, James H. (67,78) . . . . . . . 1959,62,63 Payne, Jerry (55) . . . . . . . . . . . . . 1957,58,59 Payne, Ron (86) . . . . . . . . . . . . . . . . 1959,61 Peacock, Elvis (4). . . . . . . . . . 1974,75,76,77 Pearce, Joe (41). . . . . . . . . . . . . . 1967,68,69 Pearson, Douglas B. (12) . . . . . . . . . . . . 1974 Pearson, Lindell . . . . . . . . . . . . . . . . 1948,49 Pearson, Tom (80) . . . . . . . . . . . . . . . . . 1954 Peddycoat, Dick . . . . . . . . . . . . . . . . . . . 1944 Pegues, Rod (4,14) . . . . . . . . 1978,80,81,82 Pelfrey, Carl . . . . . . . . . . . . . . . . . . . 1992 (M) Pellow, Johnny (11) . . . . . . . . . . . 1956,57,58 Pemberton, Jerry . . . . . . . . . . . . . . . 1982 (T) Pena, Tony III (87) . . . . . . . . . . . . . . . . . 1992 Pendleton, Carl (68) . . . . . . . . . . . . . . . . 2004 Pennick, James . . . . . . . . . . . . . . 1922,23,24 Penny, JaJuan (85,89) . . . . . . 1992,93,94,95 Peoples, Will (29) . . . . . . . . . . 2001,02,03,04 Perini, Dale (84,92). . . . . . . . . . . . . . 1960,61 Perkins, Antonio (4,28) . . . . . . 2001,02,03,04 Perry, Ed* . . . . . . . . . . . . . . . . . . . . No dates Perry, Fred . . . . . . . . . . . . . . . . . . . . . . . 1895 Perry, Leon (2) . . . . . . . . . . . . 1985,86,88,89 Perryman, A.G. (89) . . . . . . . . . . . . . . . . 1970 Peters, Tony L. (16) . . . . . . . . . . . . . 1973,74 Peters, Karl (15,19) . . . . . . . . . . . . . . . . 1979 Peters, Terry (16) . . . . . . . . . . . . . 1975,76,77 Peters, Tyrell (23,45) . . . . . . . 1993,94,95,96 Peters, Zarek (73,81,94) . . . . . . . . . . . . 1989 Peterson, Adrian (28) . . . . . . . . . . . . . . . 2004 Pettibone, Jerry (20). . . . . . . . . . . . . . . . 1961 Pfrimmer, Don (43) . . . . . . . . . . . . . . 1967,68 Phebus, Wright (67) . . . . . . . . . . . . . . . 1938 Phelps, Kelly (7) . . . . . . . . . . . 1978,79,81,82 Philips, Leon C. . . . . . . . . . . . . . . . . . . . 1915 Philips, Marland . . . . . . . . . . . . . . . . . . . 1928 Philips, Martin. . . . . . . . . . . . . . . . . . . . . 1927 Phillips, Anthony (68) . . . . . . . 1985,86,87,88 Phillips, Forb L. (38) . . . . . . . . . . . 1968,69,70 Phillips, Jon (66). . . . . . . . . . . 1984,85,86,87 Phillips, Michael F. (89). . . . . . . . . 1974,75,76 Phillips, T. Ray (17) . . . . . . . . . . . . . . . . 1932 Phipps, Mike (91) . . . . . . . . . . . . . 1994,95,96 Pickard, Claude . . . . . . . . . . . . . . 1904,05,08 Pickett, Jeff (71) . . . . . . . . . . . . . . 1983,84,85 Pierce, Clovis (41) . . . . . . . . . . . . . . . . . 1941 Pitchlynn, Thurman J. (36,41) . . . . . . . . 1966 Pittman, Andre (60,70) . . . . . . . . . . . . . . 1998 Pleasant, Demarrio (51) . . . . . . . . . . . . . 2004 Porkorny, Charles D. . . . . . . . . . . . . . . . 1922 Pomeroy, Gary (45) . . . . . . . . . . . . . 1982,83 Pool, Brodney (23,40). . . . . . . . . . 2002,03,04 Pope, Eric (63) . . . . . . . . . . . . 1982,83,84,85 Pope, Kenith (28) . . . . . . . . . . . . . 1971,72,73 Porter, Jack D. (74). . . . . . . . . 1966,67,68,69 Porterfield, John L. (82) . . . . . . . . . . 1962,63 Poslick, Joe (65,94) . . . . . . . . . . . 1965,66,67 Poteat, Jowahn (21) . . . . . . . . . . . 2002,03,04 Potter, Byron (42) . . . . . . . . . . . . . . . . . . 1939 Potters, Gary (85). . . . . . . . . . . . . . . . . . 1975 Potts, Frank. . . . . . . . . . . . . . . . . . . 1925,26 Powell, Raymond R.. . . . . . . . 1949,51,52,53 Powell, Roland (72 . . . . . . . . . . . . . . . . . 1956 Powers, Clyde J. (29 . . . . . . . . . . 1971,72,73 Poynor, Ben (88). . . . . . . . . . . . . . 1933,34,35 Preston, Gene . . . . . . . . . . . . . . . . . . . . 1945 Price, Harry. . . . . . . . . . . . . . . . . . 1906,07,10 Price, King . . . . . . . . . . . . . . . . . . . . . . . 1923 Price, Lance (97) . . . . . . . . . . . . . 1985,86,87 Price, William . . . . . . . . . . . . . 1945,46,47,48 Pricer, Billy C. (43) . . . . . . . . . . . . 1954,55,56 Prickett, John . . . . . . . . . . . . . . . . . . . . . 1895 Prince, Blair . . . . . . . . . . . . . . . . . . . 1985 (M) Prince, Tony (37) . . . . . . . . . . . . . . . . . . 1987 Pruitt, Greg (30,83). . . . . . . . . . . . 1970,71,72 Pryor, Brandon (56) . . . . . . . . . . . . . 2000,01

Q Qualls, Albert (81). . . . . . . . . . . . . 1969,70,71 Quinn, Daniel . . . . . . . . . . .1965,66,67,68 (T)

R Radcliffe, Earle. . . . . . . . . . . . . . . 1907,08,10 Raley, John. . . . . . . . . . . . . . . . . . . . . . . 1979 Randolph, John (87). . . . . . . . . . . . . . . . 1976 Randolph, Tim (58,85) . . . . . . . . . 1981,83,84 Rankins, Jejuan (3,17) . . . . . . . . . 2002,03,04 Rapacz, John J. . . . . . . . . . . . . . . . . 1946,47 Rasheed, Kenyon (33) . . . . . . 1989,90,91,92 Ray, Darrol (3) . . . . . . . . . . . . 1976,77,78,79 Ray, John . . . . . . . . . . . . . . . . . . . . . . . 1898 Ray, Terry (4,19) . . . . . . . . . . . 1988,89,90,91 Rayburn, Tony (35) . . . . . . . . . 1983,84,85,86 Rayl, Brett (59) . . . . . . . . . . . . . . . . . . . . 2004 Rector, Joe D. (80) . . . . . . . . . . . . 1956,57,58 Reddell, Brad (84) . . . . . . . . . 1989,90,91,92 Reddell, John C.. . . . . . . . . . . . . . 1950,51,52 Reed, Darrell (40) . . . . . . . . . 1984,85,86,87 Reed, Richard (51,96) . . . . . . . . . . . 1984,85 Reeds, Artie . . . . . . . . . . . . . . . . . . . . . . 1909 Reeds, Chester. . . . . . . . . . . . . . . . . 1904,05 Reeds, Clarence. . . . . . . . . . . . . . . . . . . 1904 Reeds, Claude E. . . . . . . . . . .1910,11,12,13 Reese, Jerry (27) . . . . . . . . . . . . . 1974,75,76 Reeves, Matt (42,99) . . . . . . . . . . . . . . . 1998 Reilly, Mike (41,50) . . . . . . . . . . . . 1977,79,80 Remy, William E. . . . . . . . . . . . . . . . . . . 1949 Rentie, Caesar (77) . . . . . . . . 1984,85,86,87 Rentzel, Lance (38) . . . . . . . . . . . 1962,63,64 Resler, Jeff (71) . . . . . . . . . . . 1991,92,93,94 Reynolds, Tanner (52) . . . . . . . . . . . 1999,00 Rhodes, Roy. . . . . . . . . . . . . . . . . . . . . . 1945 Rhodes, Steve (24). . . . . . . . . 1976,77,78,80 Rhymes, George (4). . . . . . . . 1980,81,83,84 Rhynes, Gary (42) . . . . . . . . . . . . . . . . . 1972 Rice, Jacob (68) . . . . . . . . . . . . . . . . 2003,04 Richardson, Joe A. . . . . . . . . . . . . . . . . 1945 Richardson, Ramon (91) . . . . . . . . . 1999,00 Richey, Joey . . . . . . . . . . . . . . . . . . . 1993 (T) Riddley, Steve (37) . . . . . . . . . . . . . . . . . 1996 Rideau, Rodney (45,47) . . . . . 1996,97,98,99 Riley, James (61,71). . . . . . . . . . . 1964,65,66 Ringer, Mike (15) . . . . . . . . . . . . . 1963,64,65 Ripley, J.M. “Mickey” (16) . . . . 1967,68,69,70 Risinger, R.L. . . . . . . . . . . . . . . . . . . . . . 1895 Roach, Larry (26) . . . . . . . . . . . . . 1970,71,72 Roberson, Broderick (62) . . . . 1991,92,93,94 Roberts, Donald H. (89) . . . . . . . . . . . . . 1968 Roberts, C.C... . . . . . . . . . . 1896,97,98,1900 Roberts, Fred . . . . . . . . . . . . . . . . . . . . . 1901 Roberts, Greg (65) . . . . . . . . . 1975,76,77,78 Roberts, Harold (29). . . . . . . . . . . . . 1929,30 Roberts, Hugh . . . . . . . . . . . . . . . . . . . 1908 Roberts, J.D.. . . . . . . . . . . . . . . . . 1951,52,53 Roberts, Willie (88). . . . . . . . . . . . . . 2003,04 Robertson, Dave (15) . . . . . . . . . . . . 1971,72 Robertson, Melbourne (70). . . . . . 1933,34,35 Robinson, Bobbie (32) . . . . . . . . . . . 1965,66 Robinson, David (5) . . . . . . . . . . . . . . . . 2004 Robinson, Eric (17) . . . . . . . . . . . . . . . . 1984 Robison, Leroy . . . . . . . . . . . . . . . . . 1933,34 Rockford, Jim (2) . . . . . . . . . . 1980,81,83,84 Roegiers, Sabastien (54) . . . . . . . . . . . . 1998 Rogers, Charles E. . . . . . . . . . . . . 1911,12,13 Rogers, J.W. “Jim” . . . . . . . . . . . . . . 1907,10 Rogers, Jimmy (34) . . . . . . . . 1974,76,77,78 Rogers, Joe (41). . . . . . . . . . . . . . . . 1996,97 Rogers, Otis R. (20) . . . . . . . . . . . 1936,37,38 Rogers, Tyrone . . . . . . . . . . . . . . . . . . . . 1988 Roland, Phil (99). . . . . . . . . . . . . . . . . . . 1977 Rolle, David (41). . . . . . . . . . . . . . 1956,57,58 Rollins, Zerrick (53,97) . . . . . . . . . . . . . . 1994 Romero, Frank (63,85,96) . . . 1998,99,00,01 Rose, Michael (20) . . . . . . . . . 1994,95,96,97 Rosenberg, Collin (27,36). . . . 1993,94,95,96 Ross, Alvin (25,34,48) . . . . . . . . . . . 1981,83 Ross, Dwight M. . . . . . . . . . . . . . . . . . . 1920 Ross, Eugene (39) . . . . . . . . . . . . 1964,65,66 Ross, H. Grady. . . . . . . . . . . . . . . . . . . . 1909 Ross, Ronald K. (68) . . . . . . . . . . . . . . . 1978

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Rousey, Tom. . . . . . . . . . . . . . . . . . . . . . 1940 Roush, John (62) . . . . . . . . . . . . . 1972,73,74 Rowe, David (26,29,64) . . . . . . . . . . . . . 1997 Rowe, William J. (12) . . . . . . . . . . . . . . . 1959 Rowland, Ed . . . . . . . . . . . . . . . . . 1950,51,52 Royal, Darrell . . . . . . . . . . . . . 1946,47,48,49 Royter, (Unknown) . . . . . . . . . . . . . . . . 1895 Runbeck, Leonard . . . . . . . . . . . . . . . . . 1905 Runnels, J.D. (38). . . . . . . . . . . . . 2002,03,04 Russell, Clyde (30) . . . . . . . . . . . . . . 1973,74 Russell, Kleyn (39) . . . . . . . . . . . . . . . . . 1972 Ruster, Dan (16) . . . . . . . . . . . . . . 1970,71,72

S Salmon, Don E. (39). . . . . . . . . . . . . . . . 1960 Sandefer, J.D. “Jakie” III (27) . . . . 1956,57,58 Sanders, Jerry (45). . . . . . . . . 1978,80,81,82 Sandersfield, Melvin (25,41). . 1959,60,61,62 Santee, Jack H. . . . . . . . . . . . . . . . . 1951,52 Santee, Robert P. . . . . . . . . . . . . . . . . . . 1954 Sarratt, Charles . . . . . . . . . . . . . . . . 1946,47 Saunders, Thomas W. (70,91) . . . 1970,71,72 Savage, Antwone (6) . . . . . . . 1999,00,01,02 Sawatzky, Mike (54) . . . . . . . . . . 1988,89,90 Sawyer, Steve. . . . . . . . . . . . . . . . . . . . . 1944 Schaefer, Herbert . . . . . . . . . . . . 1922,23,24 Schmitt, Pete (80). . . . . . . . . . 1989,90,91,92 Scholl, Robert (52) . . . . . . . . . . . . . . 1958,59 Schreiner, Carl S. III (67) . . . . . . . . . 1963,64 Schreiner, Carl S., Jr. . . . . . . . . . . . . . . . 1945 Schreiner, Henry F. . . . . . . . . . . . . . 1945,49 Scott, Bob. . . . . . . . . . . . . . . . . . . . . 1956,57 Searcy, Byron (76) . . . . . . . . . . . . 1955,56,57 Sellmyer, Greg (39) . . . . . . . . . . . 1976,78,79 Selmon, Dewey (91). . . . . . . . 1972,73,74,75 Selmon, Lee Roy (93). . . . . . . 1972,73,74,75 Selmon, Lucious (98) . . . . . . . . . . 1971,72,73 Severin, Robert. . . . . . . . . . . . . . . 1904,05,06 Sewell, Steve (13) . . . . . . . . . 1981,82,83,84 Seymour, Bob (36) . . . . . . . . . . . . 1937,38,39 Shadid, Mitch (31) . . . . . . . . . . . . 1940,41,42 Shane, Dan S. (86) . . . . . . . . . . . . . . . . 1967 Shankle, William (8) . . . . . . . . . . . 1991,92,94 Shanks, Patrick (51) . . . . . . . . . . . . . 1941,42 Sharp, Basil . . . . . . . . . . . . . . . . . . . 1944,45 Sharp, Mike . . . . . . . . . . . . . . . . . . . 1973 (M) Sharpe, Louis (70) . . . . . . . . . . . . 1939,40,41 Shaw, Clinton . . . . . . . . . . . . . . . . . . . . . 1917 Shearer, Clifton. . . . . . . . . . . . . . . . . . . . 1928 Shelby, Brandon (4,5) . . . . . . 2001,02,03,04 Shelley, John A. (33). . . . . . . . . . . 1969,70,71 Shepard, Darrell (8) . . . . . . . . . . . . . 1980,81 Shepard, Derrick (3) . . . . . . . . 1983,84,85,86 Shepard, Woodie (23) . . . . . . . . . . . . . . 1976 Sherrod, Dale . . . . . . . . . . . . . . . . 1955,56,57 Shields, Bennie (74) . . . . . . . . . . . . 1961,63 Shields, Larry (35) . . . . . . . . . . . . . . 1963,64 Shilling, Jack C. (63). . . . . . . . . . . . . 1957,58 Shipp, Jackie (49). . . . . . . . . . 1980,81,82,83 Shirk, John (63 . . . . . . . . . . . . . . . 1937,38,39 Shoate, Myron (8,22) . . . . . . . . . . . . 1974,76 Shoate, Rod (43) . . . . . . . . . . . . . 1972,73,74 Shoemaker, David (60,81) . . . . . . . . 1987,88 Shores, Phillip. . . . . . . . . . . . . . . . . . . . . 1982 Short, Dan . . . . . . . . . . . . . . . 1900,01,02,03 Short, Gacicuis . . . . . . . . . . . . . . . . . . . 1927 Short, Harvey . . . . . . . . . . . . . . . . . . 1898,99 Short, Tom M. (85) . . . . . . . . . . . . . . 1936,37 Shotts, Ron (22) . . . . . . . . . . . . . . 1965,66,67 Shotts, Steve (14). . . . . . . . . . . . . . . . . 1970 Shoulders, Marvin (31) . . . . . . . . . . . . . . 2000 Sills, Jake (11,19) . . . . . . . . . . . . . . . . . 1998 Silva, Frank R. . . . . . . . . . . 1948,49,50,51,52 Simcik, Douglas W. (45) . . . . . . . . . . 1976,77 Simmons, Homer (22) . . . . . . . . . 1940,41,42 Simmons, Milton E. (66) . . . . . . . . . 1953,54 Simms, Dick E. . . . . . . . . . . . . . . . . . 1930,31 Simms, Terrance (1) . . . . . . . . . . . . . 2001,02 Simon, E.N. (34). . . . . . . . . . . . . . . . 1973,74 Simpson, Broderick (51). . . . . 1993,94,95,96 Simpson, Nick (58) . . . . . . . . . . . . . . . . . 1998 Simpson, Travis (53). . . . . . . . 1983,84,85,86 Sims, Billy (20) . . . . . . . . . . . . 1975,77,78,79 Sims, Fred (23). . . . . . . . . . . . . . . . . 1981,82

Sims, Jerry L. (79,91) . . . . . . . . . . 1968,69,70 Sims, Richard (5,12). . . . . . . . . . . . . 1930,31 Sims, Wes (60) . . . . . . . . . . . . 2001,02,03,04 Singletary, Hinston L. . . . . . . . . . . . . . . . 1928 Sitton, Ken (18). . . . . . . . . . . . . . . . . 1979,80 Skidgel, Wesley A. (22) . . . . . . . . . . 1962,63 Skinner, Mike (75). . . . . . . . . . 1999,00,01,02 Skinner, Reggie (21,22,24) . . . . . . . 1998,99 Slater, Bob (68) . . . . . . . . . . . . . . 1981,82,83 Slaughter, Trae (23) . . . . . . . . . . . . . 1997,98 Slough, Elmer . . . . . . . . . . . . . . . . . 1923,24 Smalley, Harley . . . . . . . . . . . . . . . . . . . 1944 Smith, C. Lyle (40) . . . . . . . . . . . . 1939,40,41 Smith, C. Michael (39) . . . . . . . . . . . . . . 1970 Smith, David (38,44). . . . . . . . . . . . . 1972,73 Smith, Dean C. (72) . . . . . . . . . . . 1948,49,50 Smith, Fred. . . . . . . . . . . . . . . . . . 1949,50,51 Smith, Fred C. . . . . . . . . . . . . . . . . . . . . 1927 Smith, Jarvis (4,28). . . . . . . . . . . . . . 2000,01 Smith, Jay (61,71) . . . . . . . . . . . 1996, 98,99 Smith, John L. . . . . . . . . . . . . . . . . . . . . 1899 Smith, Josh (77) . . . . . . . . . . . . . . . . . . . 2000 Smith, Leon L. . . . . . . . . . . . . . . . . . . . . 1927 Smith, Michael G. . . . . . . . . . . . . . . . . . . 1973 Smith, Norman W. (16). . . . . . . . . 1962,63,64 Smith, Pete (90) . . . . . . . . . . . . . . 1935,36,37 Smith, Ray . . . . . . . . . . . . . . . . . . . . . . . 1897 Smith, Robert E. . . . . . . . . . . . . . . . 1968 (M) Smith, Todd (37) . . . . . . . . . . . . . . 1983,84,85 Smith, Travian (36) . . . . . . . . . 1994,95,96,97 Smith, Trent (88). . . . . . . . . . . 1999,00, 01,02 Smitherman, Don (24) . . . . . . . . . 1986,88,89 Smoot, Roy. . . . . . . . . . . . . . . 1918,19,20,21 Snell, Ernest B. (36,41) . . . . . . . . . . 1930,31 Snodgress, M.H.. . . . . . . . . . . . . . . . . . . 1925 Soloman, DeMario (34) . . . . . . . . . . . . . 1998 Songy, Darrell (16) . . . . . . . . . . . . 1979,80,82 Soult, Timothy A. . . . . . . . . . . . . . . . 1984 (T) Sparkman, Homer (71) . . . . . . . . . . 1943,44 Sparks, Keith (29,61) . . . . . . . . . . 1993,94,95 Spears, Roy A. . . . . . . . . . . . . . . . 1911,12,13 Speegle, Cliff (24). . . . . . . . . . . . . 1938,39,40 Spence, Armand (47) . . . . . . . . . . 1997,98,99 Spencer, Mike (51) . . . . . . . . . . . . . . . . . 1975 Spottswood, Ed (42). . . . . . . . . . . . . . . . 1938 Stacy, James (35) . . . . . . . . . . . . 1932,33,34 Stacy, Ronnie Lee (78,96) . . . . . . . . 1970,71 Stafford, Anthony (25) . . . . . . 1985,86,87,88 Stahl, William . . . . . . . . . . . . . . . . . . . . . 1921 Stamps, Harry, Jr. (76) . . . . . . 1992,93,94,95 Stanberry, Keith (19) . . . . . . . 1981,82,83,84 Stanley, Raymond (28) . . . . . . . . . . . 1929,30 Steele, David A. (89,90) . . . . . . . . . . . . . 1969 Steele, Jack (44). . . . . . . . . . . . . . 1940,41,42 Steffen, Roger (9,51) . . . . . . . . . . 1998,99,00 Steinberger, Clinton C. . . . . . . . . . . 1922,23 Steinbock, Delmar (35). . . . . . . . . . . 1934,35 Steines, William (36) . . . . . . . . . . . . . . . 1992 Stell, Damon (27) . . . . . . . . . . 1984,85,87,88 Stensrud, Bruce (17) . . . . . . . . . . 1967,68,69 Stephens, Cedric (7,22) . . . . . 1995,96,97,98 Stephens, Darren (25) . . . . . . . . . . . . . . 2004 Stephens, Sam (50) . . . . . . . . . . . . . 1941,42 Stephenson, Robert L. (31) . . . . . 1965,66,67 Stevenson, Ralph (46,61). . . . . . . 1937,38,39 Steward, J.N. . . . . . . . . . . . . . . . . . . . . . 1945 Stidham, J. Thomas (16) . . . . . . . . . . . . 1966 Stiller, Don (89). . . . . . . . . . . . . . . 1955,56,57 Stogner, C.H. (17) . . . . . . . . . . . . . . 1930,31 Stoia, Sam (56). . . . . . . . . . . . . . . . . . . . 1984 Stokes, George (79) . . . . . . . . . . . 1961,62,63 Stokes, Ricky (46) . . . . . . . . . . . . . . 1971,73 Stone, Clifford O., Jr. . . . . . . . . . . . . . . . 1945 Stout, Mark . . . . . . . . . . . . . . . . . . . 1987 (T) Stover, Albert. . . . . . . . . . . . . . . . . . . 1944,45 Stover, Robert L.. . . . . . . . . . . . . . . . . . . 1944 Strait, Derrick (2) . . . . . . . . . . 2000,01,02,03 Strouvelle, C.E.. . . . . . . . . . . . . . . . . . . . 1922 Struck, Mike (92) . . . . . . . . . . . . . 1971,72,73 Sturch, John (88) . . . . . . . . . . . . . . . . . . 2002 Sturm, Bill (11) . . . . . . . . . . . . . . . . . . . . 1955 Sullivan, David . . . . . . . . . . . . . . . . . . . . 1974 Sullivan, Glenn (9,11) . . . . . . . . . . . . 1986,87 Sumpter, R.O. “Bob”. . . . . . . . . . . . . . . . 1926 Suntrup, Tom (46). . . . . . . . . . . . . . . . . . 1977 Sutton, Anthony P. . . . . . . . . . . . . . . . . . 1974


LETTERWINNERS T

Uhles, Ric (52) . . . . . . . . . . . . . . . 1981,82,85 Unruh, Dean (60) . . . . . . . . . . . . . 1970,71,72

V Vachon, Mike (92). . . . . . . . . . . . . . . 1966,67 Vallance, Chad Y. (65) . . . . . . . . . . . . . . 1941 Valora, Forrest (82) . . . . . . . . 1977,78,79,80 Van Burkleo, Bill (15) . . . . . . . . . . . . . . . 1961 Van Camp, Eric (31) . . . . . . . . . . . 1973,74,75 Van Goethen, Melanie . . . . . . . . . . . 1992 (T) Van Horn, Bruce . . . . . . . . 1957,58,59,60 (M) Van Keirsbilck, Mark (76) . . . . 1986,87,88,89 Van Osdol, Scott (31) . . . . . . . . . . . . . . . 1979 Van Pool, Jack . . . . . . . . . . . . . . . . . 1951,53 Vardeman, Barry (39) . . . . . . . . . . . . . . . 1998 Vardeman, Robert (66) . . . . . . . . . . . 1963,65 Vardeman, Ryan (35,55) . . . . . . . . . 1995,96 Vaughan, Mike (79) . . . . . . . . . . . 1974,75,76 Venable, Jack . . . . . . . . . . . . . . . . . . . . . 1945 Venable, Jim. . . . . . . . . . . . . . . . . . . 1944,45 Vermillion, Larry (62) . . . . . . . . . . . . 1962,63 Vessels, Billy. . . . . . . . . . . . . . . . . 1950,51,52 Vickers, David (10,18) . . . . . . 1984,85,86,87 Vickers, Mike . . . . . . . . . . . . . . . .1989,90 (T) Vitito, Tim (68) . . . . . . . . . . . . . . . . . . . . 1991 Vogel, Al . . . . . . . . . . . . . . . . . . . . . . 1944,45 Vogle, Daniel O. . . . . . . . . . . . . . . . . . . . 1922 Voiles, John David (60). . . . . . . . . 1962,63,64 von Schamann, Uwe (10). . . . . . . 1976,77,78 Von Tungeln, Rudolph . . . . . . . . . . . . . . 1916

W

Y York, Marshall R. (72). . . . . . . . . . 1958,59,60 Young, Dalton (75) . . . . . . . . . . . . . . . . . 1990 Young, Gary L. (37) . . . . . . . . . . . . . 1973,74 Young, Herbert (23,48) . . . . . . . . . . . 1979,80 Young, Paul (15,22,45). . . . . . . . . . . 1930,31 Young, Roland “Waddy” (49) . . . . 1936,37,38

Z Zabel, Steve (82) . . . . . . . . . . . . . 1967,68,69

The OU Athletics Department has made every effort to verify lettermen information. We welcome any clarifications or adjustments. Please contact Jason Matheson at (405) 325-4274 or via email at jmatheson@ou.edu.

REVIEW & OPPONENTS OKLAHOM A HISTORY

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

THE SOONERS

Wade, Greg . . . . . . . . . . . . . . . . . . . 1989 (M) Waggoner, Roy. . . . . . . . . . . . . . 1904,05,06 Waggoner, F.E. “Gene”. . . . . . . . . . . . . . 1929 Walker, Ab D. (1,10) . . . . . . . . . . . . . 1930,31 Walker, Barrion (3) . . . . . . . . . . . . . . 1980,81 Walker, Barth P. (76). . . . . . . . . . . 1935,36,37 Walker, Darnell (28) . . . . . . . . . . . 1990,91,92 Walker, Marcus (24) . . . . . . . . . . . . . . . . 2004 Walker, Wade . . . . . . . . . . . . . 1946,47,48,49 Wallace, Dave (17) . . . . . . . . . . . . . . 1946,47 Wallace, Polly . . . . . . . . . . . . . . . . 1924,25,26 Wallace, Randy (50,90) . . . . . 1988,89,90,91 Walling, Vernon . . . . . . . . . . . . . . 1906,07,08 Walrond Jr., George A. (98) . . . . . . . 1976,77 Wantland, C.W. . . . . . . . . . . . . . . . . 1907,08 Ward, Allen (28) . . . . . . . . . . . . . . . . . . . 1982 Ward, Bob . . . . . . . . . . . . . . . . . . . . 1957,58 Ward, Dennis (61,71,78) . . . . . . . . . 1961,62 Ward, Jeffery C. (61) . . . . . . . . . . . . 1977,78 Ward, Paul . . . . . . . . . . . . . . . . . . 1926,27,28 Ward, Stanley (82) . . . . . . . . . . . . . . . . . 1958 Warmack, Bob (11). . . . . . . . . . . . 1966,67,68 Warner, Bobby (16) . . . . . . . . . . . . . . . . 1994 Warren, Corey (2). . . . . . . . . . 1990,91,92,93 Warren, Guy (11,15) . . . . . . . . . . . . 1929,30 Washington, Joe (24) . . . . . . . 1972,73,74,75 Waters, Ron L. (35,44) . . . . . . . . . 1972,73,74 Watkins, Chris (74) . . . . . . . . . . . . . . . . . 1991 Watkins, Smith (16,40) . . . . . . . . . . . . . . 1931 Watkins, Steve . . . . . . . . . . . . . . . . 1981 (M) Watson, Johnny A. (76) . . . . . . . . 1968,69,70 Watts, Bennett (15). . . . . . . . . . . . 1957,59,60 Watts, Bill (69,71) . . . . . . . . . . . . . . . . . . 1959 Watts, Elbert (15) . . . . . . . . . . . . . . . . . . 1981 Watts, J.C. (1,19) . . . . . . . . . . . . . 1978,79,80 Weatherford, Jennifer . . . . . . . . . . . 1994 (T) Weatherall, James . . . . . . . . . 1948,49,50,51 Webb, Terry D. (66) . . . . . . . . . . . 1973,74,75 Weddington, Darrell (30,87) . . . . . . . . . 1984 Weddington, Mike (88) . . . . . . 1979,80,81,82 Weedn, Henry. . . . . . . . . . . . . . . . . . .1911,12 Welch, Tim (45) . . . . . . . . . . . . . . 1971,72,73 Wells, Ben D. (71) . . . . . . . . . . . . . . . . . 1958 Wenzl, Troy. . . . . . . . . . . . . . . . . .1989,90 (T) Wesley, Maylon (5,31) . . . . . . 1992,93,94,95 West, John . . . . . . . . . . . . . . . . . . . . 1944,45 West, Mark . . . . . . . . . . . . . . . . . . . . 1994 (T) West, Stanley B. . . . . . . . . . . . 1946,47,48,49

Wetherbee, Phillip L. (63,70) . . . . . . . . . 1965 Whaley, Steve (18,57) . . . . . . . . . 1979,80,81 Wheeler, Jeff. . . . . . . . . . . . . . . . . . . 1995 (T) Wheeler, Gordon (88,97) . . . . . . . . . . . . 1967 Wheeler, J.W. (79) . . . . . . . . . . . . 1933,34,35 Wheeler, Jeff. . . . . . . . . . . . . . . . . . . 1995 (T) Whisenant, John B. . . . . . . . . . . . . . . . . 1916 White, Billy (50,73) . . . . . . . . . . . . 1959,60,61 White, Brad (76) . . . . . . . . . . . . . . . . . . . 1973 White, C. Lazelle . . . . . . . . . . . . . 1922,23,24 White, Derrick (14) . . . . . . . . . 1984,85,86,87 White, Jason (18) . . . . . . . 2000,01,02,03,04 White, Phil E. . . . . . . . . . . . . . . . . 1918,19,20 White, Terrance (13) . . . . . . . . 1995,96,97,98 Whited, Marvin . . . . . . . . . . . . . . . 1939,40,41 Whittington, Claude L. (21,43) . . . 1931,32,33 Wickersham, Taylor (61) . . . . 1994,95,96,97 Wilcox, John . . . . . . . . . . . . . . . . . . . . . . 1923 Wilhelm, George (55) . . . . . . . . . 1937,38,39 Wilhite, Otto . . . . . . . . . . . . . . . . . . . . . . 1909 Wilkerson, Jimmy (45) . . . . . . . . . 2000,01,02 Wilkins, Greg (90). . . . . . . . . . . . . . . . . . 1991 Williams, Chad . . . . . . . . . . . . . . . . . 1987 (M) Williams, Charles A. (56) . . . . . . . . . . . . 1966 Williams, Curtice (91,93) . . . . 1985,86,87,88 Williams, Dante (98) . . . . . . . . 1986,87,88,89 Williams, Darien (41) . . . . . . . . . . . . . . . 2004 Williams, Dewey (32,56). . . . . . . . . . . . . 1979 Williams, Earnest (20) . . . . . . . . . 1990,91,92 Williams, Edward . . . . . . . . . . . . . . . . . . 1976 Williams, Gerald (10) . . . . . . . 1995,96,97,98 Williams, Gregory (59) . . . . . . . . . . . 1987,89 Williams, Jeff (36,86) . . . . . . . . . . . . 1977,81 Williams, John (98). . . . . . . . . . . . . . . . . 2004 Williams, Robert . . . . . . . . . . . . . . . 1983,84 Williams, Roy (38) . . . . . . . . . . . . 1999,00,01 Williams, Sammy (65,75) . . . . . . . . . 1996,97 Williams, Steve (76) . . . . . . . . 1979,80,81,82 Williams, Steve (98) . . . . . . . . . . . . . 1996,97 Williams, Troy (37) . . . . . . . . . . . . . . . . . 1981 Wilmoth, Evert G. . . . . . . . . . . . . . . . 1916,17 Wilson, Bryon . . . . . . . . . . . . . . . . . . 1989 (M) Wilson, Charles Hugh (31,46) . . . . . 1930,31 Wilson, Chris (30). . . . . . . . . . 1988,89,90,91 Wilson, Corey (99) . . . . . . . . . . . . . . 1991,92 Wilson, Danny (98). . . . . . . . . 1980,81,82,83 Wilson, Keith (87) . . . . . . . . . . . . . . . . . . 1977 Wilson, Matt (60) . . . . . . . . . . . . . . . 1991,94 Wilson, Remardo . . . . . . . . . . . . . . . . . . 1989 Wilson, Stanley (32) . . . . . . . . 1979,80,81,82 Wilson, Travis (4,43) . . . . . . . . . . 2002,03,04 Wilson-Guest, Jeremy (91,96) . . . 1998,99,00 Winblood, Bill (57) . . . . . . . . . . . . . . . . . 1960 Winchester, Mike (12,22) . . . . . . . 1984,85,86 Winfrey, Ronald M. (64,96) . . . . . . . 1965,66 Wingate, Robert . . . . . . . . . . . . . . 1899,1900 Winters, Chet (40) . . . . . . . . . 1979,80,81,82 Wise, Mike (65) . . . . . . . . . . . . . . 1987,88,89 Wolf, Key. . . . . . . . . . . . . . . . . 1905,06,07,08 Wolfe, D.J. (25). . . . . . . . . . . . . . . . . . . . 2004 Wolfe, Zetta . . . . . . . . . . . . . . . . . . . . . . 1925 Wolverton, M.E. “Woody” . . . . . . . . . 1953,54 Wood, Eddie (27) . . . . . . . . . . . . . . . . . . 1959 Wood, Steven Norvel (62) . . . . . . 1938,39,40 Woods, Billy Joe (M) . . . . . 1958,59,61,62,63 Woods, C.A. “Tony” (67,99). . . 1985,86,87,88 Woods, Clovis (4,37) . . . . . . . 1996,97,98,99 Woods, Mike (2,41) . . . . . . . . 1996,97,98,99 Woods, Mort . . . . . . . . . . . . . . . . . . . 1909,10 Woodson, Paul (38) . . . . . . . . . . . . . . . . 1939 Woodworth, Calvin (60) . . . . . . . . 1953,54,55 Woolfolk, Andre (17) . . . . . . . 1999,00,01,02 Wooten, W.G. (21) . . . . . . . . . . . 1942,43,44 Works, Renaldo (47) . . . . . . . 2000,01,02,03 Wren, Ricky (92). . . . . . . . . . . . . . 1991,92,93 Wright, Curtis Truman . . . . . . . . . . . 1947,48 Wright, John W. “Bill” . . . . . . . . . . . . . . . 1944 Wright, Lonnie Gene (70) . . . . . . . . . . . . 1975 Wright, Sonny Thelton (18). . . . . . . . 1942,43 Wright, Willie (2) . . . . . . . . . . . . . . . . . . . 1978 Wyatt, Bobby J. (52) . . . . . . . . . . . . . . . . 1961 Wylie, Gary (37,40). . . . . . . . . . . . 1960,61,62 Wylie, Joe (22) . . . . . . . . . . . . . . . 1970,71,72

COACHING STAFF

Tabor, Dion . . . . . . . . . . . . . . . . . . . . 1983 (T) Tabor, Paul (73) . . . . . . . . . . . . . . 1977,78,79 Tabor, Phil (74) . . . . . . . . . . . . 1975,76,77,78 Talbott, George V.. . . . . . . . . . . . . . . . . . 1957 Tallchief, Tom . . . . . . . . . . . . . . . . . . . . . 1945 Tanner, Baron (76,92) . . . . . . . . . . . 1994,95 Tarlton, Stephen F. (61) . . . . . . . . 1968,69,70 Tate, Larry Wayne (94) . . . . . . . . . . . . . . 1974 Taton, Bruce (5) . . . . . . . . . . . . . . 1977,78,79 Tatum, John E. (50,64) . . . . . . . . . 1960,61,62 Taylor, Ben . . . . . . . . . . . . . . . . . . 1925,26,27 Taylor, Fenton. . . . . . . . . . . . . . . . . . 1928,29 Taylor, Jim (67) . . . . . . . . . . . . . . . 1972,73,74 Taylor, L. Geary (34,40) . . . . . . . . . . . . . 1961 Taylor, Otis (11) . . . . . . . . . . . 1989,90,91,92 Taylor, Ron . . . . . . . . . . . . . . . . . . . . 1971 (M) Taylor, Sherwood A. (31) . . . . . . . 1977,78,79 Teel, Charles (33,47) . . . . . . . . . . . . 1930,31 Teeter, George Howard . . . . . . . . 1938,40,41 Tennyson, Dewey (28,94). . . . . . . 1932,34,35 Terrell, David (19) . . . . . . . . . . . . . . . . . . 1967 Thatcher, J.T. (15,28) . . . . . . . 1997,98,99,00 Thibodeaux, Calvin (58) . . . . . . . . . . 2003,04 Thomas, Chuck (73). . . . . . . . 1981,82,83,84 Thomas, Clendon (35) . . . . . . . . . 1955,56,57 Thomas, George C. . . . . . . . . 1946,47,48,49 Thomas, Jamie (38) . . . . . . . . . . . 1973,74,75 Thomas, Jim (44) . . . . . . . . . . . . . 1936,37,38 Thomas, Keith (28,81) . . . . . . 1973,74,75,76 Thomas, W.S. (25) . . . . . . . . . . . . . . . . . 1964 Thompson, Bobby (29). . . . . . . . . . . . . . 1968 Thompson, Charles (6,16) . . . . . . . . 1987,88 Thompson, James . . . . . . . . . 1921,22,23,24 Thompson, Jerry (66) . . . . . . . . . . 1957,58,59 Thompson, Kevin (22) . . . . . . 1986,87,88,89 Thompson, Michael (21,45) . . . . . . . 1992,96 Thompson, Michael (19). . . . . 1999,00,02,03 Thompson, Paul (12,14). . . . . . . . . . 2002,03 Thompson, Scott (19). . . . . . . . . . . . . . . 1985 Thompson, Travis (25,26). . . . . . . . . . . . 1990 Thomsen, Todd (91) . . . . . . . 1985,86,87,88 Thornton, Mike (7) . . . . . . . . . . . . . . 1998,99 Thunander, Eric (53). . . . . . . . . . . . . 1999,00 Tigart, Thurman . . . . . . . . . . . . . . 1943,44,45 Tillery, Jerry (89). . . . . . . . . . . . . . 1958,59,60 Tillman, A.M. “Pete” . . . . . . . . . . . 1946,47,48 Tillman, Donald . . . . . . . . . . . . . . . . 1943,45 Tillman, Spencer (20,34) . . . . 1983,84,85,86 Timberlake, R.W. (81) . . . . . . . . . 1954,55,56 Tippens, Trey (88) . . . . . . . . . 1989,90,91,92 Tipps, Ken . . . . . . . . . . . . . . . . . . 1947,48,49 Tipton, Greg . . . . . . . . . . . . . . . . . . . 1994 (M) Titsworth, John (69,78). . . . . . . . . 1966,67,68 Todd, Nelson Page (71) . . . . . . . . . . 1969,71 Tolbert, James R. . . . . . . . . . . . . . . . . . . 1916 Toney, Chris (39,42) . . . . . . . . . . . . . . . . 2001 Townsend, Dan (39) . . . . . . . . . . . . . 2003,04 Travis, Reese (55,66,70) . . . . . . . . . . . . 2000 Tribby, Floyd . . . . . . . . . . . . . . . . . . . . . . 1912 Trotter, Jess . . . . . . . . . . . . . . . . . 1946,47,48 Trousdale, J.R. . . . . . . . . . . . . . . . . . 1987 (T) Truesdell, George. . . . . . . . . . . . . . . 1905,06 Truitt, John (41) . . . . . . . . . . . . . . . . 1981,83 Tubbs, Jerry (53) . . . . . . . . . . . . . 1954,55,56 Tucker, Josh (61) . . . . . . . . . . . . . . . . . 2000 Tupper, Jeff (78,91) . . . . . . . . 1982,83,84,85 Turner, Richard (96) . . . . . . . . 1977,78,79,80 Tyler, Claude. . . . . . . . . . . . . . . . . . . . . . 1919 Tyler, George . . . . . . . . . . . . . 1918,19,20,21 Tyree, James E. (41) . . . . . . . 1941,42,46,47

U

2 0 0 5 S EAS ON

Swank, Floyd . . . . . . . . . . . . . . . . . . . . . 1905 Swanson, Garry F. (49) . . . . . . . . . . . . . 1969 Swanson, Lance (21) . . . . . . . . . . 1988,89,90 Swanson, T.M. . . . . . . . . . . . . . . . . . . . . 1922 Swartz, P.W. . . . . . . . . . . . . . . . . . . . . . . 1909 Swatek, Charles . . . . . . . . . . . . . . . . . . 1915 Swatek, Roy E. . . . . . . . . . . . 1918,19,20,21 Swofford, Joe . . . . . . . . . . . . . . . . . . . . . 1931

187


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONERS IN THE NFL DRAFT 2005 (10) Pos Jammal Brown . . . . . . . . .T . . . . Mark Clayton . . . . . . . . .WR . . . Brodney Pool . . . . . . . . . .S . . . . Mark Bradley . . . . . . . . .WR . . . Dan Cody . . . . . . . . . . . . DE . . . Brandon Jones . . . . . . . .WR . . . Antonio Perkins . . . . . . . CB . . . Donte Nicholson . . . . . . . .S . . . . Lance Mitchell. . . . . . . . . LB . . . Wes Sims . . . . . . . . . . . . G. . . .

Team Rd Pick New Orleans. . . . . . . . . 1st . . . . . 15th Baltimore . . . . . . . . . . . 1st . . . . . 22nd Cleveland . . . . . . . . . . 2nd . . . . . 34th Chicago . . . . . . . . . . . 2nd . . . . . 39th Baltimore . . . . . . . . . . 2nd . . . . . 53rd Tennessee . . . . . . . . . . 3rd . . . . . 96th Cleveland . . . . . . . . . . . 4th . . . . 103rd Tampa Bay . . . . . . . . . . 5th . . . . 141st Arizona . . . . . . . . . . . . . 5th . . . . 168th San Diego. . . . . . . . . . . 6th . . . . 177th

2004 (3) Tommie Harris . . . . . . . . DT . . . Chicago . . . . . . . . . . . . 1st . . . . . 14th Teddy Lehman . . . . . . . . LB . . . Detroit . . . . . . . . . . . . . 2nd . . . . . 37th Derrick Strait. . . . . . . . . . CB . . . New York Jets. . . . . . . . 3rd . . . . . 76th 2003 (4) Andre Woolfolk . . . . . . . . CB . . . Quentin Griffin . . . . . . . . RB . . . Jimmy Wilkerson . . . . . . DE . . . Trent Smith . . . . . . . . . . . TE . . .

Tennessee . . . . . . . . . . 1st Denver . . . . . . . . . . . . . 4th Kansas City . . . . . . . . . 6th Baltimore . . . . . . . . . . . 7th

. . . . . 28th . . . . 108th . . . . 189th . . . . 223rd

2002 (2) Roy Williams. . . . . . . . . . .S . . . . Dallas . . . . . . . . . . . . . . 1st . . . . . . 8th Rocky Calmus . . . . . . . . LB . . . Tennessee . . . . . . . . . . 3rd . . . . . 77th 2001 (2) Torrance Marshall. . . . . . LB . . . Green Bay . . . . . . . . . . 3rd . . . . . 72nd Josh Heupel . . . . . . . . . . QB . . . Miami . . . . . . . . . . . . . . 6th . . . . 177th 2000 (2) Stockar McDougle . . . . . .T . . . . Detroit . . . . . . . . . . . . . . 1st . . . . . 20th William Bartee . . . . . . . . CB . . . Kansas City . . . . . . . . 2nd . . . . . 54th 1999 (3) Jermaine Fazande . . . . . RB . . . San Diego. . . . . . . . . . 2nd . . . . . 60th De’Mond Parker . . . . . . . RB . . . Green Bay . . . . . . . . . . 5th . . . . 159th Kelly Gregg. . . . . . . . . . . DT . . . Cincinnati . . . . . . . . . . . 6th . . . . 173rd 1998 (4) Stephen Alexander . . . . . TE . . . Martin Chase . . . . . . . . . DT . . . Travian Smith . . . . . . . . . LB . . . Sammy Williams. . . . . . . OL . . .

Washington. . . . . . . . . 2nd Baltimore . . . . . . . . . . . 5th Oakland . . . . . . . . . . . . 5th Baltimore . . . . . . . . . . . 6th

. . . . . 48th . . . . 124th . . . . 152nd . . . . 164th

1997 (2) Barron Tanner. . . . . . . . . DL . . . Miami . . . . . . . . . . . . . . 5th . . . . 149th Rod Manuel . . . . . . . . . . DL . . . Pittsburgh . . . . . . . . . . . 6th . . . . 199th 1996 (6) Cedric Jones. . . . . . . . . . DE . . . Jerald Moore. . . . . . . . . . RB . . . Darrius Johnson . . . . . . . CB . . . Harry Stamps . . . . . . . . . OL . . . Wendell Davis. . . . . . . . . CB . . . J.R. Conrad . . . . . . . . . . OL . . .

New York Giants . . . . . . 1st St. Louis . . . . . . . . . . . . 3rd Denver . . . . . . . . . . . . . 4th Arizona . . . . . . . . . . . . . 5th Dallas . . . . . . . . . . . . . . 6th New England . . . . . . . . 7th

. . . . . . 5th . . . . . 83rd . . . . 122nd . . . . 161st . . . . 207th . . . . 247th

1994 (2) Aubrey Beavers . . . . . . . LB . . . Miami . . . . . . . . . . . . . 2nd . . . . . 54th Rickey Brady . . . . . . . . . TE . . . L.A. Rams. . . . . . . . . . . 6th . . . . 167th

188 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

1993 (2) Pos Team Rd Pick Darnell Walker . . . . . . . . DB . . . Atlanta . . . . . . . . . . . . . 7th . . . . 178th Joey Mickey . . . . . . . . . . TE . . . Philadelphia . . . . . . . . . 7th . . . . 190th 1992 (9) Joe Bowden . . . . . . . . . . LB . . . Brian Brauninger. . . . . . . .T . . . . Mike Gaddis . . . . . . . . . . DB . . . Stacey Dillard . . . . . . . . . DT . . . Terry Ray . . . . . . . . . . . . DB . . . Jason Belser. . . . . . . . . . DB . . . Corey Mayfield . . . . . . . . DE . . . Brandon Houston . . . . . . .T . . . . Chris Wilson . . . . . . . . . . LB . . .

Houston . . . . . . . . . . . . 5th Phoenix. . . . . . . . . . . . . 6th Minnesota . . . . . . . . . . . 6th New York Giants . . . . . . 6th Atlanta . . . . . . . . . . . . . 6th Indianapolis . . . . . . . . . 8th San Francisco. . . . . . . 10th Philadelphia . . . . . . . . 12th Chicago . . . . . . . . . . . 12th

. . . . 133rd . . . . 146th . . . . 152nd . . . . 153rd . . . . 158th . . . . 197th . . . . 269th . . . . 326th . . . . 331st

1991 (5) Adrian Cooper . . . . . . . . TE . . . James Goode . . . . . . . . . LB . . . Frank Blevins . . . . . . . . . LB . . . Scott Evans . . . . . . . . . . DT . . . Tom Backes . . . . . . . . . . DE . . .

Pittsburgh . . . . . . . . . . . 4th Atlanta . . . . . . . . . . . . . 5th Green Bay . . . . . . . . . . 7th Phoenix. . . . . . . . . . . . . 8th Chicago . . . . . . . . . . . 10th

. . . . 103rd . . . . 114th . . . . 169th . . . . 209th . . . . 272nd

1990 (3) Kevin Thompson. . . . . . . DB . . . Philadelphia . . . . . . . . . 6th . . . . 162nd Leon Perry . . . . . . . . . . . RB . . . L.A. Raiders . . . . . . . . . 9th . . . . 230th Ken McMichel. . . . . . . . . DB . . . Phoenix. . . . . . . . . . . . 12th . . . . 330th 1989 (4) Anthony Stafford. . . . . . .WR . . . Eric Mitchel. . . . . . . . . . . DB . . . Tony Woods . . . . . . . . . . DT . . . Anthony Phillips . . . . . . . G. . . .

Denver . . . . . . . . . . . . . 6th Phoenix. . . . . . . . . . . . . 6th Chicago . . . . . . . . . . . . 8th Chicago . . . . . . . . . . . 12th

. . . . 152nd . . . . 165th . . . . 216th . . . . 333rd

1988 (13) Rickey Dixon. . . . . . . . . . DB . . . Keith Jackson . . . . . . . . . TE . . . Dante Jones . . . . . . . . . . LB . . . Mark Hutson . . . . . . . . . . G. . . . Greg Johnson. . . . . . . . . .T . . . . Lydell Carr . . . . . . . . . . . RB . . . Darrell Reed . . . . . . . . . . LB . . . Troy Johnson . . . . . . . . . LB . . . Jon Phillips . . . . . . . . . . . G. . . . Derrick White . . . . . . . . . DB . . . Derrick Crudup . . . . . . . . DB . . . Caesar Rentie. . . . . . . . . .T . . . . Patrick Collins. . . . . . . . . RB . . .

Cincinnati . . . . . . . . . . . 1st Philadelphia . . . . . . . . . 1st Chicago . . . . . . . . . . . 2nd Dallas . . . . . . . . . . . . . . 3rd Miami . . . . . . . . . . . . . . 4th New Orleans. . . . . . . . . 4th Green Bay . . . . . . . . . . 5th Chicago . . . . . . . . . . . . 5th Phoenix. . . . . . . . . . . . . 6th Minnesota . . . . . . . . . . . 6th L.A. Raiders . . . . . . . . . 7th Chicago . . . . . . . . . . . . 7th Green Bay . . . . . . . . . . 8th

. . . . . . 5th . . . . . 13th . . . . . 51st . . . . . 67th . . . . . 99th . . . . 106th . . . . 116th . . . . 133rd . . . . 148th . . . . 164th . . . . 171st . . . . 189th . . . . 200th

Seattle . . . . . . . . . . . . . 1st Chicago . . . . . . . . . . . . 5th Houston . . . . . . . . . . . . 5th Chicago . . . . . . . . . . . . 8th

. . . . . . 1st . . . . 120th . . . . 133rd . . . . 221st

Atlanta . . . . . . . . . . . . . 1st Tampa Bay . . . . . . . . . 2nd St. Louis . . . . . . . . . . . . 5th L.A. Rams. . . . . . . . . . 12th

. . . . . . 2nd . . . . . 40th . . . . 116th . . . . 327th

1987 (4) Brian Bosworth* . . . . . . . LB . . . Steve Bryan . . . . . . . . . . DE . . . Spencer Tillman . . . . . . . RB . . . Paul Migliazzo . . . . . . . . LB . . . * NFL Supplemental Draft 1986 (4) Tony Casillas . . . . . . . . . DT . . . Kevin Murphy . . . . . . . . . LB . . . Jeff Tupper . . . . . . . . . . . DE . . . Marcus Dupree. . . . . . . . RB . . .


SOONERS IN THE NFL DRAFT Pick . . . . . 26th . . . . . 85th . . . . 189th . . . . 199th . . . . 316th

1984 (7) Rick Bryan . . . . . . . . . . . DT . . . Jackie Shipp . . . . . . . . . . LB . . . Dwight Drane . . . . . . . . . DB . . . Bob Slater. . . . . . . . . . . . DT . . . Scott Case . . . . . . . . . . . DB . . . Thomas Benson . . . . . . . LB . . . Paul Parker. . . . . . . . . . . G. . . .

Atlanta . . . . . . . . . . . . . 1st Miami . . . . . . . . . . . . . . 1st Buffalo. . . . . . . . . . . . . . 1st Washington. . . . . . . . . 2nd Atlanta . . . . . . . . . . . . 2nd Atlanta . . . . . . . . . . . . 2nd St. Louis . . . . . . . . . . . 12th

. . . . . . 9th . . . . . 14th . . . . . 14th . . . . . 31st . . . . . 32nd . . . . . 36th . . . . 325th

1983 (3) Steve Haworth . . . . . . . . DB . . . Houston . . . . . . . . . . . . 6th . . . . 142nd Weldon Ledbetter . . . . . . RB . . . Tampa Bay . . . . . . . . . . 7th . . . . 185th Stanley Wilson . . . . . . . . RB . . . Cincinnati . . . . . . . . . . . 9th . . . . 248th

1981 (8) David Overstreet. . . . . . . RB . . . Keith Gary. . . . . . . . . . . . DE . . . Steve Rhodes. . . . . . . . .WR . . . Richard Turner . . . . . . . . DT . . . Louis Oubre . . . . . . . . . . .T . . . . Ken Sitton. . . . . . . . . . . . DB . . . J.C. Watts . . . . . . . . . . . . DB . . . Forest Valora . . . . . . . . . TE . . .

Miami . . . . . . . . . . . . . . 1st Pittsburgh . . . . . . . . . . . 1st St. Louis . . . . . . . . . . . . 4th Green Bay . . . . . . . . . . 4th New Orleans. . . . . . . . . 5th Indianapolis . . . . . . . . . 8th New York Jets. . . . . . . . 8th Green Bay . . . . . . . . . 11th

. . . . . 13th . . . . . 17th . . . . . 88th . . . . 105th . . . . 112th . . . . 204th . . . . 213th . . . . 282nd

1980 (9) Billy Sims . . . . . . . . . . . . RB . . . George Cumby . . . . . . . . LB . . . Darrol Ray . . . . . . . . . . . DB . . . John Goodman. . . . . . . . DE . . . Fred Nixon . . . . . . . . . . .WR . . . Paul Tabor . . . . . . . . . . . .C. . . . Bud Hebert . . . . . . . . . . . DB . . . Barry Burget . . . . . . . . . . LB . . . Mike Babb. . . . . . . . . . . . DB . . .

Detroit . . . . . . . . . . . . . . 1st Green Bay . . . . . . . . . . 1st New York Giants . . . . . 2nd Pittsburgh . . . . . . . . . . 2nd Green Bay . . . . . . . . . . 4th Chicago . . . . . . . . . . . . 5th New York Giants . . . . . . 7th New England . . . . . . . . 9th Atlanta . . . . . . . . . . . . 11th

. . . . . . 1st . . . . . 26th . . . . . 40th . . . . . 56th . . . . . 87th . . . . 130th . . . . 179th . . . . 235th . . . . 284th

1979 (10) Greg Roberts . . . . . . . . . G. . . . Reggie Mathis. . . . . . . . . LB . . . Sam Claphan . . . . . . . . . .T . . . . Kenny King . . . . . . . . . . . RB . . . Phil Tabor . . . . . . . . . . . . DE . . . Victor Hicks. . . . . . . . . . . TE . . . Daryl Hunt. . . . . . . . . . . . LB . . . Thomas Lott . . . . . . . . . . RB . . . Uwe Von Schamann. . . . .K . . . . Reggie Kinlaw. . . . . . . . . DT . . .

Tampa Bay . . . . . . . . . 2nd New Orleans. . . . . . . . 2nd Cleveland . . . . . . . . . . 2nd Houston . . . . . . . . . . . . 3rd New York Giants . . . . . . 4th L.A. Rams. . . . . . . . . . . 5th Houston . . . . . . . . . . . . 6th St. Louis . . . . . . . . . . . . 6th Miami . . . . . . . . . . . . . . 7th Oakland . . . . . . . . . . . 12th

. . . . . 33rd . . . . . 38th . . . . . 47th . . . . . 72nd . . . . . 90th . . . . 122nd . . . . 143rd . . . . 144th . . . . 189th . . . . 320th

1977 (5) Horace Ivory . . . . . . . . . . RB . . . Sidney Brown . . . . . . . . . DB . . . Mike Vaughan. . . . . . . . . .T . . . . Jerry Anderson . . . . . . . . DB . . . Jim Culbreath . . . . . . . . . RB . . .

New England . . . . . . . 2nd New England . . . . . . . . 3rd New York Giants . . . . . . 4th Cincinnati . . . . . . . . . . . 4th Green Bay . . . . . . . . . 10th

. . . . . 44th . . . . . 82nd . . . . . 88th . . . . 105th . . . . 260th

1976 (7) Lee Roy Selmon. . . . . . . DE . . . Joe Washington . . . . . . . RB . . . Billy Brooks. . . . . . . . . . .WR . . . Dewey Selmon . . . . . . . . DT . . . Tinker Owens . . . . . . . . .WR . . . Jimbo Elrod. . . . . . . . . . . LB . . . Tony DiRienzo . . . . . . . . .K . . . .

Tampa Bay . . . . . . . . . . 1st San Diego. . . . . . . . . . . 1st Cincinnati . . . . . . . . . . . 1st Tampa Bay . . . . . . . . . 2nd New Orleans. . . . . . . . . 4th Kansas City . . . . . . . . . 5th San Diego. . . . . . . . . . . 8th

. . . . . . 1st . . . . . . 4th . . . . . 11th . . . . . 60th . . . . . 96th . . . . 144th . . . . 212th

1975 (10) Rod Shoate. . . . . . . . . . . LB . . . Tony Peters. . . . . . . . . . . DB . . . Randy Hughes . . . . . . . . DB . . . Kyle Davis. . . . . . . . . . . . .C. . . . John Carroll . . . . . . . . . .WR . . . Wayne Hoffman . . . . . . . TE . . . Clyde Russell . . . . . . . . . RB . . . Jerry Arnold . . . . . . . . . . G. . . . John Roush . . . . . . . . . . G. . . . Grant Burget. . . . . . . . . . RB . . .

New England . . . . . . . 2nd Cleveland . . . . . . . . . . . 4th Dallas . . . . . . . . . . . . . . 4th Dallas . . . . . . . . . . . . . . 5th San Diego. . . . . . . . . . . 6th Kansas City . . . . . . . . . 8th Miami . . . . . . . . . . . . . 10th Denver . . . . . . . . . . . . 14th San Diego. . . . . . . . . . 15th New Orleans. . . . . . . . 15th

. . . . . 41st . . . . . 82nd . . . . . 96th . . . . 113th . . . . 134th . . . . 189th . . . . 239th . . . . 355th . . . . 370th . . . . 372nd

1974 (7) Durwood Keeton. . . . . . . DB . . . Gary Baccus. . . . . . . . . . LB . . . Clyde Powers . . . . . . . . . DB . . . Kenith Pope . . . . . . . . . . DB . . . Eddie Foster . . . . . . . . . . .T . . . . Dave Smith. . . . . . . . . . . LB . . . Lucious Selmon . . . . . . . DT . . .

St. Louis . . . . . . . . . . . . 4th New York Jets. . . . . . . . 5th New York Giants . . . . . . 5th Oakland . . . . . . . . . . . . 9th New England . . . . . . . 12th Philadelphia . . . . . . . . 14th New England . . . . . . . 16th

. . . . . 85th . . . . 110th . . . . 119th . . . . 227th . . . . 296th . . . . 349th . . . . 399th

1973 (11) Derland Moore . . . . . . . . DE . . . Greg Pruitt . . . . . . . . . . . RB . . . Al Chandler. . . . . . . . . . . TE . . . Leon Crosswhite. . . . . . . RB . . . Joe Wylie . . . . . . . . . . . .WR . . . Tom Brahaney . . . . . . . . .C. . . . Ken Jones. . . . . . . . . . . . .C. . . . Dan Ruster . . . . . . . . . . . DB . . . Dean Unruh . . . . . . . . . . .T . . . . Ray Hamilton . . . . . . . . . .T . . . . Larry Roach . . . . . . . . . . DB . . .

New Orleans. . . . . . . . 2nd Cleveland . . . . . . . . . . 2nd Cincinnati . . . . . . . . . . 2nd Detroit . . . . . . . . . . . . . 2nd Oakland . . . . . . . . . . . . 4th St. Louis . . . . . . . . . . . . 5th St. Louis . . . . . . . . . . . . 7th New England . . . . . . . 10th St. Louis . . . . . . . . . . . 12th New England . . . . . . . 14th Chicago . . . . . . . . . . . 17th

. . . . . 29th . . . . . 30th . . . . . 43rd . . . . . 44th . . . . 101st . . . . 108th . . . . 164th . . . . 238th . . . . 292nd . . . . 342nd . . . . 424th

OKLAHOM A HISTORY

. . . . . 67th . . . . 113th . . . . 207th . . . . 241st

Pick . . . . . 20th . . . . . 84th . . . . 178th . . . . 289th

REVIEW & OPPONENTS

L.A. Rams. . . . . . . . . . . 3rd Indianapolis . . . . . . . . . 5th L.A. Rams. . . . . . . . . . . 8th Kansas City . . . . . . . . . 9th

Team Rd L.A. Rams. . . . . . . . . . . 1st Dallas . . . . . . . . . . . . . . 3rd Miami . . . . . . . . . . . . . . 7th Detroit . . . . . . . . . . . . . 11th

THE SOONERS

1982 (4) Bill Bechtold . . . . . . . . . . .C. . . . Terry Crouch. . . . . . . . . . G. . . . Mike Reilly . . . . . . . . . . . DE . . . Lyndle Byford . . . . . . . . . .T . . . .

1978 (4) Pos Elvis Peacock . . . . . . . . . RB . . . David Hudgens. . . . . . . . DT . . . Karl Baldischwiler . . . . . . .T . . . . Richard Murray. . . . . . . . DT . . .

COACHING STAFF

Team Rd Denver . . . . . . . . . . . . . 1st Minnesota . . . . . . . . . . . 4th L.A. Rams. . . . . . . . . . . 7th Houston . . . . . . . . . . . . 8th Tampa Bay . . . . . . . . . 12th

2 0 0 5 S EAS ON

1985 (5) Pos Steve Sewell. . . . . . . . . . RB . . . Buster Rhymes. . . . . . . .WR . . . Danny Bradley . . . . . . . .WR . . . Chuck Thomas . . . . . . . . DT . . . Jim Rockford. . . . . . . . . . .S . . . .

189 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONERS IN THE NFL DRAFT 1972 (4) Pos Jack Mildren . . . . . . . . . . DB . . . Al Qualls . . . . . . . . . . . . . LB . . . Roy Bell . . . . . . . . . . . . . RB . . . John Shelley. . . . . . . . . . DB . . .

Team Rd Baltimore . . . . . . . . . . 2nd Baltimore . . . . . . . . . . . 8th Dallas . . . . . . . . . . . . . . 9th Buffalo. . . . . . . . . . . . . 17th

Pick . . . . . 46th . . . . 191st . . . . 234th . . . . 417th

1971 (3) John Watson. . . . . . . . . . .T . . . . San Francisco. . . . . . . . 7th . . . . 179th Steve Castell . . . . . . . . . LB . . . Cleveland . . . . . . . . . . 10th . . . . 248th Monty Johnson . . . . . . . . DB . . . Green Bay . . . . . . . . . 17th . . . . 427th

1960 (3) Pos Prentice Gautt. . . . . . . . . FB . . . Bobby Boyd . . . . . . . . . . .B . . . . Gilmer Louis . . . . . . . . . . .T . . . .

Team Rd Pick Cleveland . . . . . . . . . . 2nd . . . . . 19th Baltimore . . . . . . . . . . 10th . . . . 119th Green Bay . . . . . . . . . 20th . . . . 233rd

1959 (3) Dave Baker. . . . . . . . . . . QB . . . San Francisco. . . . . . . . 1st . . . . . . 5th Bob Harrison. . . . . . . . . . .C. . . . San Francisco. . . . . . . 2nd . . . . . 17th Ross Coyle . . . . . . . . . . . .E . . . . Los Angeles . . . . . . . . 20th . . . . 237th 1958 (4) Clendon Thomas . . . . . . .B . . . . Billy Krisher. . . . . . . . . . . G. . . . Doyle Jennings. . . . . . . . .T . . . . Dennit Morris . . . . . . . . . .B . . . .

Los Angeles . . . . . . . . 2nd Pittsburgh . . . . . . . . . . . 3rd Pittsburgh . . . . . . . . . . 14th San Francisco. . . . . . . 18th

1957 (7) Jerry Tubbs. . . . . . . . . . . .C. . . . Tommy McDonald. . . . . . .B . . . . Jimmy Harris. . . . . . . . . . QB . . . Billy Pricer. . . . . . . . . . . . .B . . . . Ed Gray . . . . . . . . . . . . . .T . . . . Bob Derrick. . . . . . . . . . . .B . . . . Tom Emerson . . . . . . . . . G. . . .

Chicago Bears . . . . . . . 1st . . . . . 10th Philadelphia . . . . . . . . . 3rd . . . . . 31st Philadelphia . . . . . . . . . 5th . . . . . 50th Baltimore . . . . . . . . . . . 6th . . . . . 65th Los Angeles . . . . . . . . . 7th . . . . . 75th Chicago Cards . . . . . . 12th . . . . 142nd Chicago Bears . . . . . . 28th . . . . 336th

1956 (4) Cecil Morris. . . . . . . . . . . G. . . . Bob Burris. . . . . . . . . . . . .B . . . . Bo Bolinger. . . . . . . . . . . G. . . . Joe Mobra. . . . . . . . . . . . .E . . . .

Green Bay . . . . . . . . . . 4th Green Bay . . . . . . . . . . 6th Chicago Cards . . . . . . 13th Cleveland . . . . . . . . . . 20th

. . . . . 44th . . . . . 68th . . . . 149th . . . . 241st

1955 (6) Max Boydston. . . . . . . . . .E . . . . Kurt Burris. . . . . . . . . . . . .C. . . . Buddy Leake. . . . . . . . . . .B . . . . Bob Herndon . . . . . . . . . .B . . . . Steve Champlin . . . . . . . .T . . . . Carl Allison . . . . . . . . . . . .B . . . .

Chicago Cards . . . . . . . 1st Cleveland . . . . . . . . . . . 1st Green Bay . . . . . . . . . . 3rd Chicago Cards . . . . . . 16th Cleveland . . . . . . . . . . 18th Chicago Bears . . . . . 22nd

. . . . . . 2nd . . . . . 13th . . . . . 29th . . . . 182nd . . . . 217th . . . . 263rd

. . . . . 23rd . . . . . 28th . . . . . 67th . . . . . 79th . . . . 193rd . . . . 250th

1954 (5) Larry Grigg . . . . . . . . . . . .B . . . . Merrill Green. . . . . . . . . . .B . . . . Roger Nelson . . . . . . . . . .T . . . . J.D. Roberts . . . . . . . . . . G. . . . Juel Sweatte. . . . . . . . . . .B . . . .

Baltimore . . . . . . . . . . 2nd Washington. . . . . . . . . 10th Washington. . . . . . . . . 14th Green Bay . . . . . . . . . 17th Pittsburgh . . . . . . . . . . 30th

. . . . . 16th . . . . 116th . . . . 164th . . . . 195th . . . . 355th

1964 (3) Joe Don Looney . . . . . . . .B . . . . New York Giants . . . . . . 1st . . . . . 12th Glen Condren . . . . . . . . . .T . . . . New York Giants . . . . . 11th . . . . 152nd John Garrett . . . . . . . . . . LB . . . Los Angeles . . . . . . . . 14th . . . . 189th

1953 (6) Billly Vessels. . . . . . . . . . .B . . . . Eddie Crowder . . . . . . . . QB . . . Buck McPhail . . . . . . . . . .B . . . . Tom Catlin. . . . . . . . . . . . .C. . . . Dick Bowman . . . . . . . . . G. . . . Tom Carroll . . . . . . . . . . . .B . . . .

Baltimore . . . . . . . . . . . 1st New York Giants . . . . . 2nd Baltimore . . . . . . . . . . . 3rd Baltimore . . . . . . . . . . . 4th New York Giants . . . . . 15th Los Angeles . . . . . . . . 15th

. . . . . . 2nd . . . . . 22nd . . . . . 26th . . . . . 38th . . . . 177th . . . . 180th

1970 (6) Steve Zabel . . . . . . . . . . TE . . . Jim Files . . . . . . . . . . . . . LB . . . Steve Owens . . . . . . . . . RB . . . Ken Mendenhall . . . . . . . .C. . . . Jack Porter . . . . . . . . . . . G. . . . Joe Killingsworth. . . . . . .WR . . .

Philadelphia . . . . . . . . . 1st . . . . . . 6th New York Giants . . . . . . 1st . . . . . 13th Detroit . . . . . . . . . . . . . . 1st . . . . . 19th Atlanta . . . . . . . . . . . . . 5th . . . . 116th New York Jets. . . . . . . . 8th . . . . 167th Boston . . . . . . . . . . . . 17th . . . . 420nd

1969 (1) Eddie Hinton. . . . . . . . . . FL . . . Baltimore . . . . . . . . . . . 1st . . . . . 25th 1968 (3) Bob Kalsu . . . . . . . . . . . . .T . . . . Buffalo. . . . . . . . . . . . . . 8th . . . . 199th Granville Liggins. . . . . . . LB . . . Detroit . . . . . . . . . . . . . 10th . . . . 256th Ron Shotts . . . . . . . . . . . RB . . . Dallas . . . . . . . . . . . . . 11th . . . . 292nd 1967 (5) Jim Riley. . . . . . . . . . . . . .T . . . . Ben Hart . . . . . . . . . . . . . HB . . . James Jackson. . . . . . . . .E . . . . Eugene Ross . . . . . . . . . DB . . . Tom Stidham. . . . . . . . . . .K . . . .

Miami . . . . . . . . . . . . . 2nd New Orleans. . . . . . . . . 3rd Oakland . . . . . . . . . . . . 4th New Orleans. . . . . . . . . 9th New York Giants . . . . . 13th

. . . . . 29th . . . . . 80th . . . . . 96th . . . . 237th . . . . 320nd

1966 (2) Carl McAdams . . . . . . . . CB . . . St. Louis . . . . . . . . . . . . 1st . . . . . . 8th Mike Ringer . . . . . . . . . . HB . . . St. Louis . . . . . . . . . . . 10th . . . . 149th 1965 (6) Lance Retzel. . . . . . . . . . HB . . . Ralph Neely . . . . . . . . . . .T . . . . John Flynn . . . . . . . . . . . .E . . . . Jim Grisham . . . . . . . . . . .B . . . . Larry Brown . . . . . . . . . . .B . . . . Ed McQuarters . . . . . . . . G. . . .

Minnesota . . . . . . . . . . 2nd Baltimore . . . . . . . . . . 2nd Detroit . . . . . . . . . . . . . . 5th Minnesota . . . . . . . . . . . 6th Detroit . . . . . . . . . . . . . 14th St. Louis . . . . . . . . . . . 18th

1963 (3) Jim Cook. . . . . . . . . . . . . G. . . . St. Louis . . . . . . . . . . . . 8th . . . . 101st Dennis Ward. . . . . . . . . . .T . . . . Philadelphia . . . . . . . . . 9th . . . . 116th Paul Lea . . . . . . . . . . . . . .B . . . . St. Louis . . . . . . . . . . . 14th . . . . 185th 1961 (3) Ron Hartline . . . . . . . . . . FB . . . Detroit . . . . . . . . . . . . . . 4th . . . . . 51st Mike McClellan . . . . . . . . .B . . . . San Francisco. . . . . . . . 6th . . . . . 80th Phil Lohmann . . . . . . . . . .C. . . . Cleveland . . . . . . . . . . 14th . . . . 195th

190 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

. . . . . 19th . . . . . 32nd . . . . 164th . . . . 215th

1952 (2) Jim Weatherall . . . . . . . . .T . . . . Philadelphia . . . . . . . . 2nd . . . . . 17th Ed Rowland . . . . . . . . . . .T . . . . Cleveland . . . . . . . . . . 16th . . . . 192nd


SOONERS IN THE NFL DRAFT Pick . . . . . . 4th . . . . . 95th . . . . 107th . . . . 128th . . . . 229th . . . . 271st

1950 (6) George Thomas . . . . . . . .B . . . . Stan West . . . . . . . . . . . . G. . . . Leon Manley. . . . . . . . . . G. . . . Dee Andros. . . . . . . . . . . G. . . . Darrell Royal. . . . . . . . . . .B . . . . George Brewer . . . . . . . . .B . . . .

Washington. . . . . . . . . . 1st . . . . . . 6th Los Angeles . . . . . . . . . 1st . . . . . 12th Green Bay . . . . . . . . . . 7th . . . . . 82nd Chicago Cards . . . . . . 14th . . . . 177th New York Bulldogs . . . 20th . . . . 250th Detroit . . . . . . . . . . . . . 21st . . . . 265th

1949 (2) Myrle Greathouse. . . . . . .B . . . . Chicago Cards . . . . . . . 7th . . . . . 62nd Jim Owens . . . . . . . . . . . .E . . . . Pittsburgh . . . . . . . . . . 23rd . . . . 225th 1948 (2) Nute Trotter. . . . . . . . . . . .T . . . . Boston . . . . . . . . . . . . 17th . . . . 149th Ray Pearcy. . . . . . . . . . . .C. . . . Washington. . . . . . . . . 18th . . . . 158th

1946 (5) Joe Golding . . . . . . . . . . .B . . . . Thurman Tigart . . . . . . . . G. . . . Tom Tallchief. . . . . . . . . . .T . . . . Derald Lebow . . . . . . . . . .B . . . . John West. . . . . . . . . . . . .B . . . .

Chicago Cards . . . . . . . 5th Boston . . . . . . . . . . . . . 6th Pittsburgh . . . . . . . . . . 15th Los Angeles . . . . . . . . 23rd Los Angeles . . . . . . . 32nd

. . . . . 31st . . . . . 42nd . . . . 133rd . . . . 220th . . . . 300th

1945 (4) W.G. Wooten . . . . . . . . . .E . . . . Lee Kennon . . . . . . . . . . .T . . . . Stan Green . . . . . . . . . . . .T . . . . Don Fauble. . . . . . . . . . . .B . . . .

Cleveland . . . . . . . . . . . 3rd Cleveland . . . . . . . . . . 18th Detroit . . . . . . . . . . . . . 25th Brooklyn . . . . . . . . . . . 28th

. . . . . 21st . . . . 180th . . . . 260th . . . . 288th

1944 (5) Jim Tyree . . . . . . . . . . . . .E . . . . Ed Davis . . . . . . . . . . . . . .B . . . . Clare Morford . . . . . . . . . G. . . . Max Fischer . . . . . . . . . . .C. . . . Joe Golding . . . . . . . . . . .B . . . .

Brooklyn . . . . . . . . . . . 12th . . . . .111th Chicago Bears . . . . . 22nd . . . . 227th Boston . . . . . . . . . . . 22nd . . . . 230th Detroit . . . . . . . . . . . . . 23rd . . . . 233rd Brooklyn . . . . . . . . . . . 27th . . . . 276th

1943 (4) Homer Simmons. . . . . . . .T . . . . Walter Lamb . . . . . . . . . . .E . . . . Bill Campbell. . . . . . . . . . .B . . . . Huel Hamm. . . . . . . . . . . .B . . . .

Cleveland . . . . . . . . . . 10th Chicago Bears . . . . . . 10th Chicago Cards . . . . . . 17th Detroit . . . . . . . . . . . . . 25th

1941 (2) Hal Lahar . . . . . . . . . . . . G. . . . Chicago . . . . . . . . . . . . 9th . . . . . 79th Johnny Martin. . . . . . . . . .B . . . . Chicago Bears . . . . . . 14th . . . . 128th 1940 (9) Dick Favor . . . . . . . . . . . .B . . . . Cecil Shirk . . . . . . . . . . . .E . . . . Frank Ivy. . . . . . . . . . . . . . . . . . . J.R. Manley. . . . . . . . . . . G. . . . Bob Seymour . . . . . . . . . .B . . . . Alton Coppage . . . . . . . . .E . . . . Justin Bowers . . . . . . . . . .T . . . . Beryl Clark . . . . . . . . . . . .B . . . . Ralph Stevenson . . . . . . G. . . .

Philadelphia . . . . . . . . . 3rd Chicago Cards . . . . . . . 4th Pittsburgh . . . . . . . . . . . 4th Green Bay . . . . . . . . . . 9th Washington. . . . . . . . . 10th Chicago Cards . . . . . . 13th Detroit . . . . . . . . . . . . . 13th Chicago Cards . . . . . . 16th Cleveland . . . . . . . . . . 18th

. . . . . 17th . . . . . 26th . . . . . 27th . . . . . 79th . . . . . 88th . . . . .111th . . . . 116th . . . . 141st . . . . 165th

1939 (5) Waddy Young . . . . . . . . . .E . . . . Hugh McCullough. . . . . . .B . . . . Earl Crowder. . . . . . . . . . QB . . . Jim Thomas . . . . . . . . . . G. . . . Gil Duggan . . . . . . . . . . . .T . . . .

Brooklyn . . . . . . . . . . . . 3rd Pittsburgh . . . . . . . . . . . 4th Chicago Cards . . . . . . 10th Chicago Cards . . . . . . 12th New York Giants . . . . . 15th

. . . . . 20th . . . . . 26th . . . . . 82nd . . . . 102nd . . . . 140th

1938 (2) Pete Smith . . . . . . . . . . . .E . . . . Detroit . . . . . . . . . . . . . . 3rd . . . . . 21st Ed Parks. . . . . . . . . . . . . .C. . . . Washington. . . . . . . . . . 9th . . . . . 79th 1937 (3) Bill Breeden . . . . . . . . . . .E . . . . Pittsburgh . . . . . . . . . . . 3rd . . . . . 25th Elmo “Bo” Hewes . . . . . . .B . . . . Pittsburgh . . . . . . . . . . . 4th . . . . . 35th Bill Conkwright . . . . . . . . .C. . . . Chicago Bears . . . . . . . 5th . . . . . 48th 1936 (1) J.W. Wheeler . . . . . . . . . .T . . . . Green Bay . . . . . . . . . 2nd . . . . . 16th

J.D. ROBERTS

. . . . . 85th . . . . . 89th . . . . 153rd . . . . 231st

OKLAHOM A HISTORY

. . . . . 15th . . . . . 31st . . . . . 90th . . . . 101st . . . . 122nd . . . . 201st . . . . 255th

Pick . . . . . 12th . . . . . 17th . . . . . 32nd . . . . 136th

REVIEW & OPPONENTS

Boston . . . . . . . . . . . . . 3rd Green Bay . . . . . . . . . . 5th Chicago Cards . . . . . . 11th Chicago Cards . . . . . . 12th Green Bay . . . . . . . . . 14th Chicago Cards . . . . . 22nd Chicago Bears . . . . . . 27th

Team Rd Cleveland . . . . . . . . . . 2nd Cleveland . . . . . . . . . . . 3rd Cleveland . . . . . . . . . . . 5th Washington. . . . . . . . . 15th

THE SOONERS

1947 (7) John Rapacz. . . . . . . . . . .C. . . . Paul “Buddy” Burns . . . . G. . . . Dave Wallace . . . . . . . . . .B . . . . Charles Sarratt . . . . . . . . .B . . . . Jack Mitchell. . . . . . . . . . QB . . . Wade Walker . . . . . . . . . .T . . . . Bill Morris . . . . . . . . . . . . .E . . . .

1942 (4) Pos Jack Jacobs . . . . . . . . . . .B . . . . Roger Eason. . . . . . . . . . .T . . . . Orville Matthews. . . . . . . .B . . . . Marvin Whited. . . . . . . . . .B . . . .

COACHING STAFF

Team Rd Washington. . . . . . . . . . 1st Chicago Bears . . . . . . . 8th Los Angeles . . . . . . . . . 9th Detroit . . . . . . . . . . . . . 11th Chicago Bears . . . . . . 19th Chicago Cards . . . . . . 23rd

2 0 0 5 S EAS ON

1951 (6) Pos Leon Heath. . . . . . . . . . . .B . . . . Clair Mayes. . . . . . . . . . . G. . . . Noland Lang . . . . . . . . . . .B . . . . Frankie Anderson . . . . . . .E . . . . Ed Lisak . . . . . . . . . . . . . .B . . . . Jim Owens . . . . . . . . . . . .E . . . .

191 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


6 3 NAT IONAL AWARD WINNERS

Nov. 17 Arkansas City* . . . . . . . . . . . . . W . . . . . .5-0 Nov. 28 at Fort Worth . . . . . . . . . . . . . . W . . . . .24-0

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

ALL CAPS indicate games played in Norman. * at Oklahoma City; # at Guthrie; ! at Chicago, Ill.

141 ALL-A MERICANS

SOONER FOOTBALL SEASONS 1895

(0-1)

Nov. 7

Oklahoma City (Town Team) . . L . . . . .34-0

1896

(2-0)

1897

(2-0)

Oct. 28 Norman High* . . . . . . . . . . . . . W . . . . .12-0 Nov. 11 Norman High*. . . . . . . . . . . . . . W . . . . .16-4 Dec. 1 Oklahoma City (Town Team) . . W . . . . .16-0 Dec. 31 Kingfisher College # . . . . . . . . . W . . . . .17-8

1898

1899

Oct. 12 Oct. 24 Nov. 2

1900

Oct. 10 Oct. 17 Oct. 24 Nov. 6 Nov. 20

1901

Oct. 19 Oct. 26 Nov. 6 Nov. 13 Nov. 25

1902

Oct. 1 Oct. 8 Oct. 15 Oct. 22 Oct. 29 Nov. 5 Nov. 12 Nov. 19 Nov. 24

1903

Oct. 3 Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 6 Nov. 13 Nov. 20 Nov. 25 Nov. 30 Dec. 3 Dec. 10

1904

Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 6 Nov. 13 Nov. 20 Nov. 25

(2-0)

(2-1)

KINGFISHER COLLEGE . . . . W . . . . .39-6 at Arkansas . . . . . . . . . . . . . . . W . . . . .11-5 at Arkansas City . . . . . . . . . . . . L . . . .17-11

(3-1-1)

at Texas . . . . . . . . . . . . . . . . . . L . . . . .28-2 CHILOCCO . . . . . . . . . . . . . . . W . . . . .27-0 FORT RENO . . . . . . . . . . . . . . W . . . . .79-0 at Kingfisher College . . . . . . . . T . . . . . .0-0 ARKANSAS CITY . . . . . . . . . . W . . . . .10-0

(3-2)

at Texas . . . . . . . . . . . . . . . . . . L . . . . .12-6 BAYLOR. . . . . . . . . . . . . . . . . . W . . . . .17-0 at Fairmont . . . . . . . . . . . . . . . . W . . . . .42-0 KINGFISHER COLLEGE . . . . . W . . . . .28-6 TEXAS . . . . . . . . . . . . . . . . . . . L . . . . .11-0

(6-3)

GUTHRIE . . . . . . . . . . . . . . . . . W . . . . .62-0 at Texas . . . . . . . . . . . . . . . . . . L . . . . .22-6 at Dallas Athletic Club . . . . . . . L . . . . .11-6 at Arkansas . . . . . . . . . . . . . . . W . . . . .28-0 OKLAHOMA CITY . . . . . . . . . . W . . . . .30-0 KINGFISHER COLLEGE . . . . . W . . . . .15-0 at Missouri . . . . . . . . . . . . . . . . L . . . . .22-5 EMPORIA STATE . . . . . . . . . . W . . . . . .6-5 KINGFISHER COLLEGE . . . . . W . . . . .17-0

(5-4-3)

at Chilocco Indian. . . . . . . . . . . W . . . . .38-5 KINGFISHER COLLEGE . . . . . T . . . . . .0-0 at Texas . . . . . . . . . . . . . . . . . . T . . . . . .6-6 at Texas A&M. . . . . . . . . . . . . . W . . . . . .6-0 FAIRMONT . . . . . . . . . . . . . . .W.. . . . .11-5 EMPORIA STATE . . . . . . . . . . T . . . . . .6-6 at Kansas . . . . . . . . . . . . . . . . . L . . . . .17-5 TEXAS . . . . . . . . . . . . . . . . . . . L . . . . .11-5 ARKANSAS . . . . . . . . . . . . . . . L . . . . .12-0 at Missouri Mines . . . . . . . . . . . W . . . . .12-6 at Bethany . . . . . . . . . . . . . . . . L . . . .12-10 LAWTON . . . . . . . . . . . . . . . . . W . . . . .27-5

(4-3-1)

KINGFISHER COLLEGE . . . . . T . . . . . .0-0 at Pauls Valley . . . . . . . . . . . . W . . . . .33-0 KANSAS. . . . . . . . . . . . . . . . . . L . . . . .16-0 at Lawton . . . . . . . . . . . . . . . . . W . . . . . .6-0 Oklahoma State # . . . . . . . . . . W . . . . .75-0 at Texas . . . . . . . . . . . . . . . . . L . . . .40-10 O.C. MILITARY . . . . . . . . . . . . W . . . . .71-4 BETHANY . . . . . . . . . . . . . . . . L . . . . .36-9

1905

(7-2)

1911

Oct. 9 Oct. 13 Oct. 16 Oct. 23 Oct. 30 Nov. 5 Nov. 12 Nov. 19 Nov. 24

at Central Oklahoma . . . . . . . . W . . . . .28-0 HASKELL. . . . . . . . . . . . . . . . . W . . . .18-12 at Kansas . . . . . . . . . . . . . . . . . L . . . . .34-0 KANSAS CITY MEDICS . . . . . W . . . . .33-0 WASHBURN . . . . . . . . . . . . . . L . . . . . .9-6 Texas* . . . . . . . . . . . . . . . . . . . W . . . . . .2-0 at Kingfisher College . . . . . . . . W . . . . .55-0 CENTRAL OKLAHOMA . . . . . W . . . . .58-0 BETHANY . . . . . . . . . . . . . . . . W . . . . .29-0

Oct. 7 Oct. 14 Oct. 20 Oct. 27 Nov. 4 Nov. 11 Nov. 22 Nov. 30

1906

(5-2-2)

Oct. 5 Oct. 11 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23 Nov. 28

Oct. 6 Oct. 13 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23 Nov. 28

CENTRAL OKLAHOMA . . . . . . W . . . . .12-0 KINGFISHER COLLEGE . . . . . W . . . . .11-6 at Oklahoma State . . . . . . . . . . W . . . . .23-0 at Kansas . . . . . . . . . . . . . . . . . L . . . . .20-4 Texas* . . . . . . . . . . . . . . . . . . . L . . . . .10-9 at Central Oklahoma . . . . . . . . W . . . . .17-0 PAWHUSKA. . . . . . . . . . . . . . . T . . . . . .0-0 SULPHUR . . . . . . . . . . . . . . . . W . . . . .48-0 at Washburn. . . . . . . . . . . . . . . T . . . . . .0-0

1907

(4-4)

1912

1913

Sept. 27 Oct. 4 Oct. 11 Oct. 18 Oct. 31 Nov. 10 Nov. 21 Nov. 27

Oct. 4 Oct. 11 Oct. 19 Oct. 25 Nov. 9 Nov. 12 Nov. 15 Nov. 28

at Kingfisher College . . . . . . . . W . . . . .32-0 CHILOCCO . . . . . . . . . . . . . . . W . . . . .43-0 KANSAS. . . . . . . . . . . . . . . . . . L . . . . .15-0 EPWORTH. . . . . . . . . . . . . . . . W . . . . .29-0 OKLAHOMA STATE . . . . . . . . W . . . . .67-0 at Texas A&M. . . . . . . . . . . . . . L . . . . .19-0 at Texas . . . . . . . . . . . . . . . . . L . . . .29-10 WASHBURN . . . . . . . . . . . . . . L . . . . .12-0

1908

(8-1-1)

at Central Oklahoma . . . . . . . . W . . . . .51-5 at Oklahoma State . . . . . . . . . . W . . . . .18-0 KINGFISHER COLLEGE . . . . . W . . . . .51-0 at Kansas . . . . . . . . . . . . . . . . . L . . . . .11-0 at Kansas State . . . . . . . . . . . . W . . . . .33-4 ARKANSAS . . . . . . . . . . . . . . . W . . . . .27-5 EPWORTH. . . . . . . . . . . . . . . . W . . . . .24-0 TEXAS . . . . . . . . . . . . . . . . . . . W . . . . .50-0 FAIRMONT . . . . . . . . . . . . . . . W . . . . .12-4 at Washburn. . . . . . . . . . . . . . . T . . . . . .6-6

Sept. 26 Oct. 3 Oct. 9 Oct. 17 Oct. 24 Oct. 31 Nov. 6 Nov. 13 Nov. 20 Nov. 26 Nov. 30

(6-4)

1915

Sept. 25 Oct. 3 Oct. 10 Oct. 17 Oct. 23 Oct. 30 Nov. 5 Nov. 13 Nov. 19 Nov. 24

1909

Sept. 23 Oct. 2 Oct. 9 Oct. 13 Oct. 20 Nov. 5 Nov. 12 Nov. 17 Nov. 19 Nov. 29

1910

Oct. 7 Oct. 17 Oct. 21 Oct. 28 Nov. 12 Nov. 28 Dec. 2

1914

CENTRAL OKLAHOMA . . . . . . W . . . . .55-0 KINGFISHER COLLEGE . . . . . W . . . . .46-5 at Kansas . . . . . . . . . . . . . . . . . L . . . . .11-0 NW OKLAHOMA . . . . . . . . . . . W . . . . .23-2 at Arkansas . . . . . . . . . . . . . . . L . . . . .21-5 WASHBURN . . . . . . . . . . . . . . W . . . . .42-8 at St. Louis . . . . . . . . . . . . . . . . W . . . . .12-5 Texas A&M at Dallas . . . . . . . . L . . . . .14-8 at Texas . . . . . . . . . . . . . . . . . . L . . . . .30-0 Epworth*. . . . . . . . . . . . . . . . . . W . . . .12-11

Sept. 25 Oct. 2 Oct. 9 Oct. 16 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 20 Nov. 25

(4-2-1)

1916

at Kingfisher College . . . . . . . . W . . . . .66-0 at Central Oklahoma . . . . . . . . W . . . . .79-0 OKLAHOMA STATE . . . . . . . . W . . . . .12-0 MISSOURI . . . . . . . . . . . . . . . . L . . . . .26-0 KANSAS. . . . . . . . . . . . . . . . . . L . . . . . .2-0 at Texas . . . . . . . . . . . . . . . . . . W . . . . . .3-0 EPWORTH. . . . . . . . . . . . . . . . T . . . . . .3-3

192 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Sept. 23 Sept. 30 Oct. 7 Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 18 Nov. 25 Nov. 30

(8-0)

KINGFISHER COLLEGE . . . . W . . . .104-0 OKLAHOMA CHRISTIAN . . . . W . . . . .62-0 at Oklahoma State . . . . . . . . . W . . . . .22-0 WASHBURN . . . . . . . . . . . . . . W . . . . .37-0 at Missouri . . . . . . . . . . . . . . . . W . . . . .14-6 at Kansas . . . . . . . . . . . . . . . . . W . . . . . .3-0 NW OKLAHOMA . . . . . . . . . . . W . . . . .34-6 at Texas . . . . . . . . . . . . . . . . . . W . . . . . .6-3

(5-4)

at Kingfisher College . . . . . . . . W . . . . .40-0 CENTRAL OKLAHOMA . . . . . W . . . . .87-0 Texas at Dallas . . . . . . . . . . . . W . . . . .21-6 MISSOURI . . . . . . . . . . . . . . . . L . . . . .14-0 at Kansas . . . . . . . . . . . . . . . . . W . . . . . .6-5 Texas A&M at Houston . . . . . . L . . . . .28-6 OKLAHOMA STATE . . . . . . . . W . . . . .16-0 at Nebraska . . . . . . . . . . . . . . . L . . . . .13-9 COLORADO. . . . . . . . . . . . . . . L . . . .14-12

(6-2)

KINGFISHER COLLEGE . . . . . W . . . . .74-0 at Central Oklahoma . . . . . . . . W . . . . .83-0 NW OKLAHOMA . . . . . . . . . . . W . . . .101-0 at Missouri . . . . . . . . . . . . . . . . L . . . .20-17 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .21-7 Texas at Houston . . . . . . . . . . . L . . . . .14-6 at Oklahoma State . . . . . . . . . . W . . . . . .7-0 COLORADO* . . . . . . . . . . . . . . W . . . . .14-3

(9-1-1)

CENTRAL OKLAHOMA . . . . . . W . . . . .67-0 at Kingfisher College . . . . . . . . W . . . . .67-0 EAST CENTRAL . . . . . . . . . . . W . . . . .96-6 MISSOURI . . . . . . . . . . . . . . . . W . . . . .13-0 Texas at Dallas . . . . . . . . . . . . L . . . . .32-7 at Kansas . . . . . . . . . . . . . . . . . T . . . .16-16 OKLAHOMA STATE . . . . . . . . W . . . . .28-6 at Kansas State . . . . . . . . . . . . W . . . .52-10 at Arkansas . . . . . . . . . . . . . . . W . . . . .35-7 HASKELL. . . . . . . . . . . . . . . . . W . . . .33-12 at Tulsa . . . . . . . . . . . . . . . . . . W . . . . .26-7

(10-0, 3-0 SWC CHAMPIONS)

KINGFISHER COLLEGE . . . . . W . . . . .67-0 at SW Oklahoma . . . . . . . . . . . W . . . . .55-0 NW OKLAHOMA . . . . . . . . . . . W . . . .102-0 at Missouri.. . . . . . . . . . . . . . . . W . . . . .24-0 Texas at Dallas . . . . . . . . . . . . W . . . .14-13 KANSAS. . . . . . . . . . . . . . . . . . W . . . .23-14 at Tulsa . . . . . . . . . . . . . . . . . . W . . . .14-13 ARKANSAS . . . . . . . . . . . . . . . W . . . . .24-0 at Kansas State . . . . . . . . . . . . W . . . . 21-7 Oklahoma State* . . . . . . . . . . . W . . . . .26-7

(6-5, 2-1 SWC)

CENTRAL OKLAHOMA . . . . . . W . . . . .27-0 at Oklahoma Baptist . . . . . . . .W.. . . .107-0 SW OKLAHOMA . . . . . . . . . . . W . . . .140-0 TULSA . . . . . . . . . . . . . . . . . . . L . . . . .16-0 Texas at Dallas . . . . . . . . . . . . L . . . . .21-7 MISSOURI . . . . . . . . . . . . . . . . L . . . .23-14 at Kansas . . . . . . . . . . . . . . . . . L . . . .21-13 at Kingfisher College . . . . . . . . W . . . . .96-0 KANSAS STATE . . . . . . . . . . . L . . . .14-13 at Arkansas . . . . . . . . . . . . . . . W . . . .14-13 Oklahoma State* . . . . . . . . . . . W . . . . .41-7


SOONER FOOTBALL SEASONS 1917

1918

(6-4-1, 1-1-1 SWC)

at Central Oklahoma . . . . . . . . W . . . . .99-0 KINGFISHER COLLEGE . . . . . W . . . .179-0 Phillips* . . . . . . . . . . . . . . . . . . W . . . . .52-9 at Illinois . . . . . . . . . . . . . . . . . . L . . . . .44-0 Texas at Dallas . . . . . . . . . . . . W . . . . .14-0 at Missouri . . . . . . . . . . . . . . . . W . . . . .14-7 KANSAS. . . . . . . . . . . . . . . . . . L . . . . .13-6 ARKANSAS . . . . . . . . . . . . . . . T . . . . . .0-0 TULSA . . . . . . . . . . . . . . . . . . . W . . . . .80-0 Oklahoma State* . . . . . . . . . . . L . . . . . .9-0 at Camp Doniphan . . . . . . . . . . L . . . . .21-7

(6-0, 2-0 SWC CHAMPIONS)

CENTRAL OKLAHOMA . . . . . . W . . . . .44-0 POST FIELD . . . . . . . . . . . . . . W . . . . .58-0 at Kansas . . . . . . . . . . . . . . . . . W . . . . .33-0 at Arkansas . . . . . . . . . . . . . . . W . . . .103-0 Phillips* . . . . . . . . . . . . . . . . . . W . . . . .13-7 Oklahoma State* . . . . . . . . . . . W . . . . .27-0

1919

(5-2-3, 2-1 SWC)

1920

Oct. 9 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 20 Nov. 25 Oct. 8 Oct. 15 Oct. 22 Oct. 29 Nov. 5 Nov. 12 Nov. 19 Nov. 24

1922

1923

Oct. 13 Oct. 20 Oct. 27 Nov. 3 Nov. 10 Nov. 17 Nov. 24 Nov. 29

(5-3, 2-3 MVC)

at Central Oklahoma . . . . . . . . W . . . . .21-0 OKLAHOMA STATE . . . . . . . . W . . . . . .6-0 WASHINGTON . . . . . . . . . . . . W . . . .28-13 at Nebraska . . . . . . . . . . . . . . . L . . . . .44-0 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .24-7 at Missouri . . . . . . . . . . . . . . . . L . . . .24-14 at Kansas State . . . . . . . . . . . . L . . . . .14-7 RICE. . . . . . . . . . . . . . . . . . . . . W . . . . .27-0

(2-3-3, 1-2-2 MVC)

CENTRAL OKLAHOMA . . . . . . W . . . . .21-0 KANSAS STATE . . . . . . . . . . . T . . . . . .7-7 NEBRASKA . . . . . . . . . . . . . . . L . . . . .39-7 at Kansas . . . . . . . . . . . . . . . . . L . . . . .19-3 MISSOURI . . . . . . . . . . . . . . . . W . . . .18-14 TEXAS . . . . . . . . . . . . . . . . . . . L . . . . .32-7 at Oklahoma State . . . . . . . . . . T . . . . . .3-3 at Washington . . . . . . . . . . . . . T . . . . . .0-0

(3-5, 2-4 MVC)

at Nebraska . . . . . . . . . . . . . . . L . . . . .24-0 WASHINGTON . . . . . . . . . . . . W . . . . .62-7 OKLAHOMA STATE . . . . . . . . W . . . . .12-0 KANSAS. . . . . . . . . . . . . . . . . . L . . . . . .7-3 at Missouri . . . . . . . . . . . . . . . . W . . . . .13-0 at Texas . . . . . . . . . . . . . . . . . . L . . . .26-14 at Kansas State . . . . . . . . . . . . L . . . .21-20 DRAKE. . . . . . . . . . . . . . . . . . . L . . . .26-20

1926

Oct. 9 Oct. 16 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 20 Nov. 25

1927

Oct. 8 Oct. 15 Oct. 22 Oct. 29 Nov. 5 Nov. 12 Nov. 19 Nov. 24

1928

Oct. 6 Oct. 13 Oct. 27 Nov. 3 Nov. 10 Nov. 17 Nov. 24 Nov. 29

1929

Oct. 12 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23 Nov. 28

1930

Oct. 4 Oct. 11 Oct. 18 Oct. 25 Nov. 1 Nov. 15 Nov. 22 Nov. 27

(4-3-1, 3-3-1 MVC)

at Kansas State . . . . . . . . . . . . L . . . . .16-0 DRAKE. . . . . . . . . . . . . . . . . . . W . . . . . .7-0 at Southern Methodist . . . . . . . W . . . . . .9-0 at Nebraska . . . . . . . . . . . . . . . L . . . . .12-0 KANSAS. . . . . . . . . . . . . . . . . . T . . . . . .0-0 at Missouri . . . . . . . . . . . . . . . . L . . . .16-14 WASHINGTON . . . . . . . . . . . . W . . . . .28-0 OKLAHOMA STATE . . . . . . . . W . . . . .35-0

(5-2-1, 3-2-1 MVC)

ARKANSAS . . . . . . . . . . . . . . . W . . . . .13-6 at Drake . . . . . . . . . . . . . . . . . . W . . . . .11-0 KANSAS STATE . . . . . . . . . . . L . . . .15-12 at Washington . . . . . . . . . . . . . W . . . . .21-0 MISSOURI . . . . . . . . . . . . . . . . W . . . . .10-7 at Kansas . . . . . . . . . . . . . . . . . L . . . . .10-9 ST. LOUIS . . . . . . . . . . . . . . . . W . . . . .47-0 at Oklahoma State . . . . . . . . . . T . . . .14-14

(3-3-2, 2-3 MVC)

at Chicago . . . . . . . . . . . . . . . . W . . . . .13-7 CREIGHTON . . . . . . . . . . . . . . T . . . .13-13 at Kansas State . . . . . . . . . . . . L . . . .20-14 at Central Oklahoma . . . . . . . . T . . . .14-14 WASHINGTON . . . . . . . . . . . . W . . . . .23-7 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .26-7 OKLAHOMA STATE . . . . . . . . L . . . . .13-7 at Missouri . . . . . . . . . . . . . . . . L . . . . .20-7

(5-3, 3-2 BIG 6)

at Indiana . . . . . . . . . . . . . . . . . L . . . . .10-7 CREIGHTON . . . . . . . . . . . . . . W . . . . . .7-0 KANSAS STATE . . . . . . . . . . . W . . . .33-21 at Iowa State . . . . . . . . . . . . . . L . . . . .13-0 NEBRASKA . . . . . . . . . . . . . . . L . . . . .44-6 at Kansas . . . . . . . . . . . . . . . . . W . . . . . .7-0 at Oklahoma State . . . . . . . . . . W . . . . .46-0 MISSOURI . . . . . . . . . . . . . . . . W . . . . .14-0

(3-3-2, 2-2-1 BIG 6)

at Creighton . . . . . . . . . . . . . . . W . . . . .26-0 Texas at Dallas . . . . . . . . . . . . L . . . . .21-0 KANSAS STATE . . . . . . . . . . . W . . . .14-13 IOWA STATE . . . . . . . . . . . . . . W . . . . .21-7 KANSAS. . . . . . . . . . . . . . . . . . L . . . . . .7-0 at Nebraska . . . . . . . . . . . . . . . T . . . .13-13 OKLAHOMA STATE . . . . . . . . T . . . . . .7-7 at Missouri . . . . . . . . . . . . . . . . L . . . . .13-0

(4-3-1, 3-1-1 BIG 6)

NEW MEXICO . . . . . . . . . . . . . W . . . . .47-0 NEBRASKA . . . . . . . . . . . . . . . W . . . . .20-7 Texas at Dallas . . . . . . . . . . . . L . . . . .17-7 KANSAS STATE . . . . . . . . . . . W . . . . . .7-0 at Iowa State . . . . . . . . . . . . . . W . . . .19-13 at Kansas . . . . . . . . . . . . . . . . . L . . . . .13-0 at Oklahoma State . . . . . . . . . . L . . . . . .7-0 MISSOURI . . . . . . . . . . . . . . . . T . . . . . .0-0

Oct. 3 Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 7 Nov. 14 Nov. 26 Dec. 5 Dec. 12 Dec. 19 Dec. 26

1932

Oct. 1 Oct. 8 Oct. 15 Oct. 22 Oct. 29 Nov. 5 Nov. 12 Nov. 19 Nov. 24

1933

Sept. 30 Oct. 7 Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 18 Nov. 23

1934

Oct. 6 Oct. 13 Oct. 20 Oct. 27 Nov. 3 Nov. 10 Nov. 17 Nov. 22 Dec. 1

1935

Sept. 28 Oct. 5 Oct. 12 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 28

1936

Sept. 26 Oct. 3 Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 7 Nov. 14 Nov. 26

(4-7-1, 1-4 BIG 6)

RICE. . . . . . . . . . . . . . . . . . . . . W . . . . .19-6 at Nebraska . . . . . . . . . . . . . . . L . . . . .13-0 Texas at Dallas . . . . . . . . . . . . L . . . . . .3-0 at Kansas State . . . . . . . . . . . . L . . . . .14-0 IOWA STATE . . . . . . . . . . . . . . L . . . .13-12 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .10-0 at Missouri . . . . . . . . . . . . . . . . L . . . . . .7-0 OKLAHOMA STATE . . . . . . . . T . . . . . .0-0 at Oklahoma City . . . . . . . . . . . L . . . . . .6-0 at Tulsa . . . . . . . . . . . . . . . . . . W . . . . .20-7 at Honolulu. . . . . . . . . . . . . . . . L . . . .39-20 at Hawaii . . . . . . . . . . . . . . . . . W . . . . . .7-0

(4-4-1, 3-2 BIG 6)

TULSA . . . . . . . . . . . . . . . . . . . W . . . . . .7-0 at Kansas . . . . . . . . . . . . . . . . . W . . . . .21-6 Texas at Dallas . . . . . . . . . . . . L . . . .17-10 KANSAS STATE . . . . . . . . . . . W . . . .20-13 at Oklahoma State . . . . . . . . . . L . . . . . .7-0 MISSOURI . . . . . . . . . . . . . . . . L . . . . .14-6 at Iowa State . . . . . . . . . . . . . . W . . . .19-12 NEBRASKA . . . . . . . . . . . . . . . L . . . . . .5-0 at George Washington . . . . . . . T . . . . . .7-7

(4-4-1, 3-2 BIG 6)

VANDERBILT. . . . . . . . . . . . . . T . . . . . .0-0 at Tulsa . . . . . . . . . . . . . . . . . . L . . . . 20-6 Texas at Dallas . . . . . . . . . . . . W . . . . . .9-0 IOWA STATE . . . . . . . . . . . . . . W . . . . .19-7 at Nebraska . . . . . . . . . . . . . . . L . . . . .16-7 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .20-0 at Missouri . . . . . . . . . . . . . . . . W . . . . .21-0 at Kansas State . . . . . . . . . . . . L . . . . .14-0 OKLAHOMA STATE . . . . . . . . L . . . . .13-0

(3-4-2, 2-2-1 BIG 6)

CENTENARY . . . . . . . . . . . . . . W . . . . . .7-0 Texas at Dallas . . . . . . . . . . . . L . . . . .19-0 NEBRASKA . . . . . . . . . . . . . . . L . . . . . .6-0 at Kansas . . . . . . . . . . . . . . . . . T . . . . . .7-7 MISSOURI . . . . . . . . . . . . . . . . W . . . . .31-0 IOWA STATE . . . . . . . . . . . . . . W . . . . .12-0 KANSAS STATE . . . . . . . . . . . L . . . . . .8-7 at Oklahoma State . . . . . . . . . . T . . . . . .0-0 at George Washington . . . . . . . L . . . . . .3-0

(6-3, 3-2 BIG 6)

COLORADO. . . . . . . . . . . . . . . W . . . . . .3-0 NEW MEXICO . . . . . . . . . . . . . W . . . . .25-0 Texas at Dallas . . . . . . . . . . . . L . . . . .12-7 IOWA STATE . . . . . . . . . . . . . . W . . . . .16-0 at Nebraska . . . . . . . . . . . . . . . L . . . . .19-0 KANSAS. . . . . . . . . . . . . . . . . . L . . . . . .7-0 at Missouri . . . . . . . . . . . . . . . . W . . . . .20-6 at Kansas State . . . . . . . . . . . . W . . . . . .3-0 OKLAHOMA STATE . . . . . . . . W . . . . .25-0

(3-3-3, 1-2-2 BIG 6)

TULSA . . . . . . . . . . . . . . . . . . . T . . . . . .0-0 at Colorado. . . . . . . . . . . . . . . . W . . . . . .8-0 Texas at Dallas . . . . . . . . . . . . L . . . . . .6-0 at Kansas . . . . . . . . . . . . . . . . . W . . . . .14-0 NEBRASKA . . . . . . . . . . . . . . . L . . . . .14-0 at Iowa State . . . . . . . . . . . . . . T . . . . . .7-7 KANSAS STATE . . . . . . . . . . . T . . . . . .6-6 MISSOURI . . . . . . . . . . . . . . . . L . . . .21-14 at Oklahoma State . . . . . . . . . . W . . . . 35-13

OKLAHOM A HISTORY

Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 18 Nov. 25 Dec. 2

(6-0-1, 4-0-1 MVC CHAMPIONS)

CENTRAL OKLAHOMA . . . . . . W . . . . .16-7 WASHINGTON . . . . . . . . . . . . W . . . .24-14 at Missouri . . . . . . . . . . . . . . . . W . . . . .28-7 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .21-9 at Oklahoma State . . . . . . . . . . W . . . . .36-0 at Kansas State . . . . . . . . . . . . T . . . . . .7-7 DRAKE. . . . . . . . . . . . . . . . . . . W . . . . .44-7

Oct. 3 Oct. 17 Oct. 24 Oct. 31 Nov. 7 Nov. 14 Nov. 21 Nov. 26

1931

REVIEW & OPPONENTS

1921

at Central Oklahoma . . . . . . . . W . . . . .40-0 KINGFISHER COLLEGE . . . . . W . . . .157-0 TULSA . . . . . . . . . . . . . . . . . . . L . . . . .27-0 Texas at Dallas . . . . . . . . . . . . W . . . . .12-7 at Nebraska . . . . . . . . . . . . . . . T . . . . . .7-7 MISSOURI . . . . . . . . . . . . . . . . T . . . . . .6-6 at Kansas . . . . . . . . . . . . . . . . . T . . . . . .0-0 ARKANSAS . . . . . . . . . . . . . . . L . . . . . .7-6 at Kansas State . . . . . . . . . . . . W . . . . .14-3 Oklahoma State* . . . . . . . . . . . W . . . . .33-6

1925

(2-5-1, 2-3-1 MVC)

CENTRAL OKLAHOMA . . . . . . L . . . . . .2-0 NEBRASKA . . . . . . . . . . . . . . . W . . . . .14-7 at Drake . . . . . . . . . . . . . . . . . . L . . . . .28-0 at Oklahoma State . . . . . . . . . . L . . . . . .6-0 MISSOURI . . . . . . . . . . . . . . . . L . . . . .10-0 at Kansas . . . . . . . . . . . . . . . . . L . . . . .20-0 at Washington . . . . . . . . . . . . . W . . . . . .7-0 KANSAS STATE . . . . . . . . . . . T . . . . . .7-7

THE SOONERS

Sept. 27 Oct. 4 Oct. 11 Oct. 18 Oct. 25 Nov. 1 Nov. 8 Nov. 15 Nov. 22 Nov. 27

Oct. 4 Oct. 11 Oct. 25 Nov. 1 Nov. 8 Nov. 15 Nov. 22 Nov. 27

COACHING STAFF

Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23 Nov. 28

1924

2 0 0 5 S EAS ON

Sept. 22 Sept. 29 Oct. 6 Oct. 13 Oct. 20 Nov. 3 Nov. 10 Nov. 17 Nov. 24 Nov. 29 Dec. 15

193 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONER FOOTBALL SEASONS 1937

(5-2-2, 3-1-1 BIG 6)

1943

Sept. 25 Oct. 2 Oct. 9 Oct. 16 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 25

at Tulsa . . . . . . . . . . . . . . . . . . L . . . . .19-7 RICE. . . . . . . . . . . . . . . . . . . . . W . . . . . .6-0 Texas at Dallas . . . . . . . . . . . . T . . . . . .7-7 at Nebraska . . . . . . . . . . . . . . . T . . . . . .0-0 KANSAS. . . . . . . . . . . . . . . . . . L . . . . . .6-3 at Kansas State . . . . . . . . . . . . W . . . . .19-0 IOWA STATE . . . . . . . . . . . . . . W . . . . .33-7 at Missouri . . . . . . . . . . . . . . . . W . . . . . .7-0 OKLAHOMA STATE . . . . . . . . W . . . . .16-0

Sept. 25 Oct. 2 Oct. 9 Oct. 16 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 20

1938

(10-1, 5-0 BIG 6 CHAMPIONS)

1944

Oct. 1 at Rice . . . . . . . . . . . . . . . . . . . W . . . . . .7-6 Oct. 8 Texas at Dallas . . . . . . . . . . . . W . . . . .13-0 Oct. 15 at Kansas . . . . . . . . . . . . . . . . . W . . . . .19-0 Oct. 22 NEBRASKA . . . . . . . . . . . . . . . W . . . . .14-0 Oct. 29 TULSA . . . . . . . . . . . . . . . . . . . W . . . . .28-6 Nov. 5 KANSAS STATE . . . . . . . . . . . W . . . . .26-0 Nov. 12 MISSOURI . . . . . . . . . . . . . . . . W . . . . .21-0 Nov. 19 at Iowa State . . . . . . . . . . . . . . W . . . . .10-0 Nov. 24 at Oklahoma State . . . . . . . . . . W . . . . .19-0 Dec. 3 WASHINGTON STATE . . . . . . W . . . . .28-0 Jan. 2 Tennessee* . . . . . . . . . . . . . . . L . . . . .17-0 *First Bowl Game: Orange Bowl at Miami, Fla.

1939

(6-2-1, 3-2 BIG 6)

Sept. 30 Oct. 7 Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 18 Nov. 23

SOUTHERN METHODIST. . . . T . . . . . .7-7 at Northwestern . . . . . . . . . . . . W . . . . .23-0 Texas at Dallas . . . . . . . . . . . . W . . . .24-12 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .27-7 OKLAHOMA STATE . . . . . . . . W . . . . .41-0 IOWA STATE . . . . . . . . . . . . . . W . . . . .38-6 at Kansas State . . . . . . . . . . . . W . . . .13-10 at Missouri . . . . . . . . . . . . . . . . L . . . . . .7-6 at Nebraska . . . . . . . . . . . . . . . L . . . . .13-7

1940

(6-3, 4-1 BIG 6)

Oct. 5 Oct. 12 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23 Nov. 30

1941

Sept. 27 Oct. 11 Oct. 18 Oct. 25 Nov. 1 Nov. 8 Nov. 15 Nov. 22 Nov. 29

1942

Sept. 26 Oct. 3 Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 7 Nov. 14 Nov. 21 Nov. 28

OKLAHOMA STATE . . . . . . . . W . . . .29-27 Texas at Dallas . . . . . . . . . . . . L . . . .19-16 KANSAS STATE . . . . . . . . . . . W . . . . .14-0 at Iowa State . . . . . . . . . . . . . . W . . . . .20-7 NEBRASKA . . . . . . . . . . . . . . . L . . . . .13-0 at Kansas . . . . . . . . . . . . . . . . . W . . . . .13-0 MISSOURI . . . . . . . . . . . . . . . . W . . . . . .7-0 TEMPLE. . . . . . . . . . . . . . . . . . W . . . . . .9-6 at Santa Clara . . . . . . . . . . . . . L . . . .33-13

(6-3, 3-2 BIG 6)

OKLAHOMA STATE . . . . . . . . W . . . . .19-0 Texas at Dallas . . . . . . . . . . . . L . . . . .40-7 at Kansas State.. . . . . . . . . . . . W . . . . .16-0 SANTA CLARA . . . . . . . . . . . . W . . . . .16-6 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .38-0 IOWA STATE . . . . . . . . . . . . . . W . . . . .55-0 at Missouri . . . . . . . . . . . . . . . . L . . . . .28-0 MARQUETTE. . . . . . . . . . . . . . W . . . .61-14 at Nebraska . . . . . . . . . . . . . . . L . . . . . .7-6

(3-5-2, 3-1-1 BIG 6)

at Oklahoma State . . . . . . . . . . T . . . . . .0-0 at Tulsa . . . . . . . . . . . . . . . . . . L . . . . .23-0 Texas at Dallas . . . . . . . . . . . . L . . . . . .7-0 at Kansas . . . . . . . . . . . . . . . . . W . . . . .25-0 NEBRASKA . . . . . . . . . . . . . . . L . . . . . .7-0 at Iowa State . . . . . . . . . . . . . . W . . . . .14-7 KANSAS STATE . . . . . . . . . . . W . . . . .76-0 MISSOURI . . . . . . . . . . . . . . . . T . . . . . .6-6 at Temple . . . . . . . . . . . . . . . . . L . . . . .14-7 WILLIAM & MARY . . . . . . . . . . L . . . . .14-7

Sept. 30 Oct. 7 Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 18 Nov. 25 Dec. 2

1945

(7-2, 5-0 BIG 6 CHAMPIONS)

NORMAN NAS. . . . . . . . . . . . . W . . . . .22-6 Oklahoma State* . . . . . . . . . . . W . . . .22-13 Texas at Dallas . . . . . . . . . . . . L . . . . .13-7 Tulsa*. . . . . . . . . . . . . . . . . . . . L . . . . .20-6 KANSAS STATE . . . . . . . . . . . W . . . . .37-0 IOWA STATE . . . . . . . . . . . . . . W . . . . .21-7 KANSAS. . . . . . . . . . . . . . . . . . W . . . .26-13 at Missouri . . . . . . . . . . . . . . . . W . . . .20-13 at Nebraska . . . . . . . . . . . . . . . W . . . . .26-7

(6-3-1, 4-0-1 BIG 6 CHAMPIONS)

NORMAN NAS. . . . . . . . . . . . . L . . . .28-14 Texas A&M* . . . . . . . . . . . . . . . W . . . .21-14 Texas at Dallas . . . . . . . . . . . . L . . . . .20-0 KANSAS STATE . . . . . . . . . . . W . . . . .68-0 TCU* . . . . . . . . . . . . . . . . . . . . W . . . .34-19 at Iowa State . . . . . . . . . . . . . . W . . . . .12-7 MISSOURI . . . . . . . . . . . . . . . . T . . . .21-21 at Kansas . . . . . . . . . . . . . . . . . W . . . . .20-0 Oklahoma State* . . . . . . . . . . . L . . . . .28-6 Nebraska* . . . . . . . . . . . . . . . . W . . . .31-12

(5-5, 4-1 BIG 6)

Sept. 22 Sept. 29 Oct. 6 Oct. 13 Oct. 20 Oct. 27 Nov. 3 Nov. 10 Nov. 17 Nov. 24

at Hondo, Texas, AAF . . . . . . . W . . . . .21-6 at Nebraska . . . . . . . . . . . . . . . W . . . . .20-0 TEXAS A&M. . . . . . . . . . . . . . . L . . . .19-14 Texas at Dallas . . . . . . . . . . . . L . . . . .12-7 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .39-7 at Kansas State . . . . . . . . . . . . W . . . .41-13 TCU . . . . . . . . . . . . . . . . . . . . . L . . . . 13-7 IOWA STATE . . . . . . . . . . . . . . W . . . . .14-7 at Missouri . . . . . . . . . . . . . . . . L . . . . .14-6 OKLAHOMA STATE . . . . . . . . L . . . . .47-0

1946

(8-3, 4-1 BIG 6 CHAMPIONS)

Sept. 28 Army. . . . . . . . . . . . . . . . . . . . . L . . . . .21-7 Oct. 5 TEXAS A&M. . . . . . . . . . . . . . . W . . . . .10-7 Oct. 12 Texas at Dallas . . . . . . . . . . . . L . . . .20-13 Oct. 19 KANSAS STATE . . . . . . . . . . . W . . . . .28-7 Oct. 26 at Iowa State . . . . . . . . . . . . . . W . . . . .63-0 Nov. 2 at TCU . . . . . . . . . . . . . . . . . . . W . . . .14-12 Nov. 9 at Kansas . . . . . . . . . . . . . . . . . L . . . .16-13 Nov. 16 MISSOURI . . . . . . . . . . . . . . . . W . . . . .27-6 Nov. 23 NEBRASKA . . . . . . . . . . . . . . . W . . . . .27-6 Nov. 30 at Oklahoma State . . . . . . . . . . W . . . .73-12 Jan. 1 North Carolina State* . . . . . . . . W . . . .34-13 *Gator Bowl at Jacksonville, Fla.

1947

Sept. 27 Oct. 4 Oct. 11 Oct. 18 Oct. 25 Nov. 1 Nov. 8 Nov. 15 Nov. 22 Nov. 29

(7-2-1, 4-0-1 BIG 6 CHAMPIONS)

at Detroit. . . . . . . . . . . . . . . . . . W . . . .24-20 TEXAS A&M. . . . . . . . . . . . . . . W . . . .26-14 Texas at Dallas . . . . . . . . . . . . L . . . .34-14 KANSAS. . . . . . . . . . . . . . . . . . T . . . .13-13 TCU . . . . . . . . . . . . . . . . . . . . . L . . . . .20-7 IOWA STATE . . . . . . . . . . . . . . W . . . . .27-9 at Kansas State . . . . . . . . . . . . W . . . .27-13 at Missouri . . . . . . . . . . . . . . . . W . . . .21-12 at Nebraska . . . . . . . . . . . . . . . W . . . .14-13 OKLAHOMA STATE . . . . . . . . W . . . .21-13

194 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

1948

(10-1, 5-0 BIG 6 CHAMPIONS)

1949

(11-0, 5-0 BIG 6 CHAMPIONS)

1950

(10-1, 6-0 NATIONAL CHAMPIONS)

Sept. 25 at Santa Clara . . . . . . . . . . . . . L . . . .20-17 Oct. 2 TEXAS A&M . . . . . . . . . . . . . . W . . . .42-14 Oct. 9 Texas at Dallas . . . . . . . . . . . . W . . . .20-14 Oct. 16 KANSAS STATE . . . . . . . . . . . W . . . . .42-0 Oct. 23 at TCU . . . . . . . . . . . . . . . . . . . W . . . .21-18 Oct. 30 at Iowa State . . . . . . . . . . . . . . W . . . . .33-6 Nov. 6 MISSOURI . . . . . . . . . . . . . . . . W . . . . .41-7 Nov. 13 NEBRASKA . . . . . . . . . . . . . . . W . . . .41-14 Nov. 20 at Kansas . . . . . . . . . . . . . . . . . W . . . . .60-7 Nov. 27 at Oklahoma State . . . . . . . . . . W . . . .19-15 Jan. 1 North Carolina* . . . . . . . . . . . . . . . W . . . . .14-6 *Sugar Bowl at New Orleans, La. Sept. 23 at Boston College. . . . . . . . . . . W . . . . .46-0 Oct. 1 TEXAS A&M. . . . . . . . . . . . . . . W . . . .33-13 Oct. 8 Texas at Dallas . . . . . . . . . . . . W . . . .20-14 Oct. 15 KANSAS. . . . . . . . . . . . . . . . . . W . . . .48-26 Oct. 22 at Nebraska . . . . . . . . . . . . . . . W . . . . .48-0 Oct. 29 IOWA STATE . . . . . . . . . . . . . . W . . . . .34-7 Nov. 5 at Kansas State . . . . . . . . . . . . W . . . . .39-0 Nov. 12 at Missouri . . . . . . . . . . . . . . . . W . . . . .27-7 Nov. 19 SANTA CLARA . . . . . . . . . . . . W . . . .28-21 Nov. 26 OKLAHOMA STATE . . . . . . . . W . . . . .41-0 Jan. 1 Louisiana State* . . . . . . . . . . . W . . . . .35-0 *Sugar Bowl at New Orleans, La. Sept. 30 BOSTON COLLEGE . . . . . . . . W . . . . .28-0 Oct. 7 TEXAS A&M. . . . . . . . . . . . . . . W . . . .34-28 Oct. 14 Texas at Dallas . . . . . . . . . . . . W . . . .14-13 Oct. 21 KANSAS STATE . . . . . . . . . . . W . . . . .58-0 Oct. 28 at Iowa State . . . . . . . . . . . . . . W . . . . .20-7 Nov. 4 at Colorado. . . . . . . . . . . . . . . . W . . . .27-18 Nov. 11 at Kansas . . . . . . . . . . . . . . . . . W . . . .33-13 Nov. 18 MISSOURI . . . . . . . . . . . . . . . . W . . . . .41-7 Nov. 25 NEBRASKA . . . . . . . . . . . . . . . W . . . .49-35 Dec. 2 at Oklahoma State . . . . . . . . . . W . . . .41-14 Jan. 1 Kentucky*. . . . . . . . . . . . . . . . . L . . . . .13-7 *Sugar Bowl at New Orleans, La.

1951

Sept. 29 Oct. 6 Oct. 13 Oct. 20 Oct. 27 Nov. 3 Nov. 10 Nov. 17 Nov. 24 Dec. 1

1952

Sept. 27 Oct. 4 Oct. 11 Oct. 18 Oct. 25 Nov. 1 Nov. 8 Nov. 15 Nov. 22 Nov. 29

(8-2, 6-0 BIG 7 CHAMPIONS)

WILLIAM & MARY . . . . . . . . . . W . . . . .49-7 at Texas A&M. . . . . . . . . . . . . . L . . . . .14-7 Texas at Dallas . . . . . . . . . . . . L . . . . . .9-7 KANSAS. . . . . . . . . . . . . . . . . . W . . . .33-21 COLORADO. . . . . . . . . . . . . . . W . . . .55-14 at Kansas State . . . . . . . . . . . . W . . . . .33-0 at Missouri . . . . . . . . . . . . . . . . W . . . .34-20 IOWA STATE . . . . . . . . . . . . . . W . . . . .35-6 at Nebraska . . . . . . . . . . . . . . . W . . . . .27-0 OKLAHOMA STATE . . . . . . . . W . . . . .41-6

(8-1-1, 5-0-1 BIG 7 CHAMPIONS)

at Colorado. . . . . . . . . . . . . . . . T . . . .21-21 PITTSBURGH . . . . . . . . . . . . . W . . . .49-20 Texas at Dallas . . . . . . . . . . . . W . . . .49-20 at Kansas . . . . . . . . . . . . . . . . . W . . . .42-20 KANSAS STATE . . . . . . . . . . . W . . . . .49-6 at Iowa State . . . . . . . . . . . . . . W . . . . .41-0 at Notre Dame . . . . . . . . . . . . . L . . . 27-21 MISSOURI . . . . . . . . . . . . . . . . W . . . . .47-7 NEBRASKA . . . . . . . . . . . . . . . W . . . .34-13 at Oklahoma State . . . . . . . . . . W . . . . .54-7


SOONER FOOTBALL SEASONS 1953

(9-1-1, 6-0 BIG 7 CHAMPIONS)

1958

(10-1, 7-0 BIG 8 CHAMPIONS)

Sept. 27 WEST VIRGINIA . . . . . . . . . . . W . . . .47-14 Oct. 4 OREGON . . . . . . . . . . . . . . . . . W . . . . . .6-0 Oct. 11 Texas at Dallas . . . . . . . . . . . . L . . . .15-14 Oct. 18 at Kansas . . . . . . . . . . . . . . . . . W . . . . .43-0 Oct. 25 KANSAS STATE . . . . . . . . . . . W . . . . .40-6 Nov. 1 at Colorado. . . . . . . . . . . . . . . . W . . . . .23-7 Nov. 8 at Iowa State . . . . . . . . . . . . . . W . . . . .20-0 Nov. 15 MISSOURI . . . . . . . . . . . . . . . . W . . . . .39-0 Nov. 22 NEBRASKA . . . . . . . . . . . . . . . W . . . . .40-7 Nov. 29 at Oklahoma State . . . . . . . . . . W . . . . . .7-0 Jan. 1 Syracuse*. . . . . . . . . . . . . . . . . W . . . . .21-6 *Orange Bowl at Miami, Fla.

1954

1959

(10-0, 6-0 BIG 7 CHAMPIONS)

at California . . . . . . . . . . . . . . . W . . . .27-13 TCU . . . . . . . . . . . . . . . . . . . . . W. . . .21-16 Texas at Dallas . . . . . . . . . . . . W . . . . .14-7 at Kansas . . . . . . . . . . . . . . . . . W . . . . .65-0 KANSAS STATE . . . . . . . . . . . W . . . . .21-0 at Colorado. . . . . . . . . . . . . . . . W . . . . .13-6 at Iowa State . . . . . . . . . . . . . . W . . . . .40-0 MISSOURI . . . . . . . . . . . . . . . . W . . . .34-13 NEBRASKA . . . . . . . . . . . . . . . W . . . . .55-7 at Oklahoma State . . . . . . . . . . W . . . . .14-0

Sept. 26 Oct. 3 Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 7 Nov. 14 Nov. 21 Nov. 28

1955

(11-0, 6-0 NATIONAL CHAMPIONS)

1960

1956

(10-0, 6-0 NATIONAL CHAMPIONS)

NORTH CAROLINA . . . . . . . . . W . . . . .36-0 KANSAS STATE . . . . . . . . . . . W . . . . .66-0 Texas at Dallas . . . . . . . . . . . . W . . . . .45-0 at Kansas . . . . . . . . . . . . . . . . . W . . . .34-12 at Notre Dame . . . . . . . . . . . . . W . . . . .40-0 at Colorado. . . . . . . . . . . . . . . . W . . . .27-19 at Iowa State . . . . . . . . . . . . . . W . . . . .44-0 MISSOURI . . . . . . . . . . . . . . . W . . . .67-14 NEBRASKA . . . . . . . . . . . . . . . W . . . . .54-6 at Oklahoma State . . . . . . . . . W . . . . .53-0

1957

(10-1, 6-0 BIG 7 CHAMPIONS)

(6-4-1, 5-1-1 BIG 8)

at Northwestern . . . . . . . . . . . . L . . . .45-13 COLORADO. . . . . . . . . . . . . . . W . . . .42-12 Texas at Dallas . . . . . . . . . . . . L . . . .19-12 at Missouri . . . . . . . . . . . . . . . . W . . . . .23-0 KANSAS. . . . . . . . . . . . . . . . . . W . . . . . .7-6 at Nebraska . . . . . . . . . . . . . . . L . . . .25-21 at Kansas State . . . . . . . . . . . . W . . . . .36-0 ARMY. . . . . . . . . . . . . . . . . . . . W . . . .28-20 IOWA STATE . . . . . . . . . . . . . . W . . . .35-12 OKLAHOMA STATE . . . . . . . . W . . . . .17-7

Sept. 19 at Maryland . . . . . . . . . . . . . . . W . . . . .13-3 Sept. 26 SOUTHERN CAL . . . . . . . . . . . L . . . .40-14 Oct. 10 Texas at Dallas . . . . . . . . . . . . L . . . . .28-7 Oct. 17 at Kansas . . . . . . . . . . . . . . . . . L . . . .15-14 Oct. 24 KANSAS STATE . . . . . . . . . . . W . . . . .44-0 Oct. 31 at Colorado. . . . . . . . . . . . . . . . W . . . .14-11 Nov. 7 IOWA STATE . . . . . . . . . . . . . . W . . . . .30-0 Nov. 14 MISSOURI . . . . . . . . . . . . . . . . T . . . .14-14 Nov. 21 NEBRASKA . . . . . . . . . . . . . . . W . . . . .17-7 Nov. 28 at Oklahoma State . . . . . . . . . . W . . . .21-16 Jan. 2 Florida State* . . . . . . . . . . . . . . L . . . .36-19 *Gator Bowl at Jacksonville, Fla.

(3-6-1, 2-4-1 BIG 8)

1965

(7-3, 6-1 BIG 8 CHAMPIONS)

NORTHWESTERN . . . . . . . . . L . . . . .19-3 PITTSBURGH . . . . . . . . . . . . . W . . . .15-14 Texas at Dallas . . . . . . . . . . . . L . . . . .24-0 at Kansas . . . . . . . . . . . . . . . . . T . . . .13-13 KANSAS STATE . . . . . . . . . . . W . . . . .49-7 at Colorado. . . . . . . . . . . . . . . . L . . . . . .7-0 at Iowa State . . . . . . . . . . . . . . L . . . . .10-6 MISSOURI . . . . . . . . . . . . . . . . L . . . .41-19 NEBRASKA . . . . . . . . . . . . . . . L . . . .17-14 at Oklahoma State . . . . . . . . . . W . . . . .17-6

Sept. 25 Oct. 2 Oct. 9 Oct. 16 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 25 Dec. 4

(5-5, 4-3 BIG 8)

1966

(3-7, 3-4 BIG 8)

at Pittsburgh. . . . . . . . . . . . . . . L . . . . .13-9 NAVY . . . . . . . . . . . . . . . . . . . . L . . . . .10-0 Texas at Dallas . . . . . . . . . . . . L . . . . .19-0 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .21-7 at Kansas State . . . . . . . . . . . . W . . . . .27-0 COLORADO. . . . . . . . . . . . . . . L . . . . .13-0 IOWA STATE . . . . . . . . . . . . . . W . . . .24-20 at Missouri . . . . . . . . . . . . . . . . L . . . . .30-0 at Nebraska . . . . . . . . . . . . . . . L . . . . .21-9 OKLAHOMA STATE . . . . . . . . L . . . .17-16

(6-4, 4-3 BIG 8)

Sept. 30 Oct. 7 Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 18 Nov. 25 Dec. 2

at Notre Dame . . . . . . . . . . . . . L . . . . .19-6 IOWA STATE . . . . . . . . . . . . . . L . . . .21-15 Texas at Dallas . . . . . . . . . . . . L . . . . .28-7 KANSAS. . . . . . . . . . . . . . . . . . L . . . . .10-0 COLORADO. . . . . . . . . . . . . . . L . . . .22-14 at Kansas State . . . . . . . . . . . . W . . . . .17-6 at Missouri . . . . . . . . . . . . . . . . W . . . . . .7-0 Army at Yankee Stadium . . . . . W . . . . .14-8 at Nebraska. . . . . . . . . . . . . . . W . . . .21-14 OKLAHOMA STATE . . . . . . . . W . . . .21-13

Sept. 17 Sept. 24 Oct. 8 Oct. 15 Oct. 22 Oct. 29 Nov. 5 Nov. 12 Nov. 24 Dec. 3

OREGON . . . . . . . . . . . . . . . . . W . . . . .17-0 at Iowa State . . . . . . . . . . . . . . W . . . .33-11 Texas at Dallas . . . . . . . . . . . . W . . . . .18-9 at Kansas . . . . . . . . . . . . . . . . . W . . . . .35-0 NOTRE DAME . . . . . . . . . . . . . L . . . . .38-0 at Colorado. . . . . . . . . . . . . . . . L . . . .24-21 KANSAS STATE . . . . . . . . . . . W . . . . .37-6 MISSOURI . . . . . . . . . . . . . . . . L . . . . .10-7 NEBRASKA . . . . . . . . . . . . . . . W . . . . .10-9 at Oklahoma State . . . . . . . . . . L . . . .15-14

1962

(8-3, 7-0 BIG 8 CHAMPIONS)

1967

(10-1, 7-0 BIG 8 CHAMPIONS)

Sept. 22 SYRACUSE . . . . . . . . . . . . . . . W . . . . . .7-3 Sept. 29 NOTRE DAME . . . . . . . . . . . . . L . . . . .13-7 Oct. 13 Texas at Dallas . . . . . . . . . . . . L . . . . . .9-6 Oct. 20 at Kansas . . . . . . . . . . . . . . . . . W . . . . .13-7 Oct. 27 KANSAS STATE . . . . . . . . . . . W . . . . .47-0 Nov. 3 at Colorado. . . . . . . . . . . . . . . . W . . . . .62-0 Nov. 10 at Iowa State . . . . . . . . . . . . . . W . . . . .41-0 Nov. 17 MISSOURI . . . . . . . . . . . . . . . . W . . . . .13-0 Nov. 24 NEBRASKA . . . . . . . . . . . . . . . W . . . . .34-6 Dec. 1 at Oklahoma State . . . . . . . . . . W . . . . .37-6 Jan. 1 Alabama* . . . . . . . . . . . . . . . . . L . . . . .17-0 *Orange Bowl at Miami, Fla.

Sept. 23 WASHINGTON STATE . . . . . . W . . . . .21-0 Sept. 30 MARYLAND . . . . . . . . . . . . . . . W . . . . .35-0 Oct. 14 Texas at Dallas . . . . . . . . . . . . L . . . . . .9-7 Oct. 21 at Kansas State . . . . . . . . . . . . W . . . . .46-7 Oct. 28 at Missouri . . . . . . . . . . . . . . . . W . . . . . .7-0 Nov. 4 COLORADO. . . . . . . . . . . . . . . W . . . . .23-0 Nov. 11 at Iowa State . . . . . . . . . . . . . . W . . . .52-14 Nov. 18 KANSAS. . . . . . . . . . . . . . . . . . W . . . .14-10 Nov. 23 at Nebraska . . . . . . . . . . . . . . . W . . . .21-14 Dec. 2 OKLAHOMA STATE . . . . . . . . W . . . .38-14 Jan. 1 Tennessee* . . . . . . . . . . . . . . . W . . . .26-24 *Orange Bowl at Miami, Fla.

OKLAHOM A HISTORY

Sept. 21 at Pittsburgh. . . . . . . . . . . . . . . W . . . . .26-0 Oct. 5 IOWA STATE . . . . . . . . . . . . . . W . . . .40-14 Oct. 12 Texas at Dallas . . . . . . . . . . . . W . . . . .21-7 Oct. 19 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .47-0 Oct. 26 COLORADO. . . . . . . . . . . . . . . W . . . .14-13 Nov. 2 at Kansas State . . . . . . . . . . . . W . . . . .13-0 Nov. 9 at Missouri . . . . . . . . . . . . . . . . W . . . .39-14 Nov. 16 NOTRE DAME . . . . . . . . . . . . . L . . . . . .7-0 Nov. 23 at Nebraska . . . . . . . . . . . . . . . W . . . . .32-7 Nov. 30 OKLAHOMA STATE . . . . . . . . W . . . . .53-6 Jan. 1 Duke* . . . . . . . . . . . . . . . . . . . . W . . . .48-21 *Orange Bowl at Miami, Fla.

1961

1964

REVIEW & OPPONENTS

Sept. 29 Oct. 6 Oct. 13 Oct. 20 Oct. 27 Nov. 3 Nov. 10 Nov. 17 Nov. 24 Dec. 1

Sept. 24 Oct. 1 Oct. 8 Oct. 15 Oct. 22 Oct. 29 Nov. 5 Nov. 12 Nov. 19 Nov. 26

CLEMSON . . . . . . . . . . . . . . . . W . . . .31-14 at Southern Cal . . . . . . . . . . . . W . . . .17-12 Texas at Dallas . . . . . . . . . . . . L . . . . .28-7 KANSAS. . . . . . . . . . . . . . . . . . W . . . .21-18 at Kansas State . . . . . . . . . . . . W . . . . .34-9 COLORADO. . . . . . . . . . . . . . . W . . . . .35-0 IOWA STATE . . . . . . . . . . . . . . W . . . .24-14 at Missouri . . . . . . . . . . . . . . . . W . . . . .13-3 at Nebraska . . . . . . . . . . . . . . . L . . . .29-20 OKLAHOMA STATE . . . . . . . . W . . . .34-10

THE SOONERS

Sept. 24 at North Carolina . . . . . . . . . . . W . . . . .13-6 Oct. 1 PITTSBURGH . . . . . . . . . . . . . W . . . .26-14 Oct. 8 Texas at Dallas . . . . . . . . . . . . W . . . . .20-0 Oct. 15 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .44-6 Oct. 22 COLORADO. . . . . . . . . . . . . . . W . . . .56-21 Oct. 29 at Kansas State . . . . . . . . . . . . W . . . . .40-7 Nov. 5 at Missouri . . . . . . . . . . . . . . . . W . . . . .20-0 Nov. 12 IOWA STATE . . . . . . . . . . . . . . W . . . . .52-0 Nov. 19 at Nebraska . . . . . . . . . . . . . . . W . . . . .41-0 Nov. 26 OKLAHOMA STATE . . . . . . . . W . . . . .53-0 Jan. 1 Maryland* . . . . . . . . . . . . . . . . . W . . . . .20-6 *Orange Bowl at Miami, Fla.

(8-2, 6-1 BIG 8)

Sept. 21 Sept. 28 Oct. 12 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23 Nov. 30

COACHING STAFF

Sept. 18 Sept. 25 Oct. 9 Oct. 16 Oct. 23 Oct. 30 Nov. 6 Nov. 13 Nov. 20 Nov. 27

1963

2 0 0 5 S EAS ON

Sept. 26 NOTRE DAME . . . . . . . . . . . . . L . . . .28-21 Oct. 3 at Pittsburgh. . . . . . . . . . . . . . . T . . . . . .7-7 Oct. 10 Texas at Dallas . . . . . . . . . . . . W . . . .19-14 Oct. 17 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .45-0 Oct. 24 COLORADO. . . . . . . . . . . . . . . W . . . .27-20 Oct. 31 KANSAS STATE . . . . . . . . . . . W . . . . .34-0 Nov. 7 at Missouri . . . . . . . . . . . . . . . . W . . . . .14-0 Nov. 14 IOWA STATE . . . . . . . . . . . . . . W . . . . .47-0 Nov. 21 at Nebraska . . . . . . . . . . . . . . . W . . . . .30-7 Nov. 28 OKLAHOMA STATE . . . . . . . . W . . . . .42-7 Jan. 1 Maryland* . . . . . . . . . . . . . . . . W . . . . . .7-0 *Orange Bowl at Miami, Fla.

195 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONER FOOTBALL SEASONS 1968

Sept. 21 at Notre Dame . . . . . . . . . . . . . L . . . .45-21 Sept. 28 NORTH CAROLINA ST. . . . . . W . . . .28-14 Oct. 12 Texas at Dallas . . . . . . . . . . . . L . . . .26-20 Oct. 19 IOWA STATE . . . . . . . . . . . . . . W . . . . .42-7 Oct. 26 at Colorado. . . . . . . . . . . . . . . . L . . . .41-27 Nov. 2 KANSAS STATE . . . . . . . . . . . W . . . .35-20 Nov. 9 at Kansas . . . . . . . . . . . . . . . . . W . . . .27-23 Nov. 16 MISSOURI . . . . . . . . . . . . . . . . W . . . .28-14 Nov. 23 NEBRASKA . . . . . . . . . . . . . . . W . . . . .47-0 Nov. 30 at Oklahoma State . . . . . . . . . . W . . . . .41-7 Dec. 31 Southern Methodist*. . . . . . . . . L . . . .28-27 *Bluebonnet Bowl at Houston, Texas

(7-4, 6-1 BIG 8 CHAMPIONS)

1973

Sept. 15 Sept. 29 Oct. 6 Oct. 13 Oct. 20 Oct. 27 Nov. 3 Nov. 10 Nov. 17 Nov. 23 Dec. 1

1969

(6-4, 4-3 BIG 8)

BAYLOR. . . . . . . . . . . . . . . . . . W . . . .28-11 UTAH STATE. . . . . . . . . . . . . . W . . . . .72-3 WAKE FOREST . . . . . . . . . . . . W . . . . .63-0 Texas at Dallas . . . . . . . . . . . . W . . . .16-13 at Colorado. . . . . . . . . . . . . . . . W . . . .49-14 KANSAS STATE . . . . . . . . . . . W . . . . .63-0 at Iowa State . . . . . . . . . . . . . . W . . . .28-10 MISSOURI . . . . . . . . . . . . . . . . W . . . . .37-0 at Kansas . . . . . . . . . . . . . . . . . W . . . .45-14 at Nebraska . . . . . . . . . . . . . . . W . . . .28-14 OKLAHOMA STATE . . . . . . . . W . . . .44-13

(11-1, 6-1 NATIONAL CHAMPIONS)

1974

Sept. 20 Sept. 27 Oct. 11 Oct. 18 Oct. 25 Nov. 1 Nov. 8 Nov. 15 Nov. 22 Nov. 29

at Wisconsin. . . . . . . . . . . . . . . W . . . .48-21 PITTSBURGH . . . . . . . . . . . . . W . . . . .37-8 Texas at Dallas . . . . . . . . . . . . L . . . .27-17 COLORADO. . . . . . . . . . . . . . . W . . . .42-30 at Kansas State . . . . . . . . . . . . L . . . .59-21 IOWA STATE . . . . . . . . . . . . . . W . . . .37-14 at Missouri . . . . . . . . . . . . . . . . L . . . .44-10 KANSAS. . . . . . . . . . . . . . . . . . W . . . .31-15 NEBRASKA . . . . . . . . . . . . . . . L . . . .44-14 at Oklahoma State . . . . . . . . . . W . . . .28-27

Sept. 14 Sept. 28 Oct. 5 Oct. 12 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23 Nov. 30

1970

(7-4-1, 5-2 BIG 8)

1975

(10-0-1, 7-0 BIG 8 CHAMPIONS)

at Baylor. . . . . . . . . . . . . . . . . . W . . . .42-14 at Southern Cal . . . . . . . . . . . . T . . . . . .7-7 MIAMI, FLA. . . . . . . . . . . . . . . . W . . . .24-20 Texas at Dallas . . . . . . . . . . . . W . . . .52-13 COLORADO. . . . . . . . . . . . . . . W . . . . .34-7 at Kansas State . . . . . . . . . . . . W . . . .56-14 IOWA STATE . . . . . . . . . . . . . . W . . . .34-17 at Missouri . . . . . . . . . . . . . . . . W . . . . .31-3 KANSAS. . . . . . . . . . . . . . . . . . W . . . .48-20 NEBRASKA . . . . . . . . . . . . . . . W . . . . .27-0 at Oklahoma State . . . . . . . . . . W . . . .45-18

(11-0, 7-0 NATIONAL CHAMPIONS)

Sept. 12 at Southern Methodist . . . . . . . W . . . .28-11 Sept. 19 WISCONSIN . . . . . . . . . . . . . . W . . . . .21-7 Sept. 26 OREGON STATE. . . . . . . . . . . L . . . .23-14 Oct. 10 Texas at Dallas . . . . . . . . . . . . L . . . . .41-9 Oct. 17 at Colorado. . . . . . . . . . . . . . . . W . . . .23-15 Oct. 24 KANSAS STATE . . . . . . . . . . . L . . . .19-14 Oct. 31 at Iowa State . . . . . . . . . . . . . . W . . . .29-28 Nov. 7 MISSOURI . . . . . . . . . . . . . . . . W . . . .28-13 Nov. 14 at Kansas . . . . . . . . . . . . . . . . . W . . . .28-24 Nov. 21 at Nebraska . . . . . . . . . . . . . . . L . . . .28-21 Nov. 28 OKLAHOMA STATE . . . . . . . . W . . . . .66-6 Dec. 31 Alabama* . . . . . . . . . . . . . . . . . T . . . .24-24 *Bluebonnet Bowl at Houston, Texas

Sept. 13 OREGON . . . . . . . . . . . . . . . . . W . . . . .62-7 Sept. 20 PITTSBURGH . . . . . . . . . . . . . W . . . .46-10 Sept. 26 at Miami, Fla. . . . . . . . . . . . . . . W . . . .20-17 Oct. 4 COLORADO. . . . . . . . . . . . . . . W . . . .21-20 Oct. 11 Texas at Dallas . . . . . . . . . . . . W . . . .24-17 Oct. 18 at Kansas State . . . . . . . . . . . . W . . . . .25-3 Oct. 25 IOWA STATE . . . . . . . . . . . . . . W . . . . .39-7 Nov. 1 at Oklahoma State . . . . . . . . . . W . . . . .27-7 Nov. 8 KANSAS. . . . . . . . . . . . . . . . . . L . . . . .23-3 Nov. 15 at Missouri . . . . . . . . . . . . . . . . W . . . .28-27 Nov. 22 NEBRASKA . . . . . . . . . . . . . . . W . . . .35-10 Jan. 1 Michigan* . . . . . . . . . . . . . . . . . W . . . . .14-6 *Orange Bowl at Miami, Fla.

1971

1976

(11-1, 6-1 BIG 8)

(9-2-1, 5-2 BIG 8 CHAMPIONS)

Sept. 18 SOUTHERN METHODIST . . . W . . . . .30-0 Sept. 25 at Pittsburgh. . . . . . . . . . . . . . . W . . . .55-29 Oct. 2 SOUTHERN CAL . . . . . . . . . . . W . . . .33-20 Oct. 9 Texas at Dallas . . . . . . . . . . . . W . . . .48-27 Oct. 16 COLORADO. . . . . . . . . . . . . . . W . . . .45-17 Oct. 23 at Kansas State . . . . . . . . . . . . W . . . .75-28 Oct. 30 IOWA STATE . . . . . . . . . . . . . . W . . . .43-12 Nov. 6 at Missouri . . . . . . . . . . . . . . . . W . . . . .20-3 Nov. 13 KANSAS. . . . . . . . . . . . . . . . . . W . . . .56-10 Nov. 25 NEBRASKA . . . . . . . . . . . . . . . L . . . .35-31 Dec. 4 at Oklahoma State . . . . . . . . . . W . . . .58-14 Jan. 1 Auburn* . . . . . . . . . . . . . . . . . . W . . . .40-22 *Sugar Bowl at New Orleans, La.

Sept. 11 at Vanderbilt. . . . . . . . . . . . . . . W . . . . .24-3 Sept. 18 CALIFORNIA . . . . . . . . . . . . . . W . . . .28-17 Sept. 25 FLORIDA STATE . . . . . . . . . . . W . . . . .24-9 Oct. 2 at Iowa State . . . . . . . . . . . . . . W . . . .24-10 Oct. 9 Texas at Dallas . . . . . . . . . . . . T . . . . . .6-6 Oct. 16 at Kansas . . . . . . . . . . . . . . . . . W . . . .28-10 Oct. 23 OKLAHOMA STATE . . . . . . . . L . . . .31-24 Oct. 30 at Colorado. . . . . . . . . . . . . . . . L . . . .42-31 Nov. 6 KANSAS STATE . . . . . . . . . . . W . . . .49-20 Nov. 13 MISSOURI . . . . . . . . . . . . . . . . W . . . .27-20 Nov. 26 at Nebraska . . . . . . . . . . . . . . . W . . . .20-17 Dec. 25 Wyoming*. . . . . . . . . . . . . . . . . W . . . . .41-7 *Fiesta Bowl at Tempe, Ariz.

1972

1977

(11-1, 6-1 BIG 8 CHAMPIONS)

Sept. 16 UTAH STATE. . . . . . . . . . . . . . W . . . . .49-0 Sept. 23 OREGON . . . . . . . . . . . . . . . . . W . . . . .68-3 Sept. 30 CLEMSON . . . . . . . . . . . . . . . . W . . . . .52-3 Oct. 14 Texas at Dallas . . . . . . . . . . . . W . . . . .27-0 Oct. 21 at Colorado. . . . . . . . . . . . . . . . L . . . .20-14 Oct. 28 KANSAS STATE . . . . . . . . . . . W . . . . .52-0 Nov. 4 at Iowa State . . . . . . . . . . . . . . W . . . . .20-6 Nov. 11 MISSOURI . . . . . . . . . . . . . . . . W . . . . .17-6 Nov. 18 at Kansas . . . . . . . . . . . . . . . . . W . . . . .31-7 Nov. 23 at Nebraska . . . . . . . . . . . . . . . W . . . .17-14 Dec. 2 OKLAHOMA STATE . . . . . . . . W . . . .38-15 Dec. 31 Penn State* . . . . . . . . . . . . . . . W . . . . .14-0 *Sugar Bowl at New Orleans, La.

(10-2, 7-0 BIG 8 CHAMPIONS)

Sept. 10 VANDERBILT. . . . . . . . . . . . . . W . . . .25-23 Sept. 17 UTAH . . . . . . . . . . . . . . . . . . . . W . . . .62-24 Sept. 24 at Ohio State . . . . . . . . . . . . . . W . . . .29-28 Oct. 1 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .24-9 Oct. 8 Texas at Dallas . . . . . . . . . . . . L . . . . .13-6 Oct. 15 at Missouri . . . . . . . . . . . . . . . . W . . . .21-17 Oct. 22 IOWA STATE . . . . . . . . . . . . . . W . . . .35-16 Oct. 29 at Kansas State . . . . . . . . . . . . W . . . . .42-7 Nov. 5 at Oklahoma State . . . . . . . . . . W . . . .61-28 Nov. 12 COLORADO. . . . . . . . . . . . . . . W . . . .52-14 Nov. 25 NEBRASKA . . . . . . . . . . . . . . . W . . . . .38-7 Jan. 2 Arkansas* . . . . . . . . . . . . . . . . L . . . . .31-6 *Orange Bowl at Miami, Fla.

196 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

1978

(11-1, 6-1 BIG 8 CHAMPIONS)

1979

(11-1, 7-0 BIG 8 CHAMPIONS)

1980

(10-2, 7-0 BIG 8 CHAMPIONS)

1981

(7-4-1, 4-2-1 BIG 8)

Sept. 9 at Stanford . . . . . . . . . . . . . . . . W . . . .35-29 Sept. 16 WEST VIRGINIA . . . . . . . . . . . W . . . .52-10 Sept. 23 RICE. . . . . . . . . . . . . . . . . . . . . W . . . . .66-7 Sept. 30 MISSOURI . . . . . . . . . . . . . . . . W . . . .45-23 Oct. 7 Texas at Dallas . . . . . . . . . . . . W . . . .31-10 Oct. 14 at Kansas . . . . . . . . . . . . . . . . . W . . . .17-16 Oct. 21 at Iowa State . . . . . . . . . . . . . . W . . . . .34-6 Oct. 28 KANSAS STATE . . . . . . . . . . . W . . . .56-19 Nov. 4 at Colorado. . . . . . . . . . . . . . . . W . . . . .28-7 Nov. 11 at Nebraska . . . . . . . . . . . . . . . L . . . .17-14 Nov. 18 OKLAHOMA STATE . . . . . . . . W . . . . .62-7 Jan. 1 Nebraska* . . . . . . . . . . . . . . . . W . . . .31-24 *Orange Bowl at Miami, Fla. Sept. 15 IOWA . . . . . . . . . . . . . . . . . . . . W . . . . .21-6 Sept. 22 TULSA . . . . . . . . . . . . . . . . . . . W . . . .49-13 Sept. 29 at Rice . . . . . . . . . . . . . . . . . . . W . . . .63-21 Oct. 6 COLORADO. . . . . . . . . . . . . . . W . . . .49-24 Oct. 13 Texas at Dallas . . . . . . . . . . . . L . . . . .16-7 Oct. 20 at Kansas State . . . . . . . . . . . . W . . . . .38-6 Oct. 27 IOWA STATE . . . . . . . . . . . . . . W . . . . .38-9 Nov. 3 at Oklahoma State . . . . . . . . . . W . . . . .38-7 Nov. 10 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .38-0 Nov. 17 at Missouri . . . . . . . . . . . . . . . . W . . . .24-22 Nov. 24 NEBRASKA . . . . . . . . . . . . . . . W . . . .17-14 Jan. 1 Florida State* . . . . . . . . . . . . . . W . . . . .24-7 *Orange Bowl at Miami, Fla. Sept. 13 KENTUCKY . . . . . . . . . . . . . . . W . . . . .29-7 Sept. 27 STANFORD . . . . . . . . . . . . . . . L . . . .31-14 Oct. 4 at Colorado. . . . . . . . . . . . . . . . W . . . .82-42 Oct. 11 Texas at Dallas . . . . . . . . . . . . L . . . .20-13 Oct. 18 KANSAS STATE . . . . . . . . . . . W . . . .35-21 Oct. 25 at Iowa State . . . . . . . . . . . . . . W . . . . .42-7 Nov. 1 NORTH CAROLINA . . . . . . . . . W . . . . .41-7 Nov. 8 at Kansas . . . . . . . . . . . . . . . . . W . . . .21-19 Nov. 15 MISSOURI . . . . . . . . . . . . . . . . W . . . . .17-7 Nov. 22 at Nebraska . . . . . . . . . . . . . . . W . . . .21-17 Nov. 29 OKLAHOMA STATE . . . . . . . . W . . . .63-14 Jan. 1 Florida State* . . . . . . . . . . . . . . W . . . .18-17 *Orange Bowl at Miami, Fla. Sept. 12 WYOMING . . . . . . . . . . . . . . . . W . . . .37-20 Sept. 26 at Southern Cal . . . . . . . . . . . . L . . . .28-24 Oct. 3 IOWA STATE . . . . . . . . . . . . . . T . . . . . .7-7 Oct. 10 Texas at Dallas . . . . . . . . . . . . L . . . .34-14 Oct. 17 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .45-7 Oct. 24 OREGON STATE. . . . . . . . . . . W . . . . .42-3 Oct. 31 COLORADO. . . . . . . . . . . . . . . W . . . . .49-0 Nov. 7 at Kansas State . . . . . . . . . . . . W . . . .28-21 Nov. 14 at Missouri . . . . . . . . . . . . . . . . L . . . .19-14 Nov. 21 NEBRASKA . . . . . . . . . . . . . . . L . . . .37-14 Nov. 28 at Oklahoma State . . . . . . . . . . W . . . . .27-3 Dec. 26 Houston* . . . . . . . . . . . . . . . . . W . . . .40-14 *Sun Bowl at El Paso, Texas


SOONER FOOTBALL SEASONS 1982

(8-4, 6-1 BIG 8)

Sept. 6 UCLA . . . . . . . . . . . . . . . . . . . . W . . . . .38-3 Sept. 20 MINNESOTA . . . . . . . . . . . . . . W . . . . .63-0 Sept. 27 at Miami, Fla. . . . . . . . . . . . . . . L . . . .28-16 Oct. 4 KANSAS STATE . . . . . . . . . . . W . . . .56-10 Oct. 11 Texas at Dallas . . . . . . . . . . . . W . . . .47-12 Oct. 18 OKLAHOMA STATE . . . . . . . . W . . . . .19-0 Oct. 25 at Iowa State . . . . . . . . . . . . . . W . . . . .38-0 Nov. 1 at Kansas . . . . . . . . . . . . . . . . . W . . . . .64-3 Nov. 8 MISSOURI . . . . . . . . . . . . . . . . W . . . . .77-0 Nov. 15 at Colorado. . . . . . . . . . . . . . . . W . . . . .28-0 Nov. 22 at Nebraska . . . . . . . . . . . . . . . W . . . .20-17 Jan. 1 Arkansas*. . . . . . . . . . . . . . . . . W . . . . .42-8 *Orange Bowl at Miami, Fla.

(11-1, 7-0 BIG 8 CHAMPIONS)

Sept. 14 NORTH TEXAS . . . . . . . . . . . . W . . . . .40-2 Sept. 21 UTAH STATE. . . . . . . . . . . . . . W . . . .55-21 Sept. 28 VIRGINIA TECH. . . . . . . . . . . . W . . . .27-17 Oct. 5 at Iowa State . . . . . . . . . . . . . . W . . . . .29-8 Oct. 12 Texas at Dallas . . . . . . . . . . . . L . . . . .10-7 Oct. 19 COLORADO. . . . . . . . . . . . . . . L . . . .34-17 Oct. 26 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .41-3 Nov. 2 KANSAS STATE . . . . . . . . . . . W . . . . .28-7 Nov. 9 at Missouri . . . . . . . . . . . . . . . . W . . . .56-16 Nov. 16 OKLAHOMA STATE . . . . . . . . W . . . . .21-6 Nov. 29 at Nebraska . . . . . . . . . . . . . . . L . . . .19-14 Dec. 29 Virginia* . . . . . . . . . . . . . . . . . . W . . . .48-14 *Gator Bowl at Jacksonville, Fla.

1983

1987

(11-1, 7-0 BIG 8 CHAMPIONS)

1992

(8-4, 5-2 BIG 8)

Sept. 10 Sept. 17 Sept. 24 Oct. 1 Oct. 8 Oct. 15 Oct. 22 Oct. 29 Nov. 5 Nov. 12 Nov. 26 Dec. 3

at Stanford . . . . . . . . . . . . . . . . W . . . .27-14 OHIO STATE . . . . . . . . . . . . . . L . . . .24-14 TULSA . . . . . . . . . . . . . . . . . . . W . . . .28-18 at Kansas State . . . . . . . . . . . . W . . . .29-10 Texas at Dallas . . . . . . . . . . . . L . . . .28-16 at Oklahoma State . . . . . . . . . . W . . . .21-20 IOWA STATE . . . . . . . . . . . . . . W . . . .49-11 KANSAS. . . . . . . . . . . . . . . . . . W . . . .45-14 at Missouri . . . . . . . . . . . . . . . . L . . . . .10-0 COLORADO. . . . . . . . . . . . . . . W . . . .41-28 NEBRASKA . . . . . . . . . . . . . . . L . . . .28-21 at Hawaii . . . . . . . . . . . . . . . . . W . . . .21-17

1984

(9-2-1, 6-1 BIG 8 CHAMPIONS)

(11-1, 7-0 NATIONAL CHAMPIONS)

1989

Sept. 2 Sept. 9 Sept. 16 Sept. 30 Oct. 7 Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 18

1990

Sept. 8 Sept. 15 Sept. 22 Sept. 29 Oct. 6 Oct. 13 Oct. 20 Oct. 27 Nov. 3 Nov. 10 Nov. 23

at Texas Tech . . . . . . . . . . . . . W . . . . .34-9 ARKANSAS STATE . . . . . . . . W . . . . .61-0 SOUTHERN CAL . . . . . . . . . . . L . . . .20-10 IOWA STATE . . . . . . . . . . . . . . W . . . . .17-3 Texas at Dallas . . . . . . . . . . . . L . . . .34-24 at Colorado. . . . . . . . . . . . . . . . T . . . .24-24 at Kansas . . . . . . . . . . . . . . . . . L . . . .27-10 KANSAS STATE . . . . . . . . . . . W . . . .16-14 MISSOURI . . . . . . . . . . . . . . . . W . . . .51-17 at Oklahoma State . . . . . . . . . . T . . . .15-15 NEBRASKA . . . . . . . . . . . . . . . L . . . . .33-9

1993

(9-3, 4-3 BIG 8)

1994

(6-6, 4-3 BIG 8)

Sept. 4 at TCU . . . . . . . . . . . . . . . . . . . W . . . . .35-3 Sept. 11 TEXAS A&M. . . . . . . . . . . . . . . W . . . .44-14 Sept. 25 TULSA . . . . . . . . . . . . . . . . . . . W . . . .41-20 Oct. 2 at Iowa State . . . . . . . . . . . . . . W . . . . .24-7 Oct. 9 Texas at Dallas . . . . . . . . . . . . W . . . .38-17 Oct. 16 COLORADO. . . . . . . . . . . . . . . L . . . .27-10 Oct. 23 KANSAS. . . . . . . . . . . . . . . . . . W . . . .38-23 Oct. 30 at Kansas State . . . . . . . . . . . . L . . . . .21-7 Nov. 6 at Missouri . . . . . . . . . . . . . . . . W . . . .42-23 Nov. 13 OKLAHOMA STATE . . . . . . . . W . . . . .31-0 Nov. 26 at Nebraska . . . . . . . . . . . . . . . L . . . . .21-7 Dec. 24 Texas Tech* . . . . . . . . . . . . . . . W . . . .41-10 *John Hancock Bowl at El Paso, Texas

NEW MEXICO STATE . . . . . . . W . . . . .73-3 BAYLOR. . . . . . . . . . . . . . . . . . W . . . . .33-7 at Arizona. . . . . . . . . . . . . . . . . L . . . . . .6-3 at Kansas . . . . . . . . . . . . . . . . . W . . . . .45-6 OKLAHOMA STATE . . . . . . . . W . . . .37-15 Texas at Dallas . . . . . . . . . . . . L . . . .28-24 at Iowa State . . . . . . . . . . . . . . W . . . .43-40 COLORADO. . . . . . . . . . . . . . . L . . . . .20-3 MISSOURI . . . . . . . . . . . . . . . . W . . . .52-14 KANSAS STATE . . . . . . . . . . . W . . . .42-19 at Nebraska . . . . . . . . . . . . . . . L . . . .42-25

Sept. 3 at Syracuse . . . . . . . . . . . . . . . W . . . .30-29 Sept. 10 at Texas A&M. . . . . . . . . . . . . . L . . . .36-14 Sept. 17 TEXAS TECH. . . . . . . . . . . . . . W . . . .17-11 Oct. 1 IOWA STATE . . . . . . . . . . . . . . W . . . . .34-6 Oct. 8 at Texas at Dallas . . . . . . . . . . L . . . .17-10 Oct. 15 at Colorado. . . . . . . . . . . . . . . . L . . . . .45-7 Oct. 22 at Kansas . . . . . . . . . . . . . . . . . W . . . .20-17 Oct. 29 KANSAS STATE . . . . . . . . . . . L . . . .37-20 Nov. 5 MISSOURI . . . . . . . . . . . . . . . . W . . . .30-13 Nov. 12 at Oklahoma State . . . . . . . . . . W . . . .33-14 Nov. 25 NEBRASKA . . . . . . . . . . . . . . . L . . . . .13-3 Dec. 29 BYU* . . . . . . . . . . . . . . . . . . . . L . . . . .31-6 *Copper Bowl at Tucson, Arizona

(8-3, 5-2 BIG 8)

1995

(7-4, 5-2 BIG 8)

at UCLA . . . . . . . . . . . . . . . . . . W . . . .34-14 PITTSBURGH . . . . . . . . . . . . . W . . . .52-10 TULSA . . . . . . . . . . . . . . . . . . . W . . . .52-10 KANSAS. . . . . . . . . . . . . . . . . . W . . . .31-17 at Oklahoma State . . . . . . . . . . W . . . .31-17 Texas at Dallas . . . . . . . . . . . . L . . . .14-13 IOWA STATE . . . . . . . . . . . . . . L . . . .33-31 at Colorado. . . . . . . . . . . . . . . . L . . . .32-23 at Missouri . . . . . . . . . . . . . . . . W . . . .55-10 KANSAS STATE . . . . . . . . . . . W . . . . .34-7 NEBRASKA . . . . . . . . . . . . . . . W . . . .45-10

Sept. 9 Sept. 16 Sept. 23 Sept. 30 Oct. 7 Oct. 14 Oct. 21 Oct. 28 Nov. 4 Nov. 11 Nov. 24

(5-5-1, 2-5 BIG 8)

SAN DIEGO STATE. . . . . . . . . W . . . .38-22 SOUTHERN METHODIST. . . . W . . . .24-10 NORTH TEXAS . . . . . . . . . . . . W . . . .51-10 COLORADO. . . . . . . . . . . . . . . L . . . .38-17 at Iowa State . . . . . . . . . . . . . . W . . . .39-26 Texas at Dallas . . . . . . . . . . . . T . . . .24-24 KANSAS. . . . . . . . . . . . . . . . . . L . . . .38-17 at Missouri . . . . . . . . . . . . . . . . W . . . . .13-9 at Kansas State . . . . . . . . . . . . L . . . .49-10 OKLAHOMA STATE . . . . . . . . L . . . . .12-0 at Nebraska . . . . . . . . . . . . . . . L . . . . .37-0

OKLAHOM A HISTORY

Sept. 28 at Minnesota. . . . . . . . . . . . . . . W . . . . .13-7 Oct. 5 at Kansas State . . . . . . . . . . . . W . . . . .41-6 Oct. 12 Texas at Dallas . . . . . . . . . . . . W . . . . .14-7 Oct. 19 MIAMI, FLA. . . . . . . . . . . . . . . . L . . . .27-14 Oct. 26 IOWA STATE . . . . . . . . . . . . . . W . . . .59-14 Nov. 2 KANSAS. . . . . . . . . . . . . . . . . . W . . . . .48-6 Nov. 9 at Missouri . . . . . . . . . . . . . . . . W . . . . .51-6 Nov. 16 COLORADO. . . . . . . . . . . . . . . W . . . . .31-0 Nov. 23 NEBRASKA . . . . . . . . . . . . . . . W . . . . .27-7 Nov. 30 at Oklahoma State . . . . . . . . . . W . . . . .13-0 Dec. 7 SOUTHERN METHODIST. . . . W . . . .35-13 Jan. 1 Penn State* . . . . . . . . . . . . . . . W . . . .25-10 *Orange Bowl at Miami, Fla.

(9-3, 6-1 BIG 8)

Sept. 10 at North Carolina . . . . . . . . . . . W . . . . .28-0 Sept. 17 ARIZONA . . . . . . . . . . . . . . . . . W . . . .28-10 Sept. 24 at Southern Cal . . . . . . . . . . . . L . . . . .23-7 Oct. 1 IOWA STATE . . . . . . . . . . . . . . W . . . . .35-7 Oct. 8 Texas at Dallas . . . . . . . . . . . . W . . . .28-13 Oct. 15 KANSAS STATE . . . . . . . . . . . W . . . .70-24 Oct. 22 at Colorado. . . . . . . . . . . . . . . . W . . . .17-14 Oct. 29 KANSAS. . . . . . . . . . . . . . . . . . W . . . .63-14 Nov. 5 at Oklahoma State . . . . . . . . . . W . . . .31-28 Nov. 12 at Missouri . . . . . . . . . . . . . . . . W . . . . .16-7 Nov. 19 NEBRASKA . . . . . . . . . . . . . . . L . . . . . .7-3 Jan. 2 Clemson* . . . . . . . . . . . . . . . . . L . . . . .13-6 *Citrus Bowl at Orlando, Fla.

(5-4-2, 3-2-2 BIG 8)

Sept. 3 Sept. 12 Sept. 19 Oct. 3 Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 7 Nov. 14 Nov. 27

REVIEW & OPPONENTS

1985

1988

(9-3, 5-2 BIG 8)

THE SOONERS

Sept. 8 STANFORD . . . . . . . . . . . . . . . W . . . . .19-7 Sept. 15 at Pittsburgh. . . . . . . . . . . . . . . W . . . .42-10 Sept. 22 BAYLOR. . . . . . . . . . . . . . . . . . W . . . .34-15 Sept. 29 KANSAS STATE . . . . . . . . . . . W . . . . .24-6 Oct. 13 Texas at Dallas . . . . . . . . . . . . T . . . .15-15 Oct. 20 at Iowa State . . . . . . . . . . . . . . W . . . .12-10 Oct. 27 at Kansas . . . . . . . . . . . . . . . . . L . . . .28-11 Nov. 3 MISSOURI . . . . . . . . . . . . . . . . W . . . . .49-7 Nov. 10 at Colorado. . . . . . . . . . . . . . . . W . . . .42-17 Nov. 17 at Nebraska . . . . . . . . . . . . . . . W . . . . .17-7 Nov. 24 OKLAHOMA STATE . . . . . . . . W . . . .24-14 Jan. 1 Washington*. . . . . . . . . . . . . . . L . . . .28-17 *Orange Bowl at Miami, Fla.

Sept. 5 NORTH TEXAS . . . . . . . . . . . . W . . . .69-14 Sept. 12 NORTH CAROLINA . . . . . . . . . W . . . . .28-0 Sept. 26 at Tulsa . . . . . . . . . . . . . . . . . . W . . . . .65-0 Oct. 3 at Iowa State . . . . . . . . . . . . . . W . . . . .56-3 Oct. 10 Texas at Dallas . . . . . . . . . . . . W . . . . .44-9 Oct. 17 at Kansas State . . . . . . . . . . . . W . . . .59-10 Oct. 24 COLORADO. . . . . . . . . . . . . . . W . . . . .24-6 Oct. 31 at Kansas . . . . . . . . . . . . . . . . . W . . . .71-10 Nov. 7 OKLAHOMA STATE . . . . . . . . W . . . .29-10 Nov. 14 MISSOURI . . . . . . . . . . . . . . . . W . . . .17-13 Nov. 21 at Nebraska . . . . . . . . . . . . . . . W . . . . .17-7 Jan. 1 Miami, Fla.* . . . . . . . . . . . . . . . L . . . .20-14 *Orange Bowl at Miami, Fla.

1991

COACHING STAFF

1986

2 0 0 5 S EAS ON

Sept. 11 WEST VIRGINIA . . . . . . . . . . . L . . . .41-27 Sept. 18 at Kentucky . . . . . . . . . . . . . . . W . . . . .29-8 Sept. 25 SOUTHERN CAL . . . . . . . . . . . L . . . . .12-0 Oct. 2 at Iowa State . . . . . . . . . . . . . . W . . . . .13-3 Oct. 9 Texas at Dallas . . . . . . . . . . . . W . . . .28-22 Oct. 16 at Kansas . . . . . . . . . . . . . . . . . W . . . .38-14 Oct. 23 OKLAHOMA STATE . . . . . . . . W . . . . .27-9 Oct. 30 at Colorado. . . . . . . . . . . . . . . . W . . . .45-10 Nov. 6 KANSAS STATE . . . . . . . . . . . W . . . .24-10 Nov. 13 MISSOURI . . . . . . . . . . . . . . . . W . . . .41-14 Nov. 26 at Nebraska . . . . . . . . . . . . . . . L . . . .28-24 Jan. 1 Arizona State* . . . . . . . . . . . . . L . . . .32-21 *Fiesta Bowl at Tempe, Ariz.

197 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONER FOOTBALL SEASONS 1996

Sept. 7 Sept. 21 Sept. 28 Oct. 5 Oct. 12 Oct. 19 Oct. 26 Nov. 2 Nov. 9 Nov. 16 Nov. 23

1997

Aug. 23 Sept. 6 Sept. 20 Sept. 27 Oct. 4 Oct. 11 Oct. 18 Oct. 25 Nov. 1 Nov. 8 Nov. 15 Nov. 22

1998

(3-8, 3-5 BIG 12)

TCU . . . . . . . . . . . . . . . . . . . . . L . . . . .20-7 at San Diego State. . . . . . . . . . L . . . .51-31 TULSA . . . . . . . . . . . . . . . . . . . L . . . .31-24 KANSAS. . . . . . . . . . . . . . . . . . L . . . .52-24 Texas at Dallas (OT) . . . . . . . . W . . . .30-27 at Baylor. . . . . . . . . . . . . . . . . . W . . . .28-24 at Kansas State . . . . . . . . . . . . L . . . .42-35 NEBRASKA . . . . . . . . . . . . . . . L . . . .73-21 at Oklahoma State . . . . . . . . . . W . . . .27-17 at Texas A&M. . . . . . . . . . . . . . L . . . .33-16 TEXAS TECH. . . . . . . . . . . . . . L . . . .22-12

(4-8, 2-6 BIG 12)

Northwestern (!) . . . . . . . . . . . . L . . . . .24-0 SYRACUSE . . . . . . . . . . . . . . . W . . . .36-34 at California . . . . . . . . . . . . . . . L . . . .40-36 LOUISVILLE. . . . . . . . . . . . . . . W . . . .35-14 at Kansas . . . . . . . . . . . . . . . . . L . . . .20-17 Texas at Dallas . . . . . . . . . . . . L . . . .27-24 BAYLOR. . . . . . . . . . . . . . . . . . W . . . .24-23 KANSAS STATE . . . . . . . . . . . L . . . . .26-7 at Nebraska . . . . . . . . . . . . . . . L . . . . .69-7 OKLAHOMA STATE . . . . . . . . L . . . . .30-7 TEXAS A&M. . . . . . . . . . . . . . . L . . . . .51-7 at Texas Tech . . . . . . . . . . . . . W . . . .32-21

(5-6, 3-5 BIG 12)

Sept. 5 Sept. 12 Sept. 19 Oct. 3 Oct. 10 Oct. 17 Oct. 24 Oct. 31 Nov. 7 Nov. 14 Nov. 21

NORTH TEXAS . . . . . . . . . . . . W . . . . .37-9 at TCU . . . . . . . . . . . . . . . . . . . W . . . . .10-9 CALIFORNIA . . . . . . . . . . . . . . L . . . .13-12 COLORADO. . . . . . . . . . . . . . . L . . . .27-25 Texas at Dallas . . . . . . . . . . . . L . . . . .34-3 at Missouri . . . . . . . . . . . . . . . . L . . . . .20-6 at Oklahoma State . . . . . . . . . . L . . . .41-26 IOWA STATE . . . . . . . . . . . . . . W . . . .17-14 at Texas A&M. . . . . . . . . . . . . . L . . . . .29-0 at Baylor. . . . . . . . . . . . . . . . . . W . . . .28-16 TEXAS TECH. . . . . . . . . . . . . . W . . . .20-17

1999

(7-5, 5-3 BIG 12)

Sept. 11 INDIANA STATE . . . . . . . . . . . W . . . . .49-0 Sept. 18 BAYLOR. . . . . . . . . . . . . . . . . . W . . . .41-10 Sept. 25 at Louisville . . . . . . . . . . . . . . . W . . . .42-21 Oct. 2 at Notre Dame . . . . . . . . . . . . . L . . . .34-30 Oct. 9 Texas at Dallas . . . . . . . . . . . . L . . . .38-28 Oct. 23 TEXAS A&M. . . . . . . . . . . . . . . W . . . . .51-6 Oct. 30 at Colorado. . . . . . . . . . . . . . . . L . . . .38-24 Nov. 6 MISSOURI . . . . . . . . . . . . . . . . W . . . . .37-0 Nov. 13 at Iowa State . . . . . . . . . . . . . . W . . . .31-10 Nov. 20 at Texas Tech . . . . . . . . . . . . . L . . . .38-28 Nov. 27 OKLAHOMA STATE . . . . . . . . W . . . . .44-7 Dec. 31 Mississippi* . . . . . . . . . . . . . . . L . . . .27-25 *Independence Bowl at Shreveport, La.

2000

(13-0, 8-0 NATIONAL CHAMPIONS)

Sept. 2 TEXAS-EL PASO. . . . . . . . . . . W . . . .55-14 Sept. 9 ARKANSAS STATE . . . . . . . . . W . . . . .45-7 Sept. 23 RICE. . . . . . . . . . . . . . . . . . . . . W . . . .42-14 Sept. 30 KANSAS. . . . . . . . . . . . . . . . . . W . . . .34-16 Oct. 7 Texas at Dallas . . . . . . . . . . . . W . . . .63-14 Oct. 14 at Kansas State . . . . . . . . . . . . W . . . .41-31 Oct. 28 NEBRASKA . . . . . . . . . . . . . . . W . . . .31-14 Nov. 4 at Baylor. . . . . . . . . . . . . . . . . . W . . . . .56-7 Nov. 11 at Texas A&M. . . . . . . . . . . . . . W . . . .35-31 Nov. 18 TEXAS TECH. . . . . . . . . . . . . . W . . . .27-13 Nov. 25 at Oklahoma State . . . . . . . . . . W . . . . .12-7 Dec. 2 Kansas State^ . . . . . . . . . . . . . W . . . .27-24 Jan. 3 Florida State* . . . . . . . . . . . . . W . . . . .13-2 ^Big 12 Championship Game at Kansas City, Mo. *Orange Bowl at Miami, Fla.

2001

(11-2, 6-2 BIG 12)

Aug. 25 NORTH CAROLIINA . . . . . . . . W . . . .41-27 Sept. 1 at Air Force. . . . . . . . . . . . . . . . W . . . . .44-3 Sept. 8 NORTH TEXAS . . . . . . . . . . . . W . . . .37-10 Sept. 29 KANSAS STATE . . . . . . . . . . . W . . . .38-37 Oct. 6 Texas at Dallas . . . . . . . . . . . . W . . . . .14-3 Oct. 13 at Kansas . . . . . . . . . . . . . . . . . W . . . .38-10 Oct. 20 BAYLOR. . . . . . . . . . . . . . . . . . W . . . .33-17 Oct. 27 at Nebraska . . . . . . . . . . . . . . . L . . . .20-10 Nov. 3 TULSA . . . . . . . . . . . . . . . . . . . W . . . . .58-0 Nov. 10 TEXAS A&M. . . . . . . . . . . . . . . W . . . .31-10 Nov. 17 at Texas Tech . . . . . . . . . . . . . W . . . .30-13 Nov. 24 OKLAHOMA STATE . . . . . . . . L . . . .16-13 Jan. 1 Arkansas*. . . . . . . . . . . . . . . . . W . . . . .10-3 *Cotton Bowl at Dallas, Texas

2002

(12-2, 6-2 BIG 12 CHAMPIONS)

Aug. 30 at Tulsa . . . . . . . . . . . . . . . . . . W . . . . .37-0 Sept. 7 ALABAMA . . . . . . . . . . . . . . . . W . . . .37-27 Sept. 14 TEXAS-EL PASO. . . . . . . . . . . W . . . . .68-0 Sept. 28 SOUTH FLORIDA . . . . . . . . . . W . . . .31-14 Oct. 5 at Missouri . . . . . . . . . . . . . . . . W . . . .31-24 Oct. 12 Texas at Dallas . . . . . . . . . . . . W . . . .35-24 Oct. 19 IOWA STATE . . . . . . . . . . . . . . W . . . . .49-3 Nov. 2 COLORADO. . . . . . . . . . . . . . . W . . . .27-11 Nov. 9 at Texas A&M. . . . . . . . . . . . . . L . . . .30-26 Nov. 16 at Baylor. . . . . . . . . . . . . . . . . . W . . . . .49-9 Nov. 23 TEXAS TECH. . . . . . . . . . . . . . W . . . .60-15 Nov. 30 at Oklahoma State . . . . . . . . . . L . . . .38-28 Dec. 7 Colorado^. . . . . . . . . . . . . . . . . W . . . . .29-7 Jan. 1 Washington State* . . . . . . . . . . W . . . .34-14 ^Big 12 Championship Game at Houston, Texas *Rose Bowl at Pasadena, Calif.

2003

(12-2, 8-0 BIG 12)

Aug. 30 NORTH TEXAS . . . . . . . . . . . . W . . . . .37-3 Sept. 6 at Alabama. . . . . . . . . . . . . . . . W . . . .20-13 Sept. 13 FRESNO STATE . . . . . . . . . . . W . . . .52-28 Sept. 20 UCLA . . . . . . . . . . . . . . . . . . . . W . . . .59-24 Oct. 4 at Iowa State . . . . . . . . . . . . . . W . . . . .53-7 Oct. 11 Texas at Dallas . . . . . . . . . . . . W . . . .65-13 Oct. 18 MISSOURI . . . . . . . . . . . . . . . . W . . . .34-13 Oct. 25 at Colorado. . . . . . . . . . . . . . . . W . . . .34-20 Nov. 1 OKLAHOMA STATE . . . . . . . . W . . . . .52-9 Nov. 8 TEXAS A&M. . . . . . . . . . . . . . . W . . . . .77-0 Nov. 15 BAYLOR. . . . . . . . . . . . . . . . . . W . . . . .41-3 Nov. 22 at Texas Tech . . . . . . . . . . . . . W . . . .56-25 Dec. 6 Kansas State^ . . . . . . . . . . . . . L . . . . .35-7 Jan. 4 Louisiana State*. . . . . . . . . . . . L . . . .21-14 ^ Big 12 Championship Game at Kansas City, Mo. * Sugar Bowl at New Orleans, La.

2004

(12-1, 8-0 BIG 12 CHAMPIONS)

Sept. 4 BOWLING GREEN . . . . . . . . . W . . . .40-24 Sept. 11 HOUSTON . . . . . . . . . . . . . . . . W . . . .63-13 Sept. 18 OREGON . . . . . . . . . . . . . . . . . W . . . . .31-7 Oct. 2 TEXAS TECH. . . . . . . . . . . . . . W . . . .28-13 Oct. 9 Texas at Dallas . . . . . . . . . . . . W . . . . .12-0 Oct. 16 at Kansas State . . . . . . . . . . . . W . . . .31-21 Oct. 23 KANSAS. . . . . . . . . . . . . . . . . . W . . . .41-10 Oct. 30 at Oklahoma State . . . . . . . . . . W . . . .38-35 Nov. 6 at Texas A&M. . . . . . . . . . . . . . W . . . .42-35 Nov. 13 NEBRASKA . . . . . . . . . . . . . . . W . . . . .30-3 Nov. 20 at Baylor. . . . . . . . . . . . . . . . . . W . . . . .35-0 Dec. 4 Colorado^. . . . . . . . . . . . . . . . . W . . . . .42-3 Jan. 4 USC* . . . . . . . . . . . . . . . . . . . . L . . . .55-19 ^ Big 12 Championship Game at Kansas City, Mo. * Orange Bowl at Miami, Fla. ALL CAPS indicate games played in Norman. *at Oklahoma City; # at Guthrie; ! at Chicago, Ill.

198 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Records & Championships Year 2004 2003 2002 2001 2000 1999 1998 1997 1996 1995 1994 1993 1992 1991 1990 1989 1988 1987 1986 1985 1984 1983 1982 1981 1980 1979 1978 1977 1976 1975 1974 1973 1972 1971 1970 1969 1968 1967 1966 1965 1964 1963 1962 1961 1960 1959 1958 1957 1956 1955 1954 1953 1952 1951 1950 1949 1948 1947

Overall 12-1 12-2 12-2 11-2 13-0 7-5 5-6 4-8 3-8 5-5-1 6-6 9-3 5-4-2 9-3 8-3 7-4 9-3 11-1 11-1 11-1 9-2-1 8-4 8-4 7-4-1 10-2 11-1 11-1 10-2 9-2-1 11-1 11-0 10-0-1 11-1 11-1 7-4-1 6-4 7-4 10-1 6-4 3-7 6-4-1 8-2 8-3 5-5 3-6-1 7-3 10-1 10-1 10-0 11-0 10-0 9-1-1 8-1-1 8-2 10-1 11-0 10-1 7-2-1

Conf. 8-0 8-0 6-2 6-2 8-0 5-3 3-5 2-6 3-5 2-5 4-3 4-3 3-2-2 5-2 5-2 5-2 6-1 7-0 7-0 7-0 6-1 5-2 6-1 4-2-1 7-0 7-0 6-1 7-0 5-2 6-1 7-0 7-0 6-1 6-1 5-2 4-3 6-1 7-0 4-3 3-4 5-1 6-1 7-0 4-3 2-4-1 6-1 7-0 6-0 6-0 6-0 6-0 6-0 5-0-1 6-0 6-0 5-0 5-0 4-0-1

NC CC CC

BC

CC

BC BC BC

NC CC

BC BC

CC CC NC CC CC

CC CC CC CC CC NC CC NC CC CC CC

CC CC

BC BC

BC BC BC BC BC BC BC BC

BC

CC CC CC CC NC CC NC CC CC CC CC CC NC CC CC CC CC

BC BC BC BC

BC BC


OKLAHOMA TRADITIONS Records & Championships

CC CC

Sports fans are hard-pressed to find a nickname that is as unique and as linked to a state’s history as a Sooner. The University of Oklahoma is the only school known as Sooners. Oklahoma Territory opened with the Land Run of 1889. Settlers from across the globe, seeking free land, made their way to the prairies of the plains to stake their claim to a new life. One of the few rules to claiming a lot of land was that all participants were to start at the same time, on the boom of a cannon. Settlers who went too early were called “Sooners.”

CC

OU athletic teams were called either Rough Riders or Boomers for 10 years before the current Sooner nickname emerged in 1908. The university actually derived their name from a pep club called ‘The Sooner Rooters.’ The success of University of Oklahoma athletic teams over the years has made the nickname synonymous with winning.

Crimson & Cream

In the fall of 1895, Miss May Overstreet, was asked to chair a committee to select the colors of the university. The committee decided the colors should be crimson and cream and an elaborate display of the colors was draped above a platform before the student body. The students approved with great enthusiasm and immediately pennants, banners and decorations of every description appeared on the streets, in the windows, at chapel, in classrooms, and all public places around campus.

CC CC CC

Sooner Schooner

The Sooner Schooner is a Conestoga, or covered wagon, reminiscent of the mode of travel used by pioneers who settled Oklahoma. The Schooner is powered by matching white ponies named Boomer and Sooner, and it ventures onto Owen Field in a triumphant victory ride after OU scores. Although the Schooner was introduced in 1964, it did not become the official mascot until 1980. The Schooner is well-recognized by college athletics fans across the country and makes regular appearances at university functions.

Boomer Sooner!

In 1905, Arthur M. Alden, a student in history and physiology whose father was a Norman jeweler, wrote the lyrics to the fight song, borrowing the tune from Yale University’s ‘Boola Boola’ but improvising the words. A year later, an addition was made to it from North Carolina’s ‘I’m a Tarheel Born’ and the two combined to form the university’s fight song today. Though the tune was first made known by Yale, the everlasting success of Sooner squads has taken the melody of ‘Boomer Sooner’ to national popularity.

Oklahoma!

The Pride of Oklahoma plays perhaps the most popular and recognizable state song in history. Oklahoma! is the final rousing chorus of Rodgers and Hammerstein’s epic musical. Breaking all Broadway box office records when it opened in 1943, Oklahoma! was the first collaboration between the legendary pair who were awarded a Pulitzer Prize for their seminal work.

BUD W ILKI NSON

The OU Chant

NC CC BC 7 39 23

Every fan who wears the official colors, each current student and student-athlete and all OU alumni are encouraged to stand and raise one finger in the air during the playing of the Chant -- a symbolic gesture that shows the greatness of the university and the unity between all Sooners. The Chant was written in 1936 by Jessie Lone Clarkson Gilkey, who directed the OU girl’s glee club from 1936 to 1938 and was voted Outstanding Faculty Woman in 1937. O-K-L-A-H-O-M-A Our chant rolls on and on! Thousands strong Join heart and song In alma mater’s praise Of campus beautiful by day and night Of colors proudly gleaming Red and White ‘Neath a western sky OU’s chant will never die. Live on University!

OKLAHOM A HISTORY

NC - National Champions CC - Conference Champions BC - Bowl Champions

BC BC

REVIEW & OPPONENTS

Conference 404-129-22

What is a Sooner?

NC CC CC

THE SOONERS

Record 749-285-53

Conf. 4-1 4-1 4-0-1 5-0 3-1-1 3-2 4-1 3-2 5-0 3-1-1 1-2-2 3-2 2-2-1 3-2 3-2 1-4 3-1-1 2-2-1 3-2 2-3 3-2-1 3-3-1 2-3-1 2-4 1-2-2 2-3 4-0-1 2-1 2-0 1-1-1 2-1 3-0

COACHING STAFF

Overall 8-3 5-5 6-3-1 7-2 3-5-2 6-3 6-3 6-2-1 10-1 5-2-2 3-3-3 6-3 3-4-2 4-4-1 4-4-1 4-7-1 4-3-1 3-3-2 5-3 3-3-2 5-2-1 4-3-1 2-5-1 3-5 2-3-3 5-3 6-0-1 5-2-3 6-0 6-4-1 6-5 10-0 9-1-1 6-2 5-4 8-0 4-2-1 6-4 8-1-1 4-4 5-2-2 7-2 4-3-1 5-4-3 6-3 3-2 3-1-1 2-1 2-0 2-0 2-0 0-1

2 0 0 5 S EAS ON

Year 1946 1945 1944 1943 1942 1941 1940 1939 1938 1937 1936 1935 1934 1933 1932 1931 1930 1929 1928 1927 1926 1925 1924 1923 1922 1921 1920 1919 1918 1917 1916 1915 1914 1913 1912 1911 1910 1909 1908 1907 1906 1905 1904 1903 1902 1901 1900 1899 1898 1897 1896 1895

199 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

PRENTICE GAUTT ACADEMICS CENTER

200

The Prentice Gautt Academic Center provides student-athletes with a modern, state-of-the-art academic support facility that promotes excellence. The environment encourages a collaboration between staff members and student-athletes. In addition, it is highly conducive to learning in all areas of students’ academic endeavors and features seven learning centers. Located on the second and third floors in the north end of Gaylord Family - Oklahoma Memorial Stadium, the Academic Center houses Academic Counseling Offices, two Computer Centers, Learning and Skill Development Centers for reading, study skills, math, foreign languages, career, and communication, mentoring office and study areas. ACADEMIC ADVISING Academic Advising Services, considered a campus-advising unit, are conveniently located within the center. The athletics department employs five professional full-time counselors who are here to help student-athletes through the educational process. It is important that student-athletes utilize their services. They will assist student-athletes with planning their class schedule and deciding on a degree program that will suit their needs. In addition, they can help student-athletes with career planning, setting academic goals, academic support strategies and personal counseling. CAREER CENTER Whether student-athletes are freshmen, sophomores, juniors, seniors or alumni, they will benefit from the services of the Career Center. It provides a system of services that educates and guides students through the career development process. The Career Center is dedicated to helping student-athletes make the transition from college to career by developing an individualized career plan where they gather information to assist in making a decision about a career. Additionally, they may obtain information on the suitable career list; explore classes and publications in the field as well as obtain experience; and gain knowledge and skills necessary for résumé writing, job-related letter writing, and interviewing techniques. KERR FOUNDATION COMPUTER CENTER In the 21st century, computers have become an integral part of the learning experience. Students need access to computers and their resources almost daily. The Athletics Department provides each student with the equipment and support necessary to succeed. There are currently two computer centers within the Prentice Gautt Academic Center. These centers have more than 200 computers, and are available exclusively to OU’s student-athletes. This ensures that they will never go without computer access. Laptop computers are checked out to student-athletes when the Computer Centers are unavailable. The laptop program is very important in helping OU’s student-athletes stay on top of their schoolwork when traveling. Group training is available for all new student-athletes during the first week of supervised study. This helps familiarize each student-athlete with the department’s resources and procedures. Individual training sessions are available to each student upon request and lab technicians are always on hand to help. The Athletic Computer Centers have been a model for other universities around the country. Upgrades are scheduled annually for both centers along with a face lift for the entire facility. A deep commitment from the

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

Athletics Department ensures that the excellence in the Computer Centers will continue for a long time. COMMUNICATIONS CENTER A new addition to the academic center focuses on developing communication and public speaking skills for student-athletes. This state of the art center, coordinated by a broadcast professional, builds strong media relations skills through the use of video equipment. KERR FOUNDATION FOREIGN LANGUAGE CENTER To assist student-athletes in speaking, listening, reading and writing in other languages, the Kerr Foundation Foreign Language Center offers a multi-media environment that provides instruction in all foreign languages and in English as a second language. On an individual basis, student-athletes have the option of working with computers, audio-visual equipment and tutors in order to enhance student-athletes’ language experience. Computer Language Software Programs - give student-athletes interactive, individually-paced language drills to strengthen their skills. Audio Listening Work Stations – allows student-athletes to listen to various language audio tapes and assigned materials. Foreign Language TV/Video Viewing – provides the opportunity to hear native speakers in conversation as well as providing access to cultural information. There is a TV/VCR combination unit for showing foreign videos and cable connections to allow viewing of foreign language television programs. Word Processing Software – allows student-athletes to complete foreign language writing assignments. After completion, student-athletes are able to print their assignments using the laser printer. Tutoring – offered by the Language Center consultants, knowledgeable of the languages taught at OU, provide individual or group instruction. MATH CENTER If performing math functions is a problem, the solution is the Math Center. As a supplement to class instruction, the Math Center provides all levels of math computations, concepts and problems to help student-athletes review course material and offers personal and group tutoring sessions. STUDY SKILLS CENTER If student-athletes have trouble with assigned textbook readings or studying, the Reading and Study Skills Center can help. It provides studentathletes with reading and studying techniques and how to make direct applications to current resources. THOMPSON WRITING CENTER Because learning and writing are essential life-long skills which can always be strengthened, the Writing and Study Skills Center offers personalized instruction to student-athletes who seek assistance in refreshing, reviewing, or improving these skills. The professional consultants of the center help student-athletes with a variety of academic tasks, from learning strategy instruction to any stage of the writing process including preparing for an essay exam and the formal research paper. The goal is to help student-athletes develop the strategies they need to be successful by encouraging the use of the center for all facets of the learning and writing processes encountered in college.


ACADEMICS CENTER STAFF TERESA TURNER

CORY THIGPEN

C.B. ELDER

CHRISTINE TINSLEY

RANDY GARIBAY

TERRI WATKINS

DR. NICKI MOORE

GRETCHEN WHITE

CURTIS JONES

LINDA WYATT

Asst. Dir. for Academic Affairs & Academic Counseling

Asst. Dir. for Academic Affairs; Coor. of Academic Services

Asst. Dir. for Academic Affairs & Academic Counseling

Math Center Coordinator

Communications Center Coordinator

Writing Center Coordinator

COACHING STAFF

Asst. Dir. of Academic Affairs for Psychological Services

Graphic Design

2 0 0 5 S EAS ON

Asst. Dir. of Academic Affairs & Academic Counselor

Admissions Coordinator

THE SOONERS

JENNIFER WILLIAMS

Asst. Dir. for Academic Affairs & Academic Counseling

CHRISTINA CARTER

Financial Aid & Scholarship Coordinator

Academic Counseling Secretary

THE SEED SOWER JENNIFER JARVIS-DENNY

Foreign Language Center Coordinator

REVIEW & OPPONENTS

AMBER DEMASTUS

TERRI MOYER

OKLAHOM A HISTORY

Administrative Coordinator

CECIL ROSE

Career Center Coordinator

201 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

ACADEMIC HONORS ACADEMIC ALL-CONFERENCE Year Pos Player

ACADEMIC ALL-CONFERENCE Year Pos Player

ACADEMIC ALL-CONFERENCE Year Pos Player

2004

1989

1970

2003

2002

2001

2000

1999

1998

1997

1996

1995 1992 1991 1990

RB . . . . . . . .Tashard Choice TE . . . . . . . .Joe Jon Finley DT . . . . . . . .Carl Pendleton DB . . . . . . . .Antonio Perkins DT . . . . . . . .Dusty Dvoracek RB . . . . . . . .Shawn Farria LB. . . . . . . . .Pasha Jackson DT . . . . . . . .Kory Klein S. . . . . . . . . .Matt McCoy DB . . . . . . . .Antonio Perkins WR . . . . . . . .Travis Wilson RB . . . . . . . .Renaldo Works C . . . . . . . . .Vince Carter DT . . . . . . . .Dusty Dvoracek DT . . . . . . . .Jacob Hager DE . . . . . . . .Eric Hilaire QB . . . . . . . .Nate Hybl CB . . . . . . . .Andre Woolfolk RB . . . . . . . .Renaldo Works TE . . . . . . . .Lance Donley QB . . . . . . . .Nate Hybl S. . . . . . . . . .Matt McCoy SN . . . . . . . .Ben Panter RB . . . . . . . .Renaldo Works DE . . . . . . . .Darryl Bright DT . . . . . . . .Ryan Fisher TE . . . . . . . .Chris Hammons QB . . . . . . . .Nate Hybl OL . . . . . . . .Scott Kempenich DT . . . . . . . .Kory Klein DB . . . . . . . .Matt Mayhew DB . . . . . . . .Matt McCoy SN . . . . . . . .Ben Panter OL . . . . . . . .Josh Smith DB . . . . . . . .Michael Thompson OL . . . . . . . .Ryan Allen DE . . . . . . . .Darryl Bright LB. . . . . . . . .Rocky Calmus OL . . . . . . . .Scott Kempenich WR . . . . . . . .Damian Mackey DB . . . . . . . .Matt Mayhew DS . . . . . . . .Ben Panter K. . . . . . . . . .Matt Reeves OL . . . . . . . .Ryan Allen DE . . . . . . . .Rocky Bright OL . . . . . . . .Scott Kempenich RB . . . . . . . .Seth Littrell LB. . . . . . . . .Scott Ousley SNP . . . . . . .Ben Panter LB. . . . . . . . .DeMario Soloman FL. . . . . . . . .Gerald Williams DE . . . . . . . .Ryan Allen QB . . . . . . . .Justin Fuente CB . . . . . . . .Corey T. Ivy OL . . . . . . . .Scott Kempenich MLB . . . . . . .Scott Ousley FL. . . . . . . . .Gerald Williams SNP . . . . . . .Taylor Wickersham DE . . . . . . . .Ryan Allen OL . . . . . . . .David Bullard QB . . . . . . . .Justin Fuente FL. . . . . . . . .Gerald William TE . . . . . . . .Stephen Alexander OG . . . . . . . .Milton Overton OL . . . . . . . .Paul Moriarity RB . . . . . . . .Kenyon Rasheed LB. . . . . . . . .Mike Fields OG . . . . . . . .Mike Sawatzky OT . . . . . . . .Jeff Miller

1988

1987

1986

1985 1983 1982

1981

1980

1979 1978 1977 1976

1975 1974

1973

1972 1971

OL . . . . . . . .Terran Manning QB . . . . . . . .Chris Melson OL . . . . . . . .Anthony Phillips OL . . . . . . . .Mike Sawatzky DL. . . . . . . . .Scott Evans P. . . . . . . . . .Todd Thomsen TE . . . . . . . .Keith Jackson OL . . . . . . . .Greg Johnson OL . . . . . . . .Anthony Phillips FB . . . . . . . .Lydell Carr K. . . . . . . . . .Todd Thomsen DE . . . . . . . .Darrell Reed DL. . . . . . . . .Scott Evans LB. . . . . . . . .Richard Dillon LB. . . . . . . . .Derrick Crudup OL . . . . . . . .Anthony Phillips OL . . . . . . . .Travis Simpson FB . . . . . . . .Earl Johnson DE . . . . . . . .Mike Mantle DL. . . . . . . . .Richard Reed LB. . . . . . . . .Evan Gatewood DB . . . . . . . .David Vickers OL . . . . . . . .Anthony Phillips OL . . . . . . . .Chuck Thomas DL. . . . . . . . .Daryl Goodlow DL. . . . . . . . .Rick Bryan OL . . . . . . . .Brent Burks HB . . . . . . . .Weldon Ledbetter HB . . . . . . . .Steve Sewell DT . . . . . . . .Rick Bryan P. . . . . . . . . .Michael Keeling RB . . . . . . . .Weldon Ledbetter DE . . . . . . . .Steve Whaley DL. . . . . . . . .Rick Bryan DB . . . . . . . .Dwight Drane P. . . . . . . . . .Michael Keeling RB . . . . . . . .Weldon Ledbetter DE . . . . . . . .Mike Weddington LB. . . . . . . . .Mike Coast DB . . . . . . . .Jay Jimerson P. . . . . . . . . .Michael Keeling DB . . . . . . . .Jay Jimerson OG . . . . . . . .Bill O’Gara S. . . . . . . . . .Jay Jimerson WR . . . . . . . .Bobby Kimball OL . . . . . . . .Bruce Taton S. . . . . . . . . .Sherwood Taylor LB. . . . . . . . .Obie Moore DB . . . . . . . .Lee Roy Selmon NG . . . . . . . .Dewey Selmon LB. . . . . . . . .Jamie Thomas DB . . . . . . . .Lee Roy Selmon NG . . . . . . . .Dewey Selmon LB. . . . . . . . .Jamie Thomas OG . . . . . . . .John Roush HB . . . . . . . .Grant Burget OT . . . . . . . .Lee Roy Selmon NG . . . . . . . .Dewey Selmon DB . . . . . . . .Randy Hughes OT . . . . . . . .Eddie Foster DT . . . . . . . .Dewey Selmon DB . . . . . . . .Randy Hughes DB . . . . . . . .Durwood Keeton OG . . . . . . . .Ken Jones HB . . . . . . . .Greg Pruitt HB . . . . . . . .Joe Wylie QB . . . . . . . .Jack Mildren FB . . . . . . . .Leon Crosswhite

202 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

1969 1968 1967

1966 1965

1964

1963 1962 1961 1960 1959 1958 1957 1956 1955

1954

TE . . . . . . . .Albert Chandler QB . . . . . . . .Jack Mildren HB . . . . . . . .Joe Wylie LB. . . . . . . . .Steve Aycock TE . . . . . . . .Steve Zabel QB . . . . . . . .Jack Mildren HB . . . . . . . .Eddie Hinton TE . . . . . . . .Steve Zabel DB . . . . . . . .Steve Barrett TE . . . . . . . .Steve Zabel HB . . . . . . . .Ron Shotts DE . . . . . . . .Jim Files LB. . . . . . . . .Bruce Stensrud HB . . . . . . . .Ron Shotts LB. . . . . . . . .Rick Goodwin OG . . . . . . . .Wes Butts QB . . . . . . . .Gene Cagle HB . . . . . . . .Ron Shotts DE . . . . . . . .John Koeller DB . . . . . . . .Mike Ringer TE . . . . . . . .Ron Harmon OT . . . . . . . .Butch Metcalf OG . . . . . . . .Newt Burton OG . . . . . . . .Carl Schreiner DE . . . . . . . .Rick McCurdy DT . . . . . . . .Bill Hill LB. . . . . . . . .Dave Voiles E. . . . . . . . . .Rick McCurdy G . . . . . . . . .Newt Burton C . . . . . . . . .David Voiles T. . . . . . . . . .Duane Cook T. . . . . . . . . .Dennis Ward C . . . . . . . . .Wayne Lee T. . . . . . . . . .Dennis Ward B. . . . . . . . . .Mike McClellan B. . . . . . . . . .Phil Lohmann B. . . . . . . . . .Gary Wylie T. . . . . . . . . .Jerry Thompson T. . . . . . . . . .Jim Lawrence G . . . . . . . . .Jerry Payne B. . . . . . . . . .Prentice Gautt E. . . . . . . . . .Joe Rector T. . . . . . . . . .Doyle Jennings G . . . . . . . . .Joseph Oujesky E. . . . . . . . . .John Bell B. . . . . . . . . .Jay O’Neal B. . . . . . . . . .Tommy McDonald E. . . . . . . . . .Bob Timberlake T. . . . . . . . . .Cal Woodworth B. . . . . . . . . .Jay O’Neal B. . . . . . . . . .Tommy McDonald E. . . . . . . . . .Carl Allison T. . . . . . . . . .Cal Woodworth B. . . . . . . . . .Gene Calame

NATIONAL FOOTBALL FOUNDATION SCHOLAR-ATHLETE Player Year Renaldo Works . . . . . . . . . . . . . . . . . 2003 Jay McKim . . . . . . . . . . . . . . . . . . . . 1980 Lee Roy Selmon. . . . . . . . . . . . . . . . 1975 Randy Hughes . . . . . . . . . . . . . . . . . 1974 Joe Wylie . . . . . . . . . . . . . . . . . . . . . 1972 Jack Mildren . . . . . . . . . . . . . . . . . . . 1971 NATIONAL FOOTBALL FOUNDATION AND HALL OF FAME (Began in 1959) Player Year Renaldo Works . . . . . . . . . . . . . . . . . 2003 Lee Roy Selmon. . . . . . . . . . . . . . . . 1975 Jack Mildren . . . . . . . . . . . . . . . . . . . 1971 NATIONAL COLLEGIATE ATHLETIC ASSOCIATION (Began in 1964) Player Year Scott Kempenich . . . . . . . . . . . . . . . 2000 Mike Sawatzky . . . . . . . . . . . . . . . . . 1990 Anthony Phillips . . . . . . . . . . . . . . . . 1988 Jay Jimerson . . . . . . . . . . . . . . . . . . 1980 Joe Wylie . . . . . . . . . . . . . . . . . . . . . 1972 Jack Mildren . . . . . . . . . . . . . . . . . . . 1971 VERIZON/COSIDA ACADEMIC HALL OF FAME Player Year Jack Mildren . . . . . . . . . . . . . . . . . . . 1998 Lee Roy Selmon. . . . . . . . . . . . . . . . 1993 GATES MILLENNIUM SCHOLARSHIP Player Year Laromie Hammer . . . . . . . . . . . . . . . 2000 VERIZON/COSIDA ACADEMIC ALL-AMERICANS (selected by College Sports Information Directors of America) Player Pos Year Anthony Phillips . . . . . . .OL . . . . . . 1987 Todd Thomsen . . . . . . . . K . . . . . . . 1987 Brian Bosworth . . . . . . . .LB . . . . . . 1986 Jay Jimerson . . . . . . . . .DB . . . . . . 1980 Dewey Selmon . . . . . . . NG . . . . . . 1975 Lee Roy Selmon. . . . . . .DT . . . . . . 1975 Randy Hughes . . . . . . . .DB . . . . . . 1974 John Roush . . . . . . . . . OG . . . . . . 1974 Dewey Selmon . . . . . . . NG . . . . . . 1974 Lee Roy Selmon. . . . . . .DT . . . . . . 1974 Joe Wylie . . . . . . . . . . . .HB . . . . . . 1972 Jack Mildren . . . . . . . . . .QB . . . . . . 1971 Joe Wylie . . . . . . . . . . . .HB . . . . . . 1970 Eddie Hinton. . . . . . . . . .HB . . . . . . 1968 Ron Shotts . . . . . . . . . . .HB . . . . . . 1967 Ron Shotts . . . . . . . . . . .HB . . . . . . 1966 Mike Ringer . . . . . . . . . .DB . . . . . . 1965 Newt Burton . . . . . . . . . . G . . . . . . . 1964 Newt Burton . . . . . . . . . . G . . . . . . . 1963 Wayne Lee . . . . . . . . . . . C . . . . . . . 1962 Ross Coyle . . . . . . . . . . . E . . . . . . . 1958 Doyle Jennings. . . . . . . . T . . . . . . . 1957 Jerry Tubbs. . . . . . . . . . . C . . . . . . . 1956 Carl Allison . . . . . . . . . . . E . . . . . . . 1954 Tom Catlin. . . . . . . . . . . . C . . . . . . . 1952


DAVID & MOLLY SHI BOREN

UNIVERSITY PRESIDENT

David L. Boren

13th President, The University of Oklahoma David L. Boren, who has served Oklahoma as governor and U.S. senator, became the thirteenth president of the University of Oklahoma in November 1994. He is the first person in state history to have served in all three positions.

In 1968, he received a law degree from the University of Oklahoma College of Law, where he was on the Law Review, elected to the Order of the Coif, and won the Bledsoe Prize as the outstanding graduate by a vote of the faculty.

As a senator, he was the author of the National Security Education Act in 1992, which provides scholarships for study abroad and for learning additional languages, as well as legislation to restore the tax deductibility of gifts of appreciated property to universities in 1993. Boren, also a former state legislator, spent nearly three decades in elective politics before becoming the president of the University of Oklahoma. Boren was the youngest governor in the nation when he served from 1974 to 1978. Known as a reformer, Boren campaigned with a broom as his

Over $700 million in facilities construction has been initiated during his tenure. During his first decade over $1 billion in private contributions were given to the university and the university contributor base was increased from 17,000 donors to almost 100,000. Presidential Travel Scholarships, students from 111 countries on campus, more reciprocal international exchange agreements than any other university and the new International Programs Center are all making OU more international. Above all, the Boren years have been marked by an emphasis on putting students first. There is not a university president in the country that is more committed to students as his number one priority. He teaches a freshman-level course in political science each semester and is one of the few presidents of major universities to teach. Boren is married to Molly Shi Boren, a former judge and English teacher. Molly Boren has two degrees from the University of Oklahoma, a master’s degree in English and a Juris Doctor degree from the OU College of Law. Mrs. Boren is actively involved in university life and has led the landscaping effort on all three OU campuses. Boren has two children, Carrie Christine Boren and Dan Boren.

1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS

OKLAHOM A HISTORY

One of Boren’s most far-reaching projects in promoting quality education at all levels is the Oklahoma Foundation for Excellence, which he founded in 1985. The foundation recognizes outstanding public school students and teachers and helps establish private local foundations to help give academic endowment grants to local public schools.

Under Boren’s leadership, the University of Oklahoma has developed and emerged as a “pacesetter university in American public higher education,” with 20 major new programs initiated since his inauguration. They include establishment of the Honors College, a new expository writing program for freshmen modeled on the program at Harvard, an interdisciplinary religious studies program, a new International Programs Center, and the Faculty-in-Residence Program putting faculty family apartments in student residence halls. The Retired Professors Program has been started, bringing 50 retired full professors back to the University to teach freshmen. The new Honors College helps to assure that no students need to leave Oklahoma to find an educational experience to match their potential.

REVIEW & OPPONENTS

As Oklahoma’s governor from 1974 through 1978, Boren promoted key educational initiatives that have had an enduring impact on Oklahoma. Established during his tenure were: the Oklahoma Summer Arts Institute, the Scholar-Leadership Enrichment Program, and the Oklahoma Physicians Manpower Training Program, which provides scholarships for medical students and medical personnel who commit to practice in underserved rural areas. Also, the first state funding for Gifted and Talented classes was provided in 1976 and, from 1976 through 1978, Oklahoma ranked first among all states in the percentage increases of funding for higher education.

Boren served from 1988 to 1997 as a member of the Yale University Board of Trustees. His university experience also includes four years on the faculty of Oklahoma Baptist University, where he was chairman of the Department of Political Science and chairman of the Division of Social Sciences. In 1993, the American Association of University Professors presented Boren with the Henry Yost Award as Education Advocate of the Year.

THE SOONERS

Boren is widely respected for his academic credentials, his longtime support of education, and for his distinguished political career as a reformer of the American political system. A graduate of Yale University in 1963, Boren majored in American history, graduated in the top one percent of his class and was elected Phi Beta Kappa. He was selected as a Rhodes Scholar and earned a master’s degree in politics, philosophy and economics from Oxford University, England, in 1965.

Boren left the U.S. Senate in 1994 with an approval rating of 9l percent after being reelected with 83 percent of the vote in 1990, the highest percentage in the nation in a U.S. Senate contest in that election year.

COACHING STAFF

During his time in the U.S. Senate -- from 1979 to 1994 -- Boren was the longest-serving chairman of the Senate Select Committee on Intelligence. From his days as a state legislator and governor of Oklahoma to Washington, Boren carried a commitment to reform, leading numerous efforts to make government work better for American citizens. As chairman of the Senate Intelligence Committee, he strengthened oversight of secret government programs and reformed the procedures for Presidential notice of such programs to Congress. For more than 10 years, he led the fight for congressional campaign finance reform.

2 0 0 5 S EAS ON

symbol. During his term, he instituted many progressive programs, including conflict-of-interest rules, campaign-financing disclosure, stronger open meeting laws for public bodies, and more competitive bidding on state government contracts.

203


Joe Castiglione Director of Athletics, The University of Oklahoma

In seven years, Joe Castiglione has established a pattern of excellence that few in his profession could match. While Castiglione would quickly point out that the credit belongs to the student-athletes and coaches, the staff and the university administration, the donors and the fans, someone had to make the first step, to take the lead. Under the heading of “Inspiring Champions Today … Preparing leaders for tomorrow” Castiglione has authored one of the most successful athletics eras ever witnessed at OU and an expansion of facilities that is unmatched in Sooner history.

The 11th director of athletics at the University of Oklahoma has celebrated five national championships, record numbers of graduating student-athletes, dramatically increased donor giving, huge increases in ticket sales for all sports, major facility improvements and development and construction of new facilities. And, as aggressive as the push to improve, expand and excel has been, he has produced a balanced budget in every year of his tenure, a first since the early 1980s. Other competitive highlights of Castiglione’s tenure include … • Five straight years among the top 25 in the standings for the Director’s Cup which measures overall athletics success. • Twenty OU teams ranked among the top 10 in season-ending polls. • A school-record and Big 12 best graduation rate of 74% in 2003. • Three appearances in the BCS National Championship Game and the college football national championship in 2000. • Appearances by the men’s and women’s basketball team in their respective Final Fours in 2002. • A Division I record of 74 combined victories between the football team and both basketball squads in the 2001-02 school year. • An average of more than 17 OU teams per year represented in postseason play during his tenure.

7 NATI ONAL CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

His peers have been quick and frequent in recognizing his success at OU. In October 2004, he was named Athletics Director of the Year by the Bobby Dodd Foundation. In 2003, he was inducted into the National Association of Collegiate Marketing Administrators Hall of Fame. In June 2001, he received the General Robert R. Neyland Athletic Director Award for lifetime achievement from the All-American Football Foundation. In 2000, he was named the Central Region AD of the Year by the National Association of Collegiate Directors of Athletics (NACDA).

39 C ON FERENCE CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

DIRECTOR OF ATHLETICS

204

Credited with energizing OU’s fund-raising efforts, Castiglione was instrumental in the athletics department’s major campaign, Great Expectations: The Campaign For Sooner Sports. The campaign ended in November of 2003 with at more than $125 million. The largest fund-raising effort in OU athletics history, Great Expectations included projects that impact each of OU’s nearly 500 student-athletes. Castiglione has cultivated several million dollar gifts, the largest capital gifts in history for athletics at OU and some of the largest ever for the university as a whole. He has driven dramatic facilities projects, including a $70 million project at Gaylord Family-Oklahoma Memorial Stadium. Others include $17.2 million renovation of Lloyd Noble Center, The Headington Family Tennis Complex, John Jacobs Field and the Everest Training Facility, one of the largest indoor practice areas in the country. World also included a redesign of the Sooner football practice fields; the Port Robert-

2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

son Wrestling Facility; the Sooner Soccer Complex and John Crain Field; as well as additional renovations to L. Dale Mitchell Park, the Charlie Coe Golf Learning Center, the OU Softball Complex and Barry Switzer Center. His administrative work, which has seen significant reorganization and the hiring of nine head coaches, also included the negotiation of multi-million dollar multi-media rights contract that produces more than $3 million in annual revenue for the athletics department. Castiglione was hired on April 30, 1998, after serving as athletics director at Missouri. In his 18-year career with the Tigers, Castiglione, who was named director of athletics at Missouri on Dec. 15, 1993, after rebuilding sports programs, hiring outstanding coaches, devising a master plan for facilities, inspiring record-setting increases in fund-raising and balancing the budget in each of his five years as athletics director. A 1979 Maryland graduate, Castiglione began his career as the sports promotions director at Rice. He then worked a year as director of athletic fund-raising at Georgetown before being hired in 1981 at Missouri as director of communications and marketing. Active on the national and conference level, he is currently serving on the Board of Directors for the Collegiate Women Sports Awards, the Gatorade Collegiate Advisory Board and the National Football Foundation and College Football Hall of Fame. He served two terms as chair of the Big 12 Board of Athletics Directors and is a past president of the Division I-A Athletic Directors Association and NACDA. He served a four-year term on the NCAA Championship/Competition Cabinet and is a member of the NCAA Football Special Events Certification Committee. He also served a four-year term on the NCAA’s Baseball Committee. A native of Fort Lauderdale, Fla., Castiglione was born Oct. 8, 1957. He is married to the former Kristen Bartel, a 1990 graduate of the University of Missouri. They are the parents of two sons, Joseph Robert, Jr., born on December 20, 1996, and Jonathan Edmund, born on March 21, 2000.

THE CASTIGLIONE FAMILY


OU ATHLETICS DEPARTMENT DR. GERALD GURNEY

RICK HART

KEITH GILL

KENNY MOSSMAN

STEPHANIE REMPE

Executive Associate A.D. & CFO

Associate A.D. for Academics & Student Life

Associate A.D. for Program Advancement & Branding

Associate A.D. for Media Relations & Communications

Associate A.D. & Senior Woman Administrator

MATT TRANTHAM

University of Oklahoma Athletics Department McClendon Center for Intercollegiate Athletics 180 W Brooks, Norman, OK 73019

Assistant A.D. for Event Management

OU Athletics Department Mission Statement The mission of the University of Oklahoma Athletics Department is to inspire champions today and prepare leaders for tomorrow by providing an excellent environment to enable student-athletes to achieve their highest academic, athletic and personal aspirations.

It is believed that athletic participation gives an added dimension to the student’s overall college experience and provides an opportunity for social, moral, emotional, and cultural growth and development.

The Athletics Department continues to uphold this tradition by striving to make each athletic team and individual of championship caliber. Its staff members work to instill in student-athletes an appreciation for hard work, perseverance, and pride in accomplishment. It is believed these attributes will be utilized throughout the student-athlete’s life. Complete information on the University of Oklahoma Athletics Department is located online at SoonerSports.com.

OKLAHOM A HISTORY

The athletic programs strive to create traits that once acquired will carry over and benefit student-athletes in their personal and professional endeavors. The University of Oklahoma maintains a tradition of excellence in intercollegiate sports.

REVIEW & OPPONENTS

Philosophy The University of Oklahoma Athletics Department promotes excellence in athletics without compromising excellence in academics or integrity in its commitment to rules or conduct. Student-athletes are encouraged by the coaching and administrative staff to maintain a balance between athletics, academics, and the social aspects of college.

Academics & Student Life . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8265 Administration. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8200 Baseball . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8354 Basketball, Men’s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-4732 Basketball, Women’s . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8322 Business & Finance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8440 Compliance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8561 24-Hour Hotline . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-6479 Development & Sooner Club . . . . . . . . . . . . . . . . . . . . . . (405) 325-8000 Equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8379 Events & Operations. . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8235 Facilities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8290 Football. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-2345 Graphic Design. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8223 Golf, Men’s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8342 Golf, Women’s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8343 Gymnastics, Men’s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8341 Gymnastics, Women’s . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8333 Internet Services. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-4274 Marketing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-7811 Media Relations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8231 Medical Training . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8332 O-Club . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8224 Soccer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8296 Softball . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8361 SoonerSports.com . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-4274 Sooner Sports Properties . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-2148 SoonerVision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8261 Spirit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8366 Strength & Conditioning . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8330 Tennis, Men’s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8362 Tennis, Women’s . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8325 Ticket Office . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-2424 Toll-Free. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (800) 456-4668 Track & Field . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8361 Video Scouting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8288 Volleyball . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8364 Wrestling. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . (405) 325-8209

THE SOONERS

Core Values • Integrity • Passion for Excellence • Commitment • Respect & Responsibility for Self & Others • Appreciation for and Encouragement of Gender & Cultural Diversity

OU Athletics Department Directory

COACHING STAFF

OU Athletics Department

Associate A.D. for Administration

2 0 0 5 S EAS ON

LARRY NAIFEH

205 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


Gaylord Family - Oklahoma Memorial Stadium is one of America’s most recognized college football cathedrals. Situated on the east side of the Norman campus, this historical facility is the largest sports arena in the state and, following its recent expansion, now ranks among the 15 largest on-campus facilities in the nation. Memorial Stadium’s rich heritage has not hindered its evolution, a neverending growth fueled by the football program’s overwhelming popularity. Almost since its inception, the stadium has been a work in progress. That fact holds true today. Using bond money and generous contributions, the stadium has recently undergone a number of changes. The most major of those was a $65 million venture that added 8,000 seats, including 27 suites, on the east side. Work was completed in the summer of 2003. At the same time, the press box was remodeled and outfitted with several state of the art features. Another phase of that project stretched into 2004 when renovations to the Santee Lounge, restroom and concessions facilities and a new brick facade on the west side were completed. In the two years prior to the stadium upgrade and expansion, renovations were completed in the coaches’ offices, locker rooms, sports medicine and weight training facilities.

2004 MEMORIAL STADIUM

An additional 27 suites in the new east upper deck opened in time for the 2004 season bringing the total number of suites to 63. In 1921, University of Oklahoma students started a movement for construction of a student union. By 1925, the idea had grown to include a combined football stadium/student union. In the original architect’s drawings, the north end of the proposed structure was strikingly similar to the present Oklahoma Memorial Union, which eventually was constructed separately when head coach Bennie Owen suggested it would be best to raise funds for a union and a stadium. The first game played at the site took place Oct. 20,1923 (a 63-7 win over Washington, Mo.), before the stadium/union plan got under way. The field was named Owen Field after Owen, who became a charter member of the National Football Hall of Fame. In 1925, the first contest was played in front of the new stands on the west side of the field. The 16,000-seat Oklahoma Memorial Stadium, named in honor of University personnel who died in World War I, was erected at a cost of approximately $293,000. Stands on the east side of the stadium were added prior to the 1929 season. That addition increased the seating capacity to 32,000, where it stood for 20 years. In 1949, OU president George L. Cross pushed for expansion and the result was a six-foot lowering of the old playing surface and the elimination of a running track that surrounded the playing area.

7 NATI ONAL CHAMPIONSHIPS

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

OKLAHOMA MEMORIAL STADIUM

206 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM


1982

1940

In July, 1970 the original natural grass surface was removed and artificial turf was installed. That tartan turf was replaced with super turf before the 1981 season. Owen Field returned to grass in 1994. A Stadium Master Plan was approved by the OU Board of Regents in June 1994. Construction of nine west side suites began in April 1995 and was completed that year. The suites are leased annually. Eight of the suites seat 12 and the President’s suite seats 24.

1929

COACHING STAFF

Eighteen years later came the addition of the upper deck and new press box. Another 8,436 seats were added at a cost of $5,726,345. Capacity for the 1975 National Championship season was 71,187. Before the 1980 season, the old green bleachers were replaced with the new south end zone facility. In addition to improved seating, the complex included coaches’ offices, the weight room, meeting rooms, a training room, the equipment room and two locker rooms. The addition brought the stadium capacity to 75,004. Capacity was decreased to 72,765 prior to the 1998 season to provide more wheelchair seating.

1964

2 0 0 5 S EAS ON

The changes produced 7,000 new ringside seats and brought capacity to 55,000. The north end of the stadium also was enclosed. In 1957, green grandstand bleachers were added to the south end of the field, enabling the stadium to hold 61,836 fans.

Subsequent improvements included the installation of stadium lights to allow night games, a new scoreboard and a video screen.

1925

TEAM BESTS Rushing Yards . . . . . . . . . . . . . . . . . . . . . . . . 768 vs. Kansas State, 1988 Passing Yards. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 429 vs. Baylor, 1999 Total Yards . . . . . . . . . . . . . . . . . . . . . . . . . . . 829 vs. Kansas State, 1988 Points . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 vs. Missouri, 1996 First Downs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 vs. Kansas St., 1988 LONGEST PLAYS Rush . . . . . . . . . . . . . . . . . . . . . . . . 96, Jeff Frazier vs. North Texas, 1995 Pass . . . . . . . . . . . . . . . . . 99, Tulsa’s Troy DeGar to Wes Caswell, 1996 By OU: 86, Bobby Boyd to Wahoo McDaniel vs. West Virginia, 1958 Field Goal . . . . . . . . . . . . . . . . . . . . . 60, Tony DiRienzo vs. Kansas, 1973 Punt . . . . . . . . . . . . . . . . . . . . . . . . . . 87, Joe Wylie vs. Kansas St., 1970 Punt Return . . . . . . . . . . . . . . . . . 96, Darrell Royal vs. Kansas St., 1948 Kickoff Return . . . . . . . . . . . . . 100, Buster Rhymes vs. Kansas St., 1980; Mack Heron of Kansas St., 1968 MISCELLANEOUS OU’s Record at Stadium (1923-2004) . . . . . . . . . . . . . . 320-79-14 (.792) Most Consecutive OU Wins . . . . . . . . . . . . . . . . . . . . . . . . . . 25, 1947-52 *Complete stadium facts and maps are located on page 57

OKLAHOM A HISTORY

INDIVIDUAL BESTS Rushing Yards . . . . . . . . . . . . 274, Mike Gaddis vs. Oklahoma St., 1989 Rushing Attempts . . . . . . . . . . . . . 53, Steve Owens vs. Iowa State, 1969 Rushing Touchdowns . . . . . . . . . . . . 5, Steve Owens vs. Nebraska, 1968 Passing Completions . . . . . . . . . . . . . . . . 41, TTU’s Kliff Kingsbury, 2000 By OU: 37, Josh Heupel vs. Baylor, 1999 Passing Attempts . . . . . . . . . . . . . . . . . . . 61, TTU’s Kliff Kingsbury, 2000 By OU: 54, Josh Heupel vs. Baylor, 1999 Passing Yards. . . . . . . . . . . . . . . . . 429, Josh Heupel vs. Louisville, 1999 Passing Touchdowns . . . . . . . . . . . 5, Jason White vs. Texas A&M, 2003; Josh Heupel vs. Indiana St., 1999 Receiving Yards . . . . . . . . . . . . . . . . . . 203, Jim Doran, Iowa State, 1949 By OU: 166, Mark Clayton vs. Texas A&M, 2003 Receptions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10, by five players, last by Brandon Jones vs. North Texas, 2003 Receiving Touchdowns. . . . . . . . . . 3, Mark Clayton vs. Texas A&M, 2003 Punting Average (min. 3) . . . . . . . 56.33, Mike Keeling vs. Kansas, 1981 Tackles . . . . . . . . . . . . . . . . . . . . . . . . 19, Daryl Hunt vs. Vanderbilt, 1977 Interceptions. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 by two players Sacks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 by five players, last by Dan Cody vs. Oklahoma State, 2003

REVIEW & OPPONENTS

Oklahoma Memorial Stadium Bests

THE SOONERS

The Barry Switzer Center, named after the former OU head football coach, opened in April 1999. The complex includes a sports medicine facility with the latest equipment and technology to better accommodate OU’s student-athletes; the Robin Siegfried and Family Strength and Conditioning Facility, which can accommodate more than 400 athletes; new locker rooms; new coaches offices; the Anderson All-American Plaza and the OU Touchdown Club Legends Lobby. The Legends Lobby, which underwent a $1 million upgrade in the summer of 2004, features some of OU’s finest moments, most legendary figures and rare memorabilia.

207 1950 1955 1956 1974 1975 1985 2000 NATIONAL CH AMPIONS


7 NATI ONAL CHAMPIONSHIPS

OFFICIAL WEBSITE

SoonerSports.com, the official website of the OU Athletics Department, supplies Oklahoma fans across the country and around the world with the latest news and features on OU football direct from Norman. Originating from inside Oklahoma Memorial Stadium, the website provides the latest and most accurate press releases, rosters, bios, interactive depth charts, schedules, team statistics, game notes, quotes, player journals, photo galleries, audio and video available to Sooner fans and the media. The premium content O-Zone at SoonerSports.com provides even greater access to the Sooners for OU fans. Every Tuesday during the season, the O-Zone carries video of Oklahoma’s weekly football press conference live. Members watch as head coach Bob Stoops and OU players discuss the upcoming game and take questions from the media. SoonerSports.com also provides coach and player quotes, photos, video and audio clips and the latest weekly notes from OU Athletics Media Relations in advance of the game. On game day, live statistics and Sooner Network radio broadcasts are available online with recaps, statistics, notes, quotes and photos following shortly after the game. O-Zone members gain full access to head coach Bob Stoops’ weekly television shows, daily audio interviews, video features and much more.

DAVIN JOSEPH, 2005

39 C ON FERENCE CHAMPIONSHIPS

23 BOWL CHAMPIONSHIPS

141 ALL-A MERICANS

6 3 NAT IONAL AWARD WINNERS

SOONERSPORTS.COM

BO BOLINGER, 1955

DEWEY SELMON, 1975

208

JACK MITCHELL, 1948 2005 OKLAHOMA FOOTBALL GUIDE | SOONERSPORTS.COM

2005 OU Football Guide